3H1IJ

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1iJ00
4D6TJ 2FYUJ 1BE3J 1L0NJ 4U3FJ 3BCCJ 3L72J 1EZVI 1L0LJ 1SQPJ 2IBZI 1NTKJ 1NTMJ 1SQQJ 3L75J 3CXHI 1BGYJ 3H1IJ 4PD4I 5KLVJ 2BCCJ 3H1JJ 3CWBJ 3H1KJ 3TGUJ 1PP9J 1SQXJ 1NTZJ 3L70J 1BCCJ 1P84I 1KB9I 1SQVJ 3H1HJ 1SQBJ 3L74J 3L71J 3L73J 3CX5I 1NU1J 3H1LJ 1KYOI
chains in the Genus database with same CATH superfamily
4D6TJ 2GUVA 3IFMA 1L0NJ 4LLHA 4U3FJ 1H0TB 2W6JH 2A45G 1BE3D 1GU4A 2BCCE 1S1CX 1FDMA 1QL1A 1S72P 2XNXA 3AE8C 1KV4A 1KB9H 1D7MA 3SWYA 1YBKA 1PPJE 1SVFA 3LIEA 1LP1A 2QJKB 4H44B 2QJPB 1OVVA 5E79H 3I55P 3D70A 5B66H 2YXRB 2YXQB 1EC5A 5AW4B 4O9BA 1T2KC 3H1LG 4XA4A 3SSUA 2Q3EA 1U57A 3JC22 3RL0C 4Y99C 2QJKC 5KJ7C 2OYIB 4C7RA 3HUSB 1CZQA 2P10A 1LTAC 1FU1A 1JCCA 1SQVJ 5TISH 2E74B 1L4AB 1EDJA 2KP8A 1JUNA 2R3SA 2WTYA 1IFMA 1JY2O 3MTUE 4PJ0H 1NTKD 2AEJA 1Q82Q 4R4MA 2JEEA 2K1AA 5AW7B 1BE3G 2E5YA 3BASA 3RBZA 4BRYB 3TGUD 3B5NA 1OMIA 4KT0J 1GL2B 2AEFA 4JYCA 3L74E 3AE4C 3AEBC 3S9OA 2IFNA 2E76B 1K04A 3P8CD 1MKMA 1N7LA 3AE6C 1ZN5A 3CCVP 3QH9A 1BDCA 1OVRA 3RBXA 2WWWA 4C7NB 1OXZA 1KILB 4ASWA 3H6PA 1KYOD 4U3FE 2OARA 2KS1A 3NMDA 3FXEA 2FXOA 2P58A 3O6QA 3RK3B 1VQLP 1BCCE 2R44A 1SQPE 2H89C 3WU2E 3OAKA 2QM8A 4OGQC 2N1TD 3GG2A 1HGVA 1S4XA 3T97A 1VQ5P 1M56D 2NPSD 3KZIH 3F89A 1SQVG 3L35A 2HFED 2K9YA 1NWQA 1RF1A 1KB9E 2K37A 2OYOA 1R5LA 1SQQE 3HTKA 1J1DB 2HR3A 4JYBA 1IK7A 3L72G 1BE3J 1U7MA 2E74D 4UB8H 4YXDC 3CCMP 1SQVE 3H1JE 3A3YB 3CWBE 1L0LJ 4IFFA 5APQA 1DH3A 5CCGD 1P84H 1KB9D 2E75C 1ZOYC 1OW7A 1M1JA 1RE4C 2MKVA 3L75D 1ZV8A 2FBWC 3Q5PA 1G2CA 2FYZA 2OGUA 3TYYA 3VP9A 1PFIA 3H1JG 2ZT9C 2O3JA 2KIKA 2WSCJ 1JTHA 3B4SA 1M57D 4H13D 4MN4C 1SLQA 2W6AA 4RESB 3RL0g 3TGUG 1NYHA 1N7SD 1L0NG 2M0BA 4H44C 5CCHC 3BCCD 1IFJA 2Z4EA 1OVUA 1CW5A 1KN7A 2M5AB 2W83C 5BU8B 3CCEP 3HE5B 2B9BA 2WITA 2ZFCA 1BGYE 3RK3D 1LGHB 2BCCD 1G1IA 2QRXA 2IZ1A 1KYOI 4PD4H 1DEEG 2IPPA 3CXHD 3CMEP 2WSSH 3D6ZA 1VQ8P 1LT1A 1QX8A 2G3AA 3L72J 1NGMB 2WT7B 2RH0A 2Z5IA 1SQBE 1L0NK 2ZYAA 3L71E 3LIDA 1MV8A 3AEEC 4WY4C 2BEQD 5GTIH 1P84E 4L76A 2GM4A 2W6BA 1ZP0C 3PJSK 1YITP 2ZXEB 2Y0CA 1LTJC 3H1KD 3HUSA 4A7PA 1RH5B 5KLVJ 3A7OA 2O01H 2RN0A 3H1JJ 2CK3H 3LW5J 1J2JB 3A0BE 4GOFA 1W2BO 1AVOA 3HRNA 1NTKK 2KYVA 3TGUJ 3BATA 3H32B 2V4HA 5AW2B 1J1EC 2WVRA 3CLQA 2N9BA 3OA7A 1IO4A 4JQ0D 2AXCA 1JY2N 2FXPA 3A2AA 4NPDA 1HGZA 1L0LK 1X22A 1BCCD 1LT9A 3B5NB 3L73G 3L75G 1S9KD 1T6AA 4WY4D 1VQ6P 4M3LA 3BRTB 5M1BA 1USDA 2XNDH 1LTSC 4I7ZB 5H2FE 3PLNA 3RGUA 3HTKB 1Q2NA 5AVSB 3Q3DA 1EZVI 3CXHE 4L73A 5DJUB 5AVTB 1PPJG 3WMM0 1K73Q 2OTLP 2QJYB 3B5NC 1NTZE 4JF7A 5GTHE 1DD3A 1T3JA 4TLFA 5AW3B 4C46A 4WWIA 2YKPA 5APTA 1PGPA 1RE3C 1KC8Q 1OW8A 2Z5HA 5KLVG 1JMMA 3AE3C 2WPQA 2YKOA 2N1TA 5BU5A 1NTZG 2H43A 4D6TE 1NTKE 1FOSF 3KYQA 1SFCC 2OYIA 2YO2A 1KFNA 1Y9BA 1PZQA 3IAOA 1P84I 3V5BA 1N73C 4IL6X 1PGJA 2NRGA 1EDIA 3EFGA 3MZWB 5GTIE 1EXJA 3L73J 2FFDB 3PH0A 4KHXA 2POHA 3P8CE 1SQBD 5CHXA 3WUTA 3GHGB 3L75E 3RK3E 1RF0A 1IZNB 1YQ3C 3L70E 5KLVK 3M0AA 3EFFK 4R4LA 5L8RJ 4NPFX 1UIIA 1JY3P 4HYTB 4H0LC 1Y47A 2C0XA 2A45I 2P2UA 4OGQB 1H8AA 5AW0B 3C1LA 2JKVA 2YMKA 3L73D 3II6A 3CCQP 1Z56A 3L70D 2R5BA 1KQGB 1YJNP 3L4FA 3L71D 1ZR4A 5C39A 3U1CA 2XDJA 1LNQA 2KNCA 4DCKA 3AEAC 2RKLA 1AVYA 1SQXD 4I6MC 3G4SP 3D6YA 1MUUA 4EI2A 2PAJA 3AEFC 1KFMA 1DD4A 1NTZJ 2FYUE 3KDPB 3MUDC 3P7KA 3CMAP 1QL2A 1NTME 1PV3A 1URQC 4N78D 4YXWH 2K9JA 1LTGC 2OTKE 1SQXK 3L74J 4IL6H 3L71J 2ZVOB 5APXA 4DOJA 3ZDMA 1AJYA 1G1JA 1JOCA 1NU1J 1M90Q 1JY2P 1W5CE 2FYUD 2Y0DA 1NTMD 1Y8AA 1YTZI 2A06G 3A5TA 1K8AQ 3BCCJ 2H8PD 2YO3A 1VF5C 3F5HA 5AVXB 3FWNA 2IBZG 1YHQP 1EQ7A 1SFCB 2FYUK 3RL0D 1IFPA 1PL5A 3TGUE 4PD4E 1FZCA 3CCLP 2OYHA 2JDIH 1NTZK 2LXBA 3V6IA 2JWDA 3IN6A 1KILE 3L75J 1FZFA 3AECC 3V2PA 4HKZH 2IBZE 2JP3A 1L0ND 1IC2A 3VMXA 3P8MC 2BASA 3I5CA 3KZIE 1S9KE 3H1LE 4AQRD 1FC2C 4RKUJ 1JEKA 4Y28J 1VF5D 1FS0E 1KD1Q 1GD2E 2J5UA 5B66E 1NTKG 3CX5E 1KILA 1KB9I 1EZVD 2V7QH 3M91A 1RQVA 3B8EB 4W7YA 1GL2C 1SQQG 1L0LE 3SFEC 4BRYA 2Y0EA 4D6TD 4Y99B 2JWAA 3L71G 4H0LB 3CCSP 2O1JA 3Q5RA 1RHZB 3AEGC 2Y9YA 1URQD 2FYUJ 2E76D 1PP9G 2E74C 2WZ7A 3GMAA 3JSVC 4KJMA 3IR9A 1LTJB 3BCCG 5AW9B 1ZMEC 2KSEA 1J1EB 4PJ0E 1LWUC 1RQUA 5DJTB 3C9IA 1LTBC 3AE9C 5AVWB 1NU1K 4WB4A 1VQPP 1GTWA 1IFNA 1OX3A 2LR2A 3CC4P 1QGKB 3CPWO 3CX5H 1L2PA 2KB7P 1BGYJ 3NFQA 2Q9IA 3E7KA 4TT3H 3RK2C 3L73E 1JY3O 2OQQA 4N78E 2L91A 2ZVNB 3BVHA 5AVRB 2HLOA 2M3EA 4H0LD 5APWA 1SQBK 2FFDA 2IBZD 2ITAA 3L70J 1G2CB 1T3UA 2MJZA 3WUUA 5CBOA 5CJ0A 3H25A 4I7ZC 2Q3IA 2JJLA 4LGDE 3SFDC 3H1IE 1VF5B 3RK3C 3TNUA 5APYA 2OTJP 1IK9A 2WSCH 3M9HA 1HTLC 1X0TA 3GF7A 2NPSB 2C0WA 4JPZB 1HF9A 1UIXA 2QJPC 4H13C 5KLVE 2FYUG 3H1ID 2LKMA 3H1HE 3HD7B 1DIPA 4GDOA 1URQB 5AW5B 3SWKA 2PGDA 3N4XA 4YPCA 1OW6A 2KNCB 1GW4A 1JTHB 1SQPD 2D2CD 3IF4A 3L74G 5EFWB 3R4YA 4IFDK 2O01J 1FDIA 5CCGC 3Q1MA 2FFDC 1QEXA 3H1HD 3VOPA 4ZNCA 1NU1G 3CX5D 3TDKA 1BGYG 2K88A 2FYNB 5KJ7D 3HE5A 1VL2A 2HG5D 1E79H 4PV1B 3HE4A 5KAIH 2E5TA 1VQ4P 1NAFA 1SQVK 2WSEH 4EOTA 1L0NE 1NTMK 1AFOA 3L70G 1PGOA 5H2FH 3MIWA 4IFMA 5AVUB 3H1JD 1MFTA 1EZVG 2WT7A 2HODA 3PHLA 2I8DA 4OGQD 4PD4D 2ZT9B 3PP5A 1QVGO 3RL0B 3JCUE 3Q2YA 2C9LY 2N1TC 5E79E 1GDTA 2O01N 2I1JA 1PP9D 2A45H 1N73B 5KAFH 1NTKJ 3H1LD 3Q5SA 3A0BH 3TSIA 1DX7A 4OH8B 5KAIE 2KZJA 1SQQJ 2H88C 2YIUB 1GU5A 3CXHI 3W67A 4HJGH 3PRJA 2FKWB 2L5GB 3ABVC 1USEA 5AW6B 1H89A 3L72D 1LJ2A 1FE6A 3I56P 2XU6A 4GT1A 2JR8A 3H1KJ 3KPEA 2HPCB 1YI2P 1PP9J 3AE7C 1SQXJ 5AVYB 3L36A 3U1AA 3M0DC 3GW6A 1FJPA 1L4AA 3V4QA 2E75B 2ZAEB 1JMBA 2KS1B 3GLMA 3KQGA 2V7QJ 1VQ7P 5AW1B 4ZKPA 3A0HE 1VQOP 3CXHH 3OW2O 1YYCA 5KAFE 4RJTA 1YTZT 4WBAA 5GTHH 2QIWA 3M9BA 2R5DA 5KKZC 3M0DA 1H88A 1HJBA 4XFJA 3BRVB 3NXSA 3E1IA 1FDOA 2G8YA 3HUSC 1KQLA 1SQPJ 1X8YA 4EYYQ 1GZLA 1LTTC 3R2PA 3VN0A 2GA1A 3GHGA 3CC2P 4PV1C 1URQA 3PTZA 3V2RA 3L37A 4WY4A 5KKZB 1TU3F 1FZAA 4LC1A 1EZVE 2NPSC 1M8OB 3H1IJ 3VYIA 3O6QB 1NKZB 4H44D 4BXLA 5CCHD 3CC7P 2QJYC 2N9YB 1FAVA 1YJWP 1Q90D 3A0HH 2J59M 1HVVA 3H1KG 1RE3A 3MD0A 3VTPC 1SQXG 1VQKP 4GKGA 1NAYA 1BDDA 3WUVA 4U3FD 1H0TA 3H1HJ 3TK1A 4HH2A 2D2CC 1WT6A 1N8RQ 3LW5H 2IFMA 3QWOC 1FJKA 2QA4P 4B86A 1WMKA 3U59A 1ZW0A 1KZUB 1LP1B 1NTZD 1PP9E 2WPSA 3B71A 5CCHA 2KI7B 3M06A 2YIUC 5K5GB 1NJIQ 1NVOA 4YTPC 1S5LH 1NKNA 2Y9ZA 2JO1A 1PIXA 4CPGA 2IBZI 1M7LA 1VPCA 1AA0A 2BEZF 1SQQD 2FY8A 1N2DC 2M8RA 1N73A 3FX0A 1FBMA 1KQFB 4RO0A 3MHVA 1EXIA 4AUWA 5AVQB 4PD4I 1KYOH 2W27A 4I1LA 3H1IG 1J1DC 2K9JB 1Q81Q 5BVZA 5KTBA 2VRSA 2KUBA 4N3YB 1U7JA 3EWKA 1ZXGA 3VP8A 3G6EP 1RF1C 1MZ9A 1KTMA 3L72E 2HPCA 1FZEA 1OIPA 3FXDA 1GMJA 1ZLLA 1NTMG 1SQBJ 2R3CA 3H1HG 2IZ0A 2O1KA 2WPRA 4U7JA 1FOSE 3CX5I 2YMYA 1YQ4C 3H32A 3VMYA 4N6JA 1L0LD 4C7NA 1BSNA 2NZ2A 2WPVB 5CMZA 5TISE 3GF3A 4L74A 2ZJSE 2E43A 2KOGA 4I2LC 1S5LX 4QMAA 1RF1B 2CPSA 1ZR2A 1IFDA 3VMZA 1CSBA 1P84D 2J58A 1SQXE 2P67A 1LT9C 4GOEA 3USSA 5AVVB 2Q6QA 1GL2D 2PFXA 2ZYDA 4H13B 2E42A 4UB6E 1S2EA 2BCCG 1CI6B 5APVA 2W90A 1L4AC 1GK6A 1AV1A 1LWUA 1RY3A 1L4AD 1JNMA 3AE5C 1DEBA 3HE4B 2IDBA 1LT9B 3V2NA 1HBWA 4PV1D 1SQPG 2SPZA 1RE4A 3RK2B 3KHUA 2B87B 1A02F 3NTNA 1JY3N 3WU2H 5CCGA 2OYIC 3CI9A 1NH4A 5KLIB 2XV5A 1BCCJ 3M9QA 2XZRA 4XE5B 1GK4A 5KJ7A 1GL2A 2WSEJ 5AVZB 2ZXXA 2Q7CA 2WSFJ 1XTGB 2D2CB 4OVNF 4ASVA 1KILC 2M3BA 4K3AA 3RK2D 1YJ9P 4IOIH 3E1RA 4EIJA 5KLVD 1NU1E 1M1KQ 2NPSA 2OYHB 1CI6A 4UB8E 2W8ZA 1N7SB 4K35A 1R8EA 2M5AA 1OWAA 2KSJA 1OZHA 1S5LE 1BE3E 1MFZA 2WMMA 2YNYA 3BCCE 3GHGC 5AW8B 3V4WA 3VMAA 4D6TG 1SQQK 4U3FG 2BCCJ 2A06D 2N1TB 3CWBJ 2I1KA 3N7NA 5B5EH 4ZKUA 1SP4A 3G71P 1FZCC 2AXTE 4GODA 2RMZA 3S4RA 3G3ZA 2PP6A 2KZIA 1T8ZA 2B87A 2WSFH 2CPBA 4W80A 1KYOE 1HWTC 1M1JC 1EDLA 5TJHA 4AYCA 1FZCB 1WRGA 3H1LJ 3D71A 2FXMA 4Z1MH 3FWLA 3B5ND 2H7HA 4DZOA 2IX7C 1BCCG 3FGAD 2FYNC 2HYNA 1AQTA 1SQPK 1KMIZ 1S3JA 4UB6H 1X79B 1T2KD 3MUDA 1ZRTD 1LTJA 4JBZA 3S1KA 3SWFA 1A02J 3H1KE 1GW3A 5APUA 1BSHA 1M1JB 1K05A 2ZT9D 2QSIA 3CL3D 1K9MQ 3HD7D 2DW3A 2AXTH 1NTMJ 1SQBG 4EDFA 3MP7B 3P32A 2IYPA 1FZBA 3HD7C 1SQVD 3CCRP 2AEMA 1NOHA 1SFCD 1X9VA 2E75D 4IL6E 1VQ9P 1AQ5A 1E5WA 3OJAB 1VQMP 3CWBG 1OFCX 2WQYC 1PGQA 2QVAA 3UIAA 1W2EA 2HODB 2QEXP 2C9NY 1LWUB 1YIJP 1RF0C 1XTCC 4L75A 1HUCA 1Q7YQ 3CCUP 1JCDA 2KLUA 1KQSO 1FZGA 2B88A 2KXPB 3L74D 4DT0A 2UWJE 3AE1C 2LXCB 1KORA 5CJ4A 1JM0A 1JB0J 3AE2C 2KK7A 3KXDA 4NPEA 2OYHC 1PPJD 1NU1D 2IYOA 2KLVA 1BGYD 3EQ2A 2P1JA 3CCJP 1SFCA 5APSA 4DJGA 3HD7A 3MGNA 5CBNA 3JCUH 3G9RA 4WVZA 3AEDC 2Q1KA 2PRRA 4HB1A 5KLIC 4OWFA 3W68A 1VQNP 3CWBD 1N7SA 4W7ZA 3K5BA 2XKMA 3TNUB 3ITKA 1JO5A 4ZMDA 1EDKA 3C8VA 3T97B 1L0LG 1N7SC 4GIFA 1KILD 2K3RA 2QE7H 2QM7A 2E76C 4WY4B 3TF5A 1QVFO 2A06E 2QG4A 2B89A 2Q5UA 3V2QA 5B5EE 1Q86Q 3CD6P 1VDFA 1NHLA 2P7JA 1NO4A 1HH0A 1IJDB 1HJ0A 1SS1A 2YKQA 2ZYGA 3O8ZA 1IFIA 4BWNA 1QLED 2R32A 2GUSA 1R5SA 1ZRTE 1N86A 1LTIC
chains in the Genus database with same CATH topology
4D6TJ 2FYUJ 1BE3J 1L0NJ 4U3FJ 3BCCJ 3L72J 1EZVI 1L0LJ 1SQPJ 2IBZI 1NTKJ 1NTMJ 1SQQJ 3L75J 3CXHI 1BGYJ 3H1IJ 4PD4I 5KLVJ 2BCCJ 3H1JJ 3CWBJ 3H1KJ 3TGUJ 1PP9J 1SQXJ 1NTZJ 3L70J 1BCCJ 1P84I 1KB9I 1SQVJ 3H1HJ 1SQBJ 3L74J 3L71J 3L73J 3CX5I 1NU1J 3H1LJ 1KYOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T J;  2FYU J;  1BE3 J;  1L0N J;  4U3F J;  3BCC J;  3L72 J;  1EZV I;  1L0L J;  1SQP J;  2IBZ I;  1NTK J;  1NTM J;  1SQQ J;  3L75 J;  3CXH I;  1BGY J;  3H1I J;  4PD4 I;  5KLV J;  2BCC J;  3H1J J;  3CWB J;  3H1K J;  3TGU J;  1PP9 J;  1SQX J;  1NTZ J;  3L70 J;  1BCC J;  1P84 I;  1KB9 I;  1SQV J;  3H1H J;  1SQB J;  3L74 J;  3L71 J;  3L73 J;  3CX5 I;  1NU1 J;  3H1L J;  1KYO I; 
#chains in the Genus database with same CATH topology
 4D6T J;  2GUV A;  3IFM A;  1L0N J;  4LLH A;  4U3F J;  1H0T B;  2W6J H;  2A45 G;  1BE3 D;  1GU4 A;  2BCC E;  1S1C X;  1FDM A;  1QL1 A;  1S72 P;  2XNX A;  3AE8 C;  1KV4 A;  1KB9 H;  1D7M A;  3SWY A;  1YBK A;  1PPJ E;  1SVF A;  3LIE A;  1LP1 A;  2QJK B;  4H44 B;  2QJP B;  1OVV A;  5E79 H;  3I55 P;  3D70 A;  5B66 H;  2YXR B;  2YXQ B;  1EC5 A;  5AW4 B;  4O9B A;  1T2K C;  3H1L G;  4XA4 A;  3SSU A;  2Q3E A;  1U57 A;  3JC2 2;  3RL0 C;  4Y99 C;  2QJK C;  5KJ7 C;  2OYI B;  4C7R A;  3HUS B;  1CZQ A;  2P10 A;  1LTA C;  1FU1 A;  1JCC A;  1SQV J;  5TIS H;  2E74 B;  1L4A B;  1EDJ A;  2KP8 A;  1JUN A;  2R3S A;  2WTY A;  1IFM A;  1JY2 O;  3MTU E;  4PJ0 H;  1NTK D;  2AEJ A;  1Q82 Q;  4R4M A;  2JEE A;  2K1A A;  5AW7 B;  1BE3 G;  2E5Y A;  3BAS A;  3RBZ A;  4BRY B;  3TGU D;  3B5N A;  1OMI A;  4KT0 J;  1GL2 B;  2AEF A;  4JYC A;  3L74 E;  3AE4 C;  3AEB C;  3S9O A;  2IFN A;  2E76 B;  1K04 A;  3P8C D;  1MKM A;  1N7L A;  3AE6 C;  1ZN5 A;  3CCV P;  3QH9 A;  1BDC A;  1OVR A;  3RBX A;  2WWW A;  4C7N B;  1OXZ A;  1KIL B;  4ASW A;  3H6P A;  1KYO D;  4U3F E;  2OAR A;  2KS1 A;  3NMD A;  3FXE A;  2FXO A;  2P58 A;  3O6Q A;  3RK3 B;  1VQL P;  1BCC E;  2R44 A;  1SQP E;  2H89 C;  3WU2 E;  3OAK A;  2QM8 A;  4OGQ C;  2N1T D;  3GG2 A;  1HGV A;  1S4X A;  3T97 A;  1VQ5 P;  1M56 D;  2NPS D;  3KZI H;  3F89 A;  1SQV G;  3L35 A;  2HFE D;  2K9Y A;  1NWQ A;  1RF1 A;  1KB9 E;  2K37 A;  2OYO A;  1R5L A;  1SQQ E;  3HTK A;  1J1D B;  2HR3 A;  4JYB A;  1IK7 A;  3L72 G;  1BE3 J;  1U7M A;  2E74 D;  4UB8 H;  4YXD C;  3CCM P;  1SQV E;  3H1J E;  3A3Y B;  3CWB E;  1L0L J;  4IFF A;  5APQ A;  1DH3 A;  5CCG D;  1P84 H;  1KB9 D;  2E75 C;  1ZOY C;  1OW7 A;  1M1J A;  1RE4 C;  2MKV A;  3L75 D;  1ZV8 A;  2FBW C;  3Q5P A;  1G2C A;  2FYZ A;  2OGU A;  3TYY A;  3VP9 A;  1PFI A;  3H1J G;  2ZT9 C;  2O3J A;  2KIK A;  2WSC J;  1JTH A;  3B4S A;  1M57 D;  4H13 D;  4MN4 C;  1SLQ A;  2W6A A;  4RES B;  3RL0 g;  3TGU G;  1NYH A;  1N7S D;  1L0N G;  2M0B A;  4H44 C;  5CCH C;  3BCC D;  1IFJ A;  2Z4E A;  1OVU A;  1CW5 A;  1KN7 A;  2M5A B;  2W83 C;  5BU8 B;  3CCE P;  3HE5 B;  2B9B A;  2WIT A;  2ZFC A;  1BGY E;  3RK3 D;  1LGH B;  2BCC D;  1G1I A;  2QRX A;  2IZ1 A;  1KYO I;  4PD4 H;  1DEE G;  2IPP A;  3CXH D;  3CME P;  2WSS H;  3D6Z A;  1VQ8 P;  1LT1 A;  1QX8 A;  2G3A A;  3L72 J;  1NGM B;  2WT7 B;  2RH0 A;  2Z5I A;  1SQB E;  1L0N K;  2ZYA A;  3L71 E;  3LID A;  1MV8 A;  3AEE C;  4WY4 C;  2BEQ D;  5GTI H;  1P84 E;  4L76 A;  2GM4 A;  2W6B A;  1ZP0 C;  3PJS K;  1YIT P;  2ZXE B;  2Y0C A;  1LTJ C;  3H1K D;  3HUS A;  4A7P A;  1RH5 B;  5KLV J;  3A7O A;  2O01 H;  2RN0 A;  3H1J J;  2CK3 H;  3LW5 J;  1J2J B;  3A0B E;  4GOF A;  1W2B O;  1AVO A;  3HRN A;  1NTK K;  2KYV A;  3TGU J;  3BAT A;  3H32 B;  2V4H A;  5AW2 B;  1J1E C;  2WVR A;  3CLQ A;  2N9B A;  3OA7 A;  1IO4 A;  4JQ0 D;  2AXC A;  1JY2 N;  2FXP A;  3A2A A;  4NPD A;  1HGZ A;  1L0L K;  1X22 A;  1BCC D;  1LT9 A;  3B5N B;  3L73 G;  3L75 G;  1S9K D;  1T6A A;  4WY4 D;  1VQ6 P;  4M3L A;  3BRT B;  5M1B A;  1USD A;  2XND H;  1LTS C;  4I7Z B;  5H2F E;  3PLN A;  3RGU A;  3HTK B;  1Q2N A;  5AVS B;  3Q3D A;  1EZV I;  3CXH E;  4L73 A;  5DJU B;  5AVT B;  1PPJ G;  3WMM 0;  1K73 Q;  2OTL P;  2QJY B;  3B5N C;  1NTZ E;  4JF7 A;  5GTH E;  1DD3 A;  1T3J A;  4TLF A;  5AW3 B;  4C46 A;  4WWI A;  2YKP A;  5APT A;  1PGP A;  1RE3 C;  1KC8 Q;  1OW8 A;  2Z5H A;  5KLV G;  1JMM A;  3AE3 C;  2WPQ A;  2YKO A;  2N1T A;  5BU5 A;  1NTZ G;  2H43 A;  4D6T E;  1NTK E;  1FOS F;  3KYQ A;  1SFC C;  2OYI A;  2YO2 A;  1KFN A;  1Y9B A;  1PZQ A;  3IAO A;  1P84 I;  3V5B A;  1N73 C;  4IL6 X;  1PGJ A;  2NRG A;  1EDI A;  3EFG A;  3MZW B;  5GTI E;  1EXJ A;  3L73 J;  2FFD B;  3PH0 A;  4KHX A;  2POH A;  3P8C E;  1SQB D;  5CHX A;  3WUT A;  3GHG B;  3L75 E;  3RK3 E;  1RF0 A;  1IZN B;  1YQ3 C;  3L70 E;  5KLV K;  3M0A A;  3EFF K;  4R4L A;  5L8R J;  4NPF X;  1UII A;  1JY3 P;  4HYT B;  4H0L C;  1Y47 A;  2C0X A;  2A45 I;  2P2U A;  4OGQ B;  1H8A A;  5AW0 B;  3C1L A;  2JKV A;  2YMK A;  3L73 D;  3II6 A;  3CCQ P;  1Z56 A;  3L70 D;  2R5B A;  1KQG B;  1YJN P;  3L4F A;  3L71 D;  1ZR4 A;  5C39 A;  3U1C A;  2XDJ A;  1LNQ A;  2KNC A;  4DCK A;  3AEA C;  2RKL A;  1AVY A;  1SQX D;  4I6M C;  3G4S P;  3D6Y A;  1MUU A;  4EI2 A;  2PAJ A;  3AEF C;  1KFM A;  1DD4 A;  1NTZ J;  2FYU E;  3KDP B;  3MUD C;  3P7K A;  3CMA P;  1QL2 A;  1NTM E;  1PV3 A;  1URQ C;  4N78 D;  4YXW H;  2K9J A;  1LTG C;  2OTK E;  1SQX K;  3L74 J;  4IL6 H;  3L71 J;  2ZVO B;  5APX A;  4DOJ A;  3ZDM A;  1AJY A;  1G1J A;  1JOC A;  1NU1 J;  1M90 Q;  1JY2 P;  1W5C E;  2FYU D;  2Y0D A;  1NTM D;  1Y8A A;  1YTZ I;  2A06 G;  3A5T A;  1K8A Q;  3BCC J;  2H8P D;  2YO3 A;  1VF5 C;  3F5H A;  5AVX B;  3FWN A;  2IBZ G;  1YHQ P;  1EQ7 A;  1SFC B;  2FYU K;  3RL0 D;  1IFP A;  1PL5 A;  3TGU E;  4PD4 E;  1FZC A;  3CCL P;  2OYH A;  2JDI H;  1NTZ K;  2LXB A;  3V6I A;  2JWD A;  3IN6 A;  1KIL E;  3L75 J;  1FZF A;  3AEC C;  3V2P A;  4HKZ H;  2IBZ E;  2JP3 A;  1L0N D;  1IC2 A;  3VMX A;  3P8M C;  2BAS A;  3I5C A;  3KZI E;  1S9K E;  3H1L E;  4AQR D;  1FC2 C;  4RKU J;  1JEK A;  4Y28 J;  1VF5 D;  1FS0 E;  1KD1 Q;  1GD2 E;  2J5U A;  5B66 E;  1NTK G;  3CX5 E;  1KIL A;  1KB9 I;  1EZV D;  2V7Q H;  3M91 A;  1RQV A;  3B8E B;  4W7Y A;  1GL2 C;  1SQQ G;  1L0L E;  3SFE C;  4BRY A;  2Y0E A;  4D6T D;  4Y99 B;  2JWA A;  3L71 G;  4H0L B;  3CCS P;  2O1J A;  3Q5R A;  1RHZ B;  3AEG C;  2Y9Y A;  1URQ D;  2FYU J;  2E76 D;  1PP9 G;  2E74 C;  2WZ7 A;  3GMA A;  3JSV C;  4KJM A;  3IR9 A;  1LTJ B;  3BCC G;  5AW9 B;  1ZME C;  2KSE A;  1J1E B;  4PJ0 E;  1LWU C;  1RQU A;  5DJT B;  3C9I A;  1LTB C;  3AE9 C;  5AVW B;  1NU1 K;  4WB4 A;  1VQP P;  1GTW A;  1IFN A;  1OX3 A;  2LR2 A;  3CC4 P;  1QGK B;  3CPW O;  3CX5 H;  1L2P A;  2KB7 P;  1BGY J;  3NFQ A;  2Q9I A;  3E7K A;  4TT3 H;  3RK2 C;  3L73 E;  1JY3 O;  2OQQ A;  4N78 E;  2L91 A;  2ZVN B;  3BVH A;  5AVR B;  2HLO A;  2M3E A;  4H0L D;  5APW A;  1SQB K;  2FFD A;  2IBZ D;  2ITA A;  3L70 J;  1G2C B;  1T3U A;  2MJZ A;  3WUU A;  5CBO A;  5CJ0 A;  3H25 A;  4I7Z C;  2Q3I A;  2JJL A;  4LGD E;  3SFD C;  3H1I E;  1VF5 B;  3RK3 C;  3TNU A;  5APY A;  2OTJ P;  1IK9 A;  2WSC H;  3M9H A;  1HTL C;  1X0T A;  3GF7 A;  2NPS B;  2C0W A;  4JPZ B;  1HF9 A;  1UIX A;  2QJP C;  4H13 C;  5KLV E;  2FYU G;  3H1I D;  2LKM A;  3H1H E;  3HD7 B;  1DIP A;  4GDO A;  1URQ B;  5AW5 B;  3SWK A;  2PGD A;  3N4X A;  4YPC A;  1OW6 A;  2KNC B;  1GW4 A;  1JTH B;  1SQP D;  2D2C D;  3IF4 A;  3L74 G;  5EFW B;  3R4Y A;  4IFD K;  2O01 J;  1FDI A;  5CCG C;  3Q1M A;  2FFD C;  1QEX A;  3H1H D;  3VOP A;  4ZNC A;  1NU1 G;  3CX5 D;  3TDK A;  1BGY G;  2K88 A;  2FYN B;  5KJ7 D;  3HE5 A;  1VL2 A;  2HG5 D;  1E79 H;  4PV1 B;  3HE4 A;  5KAI H;  2E5T A;  1VQ4 P;  1NAF A;  1SQV K;  2WSE H;  4EOT A;  1L0N E;  1NTM K;  1AFO A;  3L70 G;  1PGO A;  5H2F H;  3MIW A;  4IFM A;  5AVU B;  3H1J D;  1MFT A;  1EZV G;  2WT7 A;  2HOD A;  3PHL A;  2I8D A;  4OGQ D;  4PD4 D;  2ZT9 B;  3PP5 A;  1QVG O;  3RL0 B;  3JCU E;  3Q2Y A;  2C9L Y;  2N1T C;  5E79 E;  1GDT A;  2O01 N;  2I1J A;  1PP9 D;  2A45 H;  1N73 B;  5KAF H;  1NTK J;  3H1L D;  3Q5S A;  3A0B H;  3TSI A;  1DX7 A;  4OH8 B;  5KAI E;  2KZJ A;  1SQQ J;  2H88 C;  2YIU B;  1GU5 A;  3CXH I;  3W67 A;  4HJG H;  3PRJ A;  2FKW B;  2L5G B;  3ABV C;  1USE A;  5AW6 B;  1H89 A;  3L72 D;  1LJ2 A;  1FE6 A;  3I56 P;  2XU6 A;  4GT1 A;  2JR8 A;  3H1K J;  3KPE A;  2HPC B;  1YI2 P;  1PP9 J;  3AE7 C;  1SQX J;  5AVY B;  3L36 A;  3U1A A;  3M0D C;  3GW6 A;  1FJP A;  1L4A A;  3V4Q A;  2E75 B;  2ZAE B;  1JMB A;  2KS1 B;  3GLM A;  3KQG A;  2V7Q J;  1VQ7 P;  5AW1 B;  4ZKP A;  3A0H E;  1VQO P;  3CXH H;  3OW2 O;  1YYC A;  5KAF E;  4RJT A;  1YTZ T;  4WBA A;  5GTH H;  2QIW A;  3M9B A;  2R5D A;  5KKZ C;  3M0D A;  1H88 A;  1HJB A;  4XFJ A;  3BRV B;  3NXS A;  3E1I A;  1FDO A;  2G8Y A;  3HUS C;  1KQL A;  1SQP J;  1X8Y A;  4EYY Q;  1GZL A;  1LTT C;  3R2P A;  3VN0 A;  2GA1 A;  3GHG A;  3CC2 P;  4PV1 C;  1URQ A;  3PTZ A;  3V2R A;  3L37 A;  4WY4 A;  5KKZ B;  1TU3 F;  1FZA A;  4LC1 A;  1EZV E;  2NPS C;  1M8O B;  3H1I J;  3VYI A;  3O6Q B;  1NKZ B;  4H44 D;  4BXL A;  5CCH D;  3CC7 P;  2QJY C;  2N9Y B;  1FAV A;  1YJW P;  1Q90 D;  3A0H H;  2J59 M;  1HVV A;  3H1K G;  1RE3 A;  3MD0 A;  3VTP C;  1SQX G;  1VQK P;  4GKG A;  1NAY A;  1BDD A;  3WUV A;  4U3F D;  1H0T A;  3H1H J;  3TK1 A;  4HH2 A;  2D2C C;  1WT6 A;  1N8R Q;  3LW5 H;  2IFM A;  3QWO C;  1FJK A;  2QA4 P;  4B86 A;  1WMK A;  3U59 A;  1ZW0 A;  1KZU B;  1LP1 B;  1NTZ D;  1PP9 E;  2WPS A;  3B71 A;  5CCH A;  2KI7 B;  3M06 A;  2YIU C;  5K5G B;  1NJI Q;  1NVO A;  4YTP C;  1S5L H;  1NKN A;  2Y9Z A;  2JO1 A;  1PIX A;  4CPG A;  2IBZ I;  1M7L A;  1VPC A;  1AA0 A;  2BEZ F;  1SQQ D;  2FY8 A;  1N2D C;  2M8R A;  1N73 A;  3FX0 A;  1FBM A;  1KQF B;  4RO0 A;  3MHV A;  1EXI A;  4AUW A;  5AVQ B;  4PD4 I;  1KYO H;  2W27 A;  4I1L A;  3H1I G;  1J1D C;  2K9J B;  1Q81 Q;  5BVZ A;  5KTB A;  2VRS A;  2KUB A;  4N3Y B;  1U7J A;  3EWK A;  1ZXG A;  3VP8 A;  3G6E P;  1RF1 C;  1MZ9 A;  1KTM A;  3L72 E;  2HPC A;  1FZE A;  1OIP A;  3FXD A;  1GMJ A;  1ZLL A;  1NTM G;  1SQB J;  2R3C A;  3H1H G;  2IZ0 A;  2O1K A;  2WPR A;  4U7J A;  1FOS E;  3CX5 I;  2YMY A;  1YQ4 C;  3H32 A;  3VMY A;  4N6J A;  1L0L D;  4C7N A;  1BSN A;  2NZ2 A;  2WPV B;  5CMZ A;  5TIS E;  3GF3 A;  4L74 A;  2ZJS E;  2E43 A;  2KOG A;  4I2L C;  1S5L X;  4QMA A;  1RF1 B;  2CPS A;  1ZR2 A;  1IFD A;  3VMZ A;  1CSB A;  1P84 D;  2J58 A;  1SQX E;  2P67 A;  1LT9 C;  4GOE A;  3USS A;  5AVV B;  2Q6Q A;  1GL2 D;  2PFX A;  2ZYD A;  4H13 B;  2E42 A;  4UB6 E;  1S2E A;  2BCC G;  1CI6 B;  5APV A;  2W90 A;  1L4A C;  1GK6 A;  1AV1 A;  1LWU A;  1RY3 A;  1L4A D;  1JNM A;  3AE5 C;  1DEB A;  3HE4 B;  2IDB A;  1LT9 B;  3V2N A;  1HBW A;  4PV1 D;  1SQP G;  2SPZ A;  1RE4 A;  3RK2 B;  3KHU A;  2B87 B;  1A02 F;  3NTN A;  1JY3 N;  3WU2 H;  5CCG A;  2OYI C;  3CI9 A;  1NH4 A;  5KLI B;  2XV5 A;  1BCC J;  3M9Q A;  2XZR A;  4XE5 B;  1GK4 A;  5KJ7 A;  1GL2 A;  2WSE J;  5AVZ B;  2ZXX A;  2Q7C A;  2WSF J;  1XTG B;  2D2C B;  4OVN F;  4ASV A;  1KIL C;  2M3B A;  4K3A A;  3RK2 D;  1YJ9 P;  4IOI H;  3E1R A;  4EIJ A;  5KLV D;  1NU1 E;  1M1K Q;  2NPS A;  2OYH B;  1CI6 A;  4UB8 E;  2W8Z A;  1N7S B;  4K35 A;  1R8E A;  2M5A A;  1OWA A;  2KSJ A;  1OZH A;  1S5L E;  1BE3 E;  1MFZ A;  2WMM A;  2YNY A;  3BCC E;  3GHG C;  5AW8 B;  3V4W A;  3VMA A;  4D6T G;  1SQQ K;  4U3F G;  2BCC J;  2A06 D;  2N1T B;  3CWB J;  2I1K A;  3N7N A;  5B5E H;  4ZKU A;  1SP4 A;  3G71 P;  1FZC C;  2AXT E;  4GOD A;  2RMZ A;  3S4R A;  3G3Z A;  2PP6 A;  2KZI A;  1T8Z A;  2B87 A;  2WSF H;  2CPB A;  4W80 A;  1KYO E;  1HWT C;  1M1J C;  1EDL A;  5TJH A;  4AYC A;  1FZC B;  1WRG A;  3H1L J;  3D71 A;  2FXM A;  4Z1M H;  3FWL A;  3B5N D;  2H7H A;  4DZO A;  2IX7 C;  1BCC G;  3FGA D;  2FYN C;  2HYN A;  1AQT A;  1SQP K;  1KMI Z;  1S3J A;  4UB6 H;  1X79 B;  1T2K D;  3MUD A;  1ZRT D;  1LTJ A;  4JBZ A;  3S1K A;  3SWF A;  1A02 J;  3H1K E;  1GW3 A;  5APU A;  1BSH A;  1M1J B;  1K05 A;  2ZT9 D;  2QSI A;  3CL3 D;  1K9M Q;  3HD7 D;  2DW3 A;  2AXT H;  1NTM J;  1SQB G;  4EDF A;  3MP7 B;  3P32 A;  2IYP A;  1FZB A;  3HD7 C;  1SQV D;  3CCR P;  2AEM A;  1NOH A;  1SFC D;  1X9V A;  2E75 D;  4IL6 E;  1VQ9 P;  1AQ5 A;  1E5W A;  3OJA B;  1VQM P;  3CWB G;  1OFC X;  2WQY C;  1PGQ A;  2QVA A;  3UIA A;  1W2E A;  2HOD B;  2QEX P;  2C9N Y;  1LWU B;  1YIJ P;  1RF0 C;  1XTC C;  4L75 A;  1HUC A;  1Q7Y Q;  3CCU P;  1JCD A;  2KLU A;  1KQS O;  1FZG A;  2B88 A;  2KXP B;  3L74 D;  4DT0 A;  2UWJ E;  3AE1 C;  2LXC B;  1KOR A;  5CJ4 A;  1JM0 A;  1JB0 J;  3AE2 C;  2KK7 A;  3KXD A;  4NPE A;  2OYH C;  1PPJ D;  1NU1 D;  2IYO A;  2KLV A;  1BGY D;  3EQ2 A;  2P1J A;  3CCJ P;  1SFC A;  5APS A;  4DJG A;  3HD7 A;  3MGN A;  5CBN A;  3JCU H;  3G9R A;  4WVZ A;  3AED C;  2Q1K A;  2PRR A;  4HB1 A;  5KLI C;  4OWF A;  3W68 A;  1VQN P;  3CWB D;  1N7S A;  4W7Z A;  3K5B A;  2XKM A;  3TNU B;  3ITK A;  1JO5 A;  4ZMD A;  1EDK A;  3C8V A;  3T97 B;  1L0L G;  1N7S C;  4GIF A;  1KIL D;  2K3R A;  2QE7 H;  2QM7 A;  2E76 C;  4WY4 B;  3TF5 A;  1QVF O;  2A06 E;  2QG4 A;  2B89 A;  2Q5U A;  3V2Q A;  5B5E E;  1Q86 Q;  3CD6 P;  1VDF A;  1NHL A;  2P7J A;  1NO4 A;  1HH0 A;  1IJD B;  1HJ0 A;  1SS1 A;  2YKQ A;  2ZYG A;  3O8Z A;  1IFI A;  4BWN A;  1QLE D;  2R32 A;  2GUS A;  1R5S A;  1ZRT E;  1N86 A;  1LTI C; 
#chains in the Genus database with same CATH homology
 4D6T J;  2FYU J;  1BE3 J;  1L0N J;  4U3F J;  3BCC J;  3L72 J;  1EZV I;  1L0L J;  1SQP J;  2IBZ I;  1NTK J;  1NTM J;  1SQQ J;  3L75 J;  3CXH I;  1BGY J;  3H1I J;  4PD4 I;  5KLV J;  2BCC J;  3H1J J;  3CWB J;  3H1K J;  3TGU J;  1PP9 J;  1SQX J;  1NTZ J;  3L70 J;  1BCC J;  1P84 I;  1KB9 I;  1SQV J;  3H1H J;  1SQB J;  3L74 J;  3L71 J;  3L73 J;  3CX5 I;  1NU1 J;  3H1L J;  1KYO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...