1X79B

Crystal structure of human gga1 gat domain complexed with the gat-binding domain of rabaptin5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
90
structure length
90
Chain Sequence
ETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA1
total genus 43
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1x79B00
1NKNA 3BATA 5BU8B 4GIFA 1IC2A 4N3YB 3U1CA 4O9BA 2JEEA 3P8CD 3OJAB 4ZKUA 3VP9A 5KTBA 2FXMA 3U1AA 3N4XA 4I1LA 4N78D 5BVZA 2POHA 3VP8A 4ZKPA 1X79B 3BASA 3C9IA 5BU5A 3N7NA 3HRNA 3U59A 1WT6A
chains in the Genus database with same CATH superfamily
3H32B 1SQQJ 1KN7A 2K9JA 4MN4C 2E75B 1U57A 3HE4B 1HBWA 4LC1A 1N7SD 2WSEH 3AEFC 1K04A 2BCCD 2V7QJ 2Z5IA 2Y9ZA 5TISE 1IJDB 4H13B 1YQ4C 4XFJA 2NPSA 3CCMP 1L4AA 2H8PD 1T8ZA 2ZT9D 1JMBA 1ZRTE 2QVAA 2FFDA 3A7OA 3L75G 1PP9D 1QEXA 2IYOA 3PTZA 1LJ2A 1MV8A 1SQQG 2P10A 3L71E 4H44D 4JYCA 4PD4I 4Y99B 2IDBA 5AVSB 3C8VA 2OYHA 2B87B 3H1LJ 3CPWO 5GTIE 3PRJA 4IFDK 1SFCD 1PGQA 1VL2A 5B5EH 3HUSC 1SQVD 1BE3G 1JCDA 2I1KA 2ITAA 4H0LB 2JJLA 2V4HA 3Q5RA 1VQ9P 1DEBA 1VPCA 3N7NA 4NPDA 2P67A 1YJ9P 3CCJP 3VMZA 2Q5UA 1K73Q 1KQSO 3L74G 4EIJA 2KZIA 5B5EE 1NKZB 3CCRP 3KYQA 1SQPE 5AVUB 4GOFA 2O01J 2Y0CA 1SQPK 2R5BA 2YKPA 3FGAD 3BVHA 1MFTA 1NU1G 3W67A 2LXCB 4PD4E 4EDFA 5TJHA 1MZ9A 1URQC 1KFNA 1N86A 5AW2B 4I6MC 4OGQC 1KORA 3R4YA 4PV1C 1OW7A 2QJYB 2LR2A 2FYUD 3FWNA 1BDDA 2WPQA 4ZKPA 1KQGB 3RK3E 3GF3A 3PH0A 2GUSA 1S4XA 3L73E 1AA0A 4JBZA 2E74B 3TYYA 1M8OB 2Q1KA 1HH0A 3AE5C 1IFNA 1NTKD 2I1JA 1FBMA 1HGZA 2OYOA 2RN0A 3L72J 4QMAA 3SWKA 4BRYA 3B5NA 1M57D 2O3JA 2K88A 2KK7A 1DEEG 2XKMA 4YTPC 2RH0A 3TF5A 2I8DA 4BWNA 2WQYC 2JEEA 3P8MC 3PLNA 1BCCE 1L0ND 3VMAA 5AW6B 3IFMA 2KS1A 2MKVA 2WSCH 3A0BH 3IF4A 3MUDA 3B5NB 3L71G 1OIPA 1HGVA 3TNUA 4PD4D 3O8ZA 4YPCA 1SQPG 4N6JA 1DD3A 3KDPB 1RF0C 1W5CE 3P32A 3HD7D 4L73A 2QJYC 1FU1A 1LTAC 1L0NJ 2W90A 2O01N 3H1HE 1URQA 2WWWA 3JSVC 1TU3F 3HTKB 3LW5J 5APSA 4GKGA 2RMZA 1QL2A 3L70D 2WPSA 2D2CB 4HJGH 4PV1B 1VF5C 1FS0E 1BGYG 2E75C 2K1AA 2K37A 1HTLC 1S5LX 2B89A 1NTZD 3GHGB 3H1ID 2WITA 1HF9A 1NHLA 1P84E 3MTUE 1URQB 1ZR4A 1H0TB 2ZVOB 3BCCJ 3G9RA 1LTTC 1LWUB 1NTKE 5GTHH 1PFIA 2IBZD 1L0LD 1IFPA 2NPSD 3L73G 3H1JE 1JO5A 1N7LA 2W6JH 3GHGA 5KKZC 2WPRA 1VF5D 1NTZJ 3L37A 1H0TA 4OVNF 1QL1A 2H43A 3RK2B 1SFCA 2WZ7A 2FYUE 5APVA 5KAFE 3F89A 3KZIE 4U3FE 1L0LJ 3VMYA 2YIUB 1YTZT 1FZEA 3RK3D 2ZYDA 3OA7A 1QVGO 1DX7A 5AVYB 5KJ7C 1X22A 1GW4A 2R5DA 4NPEA 2K3RA 3OW2O 2OYIA 5AW8B 1HWTC 3TDKA 1JY3O 5K5GB 1CI6B 1KQLA 4U3FJ 1ZLLA 1G2CB 2A45G 2FYUJ 3EFGA 3RL0g 1PP9J 2UWJE 3QH9A 1N2DC 1Z56A 4OH8B 2QIWA 1J1DB 1GZLA 2HPCA 1NTZE 1RF1A 1NTKG 4Y28J 1P84D 1XTGB 3CI9A 1T3UA 2QSIA 1DD4A 3H1KE 3QWOC 2OQQA 4JF7A 1PGOA 1M56D 3FX0A 4H44C 5L8RJ 2E76C 1NTKJ 2Y0EA 2FBWC 4EI2A 5KAFH 3AE9C 1NU1D 5KJ7A 2E42A 1J1EC 3E1IA 4IFFA 1BDCA 2FYUG 3H32A 3KQGA 4GT1A 4GOEA 1YJNP 3BRTB 5CCGA 1WMKA 2N1TB 4WWIA 1K05A 3JCUH 1N7SC 3MIWA 3L70E 1HJBA 2A06G 2Q3IA 1LTJA 2B9BA 2J59M 4PV1D 5CCGD 5TISH 4WY4A 1JTHB 1D7MA 3L74D 3RGUA 1NU1J 3U59A 5AW7B 1SQXK 2R3SA 2VRSA 3HUSA 1M1JC 3V6IA 2QJPC 3L36A 1JY2O 4JPZB 1GL2A 2Q9IA 1LTJB 1LT9A 3S9OA 1OMIA 3SFEC 3CC7P 3D6ZA 1IC2A 3V4QA 3Q2YA 2HODA 4HH2A 2OYHC 4IL6H 5M1BA 3L74J 1A02J 1EDKA 1DH3A 4WVZA 3RK2D 3AECC 2ZYAA 3WUUA 1FDIA 2FXMA 5KLIC 3V2QA 4C46A 2KI7B 1BGYD 3A3YB 3H1IG 3CMAP 1RHZB 3HD7A 4W7YA 3V5BA 3L72E 1KILC 2HODB 3CC2P 2O1JA 2IX7C 2AEJA 3E1RA 4IL6E 4N78D 3VOPA 3SSUA 1EDIA 2SPZA 1L0LG 2ZFCA 1VQ5P 1SQVK 3H1KJ 1SQQK 1GL2C 1EZVG 1NOHA 1Y9BA 3NMDA 4L76A 3SWYA 3T97A 3H1JG 2JP3A 4I2LC 3AEBC 1EC5A 3FXEA 4IL6X 2E5YA 2C9LY 2XZRA 4R4MA 4UB8E 4CPGA 3O6QB 1NO4A 2C0WA 3L74E 1KB9D 4ZMDA 3M91A 1GTWA 3JC22 1FDOA 1KMIZ 5AW4B 3CXHH 2OARA 2H89C 2XNDH 2YNYA 5APQA 1FZGA 4W80A 1L4AD 3GG2A 2E76B 2KUBA 4ZKUA 2KLVA 1NU1E 1UIXA 1NTMK 2HLOA 5KAIE 1VQNP 1RE4C 4BXLA 4AQRD 1S72P 3V4WA 4NPFX 3L70J 2L91A 1JY3N 1KB9I 1L0NG 4GODA 3TGUE 3CX5H 1IFDA 2KZJA 2M0BA 2AXCA 2P2UA 2BCCJ 4YXDC 2OYIB 2CPSA 1ZMEC 3RBZA 4BRYB 1K9MQ 3I55P 3VYIA 1G2CA 1R5LA 1IFIA 1Y8AA 1KYOI 2YMKA 5DJUB 1FZCC 1A02F 1HVVA 3B5NC 3ABVC 3UIAA 3V2PA 2RKLA 1KILA 3B8EB 3Q5SA 2QM7A 1T3JA 3TK1A 1RF1B 2H7HA 3BCCE 2Y0DA 1GW3A 3NFQA 1YIJP 3AEAC 3BATA 3GMAA 1GK6A 2W8ZA 2C9NY 2B88A 1AVYA 5E79H 2BCCE 1JCCA 1K8AQ 2WSSH 1JEKA 1OW8A 3TGUJ 2KYVA 3CLQA 3CWBD 1DIPA 1UIIA 4DT0A 2M8RA 1ZRTD 1SQBK 2D2CD 3IN6A 2FYZA 1G1JA 1X8YA 3AEGC 3AE4C 2GA1A 2MJZA 1JOCA 3BCCG 3L71D 3L72D 4W7ZA 2IZ0A 1FZCB 5KAIH 2FY8A 3G4SP 5B66E 2IYPA 2XDJA 1SQQE 2D2CC 2OTLP 3VP8A 2QE7H 4DOJA 2A06D 1KZUB 1OZHA 5GTHE 2QEXP 4ZNCA 3CXHI 3H25A 4UB6E 1EZVE 1R8EA 1GMJA 1LT9B 2JKVA 3H1KG 2HR3A 4L75A 4M3LA 2XV5A 1CZQA 1NAYA 3IAOA 3WMM0 3H1JJ 2OGUA 1VQ4P 3HE5B 3KPEA 3B4SA 1KQFB 1NKNA 2R44A 4ASWA 2FFDB 5AVWB 2O1KA 3A0BE 3BCCD 3L72G 5KLVK 3FXDA 3CX5I 1KB9H 4AYCA 2A45H 2FYNC 1LTIC 1AJYA 3I5CA 1JB0J 1BE3J 1LTSC 5CHXA 1U7JA 2E5TA 2NZ2A 3AE7C 3P8CD 4A7PA 1AQ5A 1FE6A 4XE5B 1FOSE 1YBKA 1JMMA 1S5LE 2O01H 1BE3D 1N73C 1BCCD 1L0NE 1L0NK 3H1HJ 3N4XA 4HYTB 1YQ3C 1ZOYC 3IR9A 4K35A 5AVQB 5AW3B 1S5LH 3TSIA 2E74C 4WY4C 3E7KA 3MGNA 5AVTB 1NTMG 3AE8C 1VQPP 2BCCG 2OTJP 1GD2E 4LGDE 5AVZB 4DZOA 1SQQD 2CPBA 2JWAA 2NPSB 2QJKC 3A2AA 1Q90D 3L75D 4OWFA 2A06E 5B66H 1KD1Q 2HPCB 2N1TD 2WSFJ 3G3ZA 1BCCJ 1ZN5A 3H6PA 5KLVD 1RQUA 3CMEP 1IFJA 3EQ2A 2KOGA 1BGYJ 4HKZH 4D6TJ 1PV3A 1VF5B 3CWBE 2R32A 1M1JB 4TT3H 3M9HA 1AFOA 1LNQA 3GW6A 1NVOA 3L70G 5APUA 3U1CA 2PFXA 5AW9B 4JYBA 1T2KC 3VN0A 5APWA 2KIKA 2IBZE 3VP9A 5KLVG 1L0LK 1IFMA 3L73J 2GUVA 3R2PA 4WB4A 5AVXB 1W2BO 3H1LE 1JTHA 3C1LA 3CCVP 2H88C 2J5UA 3RL0D 2HFED 2WTYA 3NTNA 2Q6QA 2W83C 1AV1A 4D6TG 1PP9E 3H1HD 2N9YB 2WSCJ 1EZVD 2YO2A 3M0AA 3CD6P 1GL2B 1CW5A 2IFNA 3S1KA 1NJIQ 5APYA 1KC8Q 4H44B 1VQLP 3CXHD 5GTIH 4C7NA 1M90Q 1QX8A 1KTMA 3HRNA 1KFMA 3D71A 1YITP 3CC4P 4KT0J 1N8RQ 4RKUJ 3W68A 2KS1B 2AEMA 2V7QH 2AXTH 1HJ0A 5KLIB 2WT7B 2IBZI 1SQPJ 1L0LE 1L4AC 1ZXGA 1EZVI 2ZXEB 3AEEC 2PGDA 3CX5D 3CCQP 1P84H 1RE4A 1VQ6P 1BSHA 1OVVA 1KV4A 2BASA 1LT1A 2FXPA 1SQPD 5CJ4A 3ZDMA 1H8AA 1YI2P 1E5WA 3A0HE 3RK3B 2GM4A 1YJWP 1LT9C 3H1KD 2Y9YA 4OGQB 1FJKA 5CMZA 2YIUC 3AE3C 2KP8A 5CCHC 1S1CX 3HE5A 5BVZA 1EDLA 2IPPA 1SQVE 4L74A 2G8YA 1H89A 1X9VA 1BSNA 1USDA 3B71A 2E43A 1L2PA 2QG4A 2R3CA 2LKMA 5KLVE 1GK4A 2HYNA 1KYOH 2PP6A 2YXRB 2JR8A 5BU5A 1KILD 3KHUA 1Q81Q 3D6YA 4RESB 1G1IA 3PHLA 5CBOA 5H2FE 3L4FA 1SFCB 5KJ7D 2HG5D 5CBNA 2FFDC 4PJ0H 1IO4A 3GHGC 5EFWB 1LTGC 1J1EB 3L75J 3WU2H 1PGPA 1Q86Q 3GF7A 2IFMA 4O9BA 1OVRA 3CX5E 3TGUG 2LXBA 2NRGA 3AE6C 1RE3A 2A45I 3M9BA 2P58A 5APXA 3WU2E 3SWFA 1Q7YQ 1KILB 1SVFA 3P7KA 4I7ZC 5H2FH 3D70A 1VQ8P 1QLED 4R4LA 2Q3EA 2FXOA 2AEFA 2XNXA 4JQ0D 1PP9G 2OTKE 1LWUA 1FZBA 1RQVA 2NPSC 1T2KD 1RH5B 3CXHE 1SQVG 2Q7CA 4IFMA 2OYIC 3M9QA 3CCUP 2JO1A 1PIXA 1L4AB 3L73D 1Q2NA 4EOTA 1N73A 1S3JA 2ZXXA 3C9IA 4B86A 5CCHD 3Q5PA 2IBZG 3M0DC 2ZJSE 2E75D 4ASVA 1XTCC 1YYCA 2M5AB 1S9KD 2E76D 1JY3P 3II6A 3M06A 2KB7P 3MD0A 1OX3A 1SQXE 3S4RA 5KKZB 2B87A 2YXQB 1X0TA 3LIEA 1N73B 1NTMJ 2FYNB 1NTZK 3G71P 3WUVA 1FDMA 5APTA 2N1TA 2N9BA 3H1HG 1LWUC 2G3AA 2YMYA 4TLFA 2E74D 3V2RA 3VMXA 3JCUE 1Y47A 3RL0B 4PJ0E 1JY2N 1FAVA 1ZR2A 1QVFO 1JUNA 1MFZA 4YXWH 5CCGC 1CI6A 2C0XA 2L5GB 2WSFH 3EWKA 4C7NB 1IK9A 1RY3A 2BEQD 2W6BA 4U3FG 4UB6H 3K5BA 1VQMP 3MHVA 3PP5A 1EXIA 2XU6A 4U7JA 3V2NA 1SQBG 2P7JA 1VQOP 1KYOE 4D6TD 3KZIH 4RJTA 1X79B 2KXPB 4U3FD 5CJ0A 5DJTB 1KILE 2ZVNB 5AW5B 3RK3C 2WT7A 1EDJA 1J1DC 2FYUK 1PZQA 1S2EA 2JWDA 1NGMB 3H1IE 3A5TA 1KB9E 1WT6A 3H1LG 1FC2C 3RL0C 1N7SA 1OFCX 1SQVJ 1E79H 1IK7A 1NH4A 3HD7B 1S9KE 1JY2P 3EFFK 2QJKB 4KHXA 1MKMA 2W27A 3FWLA 1LP1B 1PL5A 1PPJD 2QJPB 4N3YB 3L71J 1NTKK 3H1IJ 2KSEA 1WRGA 2ZYGA 3H1JD 1NTMD 5E79E 4WY4B 1SQBD 4AUWA 3OAKA 4GDOA 1RF0A 2K9JB 3MZWB 1BCCG 2FKWB 3T97B 3HUSB 3U1AA 4PD4H 3TGUD 1JM0A 1RF1C 4I1LA 1OW6A 2N1TC 2WSEJ 4RO0A 1AVOA 1CSBA 1NU1K 3A0HH 4Y99C 3RBXA 4C7RA 3HD7C 1M1JA 1OWAA 2W6AA 1JNMA 3CCLP 2QA4P 1VQ7P 1KYOD 4WY4D 2YKQA 3WUTA 1NYHA 1SS1A 2KNCA 2OYHB 1SQXD 3CL3D 3KXDA 1YTZI 3ITKA 2AXTE 1OVUA 3Q1MA 4DJGA 4HB1A 5C39A 4LLHA 5BU8B 1FZFA 3B5ND 3CCEP 3AEDC 1R5SA 4GIFA 4DCKA 1SFCC 3MUDC 2KNCB 3Q3DA 2CK3H 3HTKA 1PPJE 2QM8A 2Z4EA 2PRRA 3OJAB 4UB8H 5KTBA 1MUUA 3O6QA 1USEA 1IZNB 3P8CE 3I56P 1FJPA 1T6AA 1AQTA 1EQ7A 3AE1C 2ZT9C 3CWBJ 4D6TE 1SQBJ 1BGYE 2J58A 4WBAA 2YKOA 2WMMA 1YHQP 1Q82Q 2M5AA 2POHA 2IZ1A 1SP4A 2BEZF 1EXJA 4N78E 2M3EA 3BASA 2QRXA 3AE2C 5AVRB 1GU5A 1OXZA 1ZW0A 2KLUA 1P84I 5CCHA 4OGQD 1FZAA 1FOSF 1H88A 1GU4A 3PJSK 1M7LA 3L75E 2DW3A 1URQD 2PAJA 1U7MA 1SQXG 5AW1B 4H0LD 1FZCA 1ZP0C 3CWBG 4K3AA 1RE3C 1J2JB 1NTME 1GL2D 1SQBE 3USSA 2YO3A 4H13C 1NTZG 1SQXJ 2M3BA 1PPJG 2Z5HA 3NXSA 1QGKB 4KJMA 4I7ZB 5KLVJ 1BE3E 5AVVB 4IOIH 3CCSP 2WPVB 3MP7B 3GLMA 1LTJC 3F5HA 1NAFA 3H1LD 3LW5H 1PGJA 3RK2C 5AW0B 3LIDA 1N7SB 2ZT9B 3M0DA 3BRVB 1ZV8A 1LTBC 2KSJA 1VDFA 3L35A 3VTPC 4H13D 1LGHB 3SFDC 4Z1MH 1VQKP 1W2EA 3HE4A 4EYYQ 1LP1A 2P1JA 2JDIH 4XA4A 2WVRA 1SLQA 3TNUB 3G6EP 1GDTA 2K9YA 4H0LC 1HUCA 2ZAEB 1NWQA 1M1KQ
chains in the Genus database with same CATH topology
3H32B 1HBWA 3HE4B 4LC1A 1N7SD 2WSEH 2Z5IA 1IJDB 2NPSA 1L4AA 2H8PD 1T8ZA 2FFDA 3A7OA 1MV8A 4Y99B 2OYHA 4JYCA 5AVSB 4IFDK 1SFCD 3HUSC 1JCDA 2I1KA 2JJLA 1DEBA 1VPCA 3N7NA 2P67A 3VMZA 2Q5UA 1NKZB 3KYQA 5AVUB 1SQPK 2R5BA 2YKPA 3BVHA 1MZ9A 1URQC 1KFNA 1N86A 5AW2B 4I6MC 2WPQA 4ZKPA 2GUSA 3TYYA 1HH0A 1IFNA 2I1JA 1FBMA 1HGZA 3B5NA 2XKMA 2JEEA 3P8MC 5AW6B 3IFMA 2WSCH 3MUDA 3B5NB 3TNUA 1HGVA 3O8ZA 4N6JA 3KDPB 1RF0C 3P32A 3HD7D 1FU1A 1LTAC 1URQA 2WWWA 3HTKB 5APSA 4GKGA 1QL2A 2WPSA 1HTLC 3GHGB 2WITA 1NHLA 3MTUE 1URQB 1ZR4A 1LTTC 1LWUB 1PFIA 2NPSD 1JO5A 1N7LA 3GHGA 2WPRA 3L37A 1QL1A 2H43A 3RK2B 1SFCA 2WZ7A 5APVA 3VMYA 1YTZT 1FZEA 3RK3D 3OA7A 1DX7A 5AVYB 5KJ7C 1GW4A 2R5DA 2OYIA 5AW8B 1HWTC 1JY3O 1CI6B 1KQLA 3RL0B 1ZLLA 1G2CB 2A45G 3EFGA 3TK1A 1N2DC 1Z56A 4OH8B 1J1DB 1GZLA 2HPCA 1RF1A 1XTGB 3CI9A 1T3UA 4JF7A 1GD2E 2E42A 5KJ7A 1J1EC 3E1IA 4IFFA 3H32A 3KQGA 4GT1A 3BRTB 5CCGA 2N1TB 1N7SC 3MIWA 1HJBA 2Q3IA 1LTJA 2J59M 4WY4A 1JTHB 3U59A 5AW7B 1SQXK 2VRSA 3HUSA 1M1JC 3L36A 2Q9IA 1JY2O 1GL2A 1LTJB 1LT9A 1IC2A 3V4QA 2HODA 4HH2A 2OYHC 1A02J 1DH3A 3RK2D 2FXMA 3V2QA 4C46A 3A3YB 4W7YA 3HD7A 3V5BA 1KILC 2HODB 2O1JA 2IX7C 4N78D 3VOPA 2ZFCA 1SQVK 1SQQK 1GL2C 1NOHA 3NMDA 3SWYA 3T97A 4I2LC 2C9LY 2XZRA 1NO4A 2C0WA 3M91A 1GTWA 5AW4B 2OARA 1FZGA 2YNYA 5APQA 4W80A 1L4AD 4ZKUA 2KLVA 2HLOA 1NTMK 1RE4C 4AQRD 3V4WA 1JY3N 1IFDA 2OYIB 2P2UA 2CPSA 3VYIA 1G2CA 1IFIA 1FZCC 1A02F 1HVVA 3B5NC 3UIAA 3V2PA 1KILA 3B8EB 1RF1B 2QM7A 1T3JA 2H7HA 1GW3A 3NFQA 2C9NY 3BATA 1GK6A 1JCCA 2KYVA 3CLQA 2M8RA 1SQBK 2FYZA 1G1JA 1X8YA 2MJZA 1FZCB 1JOCA 4W7ZA 2XDJA 3VP8A 4DOJA 1KZUB 1LT9B 4M3LA 2XV5A 1CZQA 3WMM0 3HE5B 3KPEA 1NKNA 2FFDB 5AVWB 2O1KA 5KLVK 4AYCA 2A45H 1LTIC 3I5CA 5CHXA 1AQ5A 1LTSC 3P8CD 4XE5B 1FOSE 1JMMA 2O01H 1N73C 5CCGD 4HYTB 1L0NK 3N4XA 5AVQB 5AW3B 3IR9A 3TSIA 2Z4EA 4WY4C 3MGNA 5AVTB 4LGDE 5AVZB 4DZOA 2CPBA 2NPSB 3A2AA 2HPCB 2N1TD 3G3ZA 3H6PA 1ZN5A 1IFJA 3EQ2A 2KOGA 2R32A 1M1JB 3M9HA 1AFOA 5APUA 3U1CA 5AW9B 4JYBA 1T2KC 3VN0A 5APWA 3VP9A 1L0LK 1IFMA 4WB4A 2GUVA 3R2PA 5AVXB 1JTHA 3RL0D 2HFED 2WTYA 3NTNA 2YO2A 3M0AA 1CW5A 1GL2B 2IFNA 5APYA 4C7NA 3HRNA 1KFMA 2WT7B 1L4AC 2ZXEB 1RE4A 2BASA 5CJ4A 1H8AA 1E5WA 3RK3B 2GM4A 1LT9C 1FJKA 5CMZA 2KP8A 5CCHC 3HE5A 5BVZA 2IPPA 1H89A 1X9VA 2E43A 2R3CA 2LKMA 1GK4A 2HYNA 2PP6A 5BU5A 1KILD 4RESB 1G1IA 3L4FA 1SFCB 5KJ7D 2HG5D 2FFDC 1IO4A 3GHGC 1LTGC 1J1EB 2IFMA 4O9BA 5APXA 1RE3A 2A45I 3M9BA 3SWFA 1KILB 1SVFA 3P7KA 2XNXA 1LWUA 1FZBA 2NPSC 1T2KD 2Q7CA 2OYIC 4IFMA 3M9QA 1L4AB 4EOTA 1N73A 3C9IA 4B86A 5CCHD 3M0DC 1S9KD 1XTCC 1YYCA 1JNMA 1JY3P 3II6A 3M06A 2KB7P 3MD0A 3LIEA 1N73B 1NTZK 1FDMA 5APTA 2N1TA 2N9BA 3V2RA 1LWUC 2YMYA 1ZR2A 3VMXA 1JY2N 1FAVA 1JUNA 1MFZA 5CCGC 1CI6A 2C0XA 2L5GB 2WSFH 4C7NB 1IK9A 1RY3A 2W6BA 3PP5A 2XU6A 3V2NA 2P7JA 1X79B 5AW5B 5CJ0A 2WT7A 3RK3C 1J1DC 2FYUK 3A5TA 1WT6A 3RL0C 1N7SA 1NH4A 3HD7B 1S9KE 1JY2P 4KHXA 4EIJA 2W27A 4N3YB 1NTKK 4AUWA 1WRGA 4WY4B 3OAKA 1RF0A 2FKWB 3HUSB 3U1AA 1RF1C 4I1LA 2N1TC 1CSBA 1NU1K 4Y99C 4C7RA 3HD7C 1M1JA 1OWAA 2W6AA 4WY4D 2YKQA 2OYHB 3CL3D 1YTZI 5BU8B 4LLHA 1FZFA 3B5ND 4GIFA 1SFCC 3HTKA 2QM8A 3OJAB 5KTBA 1MUUA 3P8CE 1FJPA 1EQ7A 4WBAA 2J58A 2YKOA 2POHA 1SP4A 4N78E 3BASA 5AVRB 1GU5A 1OXZA 5CCHA 1FZAA 1FOSF 1H88A 1GU4A 1M7LA 1URQD 2PAJA 5AW1B 1FZCA 1RE3C 1J2JB 1GL2D 2YO3A 2M3BA 2Z5HA 3NXSA 5AVVB 1LTJC 1NAFA 3LW5H 3RK2C 5AW0B 3LIDA 1N7SB 3M0DA 3BRVB 1ZV8A 1LTBC 2KSJA 1VDFA 3L35A 3VTPC 1LGHB 1W2EA 3HE4A 2P1JA 4XA4A 3TNUB 1SLQA 1GDTA 1HUCA 1NWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKN A;  3BAT A;  5BU8 B;  4GIF A;  1IC2 A;  4N3Y B;  3U1C A;  4O9B A;  2JEE A;  3P8C D;  3OJA B;  4ZKU A;  3VP9 A;  5KTB A;  2FXM A;  3U1A A;  3N4X A;  4I1L A;  4N78 D;  5BVZ A;  2POH A;  3VP8 A;  4ZKP A;  1X79 B;  3BAS A;  3C9I A;  5BU5 A;  3N7N A;  3HRN A;  3U59 A;  1WT6 A; 
#chains in the Genus database with same CATH topology
 3H32 B;  1SQQ J;  1KN7 A;  2K9J A;  4MN4 C;  2E75 B;  1U57 A;  3HE4 B;  1HBW A;  4LC1 A;  1N7S D;  2WSE H;  3AEF C;  1K04 A;  2BCC D;  2V7Q J;  2Z5I A;  2Y9Z A;  5TIS E;  1IJD B;  4H13 B;  1YQ4 C;  4XFJ A;  2NPS A;  3CCM P;  1L4A A;  2H8P D;  1T8Z A;  2ZT9 D;  1JMB A;  1ZRT E;  2QVA A;  2FFD A;  3A7O A;  3L75 G;  1PP9 D;  1QEX A;  2IYO A;  3PTZ A;  1LJ2 A;  1MV8 A;  1SQQ G;  2P10 A;  3L71 E;  4H44 D;  4JYC A;  4PD4 I;  4Y99 B;  2IDB A;  5AVS B;  3C8V A;  2OYH A;  2B87 B;  3H1L J;  3CPW O;  5GTI E;  3PRJ A;  4IFD K;  1SFC D;  1PGQ A;  1VL2 A;  5B5E H;  3HUS C;  1SQV D;  1BE3 G;  1JCD A;  2I1K A;  2ITA A;  4H0L B;  2JJL A;  2V4H A;  3Q5R A;  1VQ9 P;  1DEB A;  1VPC A;  3N7N A;  4NPD A;  2P67 A;  1YJ9 P;  3CCJ P;  3VMZ A;  2Q5U A;  1K73 Q;  1KQS O;  3L74 G;  4EIJ A;  2KZI A;  5B5E E;  1NKZ B;  3CCR P;  3KYQ A;  1SQP E;  5AVU B;  4GOF A;  2O01 J;  2Y0C A;  1SQP K;  2R5B A;  2YKP A;  3FGA D;  3BVH A;  1MFT A;  1NU1 G;  3W67 A;  2LXC B;  4PD4 E;  4EDF A;  5TJH A;  1MZ9 A;  1URQ C;  1KFN A;  1N86 A;  5AW2 B;  4I6M C;  4OGQ C;  1KOR A;  3R4Y A;  4PV1 C;  1OW7 A;  2QJY B;  2LR2 A;  2FYU D;  3FWN A;  1BDD A;  2WPQ A;  4ZKP A;  1KQG B;  3RK3 E;  3GF3 A;  3PH0 A;  2GUS A;  1S4X A;  3L73 E;  1AA0 A;  4JBZ A;  2E74 B;  3TYY A;  1M8O B;  2Q1K A;  1HH0 A;  3AE5 C;  1IFN A;  1NTK D;  2I1J A;  1FBM A;  1HGZ A;  2OYO A;  2RN0 A;  3L72 J;  4QMA A;  3SWK A;  4BRY A;  3B5N A;  1M57 D;  2O3J A;  2K88 A;  2KK7 A;  1DEE G;  2XKM A;  4YTP C;  2RH0 A;  3TF5 A;  2I8D A;  4BWN A;  2WQY C;  2JEE A;  3P8M C;  3PLN A;  1BCC E;  1L0N D;  3VMA A;  5AW6 B;  3IFM A;  2KS1 A;  2MKV A;  2WSC H;  3A0B H;  3IF4 A;  3MUD A;  3B5N B;  3L71 G;  1OIP A;  1HGV A;  3TNU A;  4PD4 D;  3O8Z A;  4YPC A;  1SQP G;  4N6J A;  1DD3 A;  3KDP B;  1RF0 C;  1W5C E;  3P32 A;  3HD7 D;  4L73 A;  2QJY C;  1FU1 A;  1LTA C;  1L0N J;  2W90 A;  2O01 N;  3H1H E;  1URQ A;  2WWW A;  3JSV C;  1TU3 F;  3HTK B;  3LW5 J;  5APS A;  4GKG A;  2RMZ A;  1QL2 A;  3L70 D;  2WPS A;  2D2C B;  4HJG H;  4PV1 B;  1VF5 C;  1FS0 E;  1BGY G;  2E75 C;  2K1A A;  2K37 A;  1HTL C;  1S5L X;  2B89 A;  1NTZ D;  3GHG B;  3H1I D;  2WIT A;  1HF9 A;  1NHL A;  1P84 E;  3MTU E;  1URQ B;  1ZR4 A;  1H0T B;  2ZVO B;  3BCC J;  3G9R A;  1LTT C;  1LWU B;  1NTK E;  5GTH H;  1PFI A;  2IBZ D;  1L0L D;  1IFP A;  2NPS D;  3L73 G;  3H1J E;  1JO5 A;  1N7L A;  2W6J H;  3GHG A;  5KKZ C;  2WPR A;  1VF5 D;  1NTZ J;  3L37 A;  1H0T A;  4OVN F;  1QL1 A;  2H43 A;  3RK2 B;  1SFC A;  2WZ7 A;  2FYU E;  5APV A;  5KAF E;  3F89 A;  3KZI E;  4U3F E;  1L0L J;  3VMY A;  2YIU B;  1YTZ T;  1FZE A;  3RK3 D;  2ZYD A;  3OA7 A;  1QVG O;  1DX7 A;  5AVY B;  5KJ7 C;  1X22 A;  1GW4 A;  2R5D A;  4NPE A;  2K3R A;  3OW2 O;  2OYI A;  5AW8 B;  1HWT C;  3TDK A;  1JY3 O;  5K5G B;  1CI6 B;  1KQL A;  4U3F J;  1ZLL A;  1G2C B;  2A45 G;  2FYU J;  3EFG A;  3RL0 g;  1PP9 J;  2UWJ E;  3QH9 A;  1N2D C;  1Z56 A;  4OH8 B;  2QIW A;  1J1D B;  1GZL A;  2HPC A;  1NTZ E;  1RF1 A;  1NTK G;  4Y28 J;  1P84 D;  1XTG B;  3CI9 A;  1T3U A;  2QSI A;  1DD4 A;  3H1K E;  3QWO C;  2OQQ A;  4JF7 A;  1PGO A;  1M56 D;  3FX0 A;  4H44 C;  5L8R J;  2E76 C;  1NTK J;  2Y0E A;  2FBW C;  4EI2 A;  5KAF H;  3AE9 C;  1NU1 D;  5KJ7 A;  2E42 A;  1J1E C;  3E1I A;  4IFF A;  1BDC A;  2FYU G;  3H32 A;  3KQG A;  4GT1 A;  4GOE A;  1YJN P;  3BRT B;  5CCG A;  1WMK A;  2N1T B;  4WWI A;  1K05 A;  3JCU H;  1N7S C;  3MIW A;  3L70 E;  1HJB A;  2A06 G;  2Q3I A;  1LTJ A;  2B9B A;  2J59 M;  4PV1 D;  5CCG D;  5TIS H;  4WY4 A;  1JTH B;  1D7M A;  3L74 D;  3RGU A;  1NU1 J;  3U59 A;  5AW7 B;  1SQX K;  2R3S A;  2VRS A;  3HUS A;  1M1J C;  3V6I A;  2QJP C;  3L36 A;  1JY2 O;  4JPZ B;  1GL2 A;  2Q9I A;  1LTJ B;  1LT9 A;  3S9O A;  1OMI A;  3SFE C;  3CC7 P;  3D6Z A;  1IC2 A;  3V4Q A;  3Q2Y A;  2HOD A;  4HH2 A;  2OYH C;  4IL6 H;  5M1B A;  3L74 J;  1A02 J;  1EDK A;  1DH3 A;  4WVZ A;  3RK2 D;  3AEC C;  2ZYA A;  3WUU A;  1FDI A;  2FXM A;  5KLI C;  3V2Q A;  4C46 A;  2KI7 B;  1BGY D;  3A3Y B;  3H1I G;  3CMA P;  1RHZ B;  3HD7 A;  4W7Y A;  3V5B A;  3L72 E;  1KIL C;  2HOD B;  3CC2 P;  2O1J A;  2IX7 C;  2AEJ A;  3E1R A;  4IL6 E;  4N78 D;  3VOP A;  3SSU A;  1EDI A;  2SPZ A;  1L0L G;  2ZFC A;  1VQ5 P;  1SQV K;  3H1K J;  1SQQ K;  1GL2 C;  1EZV G;  1NOH A;  1Y9B A;  3NMD A;  4L76 A;  3SWY A;  3T97 A;  3H1J G;  2JP3 A;  4I2L C;  3AEB C;  1EC5 A;  3FXE A;  4IL6 X;  2E5Y A;  2C9L Y;  2XZR A;  4R4M A;  4UB8 E;  4CPG A;  3O6Q B;  1NO4 A;  2C0W A;  3L74 E;  1KB9 D;  4ZMD A;  3M91 A;  1GTW A;  3JC2 2;  1FDO A;  1KMI Z;  5AW4 B;  3CXH H;  2OAR A;  2H89 C;  2XND H;  2YNY A;  5APQ A;  1FZG A;  4W80 A;  1L4A D;  3GG2 A;  2E76 B;  2KUB A;  4ZKU A;  2KLV A;  1NU1 E;  1UIX A;  1NTM K;  2HLO A;  5KAI E;  1VQN P;  1RE4 C;  4BXL A;  4AQR D;  1S72 P;  3V4W A;  4NPF X;  3L70 J;  2L91 A;  1JY3 N;  1KB9 I;  1L0N G;  4GOD A;  3TGU E;  3CX5 H;  1IFD A;  2KZJ A;  2M0B A;  2AXC A;  2P2U A;  2BCC J;  4YXD C;  2OYI B;  2CPS A;  1ZME C;  3RBZ A;  4BRY B;  1K9M Q;  3I55 P;  3VYI A;  1G2C A;  1R5L A;  1IFI A;  1Y8A A;  1KYO I;  2YMK A;  5DJU B;  1FZC C;  1A02 F;  1HVV A;  3B5N C;  3ABV C;  3UIA A;  3V2P A;  2RKL A;  1KIL A;  3B8E B;  3Q5S A;  2QM7 A;  1T3J A;  3TK1 A;  1RF1 B;  2H7H A;  3BCC E;  2Y0D A;  1GW3 A;  3NFQ A;  1YIJ P;  3AEA C;  3BAT A;  3GMA A;  1GK6 A;  2W8Z A;  2C9N Y;  2B88 A;  1AVY A;  5E79 H;  2BCC E;  1JCC A;  1K8A Q;  2WSS H;  1JEK A;  1OW8 A;  3TGU J;  2KYV A;  3CLQ A;  3CWB D;  1DIP A;  1UII A;  4DT0 A;  2M8R A;  1ZRT D;  1SQB K;  2D2C D;  3IN6 A;  2FYZ A;  1G1J A;  1X8Y A;  3AEG C;  3AE4 C;  2GA1 A;  2MJZ A;  1JOC A;  3BCC G;  3L71 D;  3L72 D;  4W7Z A;  2IZ0 A;  1FZC B;  5KAI H;  2FY8 A;  3G4S P;  5B66 E;  2IYP A;  2XDJ A;  1SQQ E;  2D2C C;  2OTL P;  3VP8 A;  2QE7 H;  4DOJ A;  2A06 D;  1KZU B;  1OZH A;  5GTH E;  2QEX P;  4ZNC A;  3CXH I;  3H25 A;  4UB6 E;  1EZV E;  1R8E A;  1GMJ A;  1LT9 B;  2JKV A;  3H1K G;  2HR3 A;  4L75 A;  4M3L A;  2XV5 A;  1CZQ A;  1NAY A;  3IAO A;  3WMM 0;  3H1J J;  2OGU A;  1VQ4 P;  3HE5 B;  3KPE A;  3B4S A;  1KQF B;  1NKN A;  2R44 A;  4ASW A;  2FFD B;  5AVW B;  2O1K A;  3A0B E;  3BCC D;  3L72 G;  5KLV K;  3FXD A;  3CX5 I;  1KB9 H;  4AYC A;  2A45 H;  2FYN C;  1LTI C;  1AJY A;  3I5C A;  1JB0 J;  1BE3 J;  1LTS C;  5CHX A;  1U7J A;  2E5T A;  2NZ2 A;  3AE7 C;  3P8C D;  4A7P A;  1AQ5 A;  1FE6 A;  4XE5 B;  1FOS E;  1YBK A;  1JMM A;  1S5L E;  2O01 H;  1BE3 D;  1N73 C;  1BCC D;  1L0N E;  1L0N K;  3H1H J;  3N4X A;  4HYT B;  1YQ3 C;  1ZOY C;  3IR9 A;  4K35 A;  5AVQ B;  5AW3 B;  1S5L H;  3TSI A;  2E74 C;  4WY4 C;  3E7K A;  3MGN A;  5AVT B;  1NTM G;  3AE8 C;  1VQP P;  2BCC G;  2OTJ P;  1GD2 E;  4LGD E;  5AVZ B;  4DZO A;  1SQQ D;  2CPB A;  2JWA A;  2NPS B;  2QJK C;  3A2A A;  1Q90 D;  3L75 D;  4OWF A;  2A06 E;  5B66 H;  1KD1 Q;  2HPC B;  2N1T D;  2WSF J;  3G3Z A;  1BCC J;  1ZN5 A;  3H6P A;  5KLV D;  1RQU A;  3CME P;  1IFJ A;  3EQ2 A;  2KOG A;  1BGY J;  4HKZ H;  4D6T J;  1PV3 A;  1VF5 B;  3CWB E;  2R32 A;  1M1J B;  4TT3 H;  3M9H A;  1AFO A;  1LNQ A;  3GW6 A;  1NVO A;  3L70 G;  5APU A;  3U1C A;  2PFX A;  5AW9 B;  4JYB A;  1T2K C;  3VN0 A;  5APW A;  2KIK A;  2IBZ E;  3VP9 A;  5KLV G;  1L0L K;  1IFM A;  3L73 J;  2GUV A;  3R2P A;  4WB4 A;  5AVX B;  1W2B O;  3H1L E;  1JTH A;  3C1L A;  3CCV P;  2H88 C;  2J5U A;  3RL0 D;  2HFE D;  2WTY A;  3NTN A;  2Q6Q A;  2W83 C;  1AV1 A;  4D6T G;  1PP9 E;  3H1H D;  2N9Y B;  2WSC J;  1EZV D;  2YO2 A;  3M0A A;  3CD6 P;  1GL2 B;  1CW5 A;  2IFN A;  3S1K A;  1NJI Q;  5APY A;  1KC8 Q;  4H44 B;  1VQL P;  3CXH D;  5GTI H;  4C7N A;  1M90 Q;  1QX8 A;  1KTM A;  3HRN A;  1KFM A;  3D71 A;  1YIT P;  3CC4 P;  4KT0 J;  1N8R Q;  4RKU J;  3W68 A;  2KS1 B;  2AEM A;  2V7Q H;  2AXT H;  1HJ0 A;  5KLI B;  2WT7 B;  2IBZ I;  1SQP J;  1L0L E;  1L4A C;  1ZXG A;  1EZV I;  2ZXE B;  3AEE C;  2PGD A;  3CX5 D;  3CCQ P;  1P84 H;  1RE4 A;  1VQ6 P;  1BSH A;  1OVV A;  1KV4 A;  2BAS A;  1LT1 A;  2FXP A;  1SQP D;  5CJ4 A;  3ZDM A;  1H8A A;  1YI2 P;  1E5W A;  3A0H E;  3RK3 B;  2GM4 A;  1YJW P;  1LT9 C;  3H1K D;  2Y9Y A;  4OGQ B;  1FJK A;  5CMZ A;  2YIU C;  3AE3 C;  2KP8 A;  5CCH C;  1S1C X;  3HE5 A;  5BVZ A;  1EDL A;  2IPP A;  1SQV E;  4L74 A;  2G8Y A;  1H89 A;  1X9V A;  1BSN A;  1USD A;  3B71 A;  2E43 A;  1L2P A;  2QG4 A;  2R3C A;  2LKM A;  5KLV E;  1GK4 A;  2HYN A;  1KYO H;  2PP6 A;  2YXR B;  2JR8 A;  5BU5 A;  1KIL D;  3KHU A;  1Q81 Q;  3D6Y A;  4RES B;  1G1I A;  3PHL A;  5CBO A;  5H2F E;  3L4F A;  1SFC B;  5KJ7 D;  2HG5 D;  5CBN A;  2FFD C;  4PJ0 H;  1IO4 A;  3GHG C;  5EFW B;  1LTG C;  1J1E B;  3L75 J;  3WU2 H;  1PGP A;  1Q86 Q;  3GF7 A;  2IFM A;  4O9B A;  1OVR A;  3CX5 E;  3TGU G;  2LXB A;  2NRG A;  3AE6 C;  1RE3 A;  2A45 I;  3M9B A;  2P58 A;  5APX A;  3WU2 E;  3SWF A;  1Q7Y Q;  1KIL B;  1SVF A;  3P7K A;  4I7Z C;  5H2F H;  3D70 A;  1VQ8 P;  1QLE D;  4R4L A;  2Q3E A;  2FXO A;  2AEF A;  2XNX A;  4JQ0 D;  1PP9 G;  2OTK E;  1LWU A;  1FZB A;  1RQV A;  2NPS C;  1T2K D;  1RH5 B;  3CXH E;  1SQV G;  2Q7C A;  4IFM A;  2OYI C;  3M9Q A;  3CCU P;  2JO1 A;  1PIX A;  1L4A B;  3L73 D;  1Q2N A;  4EOT A;  1N73 A;  1S3J A;  2ZXX A;  3C9I A;  4B86 A;  5CCH D;  3Q5P A;  2IBZ G;  3M0D C;  2ZJS E;  2E75 D;  4ASV A;  1XTC C;  1YYC A;  2M5A B;  1S9K D;  2E76 D;  1JY3 P;  3II6 A;  3M06 A;  2KB7 P;  3MD0 A;  1OX3 A;  1SQX E;  3S4R A;  5KKZ B;  2B87 A;  2YXQ B;  1X0T A;  3LIE A;  1N73 B;  1NTM J;  2FYN B;  1NTZ K;  3G71 P;  3WUV A;  1FDM A;  5APT A;  2N1T A;  2N9B A;  3H1H G;  1LWU C;  2G3A A;  2YMY A;  4TLF A;  2E74 D;  3V2R A;  3VMX A;  3JCU E;  1Y47 A;  3RL0 B;  4PJ0 E;  1JY2 N;  1FAV A;  1ZR2 A;  1QVF O;  1JUN A;  1MFZ A;  4YXW H;  5CCG C;  1CI6 A;  2C0X A;  2L5G B;  2WSF H;  3EWK A;  4C7N B;  1IK9 A;  1RY3 A;  2BEQ D;  2W6B A;  4U3F G;  4UB6 H;  3K5B A;  1VQM P;  3MHV A;  3PP5 A;  1EXI A;  2XU6 A;  4U7J A;  3V2N A;  1SQB G;  2P7J A;  1VQO P;  1KYO E;  4D6T D;  3KZI H;  4RJT A;  1X79 B;  2KXP B;  4U3F D;  5CJ0 A;  5DJT B;  1KIL E;  2ZVN B;  5AW5 B;  3RK3 C;  2WT7 A;  1EDJ A;  1J1D C;  2FYU K;  1PZQ A;  1S2E A;  2JWD A;  1NGM B;  3H1I E;  3A5T A;  1KB9 E;  1WT6 A;  3H1L G;  1FC2 C;  3RL0 C;  1N7S A;  1OFC X;  1SQV J;  1E79 H;  1IK7 A;  1NH4 A;  3HD7 B;  1S9K E;  1JY2 P;  3EFF K;  2QJK B;  4KHX A;  1MKM A;  2W27 A;  3FWL A;  1LP1 B;  1PL5 A;  1PPJ D;  2QJP B;  4N3Y B;  3L71 J;  1NTK K;  3H1I J;  2KSE A;  1WRG A;  2ZYG A;  3H1J D;  1NTM D;  5E79 E;  4WY4 B;  1SQB D;  4AUW A;  3OAK A;  4GDO A;  1RF0 A;  2K9J B;  3MZW B;  1BCC G;  2FKW B;  3T97 B;  3HUS B;  3U1A A;  4PD4 H;  3TGU D;  1JM0 A;  1RF1 C;  4I1L A;  1OW6 A;  2N1T C;  2WSE J;  4RO0 A;  1AVO A;  1CSB A;  1NU1 K;  3A0H H;  4Y99 C;  3RBX A;  4C7R A;  3HD7 C;  1M1J A;  1OWA A;  2W6A A;  1JNM A;  3CCL P;  2QA4 P;  1VQ7 P;  1KYO D;  4WY4 D;  2YKQ A;  3WUT A;  1NYH A;  1SS1 A;  2KNC A;  2OYH B;  1SQX D;  3CL3 D;  3KXD A;  1YTZ I;  3ITK A;  2AXT E;  1OVU A;  3Q1M A;  4DJG A;  4HB1 A;  5C39 A;  4LLH A;  5BU8 B;  1FZF A;  3B5N D;  3CCE P;  3AED C;  1R5S A;  4GIF A;  4DCK A;  1SFC C;  3MUD C;  2KNC B;  3Q3D A;  2CK3 H;  3HTK A;  1PPJ E;  2QM8 A;  2Z4E A;  2PRR A;  3OJA B;  4UB8 H;  5KTB A;  1MUU A;  3O6Q A;  1USE A;  1IZN B;  3P8C E;  3I56 P;  1FJP A;  1T6A A;  1AQT A;  1EQ7 A;  3AE1 C;  2ZT9 C;  3CWB J;  4D6T E;  1SQB J;  1BGY E;  2J58 A;  4WBA A;  2YKO A;  2WMM A;  1YHQ P;  1Q82 Q;  2M5A A;  2POH A;  2IZ1 A;  1SP4 A;  2BEZ F;  1EXJ A;  4N78 E;  2M3E A;  3BAS A;  2QRX A;  3AE2 C;  5AVR B;  1GU5 A;  1OXZ A;  1ZW0 A;  2KLU A;  1P84 I;  5CCH A;  4OGQ D;  1FZA A;  1FOS F;  1H88 A;  1GU4 A;  3PJS K;  1M7L A;  3L75 E;  2DW3 A;  1URQ D;  2PAJ A;  1U7M A;  1SQX G;  5AW1 B;  4H0L D;  1FZC A;  1ZP0 C;  3CWB G;  4K3A A;  1RE3 C;  1J2J B;  1NTM E;  1GL2 D;  1SQB E;  3USS A;  2YO3 A;  4H13 C;  1NTZ G;  1SQX J;  2M3B A;  1PPJ G;  2Z5H A;  3NXS A;  1QGK B;  4KJM A;  4I7Z B;  5KLV J;  1BE3 E;  5AVV B;  4IOI H;  3CCS P;  2WPV B;  3MP7 B;  3GLM A;  1LTJ C;  3F5H A;  1NAF A;  3H1L D;  3LW5 H;  1PGJ A;  3RK2 C;  5AW0 B;  3LID A;  1N7S B;  2ZT9 B;  3M0D A;  3BRV B;  1ZV8 A;  1LTB C;  2KSJ A;  1VDF A;  3L35 A;  3VTP C;  4H13 D;  1LGH B;  3SFD C;  4Z1M H;  1VQK P;  1W2E A;  3HE4 A;  4EYY Q;  1LP1 A;  2P1J A;  2JDI H;  4XA4 A;  2WVR A;  1SLQ A;  3TNU B;  3G6E P;  1GDT A;  2K9Y A;  4H0L C;  1HUC A;  2ZAE B;  1NWQ A;  1M1K Q; 
#chains in the Genus database with same CATH homology
 3H32 B;  1HBW A;  3HE4 B;  4LC1 A;  1N7S D;  2WSE H;  2Z5I A;  1IJD B;  2NPS A;  1L4A A;  2H8P D;  1T8Z A;  2FFD A;  3A7O A;  1MV8 A;  4Y99 B;  2OYH A;  4JYC A;  5AVS B;  4IFD K;  1SFC D;  3HUS C;  1JCD A;  2I1K A;  2JJL A;  1DEB A;  1VPC A;  3N7N A;  2P67 A;  3VMZ A;  2Q5U A;  1NKZ B;  3KYQ A;  5AVU B;  1SQP K;  2R5B A;  2YKP A;  3BVH A;  1MZ9 A;  1URQ C;  1KFN A;  1N86 A;  5AW2 B;  4I6M C;  2WPQ A;  4ZKP A;  2GUS A;  3TYY A;  1HH0 A;  1IFN A;  2I1J A;  1FBM A;  1HGZ A;  3B5N A;  2XKM A;  2JEE A;  3P8M C;  5AW6 B;  3IFM A;  2WSC H;  3MUD A;  3B5N B;  3TNU A;  1HGV A;  3O8Z A;  4N6J A;  3KDP B;  1RF0 C;  3P32 A;  3HD7 D;  1FU1 A;  1LTA C;  1URQ A;  2WWW A;  3HTK B;  5APS A;  4GKG A;  1QL2 A;  2WPS A;  1HTL C;  3GHG B;  2WIT A;  1NHL A;  3MTU E;  1URQ B;  1ZR4 A;  1LTT C;  1LWU B;  1PFI A;  2NPS D;  1JO5 A;  1N7L A;  3GHG A;  2WPR A;  3L37 A;  1QL1 A;  2H43 A;  3RK2 B;  1SFC A;  2WZ7 A;  5APV A;  3VMY A;  1YTZ T;  1FZE A;  3RK3 D;  3OA7 A;  1DX7 A;  5AVY B;  5KJ7 C;  1GW4 A;  2R5D A;  2OYI A;  5AW8 B;  1HWT C;  1JY3 O;  1CI6 B;  1KQL A;  3RL0 B;  1ZLL A;  1G2C B;  2A45 G;  3EFG A;  3TK1 A;  1N2D C;  1Z56 A;  4OH8 B;  1J1D B;  1GZL A;  2HPC A;  1RF1 A;  1XTG B;  3CI9 A;  1T3U A;  4JF7 A;  1GD2 E;  2E42 A;  5KJ7 A;  1J1E C;  3E1I A;  4IFF A;  3H32 A;  3KQG A;  4GT1 A;  3BRT B;  5CCG A;  2N1T B;  1N7S C;  3MIW A;  1HJB A;  2Q3I A;  1LTJ A;  2J59 M;  4WY4 A;  1JTH B;  3U59 A;  5AW7 B;  1SQX K;  2VRS A;  3HUS A;  1M1J C;  3L36 A;  2Q9I A;  1JY2 O;  1GL2 A;  1LTJ B;  1LT9 A;  1IC2 A;  3V4Q A;  2HOD A;  4HH2 A;  2OYH C;  1A02 J;  1DH3 A;  3RK2 D;  2FXM A;  3V2Q A;  4C46 A;  3A3Y B;  4W7Y A;  3HD7 A;  3V5B A;  1KIL C;  2HOD B;  2O1J A;  2IX7 C;  4N78 D;  3VOP A;  2ZFC A;  1SQV K;  1SQQ K;  1GL2 C;  1NOH A;  3NMD A;  3SWY A;  3T97 A;  4I2L C;  2C9L Y;  2XZR A;  1NO4 A;  2C0W A;  3M91 A;  1GTW A;  5AW4 B;  2OAR A;  1FZG A;  2YNY A;  5APQ A;  4W80 A;  1L4A D;  4ZKU A;  2KLV A;  2HLO A;  1NTM K;  1RE4 C;  4AQR D;  3V4W A;  1JY3 N;  1IFD A;  2OYI B;  2P2U A;  2CPS A;  3VYI A;  1G2C A;  1IFI A;  1FZC C;  1A02 F;  1HVV A;  3B5N C;  3UIA A;  3V2P A;  1KIL A;  3B8E B;  1RF1 B;  2QM7 A;  1T3J A;  2H7H A;  1GW3 A;  3NFQ A;  2C9N Y;  3BAT A;  1GK6 A;  1JCC A;  2KYV A;  3CLQ A;  2M8R A;  1SQB K;  2FYZ A;  1G1J A;  1X8Y A;  2MJZ A;  1FZC B;  1JOC A;  4W7Z A;  2XDJ A;  3VP8 A;  4DOJ A;  1KZU B;  1LT9 B;  4M3L A;  2XV5 A;  1CZQ A;  3WMM 0;  3HE5 B;  3KPE A;  1NKN A;  2FFD B;  5AVW B;  2O1K A;  5KLV K;  4AYC A;  2A45 H;  1LTI C;  3I5C A;  5CHX A;  1AQ5 A;  1LTS C;  3P8C D;  4XE5 B;  1FOS E;  1JMM A;  2O01 H;  1N73 C;  5CCG D;  4HYT B;  1L0N K;  3N4X A;  5AVQ B;  5AW3 B;  3IR9 A;  3TSI A;  2Z4E A;  4WY4 C;  3MGN A;  5AVT B;  4LGD E;  5AVZ B;  4DZO A;  2CPB A;  2NPS B;  3A2A A;  2HPC B;  2N1T D;  3G3Z A;  3H6P A;  1ZN5 A;  1IFJ A;  3EQ2 A;  2KOG A;  2R32 A;  1M1J B;  3M9H A;  1AFO A;  5APU A;  3U1C A;  5AW9 B;  4JYB A;  1T2K C;  3VN0 A;  5APW A;  3VP9 A;  1L0L K;  1IFM A;  4WB4 A;  2GUV A;  3R2P A;  5AVX B;  1JTH A;  3RL0 D;  2HFE D;  2WTY A;  3NTN A;  2YO2 A;  3M0A A;  1CW5 A;  1GL2 B;  2IFN A;  5APY A;  4C7N A;  3HRN A;  1KFM A;  2WT7 B;  1L4A C;  2ZXE B;  1RE4 A;  2BAS A;  5CJ4 A;  1H8A A;  1E5W A;  3RK3 B;  2GM4 A;  1LT9 C;  1FJK A;  5CMZ A;  2KP8 A;  5CCH C;  3HE5 A;  5BVZ A;  2IPP A;  1H89 A;  1X9V A;  2E43 A;  2R3C A;  2LKM A;  1GK4 A;  2HYN A;  2PP6 A;  5BU5 A;  1KIL D;  4RES B;  1G1I A;  3L4F A;  1SFC B;  5KJ7 D;  2HG5 D;  2FFD C;  1IO4 A;  3GHG C;  1LTG C;  1J1E B;  2IFM A;  4O9B A;  5APX A;  1RE3 A;  2A45 I;  3M9B A;  3SWF A;  1KIL B;  1SVF A;  3P7K A;  2XNX A;  1LWU A;  1FZB A;  2NPS C;  1T2K D;  2Q7C A;  2OYI C;  4IFM A;  3M9Q A;  1L4A B;  4EOT A;  1N73 A;  3C9I A;  4B86 A;  5CCH D;  3M0D C;  1S9K D;  1XTC C;  1YYC A;  1JNM A;  1JY3 P;  3II6 A;  3M06 A;  2KB7 P;  3MD0 A;  3LIE A;  1N73 B;  1NTZ K;  1FDM A;  5APT A;  2N1T A;  2N9B A;  3V2R A;  1LWU C;  2YMY A;  1ZR2 A;  3VMX A;  1JY2 N;  1FAV A;  1JUN A;  1MFZ A;  5CCG C;  1CI6 A;  2C0X A;  2L5G B;  2WSF H;  4C7N B;  1IK9 A;  1RY3 A;  2W6B A;  3PP5 A;  2XU6 A;  3V2N A;  2P7J A;  1X79 B;  5AW5 B;  5CJ0 A;  2WT7 A;  3RK3 C;  1J1D C;  2FYU K;  3A5T A;  1WT6 A;  3RL0 C;  1N7S A;  1NH4 A;  3HD7 B;  1S9K E;  1JY2 P;  4KHX A;  4EIJ A;  2W27 A;  4N3Y B;  1NTK K;  4AUW A;  1WRG A;  4WY4 B;  3OAK A;  1RF0 A;  2FKW B;  3HUS B;  3U1A A;  1RF1 C;  4I1L A;  2N1T C;  1CSB A;  1NU1 K;  4Y99 C;  4C7R A;  3HD7 C;  1M1J A;  1OWA A;  2W6A A;  4WY4 D;  2YKQ A;  2OYH B;  3CL3 D;  1YTZ I;  5BU8 B;  4LLH A;  1FZF A;  3B5N D;  4GIF A;  1SFC C;  3HTK A;  2QM8 A;  3OJA B;  5KTB A;  1MUU A;  3P8C E;  1FJP A;  1EQ7 A;  4WBA A;  2J58 A;  2YKO A;  2POH A;  1SP4 A;  4N78 E;  3BAS A;  5AVR B;  1GU5 A;  1OXZ A;  5CCH A;  1FZA A;  1FOS F;  1H88 A;  1GU4 A;  1M7L A;  1URQ D;  2PAJ A;  5AW1 B;  1FZC A;  1RE3 C;  1J2J B;  1GL2 D;  2YO3 A;  2M3B A;  2Z5H A;  3NXS A;  5AVV B;  1LTJ C;  1NAF A;  3LW5 H;  3RK2 C;  5AW0 B;  3LID A;  1N7S B;  3M0D A;  3BRV B;  1ZV8 A;  1LTB C;  2KSJ A;  1VDF A;  3L35 A;  3VTP C;  1LGH B;  1W2E A;  3HE4 A;  2P1J A;  4XA4 A;  3TNU B;  1SLQ A;  1GDT A;  1HUC A;  1NWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...