1P84H

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1p84H00
3H1LG 1BGYG 1SQPG 3H1IG 3H1KG 4PD4H 1SQBG 1BE3G 1SQVG 3H1JG 3L75G 3H1HG 2BCCG 3CXHH 1SQQG 1NTMG 3CWBG 1EZVG 2IBZG 1SQXG 4U3FG 3TGUG 3L71G 1PPJG 3L74G 1L0LG 1NTKG 3L73G 1P84H 1NU1G 1KYOH 1PP9G 3CX5H 1NTZG 5KLVG 3L70G 3L72G 1L0NG 4D6TG 2A06G 1BCCG 3BCCG 2FYUG 1KB9H
chains in the Genus database with same CATH superfamily
3H1KJ 3A7OA 4I7ZC 3LIEA 3VMXA 2DW3A 4ASWA 1OIPA 1KYOE 3GW6A 3PJSK 2GM4A 3L73E 3KZIH 1RE4A 4RKUJ 1J2JB 2P67A 5AVUB 1NAYA 3VTPC 1VQOP 1GU4A 3TNUA 1NAFA 1PP9D 1L4AD 2Z5IA 3VOPA 1M56D 3RL0C 1FC2C 1L0NK 3VMAA 4TLFA 1LWUA 1M7LA 1FZCA 2OYIB 5CJ4A 4DOJA 2KNCB 2K9JA 2HODA 2JKVA 2FXPA 4C46A 2P58A 2Y0EA 3RL0g 2PFXA 2W27A 3LW5H 2IZ0A 5KLVG 3T97B 1FDOA 1ZV8A 2Q3IA 1SQVJ 3IN6A 2WSCJ 2QM7A 4GOEA 2ZYGA 1ZR2A 2IFMA 2WVRA 2D2CD 3WUVA 1CI6A 5AW2B 1BGYD 1PPJE 1NO4A 1H89A 2ZXEB 4NPEA 4TT3H 4L75A 5AW4B 4UB6E 3AECC 1K9MQ 3H1KG 1JMBA 2BEZF 1HH0A 2E75B 1YTZI 1FZGA 2N9YB 3AEAC 1SVFA 3BCCD 2JO1A 1N73C 1FU1A 4XFJA 2KUBA 3I5CA 1ZMEC 5KKZB 1VF5C 1ZP0C 1KB9I 3CCVP 2AXTH 3P7KA 4YXDC 2P2UA 3TSIA 3L71E 4IFMA 1ZR4A 1U57A 2JR8A 4H13D 1L0NJ 1BCCJ 1H0TA 2JDIH 3G9RA 1OVUA 1Q90D 2RKLA 2WSFH 2IPPA 2SPZA 4WVZA 3CMEP 3PLNA 2FYUK 1G1IA 3TK1A 3D6YA 1FBMA 2E76B 5M1BA 3P8MC 1MKMA 1LTBC 4ASVA 1SQVG 1GL2B 3SSUA 1SQQE 3RK3C 3CX5E 2BEQD 2K88A 3BRVB 3MGNA 1W2EA 1Y8AA 1NTKE 1M8OB 4IL6E 1OW6A 1YYCA 1YIJP 1KILA 5H2FH 3HE5A 2ZYAA 1KV4A 4GODA 5AVRB 3G4SP 1N7SD 3BATA 3L73D 1IZNB 2Q6QA 1GMJA 2RMZA 3GF7A 4DJGA 4BWNA 1YQ4C 4AQRD 2Q5UA 3CCQP 1SLQA 1NVOA 1R5SA 1L0LE 5KJ7A 1URQB 2A45G 3FGAD 3L72G 2YXRB 5CCGC 1HWTC 3B8EB 4H44C 3V6IA 2UWJE 3B5NB 1BDDA 3CXHH 1HVVA 2E74C 2VRSA 1LTTC 5CBOA 1RE4C 3M9QA 1YBKA 1L0NG 2HFED 1BCCG 1S9KE 1SQPE 2M5AB 3IFMA 4IFDK 3V2PA 2NPSD 1RQVA 3HD7B 2XZRA 3PRJA 3GHGB 1VQ4P 1LWUC 1FZCC 4PD4E 4OGQB 1L4AA 2FYUJ 1T2KC 2QA4P 2FYNB 5APYA 1PPJD 1AVOA 1USDA 3OA7A 3WU2E 1MV8A 5KAIH 3RK2B 1X9VA 3L70E 3FXDA 5K5GB 1JY3O 1U7MA 1S1CX 4OVNF 1KC8Q 2OTJP 3NTNA 2C9NY 1SP4A 4ZKPA 2B89A 2IX7C 1EZVE 5AVWB 3ZDMA 1IO4A 1IK7A 1NTZE 1P84H 1W5CE 3HUSA 3M9BA 4D6TJ 2HG5D 3MP7B 1SS1A 3C8VA 3AEGC 3L71D 3CI9A 1T3UA 3L37A 1ZRTE 1NH4A 3AEFC 2H7HA 3L72D 4IL6X 3E1IA 1SFCB 4U3FE 3VMYA 3Q2YA 5AVSB 2Z5HA 3V2QA 1VQNP 1HJBA 4UB8E 1GK6A 3W68A 2K9YA 1EC5A 2QJPC 2XV5A 3ABVC 3H1JJ 2LXCB 2LKMA 1NU1K 4C7RA 1ZOYC 3EWKA 4DT0A 3W67A 1J1DB 2AEJA 3L74J 3CMAP 3V4WA 3G3ZA 4XA4A 2ZT9C 1SQQD 3CX5D 2FYUG 3RL0B 2OARA 2FXOA 2ZVOB 5AW1B 1RHZB 3L75J 1NTKD 3LW5J 1Q7YQ 2E75D 1DEEG 5TISE 3TGUE 5B5EH 3QH9A 2K1AA 1GD2E 4H0LC 1AA0A 4LGDE 2HPCA 1JM0A 3H1LJ 1VQ7P 4NPDA 1SQBE 3ITKA 3H1HJ 2Q3EA 3CWBE 2V4HA 4BRYB 5AVYB 5AVTB 5KAFH 2QEXP 1X22A 5BU8B 5AW7B 1KILC 1DD4A 2XDJA 4D6TG 1FOSF 2R32A 1KB9H 3GF3A 2R3SA 1USEA 1GTWA 2IBZG 1S9KD 5KJ7C 5EFWB 1N7SA 2E76D 2ITAA 2YIUC 3TYYA 2E42A 2ZFCA 5AW5B 1S72P 3F89A 1GL2D 2KYVA 3H1JG 4PD4D 1S4XA 4ZKUA 3I55P 2XNXA 1T3JA 4W80A 1NU1J 3L74G 2QM8A 1CZQA 1J1EB 2QJKB 2WSFJ 2WSEH 2R3CA 3P32A 4I2LC 3AE2C 4NPFX 3L75G 4N3YB 2N1TB 3L70D 1EXIA 2YXQB 2KLUA 4XE5B 1URQD 2B87A 2IZ1A 2OGUA 4DZOA 1L4AC 2NPSA 1EZVD 2W8ZA 3H1LG 1JTHA 1D7MA 1BE3J 5APSA 1N86A 1NTZD 3H1HG 3IR9A 4OH8B 1Q81Q 4KJMA 1YJWP 3M91A 1ZRTD 1LTIC 5KLVE 1IFNA 3FWLA 4U3FD 2W90A 1NKZB 1Q86Q 1SQXK 4QMAA 2BCCJ 2WPSA 3HD7D 2C9LY 1LP1A 3AE7C 3HUSC 4OGQD 2D2CC 3H1KE 1FZEA 1NYHA 2OYIA 2E5YA 5AVVB 1FS0E 3SWYA 3RK2D 1NU1G 2KZJA 1RQUA 4H44B 4RJTA 2A45I 2I1KA 3CXHE 2YMYA 3TGUD 1QVGO 1VL2A 1S5LE 1DEBA 1OVRA 2J5UA 1QLED 3N7NA 3A2AA 1LTJA 1SQBD 1JY3P 1QL1A 3KHUA 3KDPB 1OZHA 2WPQA 4GIFA 3CWBD 1WRGA 1G2CB 2IYOA 1MFZA 1FZCB 1BE3G 3A3YB 4H13C 1SFCD 2QRXA 2K9JB 2M3EA 2HODB 5B66H 4JQ0D 2H8PD 5GTHH 1NOHA 3M0DA 3CX5I 4EDFA 3M9HA 1JEKA 3HTKA 2G8YA 5C39A 5KAIE 3RBZA 1PGPA 1SQVE 5TJHA 2BCCG 1SQXJ 2R5BA 4N78E 1NGMB 1DX7A 1T8ZA 2PAJA 1OX3A 3RBXA 2E43A 1Q2NA 3GG2A 3MTUE 3PP5A 3K5BA 4R4LA 3VP8A 3O6QB 3CCLP 3Q5PA 1M1JB 1P84E 1PGJA 1PIXA 1N7SC 5APVA 3C1LA 5CBNA 1Q82Q 1G1JA 3L72E 1NJIQ 1FOSE 3CPWO 4U7JA 4N6JA 2OYHB 3H1IJ 3FX0A 2QVAA 3KXDA 1KTMA 2WTYA 1JNMA 4K3AA 5AW0B 2KI7B 4PV1D 1PFIA 1GL2A 1L0NE 1BCCE 5GTIH 1PZQA 1GK4A 2P1JA 2KP8A 1FDMA 4GKGA 4LLHA 4PD4I 5KLVD 1H0TB 2B88A 3Q5SA 2NPSC 1OMIA 1K05A 1OXZA 1X0TA 2KK7A 4Y28J 2QJYC 1IFDA 3AE6C 1URQA 1N7LA 2O1JA 3SWKA 2WZ7A 1JY2N 2JWAA 1SQXG 3A0HE 3AE1C 5CHXA 1L0LJ 2YO3A 3H1KD 4WY4B 4BXLA 2YKQA 2BCCD 3OAKA 1KYOH 4C7NB 1EZVI 1E5WA 1NTMK 2N1TD 4KT0J 1KILB 3HE5B 2FBWC 3TF5A 3NFQA 3G71P 2MJZA 4YPCA 2M5AA 2O01H 3CXHD 3HD7A 1SQPJ 3GHGA 3OW2O 3H1IG 5AW3B 2OYIC 1IFJA 2C0WA 2Q7CA 4JPZB 3BVHA 2K3RA 2YIUB 3PHLA 1PGQA 2P10A 3CLQA 4DCKA 2WSEJ 1RY3A 1ZW0A 1QEXA 4HH2A 2Y0CA 1LT9A 1YJ9P 1HUCA 1LTJC 1OW8A 1EDIA 4EYYQ 1KORA 1SQVD 1CSBA 1JOCA 1K8AQ 2G3AA 2FYUE 2M8RA 5KLIB 4N78D 3JCUE 5APTA 1WMKA 2WSSH 1T6AA 5CCGD 2WITA 1IFIA 3M0DC 2E75C 4H44D 3WMM0 1P84D 2A06G 2QE7H 1SFCA 3WUUA 4B86A 1GW3A 3AEEC 1NTMJ 2FFDB 4KHXA 3AE9C 3NMDA 4I7ZB 2LXBA 4D6TE 3CC2P 5AW6B 3L4FA 1K73Q 4AYCA 5CCHD 3L35A 1HGVA 3CD6P 2PGDA 1H8AA 1IFMA 1L0ND 3HRNA 1BCCD 1S3JA 2IBZE 2D2CB 1LNQA 3KZIE 3H1ID 3KYQA 1QVFO 3H32B 1MZ9A 2RH0A 1PP9J 2OTKE 3EFFK 5E79H 4Y99C 3H1JE 1BDCA 2K37A 5L8RJ 1JO5A 1W2BO 1U7JA 2XNDH 3KQGA 3L74E 1GL2C 3O8ZA 4YTPC 3BASA 4BRYA 4IL6H 1KQFB 1IFPA 3CC4P 3L75E 2IFNA 1KQSO 3NXSA 1DD3A 3VN0A 1AV1A 3GMAA 4H13B 2M3BA 2W6JH 3H1LE 1BGYJ 3Q5RA 1URQC 5GTHE 1KMIZ 3H1HE 3SWFA 3A0BH 1NTMG 4IOIH 2W83C 1EQ7A 3B4SA 1AJYA 3BCCJ 1S2EA 3KPEA 2IDBA 2I8DA 1N73B 2WT7B 1YQ3C 2KSJA 4JBZA 3HE4A 1VDFA 1VF5B 2GA1A 2HLOA 1PP9G 2N1TA 3HD7C 4WWIA 1A02J 3GHGC 1FZBA 1IC2A 2AXTE 1N7SB 4OGQC 3CXHI 2FYNC 2FYUD 2YKOA 4WY4D 1NU1E 2QG4A 3FXEA 1LT9C 1RF1A 2AXCA 1E79H 5AVXB 3D70A 3RK2C 5AVQB 2FY8A 1AQ5A 4CPGA 1N8RQ 2WPRA 4ZMDA 2OTLP 3AE4C 4Z1MH 1EDJA 3B5ND 2V7QJ 4WBAA 3WUTA 3D6ZA 1M1KQ 3B71A 1HJ0A 1N2DC 3MIWA 1VQ9P 2I1JA 1AQTA 2KS1B 3I56P 3RK3B 1BGYG 2J58A 1BE3E 2B87B 2FXMA 3N4XA 5BVZA 1VQ8P 4D6TD 4RO0A 3SFDC 1HTLC 5H2FE 2C0XA 1XTCC 4I1LA 3L73J 1H88A 1RH5B 4PJ0H 1SFCC 2WWWA 3E1RA 3V2NA 2PP6A 3H6PA 2IBZD 3BCCG 4UB8H 5CCGA 2KIKA 2O01J 2BCCE 3R4YA 2NZ2A 2KNCA 2XU6A 1JUNA 3H1JD 1P84I 3JSVC 1R8EA 1LP1B 1KQGB 2BASA 3MZWB 1J1DC 3VP9A 2E74B 3L74D 1PL5A 2AEMA 3TDKA 3V2RA 3VYIA 3T97A 1G2CA 3CCUP 2WQYC 4LC1A 3TNUB 3L36A 3L75D 4EIJA 5TISH 5CCHA 4WB4A 4HB1A 1QL2A 3CCRP 1SQQK 1JCCA 1LWUB 2O1KA 1UIIA 3RK3E 1NTKK 5AW9B 3H1LD 1Y47A 2Y0DA 1QX8A 3H1HD 3MUDA 1PV3A 3UIAA 4L73A 1LTJB 3CL3D 4K35A 4PV1C 1L0LK 2CPSA 4HJGH 2R44A 1BSNA 5CMZA 1KD1Q 1LJ2A 3O6QA 3EFGA 1VQ6P 3L73G 2OYOA 1FZFA 1RF0A 1M1JA 2H43A 2CK3H 1VPCA 3RL0D 1CI6B 2E5TA 3P8CE 1DIPA 1JMMA 1L2PA 3HTKB 3MD0A 1KN7A 3BRTB 1IK9A 1SQXE 1YJNP 2OYHA 2GUSA 3USSA 3L71J 1OFCX 4YXWH 1SQPK 3L72J 2HR3A 1GW4A 3OJAB 1NU1D 1J1EC 2QJKC 3F5HA 1M90Q 2YNYA 2N1TC 2QJPB 1Z56A 4AUWA 3H1IE 4EOTA 3AE3C 1VQMP 1EDKA 4A7PA 1SQQJ 3Q3DA 3GLMA 2ZT9B 1M57D 4EI2A 2POHA 1PPJG 2JJLA 1NTKJ 1BE3D 3D71A 4Y99B 1RF1C 3Q1MA 5E79E 2V7QH 2MKVA 2P7JA 2LR2A 1S5LX 1VQKP 4WY4A 4C7NA 5B5EE 2KLVA 2O3JA 4MN4C 2H89C 3AE8C 3RGUA 1NTZK 4H0LB 1VF5D 1JY2O 1X8YA 2N9BA 3CCJP 2ZXXA 3JC22 1YHQP 1FE6A 1KYOD 3B5NA 2ZYDA 2WMMA 4HKZH 3R2PA 4L76A 5KAFE 5APWA 2Q1KA 2Z4EA 1ZXGA 3L71G 1KB9E 1K04A 1EXJA 1ZN5A 2A06E 2L91A 1A02F 2Q9IA 4OWFA 3A0BE 3PH0A 3VMZA 3H25A 1GU5A 1NKNA 1WT6A 3E7KA 1S5LH 3FWNA 1VQ5P 4IFFA 2Y9ZA 1YTZT 5DJTB 2IBZI 3RK3D 3S1KA 1RE3A 1SQQG 4R4MA 4GT1A 2KSEA 1NTKG 5CCHC 3L70J 1IJDB 1SQBK 2ZVNB 1GDTA 5APXA 5KTBA 1X79B 2W6BA 3IAOA 1VQLP 3AEBC 1LT9B 1L4AB 4UB6H 4JYCA 2WSCH 1PGOA 2YKPA 2HYNA 1FAVA 3AE5C 1VQPP 1Y9BA 1L0LG 3MUDC 1KILE 2FKWB 1NTZJ 1JY3N 3P8CD 2FFDA 1SQXD 2E74D 4ZNCA 1MFTA 2KZIA 1YI2P 5CJ0A 1HGZA 4U3FJ 3MHVA 5KKZC 1YITP 2JWDA 1OW7A 3IF4A 1RF0C 1LGHB 1M1JC 2A45H 4HYTB 4JF7A 1SQPG 3AEDC 3H32A 2KXPB 3U59A 3HUSB 4PJ0E 2QSIA 1NTME 2W6AA 2OYHC 1T2KD 3CCEP 1LTSC 1UIXA 5APUA 3V4QA 2RN0A 1LTAC 2B9BA 2OQQA 2E76C 3CCSP 3U1CA 2WPVB 3TGUJ 1KZUB 4GOFA 2KOGA 1PP9E 1GZLA 3CX5H 3L70G 1ZLLA 3M06A 1MUUA 1SQBJ 5AW8B 1HBWA 2QIWA 3CWBJ 3CC7P 2J59M 1EZVG 5KLVK 2H88C 3S9OA 1JB0J 3G6EP 2L5GB 1KFMA 5APQA 2M0BA 1NTZG 3A0HH 2YMKA 4WY4C 1LT1A 5B66E 1L0LD 1KB9D 2Y9YA 1XTGB 2A06D 2HPCB 5BU5A 2PRRA 4U3FG 4W7YA 1NWQA 3A5TA 1EDLA 1AVYA 1N73A 2WT7A 4PV1B 3B5NC 2CPBA 3V5BA 2NRGA 1BGYE 3EQ2A 1LTGC 1NHLA 2ZT9D 5DJUB 1SQPD 3C9IA 2KB7P 1KYOI 2R5DA 3BCCE 1CW5A 4W7ZA 2O01N 2XKMA 4PD4H 3II6A 5AVZB 3LIDA 3U1AA 2FYZA 4H0LD 3PTZA 1DH3A 4RESB 3TGUG 2JEEA 3SFEC 3WU2H 3M0AA 4O9BA 3HE4B 1FDIA 1JCDA 4M3LA 4I6MC 1OVVA 1SQBG 2YO2A 1KILD 2KS1A 1KQLA 1RE3C 1JY2P 1KFNA 3CWBG 5KLIC 3JCUH 3QWOC 5GTIE 1QGKB 2AEFA 5KLVJ 4GDOA 1SQVK 2ZJSE 4JYBA 5KJ7D 3S4RA 1OWAA 2JP3A 1RF1B 2NPSB 4L74A 1FZAA 2IYPA 3CCMP 1JTHB 2GUVA 2ZAEB 2QJYB 1HF9A 1FJPA 2FFDC 1AFOA 1R5LA 1TU3F 1NTMD 1BSHA 1FJKA
chains in the Genus database with same CATH topology
3H1LG 1BGYG 1SQPG 3H1IG 3H1KG 4PD4H 1SQBG 1BE3G 1SQVG 3H1JG 3L75G 3H1HG 2BCCG 3CXHH 1SQQG 1NTMG 3CWBG 1EZVG 2IBZG 1SQXG 4U3FG 3TGUG 3L71G 1PPJG 3L74G 1L0LG 1NTKG 3L73G 1P84H 1NU1G 1KYOH 1PP9G 3CX5H 1NTZG 5KLVG 3L70G 3L72G 1L0NG 4D6TG 2A06G 1BCCG 3BCCG 2FYUG 1KB9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L G;  1BGY G;  1SQP G;  3H1I G;  3H1K G;  4PD4 H;  1SQB G;  1BE3 G;  1SQV G;  3H1J G;  3L75 G;  3H1H G;  2BCC G;  3CXH H;  1SQQ G;  1NTM G;  3CWB G;  1EZV G;  2IBZ G;  1SQX G;  4U3F G;  3TGU G;  3L71 G;  1PPJ G;  3L74 G;  1L0L G;  1NTK G;  3L73 G;  1P84 H;  1NU1 G;  1KYO H;  1PP9 G;  3CX5 H;  1NTZ G;  5KLV G;  3L70 G;  3L72 G;  1L0N G;  4D6T G;  2A06 G;  1BCC G;  3BCC G;  2FYU G;  1KB9 H; 
#chains in the Genus database with same CATH topology
 3H1K J;  3A7O A;  4I7Z C;  3LIE A;  3VMX A;  2DW3 A;  4ASW A;  1OIP A;  1KYO E;  3GW6 A;  3PJS K;  2GM4 A;  3L73 E;  3KZI H;  1RE4 A;  4RKU J;  1J2J B;  2P67 A;  5AVU B;  1NAY A;  3VTP C;  1VQO P;  1GU4 A;  3TNU A;  1NAF A;  1PP9 D;  1L4A D;  2Z5I A;  3VOP A;  1M56 D;  3RL0 C;  1FC2 C;  1L0N K;  3VMA A;  4TLF A;  1LWU A;  1M7L A;  1FZC A;  2OYI B;  5CJ4 A;  4DOJ A;  2KNC B;  2K9J A;  2HOD A;  2JKV A;  2FXP A;  4C46 A;  2P58 A;  2Y0E A;  3RL0 g;  2PFX A;  2W27 A;  3LW5 H;  2IZ0 A;  5KLV G;  3T97 B;  1FDO A;  1ZV8 A;  2Q3I A;  1SQV J;  3IN6 A;  2WSC J;  2QM7 A;  4GOE A;  2ZYG A;  1ZR2 A;  2IFM A;  2WVR A;  2D2C D;  3WUV A;  1CI6 A;  5AW2 B;  1BGY D;  1PPJ E;  1NO4 A;  1H89 A;  2ZXE B;  4NPE A;  4TT3 H;  4L75 A;  5AW4 B;  4UB6 E;  3AEC C;  1K9M Q;  3H1K G;  1JMB A;  2BEZ F;  1HH0 A;  2E75 B;  1YTZ I;  1FZG A;  2N9Y B;  3AEA C;  1SVF A;  3BCC D;  2JO1 A;  1N73 C;  1FU1 A;  4XFJ A;  2KUB A;  3I5C A;  1ZME C;  5KKZ B;  1VF5 C;  1ZP0 C;  1KB9 I;  3CCV P;  2AXT H;  3P7K A;  4YXD C;  2P2U A;  3TSI A;  3L71 E;  4IFM A;  1ZR4 A;  1U57 A;  2JR8 A;  4H13 D;  1L0N J;  1BCC J;  1H0T A;  2JDI H;  3G9R A;  1OVU A;  1Q90 D;  2RKL A;  2WSF H;  2IPP A;  2SPZ A;  4WVZ A;  3CME P;  3PLN A;  2FYU K;  1G1I A;  3TK1 A;  3D6Y A;  1FBM A;  2E76 B;  5M1B A;  3P8M C;  1MKM A;  1LTB C;  4ASV A;  1SQV G;  1GL2 B;  3SSU A;  1SQQ E;  3RK3 C;  3CX5 E;  2BEQ D;  2K88 A;  3BRV B;  3MGN A;  1W2E A;  1Y8A A;  1NTK E;  1M8O B;  4IL6 E;  1OW6 A;  1YYC A;  1YIJ P;  1KIL A;  5H2F H;  3HE5 A;  2ZYA A;  1KV4 A;  4GOD A;  5AVR B;  3G4S P;  1N7S D;  3BAT A;  3L73 D;  1IZN B;  2Q6Q A;  1GMJ A;  2RMZ A;  3GF7 A;  4DJG A;  4BWN A;  1YQ4 C;  4AQR D;  2Q5U A;  3CCQ P;  1SLQ A;  1NVO A;  1R5S A;  1L0L E;  5KJ7 A;  1URQ B;  2A45 G;  3FGA D;  3L72 G;  2YXR B;  5CCG C;  1HWT C;  3B8E B;  4H44 C;  3V6I A;  2UWJ E;  3B5N B;  1BDD A;  3CXH H;  1HVV A;  2E74 C;  2VRS A;  1LTT C;  5CBO A;  1RE4 C;  3M9Q A;  1YBK A;  1L0N G;  2HFE D;  1BCC G;  1S9K E;  1SQP E;  2M5A B;  3IFM A;  4IFD K;  3V2P A;  2NPS D;  1RQV A;  3HD7 B;  2XZR A;  3PRJ A;  3GHG B;  1VQ4 P;  1LWU C;  1FZC C;  4PD4 E;  4OGQ B;  1L4A A;  2FYU J;  1T2K C;  2QA4 P;  2FYN B;  5APY A;  1PPJ D;  1AVO A;  1USD A;  3OA7 A;  3WU2 E;  1MV8 A;  5KAI H;  3RK2 B;  1X9V A;  3L70 E;  3FXD A;  5K5G B;  1JY3 O;  1U7M A;  1S1C X;  4OVN F;  1KC8 Q;  2OTJ P;  3NTN A;  2C9N Y;  1SP4 A;  4ZKP A;  2B89 A;  2IX7 C;  1EZV E;  5AVW B;  3ZDM A;  1IO4 A;  1IK7 A;  1NTZ E;  1P84 H;  1W5C E;  3HUS A;  3M9B A;  4D6T J;  2HG5 D;  3MP7 B;  1SS1 A;  3C8V A;  3AEG C;  3L71 D;  3CI9 A;  1T3U A;  3L37 A;  1ZRT E;  1NH4 A;  3AEF C;  2H7H A;  3L72 D;  4IL6 X;  3E1I A;  1SFC B;  4U3F E;  3VMY A;  3Q2Y A;  5AVS B;  2Z5H A;  3V2Q A;  1VQN P;  1HJB A;  4UB8 E;  1GK6 A;  3W68 A;  2K9Y A;  1EC5 A;  2QJP C;  2XV5 A;  3ABV C;  3H1J J;  2LXC B;  2LKM A;  1NU1 K;  4C7R A;  1ZOY C;  3EWK A;  4DT0 A;  3W67 A;  1J1D B;  2AEJ A;  3L74 J;  3CMA P;  3V4W A;  3G3Z A;  4XA4 A;  2ZT9 C;  1SQQ D;  3CX5 D;  2FYU G;  3RL0 B;  2OAR A;  2FXO A;  2ZVO B;  5AW1 B;  1RHZ B;  3L75 J;  1NTK D;  3LW5 J;  1Q7Y Q;  2E75 D;  1DEE G;  5TIS E;  3TGU E;  5B5E H;  3QH9 A;  2K1A A;  1GD2 E;  4H0L C;  1AA0 A;  4LGD E;  2HPC A;  1JM0 A;  3H1L J;  1VQ7 P;  4NPD A;  1SQB E;  3ITK A;  3H1H J;  2Q3E A;  3CWB E;  2V4H A;  4BRY B;  5AVY B;  5AVT B;  5KAF H;  2QEX P;  1X22 A;  5BU8 B;  5AW7 B;  1KIL C;  1DD4 A;  2XDJ A;  4D6T G;  1FOS F;  2R32 A;  1KB9 H;  3GF3 A;  2R3S A;  1USE A;  1GTW A;  2IBZ G;  1S9K D;  5KJ7 C;  5EFW B;  1N7S A;  2E76 D;  2ITA A;  2YIU C;  3TYY A;  2E42 A;  2ZFC A;  5AW5 B;  1S72 P;  3F89 A;  1GL2 D;  2KYV A;  3H1J G;  4PD4 D;  1S4X A;  4ZKU A;  3I55 P;  2XNX A;  1T3J A;  4W80 A;  1NU1 J;  3L74 G;  2QM8 A;  1CZQ A;  1J1E B;  2QJK B;  2WSF J;  2WSE H;  2R3C A;  3P32 A;  4I2L C;  3AE2 C;  4NPF X;  3L75 G;  4N3Y B;  2N1T B;  3L70 D;  1EXI A;  2YXQ B;  2KLU A;  4XE5 B;  1URQ D;  2B87 A;  2IZ1 A;  2OGU A;  4DZO A;  1L4A C;  2NPS A;  1EZV D;  2W8Z A;  3H1L G;  1JTH A;  1D7M A;  1BE3 J;  5APS A;  1N86 A;  1NTZ D;  3H1H G;  3IR9 A;  4OH8 B;  1Q81 Q;  4KJM A;  1YJW P;  3M91 A;  1ZRT D;  1LTI C;  5KLV E;  1IFN A;  3FWL A;  4U3F D;  2W90 A;  1NKZ B;  1Q86 Q;  1SQX K;  4QMA A;  2BCC J;  2WPS A;  3HD7 D;  2C9L Y;  1LP1 A;  3AE7 C;  3HUS C;  4OGQ D;  2D2C C;  3H1K E;  1FZE A;  1NYH A;  2OYI A;  2E5Y A;  5AVV B;  1FS0 E;  3SWY A;  3RK2 D;  1NU1 G;  2KZJ A;  1RQU A;  4H44 B;  4RJT A;  2A45 I;  2I1K A;  3CXH E;  2YMY A;  3TGU D;  1QVG O;  1VL2 A;  1S5L E;  1DEB A;  1OVR A;  2J5U A;  1QLE D;  3N7N A;  3A2A A;  1LTJ A;  1SQB D;  1JY3 P;  1QL1 A;  3KHU A;  3KDP B;  1OZH A;  2WPQ A;  4GIF A;  3CWB D;  1WRG A;  1G2C B;  2IYO A;  1MFZ A;  1FZC B;  1BE3 G;  3A3Y B;  4H13 C;  1SFC D;  2QRX A;  2K9J B;  2M3E A;  2HOD B;  5B66 H;  4JQ0 D;  2H8P D;  5GTH H;  1NOH A;  3M0D A;  3CX5 I;  4EDF A;  3M9H A;  1JEK A;  3HTK A;  2G8Y A;  5C39 A;  5KAI E;  3RBZ A;  1PGP A;  1SQV E;  5TJH A;  2BCC G;  1SQX J;  2R5B A;  4N78 E;  1NGM B;  1DX7 A;  1T8Z A;  2PAJ A;  1OX3 A;  3RBX A;  2E43 A;  1Q2N A;  3GG2 A;  3MTU E;  3PP5 A;  3K5B A;  4R4L A;  3VP8 A;  3O6Q B;  3CCL P;  3Q5P A;  1M1J B;  1P84 E;  1PGJ A;  1PIX A;  1N7S C;  5APV A;  3C1L A;  5CBN A;  1Q82 Q;  1G1J A;  3L72 E;  1NJI Q;  1FOS E;  3CPW O;  4U7J A;  4N6J A;  2OYH B;  3H1I J;  3FX0 A;  2QVA A;  3KXD A;  1KTM A;  2WTY A;  1JNM A;  4K3A A;  5AW0 B;  2KI7 B;  4PV1 D;  1PFI A;  1GL2 A;  1L0N E;  1BCC E;  5GTI H;  1PZQ A;  1GK4 A;  2P1J A;  2KP8 A;  1FDM A;  4GKG A;  4LLH A;  4PD4 I;  5KLV D;  1H0T B;  2B88 A;  3Q5S A;  2NPS C;  1OMI A;  1K05 A;  1OXZ A;  1X0T A;  2KK7 A;  4Y28 J;  2QJY C;  1IFD A;  3AE6 C;  1URQ A;  1N7L A;  2O1J A;  3SWK A;  2WZ7 A;  1JY2 N;  2JWA A;  1SQX G;  3A0H E;  3AE1 C;  5CHX A;  1L0L J;  2YO3 A;  3H1K D;  4WY4 B;  4BXL A;  2YKQ A;  2BCC D;  3OAK A;  1KYO H;  4C7N B;  1EZV I;  1E5W A;  1NTM K;  2N1T D;  4KT0 J;  1KIL B;  3HE5 B;  2FBW C;  3TF5 A;  3NFQ A;  3G71 P;  2MJZ A;  4YPC A;  2M5A A;  2O01 H;  3CXH D;  3HD7 A;  1SQP J;  3GHG A;  3OW2 O;  3H1I G;  5AW3 B;  2OYI C;  1IFJ A;  2C0W A;  2Q7C A;  4JPZ B;  3BVH A;  2K3R A;  2YIU B;  3PHL A;  1PGQ A;  2P10 A;  3CLQ A;  4DCK A;  2WSE J;  1RY3 A;  1ZW0 A;  1QEX A;  4HH2 A;  2Y0C A;  1LT9 A;  1YJ9 P;  1HUC A;  1LTJ C;  1OW8 A;  1EDI A;  4EYY Q;  1KOR A;  1SQV D;  1CSB A;  1JOC A;  1K8A Q;  2G3A A;  2FYU E;  2M8R A;  5KLI B;  4N78 D;  3JCU E;  5APT A;  1WMK A;  2WSS H;  1T6A A;  5CCG D;  2WIT A;  1IFI A;  3M0D C;  2E75 C;  4H44 D;  3WMM 0;  1P84 D;  2A06 G;  2QE7 H;  1SFC A;  3WUU A;  4B86 A;  1GW3 A;  3AEE C;  1NTM J;  2FFD B;  4KHX A;  3AE9 C;  3NMD A;  4I7Z B;  2LXB A;  4D6T E;  3CC2 P;  5AW6 B;  3L4F A;  1K73 Q;  4AYC A;  5CCH D;  3L35 A;  1HGV A;  3CD6 P;  2PGD A;  1H8A A;  1IFM A;  1L0N D;  3HRN A;  1BCC D;  1S3J A;  2IBZ E;  2D2C B;  1LNQ A;  3KZI E;  3H1I D;  3KYQ A;  1QVF O;  3H32 B;  1MZ9 A;  2RH0 A;  1PP9 J;  2OTK E;  3EFF K;  5E79 H;  4Y99 C;  3H1J E;  1BDC A;  2K37 A;  5L8R J;  1JO5 A;  1W2B O;  1U7J A;  2XND H;  3KQG A;  3L74 E;  1GL2 C;  3O8Z A;  4YTP C;  3BAS A;  4BRY A;  4IL6 H;  1KQF B;  1IFP A;  3CC4 P;  3L75 E;  2IFN A;  1KQS O;  3NXS A;  1DD3 A;  3VN0 A;  1AV1 A;  3GMA A;  4H13 B;  2M3B A;  2W6J H;  3H1L E;  1BGY J;  3Q5R A;  1URQ C;  5GTH E;  1KMI Z;  3H1H E;  3SWF A;  3A0B H;  1NTM G;  4IOI H;  2W83 C;  1EQ7 A;  3B4S A;  1AJY A;  3BCC J;  1S2E A;  3KPE A;  2IDB A;  2I8D A;  1N73 B;  2WT7 B;  1YQ3 C;  2KSJ A;  4JBZ A;  3HE4 A;  1VDF A;  1VF5 B;  2GA1 A;  2HLO A;  1PP9 G;  2N1T A;  3HD7 C;  4WWI A;  1A02 J;  3GHG C;  1FZB A;  1IC2 A;  2AXT E;  1N7S B;  4OGQ C;  3CXH I;  2FYN C;  2FYU D;  2YKO A;  4WY4 D;  1NU1 E;  2QG4 A;  3FXE A;  1LT9 C;  1RF1 A;  2AXC A;  1E79 H;  5AVX B;  3D70 A;  3RK2 C;  5AVQ B;  2FY8 A;  1AQ5 A;  4CPG A;  1N8R Q;  2WPR A;  4ZMD A;  2OTL P;  3AE4 C;  4Z1M H;  1EDJ A;  3B5N D;  2V7Q J;  4WBA A;  3WUT A;  3D6Z A;  1M1K Q;  3B71 A;  1HJ0 A;  1N2D C;  3MIW A;  1VQ9 P;  2I1J A;  1AQT A;  2KS1 B;  3I56 P;  3RK3 B;  1BGY G;  2J58 A;  1BE3 E;  2B87 B;  2FXM A;  3N4X A;  5BVZ A;  1VQ8 P;  4D6T D;  4RO0 A;  3SFD C;  1HTL C;  5H2F E;  2C0X A;  1XTC C;  4I1L A;  3L73 J;  1H88 A;  1RH5 B;  4PJ0 H;  1SFC C;  2WWW A;  3E1R A;  3V2N A;  2PP6 A;  3H6P A;  2IBZ D;  3BCC G;  4UB8 H;  5CCG A;  2KIK A;  2O01 J;  2BCC E;  3R4Y A;  2NZ2 A;  2KNC A;  2XU6 A;  1JUN A;  3H1J D;  1P84 I;  3JSV C;  1R8E A;  1LP1 B;  1KQG B;  2BAS A;  3MZW B;  1J1D C;  3VP9 A;  2E74 B;  3L74 D;  1PL5 A;  2AEM A;  3TDK A;  3V2R A;  3VYI A;  3T97 A;  1G2C A;  3CCU P;  2WQY C;  4LC1 A;  3TNU B;  3L36 A;  3L75 D;  4EIJ A;  5TIS H;  5CCH A;  4WB4 A;  4HB1 A;  1QL2 A;  3CCR P;  1SQQ K;  1JCC A;  1LWU B;  2O1K A;  1UII A;  3RK3 E;  1NTK K;  5AW9 B;  3H1L D;  1Y47 A;  2Y0D A;  1QX8 A;  3H1H D;  3MUD A;  1PV3 A;  3UIA A;  4L73 A;  1LTJ B;  3CL3 D;  4K35 A;  4PV1 C;  1L0L K;  2CPS A;  4HJG H;  2R44 A;  1BSN A;  5CMZ A;  1KD1 Q;  1LJ2 A;  3O6Q A;  3EFG A;  1VQ6 P;  3L73 G;  2OYO A;  1FZF A;  1RF0 A;  1M1J A;  2H43 A;  2CK3 H;  1VPC A;  3RL0 D;  1CI6 B;  2E5T A;  3P8C E;  1DIP A;  1JMM A;  1L2P A;  3HTK B;  3MD0 A;  1KN7 A;  3BRT B;  1IK9 A;  1SQX E;  1YJN P;  2OYH A;  2GUS A;  3USS A;  3L71 J;  1OFC X;  4YXW H;  1SQP K;  3L72 J;  2HR3 A;  1GW4 A;  3OJA B;  1NU1 D;  1J1E C;  2QJK C;  3F5H A;  1M90 Q;  2YNY A;  2N1T C;  2QJP B;  1Z56 A;  4AUW A;  3H1I E;  4EOT A;  3AE3 C;  1VQM P;  1EDK A;  4A7P A;  1SQQ J;  3Q3D A;  3GLM A;  2ZT9 B;  1M57 D;  4EI2 A;  2POH A;  1PPJ G;  2JJL A;  1NTK J;  1BE3 D;  3D71 A;  4Y99 B;  1RF1 C;  3Q1M A;  5E79 E;  2V7Q H;  2MKV A;  2P7J A;  2LR2 A;  1S5L X;  1VQK P;  4WY4 A;  4C7N A;  5B5E E;  2KLV A;  2O3J A;  4MN4 C;  2H89 C;  3AE8 C;  3RGU A;  1NTZ K;  4H0L B;  1VF5 D;  1JY2 O;  1X8Y A;  2N9B A;  3CCJ P;  2ZXX A;  3JC2 2;  1YHQ P;  1FE6 A;  1KYO D;  3B5N A;  2ZYD A;  2WMM A;  4HKZ H;  3R2P A;  4L76 A;  5KAF E;  5APW A;  2Q1K A;  2Z4E A;  1ZXG A;  3L71 G;  1KB9 E;  1K04 A;  1EXJ A;  1ZN5 A;  2A06 E;  2L91 A;  1A02 F;  2Q9I A;  4OWF A;  3A0B E;  3PH0 A;  3VMZ A;  3H25 A;  1GU5 A;  1NKN A;  1WT6 A;  3E7K A;  1S5L H;  3FWN A;  1VQ5 P;  4IFF A;  2Y9Z A;  1YTZ T;  5DJT B;  2IBZ I;  3RK3 D;  3S1K A;  1RE3 A;  1SQQ G;  4R4M A;  4GT1 A;  2KSE A;  1NTK G;  5CCH C;  3L70 J;  1IJD B;  1SQB K;  2ZVN B;  1GDT A;  5APX A;  5KTB A;  1X79 B;  2W6B A;  3IAO A;  1VQL P;  3AEB C;  1LT9 B;  1L4A B;  4UB6 H;  4JYC A;  2WSC H;  1PGO A;  2YKP A;  2HYN A;  1FAV A;  3AE5 C;  1VQP P;  1Y9B A;  1L0L G;  3MUD C;  1KIL E;  2FKW B;  1NTZ J;  1JY3 N;  3P8C D;  2FFD A;  1SQX D;  2E74 D;  4ZNC A;  1MFT A;  2KZI A;  1YI2 P;  5CJ0 A;  1HGZ A;  4U3F J;  3MHV A;  5KKZ C;  1YIT P;  2JWD A;  1OW7 A;  3IF4 A;  1RF0 C;  1LGH B;  1M1J C;  2A45 H;  4HYT B;  4JF7 A;  1SQP G;  3AED C;  3H32 A;  2KXP B;  3U59 A;  3HUS B;  4PJ0 E;  2QSI A;  1NTM E;  2W6A A;  2OYH C;  1T2K D;  3CCE P;  1LTS C;  1UIX A;  5APU A;  3V4Q A;  2RN0 A;  1LTA C;  2B9B A;  2OQQ A;  2E76 C;  3CCS P;  3U1C A;  2WPV B;  3TGU J;  1KZU B;  4GOF A;  2KOG A;  1PP9 E;  1GZL A;  3CX5 H;  3L70 G;  1ZLL A;  3M06 A;  1MUU A;  1SQB J;  5AW8 B;  1HBW A;  2QIW A;  3CWB J;  3CC7 P;  2J59 M;  1EZV G;  5KLV K;  2H88 C;  3S9O A;  1JB0 J;  3G6E P;  2L5G B;  1KFM A;  5APQ A;  2M0B A;  1NTZ G;  3A0H H;  2YMK A;  4WY4 C;  1LT1 A;  5B66 E;  1L0L D;  1KB9 D;  2Y9Y A;  1XTG B;  2A06 D;  2HPC B;  5BU5 A;  2PRR A;  4U3F G;  4W7Y A;  1NWQ A;  3A5T A;  1EDL A;  1AVY A;  1N73 A;  2WT7 A;  4PV1 B;  3B5N C;  2CPB A;  3V5B A;  2NRG A;  1BGY E;  3EQ2 A;  1LTG C;  1NHL A;  2ZT9 D;  5DJU B;  1SQP D;  3C9I A;  2KB7 P;  1KYO I;  2R5D A;  3BCC E;  1CW5 A;  4W7Z A;  2O01 N;  2XKM A;  4PD4 H;  3II6 A;  5AVZ B;  3LID A;  3U1A A;  2FYZ A;  4H0L D;  3PTZ A;  1DH3 A;  4RES B;  3TGU G;  2JEE A;  3SFE C;  3WU2 H;  3M0A A;  4O9B A;  3HE4 B;  1FDI A;  1JCD A;  4M3L A;  4I6M C;  1OVV A;  1SQB G;  2YO2 A;  1KIL D;  2KS1 A;  1KQL A;  1RE3 C;  1JY2 P;  1KFN A;  3CWB G;  5KLI C;  3JCU H;  3QWO C;  5GTI E;  1QGK B;  2AEF A;  5KLV J;  4GDO A;  1SQV K;  2ZJS E;  4JYB A;  5KJ7 D;  3S4R A;  1OWA A;  2JP3 A;  1RF1 B;  2NPS B;  4L74 A;  1FZA A;  2IYP A;  3CCM P;  1JTH B;  2GUV A;  2ZAE B;  2QJY B;  1HF9 A;  1FJP A;  2FFD C;  1AFO A;  1R5L A;  1TU3 F;  1NTM D;  1BSH A;  1FJK A; 
#chains in the Genus database with same CATH homology
 3H1L G;  1BGY G;  1SQP G;  3H1I G;  3H1K G;  4PD4 H;  1SQB G;  1BE3 G;  1SQV G;  3H1J G;  3L75 G;  3H1H G;  2BCC G;  3CXH H;  1SQQ G;  1NTM G;  3CWB G;  1EZV G;  2IBZ G;  1SQX G;  4U3F G;  3TGU G;  3L71 G;  1PPJ G;  3L74 G;  1L0L G;  1NTK G;  3L73 G;  1P84 H;  1NU1 G;  1KYO H;  1PP9 G;  3CX5 H;  1NTZ G;  5KLV G;  3L70 G;  3L72 G;  1L0N G;  4D6T G;  2A06 G;  1BCC G;  3BCC G;  2FYU G;  1KB9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...