1X79B

Crystal structure of human gga1 gat domain complexed with the gat-binding domain of rabaptin5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
90
structure length
90
Chain Sequence
b'ETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 43
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1x79B00
4N3YB 5BVZA 5KTBA 4O9BA 3BATA 3N7NA 4I1LA 4N78D 3BASA 3C9IA 4ZKUA 4GIFA 3VP9A 5BU5A 1NKNA 1IC2A 3U1AA 3OJAB 3U1CA 2POHA 3VP8A 5BU8B 1WT6A 3N4XA 3U59A 2FXMA 3P8CD 1X79B 2JEEA 4ZKPA 3HRNA
chains in the Genus database with same CATH superfamily
2K9JA 1KB9D 5CBOA 5CCHC 3G6EP 5KJ7A 1LGHB 5L8RJ 3D6YA 2JDIH 1GU5A 5CBNA 1MZ9A 2K3RA 3CMAP 2WPSA 1SQXK 1HJBA 3GHGB 3H1IJ 3L4FA 3NXSA 1PIXA 4N3YB 3O8ZA 1JY3O 2D2CB 2WQYC 4NPFX 2NRGA 3M9QA 1U57A 4Y28J 2ZYAA 2HFED 2OYOA 2HG5D 4L74A 2QJYC 3RK3B 2FYUE 3H1LJ 2E5YA 3O6QB 1YITP 1M1JA 2YKQA 5AW7B 3AEEC 5KLIC 3PTZA 2R3SA 3CCUP 2GM4A 1BSHA 2YKPA 2XNXA 1SLQA 1G2CA 3CCEP 4KHXA 5KAFH 4NPDA 1D7MA 4H13C 1YQ4C 4WB4A 3V5BA 2O3JA 5BU5A 3RL0B 1G1IA 1K04A 2W27A 1JUNA 2B87B 3H1JJ 1SQXJ 5APYA 4H44B 3P8CD 1IZNB 2PFXA 1BE3D 4GOEA 2XV5A 4C46A 1OZHA 1RH5B 4ZKUA 2H43A 1PGPA 1SQPK 3Q2YA 3VP8A 4Z1MH 2HODA 4WY4B 4PV1D 2JP3A 4Y99C 2IBZG 3LIDA 3TSIA 4EDFA 1XTGB 4WBAA 3SWYA 1KMIZ 4I2LC 4MN4C 3L70E 4PD4E 3PJSK 2W8ZA 1VPCA 1PGJA 1YIJP 2KS1B 5TISE 4YXWH 3RL0D 3HD7A 5AVVB 1SQQK 2J58A 2O1KA 1RQUA 3B5NB 4ASWA 1S3JA 1J1EB 1Y8AA 3L75G 1LTBC 4JBZA 1R5SA 3M0DA 1MUUA 2MJZA 3H1KE 2WT7A 1VQPP 2KLVA 3R4YA 3RK3C 3VMXA 2OQQA 3IAOA 2IBZE 4I6MC 4DJGA 5DJUB 1PGOA 3L74D 1KQLA 1L0NK 3MUDC 2Q9IA 1KZUB 1PV3A 2WSEJ 1NU1D 1SQPJ 1ZRTE 3T97A 2HR3A 1GL2D 1PPJD 3CC2P 2FXPA 1SQXD 3RL0C 1X8YA 3A7OA 2OGUA 2E42A 1CI6A 1ZMEC 5CJ4A 2CPSA 1HGZA 1QX8A 3IFMA 2RH0A 3CX5E 1SQQJ 2NPSB 1IFIA 3VMYA 1JMMA 1JCCA 2KB7P 1N2DC 1RF0C 2WSEH 3FGAD 4WY4C 1SQBK 1LTJC 2K9YA 1EQ7A 2JR8A 1R8EA 4PD4I 1FZGA 2AXCA 3KZIH 2QJKB 1L0LK 3E1IA 1L0NJ 1FDMA 2FYUD 3GHGA 4DZOA 4JYBA 1PZQA 3HUSB 2N9BA 2Z5HA 5KLVE 1JY2N 3BRTB 4M3LA 1M57D 3B5NC 2FFDB 3H25A 1SP4A 3KPEA 3CPWO 1Q90D 1K8AQ 2YIUB 1YTZI 1L4AD 4GDOA 1IK7A 1EDJA 5AW6B 1VF5B 5GTIE 2RMZA 5AW4B 2ZFCA 3O6QA 2W6JH 2IBZI 2LXCB 4BRYA 3FX0A 1NAYA 1FJKA 3L75J 1XTCC 1YYCA 1NO4A 1URQD 1HH0A 2PP6A 1SQBJ 1KB9E 1OW6A 3TF5A 2KSEA 2E75B 4BWNA 1L0LJ 3ITKA 2B87A 4L75A 1KQSO 1KYOI 4PD4D 1FBMA 1CW5A 3CC4P 3GMAA 2QJPB 2NPSC 1G1JA 3CX5I 1AVOA 1VF5D 1ZXGA 3A0BE 5CHXA 5AVWB 4W80A 3MP7B 1JEKA 1IFNA 2SPZA 1KYOH 2O1JA 1KQFB 5AW8B 4WY4A 3BRVB 1NTZG 3WUUA 5APUA 1NTKG 2RN0A 4AYCA 3UIAA 1L0ND 1OW8A 2Q3IA 5APXA 1NAFA 2P7JA 3TGUG 5BVZA 2QJKC 2H88C 1N8RQ 5CCGA 1QEXA 3H1HJ 1NJIQ 2R5DA 5DJTB 2KS1A 1H88A 1ZR2A 2IBZD 3HUSC 2E75D 3B5NA 4GOFA 2FFDC 5AVQB 3H1IG 1K9MQ 1VQ8P 1GDTA 3P7KA 1HBWA 1LP1B 2YMKA 2QEXP 1EDIA 2YIUC 1OXZA 2LR2A 3NTNA 1UIXA 1VF5C 5AVZB 4LC1A 1GTWA 1NTZE 3N4XA 3L75D 1JY3P 1NTKE 1KYOD 2P1JA 3HE4B 4EYYQ 1GK4A 3TGUE 2I8DA 1P84I 1YJWP 3H1LG 1Q7YQ 3CX5D 4A7PA 3SFEC 1S5LE 1VQKP 3Q5PA 1LTSC 1M56D 1Q82Q 4QMAA 3FXEA 3H1IE 1NGMB 2E75C 2OYHB 1P84H 3L37A 5KAFE 5KKZB 1R5LA 3CI9A 2QJPC 2NPSA 2BEQD 1S9KE 4N78E 3H1JG 1SQXG 1JB0J 1K05A 1FDOA 3II6A 1LWUA 3MGNA 3H1LE 1FZAA 1IFPA 3RBXA 4YTPC 1YI2P 1RHZB 4U3FJ 4KJMA 3HTKB 1H8AA 2WZ7A 5M1BA 2HPCB 3HUSA 3IR9A 4D6TJ 3I55P 1A02F 1IFMA 1MFTA 1P84D 1GZLA 1PPJE 3OW2O 2WSSH 1BDDA 2KLUA 1SS1A 2QG4A 3H1JE 4UB6H 1SQXE 2OYIB 1AVYA 1VQ6P 2HYNA 2ITAA 4Y99B 2GA1A 4R4LA 3MD0A 2OTKE 1PP9J 3GLMA 3V2RA 1N7SA 4OVNF 3BCCJ 5K5GB 1W2BO 2QM8A 3D6ZA 3CWBJ 1NTMK 1BGYJ 1X9VA 2W90A 2FXOA 1LTAC 1SQPG 4ZNCA 1FDIA 2OYHC 3H32B 5KKZC 1QL1A 1YQ3C 1WRGA 3I5CA 1Z56A 2Y0DA 4PV1B 1AQTA 1YTZT 1LT1A 2FBWC 3AEFC 1SFCA 2ZT9D 1SQQG 3QH9A 4OGQD 2NZ2A 2KUBA 5C39A 1KFMA 4RKUJ 1LTIC 4TT3H 1RE3A 1SQPE 3AE5C 3B71A 2J5UA 3GF7A 1NTZD 4IOIH 1NTKD 2V4HA 4JF7A 3KZIE 1L0NG 3TGUD 3CMEP 1NTMJ 2YXRB 2YXQB 3CXHH 4IL6X 2OYIC 2ZYGA 3L72J 1LP1A 1LTJB 5CCHA 1KILE 2GUSA 1SQQE 1S5LX 1BCCG 5AW3B 2PRRA 4HJGH 2N1TD 5APWA 3H1ID 3Q5SA 1T2KD 1USDA 1U7MA 1NWQA 2ZT9C 1QGKB 3HE4A 1GL2B 2WPVB 5AW1B 3D70A 2VRSA 2K88A 1T6AA 4U7JA 1RY3A 1S9KD 1QL2A 4N78D 1USEA 1KQGB 3C9IA 3A2AA 2JWDA 1L0NE 3C1LA 3FXDA 1RF1B 3I56P 2Y0EA 2IYPA 4K3AA 3H1LD 1SQBG 2IZ1A 5APQA 1HUCA 3H6PA 1SQVK 1FZEA 3A0HH 2BASA 1L0LG 1H0TB 4PV1C 4JPZB 1NKNA 3G3ZA 3OAKA 4WWIA 1JMBA 2JWAA 1FOSF 3H1JD 4H0LD 2L5GB 1OW7A 3M9BA 2WMMA 3L75E 4KT0J 1DD4A 1KYOE 2A45H 3M9HA 2M5AB 4W7YA 5CCGD 3HTKA 3PLNA 1SQBE 1FZCB 2HPCA 2BEZF 2OTJP 3B8EB 2I1JA 1L4AB 1BDCA 3H1HG 1GW3A 2K37A 1L0LE 4L76A 3KQGA 3F5HA 4OH8B 3CC7P 1JCDA 1JM0A 4AQRD 5APVA 1URQB 1SQVJ 4W7ZA 1KN7A 1GL2C 3SSUA 1N73B 3AE6C 1WMKA 5B66H 2WWWA 4RESB 3L73J 3MTUE 1Q86Q 1BCCJ 3AE9C 3NMDA 3H1KJ 2H89C 3H1HE 3SFDC 1RF1C 1T3UA 1S1CX 2L91A 2KSJA 3CLQA 1PGQA 1HJ0A 2ZJSE 3U59A 2WTYA 2K1AA 2ZAEB 2KIKA 1RE4C 2ZVOB 3MHVA 2W6BA 1JY3N 5APSA 2KZJA 3MUDA 1SQPD 3WU2H 1ZLLA 1P84E 2K9JB 3A5TA 4XA4A 4RJTA 2Y9YA 1S4XA 5AW9B 3TDKA 2IFNA 2G3AA 4DCKA 1SVFA 3N7NA 3L35A 2JJLA 4IFMA 3KXDA 4YXDC 3M06A 1TU3F 1KILD 3RGUA 1SQQD 1FZFA 1A02J 1FZCC 3D71A 4U3FG 3CL3D 3W68A 1MFZA 1L4AC 2P58A 1HGVA 2KK7A 2R3CA 1OVVA 2N9YB 1EXIA 2KYVA 5EFWB 3E1RA 4D6TG 1RF0A 5APTA 1FAVA 1FU1A 1LTJA 1PL5A 4BXLA 3AE1C 3F89A 5KJ7D 2BCCG 1T8ZA 1URQC 1HWTC 1IJDB 2E74D 1W2EA 4UB6E 2WSCJ 1N7SD 3L71J 1Q81Q 1N73C 2R44A 5KLVJ 2FYNC 1OIPA 1FZBA 1BCCD 1AJYA 1DD3A 1GK6A 1ZR4A 1PP9G 3GW6A 3BVHA 4U3FE 2AXTH 1KILC 4UB8H 1EZVG 1OVUA 3BCCG 1KFNA 1RF1A 2KXPB 3CWBG 3RL0g 2Z5IA 1BGYG 2JKVA 4I7ZB 2V7QJ 1RE4A 5B5EH 3AE4C 1VQ4P 1H0TA 1VDFA 2LKMA 1SQBD 2WSCH 5KJ7C 4WVZA 1YJ9P 2E74C 1SFCD 1JTHB 3TNUB 1L0LD 1PP9E 1DIPA 1E5WA 1W5CE 3BCCE 1EDKA 4C7NB 2M5AA 2O01J 4K35A 3CWBE 4XFJA 1K73Q 1BGYE 2V7QH 1L4AA 1Y9BA 2QE7H 4DT0A 1S2EA 1M1JC 3PP5A 2FY8A 4RO0A 3CCMP 3AEAC 1KB9H 3CCJP 3AE3C 3M0AA 5CCHD 1NTMG 3V2QA 3CXHE 3H1HD 2P67A 2RKLA 1BSNA 3L71D 2Y0CA 3L72G 1JNMA 3T97B 2WPRA 3EFGA 4I1LA 2CK3H 1N73A 5CJ0A 4IFDK 3CD6P 3JCUH 3HD7D 3G71P 3MZWB 3TK1A 2O01H 1IO4A 3U1AA 3V2NA 1EC5A 1CI6B 2FFDA 2OARA 2BCCJ 3Q3DA 2KZIA 5AW2B 1HTLC 4GIFA 5AVUB 3HE5B 1GMJA 1DH3A 1BE3J 4I7ZC 1OFCX 3RBZA 2A45G 2ZT9B 1NTME 3FWNA 3VMAA 4OGQB 2FXMA 2OTLP 1X79B 5GTHH 1DEBA 2B88A 1YBKA 1NU1K 3L72E 1JO5A 3Q5RA 1ZOYC 3A0HE 2ZYDA 4TLFA 2DW3A 1J1DB 1OWAA 4H13D 2KOGA 1UIIA 3HD7C 1EZVI 1LNQA 3GG2A 4NPEA 1NVOA 5CMZA 5AVSB 2HLOA 1NYHA 4IL6H 4LLHA 3M0DC 3VYIA 4HB1A 1NOHA 4PJ0H 2AEFA 5H2FH 3HRNA 1FS0E 2IFMA 2N1TB 3BATA 1CZQA 1QVGO 1S5LH 3G4SP 2KNCB 4U3FD 1T3JA 2PAJA 1IFDA 4BRYB 3C8VA 3VTPC 2AEJA 1OMIA 1X0TA 3L74J 5AVYB 2QVAA 2POHA 1LJ2A 3CXHI 1GW4A 3V6IA 2FYUK 1KORA 3L70G 1Y47A 4D6TD 1NU1J 3PH0A 1LTTC 4GT1A 3BASA 1AA0A 1SQVG 1AFOA 2BCCD 2D2CD 3P8MC 3JSVC 1IC2A 2J59M 4OWFA 2C9NY 2C0WA 2E5TA 3B4SA 5AW0B 2Y9ZA 2QIWA 2H7HA 3V4QA 2YKOA 5B66E 1QLED 1HF9A 4O9BA 3L73G 1E79H 1PP9D 1KTMA 3RK3D 4YPCA 1H89A 2P10A 5KAIH 3KHUA 3H1KG 1LTGC 1EZVD 3BCCD 2M3EA 4OGQC 5E79H 2YMYA 3CWBD 4H0LB 2GUVA 3IF4A 1BGYD 4JYCA 1FJPA 5AVRB 2QRXA 1JTHA 3TNUA 1SQVE 1FE6A 3QWOC 3WU2E 4XE5B 1J1DC 3GHGC 1LT9B 3EFFK 1OX3A 2FYUJ 2XZRA 2OYHA 1KV4A 2D2CC 2H8PD 4C7NA 3GF3A 2C0XA 3CXHD 1ZV8A 4H44D 3L73E 1BCCE 2XKMA 1Q2NA 2A06G 2IYOA 2A45I 3JC22 3CCQP 2N1TC 2JEEA 1PFIA 1T2KC 1CSBA 1DEEG 4WY4D 2WSFJ 3L36A 3PHLA 3USSA 5AW5B 2IX7C 3KYQA 2I1KA 1VQ7P 2E76B 2KP8A 1GU4A 3R2PA 2Q6QA 1NTMD 1RQVA 3B5ND 3L72D 3K5BA 3L71G 3KDPB 4GKGA 5KLVG 4H44C 2OYIA 5BU8B 2A06E 1MV8A 3CCSP 3G9RA 4ZKPA 3L70J 3HE5A 1VQMP 2AXTE 2WSFH 4UB8E 2XDJA 2WVRA 1EXJA 4AUWA 3RK2B 3WMM0 1VQ5P 5AVXB 1LWUB 2FYNB 2IPPA 4H0LC 1HVVA 1M7LA 4GODA 2E43A 2M0BA 2ZXEB 2E76D 5KTBA 5B5EE 4L73A 3S9OA 3AE7C 1KILB 5CCGC 1MKMA 1U7JA 3AE8C 1LT9C 1JOCA 3L71E 1S72P 3H32A 3LIEA 4HH2A 4ASVA 3PRJA 4PD4H 1J1EC 4ZMDA 1FC2C 3CCLP 3VN0A 4N6JA 3TYYA 2NPSD 3VMZA 5TISH 3LW5J 5KLVK 1L2PA 2E74B 2N1TA 3RK2D 1KD1Q 2KNCA 1VQ9P 1N7SB 1ZN5A 2B9BA 1M1KQ 4EIJA 2CPBA 2P2UA 2E76C 3V2PA 1M90Q 2WITA 1WT6A 2QSIA 1IK9A 2JO1A 1ZW0A 2QM7A 2G8YA 3S4RA 1AV1A 4C7RA 1KC8Q 3L70D 3LW5H 1NHLA 5TJHA 1M1JB 4JQ0D 3NFQA 2XU6A 3JCUE 2WPQA 4R4MA 2AEMA 1SQVD 3AEBC 4EI2A 3OA7A 3VOPA 3WUVA 2R32A 2Q5UA 2W6AA 1SFCB 1G2CB 3RK2C 1GL2A 1LWUC 1AQ5A 1ZP0C 3L73D 1BE3G 1QVFO 2W83C 4LGDE 1EDLA 3CX5H 1N86A 1VQNP 3H1KD 4B86A 2IZ0A 2Q3EA 5GTHE 4HYTB 3EQ2A 3MIWA 3CCRP 1LT9A 2O01N 3E7KA 2ZVNB 1JY2P 3AEGC 2FKWB 1NH4A 3W67A 4D6TE 1IFJA 2M8RA 1ZRTD 2KI7B 2BCCE 2HODB 2Q7CA 1VQLP 2XNDH 1N7LA 3EWKA 3P8CE 1YJNP 3SWKA 2QA4P 1BE3E 4IL6E 2MKVA 1NKZB 3A3YB 1N7SC 3AECC 4PJ0E 3RK3E 5H2FE 2A06D 3HD7B 2B89A 1EZVE 3VP9A 2YO3A 5GTIH 1NTZK 1M8OB 1NTKK 2Z4EA 3U1CA 1KB9I 1FZCA 2IDBA 3L74G 1FOSE 3Q1MA 1GD2E 2FYZA 5AVTB 2WT7B 3ZDMA 2QJYB 3FWLA 1YHQP 2C9LY 3IN6A 3S1KA 1NU1G 3AE2C 1VQOP 2R5BA 1VL2A 5KLIB 1PPJG 3OJAB 1J2JB 3AEDC 1DX7A 1URQA 3P32A 5KLVD 1SFCC 1X22A 4H13B 2LXBA 2ZXXA 3ABVC 3SWFA 5KAIE 4CPGA 3WUTA 1RE3C 2PGDA 4HKZH 3L74E 1KILA 3M91A 5E79E 3A0BH 3CCVP 1OVRA 2YO2A 4EOTA 2Q1KA 2YNYA 1NU1E 1NTZJ 1NTKJ 2M3BA 4DOJA 4IFFA 1JY2O 3TGUJ 2UWJE 3V4WA 2FYUG
chains in the Genus database with same CATH topology
1GDTA 3MTUE 2GUVA 4JYCA 3P7KA 5CCHC 1HBWA 1FJPA 5AVRB 3NMDA 1LGHB 5KJ7A 1JTHA 1OXZA 3TNUA 3NTNA 1GU5A 1RF1C 4XE5B 1J1DC 1T3UA 1MZ9A 3GHGC 5AVZB 4LC1A 1GTWA 1LT9B 2KSJA 3CLQA 2WPSA 1SQXK 1HJBA 3GHGB 3N4XA 3U59A 2WTYA 1JY3P 2XZRA 2OYHA 2P1JA 3L4FA 3HE4B 3NXSA 2H8PD 1RE4C 4C7NA 4N3YB 2W6BA 3O8ZA 1GK4A 1JY3O 2C0XA 1JY3N 1ZV8A 5APSA 3MUDA 1ZLLA 3M9QA 3A5TA 4XA4A 1LTSC 2XKMA 2HFED 2A45I 2HG5D 5AW9B 2N1TC 2JEEA 2IFNA 3RK3B 1T2KC 1PFIA 1SVFA 2OYHB 3N7NA 1CSBA 3L35A 4WY4D 2JJLA 3L36A 4IFMA 1M1JA 2YKQA 3L37A 5AW7B 5AW5B 2IX7C 3M06A 3KYQA 2I1KA 1KILD 3CI9A 2GM4A 2KP8A 2NPSA 1FZFA 2YKPA 1GU4A 2XNXA 1S9KE 1SLQA 4N78E 1FZCC 1A02J 3CL3D 3R2PA 1G2CA 4KHXA 1MFZA 1L4AC 4WB4A 1HGVA 3V5BA 2R3CA 3II6A 1LWUA 3MGNA 3B5ND 2KYVA 5BU5A 3RL0B 1FZAA 1G1IA 1RF0A 3KDPB 4GKGA 2W27A 5APTA 1JUNA 1FAVA 1FU1A 1LTJA 2OYIA 5BU8B 5APYA 1MV8A 3P8CD 5KJ7D 4ZKPA 1T8ZA 1URQC 3HTKB 1HWTC 1IJDB 1W2EA 3HE5A 1H8AA 2WSFH 2WZ7A 2XDJA 2XV5A 4C46A 2HPCB 4AUWA 3HUSA 3IR9A 1N7SD 4ZKUA 2H43A 1N73C 3RK2B 1A02F 3WMM0 1IFMA 5AVXB 1LWUB 1FZBA 1SQPK 1GK6A 1GZLA 3VP8A 1ZR4A 2IPPA 2HODA 4WY4B 1HVVA 1M7LA 3BVHA 2E43A 4Y99C 1KILC 3LIDA 3TSIA 2OYIB 1XTGB 2ZXEB 2HYNA 4WBAA 5KTBA 3SWYA 4I2LC 4Y99B 1KFNA 1KILB 5CCGC 3MD0A 1RF1A 1VPCA 1LT9C 1JOCA 2Z5IA 3H32A 3V2RA 3LIEA 1N7SA 3RL0D 1RE4A 4HH2A 3HD7A 5AVVB 1J1EC 1SQQK 2J58A 2O1KA 3B5NB 1J1EB 1VDFA 3VN0A 2LKMA 2QM8A 4N6JA 3TYYA 2NPSD 2WSCH 5KJ7C 1LTBC 3VMZA 3M0DA 1NTMK 1MUUA 1SFCD 1X9VA 1JTHB 2MJZA 5KLVK 3TNUB 1LTAC 2WT7A 2N1TA 3RK2D 2KLVA 3RK3C 3VMXA 2OYHC 3H32B 1N7SB 4I6MC 1E5WA 1QL1A 1ZN5A 1WRGA 1KQLA 1L0NK 4EIJA 2CPBA 4C7NB 3I5CA 1Z56A 2P2UA 2Q9IA 1KZUB 3V2PA 1YTZT 2WITA 3T97A 1WT6A 1IK9A 1GL2D 1L4AA 1SFCA 2QM7A 1KFMA 3RL0C 4C7RA 1X8YA 1LTIC 1M1JC 3A7OA 3PP5A 2E42A 1CI6A 5CJ4A 3LW5H 1NHLA 2CPSA 1HGZA 1M1JB 3NFQA 3M0AA 5CCHD 2XU6A 1RE3A 2WPQA 3V2QA 3IFMA 2P67A 3OA7A 3VOPA 2R32A 1JNMA 2NPSB 1IFIA 2Q5UA 2WPRA 3EFGA 2W6AA 4I1LA 1N73A 1SFCB 1G2CB 5CJ0A 1JMMA 3RK2C 1JCCA 3VMYA 4IFDK 4JF7A 1GL2A 1LWUC 3HD7D 1AQ5A 2KB7P 3TK1A 2O01H 1N2DC 1IO4A 3U1AA 1RF0C 2WSEH 3V2NA 4WY4C 1CI6B 1SQBK 4LGDE 1N86A 2FFDA 1LTJC 2OARA 2OYIC 1EQ7A 5AW2B 1LTJB 4B86A 5CCHA 1FZGA 2GUSA 5AW3B 1HTLC 1L0LK 4HYTB 3E1IA 3EQ2A 3MIWA 1FDMA 1LT9A 2N1TD 4GIFA 5APWA 5AVUB 3HE5B 1T2KD 3GHGA 1DH3A 1JY2P 4DZOA 1NWQA 2FKWB 4JYBA 3HE4A 1NH4A 3HUSB 1GL2B 2A45G 2N9BA 5AW1B 2VRSA 2Z5HA 1JY2N 2FXMA 1IFJA 1X79B 3BRTB 4M3LA 3B5NC 1DEBA 2M8RA 2FFDB 1NU1K 1SP4A 2HODB 3KPEA 1RY3A 1S9KD 1JO5A 1QL2A 4N78D 2Q7CA 3C9IA 1N7LA 3A2AA 3P8CE 1YTZI 1L4AD 1RF1B 5AW6B 1J1DB 1OWAA 5AW4B 2KOGA 1NKZB 2ZFCA 5APQA 3A3YB 1N7SC 1HUCA 3HD7C 3H6PA 1SQVK 3HD7B 1FJKA 1FZEA 1XTCC 2BASA 1YYCA 5CMZA 5AVSB 3VP9A 1NO4A 1URQD 2HLOA 2YO3A 1NKNA 1NTZK 1HH0A 4LLHA 2PP6A 1NTKK 3M0DC 3VYIA 2Z4EA 3U1CA 1NOHA 1FZCA 3G3ZA 1FOSE 1GD2E 2FYZA 3HRNA 3OAKA 5AVTB 2IFMA 2WT7B 2N1TB 3BATA 1CZQA 2C9LY 1FOSF 2L5GB 1T3JA 2PAJA 2R5BA 1IFDA 3M9BA 3VTPC 1FBMA 2A45H 1CW5A 3M9HA 3OJAB 4W7YA 1J2JB 2POHA 3HTKA 5AVYB 5CCGD 1GW4A 1DX7A 2FYUK 2NPSC 1URQA 1G1JA 1FZCB 3P32A 2HPCA 1SFCC 5CHXA 5AVWB 1LTTC 4GT1A 3B8EB 4W80A 3BASA 2I1JA 1L4AB 1AFOA 1GW3A 1IFNA 2O1JA 5AW8B 3P8MC 1IC2A 4WY4A 3KQGA 2J59M 3SWFA 3BRVB 4OH8B 2C9NY 5APUA 2C0WA 1RE3C 4AYCA 3UIAA 5AW0B 2H7HA 2Q3IA 3V4QA 5APXA 1KILA 3M91A 1JCDA 1NAFA 2YKOA 2P7JA 4AQRD 5BVZA 5APVA 4O9BA 5CCGA 1URQB 2YO2A 4W7ZA 2R5DA 4EOTA 2YNYA 3RK3D 1H88A 1H89A 1ZR2A 3HUSC 1GL2C 1LTGC 1N73B 2M3BA 4DOJA 3B5NA 4IFFA 1JY2O 2WWWA 2YMYA 4RESB 2FFDC 5AVQB 3V4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3Y B;  5BVZ A;  5KTB A;  4O9B A;  3BAT A;  3N7N A;  4I1L A;  4N78 D;  3BAS A;  3C9I A;  4ZKU A;  4GIF A;  3VP9 A;  5BU5 A;  1NKN A;  1IC2 A;  3U1A A;  3OJA B;  3U1C A;  2POH A;  3VP8 A;  5BU8 B;  1WT6 A;  3N4X A;  3U59 A;  2FXM A;  3P8C D;  1X79 B;  2JEE A;  4ZKP A;  3HRN A; 
#chains in the Genus database with same CATH topology
 2K9J A;  1KB9 D;  5CBO A;  5CCH C;  3G6E P;  5KJ7 A;  1LGH B;  5L8R J;  3D6Y A;  2JDI H;  1GU5 A;  5CBN A;  1MZ9 A;  2K3R A;  3CMA P;  2WPS A;  1SQX K;  1HJB A;  3GHG B;  3H1I J;  3L4F A;  3NXS A;  1PIX A;  4N3Y B;  3O8Z A;  1JY3 O;  2D2C B;  2WQY C;  4NPF X;  2NRG A;  3M9Q A;  1U57 A;  4Y28 J;  2ZYA A;  2HFE D;  2OYO A;  2HG5 D;  4L74 A;  2QJY C;  3RK3 B;  2FYU E;  3H1L J;  2E5Y A;  3O6Q B;  1YIT P;  1M1J A;  2YKQ A;  5AW7 B;  3AEE C;  5KLI C;  3PTZ A;  2R3S A;  3CCU P;  2GM4 A;  1BSH A;  2YKP A;  2XNX A;  1SLQ A;  1G2C A;  3CCE P;  4KHX A;  5KAF H;  4NPD A;  1D7M A;  4H13 C;  1YQ4 C;  4WB4 A;  3V5B A;  2O3J A;  5BU5 A;  3RL0 B;  1G1I A;  1K04 A;  2W27 A;  1JUN A;  2B87 B;  3H1J J;  1SQX J;  5APY A;  4H44 B;  3P8C D;  1IZN B;  2PFX A;  1BE3 D;  4GOE A;  2XV5 A;  4C46 A;  1OZH A;  1RH5 B;  4ZKU A;  2H43 A;  1PGP A;  1SQP K;  3Q2Y A;  3VP8 A;  4Z1M H;  2HOD A;  4WY4 B;  4PV1 D;  2JP3 A;  4Y99 C;  2IBZ G;  3LID A;  3TSI A;  4EDF A;  1XTG B;  4WBA A;  3SWY A;  1KMI Z;  4I2L C;  4MN4 C;  3L70 E;  4PD4 E;  3PJS K;  2W8Z A;  1VPC A;  1PGJ A;  1YIJ P;  2KS1 B;  5TIS E;  4YXW H;  3RL0 D;  3HD7 A;  5AVV B;  1SQQ K;  2J58 A;  2O1K A;  1RQU A;  3B5N B;  4ASW A;  1S3J A;  1J1E B;  1Y8A A;  3L75 G;  1LTB C;  4JBZ A;  1R5S A;  3M0D A;  1MUU A;  2MJZ A;  3H1K E;  2WT7 A;  1VQP P;  2KLV A;  3R4Y A;  3RK3 C;  3VMX A;  2OQQ A;  3IAO A;  2IBZ E;  4I6M C;  4DJG A;  5DJU B;  1PGO A;  3L74 D;  1KQL A;  1L0N K;  3MUD C;  2Q9I A;  1KZU B;  1PV3 A;  2WSE J;  1NU1 D;  1SQP J;  1ZRT E;  3T97 A;  2HR3 A;  1GL2 D;  1PPJ D;  3CC2 P;  2FXP A;  1SQX D;  3RL0 C;  1X8Y A;  3A7O A;  2OGU A;  2E42 A;  1CI6 A;  1ZME C;  5CJ4 A;  2CPS A;  1HGZ A;  1QX8 A;  3IFM A;  2RH0 A;  3CX5 E;  1SQQ J;  2NPS B;  1IFI A;  3VMY A;  1JMM A;  1JCC A;  2KB7 P;  1N2D C;  1RF0 C;  2WSE H;  3FGA D;  4WY4 C;  1SQB K;  1LTJ C;  2K9Y A;  1EQ7 A;  2JR8 A;  1R8E A;  4PD4 I;  1FZG A;  2AXC A;  3KZI H;  2QJK B;  1L0L K;  3E1I A;  1L0N J;  1FDM A;  2FYU D;  3GHG A;  4DZO A;  4JYB A;  1PZQ A;  3HUS B;  2N9B A;  2Z5H A;  5KLV E;  1JY2 N;  3BRT B;  4M3L A;  1M57 D;  3B5N C;  2FFD B;  3H25 A;  1SP4 A;  3KPE A;  3CPW O;  1Q90 D;  1K8A Q;  2YIU B;  1YTZ I;  1L4A D;  4GDO A;  1IK7 A;  1EDJ A;  5AW6 B;  1VF5 B;  5GTI E;  2RMZ A;  5AW4 B;  2ZFC A;  3O6Q A;  2W6J H;  2IBZ I;  2LXC B;  4BRY A;  3FX0 A;  1NAY A;  1FJK A;  3L75 J;  1XTC C;  1YYC A;  1NO4 A;  1URQ D;  1HH0 A;  2PP6 A;  1SQB J;  1KB9 E;  1OW6 A;  3TF5 A;  2KSE A;  2E75 B;  4BWN A;  1L0L J;  3ITK A;  2B87 A;  4L75 A;  1KQS O;  1KYO I;  4PD4 D;  1FBM A;  1CW5 A;  3CC4 P;  3GMA A;  2QJP B;  2NPS C;  1G1J A;  3CX5 I;  1AVO A;  1VF5 D;  1ZXG A;  3A0B E;  5CHX A;  5AVW B;  4W80 A;  3MP7 B;  1JEK A;  1IFN A;  2SPZ A;  1KYO H;  2O1J A;  1KQF B;  5AW8 B;  4WY4 A;  3BRV B;  1NTZ G;  3WUU A;  5APU A;  1NTK G;  2RN0 A;  4AYC A;  3UIA A;  1L0N D;  1OW8 A;  2Q3I A;  5APX A;  1NAF A;  2P7J A;  3TGU G;  5BVZ A;  2QJK C;  2H88 C;  1N8R Q;  5CCG A;  1QEX A;  3H1H J;  1NJI Q;  2R5D A;  5DJT B;  2KS1 A;  1H88 A;  1ZR2 A;  2IBZ D;  3HUS C;  2E75 D;  3B5N A;  4GOF A;  2FFD C;  5AVQ B;  3H1I G;  1K9M Q;  1VQ8 P;  1GDT A;  3P7K A;  1HBW A;  1LP1 B;  2YMK A;  2QEX P;  1EDI A;  2YIU C;  1OXZ A;  2LR2 A;  3NTN A;  1UIX A;  1VF5 C;  5AVZ B;  4LC1 A;  1GTW A;  1NTZ E;  3N4X A;  3L75 D;  1JY3 P;  1NTK E;  1KYO D;  2P1J A;  3HE4 B;  4EYY Q;  1GK4 A;  3TGU E;  2I8D A;  1P84 I;  1YJW P;  3H1L G;  1Q7Y Q;  3CX5 D;  4A7P A;  3SFE C;  1S5L E;  1VQK P;  3Q5P A;  1LTS C;  1M56 D;  1Q82 Q;  4QMA A;  3FXE A;  3H1I E;  1NGM B;  2E75 C;  2OYH B;  1P84 H;  3L37 A;  5KAF E;  5KKZ B;  1R5L A;  3CI9 A;  2QJP C;  2NPS A;  2BEQ D;  1S9K E;  4N78 E;  3H1J G;  1SQX G;  1JB0 J;  1K05 A;  1FDO A;  3II6 A;  1LWU A;  3MGN A;  3H1L E;  1FZA A;  1IFP A;  3RBX A;  4YTP C;  1YI2 P;  1RHZ B;  4U3F J;  4KJM A;  3HTK B;  1H8A A;  2WZ7 A;  5M1B A;  2HPC B;  3HUS A;  3IR9 A;  4D6T J;  3I55 P;  1A02 F;  1IFM A;  1MFT A;  1P84 D;  1GZL A;  1PPJ E;  3OW2 O;  2WSS H;  1BDD A;  2KLU A;  1SS1 A;  2QG4 A;  3H1J E;  4UB6 H;  1SQX E;  2OYI B;  1AVY A;  1VQ6 P;  2HYN A;  2ITA A;  4Y99 B;  2GA1 A;  4R4L A;  3MD0 A;  2OTK E;  1PP9 J;  3GLM A;  3V2R A;  1N7S A;  4OVN F;  3BCC J;  5K5G B;  1W2B O;  2QM8 A;  3D6Z A;  3CWB J;  1NTM K;  1BGY J;  1X9V A;  2W90 A;  2FXO A;  1LTA C;  1SQP G;  4ZNC A;  1FDI A;  2OYH C;  3H32 B;  5KKZ C;  1QL1 A;  1YQ3 C;  1WRG A;  3I5C A;  1Z56 A;  2Y0D A;  4PV1 B;  1AQT A;  1YTZ T;  1LT1 A;  2FBW C;  3AEF C;  1SFC A;  2ZT9 D;  1SQQ G;  3QH9 A;  4OGQ D;  2NZ2 A;  2KUB A;  5C39 A;  1KFM A;  4RKU J;  1LTI C;  4TT3 H;  1RE3 A;  1SQP E;  3AE5 C;  3B71 A;  2J5U A;  3GF7 A;  1NTZ D;  4IOI H;  1NTK D;  2V4H A;  4JF7 A;  3KZI E;  1L0N G;  3TGU D;  3CME P;  1NTM J;  2YXR B;  2YXQ B;  3CXH H;  4IL6 X;  2OYI C;  2ZYG A;  3L72 J;  1LP1 A;  1LTJ B;  5CCH A;  1KIL E;  2GUS A;  1SQQ E;  1S5L X;  1BCC G;  5AW3 B;  2PRR A;  4HJG H;  2N1T D;  5APW A;  3H1I D;  3Q5S A;  1T2K D;  1USD A;  1U7M A;  1NWQ A;  2ZT9 C;  1QGK B;  3HE4 A;  1GL2 B;  2WPV B;  5AW1 B;  3D70 A;  2VRS A;  2K88 A;  1T6A A;  4U7J A;  1RY3 A;  1S9K D;  1QL2 A;  4N78 D;  1USE A;  1KQG B;  3C9I A;  3A2A A;  2JWD A;  1L0N E;  3C1L A;  3FXD A;  1RF1 B;  3I56 P;  2Y0E A;  2IYP A;  4K3A A;  3H1L D;  1SQB G;  2IZ1 A;  5APQ A;  1HUC A;  3H6P A;  1SQV K;  1FZE A;  3A0H H;  2BAS A;  1L0L G;  1H0T B;  4PV1 C;  4JPZ B;  1NKN A;  3G3Z A;  3OAK A;  4WWI A;  1JMB A;  2JWA A;  1FOS F;  3H1J D;  4H0L D;  2L5G B;  1OW7 A;  3M9B A;  2WMM A;  3L75 E;  4KT0 J;  1DD4 A;  1KYO E;  2A45 H;  3M9H A;  2M5A B;  4W7Y A;  5CCG D;  3HTK A;  3PLN A;  1SQB E;  1FZC B;  2HPC A;  2BEZ F;  2OTJ P;  3B8E B;  2I1J A;  1L4A B;  1BDC A;  3H1H G;  1GW3 A;  2K37 A;  1L0L E;  4L76 A;  3KQG A;  3F5H A;  4OH8 B;  3CC7 P;  1JCD A;  1JM0 A;  4AQR D;  5APV A;  1URQ B;  1SQV J;  4W7Z A;  1KN7 A;  1GL2 C;  3SSU A;  1N73 B;  3AE6 C;  1WMK A;  5B66 H;  2WWW A;  4RES B;  3L73 J;  3MTU E;  1Q86 Q;  1BCC J;  3AE9 C;  3NMD A;  3H1K J;  2H89 C;  3H1H E;  3SFD C;  1RF1 C;  1T3U A;  1S1C X;  2L91 A;  2KSJ A;  3CLQ A;  1PGQ A;  1HJ0 A;  2ZJS E;  3U59 A;  2WTY A;  2K1A A;  2ZAE B;  2KIK A;  1RE4 C;  2ZVO B;  3MHV A;  2W6B A;  1JY3 N;  5APS A;  2KZJ A;  3MUD A;  1SQP D;  3WU2 H;  1ZLL A;  1P84 E;  2K9J B;  3A5T A;  4XA4 A;  4RJT A;  2Y9Y A;  1S4X A;  5AW9 B;  3TDK A;  2IFN A;  2G3A A;  4DCK A;  1SVF A;  3N7N A;  3L35 A;  2JJL A;  4IFM A;  3KXD A;  4YXD C;  3M06 A;  1TU3 F;  1KIL D;  3RGU A;  1SQQ D;  1FZF A;  1A02 J;  1FZC C;  3D71 A;  4U3F G;  3CL3 D;  3W68 A;  1MFZ A;  1L4A C;  2P58 A;  1HGV A;  2KK7 A;  2R3C A;  1OVV A;  2N9Y B;  1EXI A;  2KYV A;  5EFW B;  3E1R A;  4D6T G;  1RF0 A;  5APT A;  1FAV A;  1FU1 A;  1LTJ A;  1PL5 A;  4BXL A;  3AE1 C;  3F89 A;  5KJ7 D;  2BCC G;  1T8Z A;  1URQ C;  1HWT C;  1IJD B;  2E74 D;  1W2E A;  4UB6 E;  2WSC J;  1N7S D;  3L71 J;  1Q81 Q;  1N73 C;  2R44 A;  5KLV J;  2FYN C;  1OIP A;  1FZB A;  1BCC D;  1AJY A;  1DD3 A;  1GK6 A;  1ZR4 A;  1PP9 G;  3GW6 A;  3BVH A;  4U3F E;  2AXT H;  1KIL C;  4UB8 H;  1EZV G;  1OVU A;  3BCC G;  1KFN A;  1RF1 A;  2KXP B;  3CWB G;  3RL0 g;  2Z5I A;  1BGY G;  2JKV A;  4I7Z B;  2V7Q J;  1RE4 A;  5B5E H;  3AE4 C;  1VQ4 P;  1H0T A;  1VDF A;  2LKM A;  1SQB D;  2WSC H;  5KJ7 C;  4WVZ A;  1YJ9 P;  2E74 C;  1SFC D;  1JTH B;  3TNU B;  1L0L D;  1PP9 E;  1DIP A;  1E5W A;  1W5C E;  3BCC E;  1EDK A;  4C7N B;  2M5A A;  2O01 J;  4K35 A;  3CWB E;  4XFJ A;  1K73 Q;  1BGY E;  2V7Q H;  1L4A A;  1Y9B A;  2QE7 H;  4DT0 A;  1S2E A;  1M1J C;  3PP5 A;  2FY8 A;  4RO0 A;  3CCM P;  3AEA C;  1KB9 H;  3CCJ P;  3AE3 C;  3M0A A;  5CCH D;  1NTM G;  3V2Q A;  3CXH E;  3H1H D;  2P67 A;  2RKL A;  1BSN A;  3L71 D;  2Y0C A;  3L72 G;  1JNM A;  3T97 B;  2WPR A;  3EFG A;  4I1L A;  2CK3 H;  1N73 A;  5CJ0 A;  4IFD K;  3CD6 P;  3JCU H;  3HD7 D;  3G71 P;  3MZW B;  3TK1 A;  2O01 H;  1IO4 A;  3U1A A;  3V2N A;  1EC5 A;  1CI6 B;  2FFD A;  2OAR A;  2BCC J;  3Q3D A;  2KZI A;  5AW2 B;  1HTL C;  4GIF A;  5AVU B;  3HE5 B;  1GMJ A;  1DH3 A;  1BE3 J;  4I7Z C;  1OFC X;  3RBZ A;  2A45 G;  2ZT9 B;  1NTM E;  3FWN A;  3VMA A;  4OGQ B;  2FXM A;  2OTL P;  1X79 B;  5GTH H;  1DEB A;  2B88 A;  1YBK A;  1NU1 K;  3L72 E;  1JO5 A;  3Q5R A;  1ZOY C;  3A0H E;  2ZYD A;  4TLF A;  2DW3 A;  1J1D B;  1OWA A;  4H13 D;  2KOG A;  1UII A;  3HD7 C;  1EZV I;  1LNQ A;  3GG2 A;  4NPE A;  1NVO A;  5CMZ A;  5AVS B;  2HLO A;  1NYH A;  4IL6 H;  4LLH A;  3M0D C;  3VYI A;  4HB1 A;  1NOH A;  4PJ0 H;  2AEF A;  5H2F H;  3HRN A;  1FS0 E;  2IFM A;  2N1T B;  3BAT A;  1CZQ A;  1QVG O;  1S5L H;  3G4S P;  2KNC B;  4U3F D;  1T3J A;  2PAJ A;  1IFD A;  4BRY B;  3C8V A;  3VTP C;  2AEJ A;  1OMI A;  1X0T A;  3L74 J;  5AVY B;  2QVA A;  2POH A;  1LJ2 A;  3CXH I;  1GW4 A;  3V6I A;  2FYU K;  1KOR A;  3L70 G;  1Y47 A;  4D6T D;  1NU1 J;  3PH0 A;  1LTT C;  4GT1 A;  3BAS A;  1AA0 A;  1SQV G;  1AFO A;  2BCC D;  2D2C D;  3P8M C;  3JSV C;  1IC2 A;  2J59 M;  4OWF A;  2C9N Y;  2C0W A;  2E5T A;  3B4S A;  5AW0 B;  2Y9Z A;  2QIW A;  2H7H A;  3V4Q A;  2YKO A;  5B66 E;  1QLE D;  1HF9 A;  4O9B A;  3L73 G;  1E79 H;  1PP9 D;  1KTM A;  3RK3 D;  4YPC A;  1H89 A;  2P10 A;  5KAI H;  3KHU A;  3H1K G;  1LTG C;  1EZV D;  3BCC D;  2M3E A;  4OGQ C;  5E79 H;  2YMY A;  3CWB D;  4H0L B;  2GUV A;  3IF4 A;  1BGY D;  4JYC A;  1FJP A;  5AVR B;  2QRX A;  1JTH A;  3TNU A;  1SQV E;  1FE6 A;  3QWO C;  3WU2 E;  4XE5 B;  1J1D C;  3GHG C;  1LT9 B;  3EFF K;  1OX3 A;  2FYU J;  2XZR A;  2OYH A;  1KV4 A;  2D2C C;  2H8P D;  4C7N A;  3GF3 A;  2C0X A;  3CXH D;  1ZV8 A;  4H44 D;  3L73 E;  1BCC E;  2XKM A;  1Q2N A;  2A06 G;  2IYO A;  2A45 I;  3JC2 2;  3CCQ P;  2N1T C;  2JEE A;  1PFI A;  1T2K C;  1CSB A;  1DEE G;  4WY4 D;  2WSF J;  3L36 A;  3PHL A;  3USS A;  5AW5 B;  2IX7 C;  3KYQ A;  2I1K A;  1VQ7 P;  2E76 B;  2KP8 A;  1GU4 A;  3R2P A;  2Q6Q A;  1NTM D;  1RQV A;  3B5N D;  3L72 D;  3K5B A;  3L71 G;  3KDP B;  4GKG A;  5KLV G;  4H44 C;  2OYI A;  5BU8 B;  2A06 E;  1MV8 A;  3CCS P;  3G9R A;  4ZKP A;  3L70 J;  3HE5 A;  1VQM P;  2AXT E;  2WSF H;  4UB8 E;  2XDJ A;  2WVR A;  1EXJ A;  4AUW A;  3RK2 B;  3WMM 0;  1VQ5 P;  5AVX B;  1LWU B;  2FYN B;  2IPP A;  4H0L C;  1HVV A;  1M7L A;  4GOD A;  2E43 A;  2M0B A;  2ZXE B;  2E76 D;  5KTB A;  5B5E E;  4L73 A;  3S9O A;  3AE7 C;  1KIL B;  5CCG C;  1MKM A;  1U7J A;  3AE8 C;  1LT9 C;  1JOC A;  3L71 E;  1S72 P;  3H32 A;  3LIE A;  4HH2 A;  4ASV A;  3PRJ A;  4PD4 H;  1J1E C;  4ZMD A;  1FC2 C;  3CCL P;  3VN0 A;  4N6J A;  3TYY A;  2NPS D;  3VMZ A;  5TIS H;  3LW5 J;  5KLV K;  1L2P A;  2E74 B;  2N1T A;  3RK2 D;  1KD1 Q;  2KNC A;  1VQ9 P;  1N7S B;  1ZN5 A;  2B9B A;  1M1K Q;  4EIJ A;  2CPB A;  2P2U A;  2E76 C;  3V2P A;  1M90 Q;  2WIT A;  1WT6 A;  2QSI A;  1IK9 A;  2JO1 A;  1ZW0 A;  2QM7 A;  2G8Y A;  3S4R A;  1AV1 A;  4C7R A;  1KC8 Q;  3L70 D;  3LW5 H;  1NHL A;  5TJH A;  1M1J B;  4JQ0 D;  3NFQ A;  2XU6 A;  3JCU E;  2WPQ A;  4R4M A;  2AEM A;  1SQV D;  3AEB C;  4EI2 A;  3OA7 A;  3VOP A;  3WUV A;  2R32 A;  2Q5U A;  2W6A A;  1SFC B;  1G2C B;  3RK2 C;  1GL2 A;  1LWU C;  1AQ5 A;  1ZP0 C;  3L73 D;  1BE3 G;  1QVF O;  2W83 C;  4LGD E;  1EDL A;  3CX5 H;  1N86 A;  1VQN P;  3H1K D;  4B86 A;  2IZ0 A;  2Q3E A;  5GTH E;  4HYT B;  3EQ2 A;  3MIW A;  3CCR P;  1LT9 A;  2O01 N;  3E7K A;  2ZVN B;  1JY2 P;  3AEG C;  2FKW B;  1NH4 A;  3W67 A;  4D6T E;  1IFJ A;  2M8R A;  1ZRT D;  2KI7 B;  2BCC E;  2HOD B;  2Q7C A;  1VQL P;  2XND H;  1N7L A;  3EWK A;  3P8C E;  1YJN P;  3SWK A;  2QA4 P;  1BE3 E;  4IL6 E;  2MKV A;  1NKZ B;  3A3Y B;  1N7S C;  3AEC C;  4PJ0 E;  3RK3 E;  5H2F E;  2A06 D;  3HD7 B;  2B89 A;  1EZV E;  3VP9 A;  2YO3 A;  5GTI H;  1NTZ K;  1M8O B;  1NTK K;  2Z4E A;  3U1C A;  1KB9 I;  1FZC A;  2IDB A;  3L74 G;  1FOS E;  3Q1M A;  1GD2 E;  2FYZ A;  5AVT B;  2WT7 B;  3ZDM A;  2QJY B;  3FWL A;  1YHQ P;  2C9L Y;  3IN6 A;  3S1K A;  1NU1 G;  3AE2 C;  1VQO P;  2R5B A;  1VL2 A;  5KLI B;  1PPJ G;  3OJA B;  1J2J B;  3AED C;  1DX7 A;  1URQ A;  3P32 A;  5KLV D;  1SFC C;  1X22 A;  4H13 B;  2LXB A;  2ZXX A;  3ABV C;  3SWF A;  5KAI E;  4CPG A;  3WUT A;  1RE3 C;  2PGD A;  4HKZ H;  3L74 E;  1KIL A;  3M91 A;  5E79 E;  3A0B H;  3CCV P;  1OVR A;  2YO2 A;  4EOT A;  2Q1K A;  2YNY A;  1NU1 E;  1NTZ J;  1NTK J;  2M3B A;  4DOJ A;  4IFF A;  1JY2 O;  3TGU J;  2UWJ E;  3V4W A;  2FYU G; 
#chains in the Genus database with same CATH homology
 1GDT A;  3MTU E;  2GUV A;  4JYC A;  3P7K A;  5CCH C;  1HBW A;  1FJP A;  5AVR B;  3NMD A;  1LGH B;  5KJ7 A;  1JTH A;  1OXZ A;  3TNU A;  3NTN A;  1GU5 A;  1RF1 C;  4XE5 B;  1J1D C;  1T3U A;  1MZ9 A;  3GHG C;  5AVZ B;  4LC1 A;  1GTW A;  1LT9 B;  2KSJ A;  3CLQ A;  2WPS A;  1SQX K;  1HJB A;  3GHG B;  3N4X A;  3U59 A;  2WTY A;  1JY3 P;  2XZR A;  2OYH A;  2P1J A;  3L4F A;  3HE4 B;  3NXS A;  2H8P D;  1RE4 C;  4C7N A;  4N3Y B;  2W6B A;  3O8Z A;  1GK4 A;  1JY3 O;  2C0X A;  1JY3 N;  1ZV8 A;  5APS A;  3MUD A;  1ZLL A;  3M9Q A;  3A5T A;  4XA4 A;  1LTS C;  2XKM A;  2HFE D;  2A45 I;  2HG5 D;  5AW9 B;  2N1T C;  2JEE A;  2IFN A;  3RK3 B;  1T2K C;  1PFI A;  1SVF A;  2OYH B;  3N7N A;  1CSB A;  3L35 A;  4WY4 D;  2JJL A;  3L36 A;  4IFM A;  1M1J A;  2YKQ A;  3L37 A;  5AW7 B;  5AW5 B;  2IX7 C;  3M06 A;  3KYQ A;  2I1K A;  1KIL D;  3CI9 A;  2GM4 A;  2KP8 A;  2NPS A;  1FZF A;  2YKP A;  1GU4 A;  2XNX A;  1S9K E;  1SLQ A;  4N78 E;  1FZC C;  1A02 J;  3CL3 D;  3R2P A;  1G2C A;  4KHX A;  1MFZ A;  1L4A C;  4WB4 A;  1HGV A;  3V5B A;  2R3C A;  3II6 A;  1LWU A;  3MGN A;  3B5N D;  2KYV A;  5BU5 A;  3RL0 B;  1FZA A;  1G1I A;  1RF0 A;  3KDP B;  4GKG A;  2W27 A;  5APT A;  1JUN A;  1FAV A;  1FU1 A;  1LTJ A;  2OYI A;  5BU8 B;  5APY A;  1MV8 A;  3P8C D;  5KJ7 D;  4ZKP A;  1T8Z A;  1URQ C;  3HTK B;  1HWT C;  1IJD B;  1W2E A;  3HE5 A;  1H8A A;  2WSF H;  2WZ7 A;  2XDJ A;  2XV5 A;  4C46 A;  2HPC B;  4AUW A;  3HUS A;  3IR9 A;  1N7S D;  4ZKU A;  2H43 A;  1N73 C;  3RK2 B;  1A02 F;  3WMM 0;  1IFM A;  5AVX B;  1LWU B;  1FZB A;  1SQP K;  1GK6 A;  1GZL A;  3VP8 A;  1ZR4 A;  2IPP A;  2HOD A;  4WY4 B;  1HVV A;  1M7L A;  3BVH A;  2E43 A;  4Y99 C;  1KIL C;  3LID A;  3TSI A;  2OYI B;  1XTG B;  2ZXE B;  2HYN A;  4WBA A;  5KTB A;  3SWY A;  4I2L C;  4Y99 B;  1KFN A;  1KIL B;  5CCG C;  3MD0 A;  1RF1 A;  1VPC A;  1LT9 C;  1JOC A;  2Z5I A;  3H32 A;  3V2R A;  3LIE A;  1N7S A;  3RL0 D;  1RE4 A;  4HH2 A;  3HD7 A;  5AVV B;  1J1E C;  1SQQ K;  2J58 A;  2O1K A;  3B5N B;  1J1E B;  1VDF A;  3VN0 A;  2LKM A;  2QM8 A;  4N6J A;  3TYY A;  2NPS D;  2WSC H;  5KJ7 C;  1LTB C;  3VMZ A;  3M0D A;  1NTM K;  1MUU A;  1SFC D;  1X9V A;  1JTH B;  2MJZ A;  5KLV K;  3TNU B;  1LTA C;  2WT7 A;  2N1T A;  3RK2 D;  2KLV A;  3RK3 C;  3VMX A;  2OYH C;  3H32 B;  1N7S B;  4I6M C;  1E5W A;  1QL1 A;  1ZN5 A;  1WRG A;  1KQL A;  1L0N K;  4EIJ A;  2CPB A;  4C7N B;  3I5C A;  1Z56 A;  2P2U A;  2Q9I A;  1KZU B;  3V2P A;  1YTZ T;  2WIT A;  3T97 A;  1WT6 A;  1IK9 A;  1GL2 D;  1L4A A;  1SFC A;  2QM7 A;  1KFM A;  3RL0 C;  4C7R A;  1X8Y A;  1LTI C;  1M1J C;  3A7O A;  3PP5 A;  2E42 A;  1CI6 A;  5CJ4 A;  3LW5 H;  1NHL A;  2CPS A;  1HGZ A;  1M1J B;  3NFQ A;  3M0A A;  5CCH D;  2XU6 A;  1RE3 A;  2WPQ A;  3V2Q A;  3IFM A;  2P67 A;  3OA7 A;  3VOP A;  2R32 A;  1JNM A;  2NPS B;  1IFI A;  2Q5U A;  2WPR A;  3EFG A;  2W6A A;  4I1L A;  1N73 A;  1SFC B;  1G2C B;  5CJ0 A;  1JMM A;  3RK2 C;  1JCC A;  3VMY A;  4IFD K;  4JF7 A;  1GL2 A;  1LWU C;  3HD7 D;  1AQ5 A;  2KB7 P;  3TK1 A;  2O01 H;  1N2D C;  1IO4 A;  3U1A A;  1RF0 C;  2WSE H;  3V2N A;  4WY4 C;  1CI6 B;  1SQB K;  4LGD E;  1N86 A;  2FFD A;  1LTJ C;  2OAR A;  2OYI C;  1EQ7 A;  5AW2 B;  1LTJ B;  4B86 A;  5CCH A;  1FZG A;  2GUS A;  5AW3 B;  1HTL C;  1L0L K;  4HYT B;  3E1I A;  3EQ2 A;  3MIW A;  1FDM A;  1LT9 A;  2N1T D;  4GIF A;  5APW A;  5AVU B;  3HE5 B;  1T2K D;  3GHG A;  1DH3 A;  1JY2 P;  4DZO A;  1NWQ A;  2FKW B;  4JYB A;  3HE4 A;  1NH4 A;  3HUS B;  1GL2 B;  2A45 G;  2N9B A;  5AW1 B;  2VRS A;  2Z5H A;  1JY2 N;  2FXM A;  1IFJ A;  1X79 B;  3BRT B;  4M3L A;  3B5N C;  1DEB A;  2M8R A;  2FFD B;  1NU1 K;  1SP4 A;  2HOD B;  3KPE A;  1RY3 A;  1S9K D;  1JO5 A;  1QL2 A;  4N78 D;  2Q7C A;  3C9I A;  1N7L A;  3A2A A;  3P8C E;  1YTZ I;  1L4A D;  1RF1 B;  5AW6 B;  1J1D B;  1OWA A;  5AW4 B;  2KOG A;  1NKZ B;  2ZFC A;  5APQ A;  3A3Y B;  1N7S C;  1HUC A;  3HD7 C;  3H6P A;  1SQV K;  3HD7 B;  1FJK A;  1FZE A;  1XTC C;  2BAS A;  1YYC A;  5CMZ A;  5AVS B;  3VP9 A;  1NO4 A;  1URQ D;  2HLO A;  2YO3 A;  1NKN A;  1NTZ K;  1HH0 A;  4LLH A;  2PP6 A;  1NTK K;  3M0D C;  3VYI A;  2Z4E A;  3U1C A;  1NOH A;  1FZC A;  3G3Z A;  1FOS E;  1GD2 E;  2FYZ A;  3HRN A;  3OAK A;  5AVT B;  2IFM A;  2WT7 B;  2N1T B;  3BAT A;  1CZQ A;  2C9L Y;  1FOS F;  2L5G B;  1T3J A;  2PAJ A;  2R5B A;  1IFD A;  3M9B A;  3VTP C;  1FBM A;  2A45 H;  1CW5 A;  3M9H A;  3OJA B;  4W7Y A;  1J2J B;  2POH A;  3HTK A;  5AVY B;  5CCG D;  1GW4 A;  1DX7 A;  2FYU K;  2NPS C;  1URQ A;  1G1J A;  1FZC B;  3P32 A;  2HPC A;  1SFC C;  5CHX A;  5AVW B;  1LTT C;  4GT1 A;  3B8E B;  4W80 A;  3BAS A;  2I1J A;  1L4A B;  1AFO A;  1GW3 A;  1IFN A;  2O1J A;  5AW8 B;  3P8M C;  1IC2 A;  4WY4 A;  3KQG A;  2J59 M;  3SWF A;  3BRV B;  4OH8 B;  2C9N Y;  5APU A;  2C0W A;  1RE3 C;  4AYC A;  3UIA A;  5AW0 B;  2H7H A;  2Q3I A;  3V4Q A;  5APX A;  1KIL A;  3M91 A;  1JCD A;  1NAF A;  2YKO A;  2P7J A;  4AQR D;  5BVZ A;  5APV A;  4O9B A;  5CCG A;  1URQ B;  2YO2 A;  4W7Z A;  2R5D A;  4EOT A;  2YNY A;  3RK3 D;  1H88 A;  1H89 A;  1ZR2 A;  3HUS C;  1GL2 C;  1LTG C;  1N73 B;  2M3B A;  4DOJ A;  3B5N A;  4IFF A;  1JY2 O;  2WWW A;  2YMY A;  4RES B;  2FFD C;  5AVQ B;  3V4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...