3H1IJ

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1iJ00
1NTZJ 1NTMJ 1SQVJ 1KYOI 3L71J 3CX5I 3L73J 2FYUJ 3L72J 1BGYJ 1BE3J 1P84I 1L0LJ 3L74J 5KLVJ 1SQXJ 1PP9J 4PD4I 4D6TJ 1SQBJ 3H1JJ 1L0NJ 3H1LJ 3BCCJ 1EZVI 3CXHI 3H1KJ 3TGUJ 3L75J 2BCCJ 1BCCJ 2IBZI 1SQQJ 3CWBJ 1SQPJ 3H1HJ 4U3FJ 3H1IJ 3L70J 1KB9I 1NTKJ 1NU1J
chains in the Genus database with same CATH superfamily
3GF7A 4DJGA 4IL6X 2KS1A 2QSIA 3CWBD 1DIPA 1G1JA 1FDIA 2PGDA 1SQXJ 3L4FA 2KLUA 5DJUB 2OYIA 1EZVI 3L72D 2ZVNB 4JYCA 2W27A 3USSA 5K5GB 3L71G 1AFOA 2IBZG 3BCCD 3E1RA 1NTME 1VQ4P 1N86A 1S72P 2QE7H 1W5CE 2JP3A 2L91A 3AE9C 2E76D 1FZEA 5BU5A 1Y47A 1JY3N 1KYOI 2N1TC 1RHZB 2B88A 1RE3A 1AQ5A 3RL0C 1NTMD 1IFDA 5B5EH 1JCCA 3RK3B 1Q7YQ 3WUTA 1LJ2A 1LWUA 3RGUA 1N73B 3CC4P 5GTHE 2QA4P 2VRSA 2O01J 3EWKA 3ABVC 2E75C 2QG4A 4OWFA 4QMAA 3CL3D 1W2BO 1XTGB 3D71A 2H7HA 5APQA 1OZHA 1L4AC 1URQD 1FZAA 2IYOA 3RL0g 1X8YA 5AVSB 2AEFA 2KZIA 2LR2A 3M06A 1EDJA 2BCCG 3P8MC 3Q5SA 1OW8A 3VP9A 3CMEP 1LT1A 4W80A 3B5ND 2V7QJ 3OAKA 3V2QA 1YITP 5CHXA 4OGQD 3B8EB 2E76B 1SQQD 2O01H 1QVGO 3S9OA 3RK2D 3II6A 1KQLA 5AVWB 4M3LA 3GMAA 2WPVB 2CPSA 3TYYA 3P32A 4WY4C 3L72G 3VYIA 1CI6A 2KXPB 4B86A 2W6BA 1YQ4C 3CI9A 3S1KA 3BCCG 1CW5A 3HD7D 1J1DB 2IX7C 4Y28J 3H1LJ 4HB1A 1EXIA 2V7QH 1IFPA 3L70J 1KMIZ 3CXHE 1FOSE 1YHQP 2FXMA 3TSIA 1Q90D 4UB8E 4IFDK 3G6EP 2OTJP 5APYA 1SQBK 1URQB 1JCDA 4WWIA 3MUDA 1EDIA 2XZRA 3EFFK 2I1KA 2HODA 1P84E 3GHGA 2M3EA 1NTMG 3V2NA 1KFMA 2D2CD 4UB6H 1SQVK 4TT3H 5CCGD 3B5NB 1QEXA 1AQTA 4DOJA 3AE8C 1DH3A 4OGQB 1WMKA 4GT1A 2WSSH 3RK2B 1VF5B 1SFCD 3UIAA 2ZVOB 1HJ0A 1NTKK 1NKNA 1SLQA 3L71J 1P84D 4XFJA 1AA0A 1OVRA 1OW7A 1FS0E 1S5LX 1LTJB 3LIEA 2Q3IA 3BRTB 2HFED 1NU1K 5CMZA 1HVVA 3FXDA 2DW3A 2AXCA 1A02F 1HBWA 1QL1A 4CPGA 3O6QB 4RKUJ 4OH8B 3OA7A 1KILE 3RK3C 2PAJA 1JMMA 5AW7B 1KORA 5EFWB 3W67A 4XA4A 1GU5A 2MKVA 5APXA 2D2CB 3T97B 1N73C 1BSHA 5APTA 3WU2E 3FWNA 1VL2A 3A0HE 1ZLLA 4PD4H 1SQPK 1EXJA 1K04A 4K35A 3HUSB 3CCSP 3D70A 1N7SD 1SFCB 2WPRA 1KILD 1M8OB 2OARA 3BVHA 3AEBC 1VQKP 2KNCA 1OFCX 1M1JB 3HD7A 2BCCJ 1BGYD 2ZXXA 1FDOA 2WSCJ 3SSUA 3TNUB 4U3FE 4AYCA 4GDOA 4JQ0D 3V2RA 1M7LA 1VQPP 4C46A 4EYYQ 2M0BA 1M1KQ 2E76C 4ZKPA 3CMAP 1LTGC 1RF0C 1VQ8P 1GL2A 1NOHA 3Q5PA 2C0WA 4O9BA 2WVRA 3L73E 3L72J 4IFMA 3P7KA 1L0LK 4U3FD 3I5CA 1KB9E 1J1DC 4U7JA 5CCGA 1SQBE 3BCCJ 2WSCH 1MV8A 2PRRA 2Q1KA 1FU1A 4PJ0E 1E5WA 1SQVE 5AW4B 2YKQA 5CCHA 5KTBA 2JJLA 1KQGB 1N7SB 1URQC 3H1KE 3L73D 1E79H 2IFNA 2YIUB 1M56D 2E74D 1SQBD 1NTKE 1Q81Q 1NTMJ 1QLED 1BDCA 3B5NC 4DZOA 2HR3A 1GK4A 3BRVB 1IFJA 4OGQC 1KYOE 3VTPC 2PP6A 3RK2C 4TLFA 4LC1A 2ZYAA 2JR8A 1NU1E 3H1KD 1RE4C 5DJTB 4PD4D 4BRYA 1NTKD 2ZJSE 1IK7A 4R4MA 1PGJA 1JNMA 1LTJC 1KD1Q 1K73Q 1JOCA 1FDMA 2Z5HA 3Q2YA 3FGAD 3A7OA 1BGYG 3FX0A 2FFDA 2M5AB 1BCCD 5AW1B 4NPFX 2KS1B 2M3BA 3V4QA 1ZW0A 2IZ1A 4ASWA 1NU1D 2BASA 1NGMB 1KILA 2OYIB 1HGVA 1SQPE 4YPCA 1NJIQ 2R3CA 2E42A 3M0DC 5M1BA 2YO3A 3CX5I 2E74B 1SP4A 2D2CC 1X22A 3H32B 5KLVK 5CJ0A 2K37A 4Z1MH 4W7ZA 5AVRB 5KAIE 4U3FG 4ASVA 3S4RA 3HUSC 3HE4A 1PV3A 2Q7CA 2RMZA 1SFCC 5GTHH 1SQPD 2HYNA 4YTPC 3VMAA 4H44B 1DEBA 3F5HA 3CCRP 2BEQD 2FYNB 4ZKUA 1M1JC 2WPSA 5AW8B 2R5DA 2Y0DA 1FZFA 3L73G 3Q3DA 2V4HA 2A45G 1ZRTE 3B71A 3SWFA 1LWUB 1SQBG 1L0LE 1SQXK 4LGDE 2WQYC 3V2PA 4JBZA 1IO4A 1MZ9A 2KIKA 5KKZC 2A06E 4JF7A 4JPZB 3ZDMA 1BSNA 1Z56A 3CCUP 4HYTB 4IOIH 1DX7A 4L75A 2FYZA 1FZCA 2I1JA 3H1KG 1OWAA 4AUWA 2B9BA 1KC8Q 3AEAC 1R5LA 1AJYA 1AV1A 3RBXA 3U1AA 4RO0A 1LGHB 2O1JA 1ZRTD 1LP1A 2IBZI 3G9RA 1L0LD 1NTKG 2YKPA 2NRGA 3H6PA 1DEEG 3CC2P 2JO1A 1SS1A 1N7SC 3H1JE 1BCCG 1L0NK 2W6AA 2XNDH 1VPCA 1FBMA 4H0LD 1NU1G 2YIUC 3CXHH 2E43A 4UB8H 1CI6B 1Q82Q 3MGNA 3M9QA 3CLQA 2P2UA 1QGKB 4D6TE 1IFIA 1P84H 1OIPA 5AVYB 1U57A 2XV5A 3CCJP 2ZXEB 1KQFB 3H1JD 2KUBA 2Y0EA 1BE3E 1LTTC 1SQPG 1JEKA 2AXTE 3KZIE 1EC5A 2KP8A 2BEZF 2HODB 3H1HE 1QVFO 5AVXB 3GHGB 3W68A 1QL2A 5H2FE 4L76A 2K88A 1BGYJ 2QJYB 5KLVE 3KXDA 3NFQA 1NVOA 1LTBC 2OYIC 3TGUE 1PGQA 3B4SA 2K3RA 1BE3D 1ZN5A 1GW4A 1GD2E 3VMZA 3M0AA 2WSFJ 2E74C 3H1HD 3CCVP 1MFZA 5APSA 1IFNA 1XTCC 3NTNA 3HRNA 1T8ZA 3VP8A 2MJZA 1IC2A 5KLVD 2R5BA 4U3FJ 4DCKA 3MTUE 4C7RA 3BASA 1VDFA 1H0TA 1L0LG 1S1CX 1ZP0C 3WU2H 3SFDC 5KJ7A 3A0HH 1SQXE 2O1KA 4IL6E 1GL2D 1RE3C 4H44C 1EDKA 2FYNC 3AEGC 4PV1D 3HE5A 4BXLA 2K9YA 3AEDC 4MN4C 2WSFH 5APVA 1WT6A 3F89A 3L73J 3IF4A 1NH4A 1LWUC 1H8AA 2P67A 2AEMA 4JYBA 1SQBJ 3CXHD 3CPWO 1USDA 3A0BE 3EQ2A 3PLNA 1ZMEC 2ZFCA 2GM4A 1RF1A 5CCHD 1IK9A 3P8CE 1ZR4A 4L73A 2OYHA 3H1JG 1ZXGA 2QM8A 2YMYA 4C7NA 1NYHA 1L0NE 2W8ZA 3H1KJ 2KNCB 3HD7B 4WVZA 2GUSA 2GUVA 1NTKJ 3FWLA 1FC2C 2IFMA 2A45H 1KB9H 3ITKA 2O3JA 1YJ9P 3L35A 3WUUA 4N6JA 1T2KD 5KAFE 5APUA 3P8CD 3TK1A 4PJ0H 1BCCJ 2OTKE 1GL2B 1M90Q 4I2LC 4XE5B 1NU1J 4PV1B 1BE3G 3V5BA 1JMBA 2FXOA 4A7PA 2YO2A 3NXSA 2GA1A 1JTHA 1VQMP 2FKWB 1HGZA 3H1HG 4Y99B 1GDTA 2YMKA 5KLVG 1SVFA 4DT0A 1M57D 3SWYA 2KOGA 3PP5A 4GKGA 1JY3O 3A2AA 3AEEC 1KYOH 3TGUG 3AE5C 2POHA 3MUDC 3GF3A 1ZR2A 1SQPJ 5AVVB 2C9LY 2K9JA 3GHGC 1NAFA 3KDPB 1Q2NA 1FJKA 1QX8A 2FYUK 2LXCB 2OGUA 1AVOA 2QJYC 3AECC 3IR9A 2WITA 3H1LE 2J58A 1HUCA 1UIXA 1VQ7P 1VQ9P 3KPEA 5KKZB 1ZOYC 3HTKA 2HLOA 4GOEA 1YJNP 3OW2O 2IYPA 3Q1MA 1PP9E 2WT7A 4BRYB 2W6JH 2Z5IA 1KV4A 4EDFA 1EZVE 2FFDB 1PL5A 1LTAC 1R8EA 3V6IA 1P84I 3M9BA 1Q86Q 1L0LJ 3IN6A 1MFTA 5KAIH 2XDJA 5B66E 2YXQB 4HKZH 1KILB 1NKZB 2W90A 1MKMA 1KN7A 2WPQA 1HWTC 1KB9D 4NPDA 3WUVA 2Y9YA 3JCUE 3V4WA 1NTZK 1LT9A 1L0NG 4I7ZB 1HJBA 1JY2P 2JWAA 5BU8B 3AE4C 5CBNA 1SQVD 3RBZA 5AVTB 1S5LE 2NPSA 4GODA 3H1IE 3AE3C 1WRGA 2HG5D 3HE4B 1TU3F 2Y9ZA 3K5BA 1DD4A 3H1JJ 1OVUA 2W83C 4N78E 1RH5B 3HD7C 2QVAA 5L8RJ 1KYOD 1YIJP 4GOFA 3H1ID 3CCMP 2R3SA 1K9MQ 4YXDC 1SQQK 1GL2C 2QJPB 3GW6A 3AE6C 2P7JA 4PV1C 1J2JB 3D6YA 3QWOC 2N1TA 4N78D 1BE3J 3AE2C 2KZJA 3L74E 2XKMA 5AVQB 1FZCB 1NAYA 3GLMA 2KB7P 4ZNCA 5APWA 2KSJA 5CCGC 2O01N 1L2PA 2H89C 4I6MC 1LTIC 1FZGA 4LLHA 1LP1B 4Y99C 2G3AA 3H1HJ 3CCQP 1KFNA 1JY3P 3G4SP 2QJKB 4OVNF 2FYUE 5CCHC 5KLVJ 3KQGA 3I56P 1FAVA 3TGUJ 3CWBE 3L74D 1JB0J 1OXZA 2FBWC 3AEFC 1L4AA 1YJWP 1K05A 1PP9G 2HPCA 2KYVA 2JEEA 2AXTH 1D7MA 3BCCE 3KZIH 1G1IA 3PJSK 2R44A 2B89A 2IDBA 3PTZA 3CC7P 5E79E 5H2FH 1T2KC 1EZVG 2A45I 1SQVG 5KJ7D 3L37A 2IPPA 4EIJA 3BATA 3VN0A 1G2CA 3L75E 4WY4A 1X9VA 2UWJE 1NTZE 2QM7A 2FFDC 3H32A 3CCEP 3QH9A 2A06D 4PD4I 2PFXA 5C39A 4KT0J 1KILC 2SPZA 5GTIE 3H1IG 3MIWA 3OJAB 2ITAA 5CJ4A 1U7JA 2Y0CA 2CPBA 3L75D 2RKLA 4IL6H 1A02J 4I7ZC 2B87A 1L0NJ 1NTZD 1T3UA 2WSEJ 3FXEA 3Q5RA 1KB9I 1FZBA 1EQ7A 2KK7A 1S3JA 1H88A 2LKMA 1H0TB 2QIWA 1BDDA 1OVVA 1VQOP 3KHUA 1KZUB 3A0BH 2ZYDA 1U7MA 1SQQE 3R4YA 4W7YA 3HE5B 4D6TD 1X0TA 4N3YB 5TISE 1YBKA 2JDIH 2KSEA 3E1IA 3I55P 3L74G 4H13D 2KLVA 4KJMA 3PRJA 2WSEH 1CZQA 3AE7C 2IZ0A 1N7LA 4ZMDA 2K1AA 1UIIA 2H43A 3C1LA 4WBAA 4WB4A 2E5YA 5AW3B 5AW9B 1GW3A 2FYUG 3TDKA 2QJPC 3N7NA 1RF1B 4H0LB 1USEA 2OYHB 5KAFH 1FZCC 1VF5D 1T3JA 3CWBG 4C7NB 2JKVA 3LIDA 3D6ZA 2P1JA 3WMM0 1Y8AA 1PGPA 2OTLP 1IFMA 2QJKC 3O8ZA 3TGUD 1N73A 1HF9A 3IAOA 2YKOA 1PGOA 4IFFA 2A06G 2R32A 3H25A 1FE6A 5B5EE 5AW6B 4NPEA 2Q6QA 3SWKA 1JTHB 2Q3EA 2QRXA 3CX5H 1PP9J 2C9NY 4BWNA 3L75G 1VQ6P 2WZ7A 4H13B 1GTWA 3SFEC 1JY2O 1N8RQ 1SQXD 1NTZG 1IZNB 1FOSF 2ZT9D 2CK3H 5AVUB 2RH0A 1SQVJ 1RF0A 1K8AQ 5BVZA 1H89A 2Q9IA 3JSVC 2P10A 3MHVA 1J1EB 2XNXA 5KLIB 2WWWA 4RESB 2K9JB 3G71P 3CCLP 2JWDA 2G8YA 4KHXA 4D6TG 3PH0A 3LW5J 5AW5B 2NPSD 5AVZB 1YQ3C 3C8VA 3H1IJ 4YXWH 1NHLA 1L0ND 2FXPA 3HTKB 1S4XA 5B66H 1FJPA 1URQA 3L36A 2WT7B 1SQQG 1LTSC 3VMXA 3GG2A 3JCUH 3B5NA 1BGYE 3G3ZA 3MD0A 3LW5H 1GZLA 5KJ7C 2ZT9B 1PPJE 2J59M 2ZAEB 1S5LH 3CX5E 2L5GB 2WMMA 2N1TD 1RE4A 3N4XA 4UB6E 3RL0D 1LT9B 1KTMA 1YTZI 3L74J 1LTJA 1Y9BA 1EDLA 1YTZT 2YNYA 4EOTA 3U1CA 1PPJD 3L70E 2NPSB 4AQRD 4HH2A 2ZYGA 2OQQA 1RF1C 3CX5D 3CD6P 3MZWB 4H0LC 2FYUJ 1SQXG 4K3AA 3VMYA 2OYHC 1PZQA 3O6QA 2E75D 2YXRB 1OX3A 3CXHI 3VOPA 3CWBJ 1L4AD 1AVYA 1VQ5P 3H1LD 4RJTA 3M0DA 2E5TA 4I1LA 3T97A 2OYOA 1JO5A 1OMIA 3L70D 1NO4A 2XU6A 1HTLC 3M9HA 1PFIA 2QEXP 2NZ2A 3HUSA 3TF5A 1PP9D 3U59A 1NTMK 1SFCA 3L71E 2IBZE 2N1TB 2RN0A 1NWQA 2P58A 1LNQA 3AE1C 3MP7B 3RL0B 4H13C 1GMJA 1M1JA 1EZVD 4WY4D 1W2EA 3L75J 3TNUA 1KQSO 1GK6A 4PD4E 3A3YB 3E7KA 4GIFA 1NTZJ 1RY3A 3NMDA 5E79H 5CBOA 3L71D 1BCCE 2IBZD 2M8RA 2E75B 1VF5C 1J1EC 5KLIC 1VQLP 2FY8A 2Z4EA 3IFMA 2C0XA 1L4AB 4H44D 2HPCB 1HH0A 1S2EA 4HJGH 3PHLA 4D6TJ 2N9BA 5AW2B 1S9KE 4EI2A 1DD3A 2H8PD 1PIXA 1ZV8A 3KYQA 1PPJG 2WTYA 3R2PA 1N7SA 3JC22 5GTIH 1G2CB 2BCCE 1YYCA 1VQNP 1SQQJ 5AW0B 5TJHA 1CSBA 2AEJA 4WY4B 1T6AA 1IJDB 3A5TA 3RK3E 1S9KD 2J5UA 3H1LG 2I8DA 2ZT9C 4R4LA 1JY2N 1MUUA 1YI2P 1X79B 2LXBA 1GU4A 1RQUA 1RQVA 3L70G 1OW6A 3L72E 2BCCD 2KI7B 1LT9C 1N2DC 4L74A 3EFGA 2B87B 1R5SA 3RK3D 2N9YB 3M91A 2H88C 2FYUD 1JM0A 5TISH 1JUNA 2NPSC 2Q5UA 3C9IA 2M5AA
chains in the Genus database with same CATH topology
1NTZJ 1NTMJ 1SQVJ 1KYOI 3L71J 3CX5I 3L73J 2FYUJ 3L72J 1BGYJ 1BE3J 1P84I 1L0LJ 3L74J 5KLVJ 1SQXJ 1PP9J 4PD4I 4D6TJ 1SQBJ 3H1JJ 1L0NJ 3H1LJ 3BCCJ 1EZVI 3CXHI 3H1KJ 3TGUJ 3L75J 2BCCJ 1BCCJ 2IBZI 1SQQJ 3CWBJ 1SQPJ 3H1HJ 4U3FJ 3H1IJ 3L70J 1KB9I 1NTKJ 1NU1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ J;  1NTM J;  1SQV J;  1KYO I;  3L71 J;  3CX5 I;  3L73 J;  2FYU J;  3L72 J;  1BGY J;  1BE3 J;  1P84 I;  1L0L J;  3L74 J;  5KLV J;  1SQX J;  1PP9 J;  4PD4 I;  4D6T J;  1SQB J;  3H1J J;  1L0N J;  3H1L J;  3BCC J;  1EZV I;  3CXH I;  3H1K J;  3TGU J;  3L75 J;  2BCC J;  1BCC J;  2IBZ I;  1SQQ J;  3CWB J;  1SQP J;  3H1H J;  4U3F J;  3H1I J;  3L70 J;  1KB9 I;  1NTK J;  1NU1 J; 
#chains in the Genus database with same CATH topology
 3GF7 A;  4DJG A;  4IL6 X;  2KS1 A;  2QSI A;  3CWB D;  1DIP A;  1G1J A;  1FDI A;  2PGD A;  1SQX J;  3L4F A;  2KLU A;  5DJU B;  2OYI A;  1EZV I;  3L72 D;  2ZVN B;  4JYC A;  2W27 A;  3USS A;  5K5G B;  3L71 G;  1AFO A;  2IBZ G;  3BCC D;  3E1R A;  1NTM E;  1VQ4 P;  1N86 A;  1S72 P;  2QE7 H;  1W5C E;  2JP3 A;  2L91 A;  3AE9 C;  2E76 D;  1FZE A;  5BU5 A;  1Y47 A;  1JY3 N;  1KYO I;  2N1T C;  1RHZ B;  2B88 A;  1RE3 A;  1AQ5 A;  3RL0 C;  1NTM D;  1IFD A;  5B5E H;  1JCC A;  3RK3 B;  1Q7Y Q;  3WUT A;  1LJ2 A;  1LWU A;  3RGU A;  1N73 B;  3CC4 P;  5GTH E;  2QA4 P;  2VRS A;  2O01 J;  3EWK A;  3ABV C;  2E75 C;  2QG4 A;  4OWF A;  4QMA A;  3CL3 D;  1W2B O;  1XTG B;  3D71 A;  2H7H A;  5APQ A;  1OZH A;  1L4A C;  1URQ D;  1FZA A;  2IYO A;  3RL0 g;  1X8Y A;  5AVS B;  2AEF A;  2KZI A;  2LR2 A;  3M06 A;  1EDJ A;  2BCC G;  3P8M C;  3Q5S A;  1OW8 A;  3VP9 A;  3CME P;  1LT1 A;  4W80 A;  3B5N D;  2V7Q J;  3OAK A;  3V2Q A;  1YIT P;  5CHX A;  4OGQ D;  3B8E B;  2E76 B;  1SQQ D;  2O01 H;  1QVG O;  3S9O A;  3RK2 D;  3II6 A;  1KQL A;  5AVW B;  4M3L A;  3GMA A;  2WPV B;  2CPS A;  3TYY A;  3P32 A;  4WY4 C;  3L72 G;  3VYI A;  1CI6 A;  2KXP B;  4B86 A;  2W6B A;  1YQ4 C;  3CI9 A;  3S1K A;  3BCC G;  1CW5 A;  3HD7 D;  1J1D B;  2IX7 C;  4Y28 J;  3H1L J;  4HB1 A;  1EXI A;  2V7Q H;  1IFP A;  3L70 J;  1KMI Z;  3CXH E;  1FOS E;  1YHQ P;  2FXM A;  3TSI A;  1Q90 D;  4UB8 E;  4IFD K;  3G6E P;  2OTJ P;  5APY A;  1SQB K;  1URQ B;  1JCD A;  4WWI A;  3MUD A;  1EDI A;  2XZR A;  3EFF K;  2I1K A;  2HOD A;  1P84 E;  3GHG A;  2M3E A;  1NTM G;  3V2N A;  1KFM A;  2D2C D;  4UB6 H;  1SQV K;  4TT3 H;  5CCG D;  3B5N B;  1QEX A;  1AQT A;  4DOJ A;  3AE8 C;  1DH3 A;  4OGQ B;  1WMK A;  4GT1 A;  2WSS H;  3RK2 B;  1VF5 B;  1SFC D;  3UIA A;  2ZVO B;  1HJ0 A;  1NTK K;  1NKN A;  1SLQ A;  3L71 J;  1P84 D;  4XFJ A;  1AA0 A;  1OVR A;  1OW7 A;  1FS0 E;  1S5L X;  1LTJ B;  3LIE A;  2Q3I A;  3BRT B;  2HFE D;  1NU1 K;  5CMZ A;  1HVV A;  3FXD A;  2DW3 A;  2AXC A;  1A02 F;  1HBW A;  1QL1 A;  4CPG A;  3O6Q B;  4RKU J;  4OH8 B;  3OA7 A;  1KIL E;  3RK3 C;  2PAJ A;  1JMM A;  5AW7 B;  1KOR A;  5EFW B;  3W67 A;  4XA4 A;  1GU5 A;  2MKV A;  5APX A;  2D2C B;  3T97 B;  1N73 C;  1BSH A;  5APT A;  3WU2 E;  3FWN A;  1VL2 A;  3A0H E;  1ZLL A;  4PD4 H;  1SQP K;  1EXJ A;  1K04 A;  4K35 A;  3HUS B;  3CCS P;  3D70 A;  1N7S D;  1SFC B;  2WPR A;  1KIL D;  1M8O B;  2OAR A;  3BVH A;  3AEB C;  1VQK P;  2KNC A;  1OFC X;  1M1J B;  3HD7 A;  2BCC J;  1BGY D;  2ZXX A;  1FDO A;  2WSC J;  3SSU A;  3TNU B;  4U3F E;  4AYC A;  4GDO A;  4JQ0 D;  3V2R A;  1M7L A;  1VQP P;  4C46 A;  4EYY Q;  2M0B A;  1M1K Q;  2E76 C;  4ZKP A;  3CMA P;  1LTG C;  1RF0 C;  1VQ8 P;  1GL2 A;  1NOH A;  3Q5P A;  2C0W A;  4O9B A;  2WVR A;  3L73 E;  3L72 J;  4IFM A;  3P7K A;  1L0L K;  4U3F D;  3I5C A;  1KB9 E;  1J1D C;  4U7J A;  5CCG A;  1SQB E;  3BCC J;  2WSC H;  1MV8 A;  2PRR A;  2Q1K A;  1FU1 A;  4PJ0 E;  1E5W A;  1SQV E;  5AW4 B;  2YKQ A;  5CCH A;  5KTB A;  2JJL A;  1KQG B;  1N7S B;  1URQ C;  3H1K E;  3L73 D;  1E79 H;  2IFN A;  2YIU B;  1M56 D;  2E74 D;  1SQB D;  1NTK E;  1Q81 Q;  1NTM J;  1QLE D;  1BDC A;  3B5N C;  4DZO A;  2HR3 A;  1GK4 A;  3BRV B;  1IFJ A;  4OGQ C;  1KYO E;  3VTP C;  2PP6 A;  3RK2 C;  4TLF A;  4LC1 A;  2ZYA A;  2JR8 A;  1NU1 E;  3H1K D;  1RE4 C;  5DJT B;  4PD4 D;  4BRY A;  1NTK D;  2ZJS E;  1IK7 A;  4R4M A;  1PGJ A;  1JNM A;  1LTJ C;  1KD1 Q;  1K73 Q;  1JOC A;  1FDM A;  2Z5H A;  3Q2Y A;  3FGA D;  3A7O A;  1BGY G;  3FX0 A;  2FFD A;  2M5A B;  1BCC D;  5AW1 B;  4NPF X;  2KS1 B;  2M3B A;  3V4Q A;  1ZW0 A;  2IZ1 A;  4ASW A;  1NU1 D;  2BAS A;  1NGM B;  1KIL A;  2OYI B;  1HGV A;  1SQP E;  4YPC A;  1NJI Q;  2R3C A;  2E42 A;  3M0D C;  5M1B A;  2YO3 A;  3CX5 I;  2E74 B;  1SP4 A;  2D2C C;  1X22 A;  3H32 B;  5KLV K;  5CJ0 A;  2K37 A;  4Z1M H;  4W7Z A;  5AVR B;  5KAI E;  4U3F G;  4ASV A;  3S4R A;  3HUS C;  3HE4 A;  1PV3 A;  2Q7C A;  2RMZ A;  1SFC C;  5GTH H;  1SQP D;  2HYN A;  4YTP C;  3VMA A;  4H44 B;  1DEB A;  3F5H A;  3CCR P;  2BEQ D;  2FYN B;  4ZKU A;  1M1J C;  2WPS A;  5AW8 B;  2R5D A;  2Y0D A;  1FZF A;  3L73 G;  3Q3D A;  2V4H A;  2A45 G;  1ZRT E;  3B71 A;  3SWF A;  1LWU B;  1SQB G;  1L0L E;  1SQX K;  4LGD E;  2WQY C;  3V2P A;  4JBZ A;  1IO4 A;  1MZ9 A;  2KIK A;  5KKZ C;  2A06 E;  4JF7 A;  4JPZ B;  3ZDM A;  1BSN A;  1Z56 A;  3CCU P;  4HYT B;  4IOI H;  1DX7 A;  4L75 A;  2FYZ A;  1FZC A;  2I1J A;  3H1K G;  1OWA A;  4AUW A;  2B9B A;  1KC8 Q;  3AEA C;  1R5L A;  1AJY A;  1AV1 A;  3RBX A;  3U1A A;  4RO0 A;  1LGH B;  2O1J A;  1ZRT D;  1LP1 A;  2IBZ I;  3G9R A;  1L0L D;  1NTK G;  2YKP A;  2NRG A;  3H6P A;  1DEE G;  3CC2 P;  2JO1 A;  1SS1 A;  1N7S C;  3H1J E;  1BCC G;  1L0N K;  2W6A A;  2XND H;  1VPC A;  1FBM A;  4H0L D;  1NU1 G;  2YIU C;  3CXH H;  2E43 A;  4UB8 H;  1CI6 B;  1Q82 Q;  3MGN A;  3M9Q A;  3CLQ A;  2P2U A;  1QGK B;  4D6T E;  1IFI A;  1P84 H;  1OIP A;  5AVY B;  1U57 A;  2XV5 A;  3CCJ P;  2ZXE B;  1KQF B;  3H1J D;  2KUB A;  2Y0E A;  1BE3 E;  1LTT C;  1SQP G;  1JEK A;  2AXT E;  3KZI E;  1EC5 A;  2KP8 A;  2BEZ F;  2HOD B;  3H1H E;  1QVF O;  5AVX B;  3GHG B;  3W68 A;  1QL2 A;  5H2F E;  4L76 A;  2K88 A;  1BGY J;  2QJY B;  5KLV E;  3KXD A;  3NFQ A;  1NVO A;  1LTB C;  2OYI C;  3TGU E;  1PGQ A;  3B4S A;  2K3R A;  1BE3 D;  1ZN5 A;  1GW4 A;  1GD2 E;  3VMZ A;  3M0A A;  2WSF J;  2E74 C;  3H1H D;  3CCV P;  1MFZ A;  5APS A;  1IFN A;  1XTC C;  3NTN A;  3HRN A;  1T8Z A;  3VP8 A;  2MJZ A;  1IC2 A;  5KLV D;  2R5B A;  4U3F J;  4DCK A;  3MTU E;  4C7R A;  3BAS A;  1VDF A;  1H0T A;  1L0L G;  1S1C X;  1ZP0 C;  3WU2 H;  3SFD C;  5KJ7 A;  3A0H H;  1SQX E;  2O1K A;  4IL6 E;  1GL2 D;  1RE3 C;  4H44 C;  1EDK A;  2FYN C;  3AEG C;  4PV1 D;  3HE5 A;  4BXL A;  2K9Y A;  3AED C;  4MN4 C;  2WSF H;  5APV A;  1WT6 A;  3F89 A;  3L73 J;  3IF4 A;  1NH4 A;  1LWU C;  1H8A A;  2P67 A;  2AEM A;  4JYB A;  1SQB J;  3CXH D;  3CPW O;  1USD A;  3A0B E;  3EQ2 A;  3PLN A;  1ZME C;  2ZFC A;  2GM4 A;  1RF1 A;  5CCH D;  1IK9 A;  3P8C E;  1ZR4 A;  4L73 A;  2OYH A;  3H1J G;  1ZXG A;  2QM8 A;  2YMY A;  4C7N A;  1NYH A;  1L0N E;  2W8Z A;  3H1K J;  2KNC B;  3HD7 B;  4WVZ A;  2GUS A;  2GUV A;  1NTK J;  3FWL A;  1FC2 C;  2IFM A;  2A45 H;  1KB9 H;  3ITK A;  2O3J A;  1YJ9 P;  3L35 A;  3WUU A;  4N6J A;  1T2K D;  5KAF E;  5APU A;  3P8C D;  3TK1 A;  4PJ0 H;  1BCC J;  2OTK E;  1GL2 B;  1M90 Q;  4I2L C;  4XE5 B;  1NU1 J;  4PV1 B;  1BE3 G;  3V5B A;  1JMB A;  2FXO A;  4A7P A;  2YO2 A;  3NXS A;  2GA1 A;  1JTH A;  1VQM P;  2FKW B;  1HGZ A;  3H1H G;  4Y99 B;  1GDT A;  2YMK A;  5KLV G;  1SVF A;  4DT0 A;  1M57 D;  3SWY A;  2KOG A;  3PP5 A;  4GKG A;  1JY3 O;  3A2A A;  3AEE C;  1KYO H;  3TGU G;  3AE5 C;  2POH A;  3MUD C;  3GF3 A;  1ZR2 A;  1SQP J;  5AVV B;  2C9L Y;  2K9J A;  3GHG C;  1NAF A;  3KDP B;  1Q2N A;  1FJK A;  1QX8 A;  2FYU K;  2LXC B;  2OGU A;  1AVO A;  2QJY C;  3AEC C;  3IR9 A;  2WIT A;  3H1L E;  2J58 A;  1HUC A;  1UIX A;  1VQ7 P;  1VQ9 P;  3KPE A;  5KKZ B;  1ZOY C;  3HTK A;  2HLO A;  4GOE A;  1YJN P;  3OW2 O;  2IYP A;  3Q1M A;  1PP9 E;  2WT7 A;  4BRY B;  2W6J H;  2Z5I A;  1KV4 A;  4EDF A;  1EZV E;  2FFD B;  1PL5 A;  1LTA C;  1R8E A;  3V6I A;  1P84 I;  3M9B A;  1Q86 Q;  1L0L J;  3IN6 A;  1MFT A;  5KAI H;  2XDJ A;  5B66 E;  2YXQ B;  4HKZ H;  1KIL B;  1NKZ B;  2W90 A;  1MKM A;  1KN7 A;  2WPQ A;  1HWT C;  1KB9 D;  4NPD A;  3WUV A;  2Y9Y A;  3JCU E;  3V4W A;  1NTZ K;  1LT9 A;  1L0N G;  4I7Z B;  1HJB A;  1JY2 P;  2JWA A;  5BU8 B;  3AE4 C;  5CBN A;  1SQV D;  3RBZ A;  5AVT B;  1S5L E;  2NPS A;  4GOD A;  3H1I E;  3AE3 C;  1WRG A;  2HG5 D;  3HE4 B;  1TU3 F;  2Y9Z A;  3K5B A;  1DD4 A;  3H1J J;  1OVU A;  2W83 C;  4N78 E;  1RH5 B;  3HD7 C;  2QVA A;  5L8R J;  1KYO D;  1YIJ P;  4GOF A;  3H1I D;  3CCM P;  2R3S A;  1K9M Q;  4YXD C;  1SQQ K;  1GL2 C;  2QJP B;  3GW6 A;  3AE6 C;  2P7J A;  4PV1 C;  1J2J B;  3D6Y A;  3QWO C;  2N1T A;  4N78 D;  1BE3 J;  3AE2 C;  2KZJ A;  3L74 E;  2XKM A;  5AVQ B;  1FZC B;  1NAY A;  3GLM A;  2KB7 P;  4ZNC A;  5APW A;  2KSJ A;  5CCG C;  2O01 N;  1L2P A;  2H89 C;  4I6M C;  1LTI C;  1FZG A;  4LLH A;  1LP1 B;  4Y99 C;  2G3A A;  3H1H J;  3CCQ P;  1KFN A;  1JY3 P;  3G4S P;  2QJK B;  4OVN F;  2FYU E;  5CCH C;  5KLV J;  3KQG A;  3I56 P;  1FAV A;  3TGU J;  3CWB E;  3L74 D;  1JB0 J;  1OXZ A;  2FBW C;  3AEF C;  1L4A A;  1YJW P;  1K05 A;  1PP9 G;  2HPC A;  2KYV A;  2JEE A;  2AXT H;  1D7M A;  3BCC E;  3KZI H;  1G1I A;  3PJS K;  2R44 A;  2B89 A;  2IDB A;  3PTZ A;  3CC7 P;  5E79 E;  5H2F H;  1T2K C;  1EZV G;  2A45 I;  1SQV G;  5KJ7 D;  3L37 A;  2IPP A;  4EIJ A;  3BAT A;  3VN0 A;  1G2C A;  3L75 E;  4WY4 A;  1X9V A;  2UWJ E;  1NTZ E;  2QM7 A;  2FFD C;  3H32 A;  3CCE P;  3QH9 A;  2A06 D;  4PD4 I;  2PFX A;  5C39 A;  4KT0 J;  1KIL C;  2SPZ A;  5GTI E;  3H1I G;  3MIW A;  3OJA B;  2ITA A;  5CJ4 A;  1U7J A;  2Y0C A;  2CPB A;  3L75 D;  2RKL A;  4IL6 H;  1A02 J;  4I7Z C;  2B87 A;  1L0N J;  1NTZ D;  1T3U A;  2WSE J;  3FXE A;  3Q5R A;  1KB9 I;  1FZB A;  1EQ7 A;  2KK7 A;  1S3J A;  1H88 A;  2LKM A;  1H0T B;  2QIW A;  1BDD A;  1OVV A;  1VQO P;  3KHU A;  1KZU B;  3A0B H;  2ZYD A;  1U7M A;  1SQQ E;  3R4Y A;  4W7Y A;  3HE5 B;  4D6T D;  1X0T A;  4N3Y B;  5TIS E;  1YBK A;  2JDI H;  2KSE A;  3E1I A;  3I55 P;  3L74 G;  4H13 D;  2KLV A;  4KJM A;  3PRJ A;  2WSE H;  1CZQ A;  3AE7 C;  2IZ0 A;  1N7L A;  4ZMD A;  2K1A A;  1UII A;  2H43 A;  3C1L A;  4WBA A;  4WB4 A;  2E5Y A;  5AW3 B;  5AW9 B;  1GW3 A;  2FYU G;  3TDK A;  2QJP C;  3N7N A;  1RF1 B;  4H0L B;  1USE A;  2OYH B;  5KAF H;  1FZC C;  1VF5 D;  1T3J A;  3CWB G;  4C7N B;  2JKV A;  3LID A;  3D6Z A;  2P1J A;  3WMM 0;  1Y8A A;  1PGP A;  2OTL P;  1IFM A;  2QJK C;  3O8Z A;  3TGU D;  1N73 A;  1HF9 A;  3IAO A;  2YKO A;  1PGO A;  4IFF A;  2A06 G;  2R32 A;  3H25 A;  1FE6 A;  5B5E E;  5AW6 B;  4NPE A;  2Q6Q A;  3SWK A;  1JTH B;  2Q3E A;  2QRX A;  3CX5 H;  1PP9 J;  2C9N Y;  4BWN A;  3L75 G;  1VQ6 P;  2WZ7 A;  4H13 B;  1GTW A;  3SFE C;  1JY2 O;  1N8R Q;  1SQX D;  1NTZ G;  1IZN B;  1FOS F;  2ZT9 D;  2CK3 H;  5AVU B;  2RH0 A;  1SQV J;  1RF0 A;  1K8A Q;  5BVZ A;  1H89 A;  2Q9I A;  3JSV C;  2P10 A;  3MHV A;  1J1E B;  2XNX A;  5KLI B;  2WWW A;  4RES B;  2K9J B;  3G71 P;  3CCL P;  2JWD A;  2G8Y A;  4KHX A;  4D6T G;  3PH0 A;  3LW5 J;  5AW5 B;  2NPS D;  5AVZ B;  1YQ3 C;  3C8V A;  3H1I J;  4YXW H;  1NHL A;  1L0N D;  2FXP A;  3HTK B;  1S4X A;  5B66 H;  1FJP A;  1URQ A;  3L36 A;  2WT7 B;  1SQQ G;  1LTS C;  3VMX A;  3GG2 A;  3JCU H;  3B5N A;  1BGY E;  3G3Z A;  3MD0 A;  3LW5 H;  1GZL A;  5KJ7 C;  2ZT9 B;  1PPJ E;  2J59 M;  2ZAE B;  1S5L H;  3CX5 E;  2L5G B;  2WMM A;  2N1T D;  1RE4 A;  3N4X A;  4UB6 E;  3RL0 D;  1LT9 B;  1KTM A;  1YTZ I;  3L74 J;  1LTJ A;  1Y9B A;  1EDL A;  1YTZ T;  2YNY A;  4EOT A;  3U1C A;  1PPJ D;  3L70 E;  2NPS B;  4AQR D;  4HH2 A;  2ZYG A;  2OQQ A;  1RF1 C;  3CX5 D;  3CD6 P;  3MZW B;  4H0L C;  2FYU J;  1SQX G;  4K3A A;  3VMY A;  2OYH C;  1PZQ A;  3O6Q A;  2E75 D;  2YXR B;  1OX3 A;  3CXH I;  3VOP A;  3CWB J;  1L4A D;  1AVY A;  1VQ5 P;  3H1L D;  4RJT A;  3M0D A;  2E5T A;  4I1L A;  3T97 A;  2OYO A;  1JO5 A;  1OMI A;  3L70 D;  1NO4 A;  2XU6 A;  1HTL C;  3M9H A;  1PFI A;  2QEX P;  2NZ2 A;  3HUS A;  3TF5 A;  1PP9 D;  3U59 A;  1NTM K;  1SFC A;  3L71 E;  2IBZ E;  2N1T B;  2RN0 A;  1NWQ A;  2P58 A;  1LNQ A;  3AE1 C;  3MP7 B;  3RL0 B;  4H13 C;  1GMJ A;  1M1J A;  1EZV D;  4WY4 D;  1W2E A;  3L75 J;  3TNU A;  1KQS O;  1GK6 A;  4PD4 E;  3A3Y B;  3E7K A;  4GIF A;  1NTZ J;  1RY3 A;  3NMD A;  5E79 H;  5CBO A;  3L71 D;  1BCC E;  2IBZ D;  2M8R A;  2E75 B;  1VF5 C;  1J1E C;  5KLI C;  1VQL P;  2FY8 A;  2Z4E A;  3IFM A;  2C0X A;  1L4A B;  4H44 D;  2HPC B;  1HH0 A;  1S2E A;  4HJG H;  3PHL A;  4D6T J;  2N9B A;  5AW2 B;  1S9K E;  4EI2 A;  1DD3 A;  2H8P D;  1PIX A;  1ZV8 A;  3KYQ A;  1PPJ G;  2WTY A;  3R2P A;  1N7S A;  3JC2 2;  5GTI H;  1G2C B;  2BCC E;  1YYC A;  1VQN P;  1SQQ J;  5AW0 B;  5TJH A;  1CSB A;  2AEJ A;  4WY4 B;  1T6A A;  1IJD B;  3A5T A;  3RK3 E;  1S9K D;  2J5U A;  3H1L G;  2I8D A;  2ZT9 C;  4R4L A;  1JY2 N;  1MUU A;  1YI2 P;  1X79 B;  2LXB A;  1GU4 A;  1RQU A;  1RQV A;  3L70 G;  1OW6 A;  3L72 E;  2BCC D;  2KI7 B;  1LT9 C;  1N2D C;  4L74 A;  3EFG A;  2B87 B;  1R5S A;  3RK3 D;  2N9Y B;  3M91 A;  2H88 C;  2FYU D;  1JM0 A;  5TIS H;  1JUN A;  2NPS C;  2Q5U A;  3C9I A;  2M5A A; 
#chains in the Genus database with same CATH homology
 1NTZ J;  1NTM J;  1SQV J;  1KYO I;  3L71 J;  3CX5 I;  3L73 J;  2FYU J;  3L72 J;  1BGY J;  1BE3 J;  1P84 I;  1L0L J;  3L74 J;  5KLV J;  1SQX J;  1PP9 J;  4PD4 I;  4D6T J;  1SQB J;  3H1J J;  1L0N J;  3H1L J;  3BCC J;  1EZV I;  3CXH I;  3H1K J;  3TGU J;  3L75 J;  2BCC J;  1BCC J;  2IBZ I;  1SQQ J;  3CWB J;  1SQP J;  3H1H J;  4U3F J;  3H1I J;  3L70 J;  1KB9 I;  1NTK J;  1NU1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...