1P84H

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
b'GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1p84H00
1P84H 4PD4H 3H1KG 1NTKG 3CWBG 3H1JG 4D6TG 1NU1G 1BE3G 1PP9G 1SQPG 3L71G 3L75G 3BCCG 1SQBG 3H1IG 3CX5H 2IBZG 3L73G 3H1HG 1NTZG 1KYOH 1SQVG 3CXHH 2BCCG 2A06G 3L70G 1EZVG 5KLVG 1L0LG 1SQQG 3TGUG 2FYUG 1SQXG 1BGYG 3H1LG 3L72G 3L74G 1KB9H 1L0NG 4U3FG 1BCCG 1NTMG 1PPJG
chains in the Genus database with same CATH superfamily
3CXHD 1NTKD 2JEEA 1VF5B 1KQSO 1L4AD 3VYIA 2ZJSE 3L4FA 2HG5D 1DD4A 2J59M 3AEDC 3H1JG 5KLIC 2LKMA 4AUWA 1JTHB 3PH0A 3L73D 2Y0DA 1SQBJ 5AW7B 2KNCA 2Q3IA 1USDA 1KORA 1VF5C 2OTJP 3IFMA 1G1IA 4C7NA 1LJ2A 3PTZA 2PP6A 2P58A 5APSA 5AW5B 1KQFB 3Q3DA 2JR8A 2WSEH 4JF7A 3E7KA 4K35A 1OXZA 2FYZA 1BGYE 4EIJA 5APTA 1L0LJ 1M1JB 4XE5B 3KPEA 3CMEP 4PV1C 1JY3O 3FXDA 1N7SB 1VQOP 1N2DC 2OYHB 3PJSK 2B87A 2WPRA 3SFDC 5KJ7A 1M8OB 3Q5RA 3C1LA 4JQ0D 3VMYA 1M1JC 5E79E 3H1JJ 3ITKA 2JWDA 1PFIA 1USEA 2K9YA 1KTMA 1L0LE 1N7SC 1ZR2A 2WWWA 2WMMA 2OYHC 3M0DA 1H0TB 3AEBC 2NPSD 2QVAA 4ASVA 2RMZA 1JUNA 2HLOA 3HE4A 1J2JB 4GKGA 1PL5A 2GM4A 3S4RA 2Q3EA 2IDBA 1IFIA 4YXDC 2QA4P 4I1LA 3H1JE 1Z56A 1VQ9P 3L75G 3I56P 5CJ4A 2QRXA 3FX0A 2N1TD 2YKPA 2ZXXA 1D7MA 2PRRA 2HPCA 2QJYB 4RJTA 1BGYD 3ABVC 2K88A 2Z5HA 4WVZA 4YPCA 3CI9A 3PLNA 1HWTC 3A0HH 3LW5J 4W80A 1SQBD 2FFDB 3N7NA 2BEZF 1SQVG 3CXHH 4UB6H 1CSBA 1LTIC 4CPGA 1Q90D 4IL6X 4IOIH 1EXIA 1RQUA 1BCCG 3FWLA 4IFMA 1EZVD 1S5LE 3RL0g 5APVA 1BE3E 1RQVA 2FKWB 5CCHA 1RF0A 2XV5A 1MZ9A 1KILE 2L91A 3AE8C 1NOHA 1OMIA 3CX5I 2FFDC 4WB4A 1SLQA 1L0LD 3A5TA 5APWA 1GL2B 1M90Q 2E74D 4JBZA 3SFEC 3P8CD 2H43A 3FWNA 4B86A 4XA4A 2IYPA 2XDJA 3HD7D 1G2CB 3CX5E 3RBXA 3A3YB 1A02F 1IK7A 1SP4A 4WY4B 3H1JD 1NHLA 2IZ0A 1SVFA 5AW1B 4PV1D 4UB8H 2N9YB 4RO0A 1X8YA 1AQTA 1RF1B 1M57D 4H0LB 3CCQP 1M1KQ 1SQVJ 2D2CC 3L74G 1E5WA 1KILA 1UIIA 3M9BA 3TNUA 1TU3F 1JNMA 2BASA 3L75E 3GHGB 1NGMB 3L35A 3B5NB 3BCCJ 5CCGC 1GTWA 1NKNA 2KUBA 4GT1A 1IFNA 4JYBA 3CCVP 3EFFK 1KN7A 1RF1C 2KOGA 1JOCA 3VMZA 4H0LC 1JM0A 3HUSC 1ZMEC 1AV1A 2YMKA 1R5SA 1RE3A 3HE5B 3GHGC 3WMM0 3L36A 5CBOA 1HUCA 3B5NC 2M5AA 1FAVA 3TGUJ 1BCCE 1VQLP 2AEJA 2O01J 2FXPA 5AW2B 2E5TA 2O01N 1J1DB 1IFPA 4WBAA 3AE5C 3L73G 2WPSA 1MUUA 1BSHA 1VPCA 3MTUE 3M0AA 2ZAEB 1SQBK 3CX5D 1SQQJ 2YXRB 1UIXA 3I5CA 5GTHE 3L74J 2ZT9D 4DT0A 3RK3E 4Z1MH 5GTIH 3AE2C 1J1DC 2E76C 3NXSA 1LWUA 2C9LY 3UIAA 2VRSA 3FXEA 5AVZB 1P84H 3JSVC 1NJIQ 3T97A 1GW4A 1VQNP 1JY2P 1YJ9P 4HB1A 1L0LK 2KXPB 1OIPA 3CWBJ 1OW8A 3VP9A 2HODA 3P8MC 3Q1MA 3L74E 3S1KA 3RL0B 2H8PD 5B66H 5E79H 2K9JA 3VN0A 1OZHA 4HYTB 1SQPG 2WZ7A 3PP5A 3AEGC 3OW2O 2QEXP 1SQVD 1LTGC 3L72G 2KNCB 1IFDA 3CXHE 4UB6E 1RHZB 4H13B 1FS0E 1YQ3C 3CD6P 3EFGA 3BCCD 2A45G 1K05A 2JP3A 3EWKA 1J1EB 2J5UA 2Q9IA 4PJ0E 4OGQB 1S9KE 2D2CD 3G71P 4TLFA 3WU2H 3D6ZA 1PP9G 1N73A 1JB0J 1ZV8A 4HKZH 3W67A 3L73E 4H13C 3RK3D 1X22A 3V2QA 3JCUH 1QL2A 1WRGA 2GUSA 1L2PA 2YO3A 2YXQB 1JY2O 2B87B 3TGUD 2WTYA 1RE4A 1Q2NA 1J1EC 4OGQC 2WSFJ 1IK9A 3H32A 5AVYB 1HGZA 2E75B 1SQPJ 5AW4B 3I55P 3BATA 2FYUG 2R5DA 2KS1A 5KAIH 1QX8A 1SQQD 4UB8E 2ITAA 3L74D 1L4AA 1EZVG 2WPQA 1Q86Q 3L72J 1T6AA 2O1JA 1MFTA 5KJ7C 1EDLA 2JJLA 3CCSP 2JO1A 3HE4B 2E75C 1FJKA 2QG4A 3KYQA 3GG2A 3SWYA 3LW5H 4TT3H 2ZYAA 1AVYA 3U59A 3AE4C 3IN6A 2SPZA 1OW6A 1LGHB 1ZLLA 2RKLA 3CWBD 5B5EH 2FYNB 3M0DC 2A45I 3CX5H 1PP9J 1HJ0A 1FZCA 2H7HA 2E42A 3GLMA 3L72E 1S9KD 5APYA 2HPCB 1S1CX 3Q5SA 2O3JA 1HH0A 2Q7CA 2FYNC 4N3YB 1YI2P 3CCJP 3PHLA 3R4YA 3H1LG 2GUVA 4BXLA 1GU5A 4U3FG 2E43A 2H88C 1NTMG 2FYUJ 1SQVK 1PP9E 2Y0CA 3HD7B 1AA0A 1P84I 3N4XA 2G3AA 1OVVA 4RKUJ 1LP1A 2ZVNB 4ZMDA 3KZIH 1HGVA 1EZVI 5GTIE 2Q5UA 2B89A 2NZ2A 1CW5A 2L5GB 4AQRD 3G3ZA 1SQBE 2NPSA 1P84E 1X9VA 2W8ZA 1URQD 2FYUE 5CCHC 1RF0C 1FZBA 3VP8A 4NPDA 1XTCC 1EZVE 3NMDA 3G4SP 2IFMA 3VTPC 1EDIA 1SQPD 3IF4A 4H44D 5B66E 1JCCA 2KYVA 1NTZG 5CHXA 1IC2A 2XKMA 1S72P 1MV8A 3CCUP 5GTHH 1VQ5P 1DD3A 1QVGO 1M7LA 3L72D 2N1TA 3P8CE 2PAJA 3GW6A 3H1LJ 1KILB 1PGOA 3TNUB 1WT6A 4U3FJ 1SQQK 4K3AA 3RK2B 1NTMJ 2I1KA 1T2KC 2O01H 4L74A 1H88A 3CC2P 4L75A 1VQ6P 2YKOA 4N78D 1KD1Q 3P7KA 1ZW0A 1SQXJ 5KKZB 3H1KG 1PP9D 1KILC 4O9BA 3TK1A 2FY8A 3WU2E 3RK2C 1ZR4A 1LT9A 5AVUB 3Q2YA 3H1LE 5TISH 3KQGA 4U3FE 2P1JA 3JCUE 1PPJG 2M5AB 2KLUA 3SWFA 1YHQP 5KKZC 1ZP0C 1IZNB 2R3CA 2H89C 3USSA 2WT7A 1P84D 3VMXA 1MKMA 1NTZJ 2IX7C 3SSUA 2FYUD 1YBKA 2V7QJ 1RE3C 3M9HA 3HD7A 2QJPB 2QJYC 5KAIE 3BCCG 4PJ0H 4A7PA 2C0XA 3MHVA 1Y47A 4IL6E 1GMJA 1LWUB 1VF5D 1SFCB 2CPBA 3AE7C 3T97B 3H1KJ 4JPZB 3L71J 1NTZE 2UWJE 1R8EA 2POHA 2BCCG 3AE6C 5B5EE 2HODB 3TGUG 3TYYA 1EXJA 1PV3A 1S3JA 5K5GB 5KAFH 3CCMP 2JWAA 1LWUC 4LLHA 1FBMA 1GK6A 1GL2C 1ZOYC 2RN0A 2K9JB 3MUDA 2V4HA 1H89A 3H1HG 4I2LC 1SQQG 1SQPK 4N6JA 1NVOA 4BRYA 4ASWA 3H1LD 1Q81Q 4U3FD 1NTMD 4OH8B 1PZQA 1FC2C 2IZ1A 2OGUA 2WSFH 3D70A 1FU1A 4EDFA 4WY4C 2QJKB 3AEFC 2XNDH 3HRNA 1K9MQ 1SQXD 1N7SD 4JYCA 1G1JA 1Q82Q 4OWFA 3U1CA 3CWBG 5L8RJ 1KFNA 3KZIE 1VQ4P 4IFFA 2W83C 1N73B 1FJPA 1SQVE 2XZRA 2PGDA 5BVZA 2BCCJ 2QJKC 4W7ZA 3QH9A 4LGDE 2A45H 1NKZB 3BCCE 3H32B 1JCDA 1JMBA 3CCEP 3A0BH 1S4XA 1NTZD 3G9RA 5KLVG 1N73C 4YTPC 3H1HJ 3L70J 2KS1B 1NU1G 5AVXB 1GDTA 1L4AB 2YO2A 4DJGA 2FYUK 1RE4C 1YYCA 2PFXA 1GW3A 1GU4A 4QMAA 2BCCE 3B71A 2Z4EA 3TGUE 1OX3A 1SFCA 3P32A 1FZGA 1OW7A 1YTZT 1LTJA 1MFZA 3OJAB 1M56D 5APQA 3H1KD 3L71D 1NH4A 5DJTB 3H1HE 1L4AC 1KQGB 1SQQE 1FZCB 3MP7B 1OWAA 3AEAC 2B9BA 4D6TG 1PPJD 1ZXGA 5TISE 1KQLA 1CZQA 1NTKJ 1JY3N 4EYYQ 3OAKA 1KC8Q 1IFJA 3D71A 5APXA 3TDKA 3D6YA 3B4SA 4WWIA 5KLVJ 1QGKB 3E1RA 1FZCC 3KDPB 1DEEG 3CWBE 2WSCJ 3RL0C 1GL2D 5H2FH 1NU1J 2C0WA 5APUA 2P2UA 2KLVA 1NTMK 3O8ZA 3HTKB 2CK3H 1LP1B 1L0NG 3VOPA 5AW6B 1KB9I 1Y9BA 1SQXK 2HFED 3G6EP 1W2BO 1NYHA 3H1IJ 2NPSB 4WY4D 4C7RA 5KLVE 2BCCD 1T3UA 5AVVB 5CCGD 3WUTA 2LXCB 1WMKA 5BU5A 3L37A 4PD4H 1NU1E 1LTTC 4H0LD 1HTLC 1KB9E 1YTZI 2WSSH 5KAFE 4D6TJ 1PIXA 3H1HD 2A06G 3EQ2A 2OYIA 1SS1A 3L70D 5M1BA 1KYOI 4R4MA 2NPSC 3B5ND 2XNXA 1GK4A 1NTZK 4EI2A 1OVUA 2N1TB 5CBNA 1AFOA 4IL6H 2IFNA 1EQ7A 1DIPA 2C9NY 4XFJA 3MZWB 2OTLP 1KYOE 5AVQB 4D6TE 4ZKUA 1L0NJ 1SQPE 4BWNA 2KZJA 2V7QH 2JDIH 2N1TC 2W90A 5AVWB 2E76D 1R5LA 1LNQA 5AW8B 1GD2E 1LT9B 3NFQA 1NWQA 3CC4P 3AE3C 2KB7P 2AEFA 2KK7A 1U7JA 4GIFA 4N78E 2E74B 2K1AA 5KLVD 2WT7B 3V5BA 1FZEA 1L0NE 5KTBA 1ZN5A 1URQA 3C9IA 4OVNF 3A0BE 1BGYJ 2CPSA 2M0BA 2I1JA 1LT9C 1NU1D 3H6PA 2E5YA 3II6A 1KB9D 4I7ZB 2B88A 3HTKA 2KIKA 1YITP 1SQXG 2AXTH 2KZIA 3VMAA 2E74C 4PV1B 2ZYGA 3V6IA 1QL1A 2OTKE 3RL0D 1PGPA 3H1ID 1LT1A 3IR9A 2A06E 3HD7C 4I7ZC 1LTSC 2W6AA 3V2PA 3M06A 1VDFA 2LXBA 1KYOD 1OVRA 1BE3G 4D6TD 1RH5B 3S9OA 4AYCA 3O6QA 4H13D 4GDOA 2LR2A 3CCRP 3IAOA 3CLQA 4BRYB 2WPVB 5AVSB 4OGQD 2Y0EA 1EC5A 4LC1A 4Y99B 2DW3A 1KMIZ 3MUDC 5H2FE 1L0ND 2WITA 2BEQD 3L71G 2NRGA 4NPFX 4PD4I 3V4WA 5KJ7D 1CI6B 1Q7YQ 2WQYC 4Y99C 2E75D 1JO5A 2ZT9B 2ZVOB 1NTME 2OYOA 4M3LA 2Y9ZA 4Y28J 4EOTA 4GOFA 3BRVB 2R3SA 2AXCA 1BE3J 4L73A 4PD4E 2ZFCA 3K5BA 1NTKK 2W6BA 1Y8AA 2A06D 1SQXE 1HBWA 3CCLP 4I6MC 1ZRTE 2ZT9C 1JTHA 3Q5PA 5KLVK 1S5LX 5EFWB 2K37A 2IBZG 4W7YA 3V4QA 3CC7P 2YMYA 4KJMA 1KV4A 3KHUA 3CMAP 2W27A 4IFDK 1NU1K 2HR3A 3A2AA 3M91A 1LTJB 1QEXA 2FBWC 3A7OA 2QJPC 2WSCH 2QM8A 1W2EA 3OA7A 1RY3A 1FOSF 1M1JA 1KB9H 1YIJP 1A02J 2FXMA 2M8RA 1N7SA 2J58A 1SFCC 2OYHA 1HJBA 4KHXA 1YQ4C 4RESB 1LTJC 1K04A 3L75J 3W68A 1VQ7P 2D2CB 3TF5A 1FOSE 1NAFA 1KZUB 3L70G 1K8AQ 1JY2N 4DZOA 1IFMA 3F5HA 4KT0J 5CCHD 2OARA 3RK3B 3H1KE 1HF9A 2WVRA 3L71E 4ZNCA 5AVTB 3MD0A 2WSEJ 1GZLA 2IPPA 1T8ZA 2YKQA 1YJNP 3AE9C 5BU8B 1KYOH 2Z5IA 3QWOC 1JMMA 4PD4D 1K73Q 1X79B 1H0TA 4DCKA 3HUSB 1AJYA 1PPJE 5AW9B 3WUUA 1ZRTD 2AXTE 1BCCJ 2IBZI 4MN4C 1CI6A 3RK3C 2HYNA 5AVRB 1U7MA 4ZKPA 1X0TA 1KFMA 1NO4A 1T2KD 1L0NK 2FXOA 3PRJA 5CMZA 2MJZA 3ZDMA 1AQ5A 2RH0A 2R5BA 1NTKG 1BE3D 3E1IA 2IBZE 1FDMA 1PGJA 1VL2A 1KILD 1E79H 2JKVA 2GA1A 3JC22 3RK2D 1VQPP 2OYIB 1EDJA 1FZAA 1FDOA 4NPEA 4C46A 2M3BA 3BASA 3CL3D 2FFDA 1BDCA 2E76B 3LIEA 1QLED 1BDDA 1IJDB 3CPWO 2QE7H 3RGUA 3RBZA 2I8DA 3SWKA 1T3JA 2KP8A 3GF7A 1EDKA 2QIWA 2P10A 5AW0B 1LTAC 2OYIC 1N86A 3H1IG 2KSJA 5AW3B 3L70E 1GL2A 1FE6A 1HVVA 1VQ8P 5C39A 2R44A 3WUVA 4YXWH 1N7LA 3L75D 3V2RA 2QM7A 3BVHA 2M3EA 1LTBC 1G2CA 3AEEC 4HH2A 1H8AA 1XTGB 3CXHI 1DEBA 1NAYA 2G8YA 2Q1KA 5CJ0A 4WY4A 3NTNA 3B8EB 3MGNA 1URQB 5CCGA 1U57A 1SFCD 2P67A 1RF1A 2IBZD 2YIUB 3L73J 3A0HE 1JEKA 3HUSA 3MIWA 3GF3A 3BRTB 2YNYA 1YJWP 4H44B 2KSEA 3GHGA 1BCCD 1NTKE 2AEMA 4C7NB 3B5NA 1N8RQ 2OQQA 1URQC 1OFCX 2Q6QA 2YIUC 4U7JA 1VQKP 3TSIA 2P7JA 3AECC 4H44C 2ZXEB 3HE5A 3R2PA 2W6JH 4HJGH 2Y9YA 1S2EA 2QSIA 2IYOA 4R4LA 3LIDA 3AE1C 3O6QB 3KXDA 5DJUB 1BGYG 4GODA 1FZFA 2ZYDA 3C8VA 1PGQA 1SQBG 3H1IE 1DH3A 3H25A 2R32A 3GMAA 1S5LH 5TJHA 1IO4A 3FGAD 1DX7A 2XU6A 1W5CE 1QVFO 4GOEA 2MKVA 1FDIA 2N9BA 2K3RA 1VQMP 1AVOA 3U1AA 2O1KA 2KI7B 3F89A 1BSNA 1L0LG 1JY3P 3M9QA 4DOJA 3V2NA 5KLIB 4L76A
chains in the Genus database with same CATH topology
1P84H 4PD4H 3H1KG 1NTKG 3CWBG 3H1JG 4D6TG 1NU1G 1BE3G 1PP9G 1SQPG 3L71G 3L75G 3BCCG 1SQBG 3H1IG 3CX5H 2IBZG 3L73G 3H1HG 1NTZG 1KYOH 1SQVG 3CXHH 2BCCG 2A06G 3L70G 1EZVG 5KLVG 1L0LG 1SQQG 3TGUG 2FYUG 1SQXG 1BGYG 3H1LG 3L72G 3L74G 1KB9H 1L0NG 4U3FG 1BCCG 1NTMG 1PPJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 H;  4PD4 H;  3H1K G;  1NTK G;  3CWB G;  3H1J G;  4D6T G;  1NU1 G;  1BE3 G;  1PP9 G;  1SQP G;  3L71 G;  3L75 G;  3BCC G;  1SQB G;  3H1I G;  3CX5 H;  2IBZ G;  3L73 G;  3H1H G;  1NTZ G;  1KYO H;  1SQV G;  3CXH H;  2BCC G;  2A06 G;  3L70 G;  1EZV G;  5KLV G;  1L0L G;  1SQQ G;  3TGU G;  2FYU G;  1SQX G;  1BGY G;  3H1L G;  3L72 G;  3L74 G;  1KB9 H;  1L0N G;  4U3F G;  1BCC G;  1NTM G;  1PPJ G; 
#chains in the Genus database with same CATH topology
 3CXH D;  1NTK D;  2JEE A;  1VF5 B;  1KQS O;  1L4A D;  3VYI A;  2ZJS E;  3L4F A;  2HG5 D;  1DD4 A;  2J59 M;  3AED C;  3H1J G;  5KLI C;  2LKM A;  4AUW A;  1JTH B;  3PH0 A;  3L73 D;  2Y0D A;  1SQB J;  5AW7 B;  2KNC A;  2Q3I A;  1USD A;  1KOR A;  1VF5 C;  2OTJ P;  3IFM A;  1G1I A;  4C7N A;  1LJ2 A;  3PTZ A;  2PP6 A;  2P58 A;  5APS A;  5AW5 B;  1KQF B;  3Q3D A;  2JR8 A;  2WSE H;  4JF7 A;  3E7K A;  4K35 A;  1OXZ A;  2FYZ A;  1BGY E;  4EIJ A;  5APT A;  1L0L J;  1M1J B;  4XE5 B;  3KPE A;  3CME P;  4PV1 C;  1JY3 O;  3FXD A;  1N7S B;  1VQO P;  1N2D C;  2OYH B;  3PJS K;  2B87 A;  2WPR A;  3SFD C;  5KJ7 A;  1M8O B;  3Q5R A;  3C1L A;  4JQ0 D;  3VMY A;  1M1J C;  5E79 E;  3H1J J;  3ITK A;  2JWD A;  1PFI A;  1USE A;  2K9Y A;  1KTM A;  1L0L E;  1N7S C;  1ZR2 A;  2WWW A;  2WMM A;  2OYH C;  3M0D A;  1H0T B;  3AEB C;  2NPS D;  2QVA A;  4ASV A;  2RMZ A;  1JUN A;  2HLO A;  3HE4 A;  1J2J B;  4GKG A;  1PL5 A;  2GM4 A;  3S4R A;  2Q3E A;  2IDB A;  1IFI A;  4YXD C;  2QA4 P;  4I1L A;  3H1J E;  1Z56 A;  1VQ9 P;  3L75 G;  3I56 P;  5CJ4 A;  2QRX A;  3FX0 A;  2N1T D;  2YKP A;  2ZXX A;  1D7M A;  2PRR A;  2HPC A;  2QJY B;  4RJT A;  1BGY D;  3ABV C;  2K88 A;  2Z5H A;  4WVZ A;  4YPC A;  3CI9 A;  3PLN A;  1HWT C;  3A0H H;  3LW5 J;  4W80 A;  1SQB D;  2FFD B;  3N7N A;  2BEZ F;  1SQV G;  3CXH H;  4UB6 H;  1CSB A;  1LTI C;  4CPG A;  1Q90 D;  4IL6 X;  4IOI H;  1EXI A;  1RQU A;  1BCC G;  3FWL A;  4IFM A;  1EZV D;  1S5L E;  3RL0 g;  5APV A;  1BE3 E;  1RQV A;  2FKW B;  5CCH A;  1RF0 A;  2XV5 A;  1MZ9 A;  1KIL E;  2L91 A;  3AE8 C;  1NOH A;  1OMI A;  3CX5 I;  2FFD C;  4WB4 A;  1SLQ A;  1L0L D;  3A5T A;  5APW A;  1GL2 B;  1M90 Q;  2E74 D;  4JBZ A;  3SFE C;  3P8C D;  2H43 A;  3FWN A;  4B86 A;  4XA4 A;  2IYP A;  2XDJ A;  3HD7 D;  1G2C B;  3CX5 E;  3RBX A;  3A3Y B;  1A02 F;  1IK7 A;  1SP4 A;  4WY4 B;  3H1J D;  1NHL A;  2IZ0 A;  1SVF A;  5AW1 B;  4PV1 D;  4UB8 H;  2N9Y B;  4RO0 A;  1X8Y A;  1AQT A;  1RF1 B;  1M57 D;  4H0L B;  3CCQ P;  1M1K Q;  1SQV J;  2D2C C;  3L74 G;  1E5W A;  1KIL A;  1UII A;  3M9B A;  3TNU A;  1TU3 F;  1JNM A;  2BAS A;  3L75 E;  3GHG B;  1NGM B;  3L35 A;  3B5N B;  3BCC J;  5CCG C;  1GTW A;  1NKN A;  2KUB A;  4GT1 A;  1IFN A;  4JYB A;  3CCV P;  3EFF K;  1KN7 A;  1RF1 C;  2KOG A;  1JOC A;  3VMZ A;  4H0L C;  1JM0 A;  3HUS C;  1ZME C;  1AV1 A;  2YMK A;  1R5S A;  1RE3 A;  3HE5 B;  3GHG C;  3WMM 0;  3L36 A;  5CBO A;  1HUC A;  3B5N C;  2M5A A;  1FAV A;  3TGU J;  1BCC E;  1VQL P;  2AEJ A;  2O01 J;  2FXP A;  5AW2 B;  2E5T A;  2O01 N;  1J1D B;  1IFP A;  4WBA A;  3AE5 C;  3L73 G;  2WPS A;  1MUU A;  1BSH A;  1VPC A;  3MTU E;  3M0A A;  2ZAE B;  1SQB K;  3CX5 D;  1SQQ J;  2YXR B;  1UIX A;  3I5C A;  5GTH E;  3L74 J;  2ZT9 D;  4DT0 A;  3RK3 E;  4Z1M H;  5GTI H;  3AE2 C;  1J1D C;  2E76 C;  3NXS A;  1LWU A;  2C9L Y;  3UIA A;  2VRS A;  3FXE A;  5AVZ B;  1P84 H;  3JSV C;  1NJI Q;  3T97 A;  1GW4 A;  1VQN P;  1JY2 P;  1YJ9 P;  4HB1 A;  1L0L K;  2KXP B;  1OIP A;  3CWB J;  1OW8 A;  3VP9 A;  2HOD A;  3P8M C;  3Q1M A;  3L74 E;  3S1K A;  3RL0 B;  2H8P D;  5B66 H;  5E79 H;  2K9J A;  3VN0 A;  1OZH A;  4HYT B;  1SQP G;  2WZ7 A;  3PP5 A;  3AEG C;  3OW2 O;  2QEX P;  1SQV D;  1LTG C;  3L72 G;  2KNC B;  1IFD A;  3CXH E;  4UB6 E;  1RHZ B;  4H13 B;  1FS0 E;  1YQ3 C;  3CD6 P;  3EFG A;  3BCC D;  2A45 G;  1K05 A;  2JP3 A;  3EWK A;  1J1E B;  2J5U A;  2Q9I A;  4PJ0 E;  4OGQ B;  1S9K E;  2D2C D;  3G71 P;  4TLF A;  3WU2 H;  3D6Z A;  1PP9 G;  1N73 A;  1JB0 J;  1ZV8 A;  4HKZ H;  3W67 A;  3L73 E;  4H13 C;  3RK3 D;  1X22 A;  3V2Q A;  3JCU H;  1QL2 A;  1WRG A;  2GUS A;  1L2P A;  2YO3 A;  2YXQ B;  1JY2 O;  2B87 B;  3TGU D;  2WTY A;  1RE4 A;  1Q2N A;  1J1E C;  4OGQ C;  2WSF J;  1IK9 A;  3H32 A;  5AVY B;  1HGZ A;  2E75 B;  1SQP J;  5AW4 B;  3I55 P;  3BAT A;  2FYU G;  2R5D A;  2KS1 A;  5KAI H;  1QX8 A;  1SQQ D;  4UB8 E;  2ITA A;  3L74 D;  1L4A A;  1EZV G;  2WPQ A;  1Q86 Q;  3L72 J;  1T6A A;  2O1J A;  1MFT A;  5KJ7 C;  1EDL A;  2JJL A;  3CCS P;  2JO1 A;  3HE4 B;  2E75 C;  1FJK A;  2QG4 A;  3KYQ A;  3GG2 A;  3SWY A;  3LW5 H;  4TT3 H;  2ZYA A;  1AVY A;  3U59 A;  3AE4 C;  3IN6 A;  2SPZ A;  1OW6 A;  1LGH B;  1ZLL A;  2RKL A;  3CWB D;  5B5E H;  2FYN B;  3M0D C;  2A45 I;  3CX5 H;  1PP9 J;  1HJ0 A;  1FZC A;  2H7H A;  2E42 A;  3GLM A;  3L72 E;  1S9K D;  5APY A;  2HPC B;  1S1C X;  3Q5S A;  2O3J A;  1HH0 A;  2Q7C A;  2FYN C;  4N3Y B;  1YI2 P;  3CCJ P;  3PHL A;  3R4Y A;  3H1L G;  2GUV A;  4BXL A;  1GU5 A;  4U3F G;  2E43 A;  2H88 C;  1NTM G;  2FYU J;  1SQV K;  1PP9 E;  2Y0C A;  3HD7 B;  1AA0 A;  1P84 I;  3N4X A;  2G3A A;  1OVV A;  4RKU J;  1LP1 A;  2ZVN B;  4ZMD A;  3KZI H;  1HGV A;  1EZV I;  5GTI E;  2Q5U A;  2B89 A;  2NZ2 A;  1CW5 A;  2L5G B;  4AQR D;  3G3Z A;  1SQB E;  2NPS A;  1P84 E;  1X9V A;  2W8Z A;  1URQ D;  2FYU E;  5CCH C;  1RF0 C;  1FZB A;  3VP8 A;  4NPD A;  1XTC C;  1EZV E;  3NMD A;  3G4S P;  2IFM A;  3VTP C;  1EDI A;  1SQP D;  3IF4 A;  4H44 D;  5B66 E;  1JCC A;  2KYV A;  1NTZ G;  5CHX A;  1IC2 A;  2XKM A;  1S72 P;  1MV8 A;  3CCU P;  5GTH H;  1VQ5 P;  1DD3 A;  1QVG O;  1M7L A;  3L72 D;  2N1T A;  3P8C E;  2PAJ A;  3GW6 A;  3H1L J;  1KIL B;  1PGO A;  3TNU B;  1WT6 A;  4U3F J;  1SQQ K;  4K3A A;  3RK2 B;  1NTM J;  2I1K A;  1T2K C;  2O01 H;  4L74 A;  1H88 A;  3CC2 P;  4L75 A;  1VQ6 P;  2YKO A;  4N78 D;  1KD1 Q;  3P7K A;  1ZW0 A;  1SQX J;  5KKZ B;  3H1K G;  1PP9 D;  1KIL C;  4O9B A;  3TK1 A;  2FY8 A;  3WU2 E;  3RK2 C;  1ZR4 A;  1LT9 A;  5AVU B;  3Q2Y A;  3H1L E;  5TIS H;  3KQG A;  4U3F E;  2P1J A;  3JCU E;  1PPJ G;  2M5A B;  2KLU A;  3SWF A;  1YHQ P;  5KKZ C;  1ZP0 C;  1IZN B;  2R3C A;  2H89 C;  3USS A;  2WT7 A;  1P84 D;  3VMX A;  1MKM A;  1NTZ J;  2IX7 C;  3SSU A;  2FYU D;  1YBK A;  2V7Q J;  1RE3 C;  3M9H A;  3HD7 A;  2QJP B;  2QJY C;  5KAI E;  3BCC G;  4PJ0 H;  4A7P A;  2C0X A;  3MHV A;  1Y47 A;  4IL6 E;  1GMJ A;  1LWU B;  1VF5 D;  1SFC B;  2CPB A;  3AE7 C;  3T97 B;  3H1K J;  4JPZ B;  3L71 J;  1NTZ E;  2UWJ E;  1R8E A;  2POH A;  2BCC G;  3AE6 C;  5B5E E;  2HOD B;  3TGU G;  3TYY A;  1EXJ A;  1PV3 A;  1S3J A;  5K5G B;  5KAF H;  3CCM P;  2JWA A;  1LWU C;  4LLH A;  1FBM A;  1GK6 A;  1GL2 C;  1ZOY C;  2RN0 A;  2K9J B;  3MUD A;  2V4H A;  1H89 A;  3H1H G;  4I2L C;  1SQQ G;  1SQP K;  4N6J A;  1NVO A;  4BRY A;  4ASW A;  3H1L D;  1Q81 Q;  4U3F D;  1NTM D;  4OH8 B;  1PZQ A;  1FC2 C;  2IZ1 A;  2OGU A;  2WSF H;  3D70 A;  1FU1 A;  4EDF A;  4WY4 C;  2QJK B;  3AEF C;  2XND H;  3HRN A;  1K9M Q;  1SQX D;  1N7S D;  4JYC A;  1G1J A;  1Q82 Q;  4OWF A;  3U1C A;  3CWB G;  5L8R J;  1KFN A;  3KZI E;  1VQ4 P;  4IFF A;  2W83 C;  1N73 B;  1FJP A;  1SQV E;  2XZR A;  2PGD A;  5BVZ A;  2BCC J;  2QJK C;  4W7Z A;  3QH9 A;  4LGD E;  2A45 H;  1NKZ B;  3BCC E;  3H32 B;  1JCD A;  1JMB A;  3CCE P;  3A0B H;  1S4X A;  1NTZ D;  3G9R A;  5KLV G;  1N73 C;  4YTP C;  3H1H J;  3L70 J;  2KS1 B;  1NU1 G;  5AVX B;  1GDT A;  1L4A B;  2YO2 A;  4DJG A;  2FYU K;  1RE4 C;  1YYC A;  2PFX A;  1GW3 A;  1GU4 A;  4QMA A;  2BCC E;  3B71 A;  2Z4E A;  3TGU E;  1OX3 A;  1SFC A;  3P32 A;  1FZG A;  1OW7 A;  1YTZ T;  1LTJ A;  1MFZ A;  3OJA B;  1M56 D;  5APQ A;  3H1K D;  3L71 D;  1NH4 A;  5DJT B;  3H1H E;  1L4A C;  1KQG B;  1SQQ E;  1FZC B;  3MP7 B;  1OWA A;  3AEA C;  2B9B A;  4D6T G;  1PPJ D;  1ZXG A;  5TIS E;  1KQL A;  1CZQ A;  1NTK J;  1JY3 N;  4EYY Q;  3OAK A;  1KC8 Q;  1IFJ A;  3D71 A;  5APX A;  3TDK A;  3D6Y A;  3B4S A;  4WWI A;  5KLV J;  1QGK B;  3E1R A;  1FZC C;  3KDP B;  1DEE G;  3CWB E;  2WSC J;  3RL0 C;  1GL2 D;  5H2F H;  1NU1 J;  2C0W A;  5APU A;  2P2U A;  2KLV A;  1NTM K;  3O8Z A;  3HTK B;  2CK3 H;  1LP1 B;  1L0N G;  3VOP A;  5AW6 B;  1KB9 I;  1Y9B A;  1SQX K;  2HFE D;  3G6E P;  1W2B O;  1NYH A;  3H1I J;  2NPS B;  4WY4 D;  4C7R A;  5KLV E;  2BCC D;  1T3U A;  5AVV B;  5CCG D;  3WUT A;  2LXC B;  1WMK A;  5BU5 A;  3L37 A;  4PD4 H;  1NU1 E;  1LTT C;  4H0L D;  1HTL C;  1KB9 E;  1YTZ I;  2WSS H;  5KAF E;  4D6T J;  1PIX A;  3H1H D;  2A06 G;  3EQ2 A;  2OYI A;  1SS1 A;  3L70 D;  5M1B A;  1KYO I;  4R4M A;  2NPS C;  3B5N D;  2XNX A;  1GK4 A;  1NTZ K;  4EI2 A;  1OVU A;  2N1T B;  5CBN A;  1AFO A;  4IL6 H;  2IFN A;  1EQ7 A;  1DIP A;  2C9N Y;  4XFJ A;  3MZW B;  2OTL P;  1KYO E;  5AVQ B;  4D6T E;  4ZKU A;  1L0N J;  1SQP E;  4BWN A;  2KZJ A;  2V7Q H;  2JDI H;  2N1T C;  2W90 A;  5AVW B;  2E76 D;  1R5L A;  1LNQ A;  5AW8 B;  1GD2 E;  1LT9 B;  3NFQ A;  1NWQ A;  3CC4 P;  3AE3 C;  2KB7 P;  2AEF A;  2KK7 A;  1U7J A;  4GIF A;  4N78 E;  2E74 B;  2K1A A;  5KLV D;  2WT7 B;  3V5B A;  1FZE A;  1L0N E;  5KTB A;  1ZN5 A;  1URQ A;  3C9I A;  4OVN F;  3A0B E;  1BGY J;  2CPS A;  2M0B A;  2I1J A;  1LT9 C;  1NU1 D;  3H6P A;  2E5Y A;  3II6 A;  1KB9 D;  4I7Z B;  2B88 A;  3HTK A;  2KIK A;  1YIT P;  1SQX G;  2AXT H;  2KZI A;  3VMA A;  2E74 C;  4PV1 B;  2ZYG A;  3V6I A;  1QL1 A;  2OTK E;  3RL0 D;  1PGP A;  3H1I D;  1LT1 A;  3IR9 A;  2A06 E;  3HD7 C;  4I7Z C;  1LTS C;  2W6A A;  3V2P A;  3M06 A;  1VDF A;  2LXB A;  1KYO D;  1OVR A;  1BE3 G;  4D6T D;  1RH5 B;  3S9O A;  4AYC A;  3O6Q A;  4H13 D;  4GDO A;  2LR2 A;  3CCR P;  3IAO A;  3CLQ A;  4BRY B;  2WPV B;  5AVS B;  4OGQ D;  2Y0E A;  1EC5 A;  4LC1 A;  4Y99 B;  2DW3 A;  1KMI Z;  3MUD C;  5H2F E;  1L0N D;  2WIT A;  2BEQ D;  3L71 G;  2NRG A;  4NPF X;  4PD4 I;  3V4W A;  5KJ7 D;  1CI6 B;  1Q7Y Q;  2WQY C;  4Y99 C;  2E75 D;  1JO5 A;  2ZT9 B;  2ZVO B;  1NTM E;  2OYO A;  4M3L A;  2Y9Z A;  4Y28 J;  4EOT A;  4GOF A;  3BRV B;  2R3S A;  2AXC A;  1BE3 J;  4L73 A;  4PD4 E;  2ZFC A;  3K5B A;  1NTK K;  2W6B A;  1Y8A A;  2A06 D;  1SQX E;  1HBW A;  3CCL P;  4I6M C;  1ZRT E;  2ZT9 C;  1JTH A;  3Q5P A;  5KLV K;  1S5L X;  5EFW B;  2K37 A;  2IBZ G;  4W7Y A;  3V4Q A;  3CC7 P;  2YMY A;  4KJM A;  1KV4 A;  3KHU A;  3CMA P;  2W27 A;  4IFD K;  1NU1 K;  2HR3 A;  3A2A A;  3M91 A;  1LTJ B;  1QEX A;  2FBW C;  3A7O A;  2QJP C;  2WSC H;  2QM8 A;  1W2E A;  3OA7 A;  1RY3 A;  1FOS F;  1M1J A;  1KB9 H;  1YIJ P;  1A02 J;  2FXM A;  2M8R A;  1N7S A;  2J58 A;  1SFC C;  2OYH A;  1HJB A;  4KHX A;  1YQ4 C;  4RES B;  1LTJ C;  1K04 A;  3L75 J;  3W68 A;  1VQ7 P;  2D2C B;  3TF5 A;  1FOS E;  1NAF A;  1KZU B;  3L70 G;  1K8A Q;  1JY2 N;  4DZO A;  1IFM A;  3F5H A;  4KT0 J;  5CCH D;  2OAR A;  3RK3 B;  3H1K E;  1HF9 A;  2WVR A;  3L71 E;  4ZNC A;  5AVT B;  3MD0 A;  2WSE J;  1GZL A;  2IPP A;  1T8Z A;  2YKQ A;  1YJN P;  3AE9 C;  5BU8 B;  1KYO H;  2Z5I A;  3QWO C;  1JMM A;  4PD4 D;  1K73 Q;  1X79 B;  1H0T A;  4DCK A;  3HUS B;  1AJY A;  1PPJ E;  5AW9 B;  3WUU A;  1ZRT D;  2AXT E;  1BCC J;  2IBZ I;  4MN4 C;  1CI6 A;  3RK3 C;  2HYN A;  5AVR B;  1U7M A;  4ZKP A;  1X0T A;  1KFM A;  1NO4 A;  1T2K D;  1L0N K;  2FXO A;  3PRJ A;  5CMZ A;  2MJZ A;  3ZDM A;  1AQ5 A;  2RH0 A;  2R5B A;  1NTK G;  1BE3 D;  3E1I A;  2IBZ E;  1FDM A;  1PGJ A;  1VL2 A;  1KIL D;  1E79 H;  2JKV A;  2GA1 A;  3JC2 2;  3RK2 D;  1VQP P;  2OYI B;  1EDJ A;  1FZA A;  1FDO A;  4NPE A;  4C46 A;  2M3B A;  3BAS A;  3CL3 D;  2FFD A;  1BDC A;  2E76 B;  3LIE A;  1QLE D;  1BDD A;  1IJD B;  3CPW O;  2QE7 H;  3RGU A;  3RBZ A;  2I8D A;  3SWK A;  1T3J A;  2KP8 A;  3GF7 A;  1EDK A;  2QIW A;  2P10 A;  5AW0 B;  1LTA C;  2OYI C;  1N86 A;  3H1I G;  2KSJ A;  5AW3 B;  3L70 E;  1GL2 A;  1FE6 A;  1HVV A;  1VQ8 P;  5C39 A;  2R44 A;  3WUV A;  4YXW H;  1N7L A;  3L75 D;  3V2R A;  2QM7 A;  3BVH A;  2M3E A;  1LTB C;  1G2C A;  3AEE C;  4HH2 A;  1H8A A;  1XTG B;  3CXH I;  1DEB A;  1NAY A;  2G8Y A;  2Q1K A;  5CJ0 A;  4WY4 A;  3NTN A;  3B8E B;  3MGN A;  1URQ B;  5CCG A;  1U57 A;  1SFC D;  2P67 A;  1RF1 A;  2IBZ D;  2YIU B;  3L73 J;  3A0H E;  1JEK A;  3HUS A;  3MIW A;  3GF3 A;  3BRT B;  2YNY A;  1YJW P;  4H44 B;  2KSE A;  3GHG A;  1BCC D;  1NTK E;  2AEM A;  4C7N B;  3B5N A;  1N8R Q;  2OQQ A;  1URQ C;  1OFC X;  2Q6Q A;  2YIU C;  4U7J A;  1VQK P;  3TSI A;  2P7J A;  3AEC C;  4H44 C;  2ZXE B;  3HE5 A;  3R2P A;  2W6J H;  4HJG H;  2Y9Y A;  1S2E A;  2QSI A;  2IYO A;  4R4L A;  3LID A;  3AE1 C;  3O6Q B;  3KXD A;  5DJU B;  1BGY G;  4GOD A;  1FZF A;  2ZYD A;  3C8V A;  1PGQ A;  1SQB G;  3H1I E;  1DH3 A;  3H25 A;  2R32 A;  3GMA A;  1S5L H;  5TJH A;  1IO4 A;  3FGA D;  1DX7 A;  2XU6 A;  1W5C E;  1QVF O;  4GOE A;  2MKV A;  1FDI A;  2N9B A;  2K3R A;  1VQM P;  1AVO A;  3U1A A;  2O1K A;  2KI7 B;  3F89 A;  1BSN A;  1L0L G;  1JY3 P;  3M9Q A;  4DOJ A;  3V2N A;  5KLI B;  4L76 A; 
#chains in the Genus database with same CATH homology
 1P84 H;  4PD4 H;  3H1K G;  1NTK G;  3CWB G;  3H1J G;  4D6T G;  1NU1 G;  1BE3 G;  1PP9 G;  1SQP G;  3L71 G;  3L75 G;  3BCC G;  1SQB G;  3H1I G;  3CX5 H;  2IBZ G;  3L73 G;  3H1H G;  1NTZ G;  1KYO H;  1SQV G;  3CXH H;  2BCC G;  2A06 G;  3L70 G;  1EZV G;  5KLV G;  1L0L G;  1SQQ G;  3TGU G;  2FYU G;  1SQX G;  1BGY G;  3H1L G;  3L72 G;  3L74 G;  1KB9 H;  1L0N G;  4U3F G;  1BCC G;  1NTM G;  1PPJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...