3H1IJ

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1iJ00
3L75J 1PP9J 1SQPJ 1SQBJ 1KB9I 3L71J 3L70J 3L74J 3BCCJ 3TGUJ 1NTMJ 3CX5I 2IBZI 3H1IJ 3H1HJ 3CWBJ 3CXHI 3H1LJ 3L72J 2BCCJ 2FYUJ 3H1KJ 1BGYJ 1EZVI 1NTKJ 1SQXJ 4U3FJ 3H1JJ 1P84I 1SQQJ 4D6TJ 1SQVJ 5KLVJ 1L0LJ 3L73J 1NU1J 1BE3J 1KYOI 4PD4I 1L0NJ 1BCCJ 1NTZJ
chains in the Genus database with same CATH superfamily
1SQBK 2B89A 1GL2D 1N73A 1IFMA 1UIXA 2N9YB 3L73G 2KNCA 2YMYA 2XNXA 1SQXJ 3G71P 1ZRTD 2OYOA 1RF1A 2IYPA 1SQVJ 2OYIC 3HE4B 1PIXA 2XNDH 4AQRD 1OW8A 3MIWA 1BDCA 1KV4A 3BRVB 1NTMJ 3H1LD 1H89A 2HPCA 3H25A 2SPZA 3SFEC 2OYIB 4H13B 1VQKP 1N7SA 1AQTA 1LGHB 3P32A 3CCEP 4PD4I 3TGUG 4U3FD 3L75D 1NTZD 4IFFA 4ZKUA 1N73C 4DJGA 4ZMDA 1CZQA 1SS1A 3H1JG 5BU8B 1VDFA 3VOPA 2OTJP 1RF1C 4H13D 1IZNB 2WZ7A 1P84D 3SWYA 1G1JA 2Z5HA 3KZIE 1N73B 4N78D 2KNCB 1SQBJ 1RF1B 2IYOA 2H7HA 2PFXA 1N7SC 5AW1B 1BE3E 3AE6C 2BEQD 1EXIA 1R5LA 2KUBA 1EC5A 1SQPG 3M06A 3V2RA 1GD2E 2HPCB 2IBZE 3H32B 1Q82Q 4GOFA 1YHQP 1NKZB 1NKNA 5APYA 3EFFK 5M1BA 2Y0CA 1USEA 1LTBC 2PAJA 2KS1B 2J59M 3D6YA 2QJYC 1L0LG 3VYIA 3L72J 5B5EH 3H1KJ 1YYCA 2H89C 2JR8A 3L35A 1AJYA 4IFDK 1BCCD 5AW4B 2LKMA 2AEFA 1DD3A 3CWBG 3MTUE 2QJYB 2JP3A 1EQ7A 5KLVG 3R4YA 4BXLA 1PP9G 3BCCG 1S9KD 1JTHA 2R32A 1SQPK 1FZCA 1Q90D 3CCSP 1ZRTE 3O6QA 3AEDC 2E74B 2K88A 2V7QH 2LXBA 2BEZF 2AEJA 1NJIQ 4Y28J 1GK6A 3L74G 3H1HG 3H1LE 1OIPA 2Q3IA 4TLFA 3TGUJ 5DJUB 1ZMEC 3Q5SA 2E74D 3H1JJ 5CCHA 1L0LK 3WMM0 2WPVB 4U3FE 3L75E 1NTZE 2KOGA 2XDJA 3U59A 4ZNCA 1JO5A 5APQA 1FZCC 1AVYA 3L71D 1KFNA 1XTGB 1PGPA 2BCCD 3MHVA 5BVZA 1VL2A 5KAIH 2B88A 2KYVA 1JTHB 2O01N 1FZCB 1JY2N 5KLVK 4N78E 2ZJSE 3A7OA 2GUVA 1RHZB 2JJLA 1SQPJ 2QM7A 3E7KA 3RK3C 4GDOA 3TNUA 3CC4P 3FGAD 3OAKA 5B5EE 1JOCA 1GU4A 1YQ3C 5CCHC 1NTKD 1M1JA 3QWOC 1SQQD 2J5UA 2JO1A 2ZVOB 2BASA 1LJ2A 1U7JA 4GKGA 1BGYD 2ZXEB 5AVVB 1R8EA 2G8YA 4GOEA 3CLQA 2I8DA 2IDBA 5APUA 1KB9I 1S1CX 3L70D 2D2CC 1FZGA 1PFIA 3GF3A 1NVOA 5CCHD 3CWBJ 3F89A 2E76C 1KN7A 1M1JC 2WSEH 1DX7A 1BCCE 5AVTB 5KLVJ 2NPSA 1X22A 5KKZC 4IL6X 3TNUB 3U1AA 2YNYA 2YKQA 1KYOD 2K1AA 2D2CB 2QJPC 5EFWB 1PP9J 3D6ZA 3II6A 2H88C 1H0TA 2E76B 1M1JB 3BCCJ 4IL6H 1DEEG 3V4WA 2I1JA 1E79H 1SQVD 1CSBA 2QJPB 1FU1A 3PLNA 2P58A 3PHLA 2C0WA 3V2QA 2D2CD 3H1IE 1FDIA 1G2CA 1NTMD 2M3BA 3L74J 4JF7A 1NH4A 3AE4C 3H1HJ 5KAIE 2H43A 2NPSC 1KYOH 4XFJA 3GHGA 5APVA 4YXDC 2W27A 4PV1C 3I56P 3CXHI 5CHXA 1NAFA 2IX7C 2B87B 2WPQA 1JNMA 1HJBA 1H0TB 2Q9IA 3PTZA 3L71E 5APSA 4PV1B 4B86A 2BCCE 3D70A 2VRSA 4W80A 2W8ZA 2R5BA 2WTYA 2Y9YA 2POHA 1Z56A 3P8CE 4BRYB 5KJ7A 3KXDA 2DW3A 1K73Q 3FWLA 1FC2C 1ZR4A 3GHGC 5CBNA 4PV1D 1N86A 4HJGH 3AEGC 5C39A 2FBWC 2R3SA 1SQQE 3LW5H 3M0DA 1OW6A 2Z5IA 1LWUA 3AEAC 3GHGB 1BE3D 1AA0A 3W67A 4N3YB 1Y8AA 1A02J 4IL6E 2WITA 1BGYE 1ZN5A 3CCQP 5KJ7C 1L0NG 5AVUB 2FYZA 2HR3A 5AW2B 3I5CA 2YO2A 1QL1A 3B4SA 1PGQA 4L75A 4GIFA 3L70E 1KQGB 3HE4A 2JWDA 2FYUD 4JYCA 1NWQA 2KLVA 2QJKB 4LLHA 1LWUC 1VQ7P 2PRRA 5AW7B 1KYOE 4WBAA 4DZOA 3MP7B 4UB6H 3LIDA 2P1JA 1UIIA 3PRJA 5AVZB 2XZRA 2GM4A 1EDLA 3WUTA 2CPBA 2ZXXA 1SQXE 2IBZI 1LWUB 1SQVE 3U1CA 1NGMB 1JY2P 1L2PA 4ZKPA 1QGKB 1NO4A 1IK7A 5GTIH 3AEFC 1MV8A 1NTME 1HF9A 3BVHA 2IBZG 1EXJA 3EFGA 2QG4A 1KQSO 2R44A 2W6BA 1VQNP 5TJHA 3O8ZA 4K3AA 4IFMA 4H13C 1L0NK 1FZEA 1FDOA 1K9MQ 1R5SA 3Q1MA 5BU5A 2W6AA 3H32A 1VQ9P 5KAFH 1SQBE 2MKVA 4GT1A 2KLUA 1LP1A 2JDIH 2ZVNB 1ZV8A 1S2EA 2AEMA 4L73A 3VTPC 2KS1A 3N7NA 3C8VA 3AE9C 1OFCX 5AW5B 1SFCD 2CPSA 2XV5A 2Q5UA 1IFNA 2Y9ZA 3HE5A 1RY3A 2WSSH 3PJSK 3IFMA 3CCMP 1EZVI 5KLIB 4UB6E 4TT3H 1L0NJ 3H1LG 3OJAB 4I2LC 1EZVG 3MD0A 1IFDA 2CK3H 4U3FG 1P84I 4I7ZC 1NTZG 1LP1B 5AVQB 1T3JA 3RK2D 3EQ2A 5GTIE 1HGZA 2WSCH 3M91A 4L76A 1W2EA 3BCCD 3B71A 3IR9A 2FYUE 3ABVC 4I7ZB 2HLOA 3M0AA 1AQ5A 3KDPB 4BWNA 1VQMP 3HE5B 2A45H 1H8AA 3JSVC 2Q1KA 1HJ0A 3EWKA 3GMAA 4PJ0H 1GU5A 1JEKA 2A06D 2ZYAA 1S3JA 2C9NY 3FX0A 1EDKA 2E74C 5KAFE 1NU1D 3L73J 4MN4C 3TGUE 5GTHH 4AYCA 1U7MA 3H1ID 1RQUA 3K5BA 3CX5D 1K04A 2QVAA 4K35A 2QSIA 4D6TD 2M8RA 3SSUA 3T97A 2P10A 1NTZK 3CCVP 4RO0A 1RE4C 1HVVA 2OYHC 4EI2A 3A2AA 1BCCG 1JY3N 3P7KA 4W7ZA 2YIUC 3Q5PA 2HG5D 2ZYDA 2FFDA 3HTKB 1OX3A 1LNQA 3AE2C 2OYHB 3H6PA 3CX5H 2AXTH 1OVVA 1KQLA 2YIUB 3E1IA 2HODA 1AVOA 1YJWP 4DOJA 1OW7A 3P8CD 1KC8Q 1GMJA 1KORA 2Q7CA 4KJMA 1USDA 1FBMA 2XU6A 3T97B 1GTWA 3CC7P 3AEEC 2FFDC 2GUSA 3KPEA 3Q3DA 1NTZJ 1AFOA 4PJ0E 1RH5B 1EDJA 4H0LB 2FFDB 5L8RJ 2O1KA 3LIEA 1LTIC 3ITKA 1PP9E 1L0LJ 4JPZB 3L71G 3F5HA 2FXOA 1IK9A 3GF7A 1EDIA 3BCCE 5GTHE 5AVSB 1FZBA 2BCCG 2ITAA 2N1TB 4NPEA 4DT0A 2FY8A 2OGUA 2HODB 2Z4EA 1MUUA 1JMMA 2RN0A 4H0LD 1GW4A 3QH9A 1QX8A 5AW3B 1LT1A 1SVFA 1JY3O 1KB9H 2B87A 3H1HE 3NFQA 2A06E 2N1TD 3IN6A 3GLMA 1NTKG 1SQQG 3WUUA 3BRTB 1NU1E 1SQXD 1PZQA 2KIKA 3Q2YA 1FE6A 5AW9B 1OWAA 3RGUA 4UB8H 1PPJD 4BRYA 1VPCA 3B5NC 3CX5E 1BGYG 2AXTE 3L36A 1BSNA 3FWNA 1VQPP 3N4XA 4HH2A 2H8PD 4D6TE 5CJ4A 2NZ2A 3HD7D 1YBKA 2JEEA 2O01H 2P7JA 2NRGA 2V7QJ 3S9OA 2JWAA 1KYOI 4H44C 3L70G 4N6JA 1BCCJ 2E42A 3B5NB 2WMMA 1AV1A 2J58A 3GG2A 3RL0B 3BATA 1QLED 2Y0EA 4H44B 1YITP 3B5ND 4W7YA 1DD4A 2WPRA 1SQBD 1FOSE 1PGJA 5CJ0A 1SQVG 2IZ0A 3RL0D 1NTKK 3RBXA 1S5LX 3CMEP 1MFTA 1SQQK 1T8ZA 4H44D 1L0ND 2R3CA 1NTMG 4I6MC 1S5LH 5APWA 1J1EC 1KFMA 4NPFX 1PV3A 4JQ0D 1OMIA 2KSJA 5AW6B 3CPWO 1ZP0C 3VMXA 2KK7A 1ZOYC 1J1EB 1KB9E 3A0BH 1FS0E 3CI9A 1J2JB 3L71J 1HUCA 1OZHA 1SLQA 1DH3A 3B8EB 3L72D 3CCJP 1X0TA 3NXSA 1J1DC 3H1KD 2FKWB 1X9VA 1GZLA 4WB4A 1LTSC 3IF4A 1G1IA 4U7JA 3S4RA 2E43A 2QJKC 4EDFA 1VQOP 3I55P 2WVRA 4UB8E 3VMAA 1XTCC 2WQYC 4OH8B 1J1DB 3UIAA 1KILA 2KXPB 1FOSF 1Q2NA 1ZXGA 1SP4A 1NTKJ 1HH0A 1SQVK 2WSEJ 3V6IA 1SQQJ 3L73D 1KZUB 4KT0J 1FDMA 3G9RA 5H2FH 1NTMK 1A02F 1Q81Q 1SFCA 2Q3EA 3G3ZA 3CL3D 5E79H 1NHLA 4M3LA 4C7NB 3NTNA 2MJZA 3CMAP 1BE3G 1BGYJ 2M5AA 4WY4B 1PPJE 1YI2P 1WT6A 1RQVA 2GA1A 1FJPA 2O1JA 1KILC 1D7MA 1MKMA 1QVFO 3L70J 2OARA 3TGUD 1LTJA 2QEXP 3H1JD 1FZFA 2HYNA 1PL5A 3AE8C 1KILB 4WY4D 1GW3A 2XKMA 4PD4D 1S5LE 1YJNP 2QIWA 1X79B 1SFCC 2FYUG 2QA4P 2K9JA 3JC22 3TDKA 4XE5B 2PP6A 3L37A 1PGOA 2K37A 2I1KA 3CC2P 1KILD 3A0BE 1SFCB 1SQPD 4CPGA 2ZFCA 1LTJC 4EOTA 1K8AQ 1YJ9P 2M5AB 4R4LA 1EZVD 1JM0A 4JBZA 1L0NE 3Q5RA 1YTZI 2QRXA 1E5WA 3TF5A 2WSFJ 3PH0A 3VMYA 4PD4H 2C0XA 3KQGA 1LTJB 5KLIC 2YXRB 3RK2C 1FJKA 3TSIA 1DIPA 3A0HH 1VQ5P 2V4HA 4YTPC 2YO3A 3SFDC 3LW5J 1OVRA 1M56D 2YKOA 1L0LD 3G4SP 3RK2B 2K9JB 5H2FE 3L72E 2KZIA 1IFJA 3H1KE 5E79E 2O3JA 3CWBD 1GDTA 4EIJA 2FYUK 2HFED 3L75G 5KLVD 1M57D 4RESB 1VQLP 1PP9D 1JUNA 5AW8B 5CBOA 2QM8A 3PP5A 1N7SB 2LXCB 4Y99C 1JCDA 3VP8A 1K05A 3G6EP 3P8MC 3L73E 1DEBA 1P84H 1OXZA 4LC1A 1FZAA 1BE3J 5TISE 3WUVA 5APTA 2A45I 4Y99B 1LTTC 1ZW0A 3C1LA 3L74D 2R5DA 1N7SD 5KTBA 3H1HD 3AE5C 3HTKA 3IAOA 1RE4A 5CCGA 1HWTC 3MZWB 2OYHA 2A45G 2YXQB 4GODA 1Q7YQ 3A3YB 2KP8A 5AVXB 1KQFB 1JMBA 3M9HA 3KHUA 4ASVA 4RKUJ 3H1JE 2KB7P 4IOIH 2FYUJ 2JKVA 1N7LA 4PD4E 1IO4A 1WMKA 4RJTA 3A0HE 3CCLP 4YXWH 1NOHA 2Q6QA 5CCGC 4O9BA 2ZT9C 1WRGA 1KILE 1VF5C 3USSA 2RMZA 4LGDE 4OVNF 1SQPE 1QEXA 4KHXA 2A06G 2ZT9B 3VN0A 2M0BA 1L4AA 3CX5I 1EZVE 2IPPA 1NU1G 1VF5B 2KSEA 4EYYQ 2N1TA 2RH0A 3AE3C 2E5YA 1RF0A 4C7RA 1HGVA 3H1IG 1QL2A 2OTLP 2E75C 5CCGD 4XA4A 2ZT9D 3RBZA 3AE1C 4D6TG 3H1LJ 1P84E 1L0LE 1VF5D 2LR2A 2IZ1A 2K3RA 2UWJE 2M3EA 4H0LC 2E75B 3HD7A 2WT7A 3O6QB 3MGNA 4U3FJ 3L75J 3CWBE 1L4AC 1KB9D 3A5TA 1YTZT 2AXCA 2N1TC 3JCUH 5KLVE 3CCUP 5K5GB 5AVRB 1YIJP 1H88A 1KMIZ 1N2DC 1RF0C 3RK3B 3HRNA 1L4AB 2E75D 4DCKA 2WSCJ 4AUWA 1W5CE 1ZR2A 3B5NA 1URQA 1VQ4P 1VQ6P 1M7LA 3HD7C 2FXPA 1NU1K 3RK3D 3AE7C 2G3AA 3M9BA 5DJTB 1L4AD 3L74E 5B66H 1LT9A 1IFIA 4Z1MH 2ZYGA 2L5GB 4C46A 3HD7B 2WT7B 1OVUA 2IFNA 4WVZA 2IFMA 2C9LY 1KD1Q 4YPCA 1M8OB 1U57A 1HBWA 1JCCA 1RE3A 1T3UA 2W90A 3ZDMA 4L74A 1MFZA 1TU3F 2P67A 3OA7A 4OGQC 1URQC 1YQ4C 3CXHD 5KKZB 1S72P 1GK4A 1S9KE 3RL0C 3HUSA 1JY2O 1LT9C 3GW6A 3SWKA 2B9BA 2Y0DA 4OGQB 1URQB 2E76D 4A7PA 4HYTB 1BSHA 3W68A 3L4FA 2N9BA 3CD6P 1LT9B 1QVGO 2W6JH 1NU1J 1S4XA 3MUDA 3AEBC 1RE3C 3KYQA 2FYNC 5CMZA 2P2UA 3TYYA 3FXDA 4OGQD 1URQD 1SQXG 2NPSB 3WU2H 3CXHH 3SWFA 3H1IJ 3NMDA 3JCUE 1BDDA 1Y9BA 2WPSA 2YMKA 3FXEA 3V2NA 3HUSC 1VQ8P 4D6TJ 2QE7H 1PPJG 1CI6A 1MZ9A 2FYNB 4I1LA 3AECC 3RL0g 1HTLC 3CCRP 3V4QA 4WWIA 1JB0J 3HUSB 2NPSD 1LTGC 2WSFH 3MUDC 1G2CB 1FAVA 3M9QA 1KTMA 4NPDA 2E5TA 4C7NA 1CW5A 5B66E 2RKLA 2KI7B 3V2PA 1NTKE 4WY4A 1T6AA 3S1KA 2BCCJ 1GL2A 1T2KC 1X8YA 2K9YA 4ASWA 1SQBG 2W83C 3C9IA 2IBZD 1CI6B 1Y47A 1JY3P 3E1RA 5AVWB 1W2BO 1SQXK 3RK3E 2WWWA 1Q86Q 2ZAEB 2OTKE 3KZIH 2L91A 1IJDB 4WY4C 1IFPA 3R2PA 3TK1A 3M0DC 1GL2C 1T2KD 3OW2O 3V5BA 3VMZA 3D71A 1M1KQ 2OQQA 4JYBA 1N8RQ 2KZJA 2OYIA 3VP9A 2PGDA 3L72G 1M90Q 3H1KG 1GL2B 3WU2E 3CXHE 5KJ7D 1IC2A 1NAYA 5APXA 3BASA 4OWFA 5AVYB 1ZLLA 5AW0B 2O01J 1NYHA 1LTAC 2YKPA 4QMAA 2FXMA 5TISH 4HKZH 4HB1A 4R4MA
chains in the Genus database with same CATH topology
3L75J 1PP9J 1SQPJ 1SQBJ 1KB9I 3L71J 3L70J 3L74J 3BCCJ 3TGUJ 1NTMJ 3CX5I 2IBZI 3H1IJ 3H1HJ 3CWBJ 3CXHI 3H1LJ 3L72J 2BCCJ 2FYUJ 3H1KJ 1BGYJ 1EZVI 1NTKJ 1SQXJ 4U3FJ 3H1JJ 1P84I 1SQQJ 4D6TJ 1SQVJ 5KLVJ 1L0LJ 3L73J 1NU1J 1BE3J 1KYOI 4PD4I 1L0NJ 1BCCJ 1NTZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 J;  1PP9 J;  1SQP J;  1SQB J;  1KB9 I;  3L71 J;  3L70 J;  3L74 J;  3BCC J;  3TGU J;  1NTM J;  3CX5 I;  2IBZ I;  3H1I J;  3H1H J;  3CWB J;  3CXH I;  3H1L J;  3L72 J;  2BCC J;  2FYU J;  3H1K J;  1BGY J;  1EZV I;  1NTK J;  1SQX J;  4U3F J;  3H1J J;  1P84 I;  1SQQ J;  4D6T J;  1SQV J;  5KLV J;  1L0L J;  3L73 J;  1NU1 J;  1BE3 J;  1KYO I;  4PD4 I;  1L0N J;  1BCC J;  1NTZ J; 
#chains in the Genus database with same CATH topology
 1SQB K;  2B89 A;  1GL2 D;  1N73 A;  1IFM A;  1UIX A;  2N9Y B;  3L73 G;  2KNC A;  2YMY A;  2XNX A;  1SQX J;  3G71 P;  1ZRT D;  2OYO A;  1RF1 A;  2IYP A;  1SQV J;  2OYI C;  3HE4 B;  1PIX A;  2XND H;  4AQR D;  1OW8 A;  3MIW A;  1BDC A;  1KV4 A;  3BRV B;  1NTM J;  3H1L D;  1H89 A;  2HPC A;  3H25 A;  2SPZ A;  3SFE C;  2OYI B;  4H13 B;  1VQK P;  1N7S A;  1AQT A;  1LGH B;  3P32 A;  3CCE P;  4PD4 I;  3TGU G;  4U3F D;  3L75 D;  1NTZ D;  4IFF A;  4ZKU A;  1N73 C;  4DJG A;  4ZMD A;  1CZQ A;  1SS1 A;  3H1J G;  5BU8 B;  1VDF A;  3VOP A;  2OTJ P;  1RF1 C;  4H13 D;  1IZN B;  2WZ7 A;  1P84 D;  3SWY A;  1G1J A;  2Z5H A;  3KZI E;  1N73 B;  4N78 D;  2KNC B;  1SQB J;  1RF1 B;  2IYO A;  2H7H A;  2PFX A;  1N7S C;  5AW1 B;  1BE3 E;  3AE6 C;  2BEQ D;  1EXI A;  1R5L A;  2KUB A;  1EC5 A;  1SQP G;  3M06 A;  3V2R A;  1GD2 E;  2HPC B;  2IBZ E;  3H32 B;  1Q82 Q;  4GOF A;  1YHQ P;  1NKZ B;  1NKN A;  5APY A;  3EFF K;  5M1B A;  2Y0C A;  1USE A;  1LTB C;  2PAJ A;  2KS1 B;  2J59 M;  3D6Y A;  2QJY C;  1L0L G;  3VYI A;  3L72 J;  5B5E H;  3H1K J;  1YYC A;  2H89 C;  2JR8 A;  3L35 A;  1AJY A;  4IFD K;  1BCC D;  5AW4 B;  2LKM A;  2AEF A;  1DD3 A;  3CWB G;  3MTU E;  2QJY B;  2JP3 A;  1EQ7 A;  5KLV G;  3R4Y A;  4BXL A;  1PP9 G;  3BCC G;  1S9K D;  1JTH A;  2R32 A;  1SQP K;  1FZC A;  1Q90 D;  3CCS P;  1ZRT E;  3O6Q A;  3AED C;  2E74 B;  2K88 A;  2V7Q H;  2LXB A;  2BEZ F;  2AEJ A;  1NJI Q;  4Y28 J;  1GK6 A;  3L74 G;  3H1H G;  3H1L E;  1OIP A;  2Q3I A;  4TLF A;  3TGU J;  5DJU B;  1ZME C;  3Q5S A;  2E74 D;  3H1J J;  5CCH A;  1L0L K;  3WMM 0;  2WPV B;  4U3F E;  3L75 E;  1NTZ E;  2KOG A;  2XDJ A;  3U59 A;  4ZNC A;  1JO5 A;  5APQ A;  1FZC C;  1AVY A;  3L71 D;  1KFN A;  1XTG B;  1PGP A;  2BCC D;  3MHV A;  5BVZ A;  1VL2 A;  5KAI H;  2B88 A;  2KYV A;  1JTH B;  2O01 N;  1FZC B;  1JY2 N;  5KLV K;  4N78 E;  2ZJS E;  3A7O A;  2GUV A;  1RHZ B;  2JJL A;  1SQP J;  2QM7 A;  3E7K A;  3RK3 C;  4GDO A;  3TNU A;  3CC4 P;  3FGA D;  3OAK A;  5B5E E;  1JOC A;  1GU4 A;  1YQ3 C;  5CCH C;  1NTK D;  1M1J A;  3QWO C;  1SQQ D;  2J5U A;  2JO1 A;  2ZVO B;  2BAS A;  1LJ2 A;  1U7J A;  4GKG A;  1BGY D;  2ZXE B;  5AVV B;  1R8E A;  2G8Y A;  4GOE A;  3CLQ A;  2I8D A;  2IDB A;  5APU A;  1KB9 I;  1S1C X;  3L70 D;  2D2C C;  1FZG A;  1PFI A;  3GF3 A;  1NVO A;  5CCH D;  3CWB J;  3F89 A;  2E76 C;  1KN7 A;  1M1J C;  2WSE H;  1DX7 A;  1BCC E;  5AVT B;  5KLV J;  2NPS A;  1X22 A;  5KKZ C;  4IL6 X;  3TNU B;  3U1A A;  2YNY A;  2YKQ A;  1KYO D;  2K1A A;  2D2C B;  2QJP C;  5EFW B;  1PP9 J;  3D6Z A;  3II6 A;  2H88 C;  1H0T A;  2E76 B;  1M1J B;  3BCC J;  4IL6 H;  1DEE G;  3V4W A;  2I1J A;  1E79 H;  1SQV D;  1CSB A;  2QJP B;  1FU1 A;  3PLN A;  2P58 A;  3PHL A;  2C0W A;  3V2Q A;  2D2C D;  3H1I E;  1FDI A;  1G2C A;  1NTM D;  2M3B A;  3L74 J;  4JF7 A;  1NH4 A;  3AE4 C;  3H1H J;  5KAI E;  2H43 A;  2NPS C;  1KYO H;  4XFJ A;  3GHG A;  5APV A;  4YXD C;  2W27 A;  4PV1 C;  3I56 P;  3CXH I;  5CHX A;  1NAF A;  2IX7 C;  2B87 B;  2WPQ A;  1JNM A;  1HJB A;  1H0T B;  2Q9I A;  3PTZ A;  3L71 E;  5APS A;  4PV1 B;  4B86 A;  2BCC E;  3D70 A;  2VRS A;  4W80 A;  2W8Z A;  2R5B A;  2WTY A;  2Y9Y A;  2POH A;  1Z56 A;  3P8C E;  4BRY B;  5KJ7 A;  3KXD A;  2DW3 A;  1K73 Q;  3FWL A;  1FC2 C;  1ZR4 A;  3GHG C;  5CBN A;  4PV1 D;  1N86 A;  4HJG H;  3AEG C;  5C39 A;  2FBW C;  2R3S A;  1SQQ E;  3LW5 H;  3M0D A;  1OW6 A;  2Z5I A;  1LWU A;  3AEA C;  3GHG B;  1BE3 D;  1AA0 A;  3W67 A;  4N3Y B;  1Y8A A;  1A02 J;  4IL6 E;  2WIT A;  1BGY E;  1ZN5 A;  3CCQ P;  5KJ7 C;  1L0N G;  5AVU B;  2FYZ A;  2HR3 A;  5AW2 B;  3I5C A;  2YO2 A;  1QL1 A;  3B4S A;  1PGQ A;  4L75 A;  4GIF A;  3L70 E;  1KQG B;  3HE4 A;  2JWD A;  2FYU D;  4JYC A;  1NWQ A;  2KLV A;  2QJK B;  4LLH A;  1LWU C;  1VQ7 P;  2PRR A;  5AW7 B;  1KYO E;  4WBA A;  4DZO A;  3MP7 B;  4UB6 H;  3LID A;  2P1J A;  1UII A;  3PRJ A;  5AVZ B;  2XZR A;  2GM4 A;  1EDL A;  3WUT A;  2CPB A;  2ZXX A;  1SQX E;  2IBZ I;  1LWU B;  1SQV E;  3U1C A;  1NGM B;  1JY2 P;  1L2P A;  4ZKP A;  1QGK B;  1NO4 A;  1IK7 A;  5GTI H;  3AEF C;  1MV8 A;  1NTM E;  1HF9 A;  3BVH A;  2IBZ G;  1EXJ A;  3EFG A;  2QG4 A;  1KQS O;  2R44 A;  2W6B A;  1VQN P;  5TJH A;  3O8Z A;  4K3A A;  4IFM A;  4H13 C;  1L0N K;  1FZE A;  1FDO A;  1K9M Q;  1R5S A;  3Q1M A;  5BU5 A;  2W6A A;  3H32 A;  1VQ9 P;  5KAF H;  1SQB E;  2MKV A;  4GT1 A;  2KLU A;  1LP1 A;  2JDI H;  2ZVN B;  1ZV8 A;  1S2E A;  2AEM A;  4L73 A;  3VTP C;  2KS1 A;  3N7N A;  3C8V A;  3AE9 C;  1OFC X;  5AW5 B;  1SFC D;  2CPS A;  2XV5 A;  2Q5U A;  1IFN A;  2Y9Z A;  3HE5 A;  1RY3 A;  2WSS H;  3PJS K;  3IFM A;  3CCM P;  1EZV I;  5KLI B;  4UB6 E;  4TT3 H;  1L0N J;  3H1L G;  3OJA B;  4I2L C;  1EZV G;  3MD0 A;  1IFD A;  2CK3 H;  4U3F G;  1P84 I;  4I7Z C;  1NTZ G;  1LP1 B;  5AVQ B;  1T3J A;  3RK2 D;  3EQ2 A;  5GTI E;  1HGZ A;  2WSC H;  3M91 A;  4L76 A;  1W2E A;  3BCC D;  3B71 A;  3IR9 A;  2FYU E;  3ABV C;  4I7Z B;  2HLO A;  3M0A A;  1AQ5 A;  3KDP B;  4BWN A;  1VQM P;  3HE5 B;  2A45 H;  1H8A A;  3JSV C;  2Q1K A;  1HJ0 A;  3EWK A;  3GMA A;  4PJ0 H;  1GU5 A;  1JEK A;  2A06 D;  2ZYA A;  1S3J A;  2C9N Y;  3FX0 A;  1EDK A;  2E74 C;  5KAF E;  1NU1 D;  3L73 J;  4MN4 C;  3TGU E;  5GTH H;  4AYC A;  1U7M A;  3H1I D;  1RQU A;  3K5B A;  3CX5 D;  1K04 A;  2QVA A;  4K35 A;  2QSI A;  4D6T D;  2M8R A;  3SSU A;  3T97 A;  2P10 A;  1NTZ K;  3CCV P;  4RO0 A;  1RE4 C;  1HVV A;  2OYH C;  4EI2 A;  3A2A A;  1BCC G;  1JY3 N;  3P7K A;  4W7Z A;  2YIU C;  3Q5P A;  2HG5 D;  2ZYD A;  2FFD A;  3HTK B;  1OX3 A;  1LNQ A;  3AE2 C;  2OYH B;  3H6P A;  3CX5 H;  2AXT H;  1OVV A;  1KQL A;  2YIU B;  3E1I A;  2HOD A;  1AVO A;  1YJW P;  4DOJ A;  1OW7 A;  3P8C D;  1KC8 Q;  1GMJ A;  1KOR A;  2Q7C A;  4KJM A;  1USD A;  1FBM A;  2XU6 A;  3T97 B;  1GTW A;  3CC7 P;  3AEE C;  2FFD C;  2GUS A;  3KPE A;  3Q3D A;  1NTZ J;  1AFO A;  4PJ0 E;  1RH5 B;  1EDJ A;  4H0L B;  2FFD B;  5L8R J;  2O1K A;  3LIE A;  1LTI C;  3ITK A;  1PP9 E;  1L0L J;  4JPZ B;  3L71 G;  3F5H A;  2FXO A;  1IK9 A;  3GF7 A;  1EDI A;  3BCC E;  5GTH E;  5AVS B;  1FZB A;  2BCC G;  2ITA A;  2N1T B;  4NPE A;  4DT0 A;  2FY8 A;  2OGU A;  2HOD B;  2Z4E A;  1MUU A;  1JMM A;  2RN0 A;  4H0L D;  1GW4 A;  3QH9 A;  1QX8 A;  5AW3 B;  1LT1 A;  1SVF A;  1JY3 O;  1KB9 H;  2B87 A;  3H1H E;  3NFQ A;  2A06 E;  2N1T D;  3IN6 A;  3GLM A;  1NTK G;  1SQQ G;  3WUU A;  3BRT B;  1NU1 E;  1SQX D;  1PZQ A;  2KIK A;  3Q2Y A;  1FE6 A;  5AW9 B;  1OWA A;  3RGU A;  4UB8 H;  1PPJ D;  4BRY A;  1VPC A;  3B5N C;  3CX5 E;  1BGY G;  2AXT E;  3L36 A;  1BSN A;  3FWN A;  1VQP P;  3N4X A;  4HH2 A;  2H8P D;  4D6T E;  5CJ4 A;  2NZ2 A;  3HD7 D;  1YBK A;  2JEE A;  2O01 H;  2P7J A;  2NRG A;  2V7Q J;  3S9O A;  2JWA A;  1KYO I;  4H44 C;  3L70 G;  4N6J A;  1BCC J;  2E42 A;  3B5N B;  2WMM A;  1AV1 A;  2J58 A;  3GG2 A;  3RL0 B;  3BAT A;  1QLE D;  2Y0E A;  4H44 B;  1YIT P;  3B5N D;  4W7Y A;  1DD4 A;  2WPR A;  1SQB D;  1FOS E;  1PGJ A;  5CJ0 A;  1SQV G;  2IZ0 A;  3RL0 D;  1NTK K;  3RBX A;  1S5L X;  3CME P;  1MFT A;  1SQQ K;  1T8Z A;  4H44 D;  1L0N D;  2R3C A;  1NTM G;  4I6M C;  1S5L H;  5APW A;  1J1E C;  1KFM A;  4NPF X;  1PV3 A;  4JQ0 D;  1OMI A;  2KSJ A;  5AW6 B;  3CPW O;  1ZP0 C;  3VMX A;  2KK7 A;  1ZOY C;  1J1E B;  1KB9 E;  3A0B H;  1FS0 E;  3CI9 A;  1J2J B;  3L71 J;  1HUC A;  1OZH A;  1SLQ A;  1DH3 A;  3B8E B;  3L72 D;  3CCJ P;  1X0T A;  3NXS A;  1J1D C;  3H1K D;  2FKW B;  1X9V A;  1GZL A;  4WB4 A;  1LTS C;  3IF4 A;  1G1I A;  4U7J A;  3S4R A;  2E43 A;  2QJK C;  4EDF A;  1VQO P;  3I55 P;  2WVR A;  4UB8 E;  3VMA A;  1XTC C;  2WQY C;  4OH8 B;  1J1D B;  3UIA A;  1KIL A;  2KXP B;  1FOS F;  1Q2N A;  1ZXG A;  1SP4 A;  1NTK J;  1HH0 A;  1SQV K;  2WSE J;  3V6I A;  1SQQ J;  3L73 D;  1KZU B;  4KT0 J;  1FDM A;  3G9R A;  5H2F H;  1NTM K;  1A02 F;  1Q81 Q;  1SFC A;  2Q3E A;  3G3Z A;  3CL3 D;  5E79 H;  1NHL A;  4M3L A;  4C7N B;  3NTN A;  2MJZ A;  3CMA P;  1BE3 G;  1BGY J;  2M5A A;  4WY4 B;  1PPJ E;  1YI2 P;  1WT6 A;  1RQV A;  2GA1 A;  1FJP A;  2O1J A;  1KIL C;  1D7M A;  1MKM A;  1QVF O;  3L70 J;  2OAR A;  3TGU D;  1LTJ A;  2QEX P;  3H1J D;  1FZF A;  2HYN A;  1PL5 A;  3AE8 C;  1KIL B;  4WY4 D;  1GW3 A;  2XKM A;  4PD4 D;  1S5L E;  1YJN P;  2QIW A;  1X79 B;  1SFC C;  2FYU G;  2QA4 P;  2K9J A;  3JC2 2;  3TDK A;  4XE5 B;  2PP6 A;  3L37 A;  1PGO A;  2K37 A;  2I1K A;  3CC2 P;  1KIL D;  3A0B E;  1SFC B;  1SQP D;  4CPG A;  2ZFC A;  1LTJ C;  4EOT A;  1K8A Q;  1YJ9 P;  2M5A B;  4R4L A;  1EZV D;  1JM0 A;  4JBZ A;  1L0N E;  3Q5R A;  1YTZ I;  2QRX A;  1E5W A;  3TF5 A;  2WSF J;  3PH0 A;  3VMY A;  4PD4 H;  2C0X A;  3KQG A;  1LTJ B;  5KLI C;  2YXR B;  3RK2 C;  1FJK A;  3TSI A;  1DIP A;  3A0H H;  1VQ5 P;  2V4H A;  4YTP C;  2YO3 A;  3SFD C;  3LW5 J;  1OVR A;  1M56 D;  2YKO A;  1L0L D;  3G4S P;  3RK2 B;  2K9J B;  5H2F E;  3L72 E;  2KZI A;  1IFJ A;  3H1K E;  5E79 E;  2O3J A;  3CWB D;  1GDT A;  4EIJ A;  2FYU K;  2HFE D;  3L75 G;  5KLV D;  1M57 D;  4RES B;  1VQL P;  1PP9 D;  1JUN A;  5AW8 B;  5CBO A;  2QM8 A;  3PP5 A;  1N7S B;  2LXC B;  4Y99 C;  1JCD A;  3VP8 A;  1K05 A;  3G6E P;  3P8M C;  3L73 E;  1DEB A;  1P84 H;  1OXZ A;  4LC1 A;  1FZA A;  1BE3 J;  5TIS E;  3WUV A;  5APT A;  2A45 I;  4Y99 B;  1LTT C;  1ZW0 A;  3C1L A;  3L74 D;  2R5D A;  1N7S D;  5KTB A;  3H1H D;  3AE5 C;  3HTK A;  3IAO A;  1RE4 A;  5CCG A;  1HWT C;  3MZW B;  2OYH A;  2A45 G;  2YXQ B;  4GOD A;  1Q7Y Q;  3A3Y B;  2KP8 A;  5AVX B;  1KQF B;  1JMB A;  3M9H A;  3KHU A;  4ASV A;  4RKU J;  3H1J E;  2KB7 P;  4IOI H;  2FYU J;  2JKV A;  1N7L A;  4PD4 E;  1IO4 A;  1WMK A;  4RJT A;  3A0H E;  3CCL P;  4YXW H;  1NOH A;  2Q6Q A;  5CCG C;  4O9B A;  2ZT9 C;  1WRG A;  1KIL E;  1VF5 C;  3USS A;  2RMZ A;  4LGD E;  4OVN F;  1SQP E;  1QEX A;  4KHX A;  2A06 G;  2ZT9 B;  3VN0 A;  2M0B A;  1L4A A;  3CX5 I;  1EZV E;  2IPP A;  1NU1 G;  1VF5 B;  2KSE A;  4EYY Q;  2N1T A;  2RH0 A;  3AE3 C;  2E5Y A;  1RF0 A;  4C7R A;  1HGV A;  3H1I G;  1QL2 A;  2OTL P;  2E75 C;  5CCG D;  4XA4 A;  2ZT9 D;  3RBZ A;  3AE1 C;  4D6T G;  3H1L J;  1P84 E;  1L0L E;  1VF5 D;  2LR2 A;  2IZ1 A;  2K3R A;  2UWJ E;  2M3E A;  4H0L C;  2E75 B;  3HD7 A;  2WT7 A;  3O6Q B;  3MGN A;  4U3F J;  3L75 J;  3CWB E;  1L4A C;  1KB9 D;  3A5T A;  1YTZ T;  2AXC A;  2N1T C;  3JCU H;  5KLV E;  3CCU P;  5K5G B;  5AVR B;  1YIJ P;  1H88 A;  1KMI Z;  1N2D C;  1RF0 C;  3RK3 B;  3HRN A;  1L4A B;  2E75 D;  4DCK A;  2WSC J;  4AUW A;  1W5C E;  1ZR2 A;  3B5N A;  1URQ A;  1VQ4 P;  1VQ6 P;  1M7L A;  3HD7 C;  2FXP A;  1NU1 K;  3RK3 D;  3AE7 C;  2G3A A;  3M9B A;  5DJT B;  1L4A D;  3L74 E;  5B66 H;  1LT9 A;  1IFI A;  4Z1M H;  2ZYG A;  2L5G B;  4C46 A;  3HD7 B;  2WT7 B;  1OVU A;  2IFN A;  4WVZ A;  2IFM A;  2C9L Y;  1KD1 Q;  4YPC A;  1M8O B;  1U57 A;  1HBW A;  1JCC A;  1RE3 A;  1T3U A;  2W90 A;  3ZDM A;  4L74 A;  1MFZ A;  1TU3 F;  2P67 A;  3OA7 A;  4OGQ C;  1URQ C;  1YQ4 C;  3CXH D;  5KKZ B;  1S72 P;  1GK4 A;  1S9K E;  3RL0 C;  3HUS A;  1JY2 O;  1LT9 C;  3GW6 A;  3SWK A;  2B9B A;  2Y0D A;  4OGQ B;  1URQ B;  2E76 D;  4A7P A;  4HYT B;  1BSH A;  3W68 A;  3L4F A;  2N9B A;  3CD6 P;  1LT9 B;  1QVG O;  2W6J H;  1NU1 J;  1S4X A;  3MUD A;  3AEB C;  1RE3 C;  3KYQ A;  2FYN C;  5CMZ A;  2P2U A;  3TYY A;  3FXD A;  4OGQ D;  1URQ D;  1SQX G;  2NPS B;  3WU2 H;  3CXH H;  3SWF A;  3H1I J;  3NMD A;  3JCU E;  1BDD A;  1Y9B A;  2WPS A;  2YMK A;  3FXE A;  3V2N A;  3HUS C;  1VQ8 P;  4D6T J;  2QE7 H;  1PPJ G;  1CI6 A;  1MZ9 A;  2FYN B;  4I1L A;  3AEC C;  3RL0 g;  1HTL C;  3CCR P;  3V4Q A;  4WWI A;  1JB0 J;  3HUS B;  2NPS D;  1LTG C;  2WSF H;  3MUD C;  1G2C B;  1FAV A;  3M9Q A;  1KTM A;  4NPD A;  2E5T A;  4C7N A;  1CW5 A;  5B66 E;  2RKL A;  2KI7 B;  3V2P A;  1NTK E;  4WY4 A;  1T6A A;  3S1K A;  2BCC J;  1GL2 A;  1T2K C;  1X8Y A;  2K9Y A;  4ASW A;  1SQB G;  2W83 C;  3C9I A;  2IBZ D;  1CI6 B;  1Y47 A;  1JY3 P;  3E1R A;  5AVW B;  1W2B O;  1SQX K;  3RK3 E;  2WWW A;  1Q86 Q;  2ZAE B;  2OTK E;  3KZI H;  2L91 A;  1IJD B;  4WY4 C;  1IFP A;  3R2P A;  3TK1 A;  3M0D C;  1GL2 C;  1T2K D;  3OW2 O;  3V5B A;  3VMZ A;  3D71 A;  1M1K Q;  2OQQ A;  4JYB A;  1N8R Q;  2KZJ A;  2OYI A;  3VP9 A;  2PGD A;  3L72 G;  1M90 Q;  3H1K G;  1GL2 B;  3WU2 E;  3CXH E;  5KJ7 D;  1IC2 A;  1NAY A;  5APX A;  3BAS A;  4OWF A;  5AVY B;  1ZLL A;  5AW0 B;  2O01 J;  1NYH A;  1LTA C;  2YKP A;  4QMA A;  2FXM A;  5TIS H;  4HKZ H;  4HB1 A;  4R4M A; 
#chains in the Genus database with same CATH homology
 3L75 J;  1PP9 J;  1SQP J;  1SQB J;  1KB9 I;  3L71 J;  3L70 J;  3L74 J;  3BCC J;  3TGU J;  1NTM J;  3CX5 I;  2IBZ I;  3H1I J;  3H1H J;  3CWB J;  3CXH I;  3H1L J;  3L72 J;  2BCC J;  2FYU J;  3H1K J;  1BGY J;  1EZV I;  1NTK J;  1SQX J;  4U3F J;  3H1J J;  1P84 I;  1SQQ J;  4D6T J;  1SQV J;  5KLV J;  1L0L J;  3L73 J;  1NU1 J;  1BE3 J;  1KYO I;  4PD4 I;  1L0N J;  1BCC J;  1NTZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...