1X79B

Crystal structure of human gga1 gat domain complexed with the gat-binding domain of rabaptin5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
90
structure length
90
Chain Sequence
ETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 43
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1x79B00
4ZKUA 1WT6A 2JEEA 3N4XA 5KTBA 3HRNA 4N78D 4GIFA 3VP9A 1IC2A 3U59A 3VP8A 4ZKPA 4I1LA 3U1CA 3U1AA 3N7NA 2FXMA 4N3YB 5BU5A 2POHA 5BVZA 1NKNA 3C9IA 1X79B 4O9BA 3P8CD 3OJAB 5BU8B 3BASA 3BATA
chains in the Genus database with same CATH superfamily
1NU1K 1EZVE 1QX8A 2KB7P 4U7JA 2WZ7A 3G9RA 3PTZA 3G71P 1Y47A 1HWTC 3V4QA 1HUCA 3L75E 4D6TG 1M1JC 2A06E 5KAFH 2YMKA 3RK3B 3IF4A 2KLVA 2FBWC 3VTPC 1SP4A 1GK4A 2KOGA 2JDIH 1RE4C 3CCRP 3P8CE 3L74J 2Y0DA 2ZYDA 2IZ0A 4OGQC 2WITA 2QRXA 1RY3A 2E75D 3H1JD 2A45H 1SQPK 1YQ4C 1N86A 2GUVA 3S1KA 4DJGA 2V7QJ 1WRGA 3HD7C 1OWAA 2E75C 4B86A 3CXHH 3HUSB 2OYIA 3WUTA 1N73B 1J1EC 4UB6E 3ITKA 3H1JE 4H0LC 4DOJA 1KYOI 1W2EA 3L73D 3M9QA 1JCDA 4EYYQ 4ZNCA 4GOEA 1FZAA 1LT1A 3MP7B 2W27A 3R4YA 3Q5RA 2XKMA 5GTIH 1FC2C 3HTKA 1MKMA 2PAJA 3TF5A 1SQVD 2K3RA 2N1TD 1YITP 2NPSD 1LTJA 4WY4C 2N9YB 1PGJA 2JWDA 1Y8AA 1HF9A 3C9IA 1ZXGA 2M3EA 1GL2A 2OYHC 1JCCA 3L73E 1BCCD 1LWUC 1HGVA 3M9BA 2C0WA 1EC5A 1YJNP 3CMAP 2WSEH 1LTBC 3RBXA 2GM4A 2QJYC 3TGUD 3VYIA 1SQVE 3H1LJ 1L4AA 2WSSH 1M90Q 2HPCA 2OARA 1YTZI 2JWAA 1VF5D 2FYNC 5APWA 3IR9A 1UIIA 2QSIA 3HE4A 1S2EA 5AVUB 3BVHA 1BCCE 2ZXXA 1DD3A 1KB9E 4D6TJ 1YBKA 1K05A 2GA1A 2ZYGA 1GW4A 2FYUE 4PV1C 3D71A 3TGUE 1FJPA 1FOSF 3E1IA 2K88A 2JR8A 2R3SA 2W6AA 3CCQP 2AXTE 3GMAA 4EOTA 1A02J 1E5WA 2Y9YA 2ZAEB 1OW7A 1EZVI 1HH0A 1T3UA 2D2CD 1VDFA 2FKWB 4YXDC 5AVZB 3CWBG 1AVOA 2ZXEB 1VQPP 1MV8A 2XNDH 1VQMP 4WWIA 1SQQK 2I1KA 1VQOP 2P67A 1GD2E 5CCGA 3WMM0 4CPGA 2KIKA 3CMEP 3CCMP 3CX5D 1JY2P 1XTGB 3H1HD 3M91A 2C0XA 3C1LA 3G4SP 1K73Q 1L0NG 2QJKB 2N1TB 2NPSB 1D7MA 2P1JA 1NTMD 3O6QB 1SQBD 4UB8E 2Z5IA 2VRSA 1PGPA 3L71G 2Q3EA 1NGMB 2XU6A 4C7RA 1FBMA 4ZKPA 3GHGA 2QE7H 3CX5E 3LIDA 4L74A 2HR3A 4YXWH 5AW1B 5CCHD 3H1HE 1OVVA 4PD4H 2K9JA 3H1KD 2J58A 1VF5B 2R5DA 3AEGC 1NTME 5KLIB 4YPCA 1SQBE 2FXMA 2G8YA 2HFED 5KLVK 3AE6C 5CCHC 3Q1MA 4Z1MH 1M1JA 3H25A 3RK2B 1N7LA 3B5NC 1FZCC 2NZ2A 1FZFA 1IZNB 1AV1A 3H1KE 1RE4A 4IFMA 2D2CB 1JMMA 1IJDB 2FFDB 1PFIA 2C9NY 2K37A 1VQLP 5AVYB 2PGDA 3AE2C 5KJ7C 1HVVA 1USEA 2HLOA 4ASVA 5APQA 1RH5B 3CLQA 1EDKA 1ZW0A 3R2PA 1X79B 4H13D 2E74C 1NU1G 1LP1A 2WSFH 5AW4B 1KB9I 3CWBJ 1FAVA 4YTPC 1YI2P 5AVSB 3WUVA 2QJPB 2WQYC 4AUWA 3AEBC 2J5UA 1EQ7A 1S72P 1EDIA 3MTUE 3D6ZA 1PP9G 3AE3C 2MKVA 1RE3A 2JEEA 5APVA 2YKQA 1L0NJ 5H2FE 2L5GB 4C46A 1FS0E 2M3BA 5TISH 2BCCG 2CPSA 1SQPG 4WY4A 4JQ0D 1QL2A 4BWNA 2IZ1A 2V4HA 2WVRA 3L71J 4KJMA 2OYHA 3JC22 1KYOH 1GDTA 1ZRTD 2C9LY 1LTSC 1SQXG 1TU3F 4IOIH 2N1TA 2NPSA 4LLHA 2OYIB 1CSBA 2HYNA 1PV3A 2H89C 2K9YA 3AE7C 3L74D 1SQBK 3A5TA 2ZT9B 3RL0D 2B89A 1NTZG 2PFXA 1EDLA 5KAIH 1YHQP 3D70A 2DW3A 5B66H 1FDOA 3VOPA 1ZRTE 3AEDC 3BRVB 2W90A 1S4XA 2OQQA 3CX5I 4M3LA 2OTKE 2QIWA 2W8ZA 4W80A 4OWFA 3BCCG 3G6EP 1LTJB 2IPPA 5E79H 3L74E 1MFZA 2KSJA 4H13B 1ZOYC 3Q5SA 1N7SC 3BRTB 2IBZD 3B8EB 4IL6H 4BXLA 2ZJSE 1KQGB 1NHLA 4KHXA 1L4AB 4QMAA 1P84D 3TDKA 1NU1J 5KKZC 3M0DC 3CCEP 3NFQA 1LTIC 3HE4B 1LT9B 1JM0A 3A0HE 2W83C 3L70E 1KD1Q 1BDCA 1H0TA 2IBZE 1ZLLA 1L0LG 1PP9J 1RHZB 5AW2B 4ZKUA 3FWLA 1SVFA 4WBAA 2WPVB 2CPBA 3CC7P 3H1LD 4HH2A 2Q9IA 1P84E 2JO1A 1HBWA 3CD6P 1IFJA 1PGQA 1FU1A 4OGQD 1IFMA 3Q5PA 3M9HA 2BCCJ 3AEAC 2A45G 4D6TD 1OW8A 3RL0B 3B4SA 3I55P 3M06A 1SQXJ 1SQQG 3SFDC 1IO4A 4HYTB 3HD7D 4Y28J 5BVZA 2Y0EA 2WWWA 3CL3D 5CCHA 3H1LE 3QWOC 2CK3H 3FXDA 1K04A 5GTHE 1PPJG 2WMMA 1PGOA 3B5NA 1FZCA 1NTZJ 1S5LE 5CBNA 4H0LD 4UB6H 1YIJP 1GTWA 1HGZA 2E76C 4D6TE 5AW7B 1NJIQ 1DX7A 3EWKA 3Q2YA 5AW6B 4N78D 4EDFA 2IDBA 1IFNA 3BCCJ 3GHGB 3L70J 5KJ7A 4N3YB 2IX7C 2WPRA 4WY4D 3CCUP 2K9JB 4DT0A 2FXPA 3TNUA 3ZDMA 1IFIA 5B5EE 1UIXA 3HE5A 3PHLA 3PLNA 5KLVG 4N78E 2Z4EA 1NTKK 4NPDA 1M1JB 2Q7CA 2WSCJ 2IFMA 1KB9D 1EXIA 2LKMA 2PRRA 1BCCG 1RF0A 2YXRB 1BGYG 2FYUD 2YIUC 4XE5B 2IYOA 2YXQB 4IFFA 1L0LJ 1E79H 2OYOA 3PP5A 1KTMA 2YO2A 4PV1D 4IFDK 1LT9A 1M7LA 1CI6A 3V6IA 2XDJA 1HJBA 3HD7B 3JCUE 2E75B 2BASA 2B87A 2AXTH 4BRYB 1LP1B 1J1EB 2IBZI 1R5SA 1PIXA 4RESB 2XV5A 1U7MA 1KILC 1N8RQ 4H0LB 4LGDE 4TT3H 1SQQJ 1AQ5A 3AEEC 2OTLP 1P84I 2LXCB 2Z5HA 3AE5C 3LIEA 1LTAC 4GIFA 2KK7A 1JY3O 1R8EA 3VN0A 1KN7A 1BE3G 1JEKA 3CWBD 4WY4B 3OAKA 1RF1A 2Q1KA 3KZIE 2IYPA 1H89A 4TLFA 2OYHB 3VMYA 3WU2E 1LWUB 3F5HA 3T97B 1VPCA 5AW9B 3IFMA 4UB8H 1AJYA 3E7KA 1AVYA 2W6BA 4HKZH 3CC2P 1KV4A 3CX5H 3KDPB 4I2LC 4RO0A 1L0ND 2FYNB 1JUNA 1H88A 3CWBE 1RQVA 4JBZA 3M0DA 1S9KD 2ZVOB 5KLVJ 3C8VA 2WSEJ 1OVRA 3L71D 3VMZA 1SLQA 1YYCA 5APXA 1W5CE 3B5ND 1G1IA 4PV1B 3VP9A 2Q3IA 1BGYJ 1AQTA 1SQVK 3RL0g 2POHA 1T6AA 1L0NE 2JJLA 2QM8A 5AVVB 3L72G 1S9KE 3O8ZA 1LGHB 3E1RA 1VQ4P 3CC4P 3L71E 4GDOA 2AEJA 3LW5H 5KJ7D 2FXOA 1NAYA 5AVXB 5BU5A 1T2KC 5AVRB 4AQRD 2FYUK 3TYYA 2OTJP 4JF7A 3IN6A 2E74D 1FDIA 1K8AQ 1S1CX 3MUDC 2AXCA 4H44C 1FZEA 4GKGA 3WUUA 4HB1A 4XFJA 3GF3A 1H0TB 1SFCD 3HD7A 3SSUA 3H32B 4BRYA 1X0TA 2IFNA 4KT0J 2LR2A 1G2CA 1URQD 3VP8A 2W6JH 3NXSA 1SFCC 1OMIA 4HJGH 1LTTC 1BE3J 1NU1D 3FXEA 2QVAA 3A7OA 1JY2O 4C7NB 1URQC 3S4RA 1VQ8P 3P8MC 4U3FG 1DIPA 1AA0A 1Q86Q 1GL2C 1PP9D 1KQSO 3MD0A 3S9OA 5AVWB 3GW6A 3II6A 3AE4C 3D6YA 3NMDA 1QVFO 4OVNF 3A3YB 1NU1E 3B5NB 1FZCB 1LWUA 3T97A 1KQLA 4I7ZC 3G3ZA 1ZMEC 4EIJA 4GOFA 2BCCD 3AECC 3AE8C 3RGUA 1DH3A 2N9BA 3NTNA 2J59M 2OGUA 5CBOA 1NTMK 1PP9E 2H7HA 1SQXD 1LTGC 2H8PD 1JTHA 2E5YA 1NWQA 1IFPA 4K35A 1BDDA 1L0NK 2PP6A 2YNYA 5AW3B 2KUBA 5AW8B 4L75A 4Y99C 3L72J 1OXZA 1NTZD 2BCCE 1SQPE 1KC8Q 1NH4A 2ZVNB 2E74B 2RN0A 1OZHA 3HRNA 5APTA 2YMYA 1N7SD 3TNUB 3V2NA 4AYCA 3HE5B 3TK1A 1LJ2A 3RK3C 1KILA 1SQXE 5K5GB 1M1KQ 1NTKG 4ZMDA 3I5CA 2V7QH 2WT7B 2KI7B 3L70D 2GUSA 3H1IG 1Z56A 3CCLP 1R5LA 3U1AA 2WSFJ 1NTZE 5CCGC 3KPEA 3A0BE 1L2PA 1KFMA 1J1DB 3USSA 2K1AA 4O9BA 3OJAB 3A0HH 1QVGO 1EZVG 1K9MQ 1WMKA 2P2UA 2KP8A 1QGKB 2L91A 1QEXA 1CI6B 3L75G 2A06G 3HUSC 1N73C 3QH9A 4PJ0E 3BCCE 1IFDA 1KORA 1P84H 2B87B 2B9BA 2FY8A 2MJZA 3H32A 3PH0A 1U57A 4U3FJ 1L0LD 2O1JA 2Q6QA 2KZIA 1SQPJ 2JP3A 3VMAA 1RQUA 3V2RA 1Q90D 4A7PA 4C7NA 4W7ZA 2YKPA 1GW3A 2M0BA 3N7NA 1NAFA 1YJ9P 5GTHH 2O1KA 1JNMA 3CPWO 2E5TA 1S5LH 2KS1A 1RF1B 2E76D 1L0LE 3H1JG 5APSA 3PRJA 1GU5A 1DEBA 3A2AA 2BEQD 2Q5UA 1SQQD 3MZWB 5KAFE 2H88C 1T3JA 1OX3A 1N7SB 1MZ9A 3CCSP 5APYA 3FGAD 2XNXA 2R44A 1VL2A 2Y0CA 3CXHD 1PPJD 4I6MC 1VQ9P 4DCKA 3KQGA 1XTCC 5KKZB 1JY3P 3MUDA 1SQXK 2B88A 3AE9C 1QL1A 3L73G 2G3AA 1SQQE 2QA4P 1S3JA 4WVZA 5B5EH 1NTKJ 2M5AA 3FX0A 1NVOA 2P58A 3H1IJ 1NTZK 5TJHA 1NYHA 3CXHE 1PPJE 5DJTB 5EFWB 1SQVG 3VMXA 1W2BO 3KHUA 1SFCA 1RE3C 3F89A 1CW5A 2WT7A 2UWJE 5KLVD 1T8ZA 4I1LA 2P10A 1VQ5P 1URQA 3L75J 2R5BA 5GTIE 4LC1A 1HTLC 1J2JB 2FYUG 2WTYA 4OGQB 3TGUG 5BU8B 2O01N 1FJKA 1BGYD 1KB9H 3K5BA 4GT1A 3JCUH 3KXDA 2AEFA 1FZBA 2QJKC 2N1TC 2NPSC 1LNQA 1YTZT 3KYQA 1KILD 2QG4A 4OH8B 5KLVE 1QLED 4DZOA 3EFFK 5L8RJ 2E76B 2KNCB 1G2CB 1JY3N 4RKUJ 1MUUA 1BGYE 1ZV8A 1L0LK 1VF5C 3RK2D 1FE6A 1OFCX 5KLIC 1ZR2A 1HJ0A 3H1JJ 1KILE 3Q3DA 3I56P 4K3AA 1AFOA 3L37A 3FWNA 2RH0A 3V5BA 3KZIH 1G1JA 3WU2H 3RK2C 1FDMA 3CCJP 3UIAA 1U7JA 4JYCA 1YQ3C 4L76A 1ZN5A 1BSNA 3SWFA 2I8DA 1BE3D 1Q2NA 1N7SA 3L35A 2D2CC 2FFDC 3H1HG 1H8AA 2QJYB 3L73J 3OW2O 2YIUB 2QEXP 1X9VA 1NTMG 1WT6A 1DD4A 3P32A 1SQBG 1JTHB 3U1CA 1SQVJ 2KSEA 3GF7A 3HUSA 1N73A 3TSIA 1USDA 2XZRA 2A45I 1BE3E 4PD4D 4W7YA 1JOCA 1NO4A 3EQ2A 1Q82Q 1BCCJ 2QJPC 3H1KG 5CJ4A 2AEMA 1CZQA 2BEZF 1OVUA 1KILB 1Y9BA 2FYUJ 1T2KD 3L4FA 1Q81Q 3CXHI 3TGUJ 2I1JA 2KZJA 3N4XA 1VQ7P 1VQKP 1GMJA 2KLUA 3L36A 2E42A 3RBZA 4H44D 1X22A 4PD4E 3L72D 1NOHA 3W67A 3BASA 2QM7A 3AEFC 3IAOA 2HODB 2ZT9D 5CJ0A 3ABVC 3JSVC 1M57D 3OA7A 4ASWA 4NPEA 1ZR4A 2OYIC 1FOSE 1JY2N 2YKOA 2ZYAA 2ZT9C 3L72E 3MHVA 2O01H 1DEEG 2KNCA 3CCVP 1IC2A 2KYVA 3V2QA 2E43A 1KZUB 4NPFX 1MFTA 1GL2D 5H2FH 2LXBA 1JB0J 5DJUB 2P7JA 1SS1A 2FYZA 1IK7A 3V2PA 1LTJC 4WB4A 2Y9ZA 3H1HJ 4RJTA 4H13C 1L4AD 5C39A 1PL5A 2NRGA 4XA4A 2KS1B 1GZLA 1RF0C 1NTMJ 4L73A 4U3FD 1VQNP 1SQBJ 4IL6X 2WPSA 3U59A 2RKLA 1VQ6P 1KYOD 5AW5B 3W68A 3AE1C 2ITAA 1J1DC 2O3JA 1L4AC 1SQPD 1PZQA 5APUA 1KFNA 1LT9C 1EXJA 3GLMA 3H1KJ 2WPQA 4R4LA 5TISE 1M8OB 1X8YA 3L74G 5AVQB 4H44B 3CI9A 5M1BA 3GG2A 4U3FE 1JMBA 5AW0B 3LW5J 1GU4A 1YJWP 3O6QA 3RK3D 2M5AB 1KYOE 2H43A 3BATA 3P7KA 2ZFCA 4EI2A 4JPZB 5CMZA 3V4WA 1GK6A 3SWKA 2RMZA 2YO3A 5CCGD 1SFCB 1N2DC 3HTKB 3A0BH 3B71A 3RL0C 3BCCD 5KTBA 1KQFB 5KAIE 1A02F 5B66E 1NKZB 3MGNA 3RK3E 3L70G 1URQB 2IBZG 2O01J 1NTKD 1S5LX 5AVTB 1RF1C 4JYBA 2KXPB 1NKNA 2SPZA 1GL2B 2R3CA 3H1ID 4MN4C 4R4MA 4PD4I 4PJ0H 2HODA 5E79E 2HG5D 3MIWA 3M0AA 1EDJA 1EZVD 4I7ZB 3PJSK 1OW6A 5CHXA 3H6PA 2FFDA 3EFGA 4GODA 2HPCB 4IL6E 1NTKE 2R32A 3L75D 1ZP0C 2A06D 1FZGA 1KMIZ 3GHGC 4N6JA 3SWYA 3SFEC 1BSHA 2JKVA 2M8RA 3H1IE 2WSCH 1JO5A 1M56D 3H1LG 1Q7YQ 3P8CD 1IK9A 4Y99B 1OIPA
chains in the Genus database with same CATH topology
1NU1K 1FJKA 4GT1A 1YYCA 5APXA 2OYHA 3B5ND 1FZBA 1G1IA 2KB7P 3VP9A 2N1TC 1GDTA 2NPSC 2Q3IA 2WZ7A 2C9LY 1LTSC 1SQVK 1YTZT 1HWTC 3KYQA 3V4QA 1KILD 2N1TA 1HUCA 2NPSA 1M1JC 4OH8B 2POHA 4LLHA 2OYIB 1CSBA 2HYNA 2JJLA 2QM8A 5AVVB 3RK3B 4DZOA 2KLVA 3VTPC 1S9KE 3O8ZA 1SQBK 1SP4A 1G2CB 1JY3N 3A5TA 1LGHB 1GK4A 3RL0D 2KOGA 3LW5H 5KJ7D 1RE4C 3P8CE 5AVXB 1MUUA 2WITA 5BU5A 1T2KC 5AVRB 1RY3A 1ZV8A 4AQRD 2FYUK 1L0LK 3VOPA 2A45H 1SQPK 3RK2D 3TYYA 3BRVB 1N86A 4JF7A 1ZR2A 2GUVA 4M3LA 1AFOA 3L37A 1FZEA 4GKGA 1WRGA 3V5BA 4W80A 3HD7C 1OWAA 1LTJB 4B86A 2IPPA 1G1JA 1SFCD 3HUSB 3RK2C 2OYIA 1N73B 1MFZA 3HD7A 1J1EC 1FDMA 2KSJA 3UIAA 3H32B 2IFNA 4JYCA 1N7SC 3BRTB 1G2CA 3B8EB 1ZN5A 1URQD 3VP8A 4DOJA 3SWFA 1W2EA 3NXSA 1N7SA 3L35A 3M9QA 1SFCC 2FFDC 1JCDA 1LTTC 1FZAA 1H8AA 1NHLA 2W27A 4KHXA 1L4AB 2XKMA 1X9VA 3HTKA 3A7OA 1JY2O 2PAJA 4C7NB 1WT6A 3M0DC 1URQC 3P32A 3NFQA 1LTIC 3HE4B 1JTHB 1LT9B 3P8MC 3U1CA 2N1TD 2NPSD 1LTJA 4WY4C 1GL2C 3HUSA 1N73A 3MD0A 3C9IA 1ZLLA 3TSIA 2XZRA 5AVWB 3II6A 1GL2A 2A45I 2OYHC 1JCCA 1LWUC 4W7YA 5AW2B 1HGVA 4ZKUA 3M9BA 2C0WA 3NMDA 1JOCA 1NO4A 1SVFA 3EQ2A 3A3YB 3B5NB 1FZCB 5CJ4A 1LWUA 4WBAA 2WSEH 3T97A 1KQLA 2CPBA 1LTBC 3G3ZA 1CZQA 2GM4A 4HH2A 2Q9IA 4EIJA 1HBWA 1IFJA 3VYIA 1KILB 1FU1A 1IFMA 3M9HA 1T2KD 1L4AA 3L4FA 1DH3A 2N9BA 3NTNA 2HPCA 2OARA 2J59M 1YTZI 5APWA 1NTMK 3IR9A 2I1JA 2H7HA 3N4XA 1LTGC 2A45G 2H8PD 3HE4A 1JTHA 1NWQA 3L36A 2E42A 5AVUB 3RL0B 3BVHA 1L0NK 2PP6A 3M06A 2YNYA 5AW3B 1IO4A 1NOHA 4HYTB 3HD7D 5BVZA 5AW8B 4Y99C 2WWWA 3CL3D 1GW4A 5CCHA 1OXZA 3BASA 2QM7A 1NH4A 1FJPA 2HODB 3HRNA 5CJ0A 5APTA 2YMYA 3B5NA 1FZCA 1N7SD 1FOSF 3E1IA 3OA7A 3TNUB 3V2NA 1ZR4A 2W6AA 2OYIC 4AYCA 4EOTA 1A02J 3HE5B 1E5WA 3TK1A 1HH0A 1T3UA 1KILA 3RK3C 1GTWA 1HGZA 1VDFA 1FOSE 2FKWB 5AW7B 1JY2N 2YKOA 3I5CA 1DX7A 5AW6B 2WT7B 5AVZB 2O01H 2GUSA 4N78D 1Z56A 2ZXEB 1IC2A 2KYVA 3V2QA 1IFNA 3U1AA 1MV8A 3GHGB 5KJ7A 2E43A 1KZUB 1SQQK 4N3YB 5CCGC 3KPEA 2I1KA 2IX7C 1KFMA 2WPRA 4WY4D 1J1DB 1GL2D 2P67A 4O9BA 1GD2E 3OJAB 5CCGA 3WMM0 2P2UA 1JY2P 2P7JA 2FYZA 2KP8A 3V2PA 1XTGB 1LTJC 3M91A 3TNUA 1CI6B 2C0XA 4WB4A 1IFIA 3HUSC 1N73C 2N1TB 3HE5A 2NPSB 1L4AD 2P1JA 4N78E 2Z4EA 1IFDA 1NTKK 4XA4A 1M1JB 1GZLA 2Q7CA 1RF0C 2IFMA 2MJZA 2Z5IA 3H32A 2VRSA 2LKMA 2XU6A 1RF0A 2WPSA 3U59A 4C7RA 1FBMA 4ZKPA 5AW5B 3GHGA 1J1DC 2O1JA 1L4AC 4XE5B 3LIDA 4IFFA 5AW1B 5CCHD 5APUA 1KFNA 2J58A 3V2RA 1LT9C 2R5DA 3PP5A 2YO2A 4C7NA 4W7ZA 4IFDK 2WPQA 2YKPA 1LT9A 1GW3A 1M7LA 1CI6A 1X8YA 3N7NA 1NAFA 2FXMA 5AVQB 3CI9A 2XDJA 2HFED 5KLVK 2O1KA 5CCHC 1JNMA 1HJBA 3HD7B 5AW0B 1GU4A 2BASA 3RK3D 1M1JA 1RF1B 2H43A 3RK2B 1N7LA 3BATA 3B5NC 1FZCC 1J1EB 5APSA 3P7KA 1GU5A 1DEBA 2ZFCA 3A2AA 2Q5UA 1FZFA 4RESB 5CMZA 1T3JA 2XV5A 1N7SB 1KILC 1MZ9A 5APYA 3V4WA 1GK6A 4LGDE 2XNXA 1AQ5A 1RE4A 2YO3A 4IFMA 1JMMA 5CCGD 1IJDB 1SFCB 2FFDB 1N2DC 3HTKB 1PFIA 2C9NY 4I6MC 3KQGA 5AVYB 3RL0C 2Z5HA 5KTBA 5KJ7C 1XTCC 1HVVA 3LIEA 1LTAC 4GIFA 1A02F 1NKZB 3MGNA 1JY3O 1JY3P 1URQB 3MUDA 1SQXK 2HLOA 5APQA 3CLQA 5AVTB 1QL1A 3VN0A 4JYBA 1RF1C 3R2PA 1NKNA 1X79B 4WY4B 1GL2B 2R3CA 3OAKA 1RF1A 2WSFH 5AW4B 1H89A 2OYHB 1FAVA 3VMYA 2HODA 1LWUB 1NTZK 2HG5D 1VPCA 5AW9B 5AVSB 3IFMA 3MIWA 3M0AA 4AUWA 3VMXA 2W6BA 1EQ7A 5CHXA 3H6PA 3MTUE 1SFCA 2FFDA 1RE3C 3EFGA 2HPCB 3KDPB 1CW5A 2R32A 1RE3A 4I2LC 2WT7A 2JEEA 1FZGA 3GHGC 5APVA 1JUNA 4N6JA 3SWYA 1H88A 1T8ZA 2YKQA 4I1LA 2M8RA 3M0DA 1URQA 2R5BA 4LC1A 1HTLC 1S9KD 2L5GB 2WSCH 4C46A 1JO5A 1J2JB 2M3BA 2WTYA 2CPSA 3VMZA 4WY4A 3P8CD 1QL2A 1IK9A 5BU8B 4Y99B 1SLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKU A;  1WT6 A;  2JEE A;  3N4X A;  5KTB A;  3HRN A;  4N78 D;  4GIF A;  3VP9 A;  1IC2 A;  3U59 A;  3VP8 A;  4ZKP A;  4I1L A;  3U1C A;  3U1A A;  3N7N A;  2FXM A;  4N3Y B;  5BU5 A;  2POH A;  5BVZ A;  1NKN A;  3C9I A;  1X79 B;  4O9B A;  3P8C D;  3OJA B;  5BU8 B;  3BAS A;  3BAT A; 
#chains in the Genus database with same CATH topology
 1NU1 K;  1EZV E;  1QX8 A;  2KB7 P;  4U7J A;  2WZ7 A;  3G9R A;  3PTZ A;  3G71 P;  1Y47 A;  1HWT C;  3V4Q A;  1HUC A;  3L75 E;  4D6T G;  1M1J C;  2A06 E;  5KAF H;  2YMK A;  3RK3 B;  3IF4 A;  2KLV A;  2FBW C;  3VTP C;  1SP4 A;  1GK4 A;  2KOG A;  2JDI H;  1RE4 C;  3CCR P;  3P8C E;  3L74 J;  2Y0D A;  2ZYD A;  2IZ0 A;  4OGQ C;  2WIT A;  2QRX A;  1RY3 A;  2E75 D;  3H1J D;  2A45 H;  1SQP K;  1YQ4 C;  1N86 A;  2GUV A;  3S1K A;  4DJG A;  2V7Q J;  1WRG A;  3HD7 C;  1OWA A;  2E75 C;  4B86 A;  3CXH H;  3HUS B;  2OYI A;  3WUT A;  1N73 B;  1J1E C;  4UB6 E;  3ITK A;  3H1J E;  4H0L C;  4DOJ A;  1KYO I;  1W2E A;  3L73 D;  3M9Q A;  1JCD A;  4EYY Q;  4ZNC A;  4GOE A;  1FZA A;  1LT1 A;  3MP7 B;  2W27 A;  3R4Y A;  3Q5R A;  2XKM A;  5GTI H;  1FC2 C;  3HTK A;  1MKM A;  2PAJ A;  3TF5 A;  1SQV D;  2K3R A;  2N1T D;  1YIT P;  2NPS D;  1LTJ A;  4WY4 C;  2N9Y B;  1PGJ A;  2JWD A;  1Y8A A;  1HF9 A;  3C9I A;  1ZXG A;  2M3E A;  1GL2 A;  2OYH C;  1JCC A;  3L73 E;  1BCC D;  1LWU C;  1HGV A;  3M9B A;  2C0W A;  1EC5 A;  1YJN P;  3CMA P;  2WSE H;  1LTB C;  3RBX A;  2GM4 A;  2QJY C;  3TGU D;  3VYI A;  1SQV E;  3H1L J;  1L4A A;  2WSS H;  1M90 Q;  2HPC A;  2OAR A;  1YTZ I;  2JWA A;  1VF5 D;  2FYN C;  5APW A;  3IR9 A;  1UII A;  2QSI A;  3HE4 A;  1S2E A;  5AVU B;  3BVH A;  1BCC E;  2ZXX A;  1DD3 A;  1KB9 E;  4D6T J;  1YBK A;  1K05 A;  2GA1 A;  2ZYG A;  1GW4 A;  2FYU E;  4PV1 C;  3D71 A;  3TGU E;  1FJP A;  1FOS F;  3E1I A;  2K88 A;  2JR8 A;  2R3S A;  2W6A A;  3CCQ P;  2AXT E;  3GMA A;  4EOT A;  1A02 J;  1E5W A;  2Y9Y A;  2ZAE B;  1OW7 A;  1EZV I;  1HH0 A;  1T3U A;  2D2C D;  1VDF A;  2FKW B;  4YXD C;  5AVZ B;  3CWB G;  1AVO A;  2ZXE B;  1VQP P;  1MV8 A;  2XND H;  1VQM P;  4WWI A;  1SQQ K;  2I1K A;  1VQO P;  2P67 A;  1GD2 E;  5CCG A;  3WMM 0;  4CPG A;  2KIK A;  3CME P;  3CCM P;  3CX5 D;  1JY2 P;  1XTG B;  3H1H D;  3M91 A;  2C0X A;  3C1L A;  3G4S P;  1K73 Q;  1L0N G;  2QJK B;  2N1T B;  2NPS B;  1D7M A;  2P1J A;  1NTM D;  3O6Q B;  1SQB D;  4UB8 E;  2Z5I A;  2VRS A;  1PGP A;  3L71 G;  2Q3E A;  1NGM B;  2XU6 A;  4C7R A;  1FBM A;  4ZKP A;  3GHG A;  2QE7 H;  3CX5 E;  3LID A;  4L74 A;  2HR3 A;  4YXW H;  5AW1 B;  5CCH D;  3H1H E;  1OVV A;  4PD4 H;  2K9J A;  3H1K D;  2J58 A;  1VF5 B;  2R5D A;  3AEG C;  1NTM E;  5KLI B;  4YPC A;  1SQB E;  2FXM A;  2G8Y A;  2HFE D;  5KLV K;  3AE6 C;  5CCH C;  3Q1M A;  4Z1M H;  1M1J A;  3H25 A;  3RK2 B;  1N7L A;  3B5N C;  1FZC C;  2NZ2 A;  1FZF A;  1IZN B;  1AV1 A;  3H1K E;  1RE4 A;  4IFM A;  2D2C B;  1JMM A;  1IJD B;  2FFD B;  1PFI A;  2C9N Y;  2K37 A;  1VQL P;  5AVY B;  2PGD A;  3AE2 C;  5KJ7 C;  1HVV A;  1USE A;  2HLO A;  4ASV A;  5APQ A;  1RH5 B;  3CLQ A;  1EDK A;  1ZW0 A;  3R2P A;  1X79 B;  4H13 D;  2E74 C;  1NU1 G;  1LP1 A;  2WSF H;  5AW4 B;  1KB9 I;  3CWB J;  1FAV A;  4YTP C;  1YI2 P;  5AVS B;  3WUV A;  2QJP B;  2WQY C;  4AUW A;  3AEB C;  2J5U A;  1EQ7 A;  1S72 P;  1EDI A;  3MTU E;  3D6Z A;  1PP9 G;  3AE3 C;  2MKV A;  1RE3 A;  2JEE A;  5APV A;  2YKQ A;  1L0N J;  5H2F E;  2L5G B;  4C46 A;  1FS0 E;  2M3B A;  5TIS H;  2BCC G;  2CPS A;  1SQP G;  4WY4 A;  4JQ0 D;  1QL2 A;  4BWN A;  2IZ1 A;  2V4H A;  2WVR A;  3L71 J;  4KJM A;  2OYH A;  3JC2 2;  1KYO H;  1GDT A;  1ZRT D;  2C9L Y;  1LTS C;  1SQX G;  1TU3 F;  4IOI H;  2N1T A;  2NPS A;  4LLH A;  2OYI B;  1CSB A;  2HYN A;  1PV3 A;  2H89 C;  2K9Y A;  3AE7 C;  3L74 D;  1SQB K;  3A5T A;  2ZT9 B;  3RL0 D;  2B89 A;  1NTZ G;  2PFX A;  1EDL A;  5KAI H;  1YHQ P;  3D70 A;  2DW3 A;  5B66 H;  1FDO A;  3VOP A;  1ZRT E;  3AED C;  3BRV B;  2W90 A;  1S4X A;  2OQQ A;  3CX5 I;  4M3L A;  2OTK E;  2QIW A;  2W8Z A;  4W80 A;  4OWF A;  3BCC G;  3G6E P;  1LTJ B;  2IPP A;  5E79 H;  3L74 E;  1MFZ A;  2KSJ A;  4H13 B;  1ZOY C;  3Q5S A;  1N7S C;  3BRT B;  2IBZ D;  3B8E B;  4IL6 H;  4BXL A;  2ZJS E;  1KQG B;  1NHL A;  4KHX A;  1L4A B;  4QMA A;  1P84 D;  3TDK A;  1NU1 J;  5KKZ C;  3M0D C;  3CCE P;  3NFQ A;  1LTI C;  3HE4 B;  1LT9 B;  1JM0 A;  3A0H E;  2W83 C;  3L70 E;  1KD1 Q;  1BDC A;  1H0T A;  2IBZ E;  1ZLL A;  1L0L G;  1PP9 J;  1RHZ B;  5AW2 B;  4ZKU A;  3FWL A;  1SVF A;  4WBA A;  2WPV B;  2CPB A;  3CC7 P;  3H1L D;  4HH2 A;  2Q9I A;  1P84 E;  2JO1 A;  1HBW A;  3CD6 P;  1IFJ A;  1PGQ A;  1FU1 A;  4OGQ D;  1IFM A;  3Q5P A;  3M9H A;  2BCC J;  3AEA C;  2A45 G;  4D6T D;  1OW8 A;  3RL0 B;  3B4S A;  3I55 P;  3M06 A;  1SQX J;  1SQQ G;  3SFD C;  1IO4 A;  4HYT B;  3HD7 D;  4Y28 J;  5BVZ A;  2Y0E A;  2WWW A;  3CL3 D;  5CCH A;  3H1L E;  3QWO C;  2CK3 H;  3FXD A;  1K04 A;  5GTH E;  1PPJ G;  2WMM A;  1PGO A;  3B5N A;  1FZC A;  1NTZ J;  1S5L E;  5CBN A;  4H0L D;  4UB6 H;  1YIJ P;  1GTW A;  1HGZ A;  2E76 C;  4D6T E;  5AW7 B;  1NJI Q;  1DX7 A;  3EWK A;  3Q2Y A;  5AW6 B;  4N78 D;  4EDF A;  2IDB A;  1IFN A;  3BCC J;  3GHG B;  3L70 J;  5KJ7 A;  4N3Y B;  2IX7 C;  2WPR A;  4WY4 D;  3CCU P;  2K9J B;  4DT0 A;  2FXP A;  3TNU A;  3ZDM A;  1IFI A;  5B5E E;  1UIX A;  3HE5 A;  3PHL A;  3PLN A;  5KLV G;  4N78 E;  2Z4E A;  1NTK K;  4NPD A;  1M1J B;  2Q7C A;  2WSC J;  2IFM A;  1KB9 D;  1EXI A;  2LKM A;  2PRR A;  1BCC G;  1RF0 A;  2YXR B;  1BGY G;  2FYU D;  2YIU C;  4XE5 B;  2IYO A;  2YXQ B;  4IFF A;  1L0L J;  1E79 H;  2OYO A;  3PP5 A;  1KTM A;  2YO2 A;  4PV1 D;  4IFD K;  1LT9 A;  1M7L A;  1CI6 A;  3V6I A;  2XDJ A;  1HJB A;  3HD7 B;  3JCU E;  2E75 B;  2BAS A;  2B87 A;  2AXT H;  4BRY B;  1LP1 B;  1J1E B;  2IBZ I;  1R5S A;  1PIX A;  4RES B;  2XV5 A;  1U7M A;  1KIL C;  1N8R Q;  4H0L B;  4LGD E;  4TT3 H;  1SQQ J;  1AQ5 A;  3AEE C;  2OTL P;  1P84 I;  2LXC B;  2Z5H A;  3AE5 C;  3LIE A;  1LTA C;  4GIF A;  2KK7 A;  1JY3 O;  1R8E A;  3VN0 A;  1KN7 A;  1BE3 G;  1JEK A;  3CWB D;  4WY4 B;  3OAK A;  1RF1 A;  2Q1K A;  3KZI E;  2IYP A;  1H89 A;  4TLF A;  2OYH B;  3VMY A;  3WU2 E;  1LWU B;  3F5H A;  3T97 B;  1VPC A;  5AW9 B;  3IFM A;  4UB8 H;  1AJY A;  3E7K A;  1AVY A;  2W6B A;  4HKZ H;  3CC2 P;  1KV4 A;  3CX5 H;  3KDP B;  4I2L C;  4RO0 A;  1L0N D;  2FYN B;  1JUN A;  1H88 A;  3CWB E;  1RQV A;  4JBZ A;  3M0D A;  1S9K D;  2ZVO B;  5KLV J;  3C8V A;  2WSE J;  1OVR A;  3L71 D;  3VMZ A;  1SLQ A;  1YYC A;  5APX A;  1W5C E;  3B5N D;  1G1I A;  4PV1 B;  3VP9 A;  2Q3I A;  1BGY J;  1AQT A;  1SQV K;  3RL0 g;  2POH A;  1T6A A;  1L0N E;  2JJL A;  2QM8 A;  5AVV B;  3L72 G;  1S9K E;  3O8Z A;  1LGH B;  3E1R A;  1VQ4 P;  3CC4 P;  3L71 E;  4GDO A;  2AEJ A;  3LW5 H;  5KJ7 D;  2FXO A;  1NAY A;  5AVX B;  5BU5 A;  1T2K C;  5AVR B;  4AQR D;  2FYU K;  3TYY A;  2OTJ P;  4JF7 A;  3IN6 A;  2E74 D;  1FDI A;  1K8A Q;  1S1C X;  3MUD C;  2AXC A;  4H44 C;  1FZE A;  4GKG A;  3WUU A;  4HB1 A;  4XFJ A;  3GF3 A;  1H0T B;  1SFC D;  3HD7 A;  3SSU A;  3H32 B;  4BRY A;  1X0T A;  2IFN A;  4KT0 J;  2LR2 A;  1G2C A;  1URQ D;  3VP8 A;  2W6J H;  3NXS A;  1SFC C;  1OMI A;  4HJG H;  1LTT C;  1BE3 J;  1NU1 D;  3FXE A;  2QVA A;  3A7O A;  1JY2 O;  4C7N B;  1URQ C;  3S4R A;  1VQ8 P;  3P8M C;  4U3F G;  1DIP A;  1AA0 A;  1Q86 Q;  1GL2 C;  1PP9 D;  1KQS O;  3MD0 A;  3S9O A;  5AVW B;  3GW6 A;  3II6 A;  3AE4 C;  3D6Y A;  3NMD A;  1QVF O;  4OVN F;  3A3Y B;  1NU1 E;  3B5N B;  1FZC B;  1LWU A;  3T97 A;  1KQL A;  4I7Z C;  3G3Z A;  1ZME C;  4EIJ A;  4GOF A;  2BCC D;  3AEC C;  3AE8 C;  3RGU A;  1DH3 A;  2N9B A;  3NTN A;  2J59 M;  2OGU A;  5CBO A;  1NTM K;  1PP9 E;  2H7H A;  1SQX D;  1LTG C;  2H8P D;  1JTH A;  2E5Y A;  1NWQ A;  1IFP A;  4K35 A;  1BDD A;  1L0N K;  2PP6 A;  2YNY A;  5AW3 B;  2KUB A;  5AW8 B;  4L75 A;  4Y99 C;  3L72 J;  1OXZ A;  1NTZ D;  2BCC E;  1SQP E;  1KC8 Q;  1NH4 A;  2ZVN B;  2E74 B;  2RN0 A;  1OZH A;  3HRN A;  5APT A;  2YMY A;  1N7S D;  3TNU B;  3V2N A;  4AYC A;  3HE5 B;  3TK1 A;  1LJ2 A;  3RK3 C;  1KIL A;  1SQX E;  5K5G B;  1M1K Q;  1NTK G;  4ZMD A;  3I5C A;  2V7Q H;  2WT7 B;  2KI7 B;  3L70 D;  2GUS A;  3H1I G;  1Z56 A;  3CCL P;  1R5L A;  3U1A A;  2WSF J;  1NTZ E;  5CCG C;  3KPE A;  3A0B E;  1L2P A;  1KFM A;  1J1D B;  3USS A;  2K1A A;  4O9B A;  3OJA B;  3A0H H;  1QVG O;  1EZV G;  1K9M Q;  1WMK A;  2P2U A;  2KP8 A;  1QGK B;  2L91 A;  1QEX A;  1CI6 B;  3L75 G;  2A06 G;  3HUS C;  1N73 C;  3QH9 A;  4PJ0 E;  3BCC E;  1IFD A;  1KOR A;  1P84 H;  2B87 B;  2B9B A;  2FY8 A;  2MJZ A;  3H32 A;  3PH0 A;  1U57 A;  4U3F J;  1L0L D;  2O1J A;  2Q6Q A;  2KZI A;  1SQP J;  2JP3 A;  3VMA A;  1RQU A;  3V2R A;  1Q90 D;  4A7P A;  4C7N A;  4W7Z A;  2YKP A;  1GW3 A;  2M0B A;  3N7N A;  1NAF A;  1YJ9 P;  5GTH H;  2O1K A;  1JNM A;  3CPW O;  2E5T A;  1S5L H;  2KS1 A;  1RF1 B;  2E76 D;  1L0L E;  3H1J G;  5APS A;  3PRJ A;  1GU5 A;  1DEB A;  3A2A A;  2BEQ D;  2Q5U A;  1SQQ D;  3MZW B;  5KAF E;  2H88 C;  1T3J A;  1OX3 A;  1N7S B;  1MZ9 A;  3CCS P;  5APY A;  3FGA D;  2XNX A;  2R44 A;  1VL2 A;  2Y0C A;  3CXH D;  1PPJ D;  4I6M C;  1VQ9 P;  4DCK A;  3KQG A;  1XTC C;  5KKZ B;  1JY3 P;  3MUD A;  1SQX K;  2B88 A;  3AE9 C;  1QL1 A;  3L73 G;  2G3A A;  1SQQ E;  2QA4 P;  1S3J A;  4WVZ A;  5B5E H;  1NTK J;  2M5A A;  3FX0 A;  1NVO A;  2P58 A;  3H1I J;  1NTZ K;  5TJH A;  1NYH A;  3CXH E;  1PPJ E;  5DJT B;  5EFW B;  1SQV G;  3VMX A;  1W2B O;  3KHU A;  1SFC A;  1RE3 C;  3F89 A;  1CW5 A;  2WT7 A;  2UWJ E;  5KLV D;  1T8Z A;  4I1L A;  2P10 A;  1VQ5 P;  1URQ A;  3L75 J;  2R5B A;  5GTI E;  4LC1 A;  1HTL C;  1J2J B;  2FYU G;  2WTY A;  4OGQ B;  3TGU G;  5BU8 B;  2O01 N;  1FJK A;  1BGY D;  1KB9 H;  3K5B A;  4GT1 A;  3JCU H;  3KXD A;  2AEF A;  1FZB A;  2QJK C;  2N1T C;  2NPS C;  1LNQ A;  1YTZ T;  3KYQ A;  1KIL D;  2QG4 A;  4OH8 B;  5KLV E;  1QLE D;  4DZO A;  3EFF K;  5L8R J;  2E76 B;  2KNC B;  1G2C B;  1JY3 N;  4RKU J;  1MUU A;  1BGY E;  1ZV8 A;  1L0L K;  1VF5 C;  3RK2 D;  1FE6 A;  1OFC X;  5KLI C;  1ZR2 A;  1HJ0 A;  3H1J J;  1KIL E;  3Q3D A;  3I56 P;  4K3A A;  1AFO A;  3L37 A;  3FWN A;  2RH0 A;  3V5B A;  3KZI H;  1G1J A;  3WU2 H;  3RK2 C;  1FDM A;  3CCJ P;  3UIA A;  1U7J A;  4JYC A;  1YQ3 C;  4L76 A;  1ZN5 A;  1BSN A;  3SWF A;  2I8D A;  1BE3 D;  1Q2N A;  1N7S A;  3L35 A;  2D2C C;  2FFD C;  3H1H G;  1H8A A;  2QJY B;  3L73 J;  3OW2 O;  2YIU B;  2QEX P;  1X9V A;  1NTM G;  1WT6 A;  1DD4 A;  3P32 A;  1SQB G;  1JTH B;  3U1C A;  1SQV J;  2KSE A;  3GF7 A;  3HUS A;  1N73 A;  3TSI A;  1USD A;  2XZR A;  2A45 I;  1BE3 E;  4PD4 D;  4W7Y A;  1JOC A;  1NO4 A;  3EQ2 A;  1Q82 Q;  1BCC J;  2QJP C;  3H1K G;  5CJ4 A;  2AEM A;  1CZQ A;  2BEZ F;  1OVU A;  1KIL B;  1Y9B A;  2FYU J;  1T2K D;  3L4F A;  1Q81 Q;  3CXH I;  3TGU J;  2I1J A;  2KZJ A;  3N4X A;  1VQ7 P;  1VQK P;  1GMJ A;  2KLU A;  3L36 A;  2E42 A;  3RBZ A;  4H44 D;  1X22 A;  4PD4 E;  3L72 D;  1NOH A;  3W67 A;  3BAS A;  2QM7 A;  3AEF C;  3IAO A;  2HOD B;  2ZT9 D;  5CJ0 A;  3ABV C;  3JSV C;  1M57 D;  3OA7 A;  4ASW A;  4NPE A;  1ZR4 A;  2OYI C;  1FOS E;  1JY2 N;  2YKO A;  2ZYA A;  2ZT9 C;  3L72 E;  3MHV A;  2O01 H;  1DEE G;  2KNC A;  3CCV P;  1IC2 A;  2KYV A;  3V2Q A;  2E43 A;  1KZU B;  4NPF X;  1MFT A;  1GL2 D;  5H2F H;  2LXB A;  1JB0 J;  5DJU B;  2P7J A;  1SS1 A;  2FYZ A;  1IK7 A;  3V2P A;  1LTJ C;  4WB4 A;  2Y9Z A;  3H1H J;  4RJT A;  4H13 C;  1L4A D;  5C39 A;  1PL5 A;  2NRG A;  4XA4 A;  2KS1 B;  1GZL A;  1RF0 C;  1NTM J;  4L73 A;  4U3F D;  1VQN P;  1SQB J;  4IL6 X;  2WPS A;  3U59 A;  2RKL A;  1VQ6 P;  1KYO D;  5AW5 B;  3W68 A;  3AE1 C;  2ITA A;  1J1D C;  2O3J A;  1L4A C;  1SQP D;  1PZQ A;  5APU A;  1KFN A;  1LT9 C;  1EXJ A;  3GLM A;  3H1K J;  2WPQ A;  4R4L A;  5TIS E;  1M8O B;  1X8Y A;  3L74 G;  5AVQ B;  4H44 B;  3CI9 A;  5M1B A;  3GG2 A;  4U3F E;  1JMB A;  5AW0 B;  3LW5 J;  1GU4 A;  1YJW P;  3O6Q A;  3RK3 D;  2M5A B;  1KYO E;  2H43 A;  3BAT A;  3P7K A;  2ZFC A;  4EI2 A;  4JPZ B;  5CMZ A;  3V4W A;  1GK6 A;  3SWK A;  2RMZ A;  2YO3 A;  5CCG D;  1SFC B;  1N2D C;  3HTK B;  3A0B H;  3B71 A;  3RL0 C;  3BCC D;  5KTB A;  1KQF B;  5KAI E;  1A02 F;  5B66 E;  1NKZ B;  3MGN A;  3RK3 E;  3L70 G;  1URQ B;  2IBZ G;  2O01 J;  1NTK D;  1S5L X;  5AVT B;  1RF1 C;  4JYB A;  2KXP B;  1NKN A;  2SPZ A;  1GL2 B;  2R3C A;  3H1I D;  4MN4 C;  4R4M A;  4PD4 I;  4PJ0 H;  2HOD A;  5E79 E;  2HG5 D;  3MIW A;  3M0A A;  1EDJ A;  1EZV D;  4I7Z B;  3PJS K;  1OW6 A;  5CHX A;  3H6P A;  2FFD A;  3EFG A;  4GOD A;  2HPC B;  4IL6 E;  1NTK E;  2R32 A;  3L75 D;  1ZP0 C;  2A06 D;  1FZG A;  1KMI Z;  3GHG C;  4N6J A;  3SWY A;  3SFE C;  1BSH A;  2JKV A;  2M8R A;  3H1I E;  2WSC H;  1JO5 A;  1M56 D;  3H1L G;  1Q7Y Q;  3P8C D;  1IK9 A;  4Y99 B;  1OIP A; 
#chains in the Genus database with same CATH homology
 1NU1 K;  1FJK A;  4GT1 A;  1YYC A;  5APX A;  2OYH A;  3B5N D;  1FZB A;  1G1I A;  2KB7 P;  3VP9 A;  2N1T C;  1GDT A;  2NPS C;  2Q3I A;  2WZ7 A;  2C9L Y;  1LTS C;  1SQV K;  1YTZ T;  1HWT C;  3KYQ A;  3V4Q A;  1KIL D;  2N1T A;  1HUC A;  2NPS A;  1M1J C;  4OH8 B;  2POH A;  4LLH A;  2OYI B;  1CSB A;  2HYN A;  2JJL A;  2QM8 A;  5AVV B;  3RK3 B;  4DZO A;  2KLV A;  3VTP C;  1S9K E;  3O8Z A;  1SQB K;  1SP4 A;  1G2C B;  1JY3 N;  3A5T A;  1LGH B;  1GK4 A;  3RL0 D;  2KOG A;  3LW5 H;  5KJ7 D;  1RE4 C;  3P8C E;  5AVX B;  1MUU A;  2WIT A;  5BU5 A;  1T2K C;  5AVR B;  1RY3 A;  1ZV8 A;  4AQR D;  2FYU K;  1L0L K;  3VOP A;  2A45 H;  1SQP K;  3RK2 D;  3TYY A;  3BRV B;  1N86 A;  4JF7 A;  1ZR2 A;  2GUV A;  4M3L A;  1AFO A;  3L37 A;  1FZE A;  4GKG A;  1WRG A;  3V5B A;  4W80 A;  3HD7 C;  1OWA A;  1LTJ B;  4B86 A;  2IPP A;  1G1J A;  1SFC D;  3HUS B;  3RK2 C;  2OYI A;  1N73 B;  1MFZ A;  3HD7 A;  1J1E C;  1FDM A;  2KSJ A;  3UIA A;  3H32 B;  2IFN A;  4JYC A;  1N7S C;  3BRT B;  1G2C A;  3B8E B;  1ZN5 A;  1URQ D;  3VP8 A;  4DOJ A;  3SWF A;  1W2E A;  3NXS A;  1N7S A;  3L35 A;  3M9Q A;  1SFC C;  2FFD C;  1JCD A;  1LTT C;  1FZA A;  1H8A A;  1NHL A;  2W27 A;  4KHX A;  1L4A B;  2XKM A;  1X9V A;  3HTK A;  3A7O A;  1JY2 O;  2PAJ A;  4C7N B;  1WT6 A;  3M0D C;  1URQ C;  3P32 A;  3NFQ A;  1LTI C;  3HE4 B;  1JTH B;  1LT9 B;  3P8M C;  3U1C A;  2N1T D;  2NPS D;  1LTJ A;  4WY4 C;  1GL2 C;  3HUS A;  1N73 A;  3MD0 A;  3C9I A;  1ZLL A;  3TSI A;  2XZR A;  5AVW B;  3II6 A;  1GL2 A;  2A45 I;  2OYH C;  1JCC A;  1LWU C;  4W7Y A;  5AW2 B;  1HGV A;  4ZKU A;  3M9B A;  2C0W A;  3NMD A;  1JOC A;  1NO4 A;  1SVF A;  3EQ2 A;  3A3Y B;  3B5N B;  1FZC B;  5CJ4 A;  1LWU A;  4WBA A;  2WSE H;  3T97 A;  1KQL A;  2CPB A;  1LTB C;  3G3Z A;  1CZQ A;  2GM4 A;  4HH2 A;  2Q9I A;  4EIJ A;  1HBW A;  1IFJ A;  3VYI A;  1KIL B;  1FU1 A;  1IFM A;  3M9H A;  1T2K D;  1L4A A;  3L4F A;  1DH3 A;  2N9B A;  3NTN A;  2HPC A;  2OAR A;  2J59 M;  1YTZ I;  5APW A;  1NTM K;  3IR9 A;  2I1J A;  2H7H A;  3N4X A;  1LTG C;  2A45 G;  2H8P D;  3HE4 A;  1JTH A;  1NWQ A;  3L36 A;  2E42 A;  5AVU B;  3RL0 B;  3BVH A;  1L0N K;  2PP6 A;  3M06 A;  2YNY A;  5AW3 B;  1IO4 A;  1NOH A;  4HYT B;  3HD7 D;  5BVZ A;  5AW8 B;  4Y99 C;  2WWW A;  3CL3 D;  1GW4 A;  5CCH A;  1OXZ A;  3BAS A;  2QM7 A;  1NH4 A;  1FJP A;  2HOD B;  3HRN A;  5CJ0 A;  5APT A;  2YMY A;  3B5N A;  1FZC A;  1N7S D;  1FOS F;  3E1I A;  3OA7 A;  3TNU B;  3V2N A;  1ZR4 A;  2W6A A;  2OYI C;  4AYC A;  4EOT A;  1A02 J;  3HE5 B;  1E5W A;  3TK1 A;  1HH0 A;  1T3U A;  1KIL A;  3RK3 C;  1GTW A;  1HGZ A;  1VDF A;  1FOS E;  2FKW B;  5AW7 B;  1JY2 N;  2YKO A;  3I5C A;  1DX7 A;  5AW6 B;  2WT7 B;  5AVZ B;  2O01 H;  2GUS A;  4N78 D;  1Z56 A;  2ZXE B;  1IC2 A;  2KYV A;  3V2Q A;  1IFN A;  3U1A A;  1MV8 A;  3GHG B;  5KJ7 A;  2E43 A;  1KZU B;  1SQQ K;  4N3Y B;  5CCG C;  3KPE A;  2I1K A;  2IX7 C;  1KFM A;  2WPR A;  4WY4 D;  1J1D B;  1GL2 D;  2P67 A;  4O9B A;  1GD2 E;  3OJA B;  5CCG A;  3WMM 0;  2P2U A;  1JY2 P;  2P7J A;  2FYZ A;  2KP8 A;  3V2P A;  1XTG B;  1LTJ C;  3M91 A;  3TNU A;  1CI6 B;  2C0X A;  4WB4 A;  1IFI A;  3HUS C;  1N73 C;  2N1T B;  3HE5 A;  2NPS B;  1L4A D;  2P1J A;  4N78 E;  2Z4E A;  1IFD A;  1NTK K;  4XA4 A;  1M1J B;  1GZL A;  2Q7C A;  1RF0 C;  2IFM A;  2MJZ A;  2Z5I A;  3H32 A;  2VRS A;  2LKM A;  2XU6 A;  1RF0 A;  2WPS A;  3U59 A;  4C7R A;  1FBM A;  4ZKP A;  5AW5 B;  3GHG A;  1J1D C;  2O1J A;  1L4A C;  4XE5 B;  3LID A;  4IFF A;  5AW1 B;  5CCH D;  5APU A;  1KFN A;  2J58 A;  3V2R A;  1LT9 C;  2R5D A;  3PP5 A;  2YO2 A;  4C7N A;  4W7Z A;  4IFD K;  2WPQ A;  2YKP A;  1LT9 A;  1GW3 A;  1M7L A;  1CI6 A;  1X8Y A;  3N7N A;  1NAF A;  2FXM A;  5AVQ B;  3CI9 A;  2XDJ A;  2HFE D;  5KLV K;  2O1K A;  5CCH C;  1JNM A;  1HJB A;  3HD7 B;  5AW0 B;  1GU4 A;  2BAS A;  3RK3 D;  1M1J A;  1RF1 B;  2H43 A;  3RK2 B;  1N7L A;  3BAT A;  3B5N C;  1FZC C;  1J1E B;  5APS A;  3P7K A;  1GU5 A;  1DEB A;  2ZFC A;  3A2A A;  2Q5U A;  1FZF A;  4RES B;  5CMZ A;  1T3J A;  2XV5 A;  1N7S B;  1KIL C;  1MZ9 A;  5APY A;  3V4W A;  1GK6 A;  4LGD E;  2XNX A;  1AQ5 A;  1RE4 A;  2YO3 A;  4IFM A;  1JMM A;  5CCG D;  1IJD B;  1SFC B;  2FFD B;  1N2D C;  3HTK B;  1PFI A;  2C9N Y;  4I6M C;  3KQG A;  5AVY B;  3RL0 C;  2Z5H A;  5KTB A;  5KJ7 C;  1XTC C;  1HVV A;  3LIE A;  1LTA C;  4GIF A;  1A02 F;  1NKZ B;  3MGN A;  1JY3 O;  1JY3 P;  1URQ B;  3MUD A;  1SQX K;  2HLO A;  5APQ A;  3CLQ A;  5AVT B;  1QL1 A;  3VN0 A;  4JYB A;  1RF1 C;  3R2P A;  1NKN A;  1X79 B;  4WY4 B;  1GL2 B;  2R3C A;  3OAK A;  1RF1 A;  2WSF H;  5AW4 B;  1H89 A;  2OYH B;  1FAV A;  3VMY A;  2HOD A;  1LWU B;  1NTZ K;  2HG5 D;  1VPC A;  5AW9 B;  5AVS B;  3IFM A;  3MIW A;  3M0A A;  4AUW A;  3VMX A;  2W6B A;  1EQ7 A;  5CHX A;  3H6P A;  3MTU E;  1SFC A;  2FFD A;  1RE3 C;  3EFG A;  2HPC B;  3KDP B;  1CW5 A;  2R32 A;  1RE3 A;  4I2L C;  2WT7 A;  2JEE A;  1FZG A;  3GHG C;  5APV A;  1JUN A;  4N6J A;  3SWY A;  1H88 A;  1T8Z A;  2YKQ A;  4I1L A;  2M8R A;  3M0D A;  1URQ A;  2R5B A;  4LC1 A;  1HTL C;  1S9K D;  2L5G B;  2WSC H;  4C46 A;  1JO5 A;  1J2J B;  2M3B A;  2WTY A;  2CPS A;  3VMZ A;  4WY4 A;  3P8C D;  1QL2 A;  1IK9 A;  5BU8 B;  4Y99 B;  1SLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...