1P84H

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1p84H00
2FYUG 1EZVG 1L0NG 1SQQG 1SQBG 1KB9H 3H1IG 3L75G 3L70G 3BCCG 3H1KG 5KLVG 3CX5H 3L71G 4PD4H 3CWBG 1SQVG 1NU1G 1NTKG 3L73G 1SQPG 2IBZG 3L72G 1BCCG 3TGUG 3H1LG 2A06G 1BE3G 3L74G 1SQXG 1P84H 4D6TG 1PP9G 1L0LG 1BGYG 1NTZG 2BCCG 1NTMG 1PPJG 3H1JG 4U3FG 3CXHH 3H1HG 1KYOH
chains in the Genus database with same CATH superfamily
5H2FE 2LXBA 2QG4A 4D6TJ 5AW3B 3CC4P 1PPJE 2KB7P 3Q5RA 1T3JA 3GHGB 4BWNA 4CPGA 2W6AA 5AW2B 1U57A 3H1LE 3L74D 2KZIA 1IFJA 3I5CA 1RF1A 1HF9A 4IL6H 3M0DA 2WSSH 1M1JB 1R5LA 2H88C 1NKNA 1SFCC 3AEDC 3EFGA 5KJ7A 1G1JA 2IX7C 2IFMA 1JOCA 3LW5H 1KN7A 4LC1A 3KPEA 1RF1B 3VMXA 1PPJD 1T6AA 4DOJA 3VMAA 2WPRA 2OYHA 1KYOD 1S72P 5CJ0A 2Y0CA 2R3CA 3HTKA 4EDFA 2ZFCA 1N7SD 2J59M 3L70J 2OARA 1JM0A 3CXHH 3GHGC 3AE4C 2AEJA 2V4HA 1PGJA 4H13B 2H89C 1NTME 5B5EE 2XNXA 1U7MA 4N6JA 1X79B 3E1RA 1YYCA 2L91A 3RBXA 3B5NA 1ZW0A 4EYYQ 1L0LG 1VQ6P 5AW9B 5E79H 2ZJSE 1BCCE 3Q2YA 2FYUG 1J1EB 5AW5B 3AE3C 3TK1A 5AW4B 5AVQB 1FOSE 2NPSA 1L0NE 3B5NB 2QIWA 1SQBE 3H1IE 2NRGA 2QVAA 1OW8A 1LP1A 4A7PA 2LKMA 1LT9C 2E43A 1KQFB 2WSEJ 1NTMD 1A02J 1R5SA 2QJPB 1GL2C 3QWOC 2V7QJ 2JWDA 3GMAA 3F5HA 1X22A 3Q3DA 3AE2C 5APTA 2E76D 1L2PA 1L0LJ 2BCCJ 3RK3C 1GDTA 5APQA 2FYUJ 3GW6A 2ZYGA 1L0ND 3CI9A 1SQBD 1J1EC 3H1ID 1S1CX 1P84H 1FBMA 4UB6H 3G6EP 1SQPE 1OZHA 1URQC 5AVUB 2OQQA 1L4AC 1S3JA 3BCCG 4WVZA 3EQ2A 2D2CB 2Q3IA 3D6ZA 1VQOP 1M1KQ 2IBZG 3HD7A 1NAYA 2ZVOB 2POHA 3B8EB 2IPPA 1VQNP 3ITKA 3LW5J 1LNQA 1FJPA 2WT7B 3P8MC 3CCMP 1Q86Q 2N1TC 1PV3A 1E79H 2K9JA 3EFFK 1SQPD 2A45G 5KAIE 1AFOA 3I55P 1QLED 3CCLP 2N9BA 1Y9BA 3TGUG 1M56D 1KILC 3BCCJ 3V2QA 3K5BA 4L73A 1X8YA 1OX3A 1LWUB 4H44D 5AVZB 4W80A 3A0BE 5CCHC 1NTKG 3V2RA 2I1JA 1BDCA 3IR9A 3MUDA 2KSEA 2HPCA 1GW4A 2QJYC 3WUTA 1L0LD 1N7SB 1G2CA 3D6YA 1J1DB 1LTJC 4AYCA 5H2FH 1KB9E 1NU1K 3TDKA 1SFCD 2AXTE 4IOIH 2WVRA 4HJGH 1YHQP 1PL5A 1KYOH 1AA0A 3CX5I 1T8ZA 3CWBJ 1NTKJ 3A5TA 2IBZE 1VDFA 3HRNA 2GM4A 3A7OA 1HJ0A 1OVVA 4K35A 3M0AA 3CMEP 2B9BA 1JMMA 1N7SC 1KB9D 2K88A 5TISE 4OGQC 1H0TA 4WWIA 2YO3A 1FZCC 4M3LA 4JQ0D 3L72J 1RY3A 1BGYJ 2WWWA 1EZVI 4U3FE 1PGQA 2E76B 3CXHD 2E74C 4W7ZA 2XZRA 4ZNCA 3RK3E 1JTHB 5AVYB 3BCCD 1X9VA 5B5EH 2YMKA 2QSIA 2IBZD 2YIUC 2HODA 4I7ZB 5B66E 3PP5A 3TGUE 3U59A 3OW2O 3H1HJ 3PLNA 2OTKE 1OW7A 1W2BO 1GL2D 1XTGB 2ZXEB 3G9RA 2RKLA 4JPZB 5APYA 3TSIA 4U3FD 3EWKA 1GU5A 1ZP0C 4I2LC 1KD1Q 1ZMEC 3C8VA 4LGDE 3RK3D 3H1LG 2Y0DA 5AW8B 1UIIA 1ZRTE 2E75C 3WUVA 2VRSA 3TNUA 3TGUD 3L74J 1LGHB 2KS1B 2QE7H 1YBKA 1URQD 3UIAA 3RL0C 1RHZB 1L4AD 4IFDK 2YNYA 2ZYAA 1GD2E 1M7LA 4N78D 3TNUB 1ZN5A 3HE4A 1KILE 1KQSO 1ZR4A 1VQ7P 3OA7A 3T97B 4H44B 3HUSB 1ZRTD 2KOGA 2XDJA 2N1TD 1T2KC 3H1LJ 5GTIE 3AE7C 2C9NY 1KV4A 2AXCA 1NTZE 3S9OA 4KT0J 1BCCG 1FDIA 2W6BA 1VPCA 1KC8Q 3CCVP 4DJGA 2K9YA 1NTMK 3OAKA 4GT1A 1RQVA 1KILD 2JO1A 1FJKA 3IF4A 1L0NG 1SFCB 1DEBA 2Y0EA 1SQBG 1PP9E 2P10A 3WMM0 1IK9A 4IL6X 4YXWH 2Z5HA 4I6MC 4RO0A 4WB4A 5CCHD 3GHGA 1EDJA 1N73C 1AQTA 3H1KE 4XFJA 4H44C 1VF5C 4PJ0E 1NTZD 1QVFO 1NTMJ 1M1JA 2ITAA 2FYNC 2QA4P 1DIPA 1DH3A 1FU1A 3G3ZA 2WTYA 2GUVA 2YMYA 1BCCJ 3A0BH 3P7KA 1NYHA 1IC2A 1PP9D 1QX8A 2WPVB 2P67A 3CC2P 5BU8B 4DCKA 1R8EA 1HH0A 1L0NJ 1SQBJ 1SQQE 3M9BA 1SQPG 4C7RA 1HTLC 2M8RA 3H1IJ 2R5DA 4BRYB 1QVGO 2W27A 4GIFA 2XKMA 1KB9H 1KQLA 1YQ3C 1QL1A 2KP8A 2AXTH 4RJTA 1Q90D 2OYIC 5AW7B 4IFFA 2R44A 2FYZA 1MV8A 1OMIA 3AE6C 1LT9B 4OGQD 1OWAA 1IJDB 4OWFA 3H1LD 2XNDH 1GL2B 3HE5B 5M1BA 1NKZB 1E5WA 1WRGA 3NTNA 1SQQD 2YKPA 3V4WA 1WT6A 4Z1MH 1PZQA 3IAOA 2WSCH 2FXOA 2XU6A 2E74D 2FKWB 2OTLP 3VTPC 1AVYA 3CMAP 1VQKP 3AE1C 3AEEC 1SQPJ 3RK3B 5TISH 4D6TE 1GU4A 2FFDC 3H1JE 3CCSP 1LT1A 2QM7A 3NFQA 1KZUB 3II6A 3A2AA 1SQXG 1URQB 5KLVE 3CCRP 1L0LK 3CX5E 1L4AB 2A45H 1Q7YQ 5K5GB 1JEKA 1BSHA 2FYUK 2KLUA 2W8ZA 3LIDA 2B89A 3M0DC 1FZGA 3G71P 5B66H 1A02F 2P1JA 2W6JH 1HUCA 1BCCD 5APWA 2E75D 2B87B 1NWQA 5CBOA 2N1TB 1EZVE 3OJAB 2NZ2A 1FZFA 2N9YB 2OYHC 3RL0D 1RE4A 3CX5D 1NGMB 3JCUE 5CBNA 1HGVA 2UWJE 3VP9A 1Q2NA 1HJBA 1YITP 1KILB 1LTSC 3MIWA 4K3AA 2WT7A 3W68A 3PH0A 1HWTC 3CC7P 4HYTB 2PGDA 3KZIE 3Q5SA 4GOEA 3CD6P 3MGNA 1LTJA 1T2KD 2Q9IA 3H6PA 2QJKC 5AVVB 3AE9C 1LTBC 2NPSC 2QJYB 3JSVC 4R4MA 3U1CA 2M3BA 3KQGA 4U3FG 2RMZA 1JCCA 3V2PA 4ASWA 1LTJB 3NXSA 1KYOI 1LWUA 3N4XA 1EDLA 2PAJA 2H8PD 1MFTA 3CCJP 5GTIH 1RF0A 1FS0E 3B4SA 4PD4E 3L73E 2WSCJ 2C9LY 3M9HA 1SQXE 2L5GB 1VF5D 1N7SA 1JO5A 2KSJA 5CCGD 1VQ8P 3MP7B 1PGPA 2ZXXA 1GTWA 4Y99C 4RKUJ 2YKQA 2ZYDA 3D71A 2WITA 4OGQB 2C0XA 4U3FJ 2B88A 1EC5A 1YTZT 4EOTA 3A3YB 4WY4D 1FZCB 2A06G 1NTKK 1OVUA 4PD4D 1M57D 3HD7C 3L73D 2QRXA 2I1KA 3TGUJ 1SQXD 3FGAD 2E74B 2K37A 1JY3P 3V4QA 2C0WA 1IO4A 4GOFA 2BASA 3B71A 3TYYA 1MFZA 2P7JA 3P32A 1S4XA 2DW3A 4C7NB 4JBZA 2YIUB 3VOPA 2WPSA 2P2UA 5CMZA 2Q7CA 3VMZA 3KDPB 5APVA 3I56P 1H89A 2QM8A 2FBWC 1FZEA 1JNMA 1BE3G 4AUWA 1VQ4P 1JTHA 1NTZG 3P8CE 2IYOA 2KNCB 3VN0A 3F89A 2YO2A 5E79E 3USSA 5L8RJ 2LR2A 3E1IA 2E75B 4W7YA 1JY2N 1PP9G 1MKMA 3MUDC 1KTMA 3RL0B 3CCUP 1OIPA 1DD4A 2R32A 2YXRB 3KHUA 3S4RA 1ZR2A 1OW6A 1DD3A 3H1KG 3W67A 4U7JA 2PP6A 3M91A 3L75E 2KI7B 1KORA 5KAFE 2O3JA 1DEEG 5BVZA 1JCDA 5KJ7D 1OXZA 1NTZJ 1ZXGA 1RE3A 4Y28J 1JY3N 2KS1A 4GDOA 2E5TA 3CX5H 5APUA 3H32B 1YQ4C 2E42A 4YXDC 4PV1C 1ZOYC 1NU1E 4TT3H 1IK7A 1SQQG 1PP9J 2A06E 2M5AB 4BXLA 3N7NA 4UB6E 3GF3A 2BEZF 1SQVG 3V5BA 1SS1A 1BDDA 3T97A 3L75D 4OH8B 3HUSA 3H1KJ 1S2EA 2OGUA 1AV1A 4I1LA 3B5ND 2Q3EA 3RK2D 1CZQA 2H43A 4LLHA 2QEXP 3JCUH 4QMAA 3KXDA 5C39A 1N73B 1TU3F 1VF5B 2YXQB 3BVHA 1HVVA 4TLFA 1S5LX 1OFCX 1H88A 1VL2A 2NPSD 2AEFA 2A06D 1BE3E 1EXIA 2JR8A 2FYNB 3MD0A 4L74A 1SFCA 3PJSK 1Z56A 3R2PA 3H1HE 5GTHE 1SQQJ 3KZIH 1CI6B 4GODA 4D6TG 1N86A 3L71E 3H1JG 4NPFX 5KLIC 4WY4B 1NVOA 1PGOA 3A0HE 2BEQD 3SWFA 5KLVG 3O6QA 1MUUA 5KAIH 3E7KA 3PTZA 2RH0A 4O9BA 1N7LA 1KFMA 2ZT9D 4YTPC 1BE3D 2OYIB 1YJWP 5CCGC 3CXHI 1L0NK 3BRVB 1JUNA 1SQBK 2FY8A 3O6QB 4HB1A 2KLVA 4PD4H 1JY3O 1MZ9A 2OYOA 1T3UA 5KKZB 1NHLA 2IBZI 3L71D 4BRYA 4MN4C 2KYVA 2IYPA 2H7HA 1EZVG 1XTCC 3HD7D 4B86A 3H1JJ 1OVRA 3L70G 4GKGA 4WY4C 1GMJA 4JF7A 1KYOE 1FC2C 2R3SA 5CJ4A 3GF7A 4H0LC 5APXA 5KLVJ 1FOSF 3H1KD 3SWYA 2JDIH 1LT9A 1QL2A 2FFDB 1SQVE 5AVXB 1U7JA 3L4FA 2A45I 2KZJA 1GL2A 1SLQA 3HE5A 3O8ZA 1IFPA 3AEBC 1USEA 1N8RQ 1SQPK 1YJNP 3FX0A 1N2DC 1AJYA 4OVNF 5KKZC 4DZOA 2KXPB 5AVWB 2Z4EA 2MKVA 3S1KA 4ZMDA 3CCEP 1VQPP 3D70A 1PFIA 1SQVD 1P84I 1URQA 1AVOA 3AEAC 2O1JA 1FDMA 1L4AA 3M06A 2O01N 2WQYC 2OYHB 1G1IA 2M0BA 1YJ9P 2HG5D 2WPQA 1IFDA 3L73G 3HTKB 1M1JC 4UB8E 4JYBA 1JMBA 1LTIC 2BCCG 2HYNA 3GG2A 4DT0A 1Q82Q 2YKOA 5DJUB 3L36A 3AE5C 2B87A 2KK7A 2IFNA 1RF1C 2N1TA 3AECC 2OTJP 3C1LA 3RK2B 1NOHA 1SQXK 5KJ7C 1K05A 4PV1D 1GK6A 4D6TD 2J5UA 2QJKB 5AVSB 1GZLA 4N3YB 1LJ2A 3H1JD 1Q81Q 5KAFH 2NPSB 4H13C 1KILA 4NPEA 4EIJA 4ZKUA 5EFWB 5KLVD 3L70E 1LP1B 3L73J 1VQLP 1FDOA 3RBZA 1SQXJ 2K3RA 3C9IA 2W83C 3MTUE 5CCHA 3Q5PA 2RN0A 2WSFH 3B5NC 3SFDC 3RK2C 3M9QA 1QGKB 4ASVA 2W90A 2ZT9B 3JC22 2Y9YA 4Y99B 3VYIA 1EZVD 2Q5UA 5AW0B 3PRJA 4XE5B 1VQ5P 3L70D 2QJPC 3H25A 4XA4A 3SSUA 3V6IA 1CSBA 1ZV8A 1VQ9P 1QEXA 4EI2A 3GLMA 2CK3H 3MHVA 3HD7B 3SFEC 2AEMA 3WU2E 1K04A 1FE6A 5GTHH 3QH9A 1S5LE 5AVTB 1L0LE 5DJTB 1YTZI 3L75G 1USDA 2BCCE 1ZLLA 2O01H 5AW6B 2FYUE 1M8OB 2K9JB 3AEGC 2ZT9C 1JY2P 1FZCA 2D2CC 3A0HH 1IFMA 3Q1MA 1K73Q 1RE4C 1GK4A 1W5CE 2JEEA 1YIJP 4ZKPA 3CWBG 2PRRA 1NU1G 1SVFA 1FZAA 4PJ0H 4IL6E 4WBAA 4C7NA 4H0LD 2I8DA 2BCCD 1LTAC 2FYUD 4IFMA 3PHLA 3L72G 3L75J 1W2EA 2JWAA 1VQMP 2Q6QA 3TF5A 2IZ1A 1BGYG 1K9MQ 2HPCB 2LXCB 4HH2A 1RH5B 4KJMA 3BRTB 2HLOA 1FZBA 1Y47A 4C46A 2KNCA 1G2CB 1KQGB 2M3EA 2J58A 1JB0J 3CXHE 1LWUC 2IDBA 1IFIA 1LTGC 3BCCE 1RF0C 3V2NA 1NU1J 4JYCA 4NPDA 3H1HG 2Z5IA 1M90Q 3RGUA 5AW1B 2JKVA 2WSFJ 3VMYA 5TJHA 1S9KE 5APSA 4PV1B 3L71G 1D7MA 4L76A 1FAVA 3IFMA 2P58A 1J1DC 1EDIA 1NTZK 5CHXA 1X0TA 3BASA 5BU5A 3U1AA 4RESB 3IN6A 1NH4A 1HGZA 1H0TB 3FXDA 2IZ0A 3CLQA 2K1AA 3L74G 3H32A 1WMKA 3P8CD 2WMMA 1BE3J 1CW5A 4UB8H 1S9KD 2R5BA 2M5AA 3MZWB 2G3AA 2Q1KA 3NMDA 4YPCA 2HR3A 4H13D 3ABVC 2O01J 3L71J 1PPJG 4N78E 4HKZH 3CWBE 2HODB 1NTKE 1P84E 2JP3A 2HFED 3L37A 3ZDMA 3SWKA 4KHXA 1GW3A 1H8AA 1N73A 1KMIZ 5KLIB 2E76C 1SP4A 1NJIQ 3AEFC 5CCGA 2ZAEB 3G4SP 3L72E 1SQQK 1BGYE 4I7ZC 1YI2P 5KTBA 3R4YA 3CCQP 1SQVK 4PD4I 2O1KA 3L35A 1EQ7A 1CI6A 3KYQA 3CWBD 1NTKD 2Y9ZA 1NU1D 2ZVNB 1P84D 4WY4A 3CL3D 2FXMA 1KFNA 1EXJA 2MJZA 3BATA 2KUBA 4L75A 2G8YA 2GUSA 2CPBA 2SPZA 3AE8C 5AVRB 2FXPA 3RL0g 2WZ7A 1NTMG 1SQVJ 2CPSA 2JJLA 3HE4B 1JY2O 3L72D 1Y8AA 1J2JB 1BGYD 2GA1A 2OYIA 1DX7A 4H0LB 2PFXA 1NO4A 1KB9I 1RE3C 1IFNA 3VP8A 3FWNA 1PIXA 4AQRD 2WSEH 1NAFA 4R4LA 1AQ5A 2D2CD 2V7QH 1UIXA 3L74E 1IZNB 3FXEA 3WU2H 3H1IG 1K8AQ 3WUUA 1LTTC 2KIKA 3H1HD 5KLVK 1HBWA 3LIEA 1S5LH 1BSNA 2XV5A 2E5YA 1EDKA 3CPWO 3HUSC 1RQUA 3FWLA 2FFDA
chains in the Genus database with same CATH topology
2FYUG 1EZVG 1L0NG 1SQQG 1SQBG 1KB9H 3H1IG 3L75G 3L70G 3BCCG 3H1KG 5KLVG 3CX5H 3L71G 4PD4H 3CWBG 1SQVG 1NU1G 1NTKG 3L73G 1SQPG 2IBZG 3L72G 1BCCG 3TGUG 3H1LG 2A06G 1BE3G 3L74G 1SQXG 1P84H 4D6TG 1PP9G 1L0LG 1BGYG 1NTZG 2BCCG 1NTMG 1PPJG 3H1JG 4U3FG 3CXHH 3H1HG 1KYOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  1EZV G;  1L0N G;  1SQQ G;  1SQB G;  1KB9 H;  3H1I G;  3L75 G;  3L70 G;  3BCC G;  3H1K G;  5KLV G;  3CX5 H;  3L71 G;  4PD4 H;  3CWB G;  1SQV G;  1NU1 G;  1NTK G;  3L73 G;  1SQP G;  2IBZ G;  3L72 G;  1BCC G;  3TGU G;  3H1L G;  2A06 G;  1BE3 G;  3L74 G;  1SQX G;  1P84 H;  4D6T G;  1PP9 G;  1L0L G;  1BGY G;  1NTZ G;  2BCC G;  1NTM G;  1PPJ G;  3H1J G;  4U3F G;  3CXH H;  3H1H G;  1KYO H; 
#chains in the Genus database with same CATH topology
 5H2F E;  2LXB A;  2QG4 A;  4D6T J;  5AW3 B;  3CC4 P;  1PPJ E;  2KB7 P;  3Q5R A;  1T3J A;  3GHG B;  4BWN A;  4CPG A;  2W6A A;  5AW2 B;  1U57 A;  3H1L E;  3L74 D;  2KZI A;  1IFJ A;  3I5C A;  1RF1 A;  1HF9 A;  4IL6 H;  3M0D A;  2WSS H;  1M1J B;  1R5L A;  2H88 C;  1NKN A;  1SFC C;  3AED C;  3EFG A;  5KJ7 A;  1G1J A;  2IX7 C;  2IFM A;  1JOC A;  3LW5 H;  1KN7 A;  4LC1 A;  3KPE A;  1RF1 B;  3VMX A;  1PPJ D;  1T6A A;  4DOJ A;  3VMA A;  2WPR A;  2OYH A;  1KYO D;  1S72 P;  5CJ0 A;  2Y0C A;  2R3C A;  3HTK A;  4EDF A;  2ZFC A;  1N7S D;  2J59 M;  3L70 J;  2OAR A;  1JM0 A;  3CXH H;  3GHG C;  3AE4 C;  2AEJ A;  2V4H A;  1PGJ A;  4H13 B;  2H89 C;  1NTM E;  5B5E E;  2XNX A;  1U7M A;  4N6J A;  1X79 B;  3E1R A;  1YYC A;  2L91 A;  3RBX A;  3B5N A;  1ZW0 A;  4EYY Q;  1L0L G;  1VQ6 P;  5AW9 B;  5E79 H;  2ZJS E;  1BCC E;  3Q2Y A;  2FYU G;  1J1E B;  5AW5 B;  3AE3 C;  3TK1 A;  5AW4 B;  5AVQ B;  1FOS E;  2NPS A;  1L0N E;  3B5N B;  2QIW A;  1SQB E;  3H1I E;  2NRG A;  2QVA A;  1OW8 A;  1LP1 A;  4A7P A;  2LKM A;  1LT9 C;  2E43 A;  1KQF B;  2WSE J;  1NTM D;  1A02 J;  1R5S A;  2QJP B;  1GL2 C;  3QWO C;  2V7Q J;  2JWD A;  3GMA A;  3F5H A;  1X22 A;  3Q3D A;  3AE2 C;  5APT A;  2E76 D;  1L2P A;  1L0L J;  2BCC J;  3RK3 C;  1GDT A;  5APQ A;  2FYU J;  3GW6 A;  2ZYG A;  1L0N D;  3CI9 A;  1SQB D;  1J1E C;  3H1I D;  1S1C X;  1P84 H;  1FBM A;  4UB6 H;  3G6E P;  1SQP E;  1OZH A;  1URQ C;  5AVU B;  2OQQ A;  1L4A C;  1S3J A;  3BCC G;  4WVZ A;  3EQ2 A;  2D2C B;  2Q3I A;  3D6Z A;  1VQO P;  1M1K Q;  2IBZ G;  3HD7 A;  1NAY A;  2ZVO B;  2POH A;  3B8E B;  2IPP A;  1VQN P;  3ITK A;  3LW5 J;  1LNQ A;  1FJP A;  2WT7 B;  3P8M C;  3CCM P;  1Q86 Q;  2N1T C;  1PV3 A;  1E79 H;  2K9J A;  3EFF K;  1SQP D;  2A45 G;  5KAI E;  1AFO A;  3I55 P;  1QLE D;  3CCL P;  2N9B A;  1Y9B A;  3TGU G;  1M56 D;  1KIL C;  3BCC J;  3V2Q A;  3K5B A;  4L73 A;  1X8Y A;  1OX3 A;  1LWU B;  4H44 D;  5AVZ B;  4W80 A;  3A0B E;  5CCH C;  1NTK G;  3V2R A;  2I1J A;  1BDC A;  3IR9 A;  3MUD A;  2KSE A;  2HPC A;  1GW4 A;  2QJY C;  3WUT A;  1L0L D;  1N7S B;  1G2C A;  3D6Y A;  1J1D B;  1LTJ C;  4AYC A;  5H2F H;  1KB9 E;  1NU1 K;  3TDK A;  1SFC D;  2AXT E;  4IOI H;  2WVR A;  4HJG H;  1YHQ P;  1PL5 A;  1KYO H;  1AA0 A;  3CX5 I;  1T8Z A;  3CWB J;  1NTK J;  3A5T A;  2IBZ E;  1VDF A;  3HRN A;  2GM4 A;  3A7O A;  1HJ0 A;  1OVV A;  4K35 A;  3M0A A;  3CME P;  2B9B A;  1JMM A;  1N7S C;  1KB9 D;  2K88 A;  5TIS E;  4OGQ C;  1H0T A;  4WWI A;  2YO3 A;  1FZC C;  4M3L A;  4JQ0 D;  3L72 J;  1RY3 A;  1BGY J;  2WWW A;  1EZV I;  4U3F E;  1PGQ A;  2E76 B;  3CXH D;  2E74 C;  4W7Z A;  2XZR A;  4ZNC A;  3RK3 E;  1JTH B;  5AVY B;  3BCC D;  1X9V A;  5B5E H;  2YMK A;  2QSI A;  2IBZ D;  2YIU C;  2HOD A;  4I7Z B;  5B66 E;  3PP5 A;  3TGU E;  3U59 A;  3OW2 O;  3H1H J;  3PLN A;  2OTK E;  1OW7 A;  1W2B O;  1GL2 D;  1XTG B;  2ZXE B;  3G9R A;  2RKL A;  4JPZ B;  5APY A;  3TSI A;  4U3F D;  3EWK A;  1GU5 A;  1ZP0 C;  4I2L C;  1KD1 Q;  1ZME C;  3C8V A;  4LGD E;  3RK3 D;  3H1L G;  2Y0D A;  5AW8 B;  1UII A;  1ZRT E;  2E75 C;  3WUV A;  2VRS A;  3TNU A;  3TGU D;  3L74 J;  1LGH B;  2KS1 B;  2QE7 H;  1YBK A;  1URQ D;  3UIA A;  3RL0 C;  1RHZ B;  1L4A D;  4IFD K;  2YNY A;  2ZYA A;  1GD2 E;  1M7L A;  4N78 D;  3TNU B;  1ZN5 A;  3HE4 A;  1KIL E;  1KQS O;  1ZR4 A;  1VQ7 P;  3OA7 A;  3T97 B;  4H44 B;  3HUS B;  1ZRT D;  2KOG A;  2XDJ A;  2N1T D;  1T2K C;  3H1L J;  5GTI E;  3AE7 C;  2C9N Y;  1KV4 A;  2AXC A;  1NTZ E;  3S9O A;  4KT0 J;  1BCC G;  1FDI A;  2W6B A;  1VPC A;  1KC8 Q;  3CCV P;  4DJG A;  2K9Y A;  1NTM K;  3OAK A;  4GT1 A;  1RQV A;  1KIL D;  2JO1 A;  1FJK A;  3IF4 A;  1L0N G;  1SFC B;  1DEB A;  2Y0E A;  1SQB G;  1PP9 E;  2P10 A;  3WMM 0;  1IK9 A;  4IL6 X;  4YXW H;  2Z5H A;  4I6M C;  4RO0 A;  4WB4 A;  5CCH D;  3GHG A;  1EDJ A;  1N73 C;  1AQT A;  3H1K E;  4XFJ A;  4H44 C;  1VF5 C;  4PJ0 E;  1NTZ D;  1QVF O;  1NTM J;  1M1J A;  2ITA A;  2FYN C;  2QA4 P;  1DIP A;  1DH3 A;  1FU1 A;  3G3Z A;  2WTY A;  2GUV A;  2YMY A;  1BCC J;  3A0B H;  3P7K A;  1NYH A;  1IC2 A;  1PP9 D;  1QX8 A;  2WPV B;  2P67 A;  3CC2 P;  5BU8 B;  4DCK A;  1R8E A;  1HH0 A;  1L0N J;  1SQB J;  1SQQ E;  3M9B A;  1SQP G;  4C7R A;  1HTL C;  2M8R A;  3H1I J;  2R5D A;  4BRY B;  1QVG O;  2W27 A;  4GIF A;  2XKM A;  1KB9 H;  1KQL A;  1YQ3 C;  1QL1 A;  2KP8 A;  2AXT H;  4RJT A;  1Q90 D;  2OYI C;  5AW7 B;  4IFF A;  2R44 A;  2FYZ A;  1MV8 A;  1OMI A;  3AE6 C;  1LT9 B;  4OGQ D;  1OWA A;  1IJD B;  4OWF A;  3H1L D;  2XND H;  1GL2 B;  3HE5 B;  5M1B A;  1NKZ B;  1E5W A;  1WRG A;  3NTN A;  1SQQ D;  2YKP A;  3V4W A;  1WT6 A;  4Z1M H;  1PZQ A;  3IAO A;  2WSC H;  2FXO A;  2XU6 A;  2E74 D;  2FKW B;  2OTL P;  3VTP C;  1AVY A;  3CMA P;  1VQK P;  3AE1 C;  3AEE C;  1SQP J;  3RK3 B;  5TIS H;  4D6T E;  1GU4 A;  2FFD C;  3H1J E;  3CCS P;  1LT1 A;  2QM7 A;  3NFQ A;  1KZU B;  3II6 A;  3A2A A;  1SQX G;  1URQ B;  5KLV E;  3CCR P;  1L0L K;  3CX5 E;  1L4A B;  2A45 H;  1Q7Y Q;  5K5G B;  1JEK A;  1BSH A;  2FYU K;  2KLU A;  2W8Z A;  3LID A;  2B89 A;  3M0D C;  1FZG A;  3G71 P;  5B66 H;  1A02 F;  2P1J A;  2W6J H;  1HUC A;  1BCC D;  5APW A;  2E75 D;  2B87 B;  1NWQ A;  5CBO A;  2N1T B;  1EZV E;  3OJA B;  2NZ2 A;  1FZF A;  2N9Y B;  2OYH C;  3RL0 D;  1RE4 A;  3CX5 D;  1NGM B;  3JCU E;  5CBN A;  1HGV A;  2UWJ E;  3VP9 A;  1Q2N A;  1HJB A;  1YIT P;  1KIL B;  1LTS C;  3MIW A;  4K3A A;  2WT7 A;  3W68 A;  3PH0 A;  1HWT C;  3CC7 P;  4HYT B;  2PGD A;  3KZI E;  3Q5S A;  4GOE A;  3CD6 P;  3MGN A;  1LTJ A;  1T2K D;  2Q9I A;  3H6P A;  2QJK C;  5AVV B;  3AE9 C;  1LTB C;  2NPS C;  2QJY B;  3JSV C;  4R4M A;  3U1C A;  2M3B A;  3KQG A;  4U3F G;  2RMZ A;  1JCC A;  3V2P A;  4ASW A;  1LTJ B;  3NXS A;  1KYO I;  1LWU A;  3N4X A;  1EDL A;  2PAJ A;  2H8P D;  1MFT A;  3CCJ P;  5GTI H;  1RF0 A;  1FS0 E;  3B4S A;  4PD4 E;  3L73 E;  2WSC J;  2C9L Y;  3M9H A;  1SQX E;  2L5G B;  1VF5 D;  1N7S A;  1JO5 A;  2KSJ A;  5CCG D;  1VQ8 P;  3MP7 B;  1PGP A;  2ZXX A;  1GTW A;  4Y99 C;  4RKU J;  2YKQ A;  2ZYD A;  3D71 A;  2WIT A;  4OGQ B;  2C0X A;  4U3F J;  2B88 A;  1EC5 A;  1YTZ T;  4EOT A;  3A3Y B;  4WY4 D;  1FZC B;  2A06 G;  1NTK K;  1OVU A;  4PD4 D;  1M57 D;  3HD7 C;  3L73 D;  2QRX A;  2I1K A;  3TGU J;  1SQX D;  3FGA D;  2E74 B;  2K37 A;  1JY3 P;  3V4Q A;  2C0W A;  1IO4 A;  4GOF A;  2BAS A;  3B71 A;  3TYY A;  1MFZ A;  2P7J A;  3P32 A;  1S4X A;  2DW3 A;  4C7N B;  4JBZ A;  2YIU B;  3VOP A;  2WPS A;  2P2U A;  5CMZ A;  2Q7C A;  3VMZ A;  3KDP B;  5APV A;  3I56 P;  1H89 A;  2QM8 A;  2FBW C;  1FZE A;  1JNM A;  1BE3 G;  4AUW A;  1VQ4 P;  1JTH A;  1NTZ G;  3P8C E;  2IYO A;  2KNC B;  3VN0 A;  3F89 A;  2YO2 A;  5E79 E;  3USS A;  5L8R J;  2LR2 A;  3E1I A;  2E75 B;  4W7Y A;  1JY2 N;  1PP9 G;  1MKM A;  3MUD C;  1KTM A;  3RL0 B;  3CCU P;  1OIP A;  1DD4 A;  2R32 A;  2YXR B;  3KHU A;  3S4R A;  1ZR2 A;  1OW6 A;  1DD3 A;  3H1K G;  3W67 A;  4U7J A;  2PP6 A;  3M91 A;  3L75 E;  2KI7 B;  1KOR A;  5KAF E;  2O3J A;  1DEE G;  5BVZ A;  1JCD A;  5KJ7 D;  1OXZ A;  1NTZ J;  1ZXG A;  1RE3 A;  4Y28 J;  1JY3 N;  2KS1 A;  4GDO A;  2E5T A;  3CX5 H;  5APU A;  3H32 B;  1YQ4 C;  2E42 A;  4YXD C;  4PV1 C;  1ZOY C;  1NU1 E;  4TT3 H;  1IK7 A;  1SQQ G;  1PP9 J;  2A06 E;  2M5A B;  4BXL A;  3N7N A;  4UB6 E;  3GF3 A;  2BEZ F;  1SQV G;  3V5B A;  1SS1 A;  1BDD A;  3T97 A;  3L75 D;  4OH8 B;  3HUS A;  3H1K J;  1S2E A;  2OGU A;  1AV1 A;  4I1L A;  3B5N D;  2Q3E A;  3RK2 D;  1CZQ A;  2H43 A;  4LLH A;  2QEX P;  3JCU H;  4QMA A;  3KXD A;  5C39 A;  1N73 B;  1TU3 F;  1VF5 B;  2YXQ B;  3BVH A;  1HVV A;  4TLF A;  1S5L X;  1OFC X;  1H88 A;  1VL2 A;  2NPS D;  2AEF A;  2A06 D;  1BE3 E;  1EXI A;  2JR8 A;  2FYN B;  3MD0 A;  4L74 A;  1SFC A;  3PJS K;  1Z56 A;  3R2P A;  3H1H E;  5GTH E;  1SQQ J;  3KZI H;  1CI6 B;  4GOD A;  4D6T G;  1N86 A;  3L71 E;  3H1J G;  4NPF X;  5KLI C;  4WY4 B;  1NVO A;  1PGO A;  3A0H E;  2BEQ D;  3SWF A;  5KLV G;  3O6Q A;  1MUU A;  5KAI H;  3E7K A;  3PTZ A;  2RH0 A;  4O9B A;  1N7L A;  1KFM A;  2ZT9 D;  4YTP C;  1BE3 D;  2OYI B;  1YJW P;  5CCG C;  3CXH I;  1L0N K;  3BRV B;  1JUN A;  1SQB K;  2FY8 A;  3O6Q B;  4HB1 A;  2KLV A;  4PD4 H;  1JY3 O;  1MZ9 A;  2OYO A;  1T3U A;  5KKZ B;  1NHL A;  2IBZ I;  3L71 D;  4BRY A;  4MN4 C;  2KYV A;  2IYP A;  2H7H A;  1EZV G;  1XTC C;  3HD7 D;  4B86 A;  3H1J J;  1OVR A;  3L70 G;  4GKG A;  4WY4 C;  1GMJ A;  4JF7 A;  1KYO E;  1FC2 C;  2R3S A;  5CJ4 A;  3GF7 A;  4H0L C;  5APX A;  5KLV J;  1FOS F;  3H1K D;  3SWY A;  2JDI H;  1LT9 A;  1QL2 A;  2FFD B;  1SQV E;  5AVX B;  1U7J A;  3L4F A;  2A45 I;  2KZJ A;  1GL2 A;  1SLQ A;  3HE5 A;  3O8Z A;  1IFP A;  3AEB C;  1USE A;  1N8R Q;  1SQP K;  1YJN P;  3FX0 A;  1N2D C;  1AJY A;  4OVN F;  5KKZ C;  4DZO A;  2KXP B;  5AVW B;  2Z4E A;  2MKV A;  3S1K A;  4ZMD A;  3CCE P;  1VQP P;  3D70 A;  1PFI A;  1SQV D;  1P84 I;  1URQ A;  1AVO A;  3AEA C;  2O1J A;  1FDM A;  1L4A A;  3M06 A;  2O01 N;  2WQY C;  2OYH B;  1G1I A;  2M0B A;  1YJ9 P;  2HG5 D;  2WPQ A;  1IFD A;  3L73 G;  3HTK B;  1M1J C;  4UB8 E;  4JYB A;  1JMB A;  1LTI C;  2BCC G;  2HYN A;  3GG2 A;  4DT0 A;  1Q82 Q;  2YKO A;  5DJU B;  3L36 A;  3AE5 C;  2B87 A;  2KK7 A;  2IFN A;  1RF1 C;  2N1T A;  3AEC C;  2OTJ P;  3C1L A;  3RK2 B;  1NOH A;  1SQX K;  5KJ7 C;  1K05 A;  4PV1 D;  1GK6 A;  4D6T D;  2J5U A;  2QJK B;  5AVS B;  1GZL A;  4N3Y B;  1LJ2 A;  3H1J D;  1Q81 Q;  5KAF H;  2NPS B;  4H13 C;  1KIL A;  4NPE A;  4EIJ A;  4ZKU A;  5EFW B;  5KLV D;  3L70 E;  1LP1 B;  3L73 J;  1VQL P;  1FDO A;  3RBZ A;  1SQX J;  2K3R A;  3C9I A;  2W83 C;  3MTU E;  5CCH A;  3Q5P A;  2RN0 A;  2WSF H;  3B5N C;  3SFD C;  3RK2 C;  3M9Q A;  1QGK B;  4ASV A;  2W90 A;  2ZT9 B;  3JC2 2;  2Y9Y A;  4Y99 B;  3VYI A;  1EZV D;  2Q5U A;  5AW0 B;  3PRJ A;  4XE5 B;  1VQ5 P;  3L70 D;  2QJP C;  3H25 A;  4XA4 A;  3SSU A;  3V6I A;  1CSB A;  1ZV8 A;  1VQ9 P;  1QEX A;  4EI2 A;  3GLM A;  2CK3 H;  3MHV A;  3HD7 B;  3SFE C;  2AEM A;  3WU2 E;  1K04 A;  1FE6 A;  5GTH H;  3QH9 A;  1S5L E;  5AVT B;  1L0L E;  5DJT B;  1YTZ I;  3L75 G;  1USD A;  2BCC E;  1ZLL A;  2O01 H;  5AW6 B;  2FYU E;  1M8O B;  2K9J B;  3AEG C;  2ZT9 C;  1JY2 P;  1FZC A;  2D2C C;  3A0H H;  1IFM A;  3Q1M A;  1K73 Q;  1RE4 C;  1GK4 A;  1W5C E;  2JEE A;  1YIJ P;  4ZKP A;  3CWB G;  2PRR A;  1NU1 G;  1SVF A;  1FZA A;  4PJ0 H;  4IL6 E;  4WBA A;  4C7N A;  4H0L D;  2I8D A;  2BCC D;  1LTA C;  2FYU D;  4IFM A;  3PHL A;  3L72 G;  3L75 J;  1W2E A;  2JWA A;  1VQM P;  2Q6Q A;  3TF5 A;  2IZ1 A;  1BGY G;  1K9M Q;  2HPC B;  2LXC B;  4HH2 A;  1RH5 B;  4KJM A;  3BRT B;  2HLO A;  1FZB A;  1Y47 A;  4C46 A;  2KNC A;  1G2C B;  1KQG B;  2M3E A;  2J58 A;  1JB0 J;  3CXH E;  1LWU C;  2IDB A;  1IFI A;  1LTG C;  3BCC E;  1RF0 C;  3V2N A;  1NU1 J;  4JYC A;  4NPD A;  3H1H G;  2Z5I A;  1M90 Q;  3RGU A;  5AW1 B;  2JKV A;  2WSF J;  3VMY A;  5TJH A;  1S9K E;  5APS A;  4PV1 B;  3L71 G;  1D7M A;  4L76 A;  1FAV A;  3IFM A;  2P58 A;  1J1D C;  1EDI A;  1NTZ K;  5CHX A;  1X0T A;  3BAS A;  5BU5 A;  3U1A A;  4RES B;  3IN6 A;  1NH4 A;  1HGZ A;  1H0T B;  3FXD A;  2IZ0 A;  3CLQ A;  2K1A A;  3L74 G;  3H32 A;  1WMK A;  3P8C D;  2WMM A;  1BE3 J;  1CW5 A;  4UB8 H;  1S9K D;  2R5B A;  2M5A A;  3MZW B;  2G3A A;  2Q1K A;  3NMD A;  4YPC A;  2HR3 A;  4H13 D;  3ABV C;  2O01 J;  3L71 J;  1PPJ G;  4N78 E;  4HKZ H;  3CWB E;  2HOD B;  1NTK E;  1P84 E;  2JP3 A;  2HFE D;  3L37 A;  3ZDM A;  3SWK A;  4KHX A;  1GW3 A;  1H8A A;  1N73 A;  1KMI Z;  5KLI B;  2E76 C;  1SP4 A;  1NJI Q;  3AEF C;  5CCG A;  2ZAE B;  3G4S P;  3L72 E;  1SQQ K;  1BGY E;  4I7Z C;  1YI2 P;  5KTB A;  3R4Y A;  3CCQ P;  1SQV K;  4PD4 I;  2O1K A;  3L35 A;  1EQ7 A;  1CI6 A;  3KYQ A;  3CWB D;  1NTK D;  2Y9Z A;  1NU1 D;  2ZVN B;  1P84 D;  4WY4 A;  3CL3 D;  2FXM A;  1KFN A;  1EXJ A;  2MJZ A;  3BAT A;  2KUB A;  4L75 A;  2G8Y A;  2GUS A;  2CPB A;  2SPZ A;  3AE8 C;  5AVR B;  2FXP A;  3RL0 g;  2WZ7 A;  1NTM G;  1SQV J;  2CPS A;  2JJL A;  3HE4 B;  1JY2 O;  3L72 D;  1Y8A A;  1J2J B;  1BGY D;  2GA1 A;  2OYI A;  1DX7 A;  4H0L B;  2PFX A;  1NO4 A;  1KB9 I;  1RE3 C;  1IFN A;  3VP8 A;  3FWN A;  1PIX A;  4AQR D;  2WSE H;  1NAF A;  4R4L A;  1AQ5 A;  2D2C D;  2V7Q H;  1UIX A;  3L74 E;  1IZN B;  3FXE A;  3WU2 H;  3H1I G;  1K8A Q;  3WUU A;  1LTT C;  2KIK A;  3H1H D;  5KLV K;  1HBW A;  3LIE A;  1S5L H;  1BSN A;  2XV5 A;  2E5Y A;  1EDK A;  3CPW O;  3HUS C;  1RQU A;  3FWL A;  2FFD A; 
#chains in the Genus database with same CATH homology
 2FYU G;  1EZV G;  1L0N G;  1SQQ G;  1SQB G;  1KB9 H;  3H1I G;  3L75 G;  3L70 G;  3BCC G;  3H1K G;  5KLV G;  3CX5 H;  3L71 G;  4PD4 H;  3CWB G;  1SQV G;  1NU1 G;  1NTK G;  3L73 G;  1SQP G;  2IBZ G;  3L72 G;  1BCC G;  3TGU G;  3H1L G;  2A06 G;  1BE3 G;  3L74 G;  1SQX G;  1P84 H;  4D6T G;  1PP9 G;  1L0L G;  1BGY G;  1NTZ G;  2BCC G;  1NTM G;  1PPJ G;  3H1J G;  4U3F G;  3CXH H;  3H1H G;  1KYO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...