1X79B

Crystal structure of human gga1 gat domain complexed with the gat-binding domain of rabaptin5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
90
structure length
90
Chain Sequence
ETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 90
sequence length 90
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1x79B00
3HRNA 4ZKUA 3OJAB 3P8CD 3U59A 3BASA 1WT6A 4GIFA 5KTBA 3U1AA 3VP9A 3VP8A 1X79B 2FXMA 2POHA 3BATA 5BVZA 3U1CA 1IC2A 4ZKPA 4N78D 2JEEA 5BU8B 4N3YB 1NKNA 4O9BA 3N7NA 4I1LA 3N4XA 5BU5A 3C9IA
chains in the Genus database with same CATH superfamily
3L35A 1NTZG 3HTKA 4RKUJ 3BRTB 2HG5D 1ZW0A 4KHXA 4IFFA 1VQOP 4PJ0E 1KB9I 5CMZA 1M90Q 1OW8A 3CCSP 2ZFCA 4KT0J 3PJSK 4PD4H 3KDPB 4Y28J 3GMAA 2E76C 1RF0A 1GL2C 3RK3C 1YQ3C 1VQ7P 2FYNC 3L75D 2BEQD 2QA4P 4H44B 5APXA 1PGJA 1LP1A 3V6IA 3L75J 2E5TA 1JY3N 1MUUA 2WPQA 5APVA 3ABVC 1SQBK 2WSFJ 3A5TA 2E43A 3AE6C 2M3EA 2AXTE 1URQA 2ZT9C 3O8ZA 1SQQD 5KLIB 2R44A 1SQQJ 2KI7B 1SVFA 1FAVA 3TGUE 3RK2D 2B88A 3H1KE 1J1EB 4N3YB 2HFED 2KLUA 4D6TD 3H1ID 4D6TJ 3H1IJ 3L36A 2FYUD 3GG2A 3A0BE 1ZMEC 2M0BA 1OFCX 2FYUJ 3CC4P 3R2PA 1KYOH 1JY3P 5E79E 2FXMA 1UIIA 2JDIH 4HB1A 2JJLA 3B5ND 5B66H 3H1HD 1JY2N 3O6QB 2E76B 1GL2B 1PPJD 4A7PA 3C1LA 3H1HJ 3RK3B 1N73C 1S3JA 4TT3H 4NPEA 3Q1MA 4EI2A 1NH4A 1KQLA 3CC2P 2K9YA 1HWTC 2N1TA 2A45G 1NU1D 3PHLA 2G3AA 2YNYA 3L71E 3L70D 1EZVG 2RN0A 4DCKA 1ZRTD 2ZT9B 4EDFA 4YXDC 3L4FA 2P1JA 5AW0B 3FWNA 4Z1MH 1Q86Q 3HE5B 1JTHB 3WU2H 3N7NA 1J2JB 1IJDB 1EDJA 1JY2P 1IK7A 3ZDMA 1YYCA 2CK3H 1VQKP 3CX5D 1SLQA 1KFNA 2I1KA 3FXEA 1W2BO 2IZ1A 4WY4A 3NMDA 2WSEJ 4OVNF 1BCCG 3T97B 3B8EB 2OYIC 2Z4EA 2QM8A 3MGNA 1AA0A 2IDBA 1VQ6P 1DIPA 2AEFA 1N73B 3S4RA 2QEXP 2K88A 2XV5A 3MD0A 4DZOA 1IO4A 1VQMP 1NTKD 2HYNA 3UIAA 1JOCA 1NTKJ 1X22A 1N7SA 1IK9A 2JWDA 1HJBA 4PV1D 3RBXA 4N6JA 1Z56A 3BCCE 1S5LH 3CC7P 1T3JA 1ZXGA 2RH0A 3AE1C 1R5SA 2YKQA 2N1TC 5APYA 1EZVI 3ITKA 3M9HA 5K5GB 1OVVA 1AQTA 4DJGA 1SQPD 3AE8C 3G3ZA 5CCGA 1Q82Q 2KUBA 3TGUG 2W6BA 1SQPJ 1G2CA 3H1KG 4U3FE 4AQRD 1YITP 1KQGB 3D6ZA 2Y0DA 2OYIB 2A06E 2IX7C 3VMZA 4W80A 3H1JE 3R4YA 3CD6P 4YTPC 1WT6A 2WSCH 3WMM0 5C39A 2KZIA 4PD4E 2PAJA 2KK7A 4N78D 3K5BA 1SQXD 3HE4B 2GM4A 4L76A 1SQXJ 2Q9IA 4IL6E 3D6YA 4R4MA 3P8CD 4NPFX 2ZYDA 3VOPA 2WSFH 1T3UA 5KTBA 1YTZI 3L71G 2JO1A 4I7ZC 1N7SC 5CBOA 2M5AA 3D70A 1M1JA 1DEBA 2FYZA 2B87B 3FWLA 3VTPC 2E75C 4XFJA 1RHZB 2IBZE 4JYCA 5L8RJ 1KILC 1P84D 3JC22 2ZVNB 4B86A 2LR2A 5CJ4A 5CCGC 4EIJA 1DD3A 1TU3F 1KB9D 1HBWA 2J5UA 1L0LG 1KYOE 4HJGH 1UIXA 2K9JA 3IR9A 5CCHC 5B66E 1K8AQ 4C46A 1L2PA 1DH3A 3CMAP 2NPSC 1HUCA 1IFMA 1K73Q 1JEKA 2E74C 5APTA 2FKWB 4EYYQ 4TLFA 2AEMA 2ZJSE 2XNXA 1FZFA 1NO4A 4I7ZB 1N7SB 1X9VA 4JBZA 3HRNA 1N86A 1BGYD 1NTMK 1BGYJ 1OWAA 2JR8A 3L73G 1SQBD 1YI2P 2E75B 1PZQA 3C8VA 1SQBJ 1KV4A 1KILB 1T2KD 5BU5A 4H13D 1JY3O 1L4AD 1LTIC 4BWNA 1L0LK 5AVZB 1N7LA 4DT0A 1BDCA 2ZXEB 3MUDC 2A06G 2QM7A 1R8EA 1IC2A 5AW3B 3H1JG 3FXDA 5BU8B 2FY8A 5CHXA 1U7JA 4OH8B 2KSJA 1QL2A 1CZQA 2NPSB 3D71A 4DOJA 1NAYA 1GDTA 2E74B 4GOFA 3JCUH 4GODA 1KD1Q 2YKPA 2H88C 1Q7YQ 1L0NE 1S9KE 2Q5UA 2WTYA 4JPZB 1QX8A 3O6QA 1GL2A 1BE3D 2XKMA 3KYQA 4LGDE 1GW4A 1BE3J 3CXHH 1SFCD 5KAIE 3TNUA 1KQFB 3USSA 1JY2O 5KJ7C 4H44D 2KYVA 3H1LG 2M5AB 2H43A 2IBZG 2R3CA 1JMMA 1NJIQ 1FZEA 2YXQB 2KP8A 3QH9A 2R32A 3HE5A 3M0DC 2P10A 1JTHA 2YXRB 2QJPB 3V2NA 1SQVK 1H0TB 5KLVK 5KLIC 3BASA 2RMZA 1FJPA 1GTWA 4XE5B 4C7NB 3T97A 2O1KA 3L75E 1J1EC 1VDFA 3MZWB 4IFMA 4PD4I 2WVRA 1KFMA 2IFMA 1N73A 2Z5IA 3Q5PA 5EFWB 3AE4C 3RK3D 1PP9G 1SQQE 2W6JH 5KAFE 1E79H 3A3YB 1PL5A 2WSCJ 3LIDA 3E1IA 2V4HA 2LKMA 1P84H 2WPSA 1A02F 1ZV8A 4D6TE 3H1IE 3G71P 2OARA 1AVOA 3OA7A 2FYUE 1FE6A 1KB9H 3E1RA 1HF9A 1OW7A 3LW5J 3A2AA 1BCCD 3KZIH 3H1HE 1GU4A 4L75A 2JP3A 1S5LX 1LTJC 1PPJE 3EFFK 1XTGB 3V4WA 1FOSE 3S9OA 2JWAA 1K9MQ 2HODB 2OYIA 1NTZK 3MTUE 1FDOA 1GW3A 2XU6A 1AQ5A 5AVXB 4UB8E 4K35A 1NU1E 3AE5C 1LGHB 2D2CD 2VRSA 3L70E 3RL0g 1MKMA 4ZNCA 1ZRTE 3HE4A 4LC1A 2BCCD 1WRGA 1PIXA 2BCCJ 1IFJA 3TNUB 1IFPA 1CI6A 2QIWA 3BVHA 1S72P 2MJZA 3CWBD 3SWYA 1E5WA 5GTIH 1AV1A 3B5NC 1KQSO 3CWBJ 3CX5E 3SWKA 1NU1J 3L70J 1Y9BA 4JF7A 3IFMA 4L73A 2B87A 1FBMA 2DW3A 3WUUA 3SSUA 2K3RA 1BSNA 1LTJB 4OGQD 3L72D 2W8ZA 3I5CA 3L72J 3BRVB 2WITA 1NAFA 1URQD 4BRYB 1VQLP 2W27A 2C0WA 2N9BA 1D7MA 2M8RA 1RH5B 1CW5A 1NTKE 3RL0D 3L75G 4I2LC 3AE2C 5DJTB 1NYHA 1K04A 2KB7P 1USEA 2NRGA 5APUA 2ZYGA 5AW4B 2QE7H 3CCRP 3CCLP 1AJYA 1JUNA 5AW9B 4L74A 3VMAA 1VQ9P 1QVGO 2P58A 1H89A 2O1JA 1SQQG 1YTZT 1YIJP 4JQ0D 3BATA 1Q81Q 3CCEP 1S2EA 3WUVA 1SQPE 3Q5RA 3B5NB 2H8PD 1NTMD 1NTMJ 3AE9C 1KC8Q 4D6TG 1FZCC 2A45I 3A0HE 2FYUG 2N1TD 3CXHD 3EFGA 3L74D 1NHLA 1HJ0A 1OVRA 2AXCA 3L74J 1S4XA 1KILA 1L0LD 3CCUP 2FXOA 3M9BA 3H1HG 1DD4A 4PV1C 1PPJG 1WMKA 1RQUA 4N78E 1SQXE 2FFDC 3VP8A 5AW1B 3U1CA 3V2QA 1OMIA 3P8CE 5CCHA 1MV8A 3P8MC 1OIPA 2NPSA 1X8YA 4WY4D 2OYHC 3JSVC 1YJNP 2W83C 5TISH 1T6AA 1KORA 1NKNA 3L73D 2IZ0A 4H0LC 5AW5B 2P2UA 1FZGA 1FZCB 1P84E 1CI6B 3CPWO 2QJYC 1HGVA 4EOTA 2RKLA 1N7SD 2R3SA 3LW5H 1KN7A 1U57A 1KB9E 5AVTB 2J58A 3H32B 4PV1B 3TDKA 2ZXXA 3KZIE 2FFDB 2OQQA 3MUDA 3TYYA 1U7MA 2P67A 1KILD 1LT9C 1ZP0C 1SQVD 1EC5A 3C9IA 5KLVD 5CCGD 1SQVJ 1H0TA 5KLVJ 3U59A 4RO0A 3I56P 1KZUB 2WMMA 1RE3C 4AYCA 1FS0E 2OYHB 5CCHD 2M3BA 2W90A 4C7NA 1BGYE 5AW6B 1VF5C 2OYOA 2O01H 3IAOA 2Q3IA 1SQBE 3PLNA 4H0LB 4HKZH 1SQPG 5AVWB 2WZ7A 2QJYB 3H1LD 3HUSC 5AVYB 5GTIE 3H1LJ 3GW6A 1OZHA 5KJ7A 2GUVA 4M3LA 2WPRA 3BCCG 3CX5I 1OXZA 3RBZA 2XZRA 2WPVB 4LLHA 4UB6H 1LT9B 3M0DA 3WU2E 1VQ8P 2OTJP 2Q6QA 3OW2O 1SQXG 3I55P 1K05A 1OX3A 2Y9YA 2E42A 4U3FG 2OTKE 4GKGA 4WWIA 3SWFA 1JMBA 1QLED 3PP5A 1BE3E 2OGUA 3A7OA 1NTZD 1NVOA 2HODA 1NTZJ 1VF5B 2QJPC 1YJWP 4H13C 5AVSB 1L4AC 2YMYA 4GDOA 1VL2A 3P32A 2PFXA 1NWQA 1RF1C 1PP9D 3AECC 3CCMP 1PP9J 3B71A 4ASWA 1BDDA 3HUSB 4WB4A 5M1BA 3GHGC 2Q1KA 2P7JA 5KKZC 1ZN5A 2KNCB 1S5LE 2LXCB 1LTTC 2KZJA 2N9YB 1JM0A 2QVAA 1SP4A 4YPCA 4I1LA 2GUSA 3AEGC 2C9LY 4AUWA 2YIUB 1SFCC 2XDJA 5B5EH 3U1AA 1RY3A 4BXLA 2KIKA 1GK6A 1LTJA 3P7KA 1PGQA 3LIEA 1VQNP 1HGZA 4BRYA 2Q7CA 4JYBA 4H13B 1L4AB 1VPCA 1BGYG 3RK3E 3M91A 1RF1B 5TISE 2KSEA 5GTHH 3VYIA 4K3AA 3GHGB 1RQVA 1FZBA 1MZ9A 1J1DC 3MHVA 5KKZB 2NZ2A 2CPSA 3HD7C 3CI9A 1EDKA 1JCDA 1QVFO 2E76D 1GL2D 1EZVD 3E7KA 4WVZA 3AEBC 4YXWH 3B5NA 1BCCE 2O3JA 1IFIA 2I8DA 3CL3D 2Y0EA 3Q2YA 1SFCB 2SPZA 1RE4C 1N2DC 1IFNA 3VMYA 3L37A 2WWWA 1ZLLA 5AVQB 1LWUC 2MKVA 4IL6H 2IBZI 2ZT9D 1AFOA 1EQ7A 4KJMA 1IZNB 5APSA 3M9QA 2BASA 1BE3G 2IYPA 3NTNA 1BCCJ 3EWKA 2BCCE 2HPCB 2BEZF 2GA1A 1KYOI 4XA4A 2L91A 3IN6A 2QSIA 3VN0A 2KXPB 1GK4A 4MN4C 1L0NG 1J1DB 1LTGC 3CWBE 2IFNA 3OAKA 1M56D 4W7YA 3HD7B 3F5HA 3PRJA 2H7HA 1LTAC 3RK2C 1Y8AA 2WT7B 2IPPA 4CPGA 3L72E 1FZCA 2R5DA 5AVUB 2O01J 2HR3A 2D2CC 4UB6E 1ZOYC 1Y47A 1VQ5P 2I1JA 1S1CX 1FJKA 3PH0A 1LWUB 3TGUD 1MFTA 2FYNB 3OJAB 3TGUJ 1M57D 3H1KD 3H32A 2KS1B 3H1KJ 4RESB 1OW6A 1PV3A 2XNDH 5AVVB 2FFDA 2QG4A 4I6MC 1RF0C 2J59M 3G6EP 1W5CE 5DJUB 1L0NK 3FGAD 2C0XA 1MFZA 3V5BA 4IOIH 1N8RQ 4OWFA 1BSHA 1G1JA 3JCUE 2B9BA 2OYHA 3TSIA 2W6AA 1NTME 2Z5HA 4OGQC 1YJ9P 2FXPA 1A02J 2K37A 3MP7B 1HVVA 3RK2B 3MIWA 1URQC 3CLQA 1USDA 1YQ4C 3L71D 3CXHE 3L74E 5CBNA 1JO5A 3L71J 3V2PA 3RL0C 3VP9A 1ZR2A 1H88A 1L0LE 4GT1A 1FZAA 2D2CB 5AVRB 4IFDK 1H8AA 4O9BA 1JCCA 3SFDC 3HTKB 1GU5A 3PTZA 3H1IG 5B5EE 2OTLP 1QL1A 2V7QH 1LT9A 2YKOA 3V2RA 1QGKB 1IFDA 1LP1B 5KAIH 1L0LJ 2ZVOB 2B89A 3TK1A 2BCCG 1RE3A 2Y9ZA 3QWOC 5BVZA 2YO3A 1ZR4A 3L73E 5GTHE 4OGQB 2A45H 3CWBG 1NU1G 1URQB 1DEEG 1SQQK 4GIFA 3L70G 5H2FH 3Q3DA 2L5GB 2K1AA 2HLOA 3RL0B 3AEEC 3Q5SA 1LTSC 3BCCD 4GOEA 1PGOA 3II6A 3HUSA 3BCCJ 4Y99C 2KLVA 4ASVA 3L72G 2YMKA 4H0LD 3EQ2A 3VMXA 1LT1A 2FYUK 3AE7C 1KILE 3L73J 3TF5A 1FC2C 2KNCA 3W68A 4WY4C 1SQVE 2POHA 5KLVE 3AEFC 1OVUA 4U3FD 1XTCC 1QEXA 4U3FJ 3NFQA 4WBAA 1GMJA 2A06D 4PJ0H 4NPDA 2C9NY 3RGUA 2ZAEB 3H1JD 2E75D 1KMIZ 3CCQP 3M06A 3H1JJ 2N1TB 3CCJP 1YBKA 1NU1K 5KAFH 4PD4D 1NTKG 3KHUA 1L4AA 3CCVP 5APWA 3H1LE 1NTMG 1X79B 3G4SP 1RF1A 3V4QA 1EDIA 3GF7A 3H6PA 1VF5D 4ZMDA 2FBWC 4C7RA 1DX7A 2NPSD 4Y99B 3L74G 3GHGA 2AXTH 2E74D 1AVYA 3FX0A 4W7ZA 1G1IA 1KTMA 4WY4B 1T8ZA 3M0AA 1LNQA 2IBZD 2LXBA 3A0BH 2WQYC 4UB8H 1SS1A 1SFCA 1NTZE 1EDLA 2UWJE 5E79H 2CPBA 4U7JA 2G8YA 3CMEP 1FU1A 1KYOD 1NTKK 2PP6A 1PGPA 5AW7B 1X0TA 1PP9E 4HYTB 1JNMA 2YIUC 1FDIA 4RJTA 1HTLC 2R5BA 5CJ0A 2HPCA 3CX5H 4QMAA 3AE3C 2WSEH 1T2KC 1M1JC 2ITAA 4IL6X 1SQPK 1G2CB 3AEDC 3S1KA 3CXHI 3HD7A 1EXIA 2WSSH 1CSBA 1GZLA 2YO2A 3IF4A 5TJHA 2WT7A 2KOGA 2QJKC 2AEJA 1GD2E 1SQVG 3GF3A 5KLVG 1M8OB 1W2EA 3W67A 1R5LA 1Q2NA 5KJ7D 3SFEC 1RE4A 5AW8B 3KPEA 2PRRA 2QRXA 1SQXK 1LWUA 3KQGA 5APQA 3NXSA 1NOHA 2E5YA 1NKZB 2KS1A 3G9RA 1VQ4P 2O01N 1LJ2A 3AEAC 4ZKPA 1VQPP 4R4LA 1YHQP 1M1KQ 1L0ND 3F89A 5AW2B 1S9KD 4HH2A 4H44C 1L0NJ 2Q3EA 1M1JB 2ZYAA 3A0HH 3B4SA 5H2FE 2V7QJ 2Y0CA 1EZVE 2JKVA 1NGMB 3KXDA 2JEEA 3N4XA 1SQBG 4ZKUA 1FOSF 1FDMA 1M7LA 2H89C 2QJKB 2IYOA 1HH0A 3GLMA 3HD7D 2K9JB 3WUTA 2PGDA 1Q90D 1EXJA 1P84I 1LTBC 1JB0J 3H25A 1PFIA
chains in the Genus database with same CATH topology
1L4AD 1LTIC 3L35A 1L0NK 1L0LK 2C0XA 3HTKA 1MFZA 3BRTB 3V5BA 2HG5D 5AVZB 4KHXA 1N7LA 4IFFA 5AW5B 2ZXEB 2P2UA 1FZGA 1FZCB 5CMZA 1G1JA 2OYHA 1CI6B 2ZFCA 3TSIA 2W6AA 1HGVA 2QM7A 4EOTA 1IC2A 2Z5HA 5AW3B 1N7SD 3KDPB 3LW5H 1A02J 5BU8B 1RF0A 1GL2C 1HVVA 3RK3C 3RK2B 3MIWA 5CHXA 1URQC 4OH8B 3CLQA 2KSJA 1QL2A 1CZQA 2NPSB 5AVTB 5APXA 2J58A 3H32B 4DOJA 1JY3N 1GDTA 1MUUA 1JO5A 2WPQA 3V2PA 3RL0C 3VP9A 5APVA 1ZR2A 2YKPA 1H88A 2FFDB 3MUDA 3TYYA 1S9KE 2P67A 4GT1A 1FZAA 2Q5UA 2WTYA 1KILD 1SQBK 1LT9C 5AVRB 4IFDK 1H8AA 4O9BA 3A5TA 1JCCA 2E43A 1GL2A 3C9IA 2XKMA 3KYQA 4LGDE 5CCGD 1URQA 3HTKB 1GW4A 1GU5A 3O8ZA 1SFCD 3U59A 3TNUA 1KZUB 1RE3C 4AYCA 2OYHB 1JY2O 1SVFA 2M3BA 1FAVA 5CCHD 4C7NA 3RK2D 5KJ7C 5AW6B 1QL1A 1J1EB 4N3YB 2HFED 1LT9A 2YKOA 2KYVA 2O01H 3V2RA 3L36A 1IFDA 2Q3IA 3TK1A 2H43A 2R3CA 3R2PA 1JMMA 1RE3A 1JY3P 2FXMA 5AVWB 5BVZA 2WZ7A 1FZEA 2KP8A 3HUSC 5AVYB 3HE5A 2R32A 2YO3A 2JJLA 3B5ND 1ZR4A 3M0DC 1JY2N 5KJ7A 2GUVA 1JTHA 1GL2B 2A45H 3RK3B 4M3LA 3V2NA 1SQVK 2WPRA 1N73C 1URQB 5KLVK 3BASA 1OXZA 1SQQK 2XZRA 1FJPA 4GIFA 1NH4A 2L5GB 1GTWA 2HLOA 1KQLA 4XE5B 3RL0B 1HWTC 4LLHA 4C7NB 2N1TA 1LTSC 2A45G 3T97A 2O1KA 3II6A 1J1EC 1VDFA 3HUSA 2YNYA 1LT9B 4IFMA 4Y99C 3M0DA 2KLVA 1KFMA 3EQ2A 2IFMA 3VMXA 1N73A 2E42A 2FYUK 2Z5IA 4GKGA 3L4FA 4WY4C 3SWFA 2P1JA 5AW0B 3PP5A 2POHA 3HE5B 3A7OA 3RK3D 2HODA 1JTHB 3N7NA 1J2JB 1IJDB 1XTCC 3A3YB 1JY2P 5AVSB 1L4AC 3NFQA 2YMYA 4WBAA 1YYCA 1SLQA 1KFNA 3LIDA 3E1IA 2C9NY 2I1KA 3P32A 2LKMA 1NWQA 1RF1C 2WPSA 1A02F 4WY4A 1ZV8A 3NMDA 3M06A 2N1TB 2OARA 3B8EB 2OYIC 3OA7A 2Z4EA 2QM8A 1NU1K 3HUSB 3MGNA 4WB4A 3GHGC 2P7JA 1N73B 1L4AA 5APWA 2XV5A 3MD0A 1ZN5A 3A2AA 4DZOA 1IO4A 1GU4A 1LTTC 1X79B 1RF1A 1LTJC 1XTGB 3V4WA 3V4QA 3H6PA 1FOSE 1SP4A 2HYNA 3UIAA 4C7RA 2HODB 1JOCA 2OYIA 1NTZK 1DX7A 1N7SA 4I1LA 2NPSD 3MTUE 4Y99B 3GHGA 1IK9A 1GW3A 2GUSA 2XU6A 1HJBA 2C9LY 4AUWA 1AQ5A 5AVXB 1SFCC 2XDJA 4N6JA 1Z56A 4W7ZA 1G1IA 3U1AA 1T3JA 1LGHB 1RY3A 4WY4B 2YKQA 2N1TC 2VRSA 1GK6A 5APYA 1LTJA 1T8ZA 3P7KA 3M0AA 3LIEA 3HE4A 3M9HA 1HGZA 4LC1A 2Q7CA 1WRGA 4JYBA 1L4AB 3G3ZA 1IFJA 1VPCA 5CCGA 3TNUB 2W6BA 1SFCA 1G2CA 1CI6A 3M91A 3BVHA 1RF1B 2CPBA 2MJZA 4AQRD 3SWYA 1FU1A 1E5WA 3B5NC 3VYIA 1NTKK 2OYIB 2PP6A 2IX7C 5AW7B 3GHGB 3VMZA 4W80A 1FZBA 1MZ9A 4HYTB 1JNMA 1J1DC 4JF7A 2CPSA 3IFMA 1HTLC 1WT6A 3HD7C 1FBMA 3CI9A 2R5BA 2WSCH 3WMM0 5CJ0A 1JCDA 1LTJB 2PAJA 2HPCA 4N78D 3I5CA 1GL2D 3HE4B 2GM4A 3BRVB 2WITA 1NAFA 1URQD 3B5NA 2Q9IA 2WSEH 1T2KC 1IFIA 2W27A 1M1JC 2C0WA 3CL3D 3P8CD 2N9BA 2M8RA 1SQPK 3VOPA 2WSFH 1CW5A 1SFCB 1G2CB 1T3UA 3RL0D 5KTBA 4I2LC 1YTZI 3HD7A 1RE4C 2KB7P 1N2DC 1IFNA 3VMYA 3L37A 2WWWA 5APUA 1ZLLA 5AVQB 1CSBA 1GZLA 1N7SC 2YO2A 1LWUC 5AW4B 2WT7A 2KOGA 1AFOA 1EQ7A 1JUNA 1GD2E 1M1JA 5APSA 1DEBA 2FYZA 3M9QA 5AW9B 2BASA 3NTNA 1H89A 2O1JA 1YTZT 3VTPC 1W2EA 3BATA 5KJ7D 4JYCA 1RE4A 2HPCB 4XA4A 1KILC 5AW8B 3KPEA 3VN0A 1SQXK 3B5NB 2H8PD 1LWUA 1GK4A 4B86A 3KQGA 5APQA 5CJ4A 3NXSA 5CCGC 1NOHA 4EIJA 1NKZB 1FZCC 1J1DB 1LTGC 1HBWA 2A45I 2IFNA 3OAKA 2N1TD 4W7YA 3HD7B 3IR9A 3EFGA 4ZKPA 2H7HA 5CCHC 1NHLA 1LTAC 3RK2C 4C46A 1DH3A 1KILA 5AW2B 1S9KD 2WT7B 2NPSC 4HH2A 3M9BA 1HUCA 1IFMA 2IPPA 1M1JB 5APTA 4N78E 2FKWB 1FZCA 2FFDC 2R5DA 3VP8A 5AVUB 5AW1B 3U1CA 3V2QA 1FZFA 2XNXA 3P8CE 2I1JA 1NO4A 5CCHA 1MV8A 1FJKA 1N7SB 1X9VA 2JEEA 1LWUB 3N4XA 3HRNA 3P8MC 4ZKUA 1FOSF 1FDMA 1M7LA 1N86A 1NTMK 3OJAB 2NPSA 1X8YA 1HH0A 3HD7D 3H32A 4WY4D 2OYHC 4RESB 1OWAA 5AVVB 2FFDA 4I6MC 1RF0C 2J59M 1LTBC 1KILB 1T2KD 1PFIA 5BU5A 1NKNA 1JY3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRN A;  4ZKU A;  3OJA B;  3P8C D;  3U59 A;  3BAS A;  1WT6 A;  4GIF A;  5KTB A;  3U1A A;  3VP9 A;  3VP8 A;  1X79 B;  2FXM A;  2POH A;  3BAT A;  5BVZ A;  3U1C A;  1IC2 A;  4ZKP A;  4N78 D;  2JEE A;  5BU8 B;  4N3Y B;  1NKN A;  4O9B A;  3N7N A;  4I1L A;  3N4X A;  5BU5 A;  3C9I A; 
#chains in the Genus database with same CATH topology
 3L35 A;  1NTZ G;  3HTK A;  4RKU J;  3BRT B;  2HG5 D;  1ZW0 A;  4KHX A;  4IFF A;  1VQO P;  4PJ0 E;  1KB9 I;  5CMZ A;  1M90 Q;  1OW8 A;  3CCS P;  2ZFC A;  4KT0 J;  3PJS K;  4PD4 H;  3KDP B;  4Y28 J;  3GMA A;  2E76 C;  1RF0 A;  1GL2 C;  3RK3 C;  1YQ3 C;  1VQ7 P;  2FYN C;  3L75 D;  2BEQ D;  2QA4 P;  4H44 B;  5APX A;  1PGJ A;  1LP1 A;  3V6I A;  3L75 J;  2E5T A;  1JY3 N;  1MUU A;  2WPQ A;  5APV A;  3ABV C;  1SQB K;  2WSF J;  3A5T A;  2E43 A;  3AE6 C;  2M3E A;  2AXT E;  1URQ A;  2ZT9 C;  3O8Z A;  1SQQ D;  5KLI B;  2R44 A;  1SQQ J;  2KI7 B;  1SVF A;  1FAV A;  3TGU E;  3RK2 D;  2B88 A;  3H1K E;  1J1E B;  4N3Y B;  2HFE D;  2KLU A;  4D6T D;  3H1I D;  4D6T J;  3H1I J;  3L36 A;  2FYU D;  3GG2 A;  3A0B E;  1ZME C;  2M0B A;  1OFC X;  2FYU J;  3CC4 P;  3R2P A;  1KYO H;  1JY3 P;  5E79 E;  2FXM A;  1UII A;  2JDI H;  4HB1 A;  2JJL A;  3B5N D;  5B66 H;  3H1H D;  1JY2 N;  3O6Q B;  2E76 B;  1GL2 B;  1PPJ D;  4A7P A;  3C1L A;  3H1H J;  3RK3 B;  1N73 C;  1S3J A;  4TT3 H;  4NPE A;  3Q1M A;  4EI2 A;  1NH4 A;  1KQL A;  3CC2 P;  2K9Y A;  1HWT C;  2N1T A;  2A45 G;  1NU1 D;  3PHL A;  2G3A A;  2YNY A;  3L71 E;  3L70 D;  1EZV G;  2RN0 A;  4DCK A;  1ZRT D;  2ZT9 B;  4EDF A;  4YXD C;  3L4F A;  2P1J A;  5AW0 B;  3FWN A;  4Z1M H;  1Q86 Q;  3HE5 B;  1JTH B;  3WU2 H;  3N7N A;  1J2J B;  1IJD B;  1EDJ A;  1JY2 P;  1IK7 A;  3ZDM A;  1YYC A;  2CK3 H;  1VQK P;  3CX5 D;  1SLQ A;  1KFN A;  2I1K A;  3FXE A;  1W2B O;  2IZ1 A;  4WY4 A;  3NMD A;  2WSE J;  4OVN F;  1BCC G;  3T97 B;  3B8E B;  2OYI C;  2Z4E A;  2QM8 A;  3MGN A;  1AA0 A;  2IDB A;  1VQ6 P;  1DIP A;  2AEF A;  1N73 B;  3S4R A;  2QEX P;  2K88 A;  2XV5 A;  3MD0 A;  4DZO A;  1IO4 A;  1VQM P;  1NTK D;  2HYN A;  3UIA A;  1JOC A;  1NTK J;  1X22 A;  1N7S A;  1IK9 A;  2JWD A;  1HJB A;  4PV1 D;  3RBX A;  4N6J A;  1Z56 A;  3BCC E;  1S5L H;  3CC7 P;  1T3J A;  1ZXG A;  2RH0 A;  3AE1 C;  1R5S A;  2YKQ A;  2N1T C;  5APY A;  1EZV I;  3ITK A;  3M9H A;  5K5G B;  1OVV A;  1AQT A;  4DJG A;  1SQP D;  3AE8 C;  3G3Z A;  5CCG A;  1Q82 Q;  2KUB A;  3TGU G;  2W6B A;  1SQP J;  1G2C A;  3H1K G;  4U3F E;  4AQR D;  1YIT P;  1KQG B;  3D6Z A;  2Y0D A;  2OYI B;  2A06 E;  2IX7 C;  3VMZ A;  4W80 A;  3H1J E;  3R4Y A;  3CD6 P;  4YTP C;  1WT6 A;  2WSC H;  3WMM 0;  5C39 A;  2KZI A;  4PD4 E;  2PAJ A;  2KK7 A;  4N78 D;  3K5B A;  1SQX D;  3HE4 B;  2GM4 A;  4L76 A;  1SQX J;  2Q9I A;  4IL6 E;  3D6Y A;  4R4M A;  3P8C D;  4NPF X;  2ZYD A;  3VOP A;  2WSF H;  1T3U A;  5KTB A;  1YTZ I;  3L71 G;  2JO1 A;  4I7Z C;  1N7S C;  5CBO A;  2M5A A;  3D70 A;  1M1J A;  1DEB A;  2FYZ A;  2B87 B;  3FWL A;  3VTP C;  2E75 C;  4XFJ A;  1RHZ B;  2IBZ E;  4JYC A;  5L8R J;  1KIL C;  1P84 D;  3JC2 2;  2ZVN B;  4B86 A;  2LR2 A;  5CJ4 A;  5CCG C;  4EIJ A;  1DD3 A;  1TU3 F;  1KB9 D;  1HBW A;  2J5U A;  1L0L G;  1KYO E;  4HJG H;  1UIX A;  2K9J A;  3IR9 A;  5CCH C;  5B66 E;  1K8A Q;  4C46 A;  1L2P A;  1DH3 A;  3CMA P;  2NPS C;  1HUC A;  1IFM A;  1K73 Q;  1JEK A;  2E74 C;  5APT A;  2FKW B;  4EYY Q;  4TLF A;  2AEM A;  2ZJS E;  2XNX A;  1FZF A;  1NO4 A;  4I7Z B;  1N7S B;  1X9V A;  4JBZ A;  3HRN A;  1N86 A;  1BGY D;  1NTM K;  1BGY J;  1OWA A;  2JR8 A;  3L73 G;  1SQB D;  1YI2 P;  2E75 B;  1PZQ A;  3C8V A;  1SQB J;  1KV4 A;  1KIL B;  1T2K D;  5BU5 A;  4H13 D;  1JY3 O;  1L4A D;  1LTI C;  4BWN A;  1L0L K;  5AVZ B;  1N7L A;  4DT0 A;  1BDC A;  2ZXE B;  3MUD C;  2A06 G;  2QM7 A;  1R8E A;  1IC2 A;  5AW3 B;  3H1J G;  3FXD A;  5BU8 B;  2FY8 A;  5CHX A;  1U7J A;  4OH8 B;  2KSJ A;  1QL2 A;  1CZQ A;  2NPS B;  3D71 A;  4DOJ A;  1NAY A;  1GDT A;  2E74 B;  4GOF A;  3JCU H;  4GOD A;  1KD1 Q;  2YKP A;  2H88 C;  1Q7Y Q;  1L0N E;  1S9K E;  2Q5U A;  2WTY A;  4JPZ B;  1QX8 A;  3O6Q A;  1GL2 A;  1BE3 D;  2XKM A;  3KYQ A;  4LGD E;  1GW4 A;  1BE3 J;  3CXH H;  1SFC D;  5KAI E;  3TNU A;  1KQF B;  3USS A;  1JY2 O;  5KJ7 C;  4H44 D;  2KYV A;  3H1L G;  2M5A B;  2H43 A;  2IBZ G;  2R3C A;  1JMM A;  1NJI Q;  1FZE A;  2YXQ B;  2KP8 A;  3QH9 A;  2R32 A;  3HE5 A;  3M0D C;  2P10 A;  1JTH A;  2YXR B;  2QJP B;  3V2N A;  1SQV K;  1H0T B;  5KLV K;  5KLI C;  3BAS A;  2RMZ A;  1FJP A;  1GTW A;  4XE5 B;  4C7N B;  3T97 A;  2O1K A;  3L75 E;  1J1E C;  1VDF A;  3MZW B;  4IFM A;  4PD4 I;  2WVR A;  1KFM A;  2IFM A;  1N73 A;  2Z5I A;  3Q5P A;  5EFW B;  3AE4 C;  3RK3 D;  1PP9 G;  1SQQ E;  2W6J H;  5KAF E;  1E79 H;  3A3Y B;  1PL5 A;  2WSC J;  3LID A;  3E1I A;  2V4H A;  2LKM A;  1P84 H;  2WPS A;  1A02 F;  1ZV8 A;  4D6T E;  3H1I E;  3G71 P;  2OAR A;  1AVO A;  3OA7 A;  2FYU E;  1FE6 A;  1KB9 H;  3E1R A;  1HF9 A;  1OW7 A;  3LW5 J;  3A2A A;  1BCC D;  3KZI H;  3H1H E;  1GU4 A;  4L75 A;  2JP3 A;  1S5L X;  1LTJ C;  1PPJ E;  3EFF K;  1XTG B;  3V4W A;  1FOS E;  3S9O A;  2JWA A;  1K9M Q;  2HOD B;  2OYI A;  1NTZ K;  3MTU E;  1FDO A;  1GW3 A;  2XU6 A;  1AQ5 A;  5AVX B;  4UB8 E;  4K35 A;  1NU1 E;  3AE5 C;  1LGH B;  2D2C D;  2VRS A;  3L70 E;  3RL0 g;  1MKM A;  4ZNC A;  1ZRT E;  3HE4 A;  4LC1 A;  2BCC D;  1WRG A;  1PIX A;  2BCC J;  1IFJ A;  3TNU B;  1IFP A;  1CI6 A;  2QIW A;  3BVH A;  1S72 P;  2MJZ A;  3CWB D;  3SWY A;  1E5W A;  5GTI H;  1AV1 A;  3B5N C;  1KQS O;  3CWB J;  3CX5 E;  3SWK A;  1NU1 J;  3L70 J;  1Y9B A;  4JF7 A;  3IFM A;  4L73 A;  2B87 A;  1FBM A;  2DW3 A;  3WUU A;  3SSU A;  2K3R A;  1BSN A;  1LTJ B;  4OGQ D;  3L72 D;  2W8Z A;  3I5C A;  3L72 J;  3BRV B;  2WIT A;  1NAF A;  1URQ D;  4BRY B;  1VQL P;  2W27 A;  2C0W A;  2N9B A;  1D7M A;  2M8R A;  1RH5 B;  1CW5 A;  1NTK E;  3RL0 D;  3L75 G;  4I2L C;  3AE2 C;  5DJT B;  1NYH A;  1K04 A;  2KB7 P;  1USE A;  2NRG A;  5APU A;  2ZYG A;  5AW4 B;  2QE7 H;  3CCR P;  3CCL P;  1AJY A;  1JUN A;  5AW9 B;  4L74 A;  3VMA A;  1VQ9 P;  1QVG O;  2P58 A;  1H89 A;  2O1J A;  1SQQ G;  1YTZ T;  1YIJ P;  4JQ0 D;  3BAT A;  1Q81 Q;  3CCE P;  1S2E A;  3WUV A;  1SQP E;  3Q5R A;  3B5N B;  2H8P D;  1NTM D;  1NTM J;  3AE9 C;  1KC8 Q;  4D6T G;  1FZC C;  2A45 I;  3A0H E;  2FYU G;  2N1T D;  3CXH D;  3EFG A;  3L74 D;  1NHL A;  1HJ0 A;  1OVR A;  2AXC A;  3L74 J;  1S4X A;  1KIL A;  1L0L D;  3CCU P;  2FXO A;  3M9B A;  3H1H G;  1DD4 A;  4PV1 C;  1PPJ G;  1WMK A;  1RQU A;  4N78 E;  1SQX E;  2FFD C;  3VP8 A;  5AW1 B;  3U1C A;  3V2Q A;  1OMI A;  3P8C E;  5CCH A;  1MV8 A;  3P8M C;  1OIP A;  2NPS A;  1X8Y A;  4WY4 D;  2OYH C;  3JSV C;  1YJN P;  2W83 C;  5TIS H;  1T6A A;  1KOR A;  1NKN A;  3L73 D;  2IZ0 A;  4H0L C;  5AW5 B;  2P2U A;  1FZG A;  1FZC B;  1P84 E;  1CI6 B;  3CPW O;  2QJY C;  1HGV A;  4EOT A;  2RKL A;  1N7S D;  2R3S A;  3LW5 H;  1KN7 A;  1U57 A;  1KB9 E;  5AVT B;  2J58 A;  3H32 B;  4PV1 B;  3TDK A;  2ZXX A;  3KZI E;  2FFD B;  2OQQ A;  3MUD A;  3TYY A;  1U7M A;  2P67 A;  1KIL D;  1LT9 C;  1ZP0 C;  1SQV D;  1EC5 A;  3C9I A;  5KLV D;  5CCG D;  1SQV J;  1H0T A;  5KLV J;  3U59 A;  4RO0 A;  3I56 P;  1KZU B;  2WMM A;  1RE3 C;  4AYC A;  1FS0 E;  2OYH B;  5CCH D;  2M3B A;  2W90 A;  4C7N A;  1BGY E;  5AW6 B;  1VF5 C;  2OYO A;  2O01 H;  3IAO A;  2Q3I A;  1SQB E;  3PLN A;  4H0L B;  4HKZ H;  1SQP G;  5AVW B;  2WZ7 A;  2QJY B;  3H1L D;  3HUS C;  5AVY B;  5GTI E;  3H1L J;  3GW6 A;  1OZH A;  5KJ7 A;  2GUV A;  4M3L A;  2WPR A;  3BCC G;  3CX5 I;  1OXZ A;  3RBZ A;  2XZR A;  2WPV B;  4LLH A;  4UB6 H;  1LT9 B;  3M0D A;  3WU2 E;  1VQ8 P;  2OTJ P;  2Q6Q A;  3OW2 O;  1SQX G;  3I55 P;  1K05 A;  1OX3 A;  2Y9Y A;  2E42 A;  4U3F G;  2OTK E;  4GKG A;  4WWI A;  3SWF A;  1JMB A;  1QLE D;  3PP5 A;  1BE3 E;  2OGU A;  3A7O A;  1NTZ D;  1NVO A;  2HOD A;  1NTZ J;  1VF5 B;  2QJP C;  1YJW P;  4H13 C;  5AVS B;  1L4A C;  2YMY A;  4GDO A;  1VL2 A;  3P32 A;  2PFX A;  1NWQ A;  1RF1 C;  1PP9 D;  3AEC C;  3CCM P;  1PP9 J;  3B71 A;  4ASW A;  1BDD A;  3HUS B;  4WB4 A;  5M1B A;  3GHG C;  2Q1K A;  2P7J A;  5KKZ C;  1ZN5 A;  2KNC B;  1S5L E;  2LXC B;  1LTT C;  2KZJ A;  2N9Y B;  1JM0 A;  2QVA A;  1SP4 A;  4YPC A;  4I1L A;  2GUS A;  3AEG C;  2C9L Y;  4AUW A;  2YIU B;  1SFC C;  2XDJ A;  5B5E H;  3U1A A;  1RY3 A;  4BXL A;  2KIK A;  1GK6 A;  1LTJ A;  3P7K A;  1PGQ A;  3LIE A;  1VQN P;  1HGZ A;  4BRY A;  2Q7C A;  4JYB A;  4H13 B;  1L4A B;  1VPC A;  1BGY G;  3RK3 E;  3M91 A;  1RF1 B;  5TIS E;  2KSE A;  5GTH H;  3VYI A;  4K3A A;  3GHG B;  1RQV A;  1FZB A;  1MZ9 A;  1J1D C;  3MHV A;  5KKZ B;  2NZ2 A;  2CPS A;  3HD7 C;  3CI9 A;  1EDK A;  1JCD A;  1QVF O;  2E76 D;  1GL2 D;  1EZV D;  3E7K A;  4WVZ A;  3AEB C;  4YXW H;  3B5N A;  1BCC E;  2O3J A;  1IFI A;  2I8D A;  3CL3 D;  2Y0E A;  3Q2Y A;  1SFC B;  2SPZ A;  1RE4 C;  1N2D C;  1IFN A;  3VMY A;  3L37 A;  2WWW A;  1ZLL A;  5AVQ B;  1LWU C;  2MKV A;  4IL6 H;  2IBZ I;  2ZT9 D;  1AFO A;  1EQ7 A;  4KJM A;  1IZN B;  5APS A;  3M9Q A;  2BAS A;  1BE3 G;  2IYP A;  3NTN A;  1BCC J;  3EWK A;  2BCC E;  2HPC B;  2BEZ F;  2GA1 A;  1KYO I;  4XA4 A;  2L91 A;  3IN6 A;  2QSI A;  3VN0 A;  2KXP B;  1GK4 A;  4MN4 C;  1L0N G;  1J1D B;  1LTG C;  3CWB E;  2IFN A;  3OAK A;  1M56 D;  4W7Y A;  3HD7 B;  3F5H A;  3PRJ A;  2H7H A;  1LTA C;  3RK2 C;  1Y8A A;  2WT7 B;  2IPP A;  4CPG A;  3L72 E;  1FZC A;  2R5D A;  5AVU B;  2O01 J;  2HR3 A;  2D2C C;  4UB6 E;  1ZOY C;  1Y47 A;  1VQ5 P;  2I1J A;  1S1C X;  1FJK A;  3PH0 A;  1LWU B;  3TGU D;  1MFT A;  2FYN B;  3OJA B;  3TGU J;  1M57 D;  3H1K D;  3H32 A;  2KS1 B;  3H1K J;  4RES B;  1OW6 A;  1PV3 A;  2XND H;  5AVV B;  2FFD A;  2QG4 A;  4I6M C;  1RF0 C;  2J59 M;  3G6E P;  1W5C E;  5DJU B;  1L0N K;  3FGA D;  2C0X A;  1MFZ A;  3V5B A;  4IOI H;  1N8R Q;  4OWF A;  1BSH A;  1G1J A;  3JCU E;  2B9B A;  2OYH A;  3TSI A;  2W6A A;  1NTM E;  2Z5H A;  4OGQ C;  1YJ9 P;  2FXP A;  1A02 J;  2K37 A;  3MP7 B;  1HVV A;  3RK2 B;  3MIW A;  1URQ C;  3CLQ A;  1USD A;  1YQ4 C;  3L71 D;  3CXH E;  3L74 E;  5CBN A;  1JO5 A;  3L71 J;  3V2P A;  3RL0 C;  3VP9 A;  1ZR2 A;  1H88 A;  1L0L E;  4GT1 A;  1FZA A;  2D2C B;  5AVR B;  4IFD K;  1H8A A;  4O9B A;  1JCC A;  3SFD C;  3HTK B;  1GU5 A;  3PTZ A;  3H1I G;  5B5E E;  2OTL P;  1QL1 A;  2V7Q H;  1LT9 A;  2YKO A;  3V2R A;  1QGK B;  1IFD A;  1LP1 B;  5KAI H;  1L0L J;  2ZVO B;  2B89 A;  3TK1 A;  2BCC G;  1RE3 A;  2Y9Z A;  3QWO C;  5BVZ A;  2YO3 A;  1ZR4 A;  3L73 E;  5GTH E;  4OGQ B;  2A45 H;  3CWB G;  1NU1 G;  1URQ B;  1DEE G;  1SQQ K;  4GIF A;  3L70 G;  5H2F H;  3Q3D A;  2L5G B;  2K1A A;  2HLO A;  3RL0 B;  3AEE C;  3Q5S A;  1LTS C;  3BCC D;  4GOE A;  1PGO A;  3II6 A;  3HUS A;  3BCC J;  4Y99 C;  2KLV A;  4ASV A;  3L72 G;  2YMK A;  4H0L D;  3EQ2 A;  3VMX A;  1LT1 A;  2FYU K;  3AE7 C;  1KIL E;  3L73 J;  3TF5 A;  1FC2 C;  2KNC A;  3W68 A;  4WY4 C;  1SQV E;  2POH A;  5KLV E;  3AEF C;  1OVU A;  4U3F D;  1XTC C;  1QEX A;  4U3F J;  3NFQ A;  4WBA A;  1GMJ A;  2A06 D;  4PJ0 H;  4NPD A;  2C9N Y;  3RGU A;  2ZAE B;  3H1J D;  2E75 D;  1KMI Z;  3CCQ P;  3M06 A;  3H1J J;  2N1T B;  3CCJ P;  1YBK A;  1NU1 K;  5KAF H;  4PD4 D;  1NTK G;  3KHU A;  1L4A A;  3CCV P;  5APW A;  3H1L E;  1NTM G;  1X79 B;  3G4S P;  1RF1 A;  3V4Q A;  1EDI A;  3GF7 A;  3H6P A;  1VF5 D;  4ZMD A;  2FBW C;  4C7R A;  1DX7 A;  2NPS D;  4Y99 B;  3L74 G;  3GHG A;  2AXT H;  2E74 D;  1AVY A;  3FX0 A;  4W7Z A;  1G1I A;  1KTM A;  4WY4 B;  1T8Z A;  3M0A A;  1LNQ A;  2IBZ D;  2LXB A;  3A0B H;  2WQY C;  4UB8 H;  1SS1 A;  1SFC A;  1NTZ E;  1EDL A;  2UWJ E;  5E79 H;  2CPB A;  4U7J A;  2G8Y A;  3CME P;  1FU1 A;  1KYO D;  1NTK K;  2PP6 A;  1PGP A;  5AW7 B;  1X0T A;  1PP9 E;  4HYT B;  1JNM A;  2YIU C;  1FDI A;  4RJT A;  1HTL C;  2R5B A;  5CJ0 A;  2HPC A;  3CX5 H;  4QMA A;  3AE3 C;  2WSE H;  1T2K C;  1M1J C;  2ITA A;  4IL6 X;  1SQP K;  1G2C B;  3AED C;  3S1K A;  3CXH I;  3HD7 A;  1EXI A;  2WSS H;  1CSB A;  1GZL A;  2YO2 A;  3IF4 A;  5TJH A;  2WT7 A;  2KOG A;  2QJK C;  2AEJ A;  1GD2 E;  1SQV G;  3GF3 A;  5KLV G;  1M8O B;  1W2E A;  3W67 A;  1R5L A;  1Q2N A;  5KJ7 D;  3SFE C;  1RE4 A;  5AW8 B;  3KPE A;  2PRR A;  2QRX A;  1SQX K;  1LWU A;  3KQG A;  5APQ A;  3NXS A;  1NOH A;  2E5Y A;  1NKZ B;  2KS1 A;  3G9R A;  1VQ4 P;  2O01 N;  1LJ2 A;  3AEA C;  4ZKP A;  1VQP P;  4R4L A;  1YHQ P;  1M1K Q;  1L0N D;  3F89 A;  5AW2 B;  1S9K D;  4HH2 A;  4H44 C;  1L0N J;  2Q3E A;  1M1J B;  2ZYA A;  3A0H H;  3B4S A;  5H2F E;  2V7Q J;  2Y0C A;  1EZV E;  2JKV A;  1NGM B;  3KXD A;  2JEE A;  3N4X A;  1SQB G;  4ZKU A;  1FOS F;  1FDM A;  1M7L A;  2H89 C;  2QJK B;  2IYO A;  1HH0 A;  3GLM A;  3HD7 D;  2K9J B;  3WUT A;  2PGD A;  1Q90 D;  1EXJ A;  1P84 I;  1LTB C;  1JB0 J;  3H25 A;  1PFI A; 
#chains in the Genus database with same CATH homology
 1L4A D;  1LTI C;  3L35 A;  1L0N K;  1L0L K;  2C0X A;  3HTK A;  1MFZ A;  3BRT B;  3V5B A;  2HG5 D;  5AVZ B;  4KHX A;  1N7L A;  4IFF A;  5AW5 B;  2ZXE B;  2P2U A;  1FZG A;  1FZC B;  5CMZ A;  1G1J A;  2OYH A;  1CI6 B;  2ZFC A;  3TSI A;  2W6A A;  1HGV A;  2QM7 A;  4EOT A;  1IC2 A;  2Z5H A;  5AW3 B;  1N7S D;  3KDP B;  3LW5 H;  1A02 J;  5BU8 B;  1RF0 A;  1GL2 C;  1HVV A;  3RK3 C;  3RK2 B;  3MIW A;  5CHX A;  1URQ C;  4OH8 B;  3CLQ A;  2KSJ A;  1QL2 A;  1CZQ A;  2NPS B;  5AVT B;  5APX A;  2J58 A;  3H32 B;  4DOJ A;  1JY3 N;  1GDT A;  1MUU A;  1JO5 A;  2WPQ A;  3V2P A;  3RL0 C;  3VP9 A;  5APV A;  1ZR2 A;  2YKP A;  1H88 A;  2FFD B;  3MUD A;  3TYY A;  1S9K E;  2P67 A;  4GT1 A;  1FZA A;  2Q5U A;  2WTY A;  1KIL D;  1SQB K;  1LT9 C;  5AVR B;  4IFD K;  1H8A A;  4O9B A;  3A5T A;  1JCC A;  2E43 A;  1GL2 A;  3C9I A;  2XKM A;  3KYQ A;  4LGD E;  5CCG D;  1URQ A;  3HTK B;  1GW4 A;  1GU5 A;  3O8Z A;  1SFC D;  3U59 A;  3TNU A;  1KZU B;  1RE3 C;  4AYC A;  2OYH B;  1JY2 O;  1SVF A;  2M3B A;  1FAV A;  5CCH D;  4C7N A;  3RK2 D;  5KJ7 C;  5AW6 B;  1QL1 A;  1J1E B;  4N3Y B;  2HFE D;  1LT9 A;  2YKO A;  2KYV A;  2O01 H;  3V2R A;  3L36 A;  1IFD A;  2Q3I A;  3TK1 A;  2H43 A;  2R3C A;  3R2P A;  1JMM A;  1RE3 A;  1JY3 P;  2FXM A;  5AVW B;  5BVZ A;  2WZ7 A;  1FZE A;  2KP8 A;  3HUS C;  5AVY B;  3HE5 A;  2R32 A;  2YO3 A;  2JJL A;  3B5N D;  1ZR4 A;  3M0D C;  1JY2 N;  5KJ7 A;  2GUV A;  1JTH A;  1GL2 B;  2A45 H;  3RK3 B;  4M3L A;  3V2N A;  1SQV K;  2WPR A;  1N73 C;  1URQ B;  5KLV K;  3BAS A;  1OXZ A;  1SQQ K;  2XZR A;  1FJP A;  4GIF A;  1NH4 A;  2L5G B;  1GTW A;  2HLO A;  1KQL A;  4XE5 B;  3RL0 B;  1HWT C;  4LLH A;  4C7N B;  2N1T A;  1LTS C;  2A45 G;  3T97 A;  2O1K A;  3II6 A;  1J1E C;  1VDF A;  3HUS A;  2YNY A;  1LT9 B;  4IFM A;  4Y99 C;  3M0D A;  2KLV A;  1KFM A;  3EQ2 A;  2IFM A;  3VMX A;  1N73 A;  2E42 A;  2FYU K;  2Z5I A;  4GKG A;  3L4F A;  4WY4 C;  3SWF A;  2P1J A;  5AW0 B;  3PP5 A;  2POH A;  3HE5 B;  3A7O A;  3RK3 D;  2HOD A;  1JTH B;  3N7N A;  1J2J B;  1IJD B;  1XTC C;  3A3Y B;  1JY2 P;  5AVS B;  1L4A C;  3NFQ A;  2YMY A;  4WBA A;  1YYC A;  1SLQ A;  1KFN A;  3LID A;  3E1I A;  2C9N Y;  2I1K A;  3P32 A;  2LKM A;  1NWQ A;  1RF1 C;  2WPS A;  1A02 F;  4WY4 A;  1ZV8 A;  3NMD A;  3M06 A;  2N1T B;  2OAR A;  3B8E B;  2OYI C;  3OA7 A;  2Z4E A;  2QM8 A;  1NU1 K;  3HUS B;  3MGN A;  4WB4 A;  3GHG C;  2P7J A;  1N73 B;  1L4A A;  5APW A;  2XV5 A;  3MD0 A;  1ZN5 A;  3A2A A;  4DZO A;  1IO4 A;  1GU4 A;  1LTT C;  1X79 B;  1RF1 A;  1LTJ C;  1XTG B;  3V4W A;  3V4Q A;  3H6P A;  1FOS E;  1SP4 A;  2HYN A;  3UIA A;  4C7R A;  2HOD B;  1JOC A;  2OYI A;  1NTZ K;  1DX7 A;  1N7S A;  4I1L A;  2NPS D;  3MTU E;  4Y99 B;  3GHG A;  1IK9 A;  1GW3 A;  2GUS A;  2XU6 A;  1HJB A;  2C9L Y;  4AUW A;  1AQ5 A;  5AVX B;  1SFC C;  2XDJ A;  4N6J A;  1Z56 A;  4W7Z A;  1G1I A;  3U1A A;  1T3J A;  1LGH B;  1RY3 A;  4WY4 B;  2YKQ A;  2N1T C;  2VRS A;  1GK6 A;  5APY A;  1LTJ A;  1T8Z A;  3P7K A;  3M0A A;  3LIE A;  3HE4 A;  3M9H A;  1HGZ A;  4LC1 A;  2Q7C A;  1WRG A;  4JYB A;  1L4A B;  3G3Z A;  1IFJ A;  1VPC A;  5CCG A;  3TNU B;  2W6B A;  1SFC A;  1G2C A;  1CI6 A;  3M91 A;  3BVH A;  1RF1 B;  2CPB A;  2MJZ A;  4AQR D;  3SWY A;  1FU1 A;  1E5W A;  3B5N C;  3VYI A;  1NTK K;  2OYI B;  2PP6 A;  2IX7 C;  5AW7 B;  3GHG B;  3VMZ A;  4W80 A;  1FZB A;  1MZ9 A;  4HYT B;  1JNM A;  1J1D C;  4JF7 A;  2CPS A;  3IFM A;  1HTL C;  1WT6 A;  3HD7 C;  1FBM A;  3CI9 A;  2R5B A;  2WSC H;  3WMM 0;  5CJ0 A;  1JCD A;  1LTJ B;  2PAJ A;  2HPC A;  4N78 D;  3I5C A;  1GL2 D;  3HE4 B;  2GM4 A;  3BRV B;  2WIT A;  1NAF A;  1URQ D;  3B5N A;  2Q9I A;  2WSE H;  1T2K C;  1IFI A;  2W27 A;  1M1J C;  2C0W A;  3CL3 D;  3P8C D;  2N9B A;  2M8R A;  1SQP K;  3VOP A;  2WSF H;  1CW5 A;  1SFC B;  1G2C B;  1T3U A;  3RL0 D;  5KTB A;  4I2L C;  1YTZ I;  3HD7 A;  1RE4 C;  2KB7 P;  1N2D C;  1IFN A;  3VMY A;  3L37 A;  2WWW A;  5APU A;  1ZLL A;  5AVQ B;  1CSB A;  1GZL A;  1N7S C;  2YO2 A;  1LWU C;  5AW4 B;  2WT7 A;  2KOG A;  1AFO A;  1EQ7 A;  1JUN A;  1GD2 E;  1M1J A;  5APS A;  1DEB A;  2FYZ A;  3M9Q A;  5AW9 B;  2BAS A;  3NTN A;  1H89 A;  2O1J A;  1YTZ T;  3VTP C;  1W2E A;  3BAT A;  5KJ7 D;  4JYC A;  1RE4 A;  2HPC B;  4XA4 A;  1KIL C;  5AW8 B;  3KPE A;  3VN0 A;  1SQX K;  3B5N B;  2H8P D;  1LWU A;  1GK4 A;  4B86 A;  3KQG A;  5APQ A;  5CJ4 A;  3NXS A;  5CCG C;  1NOH A;  4EIJ A;  1NKZ B;  1FZC C;  1J1D B;  1LTG C;  1HBW A;  2A45 I;  2IFN A;  3OAK A;  2N1T D;  4W7Y A;  3HD7 B;  3IR9 A;  3EFG A;  4ZKP A;  2H7H A;  5CCH C;  1NHL A;  1LTA C;  3RK2 C;  4C46 A;  1DH3 A;  1KIL A;  5AW2 B;  1S9K D;  2WT7 B;  2NPS C;  4HH2 A;  3M9B A;  1HUC A;  1IFM A;  2IPP A;  1M1J B;  5APT A;  4N78 E;  2FKW B;  1FZC A;  2FFD C;  2R5D A;  3VP8 A;  5AVU B;  5AW1 B;  3U1C A;  3V2Q A;  1FZF A;  2XNX A;  3P8C E;  2I1J A;  1NO4 A;  5CCH A;  1MV8 A;  1FJK A;  1N7S B;  1X9V A;  2JEE A;  1LWU B;  3N4X A;  3HRN A;  3P8M C;  4ZKU A;  1FOS F;  1FDM A;  1M7L A;  1N86 A;  1NTM K;  3OJA B;  2NPS A;  1X8Y A;  1HH0 A;  3HD7 D;  3H32 A;  4WY4 D;  2OYH C;  4RES B;  1OWA A;  5AVV B;  2FFD A;  4I6M C;  1RF0 C;  2J59 M;  1LTB C;  1KIL B;  1T2K D;  1PFI A;  5BU5 A;  1NKN A;  1JY3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...