3H1IJ

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1iJ00
1BE3J 1BGYJ 3L71J 3H1LJ 3L70J 1KYOI 1SQVJ 3H1HJ 3TGUJ 1SQQJ 5KLVJ 1SQPJ 3L73J 1NTKJ 2BCCJ 1SQXJ 1NU1J 1BCCJ 4D6TJ 1L0NJ 1NTMJ 3H1IJ 3L74J 1L0LJ 1SQBJ 4U3FJ 3H1JJ 2FYUJ 3CWBJ 3CX5I 3L72J 3H1KJ 4PD4I 1P84I 3CXHI 1KB9I 2IBZI 1NTZJ 3L75J 1PP9J 3BCCJ 1EZVI
chains in the Genus database with same CATH superfamily
3A0HH 1IFDA 1KYOI 5KTBA 1IFMA 2CPSA 4D6TG 3L70D 1QL1A 2QA4P 3MIWA 3P8CD 3HE4B 3IN6A 4UB8H 3L4FA 1WMKA 3CX5D 3KXDA 2O1JA 2P7JA 3L70G 2WT7B 3G6EP 4AUWA 2ZYDA 2V7QJ 5AW3B 2KOGA 2DW3A 1OVUA 1GTWA 3VYIA 1N7SA 2V7QH 5GTHH 1L0LK 3AECC 1EZVD 4JQ0D 2WTYA 1OIPA 3RL0g 1KB9H 1XTGB 1IZNB 4YPCA 3PP5A 1AQTA 3A0BE 4H13D 4U3FE 1EZVG 1DEEG 1KFMA 3H32A 3IFMA 1FZBA 2N1TC 4UB6H 1KILD 3BRVB 1ZRTE 4JYBA 4DZOA 4OH8B 1KQSO 2NPSC 1QLED 1ZR2A 3GMAA 1U7MA 2AEJA 1BE3D 1FDMA 1FDOA 3JCUH 2K37A 2NRGA 3HUSA 3AE1C 2KSEA 1L0LJ 5AW7B 3A3YB 2NPSB 1Z56A 1BE3G 4EOTA 1YIJP 1DEBA 2A06E 2FYUK 3MZWB 2ZXXA 3H1KD 3TYYA 1Y47A 3TGUJ 2OYOA 1KTMA 3AEBC 1HGZA 5KLVD 3H1KG 5B5EE 2E76D 1RF1A 2L91A 1FJPA 4PV1D 2WSFJ 3II6A 2Q1KA 1VDFA 4Z1MH 2QJYC 1RF0A 4GT1A 5KLVG 1HTLC 1Q2NA 2OTKE 2WSFH 4D6TE 3PTZA 1ZP0C 3MHVA 2QJYB 1SQPD 2QIWA 1Q90D 3CMAP 1L4AA 1S5LX 3L70E 3AE3C 2M3EA 3AEFC 1KZUB 1NTZD 1VQKP 1VQMP 3CX5E 3SWYA 2ZFCA 1ZN5A 2JWDA 1NH4A 1VL2A 3C1LA 1MFTA 2O3JA 1GZLA 3JSVC 2RMZA 1LTSC 1M1JC 1Q81Q 2ZVOB 1JCCA 5KLIC 4YTPC 3CMEP 3N4XA 4HJGH 3Q1MA 2IDBA 1M1JB 2N1TD 1NHLA 5CMZA 1D7MA 1L0NK 5KLIB 5APXA 4JF7A 4WBAA 2LXCB 1S2EA 1MZ9A 1LT1A 3KZIH 3M9HA 2Q7CA 1NTKK 3L36A 3SSUA 3FX0A 3CX5I 3R4YA 1URQA 1LWUC 1PP9J 1PGPA 1LTIC 3G4SP 1MFZA 1KQFB 5KAIH 2JR8A 3QH9A 1LWUB 3AE4C 1RE3A 2AEMA 3T97B 3CL3D 5KAFE 3EFFK 1NTMK 2OTJP 1LTJC 1YYCA 2H89C 4LGDE 2E75D 2M0BA 2HPCA 2M8RA 1GW3A 1X8YA 3FXDA 1NKNA 1GL2B 1M56D 1LTJB 2WPQA 4ASVA 2HODB 3CCLP 3GF3A 1PPJD 2PFXA 3CCSP 1FZAA 5APYA 1H88A 3FXEA 4H0LC 1NO4A 3CCMP 1PPJG 3F5HA 3M0AA 2OYIA 1GK4A 2JKVA 1MV8A 2ZT9D 3SWKA 3H1LG 1EDIA 3H1JD 1SQVG 3VMAA 3Q5SA 4IL6X 1TU3F 4H0LB 2YMYA 2K1AA 1SQPJ 4EYYQ 3H1JG 4XE5B 4L74A 1M1KQ 3FWLA 1JY3O 1SQXK 4I2LC 3NTNA 1W2BO 2GM4A 1NTZJ 3H1HJ 2VRSA 3CCEP 4NPEA 3RK3C 1M57D 3Q5RA 2QM8A 4R4MA 2C0WA 4R4LA 1NAYA 3IAOA 1LT9C 2C0XA 3KHUA 1PGQA 4PD4D 3PRJA 3CXHD 4MN4C 3RK3B 1G2CB 1JCDA 2P10A 3MD0A 3L75D 1LT9B 1YBKA 3B5ND 1NVOA 1VQPP 1QGKB 1SQBE 1NU1J 1RQUA 2O01J 1YQ3C 1VQ5P 2Y0DA 4Y99C 1YJ9P 4NPFX 1JB0J 3L75G 2JDIH 1N2DC 2OYHB 2O01H 1KQGB 4Y99B 1VQ6P 3CCJP 1JTHA 3B4SA 1FC2C 4A7PA 2FXPA 4KT0J 3FWNA 3CD6P 2XKMA 1FZCB 1SQQK 3L74J 4C7NA 3V2RA 1JOCA 3TNUA 1OFCX 2Z5IA 3MUDA 1AV1A 1URQD 1T2KC 2YKPA 3P8MC 4H0LD 3I55P 2HLOA 3MTUE 2WITA 3D70A 1KILA 4RO0A 1PPJE 1CI6A 3H25A 2Q9IA 5CCHA 1KMIZ 1M7LA 5GTIH 2KZIA 2A45H 3H1LE 1SQVE 1KN7A 1P84H 4C46A 1N86A 1E5WA 2IFNA 2YMKA 3V4WA 2FY8A 5L8RJ 1RE4A 2GUSA 4XA4A 3TF5A 2D2CC 3H1JE 1Q82Q 3M0DC 4ASWA 2CPBA 5E79E 2KXPB 4QMAA 2QRXA 4N78E 4L75A 5AW2B 1X0TA 5AW9B 2D2CB 4RKUJ 2IFMA 2IZ0A 1X9VA 3HE4A 2WPVB 1LTTC 2KUBA 1NKZB 3HD7C 4B86A 1CZQA 2OQQA 2WT7A 1M90Q 1FS0E 5AVTB 1AJYA 1YITP 3CCVP 4Y28J 5KJ7C 4BRYB 2KSJA 3HD7B 1L0LG 3BVHA 4WY4B 1H0TB 4PD4E 2E74C 1HBWA 3CXHE 1MUUA 3G3ZA 3AEEC 2IZ1A 3RK2D 3L75E 2XV5A 3Q3DA 2E74B 4CPGA 4H44C 3D6ZA 2MJZA 3M9QA 1VF5C 2R3CA 3L73J 4ZNCA 4M3LA 1KYOH 1FAVA 3H1IE 1YJNP 4KJMA 3CC4P 2J59M 1AVOA 1OZHA 2FYUD 1VF5B 2KS1A 1AA0A 3BCCJ 1JM0A 2N1TA 1FDIA 3Q5PA 2FYUG 4EIJA 1USEA 3VMZA 3CWBJ 4PD4I 3CXHI 5DJTB 2WSSH 1PFIA 1VQ9P 3KDPB 2HFED 2BCCJ 2FFDA 1JY2N 4W80A 1VQ7P 2B88A 4L76A 2N9YB 1M8OB 1N73A 2XU6A 4UB6E 2UWJE 2YO2A 3O6QA 4N6JA 3RGUA 4WWIA 2WPRA 1EXJA 3N7NA 2PRRA 5CBNA 3VMYA 2KNCB 1ZOYC 1DD4A 2B89A 2Y9YA 3RK3E 1PGOA 3USSA 5DJUB 5CCHD 1GW4A 1SVFA 2Q3EA 2M5AA 3PH0A 1L0LE 4PJ0E 1IFPA 2RN0A 4U3FJ 1DX7A 1SFCD 1IK7A 1A02F 1HH0A 1L0ND 1T8ZA 4H44D 1ZXGA 3A0BH 5KKZC 4EDFA 5AVQB 1FOSF 1NAFA 2I1KA 1L0NG 3VTPC 3WUUA 3W68A 1NTKD 3OJAB 3P7KA 5KKZB 5AW1B 1ZW0A 1RY3A 4I1LA 3B8EB 1IC2A 1NTKG 2HR3A 3SFEC 2WVRA 5APWA 1IO4A 2FYUE 5AVRB 3W67A 4TT3H 3PLNA 4DOJA 2XDJA 1N7SB 1NTMD 1RH5B 4BWNA 3WUVA 2ZJSE 2K9JA 1BDCA 1Q86Q 3QWOC 4HKZH 1NTMG 3SWFA 1BDDA 1LWUA 4D6TJ 3V4QA 2XNDH 3OA7A 1FJKA 5AW8B 2W27A 1J1EB 1W5CE 1YJWP 2FKWB 3H32B 1BCCD 3HUSC 1JY3P 3L71G 3Q2YA 2IBZD 4I7ZC 3B5NA 3L70J 4TLFA 1BCCG 4O9BA 1QEXA 1YQ4C 3HUSB 2IBZG 5APTA 1S5LE 3S9OA 3RL0B 2ITAA 3AE5C 3C8VA 1IFJA 4I7ZB 1LTBC 4W7ZA 1JMBA 2YXRB 3EQ2A 2NPSD 3CX5H 5EFWB 4N3YB 1YTZI 5AW4B 1ZLLA 2RH0A 1RF0C 1EC5A 3EFGA 3E7KA 2YKQA 1SQXD 5CCGC 3CC7P 5KAIE 2R5BA 1SQBD 1OVRA 1KC8Q 3NMDA 3PHLA 3B71A 1SQXG 1HJ0A 3AEAC 2FXOA 4ZKUA 1SQBG 1FU1A 1FOSE 1L0NE 1MKMA 3LIDA 3G9RA 2J5UA 1GL2C 1K73Q 2QEXP 1L4AB 1BE3J 1NTKE 2WQYC 1EXIA 1BGYD 4KHXA 1OW7A 3K5BA 1NOHA 1SQPK 1SLQA 3H1KJ 4HH2A 1USDA 1BGYG 2W90A 1WRGA 1U7JA 1LT9A 1NTZK 5KLVJ 3H1LD 5TJHA 1JNMA 1SQVD 1NTME 1PGJA 2KP8A 3U59A 1ZV8A 2E42A 3LIEA 2QJKC 1BSNA 2HG5D 2M3BA 4LLHA 5CHXA 5BVZA 2H43A 3G71P 3L71E 4RJTA 1SQQG 2B87A 1GD2E 3AE2C 4N78D 2QJKB 1BCCE 1HGVA 2IBZE 2E5YA 4AQRD 1OMIA 3HRNA 1NU1K 1AQ5A 5AW6B 1RE3C 2E43A 5AVSB 2AXTE 4IFMA 5CCGD 4IL6E 1GU5A 2KZJA 5B66H 3ABVC 1JMMA 2Q5UA 2POHA 1K8AQ 1SQXE 2OYHC 4LC1A 1JY3N 1LP1B 4C7RA 1S9KE 1GL2D 1T3JA 3JC22 3H1ID 3P32A 2Z4EA 2IBZI 2FYNC 1FZCC 1JY2P 3L72D 3WU2E 1YHQP 2AEFA 1IJDB 2K88A 1DH3A 3HTKA 3H1IG 1FBMA 3L72G 2FYNB 1KFNA 1RHZB 2C9NY 3GF7A 2IYOA 1BGYE 2MKVA 5AVUB 5TISH 3AEDC 2BEQD 5APQA 4BRYA 2WSEJ 1PZQA 3VP9A 3TK1A 4NPDA 2JWAA 4K35A 2KB7P 2QG4A 3M06A 3V2PA 1ZMEC 2WSEH 1KB9D 5H2FE 1UIXA 1SQQE 1SFCA 1K05A 4GDOA 3WMM0 1XTCC 5AVYB 1R5SA 1NWQA 3ZDMA 3H1LJ 3RK3D 1SQVJ 2RKLA 5AVZB 2KI7B 3L37A 3BATA 3MGNA 3H1JJ 5K5GB 4WY4C 1FZGA 1L0LD 2K9YA 2YIUC 2P1JA 4GODA 3O8ZA 1FZEA 4OVNF 3HE5B 2Z5HA 1JTHB 3MUDC 5E79H 2JEEA 3S1KA 3CI9A 3TGUD 1VPCA 4H13C 3U1AA 2YIUB 2WZ7A 2QSIA 1S4XA 1PV3A 2W6AA 1IFIA 3TNUB 2AXCA 1KILC 3V6IA 3TGUG 1N7LA 3L73E 4H13B 1HVVA 2E5TA 3A0HE 3VMXA 2I8DA 1WT6A 1KILB 4L73A 3L72E 1H8AA 1CI6B 1GK6A 1RE4C 3CCQP 1J2JB 4UB8E 3L75J 3CLQA 3BASA 1T2KD 1OWAA 4PD4H 1Y8AA 3CXHH 1K9MQ 2BASA 3LW5J 5M1BA 4U7JA 1Y9BA 2ZAEB 2R44A 1L2PA 2PAJA 1NYHA 1X79B 3GHGC 2NPSA 2E76C 3LW5H 1ZR4A 3KYQA 4PV1C 1T6AA 5GTHE 2BCCE 2W6JH 1JO5A 4DCKA 3GHGB 2D2CD 2E76B 4PV1B 1KB9E 5CBOA 2P58A 5C39A 3OAKA 1CSBA 3D6YA 2G8YA 2JO1A 2YXQB 3HD7D 4WY4D 1KD1Q 3JCUE 5CJ0A 4I6MC 3RBZA 5KJ7D 1SP4A 4HYTB 1PP9D 2E74D 4WVZA 2LR2A 4GKGA 3CPWO 2FYZA 1Q7YQ 1PP9G 4HB1A 4YXWH 1NGMB 1KB9I 2KS1B 2YNYA 2G3AA 3TGUE 1LNQA 1VF5D 2N9BA 2W6BA 3AE8C 3RBXA 2I1JA 2N1TB 1OW8A 2H7HA 3VN0A 3AE9C 1M1JA 2XZRA 2H88C 1OX3A 2FFDC 2IYPA 1OW6A 2QJPC 2KK7A 3U1CA 1EDKA 1FZFA 1GMJA 4PJ0H 1N7SC 3GW6A 3OW2O 1N73C 1OXZA 2FFDB 2QJPB 2PP6A 3D71A 1PIXA 2WPSA 1N73B 4RESB 1EDLA 3V2QA 1J1EC 3O6QB 2E75C 5CCGA 5B5EH 3L71D 3A7OA 2ZVNB 3V5BA 5AVVB 1R5LA 2FYUJ 3T97A 2LXBA 1UIIA 2E75B 3RL0C 3P8CE 1NJIQ 1SQPG 5APVA 2Y9ZA 3H1HD 2CK3H 4ZKPA 1YTZT 1GL2A 2M5AB 1LTJA 5CJ4A 4DT0A 4JYCA 1IK9A 2HODA 1NTZG 3H1HG 2H8PD 3KZIE 2ZT9C 5APSA 3WUTA 1BSHA 4JPZB 3GG2A 1RF1C 2Q6QA 2YKOA 4OGQC 2QM7A 2IX7C 2ZT9B 1EZVE 1NU1D 3UIAA 1RF1B 1KORA 1PP9E 4IOIH 4OGQB 1S9KD 1S5LH 1NU1G 3F89A 1L4AC 1KILE 2B9BA 2LKMA 2YO3A 1CW5A 5KLVK 3CCUP 2NZ2A 3L74D 1BE3E 1SS1A 1N7SD 3KPEA 3M91A 2FXMA 1A02J 2K9JB 1H89A 3AE6C 5APUA 3L74G 3B5NC 1L0NJ 2O01N 3H1KE 2Y0EA 2ZYAA 2P2UA 1P84D 5BU5A 3R2PA 2HYNA 2PGDA 3I56P 1G2CA 2R32A 1EZVI 1IFNA 3B5NB 5KLVE 2A45G 4AYCA 1NTKJ 3C9IA 1LP1A 3TSIA 1W2EA 5KAFH 1SQQD 1S1CX 3TDKA 3KQGA 3RL0D 2OYHA 1EDJA 2WMMA 2GUVA 2K3RA 3SFDC 1HWTC 1VQ8P 1URQC 2ZXEB 1SQPE 3AEGC 3H6PA 4ZMDA 3AE7C 1G1JA 1FZCA 1NTMJ 1GDTA 1YI2P 1VQLP 1QL2A 1OVVA 1URQB 1NTZE 3H1HE 4WB4A 3L71J 5B66E 1X22A 1RQVA 2W83C 4OGQD 2OARA 2JP3A 1BCCJ 1HF9A 1FE6A 4OWFA 2JJLA 5BU8B 1JEKA 1SQBK 3GLMA 2ZYGA 1R8EA 1KYOD 3FGAD 2R3SA 1L4AD 2HPCB 1T3UA 1S3JA 1NU1E 3L73D 5AW5B 4YXDC 1K04A 1HJBA 2P67A 3EWKA 2L5GB 4XFJA 3L73G 2OYIC 2AXTH 3BCCD 5TISE 3M0DA 3CCRP 4IL6H 3NFQA 4GOFA 1SQXJ 3L74E 1SQBJ 3L35A 2OYIB 3BCCG 5AW0B 4DJGA 3RK2C 3V2NA 3CWBD 2QE7H 4BXLA 1KV4A 3S4RA 2SPZA 5GTIE 3I5CA 1G1IA 3HE5A 2B87B 3HD7A 2GA1A 4WY4A 1N8RQ 1H0TA 5AVXB 1P84E 1SQVK 4GOEA 3CWBG 1AVYA 1KQLA 3RK2B 2BCCD 3IR9A 3WU2H 5KJ7A 2OTLP 2KIKA 3E1IA 1BGYJ 1EQ7A 2BCCG 2BEZF 4IFDK 1LJ2A 2QVAA 1U57A 3M9BA 3CC2P 2J58A 4GIFA 2R5DA 1SQQJ 1PL5A 2Q3IA 2KYVA 1VQ4P 3BRTB 4JBZA 5H2FH 2A45I 1P84I 4U3FD 1QX8A 1LTGC 3GHGA 1ZRTD 3VOPA 2IPPA 1JUNA 2WSCJ 3HTKB 4U3FG 1S72P 2XNXA 1KYOE 4C7NB 2KLVA 1QVFO 2W8ZA 3MP7B 2WSCH 5AVWB 1DIPA 3E1RA 5CCHC 2KLUA 2A06D 1LGHB 3ITKA 4EI2A 2OGUA 2WWWA 1J1DC 2KNCA 2FBWC 2Y0CA 3PJSK 4K3AA 1LTAC 3A5TA 2O1KA 1E79H 1SFCC 2A06G 1GU4A 1HUCA 3BCCE 1DD3A 1AFOA 1J1DB 3A2AA 1QVGO 3VP8A 1SFCB 2V4HA 3H1IJ 3CWBE 4IFFA 1JY2O 3L72J 3NXSA 4D6TD 2C9LY 4H44B 4W7YA 3IF4A 1VQNP 1VQOP
chains in the Genus database with same CATH topology
1BE3J 1BGYJ 3L71J 3H1LJ 3L70J 1KYOI 1SQVJ 3H1HJ 3TGUJ 1SQQJ 5KLVJ 1SQPJ 3L73J 1NTKJ 2BCCJ 1SQXJ 1NU1J 1BCCJ 4D6TJ 1L0NJ 1NTMJ 3H1IJ 3L74J 1L0LJ 1SQBJ 4U3FJ 3H1JJ 2FYUJ 3CWBJ 3CX5I 3L72J 3H1KJ 4PD4I 1P84I 3CXHI 1KB9I 2IBZI 1NTZJ 3L75J 1PP9J 3BCCJ 1EZVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 J;  1BGY J;  3L71 J;  3H1L J;  3L70 J;  1KYO I;  1SQV J;  3H1H J;  3TGU J;  1SQQ J;  5KLV J;  1SQP J;  3L73 J;  1NTK J;  2BCC J;  1SQX J;  1NU1 J;  1BCC J;  4D6T J;  1L0N J;  1NTM J;  3H1I J;  3L74 J;  1L0L J;  1SQB J;  4U3F J;  3H1J J;  2FYU J;  3CWB J;  3CX5 I;  3L72 J;  3H1K J;  4PD4 I;  1P84 I;  3CXH I;  1KB9 I;  2IBZ I;  1NTZ J;  3L75 J;  1PP9 J;  3BCC J;  1EZV I; 
#chains in the Genus database with same CATH topology
 3A0H H;  1IFD A;  1KYO I;  5KTB A;  1IFM A;  2CPS A;  4D6T G;  3L70 D;  1QL1 A;  2QA4 P;  3MIW A;  3P8C D;  3HE4 B;  3IN6 A;  4UB8 H;  3L4F A;  1WMK A;  3CX5 D;  3KXD A;  2O1J A;  2P7J A;  3L70 G;  2WT7 B;  3G6E P;  4AUW A;  2ZYD A;  2V7Q J;  5AW3 B;  2KOG A;  2DW3 A;  1OVU A;  1GTW A;  3VYI A;  1N7S A;  2V7Q H;  5GTH H;  1L0L K;  3AEC C;  1EZV D;  4JQ0 D;  2WTY A;  1OIP A;  3RL0 g;  1KB9 H;  1XTG B;  1IZN B;  4YPC A;  3PP5 A;  1AQT A;  3A0B E;  4H13 D;  4U3F E;  1EZV G;  1DEE G;  1KFM A;  3H32 A;  3IFM A;  1FZB A;  2N1T C;  4UB6 H;  1KIL D;  3BRV B;  1ZRT E;  4JYB A;  4DZO A;  4OH8 B;  1KQS O;  2NPS C;  1QLE D;  1ZR2 A;  3GMA A;  1U7M A;  2AEJ A;  1BE3 D;  1FDM A;  1FDO A;  3JCU H;  2K37 A;  2NRG A;  3HUS A;  3AE1 C;  2KSE A;  1L0L J;  5AW7 B;  3A3Y B;  2NPS B;  1Z56 A;  1BE3 G;  4EOT A;  1YIJ P;  1DEB A;  2A06 E;  2FYU K;  3MZW B;  2ZXX A;  3H1K D;  3TYY A;  1Y47 A;  3TGU J;  2OYO A;  1KTM A;  3AEB C;  1HGZ A;  5KLV D;  3H1K G;  5B5E E;  2E76 D;  1RF1 A;  2L91 A;  1FJP A;  4PV1 D;  2WSF J;  3II6 A;  2Q1K A;  1VDF A;  4Z1M H;  2QJY C;  1RF0 A;  4GT1 A;  5KLV G;  1HTL C;  1Q2N A;  2OTK E;  2WSF H;  4D6T E;  3PTZ A;  1ZP0 C;  3MHV A;  2QJY B;  1SQP D;  2QIW A;  1Q90 D;  3CMA P;  1L4A A;  1S5L X;  3L70 E;  3AE3 C;  2M3E A;  3AEF C;  1KZU B;  1NTZ D;  1VQK P;  1VQM P;  3CX5 E;  3SWY A;  2ZFC A;  1ZN5 A;  2JWD A;  1NH4 A;  1VL2 A;  3C1L A;  1MFT A;  2O3J A;  1GZL A;  3JSV C;  2RMZ A;  1LTS C;  1M1J C;  1Q81 Q;  2ZVO B;  1JCC A;  5KLI C;  4YTP C;  3CME P;  3N4X A;  4HJG H;  3Q1M A;  2IDB A;  1M1J B;  2N1T D;  1NHL A;  5CMZ A;  1D7M A;  1L0N K;  5KLI B;  5APX A;  4JF7 A;  4WBA A;  2LXC B;  1S2E A;  1MZ9 A;  1LT1 A;  3KZI H;  3M9H A;  2Q7C A;  1NTK K;  3L36 A;  3SSU A;  3FX0 A;  3CX5 I;  3R4Y A;  1URQ A;  1LWU C;  1PP9 J;  1PGP A;  1LTI C;  3G4S P;  1MFZ A;  1KQF B;  5KAI H;  2JR8 A;  3QH9 A;  1LWU B;  3AE4 C;  1RE3 A;  2AEM A;  3T97 B;  3CL3 D;  5KAF E;  3EFF K;  1NTM K;  2OTJ P;  1LTJ C;  1YYC A;  2H89 C;  4LGD E;  2E75 D;  2M0B A;  2HPC A;  2M8R A;  1GW3 A;  1X8Y A;  3FXD A;  1NKN A;  1GL2 B;  1M56 D;  1LTJ B;  2WPQ A;  4ASV A;  2HOD B;  3CCL P;  3GF3 A;  1PPJ D;  2PFX A;  3CCS P;  1FZA A;  5APY A;  1H88 A;  3FXE A;  4H0L C;  1NO4 A;  3CCM P;  1PPJ G;  3F5H A;  3M0A A;  2OYI A;  1GK4 A;  2JKV A;  1MV8 A;  2ZT9 D;  3SWK A;  3H1L G;  1EDI A;  3H1J D;  1SQV G;  3VMA A;  3Q5S A;  4IL6 X;  1TU3 F;  4H0L B;  2YMY A;  2K1A A;  1SQP J;  4EYY Q;  3H1J G;  4XE5 B;  4L74 A;  1M1K Q;  3FWL A;  1JY3 O;  1SQX K;  4I2L C;  3NTN A;  1W2B O;  2GM4 A;  1NTZ J;  3H1H J;  2VRS A;  3CCE P;  4NPE A;  3RK3 C;  1M57 D;  3Q5R A;  2QM8 A;  4R4M A;  2C0W A;  4R4L A;  1NAY A;  3IAO A;  1LT9 C;  2C0X A;  3KHU A;  1PGQ A;  4PD4 D;  3PRJ A;  3CXH D;  4MN4 C;  3RK3 B;  1G2C B;  1JCD A;  2P10 A;  3MD0 A;  3L75 D;  1LT9 B;  1YBK A;  3B5N D;  1NVO A;  1VQP P;  1QGK B;  1SQB E;  1NU1 J;  1RQU A;  2O01 J;  1YQ3 C;  1VQ5 P;  2Y0D A;  4Y99 C;  1YJ9 P;  4NPF X;  1JB0 J;  3L75 G;  2JDI H;  1N2D C;  2OYH B;  2O01 H;  1KQG B;  4Y99 B;  1VQ6 P;  3CCJ P;  1JTH A;  3B4S A;  1FC2 C;  4A7P A;  2FXP A;  4KT0 J;  3FWN A;  3CD6 P;  2XKM A;  1FZC B;  1SQQ K;  3L74 J;  4C7N A;  3V2R A;  1JOC A;  3TNU A;  1OFC X;  2Z5I A;  3MUD A;  1AV1 A;  1URQ D;  1T2K C;  2YKP A;  3P8M C;  4H0L D;  3I55 P;  2HLO A;  3MTU E;  2WIT A;  3D70 A;  1KIL A;  4RO0 A;  1PPJ E;  1CI6 A;  3H25 A;  2Q9I A;  5CCH A;  1KMI Z;  1M7L A;  5GTI H;  2KZI A;  2A45 H;  3H1L E;  1SQV E;  1KN7 A;  1P84 H;  4C46 A;  1N86 A;  1E5W A;  2IFN A;  2YMK A;  3V4W A;  2FY8 A;  5L8R J;  1RE4 A;  2GUS A;  4XA4 A;  3TF5 A;  2D2C C;  3H1J E;  1Q82 Q;  3M0D C;  4ASW A;  2CPB A;  5E79 E;  2KXP B;  4QMA A;  2QRX A;  4N78 E;  4L75 A;  5AW2 B;  1X0T A;  5AW9 B;  2D2C B;  4RKU J;  2IFM A;  2IZ0 A;  1X9V A;  3HE4 A;  2WPV B;  1LTT C;  2KUB A;  1NKZ B;  3HD7 C;  4B86 A;  1CZQ A;  2OQQ A;  2WT7 A;  1M90 Q;  1FS0 E;  5AVT B;  1AJY A;  1YIT P;  3CCV P;  4Y28 J;  5KJ7 C;  4BRY B;  2KSJ A;  3HD7 B;  1L0L G;  3BVH A;  4WY4 B;  1H0T B;  4PD4 E;  2E74 C;  1HBW A;  3CXH E;  1MUU A;  3G3Z A;  3AEE C;  2IZ1 A;  3RK2 D;  3L75 E;  2XV5 A;  3Q3D A;  2E74 B;  4CPG A;  4H44 C;  3D6Z A;  2MJZ A;  3M9Q A;  1VF5 C;  2R3C A;  3L73 J;  4ZNC A;  4M3L A;  1KYO H;  1FAV A;  3H1I E;  1YJN P;  4KJM A;  3CC4 P;  2J59 M;  1AVO A;  1OZH A;  2FYU D;  1VF5 B;  2KS1 A;  1AA0 A;  3BCC J;  1JM0 A;  2N1T A;  1FDI A;  3Q5P A;  2FYU G;  4EIJ A;  1USE A;  3VMZ A;  3CWB J;  4PD4 I;  3CXH I;  5DJT B;  2WSS H;  1PFI A;  1VQ9 P;  3KDP B;  2HFE D;  2BCC J;  2FFD A;  1JY2 N;  4W80 A;  1VQ7 P;  2B88 A;  4L76 A;  2N9Y B;  1M8O B;  1N73 A;  2XU6 A;  4UB6 E;  2UWJ E;  2YO2 A;  3O6Q A;  4N6J A;  3RGU A;  4WWI A;  2WPR A;  1EXJ A;  3N7N A;  2PRR A;  5CBN A;  3VMY A;  2KNC B;  1ZOY C;  1DD4 A;  2B89 A;  2Y9Y A;  3RK3 E;  1PGO A;  3USS A;  5DJU B;  5CCH D;  1GW4 A;  1SVF A;  2Q3E A;  2M5A A;  3PH0 A;  1L0L E;  4PJ0 E;  1IFP A;  2RN0 A;  4U3F J;  1DX7 A;  1SFC D;  1IK7 A;  1A02 F;  1HH0 A;  1L0N D;  1T8Z A;  4H44 D;  1ZXG A;  3A0B H;  5KKZ C;  4EDF A;  5AVQ B;  1FOS F;  1NAF A;  2I1K A;  1L0N G;  3VTP C;  3WUU A;  3W68 A;  1NTK D;  3OJA B;  3P7K A;  5KKZ B;  5AW1 B;  1ZW0 A;  1RY3 A;  4I1L A;  3B8E B;  1IC2 A;  1NTK G;  2HR3 A;  3SFE C;  2WVR A;  5APW A;  1IO4 A;  2FYU E;  5AVR B;  3W67 A;  4TT3 H;  3PLN A;  4DOJ A;  2XDJ A;  1N7S B;  1NTM D;  1RH5 B;  4BWN A;  3WUV A;  2ZJS E;  2K9J A;  1BDC A;  1Q86 Q;  3QWO C;  4HKZ H;  1NTM G;  3SWF A;  1BDD A;  1LWU A;  4D6T J;  3V4Q A;  2XND H;  3OA7 A;  1FJK A;  5AW8 B;  2W27 A;  1J1E B;  1W5C E;  1YJW P;  2FKW B;  3H32 B;  1BCC D;  3HUS C;  1JY3 P;  3L71 G;  3Q2Y A;  2IBZ D;  4I7Z C;  3B5N A;  3L70 J;  4TLF A;  1BCC G;  4O9B A;  1QEX A;  1YQ4 C;  3HUS B;  2IBZ G;  5APT A;  1S5L E;  3S9O A;  3RL0 B;  2ITA A;  3AE5 C;  3C8V A;  1IFJ A;  4I7Z B;  1LTB C;  4W7Z A;  1JMB A;  2YXR B;  3EQ2 A;  2NPS D;  3CX5 H;  5EFW B;  4N3Y B;  1YTZ I;  5AW4 B;  1ZLL A;  2RH0 A;  1RF0 C;  1EC5 A;  3EFG A;  3E7K A;  2YKQ A;  1SQX D;  5CCG C;  3CC7 P;  5KAI E;  2R5B A;  1SQB D;  1OVR A;  1KC8 Q;  3NMD A;  3PHL A;  3B71 A;  1SQX G;  1HJ0 A;  3AEA C;  2FXO A;  4ZKU A;  1SQB G;  1FU1 A;  1FOS E;  1L0N E;  1MKM A;  3LID A;  3G9R A;  2J5U A;  1GL2 C;  1K73 Q;  2QEX P;  1L4A B;  1BE3 J;  1NTK E;  2WQY C;  1EXI A;  1BGY D;  4KHX A;  1OW7 A;  3K5B A;  1NOH A;  1SQP K;  1SLQ A;  3H1K J;  4HH2 A;  1USD A;  1BGY G;  2W90 A;  1WRG A;  1U7J A;  1LT9 A;  1NTZ K;  5KLV J;  3H1L D;  5TJH A;  1JNM A;  1SQV D;  1NTM E;  1PGJ A;  2KP8 A;  3U59 A;  1ZV8 A;  2E42 A;  3LIE A;  2QJK C;  1BSN A;  2HG5 D;  2M3B A;  4LLH A;  5CHX A;  5BVZ A;  2H43 A;  3G71 P;  3L71 E;  4RJT A;  1SQQ G;  2B87 A;  1GD2 E;  3AE2 C;  4N78 D;  2QJK B;  1BCC E;  1HGV A;  2IBZ E;  2E5Y A;  4AQR D;  1OMI A;  3HRN A;  1NU1 K;  1AQ5 A;  5AW6 B;  1RE3 C;  2E43 A;  5AVS B;  2AXT E;  4IFM A;  5CCG D;  4IL6 E;  1GU5 A;  2KZJ A;  5B66 H;  3ABV C;  1JMM A;  2Q5U A;  2POH A;  1K8A Q;  1SQX E;  2OYH C;  4LC1 A;  1JY3 N;  1LP1 B;  4C7R A;  1S9K E;  1GL2 D;  1T3J A;  3JC2 2;  3H1I D;  3P32 A;  2Z4E A;  2IBZ I;  2FYN C;  1FZC C;  1JY2 P;  3L72 D;  3WU2 E;  1YHQ P;  2AEF A;  1IJD B;  2K88 A;  1DH3 A;  3HTK A;  3H1I G;  1FBM A;  3L72 G;  2FYN B;  1KFN A;  1RHZ B;  2C9N Y;  3GF7 A;  2IYO A;  1BGY E;  2MKV A;  5AVU B;  5TIS H;  3AED C;  2BEQ D;  5APQ A;  4BRY A;  2WSE J;  1PZQ A;  3VP9 A;  3TK1 A;  4NPD A;  2JWA A;  4K35 A;  2KB7 P;  2QG4 A;  3M06 A;  3V2P A;  1ZME C;  2WSE H;  1KB9 D;  5H2F E;  1UIX A;  1SQQ E;  1SFC A;  1K05 A;  4GDO A;  3WMM 0;  1XTC C;  5AVY B;  1R5S A;  1NWQ A;  3ZDM A;  3H1L J;  3RK3 D;  1SQV J;  2RKL A;  5AVZ B;  2KI7 B;  3L37 A;  3BAT A;  3MGN A;  3H1J J;  5K5G B;  4WY4 C;  1FZG A;  1L0L D;  2K9Y A;  2YIU C;  2P1J A;  4GOD A;  3O8Z A;  1FZE A;  4OVN F;  3HE5 B;  2Z5H A;  1JTH B;  3MUD C;  5E79 H;  2JEE A;  3S1K A;  3CI9 A;  3TGU D;  1VPC A;  4H13 C;  3U1A A;  2YIU B;  2WZ7 A;  2QSI A;  1S4X A;  1PV3 A;  2W6A A;  1IFI A;  3TNU B;  2AXC A;  1KIL C;  3V6I A;  3TGU G;  1N7L A;  3L73 E;  4H13 B;  1HVV A;  2E5T A;  3A0H E;  3VMX A;  2I8D A;  1WT6 A;  1KIL B;  4L73 A;  3L72 E;  1H8A A;  1CI6 B;  1GK6 A;  1RE4 C;  3CCQ P;  1J2J B;  4UB8 E;  3L75 J;  3CLQ A;  3BAS A;  1T2K D;  1OWA A;  4PD4 H;  1Y8A A;  3CXH H;  1K9M Q;  2BAS A;  3LW5 J;  5M1B A;  4U7J A;  1Y9B A;  2ZAE B;  2R44 A;  1L2P A;  2PAJ A;  1NYH A;  1X79 B;  3GHG C;  2NPS A;  2E76 C;  3LW5 H;  1ZR4 A;  3KYQ A;  4PV1 C;  1T6A A;  5GTH E;  2BCC E;  2W6J H;  1JO5 A;  4DCK A;  3GHG B;  2D2C D;  2E76 B;  4PV1 B;  1KB9 E;  5CBO A;  2P58 A;  5C39 A;  3OAK A;  1CSB A;  3D6Y A;  2G8Y A;  2JO1 A;  2YXQ B;  3HD7 D;  4WY4 D;  1KD1 Q;  3JCU E;  5CJ0 A;  4I6M C;  3RBZ A;  5KJ7 D;  1SP4 A;  4HYT B;  1PP9 D;  2E74 D;  4WVZ A;  2LR2 A;  4GKG A;  3CPW O;  2FYZ A;  1Q7Y Q;  1PP9 G;  4HB1 A;  4YXW H;  1NGM B;  1KB9 I;  2KS1 B;  2YNY A;  2G3A A;  3TGU E;  1LNQ A;  1VF5 D;  2N9B A;  2W6B A;  3AE8 C;  3RBX A;  2I1J A;  2N1T B;  1OW8 A;  2H7H A;  3VN0 A;  3AE9 C;  1M1J A;  2XZR A;  2H88 C;  1OX3 A;  2FFD C;  2IYP A;  1OW6 A;  2QJP C;  2KK7 A;  3U1C A;  1EDK A;  1FZF A;  1GMJ A;  4PJ0 H;  1N7S C;  3GW6 A;  3OW2 O;  1N73 C;  1OXZ A;  2FFD B;  2QJP B;  2PP6 A;  3D71 A;  1PIX A;  2WPS A;  1N73 B;  4RES B;  1EDL A;  3V2Q A;  1J1E C;  3O6Q B;  2E75 C;  5CCG A;  5B5E H;  3L71 D;  3A7O A;  2ZVN B;  3V5B A;  5AVV B;  1R5L A;  2FYU J;  3T97 A;  2LXB A;  1UII A;  2E75 B;  3RL0 C;  3P8C E;  1NJI Q;  1SQP G;  5APV A;  2Y9Z A;  3H1H D;  2CK3 H;  4ZKP A;  1YTZ T;  1GL2 A;  2M5A B;  1LTJ A;  5CJ4 A;  4DT0 A;  4JYC A;  1IK9 A;  2HOD A;  1NTZ G;  3H1H G;  2H8P D;  3KZI E;  2ZT9 C;  5APS A;  3WUT A;  1BSH A;  4JPZ B;  3GG2 A;  1RF1 C;  2Q6Q A;  2YKO A;  4OGQ C;  2QM7 A;  2IX7 C;  2ZT9 B;  1EZV E;  1NU1 D;  3UIA A;  1RF1 B;  1KOR A;  1PP9 E;  4IOI H;  4OGQ B;  1S9K D;  1S5L H;  1NU1 G;  3F89 A;  1L4A C;  1KIL E;  2B9B A;  2LKM A;  2YO3 A;  1CW5 A;  5KLV K;  3CCU P;  2NZ2 A;  3L74 D;  1BE3 E;  1SS1 A;  1N7S D;  3KPE A;  3M91 A;  2FXM A;  1A02 J;  2K9J B;  1H89 A;  3AE6 C;  5APU A;  3L74 G;  3B5N C;  1L0N J;  2O01 N;  3H1K E;  2Y0E A;  2ZYA A;  2P2U A;  1P84 D;  5BU5 A;  3R2P A;  2HYN A;  2PGD A;  3I56 P;  1G2C A;  2R32 A;  1EZV I;  1IFN A;  3B5N B;  5KLV E;  2A45 G;  4AYC A;  1NTK J;  3C9I A;  1LP1 A;  3TSI A;  1W2E A;  5KAF H;  1SQQ D;  1S1C X;  3TDK A;  3KQG A;  3RL0 D;  2OYH A;  1EDJ A;  2WMM A;  2GUV A;  2K3R A;  3SFD C;  1HWT C;  1VQ8 P;  1URQ C;  2ZXE B;  1SQP E;  3AEG C;  3H6P A;  4ZMD A;  3AE7 C;  1G1J A;  1FZC A;  1NTM J;  1GDT A;  1YI2 P;  1VQL P;  1QL2 A;  1OVV A;  1URQ B;  1NTZ E;  3H1H E;  4WB4 A;  3L71 J;  5B66 E;  1X22 A;  1RQV A;  2W83 C;  4OGQ D;  2OAR A;  2JP3 A;  1BCC J;  1HF9 A;  1FE6 A;  4OWF A;  2JJL A;  5BU8 B;  1JEK A;  1SQB K;  3GLM A;  2ZYG A;  1R8E A;  1KYO D;  3FGA D;  2R3S A;  1L4A D;  2HPC B;  1T3U A;  1S3J A;  1NU1 E;  3L73 D;  5AW5 B;  4YXD C;  1K04 A;  1HJB A;  2P67 A;  3EWK A;  2L5G B;  4XFJ A;  3L73 G;  2OYI C;  2AXT H;  3BCC D;  5TIS E;  3M0D A;  3CCR P;  4IL6 H;  3NFQ A;  4GOF A;  1SQX J;  3L74 E;  1SQB J;  3L35 A;  2OYI B;  3BCC G;  5AW0 B;  4DJG A;  3RK2 C;  3V2N A;  3CWB D;  2QE7 H;  4BXL A;  1KV4 A;  3S4R A;  2SPZ A;  5GTI E;  3I5C A;  1G1I A;  3HE5 A;  2B87 B;  3HD7 A;  2GA1 A;  4WY4 A;  1N8R Q;  1H0T A;  5AVX B;  1P84 E;  1SQV K;  4GOE A;  3CWB G;  1AVY A;  1KQL A;  3RK2 B;  2BCC D;  3IR9 A;  3WU2 H;  5KJ7 A;  2OTL P;  2KIK A;  3E1I A;  1BGY J;  1EQ7 A;  2BCC G;  2BEZ F;  4IFD K;  1LJ2 A;  2QVA A;  1U57 A;  3M9B A;  3CC2 P;  2J58 A;  4GIF A;  2R5D A;  1SQQ J;  1PL5 A;  2Q3I A;  2KYV A;  1VQ4 P;  3BRT B;  4JBZ A;  5H2F H;  2A45 I;  1P84 I;  4U3F D;  1QX8 A;  1LTG C;  3GHG A;  1ZRT D;  3VOP A;  2IPP A;  1JUN A;  2WSC J;  3HTK B;  4U3F G;  1S72 P;  2XNX A;  1KYO E;  4C7N B;  2KLV A;  1QVF O;  2W8Z A;  3MP7 B;  2WSC H;  5AVW B;  1DIP A;  3E1R A;  5CCH C;  2KLU A;  2A06 D;  1LGH B;  3ITK A;  4EI2 A;  2OGU A;  2WWW A;  1J1D C;  2KNC A;  2FBW C;  2Y0C A;  3PJS K;  4K3A A;  1LTA C;  3A5T A;  2O1K A;  1E79 H;  1SFC C;  2A06 G;  1GU4 A;  1HUC A;  3BCC E;  1DD3 A;  1AFO A;  1J1D B;  3A2A A;  1QVG O;  3VP8 A;  1SFC B;  2V4H A;  3H1I J;  3CWB E;  4IFF A;  1JY2 O;  3L72 J;  3NXS A;  4D6T D;  2C9L Y;  4H44 B;  4W7Y A;  3IF4 A;  1VQN P;  1VQO P; 
#chains in the Genus database with same CATH homology
 1BE3 J;  1BGY J;  3L71 J;  3H1L J;  3L70 J;  1KYO I;  1SQV J;  3H1H J;  3TGU J;  1SQQ J;  5KLV J;  1SQP J;  3L73 J;  1NTK J;  2BCC J;  1SQX J;  1NU1 J;  1BCC J;  4D6T J;  1L0N J;  1NTM J;  3H1I J;  3L74 J;  1L0L J;  1SQB J;  4U3F J;  3H1J J;  2FYU J;  3CWB J;  3CX5 I;  3L72 J;  3H1K J;  4PD4 I;  1P84 I;  3CXH I;  1KB9 I;  2IBZ I;  1NTZ J;  3L75 J;  1PP9 J;  3BCC J;  1EZV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...