3E7KA

Crystal structure of an antiparallel coiled-coil tetramerization domain from trpm7 channels
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
54
structure length
54
Chain Sequence
AGSRVTFERVEQMSIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords TRPM7 channel
publication title X-ray crystal structure of a TRPM assembly domain reveals an antiparallel four-stranded coiled-coil.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 26
structure length 54
sequence length 54
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1010 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces TRPM, tetramerisation domain 3e7kA00
3E7KA
chains in the Genus database with same CATH superfamily
2P10A 3CMAP 1IFPA 2HR3A 5KKZC 1R8EA 2HLOA 4WY4B 2O1KA 3L71G 2YO2A 2P1JA 2B87B 3P32A 2AEMA 1KFNA 2N1TC 1X22A 4RKUJ 3KYQA 1SFCA 3EWKA 5KLVG 2Q1KA 1BGYE 1MZ9A 1S1CX 3VMXA 1NTKJ 3B5ND 4UB6E 1VQLP 4U7JA 1L4AD 4K35A 2WPVB 3D71A 3AEDC 1W2EA 2YO3A 3OA7A 2WSEJ 1M1JB 5DJTB 2VRSA 1FJPA 1JY3P 3RL0g 3H1KE 3G4SP 2V7QJ 1A02F 1GTWA 3BCCG 1KB9D 3OAKA 2FYUE 3H25A 1S9KD 1SQBE 1YHQP 1KB9I 3R2PA 2YNYA 1HGVA 4H13B 3L73J 1Q2NA 1QL1A 2B89A 5AVTB 3KPEA 3TYYA 4JYCA 5L8RJ 3CX5D 1SQPJ 1X79B 2AXCA 2KB7P 3CX5I 1IO4A 3Q1MA 1NU1E 3G71P 1DEEG 1PPJE 2QM7A 2Z5HA 1ZR2A 1S5LH 5KJ7C 1PV3A 2WT7A 4BXLA 2FY8A 1QGKB 2Z5IA 4D6TJ 1VQ5P 3H1HG 5AVQB 2BASA 5M1BA 5B5EE 1DIPA 4W7ZA 3H1JJ 3L71D 2FKWB 3B71A 3USSA 2WSCJ 1MFZA 1CW5A 4H13D 2W6AA 2WMMA 2ZT9B 2WSSH 3HD7A 5AW2B 1ZXGA 1FJKA 4IFDK 2IZ0A 5CCHA 2E76C 2KZJA 1K04A 1XTGB 1GDTA 1M1KQ 3U1AA 2NRGA 3CC7P 3S9OA 3H32B 1ZR4A 5CCGC 3VOPA 1FBMA 3MZWB 3RK3C 3L72J 1AFOA 2RKLA 1NTMK 1AA0A 1G1IA 2O01J 2YIUC 2I1KA 2ZYAA 1VF5D 1L0LK 2HODA 1GW4A 3BCCD 1E5WA 1EDJA 3M9QA 1JTHB 1NTKG 1URQA 1HJ0A 1PGPA 4ZKUA 1BSNA 1FDMA 3HTKB 3V5BA 1RF1A 1FOSF 2K37A 1ZRTD 2ZT9D 4EDFA 3AE5C 3AE9C 3JCUH 3RK2D 1RF0A 3L75E 4NPFX 1JUNA 2IBZI 5AW9B 1U7JA 1GZLA 1RE4C 2L91A 5AVZB 3B5NA 4U3FE 1SQVJ 5AW8B 1HBWA 5AVSB 1YTZT 2XZRA 2K9JA 2QJKB 3V2QA 2P7JA 3H1HD 3L73G 2E75B 2Y9YA 4DZOA 2N1TA 1SQPG 2WVRA 3E7KA 2MJZA 3O6QB 4BRYA 1M7LA 1EXIA 2K3RA 1A02J 1ZRTE 3Q5SA 1KILD 2N9BA 1SQBJ 2IBZE 1LT1A 2FYZA 2KNCB 4GODA 3RBXA 5KLIC 2C9LY 4D6TG 1PGJA 3CMEP 2QJKC 1KORA 1FZFA 3I56P 3GG2A 1BE3J 4AQRD 2E75C 3TGUJ 4AYCA 3P8CD 1OVVA 3H1JG 2QJYB 1HVVA 1NU1J 1M90Q 3HE4B 4GOFA 2HG5D 3S1KA 1NAFA 3CCEP 1YJWP 5AVRB 3WU2H 3AEEC 2OTLP 2OTJP 1DD3A 1KFMA 1R5LA 1SQQJ 3GW6A 2KZIA 3L70E 5AW5B 1VQOP 1VQ8P 2LR2A 1UIIA 3L72G 5AVVB 1NKNA 1SFCD 3VMZA 4H44B 2AEJA 5KJ7A 2A45G 3C9IA 2ZYDA 1SQXG 1AQTA 1YQ3C 1GW3A 1IZNB 1K73Q 2P2UA 1NTME 2XV5A 2Y0DA 2PGDA 2E74B 1P84D 3K5BA 1L0LE 2XU6A 3M9HA 4W80A 1CI6A 2BCCD 2HPCA 4K3AA 3H1LE 2KSJA 3WMM0 3Q3DA 4I7ZC 2OYHC 4Y99B 5KAFH 1U57A 1JMMA 1GU4A 3VP8A 1EQ7A 1NKZB 1GL2C 2QRXA 4MN4C 3GF3A 3P8MC 1SQVG 2O01N 2GA1A 3CD6P 1WRGA 1Q7YQ 3I5CA 2XNXA 4D6TD 4H44D 1SVFA 1JNMA 1KZUB 2W8ZA 3BVHA 3G3ZA 2M8RA 5APTA 3Q5PA 1FZGA 3H6PA 2E5TA 2POHA 1UIXA 1NTZD 3H1JD 3MGNA 2KLUA 1Q81Q 2CPSA 1YBKA 2QJPC 1SQBG 4U3FJ 2Q3EA 5TISH 1LTJB 1Q90D 3UIAA 2R3SA 5B66H 3P7KA 1EDIA 4W7YA 1H88A 1BCCD 1BE3G 2HFED 2D2CD 1KQGB 4UB8H 3TGUG 1KB9H 1PP9E 1L0ND 1KILA 3L72D 1NU1G 4KT0J 5B5EH 3L74D 1EZVD 4GDOA 1EZVI 1IFJA 1HWTC 3HD7D 2KS1A 1SQXD 1MKMA 5CCHD 1VQ6P 4BWNA 3AEBC 3CX5H 2KUBA 1J1DB 2B88A 1FU1A 2WPRA 1LP1A 1HUCA 3H1IE 1SQQG 3AE1C 2Q3IA 2NPSC 3CWBE 2FXOA 4PD4D 2FFDB 3B5NB 1RQVA 2P67A 1U7MA 3V4QA 3WU2E 1IFNA 3F89A 1L4AB 3HUSA 5APYA 2WQYC 2K9JB 5GTIE 3WUTA 1KTMA 2CK3H 1OVUA 1SLQA 1N86A 1T3UA 3F5HA 1J1EC 2ZAEB 4BRYB 1URQD 3LW5J 3L70J 2BEZF 1SQVD 1JY2P 1Y9BA 4OGQC 3NXSA 1JCDA 3CL3D 3TNUA 1PFIA 4ZKPA 1EXJA 2W6BA 2LXBA 1L4AC 1NVOA 5C39A 1LTIC 3JSVC 3IR9A 2E5YA 2KOGA 3HRNA 4EI2A 2MKVA 3SWFA 3B8EB 1N7SC 1NTMJ 3RL0D 3U1CA 1K8AQ 2SPZA 4YTPC 2J58A 4QMAA 5KAFE 4WY4C 3LIEA 5AW6B 1NYHA 2J5UA 4A7PA 2G8YA 3H1LJ 2N1TD 1BE3D 2JO1A 1NJIQ 3V2PA 2GUVA 2A06D 4U3FG 2FXPA 3S4RA 3KXDA 3V2NA 4JYBA 1OX3A 5TISE 1M1JC 1SQQD 3D70A 2ITAA 4OWFA 2IFMA 2QM8A 2IYOA 4WVZA 2OYHA 2W90A 2KYVA 5B66E 2XNDH 4IOIH 1QVFO 5AW0B 2H43A 1SP4A 1GL2A 2KI7B 1RHZB 2JP3A 3PH0A 4UB8E 1KB9E 1M57D 4L75A 5APUA 1LT9A 3E1IA 4H13C 1S9KE 1VF5B 1T8ZA 2ZFCA 2V4HA 1PP9J 3A7OA 3HE5B 5CBNA 4C7NB 3M91A 3CX5E 1FAVA 1T6AA 2JJLA 5KLVD 1G2CA 5KJ7D 1YYCA 3RK2B 1DD4A 3FWLA 1SS1A 3BRTB 1X0TA 4DJGA 2Y0CA 1VF5C 5CMZA 2QA4P 3WUVA 3M9BA 3L70G 4YXDC 2WITA 3A2AA 1FZCB 4WBAA 2H8PD 1MUUA 3MTUE 4M3LA 1EDLA 3L35A 2OYIA 3T97A 1Z56A 5AW3B 1H0TA 3L71E 2ZT9C 1L2PA 1LTSC 1NO4A 1Y8AA 2PFXA 3GHGA 3JC22 1N73A 1PIXA 3RK2C 2E76D 2FYNB 5AW7B 1NTMG 1YIJP 2QIWA 2ZVNB 2O3JA 1KILB 1PGOA 5CCGD 3G9RA 3RK3D 2C0XA 4N6JA 3PJSK 1JB0J 2K1AA 3H1LG 1BGYJ 4LGDE 3FX0A 3VMAA 1IFMA 4XE5B 1PL5A 5BVZA 2XKMA 1BSHA 4CPGA 5APVA 1BDCA 3FXDA 5BU5A 5AVWB 1LWUB 1OMIA 5APXA 1OW6A 3HUSB 3BCCE 4JQ0D 2Q9IA 3BRVB 2JDIH 3B4SA 2QEXP 2E43A 1JEKA 4PV1D 4R4MA 1OZHA 3O8ZA 3H1KJ 5TJHA 3ITKA 1NHLA 2FYUJ 2WWWA 3SWYA 2R5BA 1JY3O 1G1JA 3MHVA 4C7RA 3TNUB 2OQQA 2M0BA 1NH4A 2YXQB 2KLVA 4EOTA 1SFCB 3ZDMA 2ZXEB 5CJ4A 4HYTB 1S72P 3PTZA 4WY4A 1MFTA 3I55P 2M5AA 2B87A 1NTZK 1GU5A 2Z4EA 3II6A 3PLNA 1QEXA 4L73A 3H1HE 3KZIH 1PP9G 3CLQA 3CPWO 5CBOA 1KYOD 3FWNA 1KILE 4WB4A 2Q5UA 4LC1A 1SFCC 1NTKD 1M8OB 5GTIH 1L0NK 3VMYA 3V2RA 2JR8A 3CC2P 2QJYC 3C1LA 3RBZA 1SQXK 1RE3C 3P8CE 2RMZA 5E79H 3MIWA 3A0HE 2M3EA 2K9YA 2ZJSE 2H7HA 1NGMB 1Q82Q 3ABVC 1HGZA 2Y0EA 4JBZA 1BDDA 1JY3N 1T2KD 2I8DA 3L73D 1P84I 2WT7B 5K5GB 2WPQA 3AE7C 3BASA 1SQPD 3IAOA 2RN0A 1BGYG 1AV1A 1VQMP 4H44C 1AQ5A 2D2CB 2R5DA 3EQ2A 1SQVK 2YKOA 1ZLLA 2E42A 1KC8Q 3CXHD 2G3AA 4JPZB 5CCGA 4KJMA 2E74C 3HD7B 3L75J 1ZOYC 4ZMDA 3H1KG 1P84E 3PRJA 3TK1A 4Y99C 2BCCE 1YJ9P 2FYUG 2OYOA 4GKGA 1FDIA 1ZW0A 3TDKA 3SFDC 1LJ2A 3VYIA 1R5SA 3TF5A 1Y47A 1GL2D 4IL6X 2LKMA 1N8RQ 2OYIB 2IPPA 4H0LD 3M06A 3H32A 5BU8B 2HODB 2Y9ZA 3IF4A 2FBWC 3HD7C 2QVAA 5AVUB 1N73B 5CCHC 1URQB 1XTCC 4D6TE 2PRRA 1HF9A 3W67A 1PPJG 3N4XA 1RF1B 5H2FH 4PJ0E 1RE4A 2ZXXA 1QL2A 1NTZE 3H1JE 1IFIA 3KZIE 1LTJC 3MP7B 4ASWA 3M0DC 2A45I 1SQQK 3CCQP 1VPCA 3A0BE 3RL0B 1AVOA 2B9BA 3AEFC 2ZYGA 4PD4I 3AEGC 5KKZB 4N78D 1LTBC 4OVNF 1E79H 5APQA 1HTLC 1ZN5A 1BCCE 2C9NY 1RF1C 1D7MA 2KIKA 1BGYD 2N1TB 1L0NE 1QLED 2YKPA 3L72E 3L74E 1EZVE 3MUDC 1KD1Q 2K88A 1RF0C 3CC4P 1J1DC 5E79E 4GIFA 1SQXE 1LTTC 4RJTA 1KV4A 2O1JA 4TLFA 2FFDC 3B5NC 5KLVK 3O6QA 1VDFA 3CCMP 1VQPP 5AVXB 4Y28J 4PD4E 1FC2C 1FE6A 3H1KD 4R4LA 1Q86Q 4OH8B 2M5AB 3M0AA 3SSUA 2KNCA 4N78E 3VN0A 2YKQA 2FYUD 1LTGC 1J2JB 1SQBD 1OW8A 3IN6A 1IFDA 2W83C 1VQ4P 1X9VA 4YXWH 4RESB 1OVRA 1L0LJ 1KQLA 4OGQD 2WSFH 2PP6A 3Q2YA 2JKVA 2WZ7A 1VQ9P 1SQVE 3HE4A 3L75G 1RE3A 3TGUD 1DH3A 2PAJA 3EFGA 3D6YA 2ZVOB 1NU1D 1PPJD 1N7SD 5KTBA 1S4XA 1W5CE 3NTNA 4HB1A 4I1LA 2IFNA 2P58A 5AW4B 4WY4D 2M3BA 3OW2O 2KSEA 3MD0A 3U59A 3GMAA 4GOEA 3D6ZA 2RH0A 1KN7A 1IJDB 3AECC 2AXTE 2BCCJ 4Z1MH 3AEAC 3KHUA 2IBZG 1PZQA 2OTKE 1BE3E 1CI6B 3TGUE 2HPCB 2IX7C 3V6IA 5KAIE 1KQFB 2IYPA 2A06E 3AE6C 3AE3C 3E1RA 5H2FE 1N2DC 1JM0A 1OWAA 2E76B 4KHXA 1AJYA 1VQKP 2JWDA 5APSA 2W27A 1VL2A 5GTHH 4HKZH 4LLHA 2OGUA 1SQQE 3RK3B 1NTZJ 1WMKA 1CSBA 2YIUB 1EDKA 4XFJA 2HYNA 3PP5A 3H1IJ 3CWBJ 3LW5H 3CCUP 3A0HH 2C0WA 1YI2P 2UWJE 1X8YA 1OFCX 1BCCJ 2IDBA 1FZEA 1RY3A 1EC5A 3R4YA 3KQGA 3L75D 4PV1B 1L0NJ 1KYOH 1NTKK 3L36A 2KXPB 1H89A 3L74J 1LTJA 5CHXA 1W2BO 1ZMEC 3M0DA 4C46A 5KLVE 1MV8A 4U3FD 3OJAB 1SQXJ 2NPSA 1S5LX 3QWOC 1L0LG 3FGAD 1FZCC 2WSEH 2KS1B 2IZ1A 1YQ4C 4DOJA 1JY2O 2N9YB 1ZV8A 2V7QH 1LP1B 1IK9A 1JMBA 2YMKA 4PV1C 4L74A 4JF7A 1FOSE 4RO0A 1DEBA 3MUDA 2IBZD 2FYNC 1ZP0C 1YITP 1P84H 2YXRB 1KILC 2BEQD 5DJUB 1SQPK 1QVGO 3WUUA 1GD2E 4ASVA 5KLIB 2FFDA 3QH9A 3KDPB 4N3YB 3CCSP 1L4AA 5APWA 1HJBA 3RK3E 2BCCG 1AVYA 1N7SA 3SFEC 3AE8C 3CXHH 1LWUC 2JWAA 1H8AA 3EFFK 2WTYA 4IFFA 3HUSC 3A3YB 4IFMA 4PJ0H 4DT0A 1YJNP 3CI9A 2Q6QA 1GK6A 3SWKA 4EYYQ 3L70D 1FZAA 4DCKA 2WSCH 2R32A 3BATA 1S5LE 3A0BH 1JY2N 1NTZG 2J59M 1OIPA 1NOHA 1QX8A 2H89C 5GTHE 5CJ0A 1KYOI 1HH0A 1NTMD 2KK7A 3H1IG 1T3JA 1FDOA 1K05A 2GM4A 3CWBG 4HJGH 1M1JA 1NWQA 2E75D 1RH5B 1IK7A 4YPCA 1L0LD 2O01H 1TU3F 4ZNCA 3VTPC 3TSIA 1T2KC 1BCCG 3VP9A 3H1LD 2A45H 1GMJA 1VQ7P 2OARA 1L0NG 4IL6H 1OXZA 3L74G 1RQUA 1EZVG 4I2LC 4I7ZB 2OYHB 4PD4H 3V4WA 2QG4A 1KMIZ 1KYOE 2XDJA 1GL2B 3LIDA 1NTKE 1LGHB 4H0LB 1LT9B 3L71J 3GF7A 3AE2C 1LNQA 4HH2A 3IFMA 1M56D 5KLVJ 1KQSO 3N7NA 4O9BA 4UB6H 2R44A 1NAYA 4NPDA 2WPSA 3RGUA 1USEA 2QJPB 3AE4C 3CXHI 3A5TA 3W68A 1G2CB 2QE7H 1PGQA 4TT3H 3CCJP 2R3CA 3JCUE 4L76A 3HE5A 1FS0E 4H0LC 4C7NA 5AVYB 4GT1A 1LT9C 2FYUK 3CCLP 2I1JA 1SQBK 3L73E 1PP9D 1CZQA 4B86A 3PHLA 2WSFJ 1FZBA 3FXEA 1SQPE 1JCCA 2D2CC 1YTZI 3BCCJ 2W6JH 2AXTH 3T97B 1H0TB 3CCVP 3GLMA 2E74D 1FZCA 1JO5A 3GHGB 3H1ID 3CXHE 2AEFA 3CWBD 1NU1K 1N7LA 1IC2A 5KAIH 4I6MC 2Q7CA 2NPSB 2YMYA 2LXCB 3L4FA 2GUSA 1VQNP 1JTHA 3Q5RA 3CCRP 1LTAC 2QSIA 3NFQA 2NZ2A 2OYIC 2CPBA 3HTKA 1S2EA 2A06G 4AUWA 1DX7A 4EIJA 1OW7A 3H1HJ 3GHGC 1N73C 1J1EB 1JOCA 1URQC 5EFWB 1S3JA 2KP8A 2JEEA 1USDA 4NPEA 1K9MQ 4OGQB 4XA4A 4WWIA 3C8VA 2H88C 1LWUA 2DW3A 2L5GB 1GK4A 3NMDA 2FXMA 3L37A 5AW1B 1WT6A 3G6EP 2NPSD 1N7SB 3RL0C 4IL6E
chains in the Genus database with same CATH topology
3E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E7K A; 
#chains in the Genus database with same CATH topology
 2P10 A;  3CMA P;  1IFP A;  2HR3 A;  5KKZ C;  1R8E A;  2HLO A;  4WY4 B;  2O1K A;  3L71 G;  2YO2 A;  2P1J A;  2B87 B;  3P32 A;  2AEM A;  1KFN A;  2N1T C;  1X22 A;  4RKU J;  3KYQ A;  1SFC A;  3EWK A;  5KLV G;  2Q1K A;  1BGY E;  1MZ9 A;  1S1C X;  3VMX A;  1NTK J;  3B5N D;  4UB6 E;  1VQL P;  4U7J A;  1L4A D;  4K35 A;  2WPV B;  3D71 A;  3AED C;  1W2E A;  2YO3 A;  3OA7 A;  2WSE J;  1M1J B;  5DJT B;  2VRS A;  1FJP A;  1JY3 P;  3RL0 g;  3H1K E;  3G4S P;  2V7Q J;  1A02 F;  1GTW A;  3BCC G;  1KB9 D;  3OAK A;  2FYU E;  3H25 A;  1S9K D;  1SQB E;  1YHQ P;  1KB9 I;  3R2P A;  2YNY A;  1HGV A;  4H13 B;  3L73 J;  1Q2N A;  1QL1 A;  2B89 A;  5AVT B;  3KPE A;  3TYY A;  4JYC A;  5L8R J;  3CX5 D;  1SQP J;  1X79 B;  2AXC A;  2KB7 P;  3CX5 I;  1IO4 A;  3Q1M A;  1NU1 E;  3G71 P;  1DEE G;  1PPJ E;  2QM7 A;  2Z5H A;  1ZR2 A;  1S5L H;  5KJ7 C;  1PV3 A;  2WT7 A;  4BXL A;  2FY8 A;  1QGK B;  2Z5I A;  4D6T J;  1VQ5 P;  3H1H G;  5AVQ B;  2BAS A;  5M1B A;  5B5E E;  1DIP A;  4W7Z A;  3H1J J;  3L71 D;  2FKW B;  3B71 A;  3USS A;  2WSC J;  1MFZ A;  1CW5 A;  4H13 D;  2W6A A;  2WMM A;  2ZT9 B;  2WSS H;  3HD7 A;  5AW2 B;  1ZXG A;  1FJK A;  4IFD K;  2IZ0 A;  5CCH A;  2E76 C;  2KZJ A;  1K04 A;  1XTG B;  1GDT A;  1M1K Q;  3U1A A;  2NRG A;  3CC7 P;  3S9O A;  3H32 B;  1ZR4 A;  5CCG C;  3VOP A;  1FBM A;  3MZW B;  3RK3 C;  3L72 J;  1AFO A;  2RKL A;  1NTM K;  1AA0 A;  1G1I A;  2O01 J;  2YIU C;  2I1K A;  2ZYA A;  1VF5 D;  1L0L K;  2HOD A;  1GW4 A;  3BCC D;  1E5W A;  1EDJ A;  3M9Q A;  1JTH B;  1NTK G;  1URQ A;  1HJ0 A;  1PGP A;  4ZKU A;  1BSN A;  1FDM A;  3HTK B;  3V5B A;  1RF1 A;  1FOS F;  2K37 A;  1ZRT D;  2ZT9 D;  4EDF A;  3AE5 C;  3AE9 C;  3JCU H;  3RK2 D;  1RF0 A;  3L75 E;  4NPF X;  1JUN A;  2IBZ I;  5AW9 B;  1U7J A;  1GZL A;  1RE4 C;  2L91 A;  5AVZ B;  3B5N A;  4U3F E;  1SQV J;  5AW8 B;  1HBW A;  5AVS B;  1YTZ T;  2XZR A;  2K9J A;  2QJK B;  3V2Q A;  2P7J A;  3H1H D;  3L73 G;  2E75 B;  2Y9Y A;  4DZO A;  2N1T A;  1SQP G;  2WVR A;  3E7K A;  2MJZ A;  3O6Q B;  4BRY A;  1M7L A;  1EXI A;  2K3R A;  1A02 J;  1ZRT E;  3Q5S A;  1KIL D;  2N9B A;  1SQB J;  2IBZ E;  1LT1 A;  2FYZ A;  2KNC B;  4GOD A;  3RBX A;  5KLI C;  2C9L Y;  4D6T G;  1PGJ A;  3CME P;  2QJK C;  1KOR A;  1FZF A;  3I56 P;  3GG2 A;  1BE3 J;  4AQR D;  2E75 C;  3TGU J;  4AYC A;  3P8C D;  1OVV A;  3H1J G;  2QJY B;  1HVV A;  1NU1 J;  1M90 Q;  3HE4 B;  4GOF A;  2HG5 D;  3S1K A;  1NAF A;  3CCE P;  1YJW P;  5AVR B;  3WU2 H;  3AEE C;  2OTL P;  2OTJ P;  1DD3 A;  1KFM A;  1R5L A;  1SQQ J;  3GW6 A;  2KZI A;  3L70 E;  5AW5 B;  1VQO P;  1VQ8 P;  2LR2 A;  1UII A;  3L72 G;  5AVV B;  1NKN A;  1SFC D;  3VMZ A;  4H44 B;  2AEJ A;  5KJ7 A;  2A45 G;  3C9I A;  2ZYD A;  1SQX G;  1AQT A;  1YQ3 C;  1GW3 A;  1IZN B;  1K73 Q;  2P2U A;  1NTM E;  2XV5 A;  2Y0D A;  2PGD A;  2E74 B;  1P84 D;  3K5B A;  1L0L E;  2XU6 A;  3M9H A;  4W80 A;  1CI6 A;  2BCC D;  2HPC A;  4K3A A;  3H1L E;  2KSJ A;  3WMM 0;  3Q3D A;  4I7Z C;  2OYH C;  4Y99 B;  5KAF H;  1U57 A;  1JMM A;  1GU4 A;  3VP8 A;  1EQ7 A;  1NKZ B;  1GL2 C;  2QRX A;  4MN4 C;  3GF3 A;  3P8M C;  1SQV G;  2O01 N;  2GA1 A;  3CD6 P;  1WRG A;  1Q7Y Q;  3I5C A;  2XNX A;  4D6T D;  4H44 D;  1SVF A;  1JNM A;  1KZU B;  2W8Z A;  3BVH A;  3G3Z A;  2M8R A;  5APT A;  3Q5P A;  1FZG A;  3H6P A;  2E5T A;  2POH A;  1UIX A;  1NTZ D;  3H1J D;  3MGN A;  2KLU A;  1Q81 Q;  2CPS A;  1YBK A;  2QJP C;  1SQB G;  4U3F J;  2Q3E A;  5TIS H;  1LTJ B;  1Q90 D;  3UIA A;  2R3S A;  5B66 H;  3P7K A;  1EDI A;  4W7Y A;  1H88 A;  1BCC D;  1BE3 G;  2HFE D;  2D2C D;  1KQG B;  4UB8 H;  3TGU G;  1KB9 H;  1PP9 E;  1L0N D;  1KIL A;  3L72 D;  1NU1 G;  4KT0 J;  5B5E H;  3L74 D;  1EZV D;  4GDO A;  1EZV I;  1IFJ A;  1HWT C;  3HD7 D;  2KS1 A;  1SQX D;  1MKM A;  5CCH D;  1VQ6 P;  4BWN A;  3AEB C;  3CX5 H;  2KUB A;  1J1D B;  2B88 A;  1FU1 A;  2WPR A;  1LP1 A;  1HUC A;  3H1I E;  1SQQ G;  3AE1 C;  2Q3I A;  2NPS C;  3CWB E;  2FXO A;  4PD4 D;  2FFD B;  3B5N B;  1RQV A;  2P67 A;  1U7M A;  3V4Q A;  3WU2 E;  1IFN A;  3F89 A;  1L4A B;  3HUS A;  5APY A;  2WQY C;  2K9J B;  5GTI E;  3WUT A;  1KTM A;  2CK3 H;  1OVU A;  1SLQ A;  1N86 A;  1T3U A;  3F5H A;  1J1E C;  2ZAE B;  4BRY B;  1URQ D;  3LW5 J;  3L70 J;  2BEZ F;  1SQV D;  1JY2 P;  1Y9B A;  4OGQ C;  3NXS A;  1JCD A;  3CL3 D;  3TNU A;  1PFI A;  4ZKP A;  1EXJ A;  2W6B A;  2LXB A;  1L4A C;  1NVO A;  5C39 A;  1LTI C;  3JSV C;  3IR9 A;  2E5Y A;  2KOG A;  3HRN A;  4EI2 A;  2MKV A;  3SWF A;  3B8E B;  1N7S C;  1NTM J;  3RL0 D;  3U1C A;  1K8A Q;  2SPZ A;  4YTP C;  2J58 A;  4QMA A;  5KAF E;  4WY4 C;  3LIE A;  5AW6 B;  1NYH A;  2J5U A;  4A7P A;  2G8Y A;  3H1L J;  2N1T D;  1BE3 D;  2JO1 A;  1NJI Q;  3V2P A;  2GUV A;  2A06 D;  4U3F G;  2FXP A;  3S4R A;  3KXD A;  3V2N A;  4JYB A;  1OX3 A;  5TIS E;  1M1J C;  1SQQ D;  3D70 A;  2ITA A;  4OWF A;  2IFM A;  2QM8 A;  2IYO A;  4WVZ A;  2OYH A;  2W90 A;  2KYV A;  5B66 E;  2XND H;  4IOI H;  1QVF O;  5AW0 B;  2H43 A;  1SP4 A;  1GL2 A;  2KI7 B;  1RHZ B;  2JP3 A;  3PH0 A;  4UB8 E;  1KB9 E;  1M57 D;  4L75 A;  5APU A;  1LT9 A;  3E1I A;  4H13 C;  1S9K E;  1VF5 B;  1T8Z A;  2ZFC A;  2V4H A;  1PP9 J;  3A7O A;  3HE5 B;  5CBN A;  4C7N B;  3M91 A;  3CX5 E;  1FAV A;  1T6A A;  2JJL A;  5KLV D;  1G2C A;  5KJ7 D;  1YYC A;  3RK2 B;  1DD4 A;  3FWL A;  1SS1 A;  3BRT B;  1X0T A;  4DJG A;  2Y0C A;  1VF5 C;  5CMZ A;  2QA4 P;  3WUV A;  3M9B A;  3L70 G;  4YXD C;  2WIT A;  3A2A A;  1FZC B;  4WBA A;  2H8P D;  1MUU A;  3MTU E;  4M3L A;  1EDL A;  3L35 A;  2OYI A;  3T97 A;  1Z56 A;  5AW3 B;  1H0T A;  3L71 E;  2ZT9 C;  1L2P A;  1LTS C;  1NO4 A;  1Y8A A;  2PFX A;  3GHG A;  3JC2 2;  1N73 A;  1PIX A;  3RK2 C;  2E76 D;  2FYN B;  5AW7 B;  1NTM G;  1YIJ P;  2QIW A;  2ZVN B;  2O3J A;  1KIL B;  1PGO A;  5CCG D;  3G9R A;  3RK3 D;  2C0X A;  4N6J A;  3PJS K;  1JB0 J;  2K1A A;  3H1L G;  1BGY J;  4LGD E;  3FX0 A;  3VMA A;  1IFM A;  4XE5 B;  1PL5 A;  5BVZ A;  2XKM A;  1BSH A;  4CPG A;  5APV A;  1BDC A;  3FXD A;  5BU5 A;  5AVW B;  1LWU B;  1OMI A;  5APX A;  1OW6 A;  3HUS B;  3BCC E;  4JQ0 D;  2Q9I A;  3BRV B;  2JDI H;  3B4S A;  2QEX P;  2E43 A;  1JEK A;  4PV1 D;  4R4M A;  1OZH A;  3O8Z A;  3H1K J;  5TJH A;  3ITK A;  1NHL A;  2FYU J;  2WWW A;  3SWY A;  2R5B A;  1JY3 O;  1G1J A;  3MHV A;  4C7R A;  3TNU B;  2OQQ A;  2M0B A;  1NH4 A;  2YXQ B;  2KLV A;  4EOT A;  1SFC B;  3ZDM A;  2ZXE B;  5CJ4 A;  4HYT B;  1S72 P;  3PTZ A;  4WY4 A;  1MFT A;  3I55 P;  2M5A A;  2B87 A;  1NTZ K;  1GU5 A;  2Z4E A;  3II6 A;  3PLN A;  1QEX A;  4L73 A;  3H1H E;  3KZI H;  1PP9 G;  3CLQ A;  3CPW O;  5CBO A;  1KYO D;  3FWN A;  1KIL E;  4WB4 A;  2Q5U A;  4LC1 A;  1SFC C;  1NTK D;  1M8O B;  5GTI H;  1L0N K;  3VMY A;  3V2R A;  2JR8 A;  3CC2 P;  2QJY C;  3C1L A;  3RBZ A;  1SQX K;  1RE3 C;  3P8C E;  2RMZ A;  5E79 H;  3MIW A;  3A0H E;  2M3E A;  2K9Y A;  2ZJS E;  2H7H A;  1NGM B;  1Q82 Q;  3ABV C;  1HGZ A;  2Y0E A;  4JBZ A;  1BDD A;  1JY3 N;  1T2K D;  2I8D A;  3L73 D;  1P84 I;  2WT7 B;  5K5G B;  2WPQ A;  3AE7 C;  3BAS A;  1SQP D;  3IAO A;  2RN0 A;  1BGY G;  1AV1 A;  1VQM P;  4H44 C;  1AQ5 A;  2D2C B;  2R5D A;  3EQ2 A;  1SQV K;  2YKO A;  1ZLL A;  2E42 A;  1KC8 Q;  3CXH D;  2G3A A;  4JPZ B;  5CCG A;  4KJM A;  2E74 C;  3HD7 B;  3L75 J;  1ZOY C;  4ZMD A;  3H1K G;  1P84 E;  3PRJ A;  3TK1 A;  4Y99 C;  2BCC E;  1YJ9 P;  2FYU G;  2OYO A;  4GKG A;  1FDI A;  1ZW0 A;  3TDK A;  3SFD C;  1LJ2 A;  3VYI A;  1R5S A;  3TF5 A;  1Y47 A;  1GL2 D;  4IL6 X;  2LKM A;  1N8R Q;  2OYI B;  2IPP A;  4H0L D;  3M06 A;  3H32 A;  5BU8 B;  2HOD B;  2Y9Z A;  3IF4 A;  2FBW C;  3HD7 C;  2QVA A;  5AVU B;  1N73 B;  5CCH C;  1URQ B;  1XTC C;  4D6T E;  2PRR A;  1HF9 A;  3W67 A;  1PPJ G;  3N4X A;  1RF1 B;  5H2F H;  4PJ0 E;  1RE4 A;  2ZXX A;  1QL2 A;  1NTZ E;  3H1J E;  1IFI A;  3KZI E;  1LTJ C;  3MP7 B;  4ASW A;  3M0D C;  2A45 I;  1SQQ K;  3CCQ P;  1VPC A;  3A0B E;  3RL0 B;  1AVO A;  2B9B A;  3AEF C;  2ZYG A;  4PD4 I;  3AEG C;  5KKZ B;  4N78 D;  1LTB C;  4OVN F;  1E79 H;  5APQ A;  1HTL C;  1ZN5 A;  1BCC E;  2C9N Y;  1RF1 C;  1D7M A;  2KIK A;  1BGY D;  2N1T B;  1L0N E;  1QLE D;  2YKP A;  3L72 E;  3L74 E;  1EZV E;  3MUD C;  1KD1 Q;  2K88 A;  1RF0 C;  3CC4 P;  1J1D C;  5E79 E;  4GIF A;  1SQX E;  1LTT C;  4RJT A;  1KV4 A;  2O1J A;  4TLF A;  2FFD C;  3B5N C;  5KLV K;  3O6Q A;  1VDF A;  3CCM P;  1VQP P;  5AVX B;  4Y28 J;  4PD4 E;  1FC2 C;  1FE6 A;  3H1K D;  4R4L A;  1Q86 Q;  4OH8 B;  2M5A B;  3M0A A;  3SSU A;  2KNC A;  4N78 E;  3VN0 A;  2YKQ A;  2FYU D;  1LTG C;  1J2J B;  1SQB D;  1OW8 A;  3IN6 A;  1IFD A;  2W83 C;  1VQ4 P;  1X9V A;  4YXW H;  4RES B;  1OVR A;  1L0L J;  1KQL A;  4OGQ D;  2WSF H;  2PP6 A;  3Q2Y A;  2JKV A;  2WZ7 A;  1VQ9 P;  1SQV E;  3HE4 A;  3L75 G;  1RE3 A;  3TGU D;  1DH3 A;  2PAJ A;  3EFG A;  3D6Y A;  2ZVO B;  1NU1 D;  1PPJ D;  1N7S D;  5KTB A;  1S4X A;  1W5C E;  3NTN A;  4HB1 A;  4I1L A;  2IFN A;  2P58 A;  5AW4 B;  4WY4 D;  2M3B A;  3OW2 O;  2KSE A;  3MD0 A;  3U59 A;  3GMA A;  4GOE A;  3D6Z A;  2RH0 A;  1KN7 A;  1IJD B;  3AEC C;  2AXT E;  2BCC J;  4Z1M H;  3AEA C;  3KHU A;  2IBZ G;  1PZQ A;  2OTK E;  1BE3 E;  1CI6 B;  3TGU E;  2HPC B;  2IX7 C;  3V6I A;  5KAI E;  1KQF B;  2IYP A;  2A06 E;  3AE6 C;  3AE3 C;  3E1R A;  5H2F E;  1N2D C;  1JM0 A;  1OWA A;  2E76 B;  4KHX A;  1AJY A;  1VQK P;  2JWD A;  5APS A;  2W27 A;  1VL2 A;  5GTH H;  4HKZ H;  4LLH A;  2OGU A;  1SQQ E;  3RK3 B;  1NTZ J;  1WMK A;  1CSB A;  2YIU B;  1EDK A;  4XFJ A;  2HYN A;  3PP5 A;  3H1I J;  3CWB J;  3LW5 H;  3CCU P;  3A0H H;  2C0W A;  1YI2 P;  2UWJ E;  1X8Y A;  1OFC X;  1BCC J;  2IDB A;  1FZE A;  1RY3 A;  1EC5 A;  3R4Y A;  3KQG A;  3L75 D;  4PV1 B;  1L0N J;  1KYO H;  1NTK K;  3L36 A;  2KXP B;  1H89 A;  3L74 J;  1LTJ A;  5CHX A;  1W2B O;  1ZME C;  3M0D A;  4C46 A;  5KLV E;  1MV8 A;  4U3F D;  3OJA B;  1SQX J;  2NPS A;  1S5L X;  3QWO C;  1L0L G;  3FGA D;  1FZC C;  2WSE H;  2KS1 B;  2IZ1 A;  1YQ4 C;  4DOJ A;  1JY2 O;  2N9Y B;  1ZV8 A;  2V7Q H;  1LP1 B;  1IK9 A;  1JMB A;  2YMK A;  4PV1 C;  4L74 A;  4JF7 A;  1FOS E;  4RO0 A;  1DEB A;  3MUD A;  2IBZ D;  2FYN C;  1ZP0 C;  1YIT P;  1P84 H;  2YXR B;  1KIL C;  2BEQ D;  5DJU B;  1SQP K;  1QVG O;  3WUU A;  1GD2 E;  4ASV A;  5KLI B;  2FFD A;  3QH9 A;  3KDP B;  4N3Y B;  3CCS P;  1L4A A;  5APW A;  1HJB A;  3RK3 E;  2BCC G;  1AVY A;  1N7S A;  3SFE C;  3AE8 C;  3CXH H;  1LWU C;  2JWA A;  1H8A A;  3EFF K;  2WTY A;  4IFF A;  3HUS C;  3A3Y B;  4IFM A;  4PJ0 H;  4DT0 A;  1YJN P;  3CI9 A;  2Q6Q A;  1GK6 A;  3SWK A;  4EYY Q;  3L70 D;  1FZA A;  4DCK A;  2WSC H;  2R32 A;  3BAT A;  1S5L E;  3A0B H;  1JY2 N;  1NTZ G;  2J59 M;  1OIP A;  1NOH A;  1QX8 A;  2H89 C;  5GTH E;  5CJ0 A;  1KYO I;  1HH0 A;  1NTM D;  2KK7 A;  3H1I G;  1T3J A;  1FDO A;  1K05 A;  2GM4 A;  3CWB G;  4HJG H;  1M1J A;  1NWQ A;  2E75 D;  1RH5 B;  1IK7 A;  4YPC A;  1L0L D;  2O01 H;  1TU3 F;  4ZNC A;  3VTP C;  3TSI A;  1T2K C;  1BCC G;  3VP9 A;  3H1L D;  2A45 H;  1GMJ A;  1VQ7 P;  2OAR A;  1L0N G;  4IL6 H;  1OXZ A;  3L74 G;  1RQU A;  1EZV G;  4I2L C;  4I7Z B;  2OYH B;  4PD4 H;  3V4W A;  2QG4 A;  1KMI Z;  1KYO E;  2XDJ A;  1GL2 B;  3LID A;  1NTK E;  1LGH B;  4H0L B;  1LT9 B;  3L71 J;  3GF7 A;  3AE2 C;  1LNQ A;  4HH2 A;  3IFM A;  1M56 D;  5KLV J;  1KQS O;  3N7N A;  4O9B A;  4UB6 H;  2R44 A;  1NAY A;  4NPD A;  2WPS A;  3RGU A;  1USE A;  2QJP B;  3AE4 C;  3CXH I;  3A5T A;  3W68 A;  1G2C B;  2QE7 H;  1PGQ A;  4TT3 H;  3CCJ P;  2R3C A;  3JCU E;  4L76 A;  3HE5 A;  1FS0 E;  4H0L C;  4C7N A;  5AVY B;  4GT1 A;  1LT9 C;  2FYU K;  3CCL P;  2I1J A;  1SQB K;  3L73 E;  1PP9 D;  1CZQ A;  4B86 A;  3PHL A;  2WSF J;  1FZB A;  3FXE A;  1SQP E;  1JCC A;  2D2C C;  1YTZ I;  3BCC J;  2W6J H;  2AXT H;  3T97 B;  1H0T B;  3CCV P;  3GLM A;  2E74 D;  1FZC A;  1JO5 A;  3GHG B;  3H1I D;  3CXH E;  2AEF A;  3CWB D;  1NU1 K;  1N7L A;  1IC2 A;  5KAI H;  4I6M C;  2Q7C A;  2NPS B;  2YMY A;  2LXC B;  3L4F A;  2GUS A;  1VQN P;  1JTH A;  3Q5R A;  3CCR P;  1LTA C;  2QSI A;  3NFQ A;  2NZ2 A;  2OYI C;  2CPB A;  3HTK A;  1S2E A;  2A06 G;  4AUW A;  1DX7 A;  4EIJ A;  1OW7 A;  3H1H J;  3GHG C;  1N73 C;  1J1E B;  1JOC A;  1URQ C;  5EFW B;  1S3J A;  2KP8 A;  2JEE A;  1USD A;  4NPE A;  1K9M Q;  4OGQ B;  4XA4 A;  4WWI A;  3C8V A;  2H88 C;  1LWU A;  2DW3 A;  2L5G B;  1GK4 A;  3NMD A;  2FXM A;  3L37 A;  5AW1 B;  1WT6 A;  3G6E P;  2NPS D;  1N7S B;  3RL0 C;  4IL6 E; 
#chains in the Genus database with same CATH homology
 3E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...