1P84H

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1p84H00
1SQPG 3H1JG 1BGYG 1NTMG 1NTZG 1KB9H 2IBZG 3H1LG 3CX5H 3H1KG 1L0NG 2FYUG 3L72G 4PD4H 5KLVG 3CWBG 1NU1G 2BCCG 3L74G 1P84H 1NTKG 3L73G 1SQXG 3TGUG 3H1IG 3BCCG 1PPJG 1L0LG 4D6TG 3CXHH 1BCCG 4U3FG 2A06G 1EZVG 1SQQG 1SQVG 3L71G 3L75G 1KYOH 1SQBG 3H1HG 1PP9G 3L70G 1BE3G
chains in the Genus database with same CATH superfamily
3NTNA 1HBWA 1L0LD 2AXTH 3AEDC 3C8VA 2BASA 4LLHA 2B87B 1JY3P 1FU1A 3AECC 1G1JA 2DW3A 2AXCA 1DD3A 5DJUB 2L5GB 1AVOA 4EOTA 3AEAC 3L73E 1U7MA 1RF0A 1BSNA 1OW7A 2V7QJ 1AQ5A 1LWUA 1BE3D 1N7SC 1PPJD 1JNMA 1GU5A 3HE4A 4JYBA 1ZW0A 2FXOA 2YMYA 3U1CA 1KB9I 2O1JA 2WPVB 3RL0D 1EZVG 2IYOA 1YBKA 3NFQA 1W5CE 2NPSB 4ZMDA 1EZVI 3BCCE 1M56D 1FZFA 1MKMA 1PPJE 1BE3E 4MN4C 1NTZE 3UIAA 1P84I 2JWDA 2E5TA 3Q5RA 5AVRB 1PL5A 2N9YB 1YYCA 4KT0J 1DIPA 3CCRP 4C7NA 1FDMA 3P8CD 2AXTE 5B5EE 2PFXA 4WY4D 3HD7C 1KYOD 1ZN5A 3PTZA 1GK4A 1NKZB 1FZAA 1NTKE 2JO1A 1PP9J 3MUDA 1KILA 4JPZB 1Q81Q 4RJTA 1E5WA 2KZJA 1N73B 3KQGA 1L4AA 4DZOA 1KQFB 2AEJA 2QM7A 3RK3E 3D6ZA 3WUTA 2E75B 3CXHH 1BCCG 2WITA 2WPSA 3L74J 2P7JA 1SQQG 3F89A 3TGUJ 1OW8A 1XTGB 1N7LA 2Q1KA 2XKMA 5AW3B 3RBXA 2HPCA 2QJKC 1SQVD 3E1IA 3GG2A 3H32A 1FDOA 1G2CA 1JY2P 1BDDA 1IFPA 2QJKB 1MFTA 4TT3H 1PIXA 2I1KA 1QVGO 2KZIA 2R3SA 2QJPB 2Y0DA 3RK3D 2OTLP 1SFCB 2FFDA 4L73A 4PV1B 3L37A 2FYUK 3TDKA 2OYIC 3S1KA 2IBZG 3KDPB 2R32A 3H1LG 1FAVA 2LR2A 3KYQA 5KAIE 2N1TD 1U57A 1SVFA 1KYOE 2KP8A 3GF3A 1A02J 1NU1D 1GD2E 4I7ZC 2R5BA 3VMZA 1KQSO 1RE3A 2K9JB 4U3FJ 2W8ZA 3L74E 1URQD 1SQPD 1Y8AA 1IC2A 2IZ1A 3TF5A 2XDJA 2R44A 1JB0J 1LTSC 1NTZD 2GUSA 1QL1A 2W90A 2WWWA 1S72P 1IJDB 3RK3C 3L36A 1JO5A 2YIUC 2B89A 3O6QA 1AJYA 1GK6A 3HE5A 5BU5A 3CWBD 3H1JD 2LXBA 3SFDC 3H1KJ 1J1EB 1LJ2A 3CPWO 4Z1MH 5CJ0A 3IN6A 3OAKA 1FZCA 2RH0A 1M1JB 1VQMP 3MZWB 2RN0A 2E5YA 4BWNA 2HFED 5GTHH 4IFMA 3M0AA 2WPQA 3ZDMA 1SQVJ 3KHUA 1GMJA 1NTMD 3TNUB 1OXZA 3BRTB 1S9KD 1HGZA 3H1JJ 1FS0E 1BE3J 1SQBD 2AEMA 1CZQA 4BRYA 2OYIB 3NXSA 3MP7B 2ZYGA 2JP3A 3L73G 2Q3EA 3SWKA 1YTZT 5KLIB 1K05A 4ZKPA 1JCCA 2CPBA 1NAYA 3WU2H 1LWUB 1IZNB 1PZQA 2NZ2A 1YIJP 5AVUB 4HJGH 3C1LA 5AVQB 5B5EH 1H0TB 1EQ7A 3CX5D 1SFCA 3AE5C 1EZVE 1Y47A 3PHLA 2E74D 4LGDE 5M1BA 1LWUC 2I8DA 2OYHB 3L70D 3A5TA 3D70A 1PGQA 2E75C 5AW2B 1KN7A 1MZ9A 2YIUB 5DJTB 1LP1A 2LKMA 2KB7P 2XZRA 5GTIH 1SQPK 3RL0C 2HPCB 1NTZG 5APYA 2Z5IA 1NOHA 1YI2P 1JOCA 3T97B 1YQ3C 2J59M 4I1LA 1FC2C 3W67A 1WMKA 2OGUA 4GKGA 2KXPB 2KK7A 1JMMA 4H44C 3VMAA 3L71J 1NTKJ 1FZCB 2E76D 4IOIH 4M3LA 1T6AA 4W80A 4ASVA 3M06A 3AEFC 3TGUD 1JY2N 3TSIA 2GA1A 2BCCE 1JY3O 2JWAA 2K9YA 1OVVA 3V2QA 1XTCC 2B9BA 2G8YA 1S5LE 3RK2C 2N1TA 2H8PD 5E79E 5KLVK 2WSEJ 2WTYA 2FFDC 4AYCA 2QE7H 2E75D 1S2EA 1WRGA 5CCHD 2JDIH 3C9IA 3EWKA 3LW5H 1BGYE 3GLMA 3H1JG 2KOGA 3H6PA 2RMZA 5AW5B 3VN0A 3Q2YA 1ZR4A 1FZGA 1M90Q 4IFFA 3S4RA 3A0BH 1IK9A 2YMKA 3PLNA 4GODA 4NPEA 1QLED 2IBZI 1K04A 1RHZB 1FBMA 4ZKUA 4WY4B 1HJBA 2PGDA 3CCMP 2IPPA 1S1CX 2XNDH 4PD4I 2YO2A 1J1DC 3AEGC 3EFGA 3FGAD 1NU1G 1ZXGA 3L73J 2HLOA 3H1IJ 3P8MC 5BU8B 1L0LE 3GF7A 1PV3A 5CCGA 3AEBC 2A06E 1SQXD 2KI7B 3A0HE 3L72J 5KKZB 2H43A 2OYIA 4IFDK 1QVFO 2E74B 3AE2C 1RF1A 3H1KD 1KMIZ 4OGQD 1N7SA 4N78D 1K8AQ 1H8AA 3NMDA 1YJWP 1JUNA 1LT1A 1Q90D 2E76C 1A02F 1TU3F 2WSCJ 1IFJA 2KSEA 2AEFA 3A2AA 3A3YB 2A06D 2JKVA 3EQ2A 5AVTB 4WB4A 5AW7B 1JMBA 4WBAA 3RK2D 3U59A 3CCSP 1IFDA 1M1KQ 2H88C 3BVHA 1SQBE 3BATA 2ZT9B 2FYUE 2M5AB 2O3JA 3L71E 3V4QA 2LXCB 1IFMA 3WUVA 1KC8Q 2W6BA 3CCLP 2KUBA 3B5NA 4EDFA 2ZT9C 3IFMA 1L0NG 3BCCJ 3LIDA 2R5DA 1ZR2A 2O1KA 2Y0EA 1HUCA 3CC4P 1URQA 2HODA 3MIWA 3VP9A 2XV5A 4IL6H 1NJIQ 2QIWA 3BCCG 3M91A 3R2PA 3HD7A 4DCKA 1U7JA 1PPJG 3USSA 5KLVJ 4L75A 1RY3A 3Q5PA 4W7ZA 2P1JA 1IO4A 4EYYQ 1IFNA 2BEQD 3G4SP 3AE6C 2C0WA 2ZFCA 1KILC 1SQVG 1VL2A 3AE8C 3L75G 4EIJA 1L4AC 1PP9G 1SS1A 4K3AA 4TLFA 1K73Q 3L74D 5AW6B 2PAJA 4HB1A 3IAOA 1CSBA 2FYZA 2SPZA 4YXDC 3CLQA 1NU1E 3MD0A 1S5LH 2CPSA 3CCUP 1OVUA 1NAFA 1KQGB 1SQPJ 1PP9D 2K1AA 2KLUA 2W6AA 3QWOC 4QMAA 3CD6P 2FYUD 2HG5D 2OYOA 5KLVE 4YPCA 1VQKP 1JY3N 3WU2E 5H2FE 1G1IA 1YJNP 3CMEP 3HD7B 5H2FH 2IX7C 3P7KA 1NKNA 2M3BA 1NTZK 2Z5HA 5CMZA 2H89C 4H0LD 3H1HD 2QVAA 3S9OA 3JCUH 4OVNF 5CCHC 1GTWA 1NYHA 2FBWC 1KILB 3A0BE 2ZAEB 1N8RQ 1GW3A 2D2CD 2JEEA 2FYUJ 1R5SA 1NU1K 3FXEA 5APQA 3V2PA 3KZIE 3L70E 5APSA 1KB9D 3CXHE 1FOSE 3OA7A 1RE3C 4CPGA 3JC22 5CCGD 1SQXE 1M8OB 3CX5E 1YJ9P 3O8ZA 3CCJP 1LTGC 4B86A 2OYHC 5AW1B 1T8ZA 2IDBA 2PRRA 5AVYB 1OMIA 2ITAA 1ZLLA 1BGYG 1LP1B 3CCEP 3AE1C 1N7SB 1NTKD 4C7RA 1AQTA 2WSFJ 1VQ4P 4LC1A 1OVRA 1VF5D 2HYNA 3BRVB 3TYYA 1LTAC 3SWFA 1IK7A 3MHVA 3P8CE 5AVWB 5KLIC 1EC5A 2OYHA 4L74A 2QM8A 3H1KG 2QEXP 2Q9IA 5KLVD 3H1IE 4PJ0E 3V5BA 1DEBA 1KYOI 1JTHB 1LTBC 1MV8A 1NTME 1NTKG 1P84H 1M57D 2A45I 2K37A 2ZT9D 3HE4B 4ZNCA 3Q1MA 3BCCD 4OGQC 4OWFA 5KAFE 1L0LG 2A45G 3CL3D 3KPEA 1P84D 4WY4A 2W83C 1HVVA 2A06G 2D2CC 2ZYAA 3GW6A 3JCUE 5AW0B 3L71G 3VMYA 4BRYB 1GL2A 3CWBE 1BCCE 3OW2O 2YXRB 1SQQE 4H13C 1KFNA 2KIKA 3CI9A 3TNUA 2FYNC 2BCCD 3B5NB 1VQOP 5TJHA 3CX5I 2WPRA 5CCGC 1EDJA 3FWNA 4D6TE 1OIPA 4RO0A 3Q3DA 1VQ8P 3MUDC 2KNCB 4WY4C 4ASWA 2O01N 2KS1A 1GL2C 2N9BA 2GUVA 2P67A 2WMMA 4XFJA 5CHXA 4C46A 2C9LY 2FXPA 2OTJP 1OWAA 2FYUG 1SP4A 3L75J 4BXLA 1PGPA 1VDFA 3GHGA 4HKZH 1EDIA 1NHLA 2PP6A 1QEXA 4HH2A 4U7JA 5AVSB 3V2RA 1FZEA 1DD4A 2ZXEB 1SQXG 1GDTA 3TGUG 4JQ0D 3V2NA 1BCCJ 3B4SA 2K9JA 3GMAA 3KXDA 3WMM0 2NRGA 3IF4A 4U3FD 5K5GB 1N2DC 2ZVOB 1VQ5P 1KB9E 1R5LA 3L72E 3T97A 1KYOH 1NU1J 2J5UA 5KAFH 3MTUE 1PFIA 3ABVC 3V6IA 4H13D 1EXJA 1SQPG 1NVOA 2WSSH 2MJZA 1NO4A 2YNYA 2N1TC 1LNQA 3VOPA 1Q86Q 1KTMA 1VQ7P 2R3CA 1NTMG 2J58A 2Y0CA 3VMXA 2H7HA 1J1DB 3B5ND 1G2CB 3I56P 1AVYA 2P10A 4IL6E 3RBZA 1DH3A 3H32B 3KZIH 1L0ND 2WT7B 2HR3A 4RKUJ 3SWYA 2GM4A 1FZBA 2FY8A 3CWBG 2A45H 2QJPC 4H44B 4DT0A 1W2BO 5APXA 1UIXA 4AQRD 3HRNA 3CCVP 2HODB 2K3RA 1VF5C 1FJKA 1URQB 1IFIA 1M1JC 3A0HH 3H1JE 3H1LJ 1GW4A 3I5CA 4D6TD 4D6TG 1YITP 1JM0A 1LTJB 3AEEC 4N3YB 1FE6A 1DEEG 3AE9C 5L8RJ 1SQQD 1Q82Q 2Y9YA 3L70G 5CCHA 4WWIA 2KS1B 1QL2A 1UIIA 2E74C 2KLVA 4C7NB 2KSJA 1USEA 1HJ0A 1P84E 2UWJE 4NPDA 1RF1C 1VQ9P 1EDKA 3AE3C 5KJ7D 3L70J 1AFOA 3R4YA 1L2PA 3H1HJ 3HE5B 2WSFH 1ZMEC 1GL2D 1OX3A 3AE7C 2I1JA 3FX0A 3H1LE 3SSUA 1LTJA 3RGUA 5CBOA 1J2JB 1FZCC 2NPSA 4EI2A 3D6YA 3VP8A 1KFMA 1VQPP 4PD4E 1GL2B 1KQLA 1MFZA 1RF1B 4NPFX 2IFNA 1L0LJ 3L72G 4PD4H 3G6EP 1SQQJ 1GU4A 1VQLP 1ZRTD 1NTMK 1PGOA 1H0TA 1HGVA 1L4AD 2Q3IA 3H1IG 5BVZA 2IZ0A 5APTA 3M9HA 5AW9B 4JBZA 2QG4A 4JF7A 4XE5B 1H89A 2FKWB 1JTHA 4N78E 2Z4EA 2NPSC 1RH5B 3L72D 5KKZC 1URQC 1VPCA 1YTZI 2ZVNB 3K5BA 1NTMJ 1WT6A 1EZVD 1SQBG 1FDIA 2WSCH 3L71D 3M0DA 4UB6E 1SQQK 3CXHD 3LW5J 5B66E 5KTBA 2C0XA 3PJSK 3Q5SA 3RK2B 4A7PA 1AA0A 1Y9BA 3U1AA 4H44D 2YKPA 3L35A 4GIFA 1S5LX 5AVVB 2E42A 1T2KD 1T3JA 2CK3H 1NWQA 1SLQA 1EDLA 4GT1A 4HYTB 2OQQA 2JR8A 1Q2NA 3HUSC 3H1HE 3IR9A 3M0DC 1KB9H 2XNXA 3VYIA 1HH0A 4I7ZB 2N1TB 2IYPA 3PH0A 1HTLC 5C39A 4DOJA 3CMAP 4UB8E 3II6A 3ITKA 3L75E 3HUSB 4YXWH 1BDCA 1PP9E 3E7KA 2P2UA 4YTPC 3RL0B 2OARA 1FJPA 1NH4A 1HF9A 3GHGB 3HUSA 4IL6X 4O9BA 5APUA 2M0BA 1S9KE 3W68A 1LTTC 1ZOYC 1LGHB 1BCCD 2ZXXA 4U3FG 3G3ZA 3G9RA 1RQVA 1USDA 3FXDA 3PP5A 2L91A 3QH9A 4H13B 1T2KC 1M7LA 5TISE 1HWTC 3GHGC 3CC2P 2Q5UA 3N7NA 2W27A 1QGKB 2WT7A 2M3EA 1RF0C 1RQUA 1VF5B 1NTKK 1D7MA 1SQPE 3H1ID 3TK1A 3L73D 1R8EA 2ZYDA 1Q7YQ 1OW6A 1ZP0C 1LTIC 3M9BA 1KZUB 4Y99B 3H25A 3D71A 2V7QH 5KAIH 3PRJA 2YXQB 4GDOA 2BCCG 1X8YA 1JY2O 2YKQA 4Y28J 5CBNA 4AUWA 1KD1Q 3MGNA 1KILD 2G3AA 3B71A 1J1EC 1E79H 1OFCX 2QSIA 3N4XA 2POHA 1H88A 1W2EA 1T3UA 2M8RA 1CI6B 4OGQB 2KYVA 1YQ4C 1BGYJ 3H1HG 3CXHI 5EFWB 1LT9B 1BE3G 1SFCD 2B87A 3RK3B 2M5AA 2RKLA 4OH8B 3CCQP 2FXMA 2OTKE 2QRXA 2WQYC 3H1KE 2C9NY 1QX8A 1ZRTE 2W6JH 1VQ6P 1M1JA 4GOEA 3P32A 1KILE 1SQBJ 1SQXK 4DJGA 5AW8B 1DX7A 4PD4D 3F5HA 3HTKB 2QJYB 3EFFK 4L76A 1Z56A 3FWLA 3O6QB 4GOFA 2Q7CA 5AW4B 1LT9A 2YO3A 3V4WA 4D6TJ 1X79B 3H1LD 1CI6A 1SQVK 2IBZD 1S4XA 4UB6H 5AVZB 2FFDB 5KLVG 4PV1C 2WVRA 3A7OA 2XU6A 1OZHA 1L0LK 3CWBJ 1SFCC 4Y99C 1EXIA 2BEZF 4PJ0H 2WSEH 3BASA 4R4LA 3CC7P 5APWA 1LTJC 2E76B 2FYNB 1L0NJ 3B5NC 4K35A 1NGMB 1LT9C 4JYCA 4KHXA 1BGYD 1GZLA 1X22A 1X9VA 2MKVA 2P58A 4UB8H 2E43A 1KV4A 2D2CB 2YKOA 4XA4A 3AE4C 5KJ7A 4I2LC 5CJ4A 1KORA 4H0LB 4WVZA 3WUUA 2IFMA 2K88A 3HD7D 1X0TA 1JCDA 2NPSD 2IBZE 5GTIE 3TGUE 3I55P 1N73C 5TISH 4I6MC 1L0NK 1RE4C 1L0NE 3B8EB 3RL0g 2B88A 3L75D 2O01H 5APVA 1YHQP 2QA4P 1K9MQ 3LIEA 3CX5H 5KJ7C 4H0LC 1S3JA 5AVXB 1FOSF 5GTHE 1SQXJ 2JJLA 1MUUA 2QJYC 3OJAB 2O01J 1JEKA 3L4FA 3L74G 2Y9ZA 3JSVC 2VRSA 1L4AB 4KJMA 1N73A 4N6JA 5B66H 2Q6QA 4R4MA 3SFEC 3VTPC 1RE4A 1SQVE 1PGJA 1N86A 4W7YA 3G71P 2BCCJ 2ZJSE 1CW5A 3M9QA 4RESB 5E79H 3HTKA 1ZV8A 1AV1A 1SQBK 1VQNP 1BSHA 4U3FE 2V4HA 1N7SD 3E1RA 1NTZJ 2WZ7A 2KNCA 4PV1D
chains in the Genus database with same CATH topology
1SQPG 3H1JG 1BGYG 1NTMG 1NTZG 1KB9H 2IBZG 3H1LG 3CX5H 3H1KG 1L0NG 2FYUG 3L72G 4PD4H 5KLVG 3CWBG 1NU1G 2BCCG 3L74G 1P84H 1NTKG 3L73G 1SQXG 3TGUG 3H1IG 3BCCG 1PPJG 1L0LG 4D6TG 3CXHH 1BCCG 4U3FG 2A06G 1EZVG 1SQQG 1SQVG 3L71G 3L75G 1KYOH 1SQBG 3H1HG 1PP9G 3L70G 1BE3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP G;  3H1J G;  1BGY G;  1NTM G;  1NTZ G;  1KB9 H;  2IBZ G;  3H1L G;  3CX5 H;  3H1K G;  1L0N G;  2FYU G;  3L72 G;  4PD4 H;  5KLV G;  3CWB G;  1NU1 G;  2BCC G;  3L74 G;  1P84 H;  1NTK G;  3L73 G;  1SQX G;  3TGU G;  3H1I G;  3BCC G;  1PPJ G;  1L0L G;  4D6T G;  3CXH H;  1BCC G;  4U3F G;  2A06 G;  1EZV G;  1SQQ G;  1SQV G;  3L71 G;  3L75 G;  1KYO H;  1SQB G;  3H1H G;  1PP9 G;  3L70 G;  1BE3 G; 
#chains in the Genus database with same CATH topology
 3NTN A;  1HBW A;  1L0L D;  2AXT H;  3AED C;  3C8V A;  2BAS A;  4LLH A;  2B87 B;  1JY3 P;  1FU1 A;  3AEC C;  1G1J A;  2DW3 A;  2AXC A;  1DD3 A;  5DJU B;  2L5G B;  1AVO A;  4EOT A;  3AEA C;  3L73 E;  1U7M A;  1RF0 A;  1BSN A;  1OW7 A;  2V7Q J;  1AQ5 A;  1LWU A;  1BE3 D;  1N7S C;  1PPJ D;  1JNM A;  1GU5 A;  3HE4 A;  4JYB A;  1ZW0 A;  2FXO A;  2YMY A;  3U1C A;  1KB9 I;  2O1J A;  2WPV B;  3RL0 D;  1EZV G;  2IYO A;  1YBK A;  3NFQ A;  1W5C E;  2NPS B;  4ZMD A;  1EZV I;  3BCC E;  1M56 D;  1FZF A;  1MKM A;  1PPJ E;  1BE3 E;  4MN4 C;  1NTZ E;  3UIA A;  1P84 I;  2JWD A;  2E5T A;  3Q5R A;  5AVR B;  1PL5 A;  2N9Y B;  1YYC A;  4KT0 J;  1DIP A;  3CCR P;  4C7N A;  1FDM A;  3P8C D;  2AXT E;  5B5E E;  2PFX A;  4WY4 D;  3HD7 C;  1KYO D;  1ZN5 A;  3PTZ A;  1GK4 A;  1NKZ B;  1FZA A;  1NTK E;  2JO1 A;  1PP9 J;  3MUD A;  1KIL A;  4JPZ B;  1Q81 Q;  4RJT A;  1E5W A;  2KZJ A;  1N73 B;  3KQG A;  1L4A A;  4DZO A;  1KQF B;  2AEJ A;  2QM7 A;  3RK3 E;  3D6Z A;  3WUT A;  2E75 B;  3CXH H;  1BCC G;  2WIT A;  2WPS A;  3L74 J;  2P7J A;  1SQQ G;  3F89 A;  3TGU J;  1OW8 A;  1XTG B;  1N7L A;  2Q1K A;  2XKM A;  5AW3 B;  3RBX A;  2HPC A;  2QJK C;  1SQV D;  3E1I A;  3GG2 A;  3H32 A;  1FDO A;  1G2C A;  1JY2 P;  1BDD A;  1IFP A;  2QJK B;  1MFT A;  4TT3 H;  1PIX A;  2I1K A;  1QVG O;  2KZI A;  2R3S A;  2QJP B;  2Y0D A;  3RK3 D;  2OTL P;  1SFC B;  2FFD A;  4L73 A;  4PV1 B;  3L37 A;  2FYU K;  3TDK A;  2OYI C;  3S1K A;  2IBZ G;  3KDP B;  2R32 A;  3H1L G;  1FAV A;  2LR2 A;  3KYQ A;  5KAI E;  2N1T D;  1U57 A;  1SVF A;  1KYO E;  2KP8 A;  3GF3 A;  1A02 J;  1NU1 D;  1GD2 E;  4I7Z C;  2R5B A;  3VMZ A;  1KQS O;  1RE3 A;  2K9J B;  4U3F J;  2W8Z A;  3L74 E;  1URQ D;  1SQP D;  1Y8A A;  1IC2 A;  2IZ1 A;  3TF5 A;  2XDJ A;  2R44 A;  1JB0 J;  1LTS C;  1NTZ D;  2GUS A;  1QL1 A;  2W90 A;  2WWW A;  1S72 P;  1IJD B;  3RK3 C;  3L36 A;  1JO5 A;  2YIU C;  2B89 A;  3O6Q A;  1AJY A;  1GK6 A;  3HE5 A;  5BU5 A;  3CWB D;  3H1J D;  2LXB A;  3SFD C;  3H1K J;  1J1E B;  1LJ2 A;  3CPW O;  4Z1M H;  5CJ0 A;  3IN6 A;  3OAK A;  1FZC A;  2RH0 A;  1M1J B;  1VQM P;  3MZW B;  2RN0 A;  2E5Y A;  4BWN A;  2HFE D;  5GTH H;  4IFM A;  3M0A A;  2WPQ A;  3ZDM A;  1SQV J;  3KHU A;  1GMJ A;  1NTM D;  3TNU B;  1OXZ A;  3BRT B;  1S9K D;  1HGZ A;  3H1J J;  1FS0 E;  1BE3 J;  1SQB D;  2AEM A;  1CZQ A;  4BRY A;  2OYI B;  3NXS A;  3MP7 B;  2ZYG A;  2JP3 A;  3L73 G;  2Q3E A;  3SWK A;  1YTZ T;  5KLI B;  1K05 A;  4ZKP A;  1JCC A;  2CPB A;  1NAY A;  3WU2 H;  1LWU B;  1IZN B;  1PZQ A;  2NZ2 A;  1YIJ P;  5AVU B;  4HJG H;  3C1L A;  5AVQ B;  5B5E H;  1H0T B;  1EQ7 A;  3CX5 D;  1SFC A;  3AE5 C;  1EZV E;  1Y47 A;  3PHL A;  2E74 D;  4LGD E;  5M1B A;  1LWU C;  2I8D A;  2OYH B;  3L70 D;  3A5T A;  3D70 A;  1PGQ A;  2E75 C;  5AW2 B;  1KN7 A;  1MZ9 A;  2YIU B;  5DJT B;  1LP1 A;  2LKM A;  2KB7 P;  2XZR A;  5GTI H;  1SQP K;  3RL0 C;  2HPC B;  1NTZ G;  5APY A;  2Z5I A;  1NOH A;  1YI2 P;  1JOC A;  3T97 B;  1YQ3 C;  2J59 M;  4I1L A;  1FC2 C;  3W67 A;  1WMK A;  2OGU A;  4GKG A;  2KXP B;  2KK7 A;  1JMM A;  4H44 C;  3VMA A;  3L71 J;  1NTK J;  1FZC B;  2E76 D;  4IOI H;  4M3L A;  1T6A A;  4W80 A;  4ASV A;  3M06 A;  3AEF C;  3TGU D;  1JY2 N;  3TSI A;  2GA1 A;  2BCC E;  1JY3 O;  2JWA A;  2K9Y A;  1OVV A;  3V2Q A;  1XTC C;  2B9B A;  2G8Y A;  1S5L E;  3RK2 C;  2N1T A;  2H8P D;  5E79 E;  5KLV K;  2WSE J;  2WTY A;  2FFD C;  4AYC A;  2QE7 H;  2E75 D;  1S2E A;  1WRG A;  5CCH D;  2JDI H;  3C9I A;  3EWK A;  3LW5 H;  1BGY E;  3GLM A;  3H1J G;  2KOG A;  3H6P A;  2RMZ A;  5AW5 B;  3VN0 A;  3Q2Y A;  1ZR4 A;  1FZG A;  1M90 Q;  4IFF A;  3S4R A;  3A0B H;  1IK9 A;  2YMK A;  3PLN A;  4GOD A;  4NPE A;  1QLE D;  2IBZ I;  1K04 A;  1RHZ B;  1FBM A;  4ZKU A;  4WY4 B;  1HJB A;  2PGD A;  3CCM P;  2IPP A;  1S1C X;  2XND H;  4PD4 I;  2YO2 A;  1J1D C;  3AEG C;  3EFG A;  3FGA D;  1NU1 G;  1ZXG A;  3L73 J;  2HLO A;  3H1I J;  3P8M C;  5BU8 B;  1L0L E;  3GF7 A;  1PV3 A;  5CCG A;  3AEB C;  2A06 E;  1SQX D;  2KI7 B;  3A0H E;  3L72 J;  5KKZ B;  2H43 A;  2OYI A;  4IFD K;  1QVF O;  2E74 B;  3AE2 C;  1RF1 A;  3H1K D;  1KMI Z;  4OGQ D;  1N7S A;  4N78 D;  1K8A Q;  1H8A A;  3NMD A;  1YJW P;  1JUN A;  1LT1 A;  1Q90 D;  2E76 C;  1A02 F;  1TU3 F;  2WSC J;  1IFJ A;  2KSE A;  2AEF A;  3A2A A;  3A3Y B;  2A06 D;  2JKV A;  3EQ2 A;  5AVT B;  4WB4 A;  5AW7 B;  1JMB A;  4WBA A;  3RK2 D;  3U59 A;  3CCS P;  1IFD A;  1M1K Q;  2H88 C;  3BVH A;  1SQB E;  3BAT A;  2ZT9 B;  2FYU E;  2M5A B;  2O3J A;  3L71 E;  3V4Q A;  2LXC B;  1IFM A;  3WUV A;  1KC8 Q;  2W6B A;  3CCL P;  2KUB A;  3B5N A;  4EDF A;  2ZT9 C;  3IFM A;  1L0N G;  3BCC J;  3LID A;  2R5D A;  1ZR2 A;  2O1K A;  2Y0E A;  1HUC A;  3CC4 P;  1URQ A;  2HOD A;  3MIW A;  3VP9 A;  2XV5 A;  4IL6 H;  1NJI Q;  2QIW A;  3BCC G;  3M91 A;  3R2P A;  3HD7 A;  4DCK A;  1U7J A;  1PPJ G;  3USS A;  5KLV J;  4L75 A;  1RY3 A;  3Q5P A;  4W7Z A;  2P1J A;  1IO4 A;  4EYY Q;  1IFN A;  2BEQ D;  3G4S P;  3AE6 C;  2C0W A;  2ZFC A;  1KIL C;  1SQV G;  1VL2 A;  3AE8 C;  3L75 G;  4EIJ A;  1L4A C;  1PP9 G;  1SS1 A;  4K3A A;  4TLF A;  1K73 Q;  3L74 D;  5AW6 B;  2PAJ A;  4HB1 A;  3IAO A;  1CSB A;  2FYZ A;  2SPZ A;  4YXD C;  3CLQ A;  1NU1 E;  3MD0 A;  1S5L H;  2CPS A;  3CCU P;  1OVU A;  1NAF A;  1KQG B;  1SQP J;  1PP9 D;  2K1A A;  2KLU A;  2W6A A;  3QWO C;  4QMA A;  3CD6 P;  2FYU D;  2HG5 D;  2OYO A;  5KLV E;  4YPC A;  1VQK P;  1JY3 N;  3WU2 E;  5H2F E;  1G1I A;  1YJN P;  3CME P;  3HD7 B;  5H2F H;  2IX7 C;  3P7K A;  1NKN A;  2M3B A;  1NTZ K;  2Z5H A;  5CMZ A;  2H89 C;  4H0L D;  3H1H D;  2QVA A;  3S9O A;  3JCU H;  4OVN F;  5CCH C;  1GTW A;  1NYH A;  2FBW C;  1KIL B;  3A0B E;  2ZAE B;  1N8R Q;  1GW3 A;  2D2C D;  2JEE A;  2FYU J;  1R5S A;  1NU1 K;  3FXE A;  5APQ A;  3V2P A;  3KZI E;  3L70 E;  5APS A;  1KB9 D;  3CXH E;  1FOS E;  3OA7 A;  1RE3 C;  4CPG A;  3JC2 2;  5CCG D;  1SQX E;  1M8O B;  3CX5 E;  1YJ9 P;  3O8Z A;  3CCJ P;  1LTG C;  4B86 A;  2OYH C;  5AW1 B;  1T8Z A;  2IDB A;  2PRR A;  5AVY B;  1OMI A;  2ITA A;  1ZLL A;  1BGY G;  1LP1 B;  3CCE P;  3AE1 C;  1N7S B;  1NTK D;  4C7R A;  1AQT A;  2WSF J;  1VQ4 P;  4LC1 A;  1OVR A;  1VF5 D;  2HYN A;  3BRV B;  3TYY A;  1LTA C;  3SWF A;  1IK7 A;  3MHV A;  3P8C E;  5AVW B;  5KLI C;  1EC5 A;  2OYH A;  4L74 A;  2QM8 A;  3H1K G;  2QEX P;  2Q9I A;  5KLV D;  3H1I E;  4PJ0 E;  3V5B A;  1DEB A;  1KYO I;  1JTH B;  1LTB C;  1MV8 A;  1NTM E;  1NTK G;  1P84 H;  1M57 D;  2A45 I;  2K37 A;  2ZT9 D;  3HE4 B;  4ZNC A;  3Q1M A;  3BCC D;  4OGQ C;  4OWF A;  5KAF E;  1L0L G;  2A45 G;  3CL3 D;  3KPE A;  1P84 D;  4WY4 A;  2W83 C;  1HVV A;  2A06 G;  2D2C C;  2ZYA A;  3GW6 A;  3JCU E;  5AW0 B;  3L71 G;  3VMY A;  4BRY B;  1GL2 A;  3CWB E;  1BCC E;  3OW2 O;  2YXR B;  1SQQ E;  4H13 C;  1KFN A;  2KIK A;  3CI9 A;  3TNU A;  2FYN C;  2BCC D;  3B5N B;  1VQO P;  5TJH A;  3CX5 I;  2WPR A;  5CCG C;  1EDJ A;  3FWN A;  4D6T E;  1OIP A;  4RO0 A;  3Q3D A;  1VQ8 P;  3MUD C;  2KNC B;  4WY4 C;  4ASW A;  2O01 N;  2KS1 A;  1GL2 C;  2N9B A;  2GUV A;  2P67 A;  2WMM A;  4XFJ A;  5CHX A;  4C46 A;  2C9L Y;  2FXP A;  2OTJ P;  1OWA A;  2FYU G;  1SP4 A;  3L75 J;  4BXL A;  1PGP A;  1VDF A;  3GHG A;  4HKZ H;  1EDI A;  1NHL A;  2PP6 A;  1QEX A;  4HH2 A;  4U7J A;  5AVS B;  3V2R A;  1FZE A;  1DD4 A;  2ZXE B;  1SQX G;  1GDT A;  3TGU G;  4JQ0 D;  3V2N A;  1BCC J;  3B4S A;  2K9J A;  3GMA A;  3KXD A;  3WMM 0;  2NRG A;  3IF4 A;  4U3F D;  5K5G B;  1N2D C;  2ZVO B;  1VQ5 P;  1KB9 E;  1R5L A;  3L72 E;  3T97 A;  1KYO H;  1NU1 J;  2J5U A;  5KAF H;  3MTU E;  1PFI A;  3ABV C;  3V6I A;  4H13 D;  1EXJ A;  1SQP G;  1NVO A;  2WSS H;  2MJZ A;  1NO4 A;  2YNY A;  2N1T C;  1LNQ A;  3VOP A;  1Q86 Q;  1KTM A;  1VQ7 P;  2R3C A;  1NTM G;  2J58 A;  2Y0C A;  3VMX A;  2H7H A;  1J1D B;  3B5N D;  1G2C B;  3I56 P;  1AVY A;  2P10 A;  4IL6 E;  3RBZ A;  1DH3 A;  3H32 B;  3KZI H;  1L0N D;  2WT7 B;  2HR3 A;  4RKU J;  3SWY A;  2GM4 A;  1FZB A;  2FY8 A;  3CWB G;  2A45 H;  2QJP C;  4H44 B;  4DT0 A;  1W2B O;  5APX A;  1UIX A;  4AQR D;  3HRN A;  3CCV P;  2HOD B;  2K3R A;  1VF5 C;  1FJK A;  1URQ B;  1IFI A;  1M1J C;  3A0H H;  3H1J E;  3H1L J;  1GW4 A;  3I5C A;  4D6T D;  4D6T G;  1YIT P;  1JM0 A;  1LTJ B;  3AEE C;  4N3Y B;  1FE6 A;  1DEE G;  3AE9 C;  5L8R J;  1SQQ D;  1Q82 Q;  2Y9Y A;  3L70 G;  5CCH A;  4WWI A;  2KS1 B;  1QL2 A;  1UII A;  2E74 C;  2KLV A;  4C7N B;  2KSJ A;  1USE A;  1HJ0 A;  1P84 E;  2UWJ E;  4NPD A;  1RF1 C;  1VQ9 P;  1EDK A;  3AE3 C;  5KJ7 D;  3L70 J;  1AFO A;  3R4Y A;  1L2P A;  3H1H J;  3HE5 B;  2WSF H;  1ZME C;  1GL2 D;  1OX3 A;  3AE7 C;  2I1J A;  3FX0 A;  3H1L E;  3SSU A;  1LTJ A;  3RGU A;  5CBO A;  1J2J B;  1FZC C;  2NPS A;  4EI2 A;  3D6Y A;  3VP8 A;  1KFM A;  1VQP P;  4PD4 E;  1GL2 B;  1KQL A;  1MFZ A;  1RF1 B;  4NPF X;  2IFN A;  1L0L J;  3L72 G;  4PD4 H;  3G6E P;  1SQQ J;  1GU4 A;  1VQL P;  1ZRT D;  1NTM K;  1PGO A;  1H0T A;  1HGV A;  1L4A D;  2Q3I A;  3H1I G;  5BVZ A;  2IZ0 A;  5APT A;  3M9H A;  5AW9 B;  4JBZ A;  2QG4 A;  4JF7 A;  4XE5 B;  1H89 A;  2FKW B;  1JTH A;  4N78 E;  2Z4E A;  2NPS C;  1RH5 B;  3L72 D;  5KKZ C;  1URQ C;  1VPC A;  1YTZ I;  2ZVN B;  3K5B A;  1NTM J;  1WT6 A;  1EZV D;  1SQB G;  1FDI A;  2WSC H;  3L71 D;  3M0D A;  4UB6 E;  1SQQ K;  3CXH D;  3LW5 J;  5B66 E;  5KTB A;  2C0X A;  3PJS K;  3Q5S A;  3RK2 B;  4A7P A;  1AA0 A;  1Y9B A;  3U1A A;  4H44 D;  2YKP A;  3L35 A;  4GIF A;  1S5L X;  5AVV B;  2E42 A;  1T2K D;  1T3J A;  2CK3 H;  1NWQ A;  1SLQ A;  1EDL A;  4GT1 A;  4HYT B;  2OQQ A;  2JR8 A;  1Q2N A;  3HUS C;  3H1H E;  3IR9 A;  3M0D C;  1KB9 H;  2XNX A;  3VYI A;  1HH0 A;  4I7Z B;  2N1T B;  2IYP A;  3PH0 A;  1HTL C;  5C39 A;  4DOJ A;  3CMA P;  4UB8 E;  3II6 A;  3ITK A;  3L75 E;  3HUS B;  4YXW H;  1BDC A;  1PP9 E;  3E7K A;  2P2U A;  4YTP C;  3RL0 B;  2OAR A;  1FJP A;  1NH4 A;  1HF9 A;  3GHG B;  3HUS A;  4IL6 X;  4O9B A;  5APU A;  2M0B A;  1S9K E;  3W68 A;  1LTT C;  1ZOY C;  1LGH B;  1BCC D;  2ZXX A;  4U3F G;  3G3Z A;  3G9R A;  1RQV A;  1USD A;  3FXD A;  3PP5 A;  2L91 A;  3QH9 A;  4H13 B;  1T2K C;  1M7L A;  5TIS E;  1HWT C;  3GHG C;  3CC2 P;  2Q5U A;  3N7N A;  2W27 A;  1QGK B;  2WT7 A;  2M3E A;  1RF0 C;  1RQU A;  1VF5 B;  1NTK K;  1D7M A;  1SQP E;  3H1I D;  3TK1 A;  3L73 D;  1R8E A;  2ZYD A;  1Q7Y Q;  1OW6 A;  1ZP0 C;  1LTI C;  3M9B A;  1KZU B;  4Y99 B;  3H25 A;  3D71 A;  2V7Q H;  5KAI H;  3PRJ A;  2YXQ B;  4GDO A;  2BCC G;  1X8Y A;  1JY2 O;  2YKQ A;  4Y28 J;  5CBN A;  4AUW A;  1KD1 Q;  3MGN A;  1KIL D;  2G3A A;  3B71 A;  1J1E C;  1E79 H;  1OFC X;  2QSI A;  3N4X A;  2POH A;  1H88 A;  1W2E A;  1T3U A;  2M8R A;  1CI6 B;  4OGQ B;  2KYV A;  1YQ4 C;  1BGY J;  3H1H G;  3CXH I;  5EFW B;  1LT9 B;  1BE3 G;  1SFC D;  2B87 A;  3RK3 B;  2M5A A;  2RKL A;  4OH8 B;  3CCQ P;  2FXM A;  2OTK E;  2QRX A;  2WQY C;  3H1K E;  2C9N Y;  1QX8 A;  1ZRT E;  2W6J H;  1VQ6 P;  1M1J A;  4GOE A;  3P32 A;  1KIL E;  1SQB J;  1SQX K;  4DJG A;  5AW8 B;  1DX7 A;  4PD4 D;  3F5H A;  3HTK B;  2QJY B;  3EFF K;  4L76 A;  1Z56 A;  3FWL A;  3O6Q B;  4GOF A;  2Q7C A;  5AW4 B;  1LT9 A;  2YO3 A;  3V4W A;  4D6T J;  1X79 B;  3H1L D;  1CI6 A;  1SQV K;  2IBZ D;  1S4X A;  4UB6 H;  5AVZ B;  2FFD B;  5KLV G;  4PV1 C;  2WVR A;  3A7O A;  2XU6 A;  1OZH A;  1L0L K;  3CWB J;  1SFC C;  4Y99 C;  1EXI A;  2BEZ F;  4PJ0 H;  2WSE H;  3BAS A;  4R4L A;  3CC7 P;  5APW A;  1LTJ C;  2E76 B;  2FYN B;  1L0N J;  3B5N C;  4K35 A;  1NGM B;  1LT9 C;  4JYC A;  4KHX A;  1BGY D;  1GZL A;  1X22 A;  1X9V A;  2MKV A;  2P58 A;  4UB8 H;  2E43 A;  1KV4 A;  2D2C B;  2YKO A;  4XA4 A;  3AE4 C;  5KJ7 A;  4I2L C;  5CJ4 A;  1KOR A;  4H0L B;  4WVZ A;  3WUU A;  2IFM A;  2K88 A;  3HD7 D;  1X0T A;  1JCD A;  2NPS D;  2IBZ E;  5GTI E;  3TGU E;  3I55 P;  1N73 C;  5TIS H;  4I6M C;  1L0N K;  1RE4 C;  1L0N E;  3B8E B;  3RL0 g;  2B88 A;  3L75 D;  2O01 H;  5APV A;  1YHQ P;  2QA4 P;  1K9M Q;  3LIE A;  3CX5 H;  5KJ7 C;  4H0L C;  1S3J A;  5AVX B;  1FOS F;  5GTH E;  1SQX J;  2JJL A;  1MUU A;  2QJY C;  3OJA B;  2O01 J;  1JEK A;  3L4F A;  3L74 G;  2Y9Z A;  3JSV C;  2VRS A;  1L4A B;  4KJM A;  1N73 A;  4N6J A;  5B66 H;  2Q6Q A;  4R4M A;  3SFE C;  3VTP C;  1RE4 A;  1SQV E;  1PGJ A;  1N86 A;  4W7Y A;  3G71 P;  2BCC J;  2ZJS E;  1CW5 A;  3M9Q A;  4RES B;  5E79 H;  3HTK A;  1ZV8 A;  1AV1 A;  1SQB K;  1VQN P;  1BSH A;  4U3F E;  2V4H A;  1N7S D;  3E1R A;  1NTZ J;  2WZ7 A;  2KNC A;  4PV1 D; 
#chains in the Genus database with same CATH homology
 1SQP G;  3H1J G;  1BGY G;  1NTM G;  1NTZ G;  1KB9 H;  2IBZ G;  3H1L G;  3CX5 H;  3H1K G;  1L0N G;  2FYU G;  3L72 G;  4PD4 H;  5KLV G;  3CWB G;  1NU1 G;  2BCC G;  3L74 G;  1P84 H;  1NTK G;  3L73 G;  1SQX G;  3TGU G;  3H1I G;  3BCC G;  1PPJ G;  1L0L G;  4D6T G;  3CXH H;  1BCC G;  4U3F G;  2A06 G;  1EZV G;  1SQQ G;  1SQV G;  3L71 G;  3L75 G;  1KYO H;  1SQB G;  3H1H G;  1PP9 G;  3L70 G;  1BE3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...