2Q1KA

Cyrstal structure of asce from aeromonas hydrophilla
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
PVFARELHAQLVQALGDVKRRLLRGGTQQQYQQWQQEADAIEAGMNIIEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AscE
publication title Structure of AscE and induced burial regions in AscE and AscG upon formation of the chaperone needle-subunit complex of type III secretion system in Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Chaperone
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2q1kA00
2LXBA 2P58A 2QVAA 2B87A 2B87B 2B89A 1S3JA 4K3AA 1DEEG 1FC2C 4BXLA 1EC5A 4K35A 4NPEA 1X0TA 2M5AA 3QWOC 1U7MA 2M5AB 2I8DA 2Q1KA 5CBNA 1BDCA 3FXDA 1OVVA 4NPDA 1EDLA 3RGUA 1H0TA 2UWJE 5C39A 4ZMDA 4ASWA 3FXEA 2KUBA 4ZNCA 2ZAEB 1EDKA 3MZWB 1JM0A 2KI7B 2KZJA 1U7JA 2KS1B 2JWDA 2HR3A 1MFTA 5DJTB 2RKLA 2R44A 2M0BA 4KJMA 4NPFX 2LR2A 3PH0A 4GODA 1ZXGA 4ASVA 1OVUA 5EFWB 1EDIA 3S1KA 1SS1A 5DJUB 4HKZH 1H0TB 4WWIA 1LP1A 1BDDA 4GOFA 5CBOA 1EDJA 4CPGA 5K5GB 2OTKE 2LXCB 4EYYQ 2KZIA 4HB1A 2B88A 2SPZA 2WMMA 4MN4C 2KIKA 1NVOA 3MHVA 1Q2NA 1LT1A 2QRXA 2K3RA 4GOEA 1LP1B 1OVRA 1Y47A 1ZW0A 4IOIH 3ZDMA 4HJGH 4JBZA 1JMBA
chains in the Genus database with same CATH superfamily
4U3FD 4WVZA 3G71P 1T3JA 2QJYB 1YQ3C 3H1HD 5APUA 1QVFO 3GG2A 2ZJSE 3B5NC 3TNUB 3B5ND 2ZVOB 3CCJP 3CX5H 2Y0EA 4ZNCA 4ZKUA 2H43A 2FKWB 1KV4A 1U7JA 2AEFA 2H8PD 3ITKA 2WVRA 4PD4I 1WT6A 2R44A 5APWA 4NPFX 3V2RA 1CI6A 3H1KJ 1KORA 5CCHA 2QJPC 5EFWB 1OXZA 1JMMA 3V2QA 1N7SB 1EZVG 2LXCB 3H1KE 1GZLA 2R32A 4HB1A 3NMDA 4W7YA 1M8OB 1IC2A 3KZIH 5CCGC 3PP5A 3OJAB 5CCGD 3KPEA 2M3EA 1G1IA 1SQQD 4OWFA 1ZW0A 3HE5B 4JF7A 3EFGA 1GD2E 3V4WA 2Q3IA 1GK4A 3JCUH 3HD7C 2ZT9C 4RJTA 2B87A 3HD7D 2ZT9D 2WZ7A 1SQBG 1L0NJ 4TLFA 3HE4A 2YMKA 4BXLA 5AVUB 1LTGC 1W2EA 3V5BA 2KXPB 3OW2O 1MKMA 1X0TA 4UB8H 4QMAA 3WUUA 2OGUA 3PJSK 4JPZB 2P7JA 1JCCA 2RMZA 4W80A 1NTKD 2WPQA 2YMYA 4LC1A 3Q1MA 1URQA 1OW6A 5AVXB 1OVVA 3AE2C 1NU1G 1L0NE 3HTKA 1H0TA 3L70D 3L35A 4IL6X 1BE3D 3CWBG 2WSCH 3WU2E 1LT9B 4U3FG 1JCDA 3GHGB 2RN0A 2KYVA 1KB9H 3H1HG 1GU4A 4YXDC 4AUWA 3C8VA 1JUNA 5L8RJ 2V4HA 2KZIA 5CMZA 1GL2C 1M7LA 2IZ0A 5AVTB 4GIFA 2N1TB 2YO2A 4WBAA 1PGPA 3M0DA 2NPSB 3NXSA 2H7HA 3G9RA 2IBZG 1LP1B 3L4FA 1JB0J 5AW5B 4W7ZA 3AE7C 5KLIC 2PP6A 3TNUA 1BCCJ 5B5EE 1R5LA 5E79H 3TGUJ 3BATA 1YJ9P 3CCUP 3H25A 3GF3A 3PTZA 1VL2A 4C7RA 3WUVA 3D71A 1RE3A 1SQXE 3MUDC 2BCCJ 1BCCE 2Q1KA 3OA7A 1SQVJ 3M0AA 4N6JA 3TGUE 2OYHA 1H89A 3PRJA 4RKUJ 1X79B 3VTPC 2PRRA 1N7SA 2XNXA 1NTZK 1SQQG 2BCCE 1XTGB 1S1CX 1SQVE 4L75A 2I1JA 3F5HA 3H1JD 3L72G 1YQ4C 2P67A 3W67A 3D6YA 2FXMA 2YIUC 4B86A 1JTHB 1HBWA 1YTZI 2ZYGA 1EDIA 2XNDH 1RF1A 2QJKB 1N86A 4PV1B 1KQLA 4I7ZC 2WSEH 1Q7YQ 1M1JB 1KD1Q 1EXJA 1S9KD 3TF5A 1FJPA 3HE5A 4O9BA 1J2JB 1AJYA 3CX5E 1OFCX 1OW7A 1OW8A 5APQA 2E74C 3CLQA 3L70G 3CCMP 2JKVA 2Z5HA 2WPSA 4GOEA 2FYZA 1E79H 1GMJA 2IYPA 3RK3B 1LTAC 4H44C 5CCHC 1VQPP 3AE3C 5CCHD 3L75E 1VQ4P 3L73D 4K3AA 4N3YB 1USDA 3VYIA 1L0LK 3PHLA 5AVRB 2I8DA 2L5GB 3CMEP 2HG5D 3KZIE 2A06E 2PGDA 1NTMK 3L71J 3GHGA 1JY3N 2E75B 4ASWA 1X22A 3FXEA 5CJ4A 3JSVC 2ZAEB 1G1JA 1SFCA 2C9LY 2I1KA 1LWUA 3JCUE 1NAFA 3H1KD 3L71E 1H8AA 2A45I 2N1TA 2FFDC 1LTBC 2NPSA 4UB8E 1BGYJ 2IPPA 3F89A 3LIDA 1DEBA 2FY8A 5TJHA 1LP1A 4GOFA 1VF5B 3VN0A 1RY3A 2FYUE 2WSCJ 2HODB 2BEQD 4CPGA 2Y9YA 2ZYDA 3FWNA 3BVHA 3U1CA 1SQXK 3H1LJ 1URQC 1FZGA 3P8MC 1URQD 3H1IJ 3RK2C 2K9YA 2OYIA 2K3RA 3RK2D 3WMM0 1IO4A 1PGQA 1IFDA 1QGKB 2WTYA 3H1JG 3QH9A 3GF7A 4JBZA 5AW4B 2R5BA 2W6JH 1JMBA 3H1LE 2E43A 1KILE 4IFDK 2R3CA 1KB9E 1L0ND 1HJBA 3CC4P 1S5LX 3NTNA 2ZXXA 1SQPE 3G4SP 1KYOH 2AXCA 1JTHA 3CI9A 2OTLP 1RF0C 2P1JA 3HUSA 2WSSH 3RGUA 4JYCA 1PZQA 3M0DC 3OAKA 2QJYC 1EDKA 1JM0A 3AE8C 4C7NA 5E79E 4H0LB 1RH5B 2W6BA 3T97B 3RK3E 1KQSO 3A0HH 1OX3A 3B71A 3SWYA 2YNYA 5AW7B 1M90Q 5AW2B 1AQTA 1GK6A 1JY2P 2WPVB 1VPCA 3M9HA 1LTJA 3CPWO 1Q90D 2PFXA 3SFEC 2OYHC 4YXWH 2WSEJ 4ZKPA 2SPZA 3RL0B 2QA4P 1Q2NA 5B5EH 1RHZB 3Q5PA 2IFMA 4EIJA 2QG4A 1FAVA 1T3UA 1NOHA 2O1KA 1N7SD 3H1KG 3TGUD 2D2CB 5B66H 1J1DC 1K05A 2KNCB 2O01H 2QVAA 3PLNA 3CC7P 1RF1C 1P84D 1LNQA 1N8RQ 2BEZF 5GTHH 2M5AB 1JOCA 1L4AB 3I55P 2K1AA 1T6AA 2Q5UA 1MZ9A 3CC2P 1CSBA 3H32A 2UWJE 5APYA 4ZMDA 2P2UA 1ZRTE 3IN6A 5CHXA 1KMIZ 1NH4A 2HODA 2KI7B 1KN7A 2JEEA 2E5TA 1KFMA 1DH3A 5TISH 3CX5D 1JO5A 4EOTA 3A2AA 4L76A 1A02F 1U57A 2WT7B 3IAOA 1L0NG 1FZEA 1TU3F 4HKZH 1NTKK 1JY2N 4WWIA 2IBZD 2K9JB 3AE1C 1VQMP 1Q81Q 2GUSA 4H13C 4H13D 2E76C 5APXA 1ZMEC 2E76D 2J59M 1YITP 1P84I 1SQPK 3KXDA 4Y99C 3CL3D 1NTZJ 2Q3EA 4BRYB 1SFCC 1LTTC 3BCCJ 1SFCD 1LWUC 3LW5H 1FZFA 2A06D 3SFDC 5KLVE 1IFIA 2B89A 1NTZE 2NPSD 1AVYA 3AEEC 3BCCE 3CX5I 2JDIH 2OYOA 1VDFA 3L71D 3L72D 3T97A 2NRGA 2XZRA 3FXDA 3LIEA 1DD4A 2IBZI 1EDLA 5APTA 5C39A 3CCRP 4D6TJ 3KYQA 3AEFC 2OYIC 1YYCA 2KZJA 3VP9A 1BCCG 2R3SA 3TGUG 3PH0A 1ZXGA 1BGYD 1H88A 2KLUA 4D6TE 5BU5A 1L0LJ 1JY3O 3VMXA 1PP9J 2B9BA 1KYOE 2IX7C 5APSA 2BCCG 2O1JA 1SLQA 3U59A 1NTMJ 1OMIA 1SQVG 3BRVB 1HH0A 4EYYQ 3H1LD 1CZQA 1KB9D 2KNCA 1KC8Q 2WITA 3H1ID 4OVNF 1L0LE 2WMMA 2HLOA 3HUSC 5KAFH 4I1LA 2G3AA 1PP9E 3GW6A 2MKVA 1K73Q 1NTME 5GTIH 4WY4A 3A0HE 1N73B 1VQLP 3P8CD 1Y47A 3I56P 1E5WA 4GKGA 3FWLA 2QJPB 3BRTB 1VQ8P 3AECC 2WPRA 2QE7H 2GM4A 2C9NY 3AE4C 4TT3H 1VQ7P 1DEEG 1FC2C 2FBWC 3Q5RA 1IFPA 1R5SA 3VP8A 1U7MA 2KSJA 1SQXJ 1LTJC 3RK3D 2WT7A 2FXOA 3L74J 3USSA 5AW3B 2K9JA 1NAYA 4N78D 1GDTA 5B66E 1IK9A 1KB9I 1NKNA 5DJTB 2A06G 2M0BA 4U7JA 1DIPA 3L74E 2ZT9B 1FS0E 5AW6B 3N7NA 5GTHE 1SQBE 3II6A 4YPCA 3E7KA 1BSHA 5KLVK 5CBOA 5K5GB 3P32A 1G2CB 3L71G 3RBXA 1KILB 3HRNA 3MGNA 1GW4A 3SSUA 1VQNP 1Q82Q 5AVYB 5TISE 2V7QH 3IR9A 1VF5D 3CD6P 1QLED 1W5CE 2W8ZA 2YKOA 3G3ZA 4LLHA 1BGYG 2AXTH 4DCKA 1J1EC 3L75J 4IL6E 1PGOA 4NPEA 2C0WA 2IZ1A 1K8AQ 2JJLA 1GL2B 3H1LG 1BDCA 1T2KC 5KTBA 3H1IG 1T2KD 1YJNP 5KJ7A 2FYNC 3M9QA 1NO4A 4DOJA 4AYCA 3V6IA 1S5LH 2A45H 5KLIB 2RKLA 1AFOA 2LR2A 1KZUB 1LT9A 1ZN5A 1VQOP 5AW1B 1ZOYC 3RL0g 5APVA 1OIPA 2HYNA 2N9BA 3V2PA 3AE6C 1N73A 2FYUJ 2Q7CA 1VQ5P 1N7LA 2KB7P 2DW3A 2PAJA 2CK3H 3A0BH 1YJWP 1NTZD 3M91A 1IK7A 3AEBC 1LT1A 2JP3A 1JY2O 3BCCD 2K88A 1OWAA 2LKMA 1ZR2A 1HWTC 1KQFB 4EDFA 1NTKJ 3RL0C 4I7ZB 3RL0D 4GT1A 4JYBA 3EFFK 2FXPA 1SQBK 2O01N 5KAFE 1SQPJ 4GDOA 1BE3J 3MIWA 1DD3A 3SWKA 1NTKE 2E74B 2D2CD 5GTIE 3GMAA 2KUBA 3L70E 1KYOD 1A02J 2M3BA 1IZNB 5AW8B 1UIXA 1NU1K 2YKQA 1BE3E 4WY4C 1G2CA 4OGQB 4JQ0D 4WY4D 4KJMA 1KILA 1CI6B 4H44B 1YHQP 3CCSP 2OQQA 1PP9D 1M57D 3S9OA 2ITAA 2HPCB 1M1JA 1PIXA 3EWKA 3MP7B 1PPJE 4IFMA 5M1BA 1HJ0A 5AVVB 1PL5A 1M1KQ 2J5UA 1OVRA 1QX8A 1S2EA 1RE3C 2XU6A 2N9YB 1GL2A 1EQ7A 3BASA 1FDIA 2FFDB 2AEJA 1KYOI 2V7QJ 1IFMA 2B87B 3VOPA 1AV1A 2XV5A 4AQRD 1KTMA 2JWAA 3CXHH 2POHA 3HE4B 4HYTB 2NZ2A 3D6ZA 1SQXD 2R5DA 2W90A 3QWOC 1N7SC 1BCCD 1N2DC 3U1AA 5CBNA 2QM8A 1NTZG 1PV3A 3RK2B 3HTKB 1MUUA 2QM7A 4RO0A 3BCCG 3A5TA 3MUDA 2BCCD 2JWDA 2AXTE 1MFTA 1SQVD 1ZLLA 1USEA 3H1JE 5BU8B 2KK7A 1SQQK 1HVVA 1GU5A 2GUVA 2Y9ZA 4PD4H 4M3LA 1AVOA 2KLVA 5KAIH 1FZCB 1P84H 3ABVC 1W2BO 3O6QB 4D6TG 2YKPA 5KJ7C 1S5LE 5KJ7D 1ZR4A 3RBZA 3L73J 2AEMA 1LTSC 4L73A 1GW3A 3IF4A 4IL6H 4Z1MH 2IFNA 1LT9C 1L0LG 1IJDB 5KLVJ 3L75D 1PP9G 3GHGC 1GTWA 3L73E 2WSFH 2MJZA 1NTMG 5KKZB 1RQUA 3G6EP 2IYOA 3A0BE 1N73C 1UIIA 2OYHB 4NPDA 2N1TC 2XKMA 2N1TD 2NPSC 2HPCA 2KS1B 3B8EB 3S4RA 1Q86Q 1JNMA 1J1DB 3V4QA 4KHXA 1X9VA 3I5CA 3S1KA 1RF1B 2FYUD 2W83C 1SQXG 2OTKE 1WMKA 2Z5IA 3E1RA 3L74G 2FFDA 2B88A 1IFNA 3K5BA 4MN4C 3MHVA 2L91A 3N4XA 1T8ZA 1FDOA 1MFZA 2QEXP 1L2PA 3B5NB 3GLMA 4PJ0H 4HJGH 1Z56A 1CW5A 1KILC 3V2NA 1KILD 1FBMA 4DZOA 3JC22 2QJKC 2Q6QA 4PV1C 3VMAA 4PV1D 3CMAP 5H2FH 1M1JC 4K35A 5AW9B 4H13B 1SQPD 2M5AA 1L4AA 2E76B 3P7KA 3M9BA 1FZAA 1YTZT 1HUCA 4Y99B 3AEGC 2E42A 3KQGA 3TK1A 3WUTA 1SFCB 3MZWB 1PPJD 1FZCA 1RQVA 1LWUB 2KP8A 5BVZA 2JO1A 3O6QA 1EZVE 1FDMA 1RF0A 2O01J 4XA4A 3RK3C 3CXHE 1GL2D 3TYYA 4ASVA 4I6MC 1SS1A 3L75G 3VMZA 1HF9A 1K9MQ 1BSNA 1SQBJ 2VRSA 3EQ2A 1EXIA 4IFFA 2ZVNB 1VQ9P 1VQKP 2ZYAA 3A3YB 1K04A 1QEXA 1YI2P 3HD7B 3VMYA 2ZFCA 2QRXA 2E75C 1RE4A 3SWFA 3C1LA 4Y28J 2OYIB 1NU1J 2E75D 4BRYA 2XDJA 1DX7A 2YO3A 3CCQP 1IFJA 1QL1A 4I2LC 4A7PA 2Q9IA 3CWBJ 4HH2A 2O3JA 2LXBA 4PD4E 4KT0J 1KQGB 5KAIE 4UB6H 1NU1E 1P84E 4U3FJ 5AVQB 2HFED 2JR8A 1VF5C 2FYUG 3KDPB 1JY3P 2KS1A 3H1HJ 3CWBE 2KOGA 3TDKA 1S4XA 3HUSB 4U3FE 2WSFJ 5AVZB 1NHLA 1NGMB 1LJ2A 1ZRTD 3LW5J 5AVSB 3H1HE 4C7NB 2HR3A 2KSEA 4R4MA 1NTKG 1KFNA 3TSIA 4XFJA 2E74D 3AE5C 3CCLP 2IBZE 2ZXEB 3E1IA 1L0NK 4RESB 1SP4A 1SQPG 1BE3G 3B5NA 4OGQC 1LTJB 1NWQA 1AA0A 4OGQD 1ZV8A 3CCVP 4H44D 1QVGO 2CPBA 2KIKA 1NVOA 3M06A 1PPJG 2GA1A 4OH8B 1PFIA 3A7OA 4H0LC 4H0LD 1SQQJ 4IOIH 3ZDMA 1LTIC 3L72J 3IFMA 5KLVD 3FGAD 3L37A 5AVWB 1S3JA 2QIWA 4L74A 1YIJP 1SQQE 2H89C 2Y0DA 4BWNA 1LGHB 3L72E 1QL2A 1ZP0C 2YIUB 3H32B 3FX0A 1NKZB 5CCGA 1YBKA 1OZHA 4PJ0E 4R4LA 3L70J 2G8YA 2E5YA 3Q2YA 1MV8A 2J58A 1FOSE 3L36A 3HD7A 2YXQB 5H2FE 2D2CC 1OVUA 1BGYE 1D7MA 4LGDE 4D6TD 1J1EB 5DJUB 3MD0A 3AEAC 1BDDA 3AEDC 3Q3DA 3O8ZA 1L4AC 3B4SA 1L4AD 3H1IE 1L0LD 5AW0B 1SQVK 2CPSA 2M8RA 4XE5B 2FYNB 2RH0A 1S72P 4YTPC 1NTMD 2H88C 1FZCC 1Y8AA 3NFQA 2C0XA 3P8CE 1M56D 3C9IA 2YXRB 2W6AA 1NJIQ 2P58A 2QSIA 3CCEP 3WU2H 2A45G 1EC5A 2Y0CA 1EZVD 4DT0A 3W68A 3CXHD 3L73G 3R4YA 4DJGA 1RE4C 4N78E 3UIAA 1SVFA 5KKZC 4EI2A 1Y9BA 2P10A 3Q5SA 2IDBA 4UB6E 3L74D 3H1JJ 5KLVG 2Z4EA 4GODA 1URQB 2WQYC 1X8YA 1XTCC 1SQBD 1H0TB 1FJKA 1FE6A 2OARA 1HGZA 3D70A 2K37A 1FOSF 1EDJA 5CJ0A 1FZBA 2W27A 1AQ5A 1PGJA 2OTJP 3AE9C 1FU1A 1WRGA 1JEKA 1R8EA 3R2PA 2BASA 4WB4A 4PD4D 1NU1D 3MTUE 3H6PA 1EZVI 3CXHI 4WY4B 1S9KE 3CWBD 1HGVA 2WWWA 2FYUK 1VQ6P 4C46A 1NYHA 3KHUA 1HTLC
chains in the Genus database with same CATH topology
2LXBA 2P58A 2QVAA 2B87A 2B87B 2B89A 1S3JA 4K3AA 1DEEG 1FC2C 4BXLA 1EC5A 4K35A 4NPEA 1X0TA 2M5AA 3QWOC 1U7MA 2M5AB 2I8DA 2Q1KA 5CBNA 1BDCA 3FXDA 1OVVA 4NPDA 1EDLA 3RGUA 1H0TA 2UWJE 5C39A 4ZMDA 4ASWA 3FXEA 2KUBA 4ZNCA 2ZAEB 1EDKA 3MZWB 1JM0A 2KI7B 2KZJA 1U7JA 2KS1B 2JWDA 2HR3A 1MFTA 5DJTB 2RKLA 2R44A 2M0BA 4KJMA 4NPFX 2LR2A 3PH0A 4GODA 1ZXGA 4ASVA 1OVUA 5EFWB 1EDIA 3S1KA 1SS1A 5DJUB 4HKZH 1H0TB 4WWIA 1LP1A 1BDDA 4GOFA 5CBOA 1EDJA 4CPGA 5K5GB 2OTKE 2LXCB 4EYYQ 2KZIA 4HB1A 2B88A 2SPZA 2WMMA 4MN4C 2KIKA 1NVOA 3MHVA 1Q2NA 1LT1A 2QRXA 2K3RA 4GOEA 1LP1B 1OVRA 1Y47A 1ZW0A 4IOIH 3ZDMA 4HJGH 4JBZA 1JMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXB A;  2P58 A;  2QVA A;  2B87 A;  2B87 B;  2B89 A;  1S3J A;  4K3A A;  1DEE G;  1FC2 C;  4BXL A;  1EC5 A;  4K35 A;  4NPE A;  1X0T A;  2M5A A;  3QWO C;  1U7M A;  2M5A B;  2I8D A;  2Q1K A;  5CBN A;  1BDC A;  3FXD A;  1OVV A;  4NPD A;  1EDL A;  3RGU A;  1H0T A;  2UWJ E;  5C39 A;  4ZMD A;  4ASW A;  3FXE A;  2KUB A;  4ZNC A;  2ZAE B;  1EDK A;  3MZW B;  1JM0 A;  2KI7 B;  2KZJ A;  1U7J A;  2KS1 B;  2JWD A;  2HR3 A;  1MFT A;  5DJT B;  2RKL A;  2R44 A;  2M0B A;  4KJM A;  4NPF X;  2LR2 A;  3PH0 A;  4GOD A;  1ZXG A;  4ASV A;  1OVU A;  5EFW B;  1EDI A;  3S1K A;  1SS1 A;  5DJU B;  4HKZ H;  1H0T B;  4WWI A;  1LP1 A;  1BDD A;  4GOF A;  5CBO A;  1EDJ A;  4CPG A;  5K5G B;  2OTK E;  2LXC B;  4EYY Q;  2KZI A;  4HB1 A;  2B88 A;  2SPZ A;  2WMM A;  4MN4 C;  2KIK A;  1NVO A;  3MHV A;  1Q2N A;  1LT1 A;  2QRX A;  2K3R A;  4GOE A;  1LP1 B;  1OVR A;  1Y47 A;  1ZW0 A;  4IOI H;  3ZDM A;  4HJG H;  4JBZ A;  1JMB A; 
#chains in the Genus database with same CATH topology
 4U3F D;  4WVZ A;  3G71 P;  1T3J A;  2QJY B;  1YQ3 C;  3H1H D;  5APU A;  1QVF O;  3GG2 A;  2ZJS E;  3B5N C;  3TNU B;  3B5N D;  2ZVO B;  3CCJ P;  3CX5 H;  2Y0E A;  4ZNC A;  4ZKU A;  2H43 A;  2FKW B;  1KV4 A;  1U7J A;  2AEF A;  2H8P D;  3ITK A;  2WVR A;  4PD4 I;  1WT6 A;  2R44 A;  5APW A;  4NPF X;  3V2R A;  1CI6 A;  3H1K J;  1KOR A;  5CCH A;  2QJP C;  5EFW B;  1OXZ A;  1JMM A;  3V2Q A;  1N7S B;  1EZV G;  2LXC B;  3H1K E;  1GZL A;  2R32 A;  4HB1 A;  3NMD A;  4W7Y A;  1M8O B;  1IC2 A;  3KZI H;  5CCG C;  3PP5 A;  3OJA B;  5CCG D;  3KPE A;  2M3E A;  1G1I A;  1SQQ D;  4OWF A;  1ZW0 A;  3HE5 B;  4JF7 A;  3EFG A;  1GD2 E;  3V4W A;  2Q3I A;  1GK4 A;  3JCU H;  3HD7 C;  2ZT9 C;  4RJT A;  2B87 A;  3HD7 D;  2ZT9 D;  2WZ7 A;  1SQB G;  1L0N J;  4TLF A;  3HE4 A;  2YMK A;  4BXL A;  5AVU B;  1LTG C;  1W2E A;  3V5B A;  2KXP B;  3OW2 O;  1MKM A;  1X0T A;  4UB8 H;  4QMA A;  3WUU A;  2OGU A;  3PJS K;  4JPZ B;  2P7J A;  1JCC A;  2RMZ A;  4W80 A;  1NTK D;  2WPQ A;  2YMY A;  4LC1 A;  3Q1M A;  1URQ A;  1OW6 A;  5AVX B;  1OVV A;  3AE2 C;  1NU1 G;  1L0N E;  3HTK A;  1H0T A;  3L70 D;  3L35 A;  4IL6 X;  1BE3 D;  3CWB G;  2WSC H;  3WU2 E;  1LT9 B;  4U3F G;  1JCD A;  3GHG B;  2RN0 A;  2KYV A;  1KB9 H;  3H1H G;  1GU4 A;  4YXD C;  4AUW A;  3C8V A;  1JUN A;  5L8R J;  2V4H A;  2KZI A;  5CMZ A;  1GL2 C;  1M7L A;  2IZ0 A;  5AVT B;  4GIF A;  2N1T B;  2YO2 A;  4WBA A;  1PGP A;  3M0D A;  2NPS B;  3NXS A;  2H7H A;  3G9R A;  2IBZ G;  1LP1 B;  3L4F A;  1JB0 J;  5AW5 B;  4W7Z A;  3AE7 C;  5KLI C;  2PP6 A;  3TNU A;  1BCC J;  5B5E E;  1R5L A;  5E79 H;  3TGU J;  3BAT A;  1YJ9 P;  3CCU P;  3H25 A;  3GF3 A;  3PTZ A;  1VL2 A;  4C7R A;  3WUV A;  3D71 A;  1RE3 A;  1SQX E;  3MUD C;  2BCC J;  1BCC E;  2Q1K A;  3OA7 A;  1SQV J;  3M0A A;  4N6J A;  3TGU E;  2OYH A;  1H89 A;  3PRJ A;  4RKU J;  1X79 B;  3VTP C;  2PRR A;  1N7S A;  2XNX A;  1NTZ K;  1SQQ G;  2BCC E;  1XTG B;  1S1C X;  1SQV E;  4L75 A;  2I1J A;  3F5H A;  3H1J D;  3L72 G;  1YQ4 C;  2P67 A;  3W67 A;  3D6Y A;  2FXM A;  2YIU C;  4B86 A;  1JTH B;  1HBW A;  1YTZ I;  2ZYG A;  1EDI A;  2XND H;  1RF1 A;  2QJK B;  1N86 A;  4PV1 B;  1KQL A;  4I7Z C;  2WSE H;  1Q7Y Q;  1M1J B;  1KD1 Q;  1EXJ A;  1S9K D;  3TF5 A;  1FJP A;  3HE5 A;  4O9B A;  1J2J B;  1AJY A;  3CX5 E;  1OFC X;  1OW7 A;  1OW8 A;  5APQ A;  2E74 C;  3CLQ A;  3L70 G;  3CCM P;  2JKV A;  2Z5H A;  2WPS A;  4GOE A;  2FYZ A;  1E79 H;  1GMJ A;  2IYP A;  3RK3 B;  1LTA C;  4H44 C;  5CCH C;  1VQP P;  3AE3 C;  5CCH D;  3L75 E;  1VQ4 P;  3L73 D;  4K3A A;  4N3Y B;  1USD A;  3VYI A;  1L0L K;  3PHL A;  5AVR B;  2I8D A;  2L5G B;  3CME P;  2HG5 D;  3KZI E;  2A06 E;  2PGD A;  1NTM K;  3L71 J;  3GHG A;  1JY3 N;  2E75 B;  4ASW A;  1X22 A;  3FXE A;  5CJ4 A;  3JSV C;  2ZAE B;  1G1J A;  1SFC A;  2C9L Y;  2I1K A;  1LWU A;  3JCU E;  1NAF A;  3H1K D;  3L71 E;  1H8A A;  2A45 I;  2N1T A;  2FFD C;  1LTB C;  2NPS A;  4UB8 E;  1BGY J;  2IPP A;  3F89 A;  3LID A;  1DEB A;  2FY8 A;  5TJH A;  1LP1 A;  4GOF A;  1VF5 B;  3VN0 A;  1RY3 A;  2FYU E;  2WSC J;  2HOD B;  2BEQ D;  4CPG A;  2Y9Y A;  2ZYD A;  3FWN A;  3BVH A;  3U1C A;  1SQX K;  3H1L J;  1URQ C;  1FZG A;  3P8M C;  1URQ D;  3H1I J;  3RK2 C;  2K9Y A;  2OYI A;  2K3R A;  3RK2 D;  3WMM 0;  1IO4 A;  1PGQ A;  1IFD A;  1QGK B;  2WTY A;  3H1J G;  3QH9 A;  3GF7 A;  4JBZ A;  5AW4 B;  2R5B A;  2W6J H;  1JMB A;  3H1L E;  2E43 A;  1KIL E;  4IFD K;  2R3C A;  1KB9 E;  1L0N D;  1HJB A;  3CC4 P;  1S5L X;  3NTN A;  2ZXX A;  1SQP E;  3G4S P;  1KYO H;  2AXC A;  1JTH A;  3CI9 A;  2OTL P;  1RF0 C;  2P1J A;  3HUS A;  2WSS H;  3RGU A;  4JYC A;  1PZQ A;  3M0D C;  3OAK A;  2QJY C;  1EDK A;  1JM0 A;  3AE8 C;  4C7N A;  5E79 E;  4H0L B;  1RH5 B;  2W6B A;  3T97 B;  3RK3 E;  1KQS O;  3A0H H;  1OX3 A;  3B71 A;  3SWY A;  2YNY A;  5AW7 B;  1M90 Q;  5AW2 B;  1AQT A;  1GK6 A;  1JY2 P;  2WPV B;  1VPC A;  3M9H A;  1LTJ A;  3CPW O;  1Q90 D;  2PFX A;  3SFE C;  2OYH C;  4YXW H;  2WSE J;  4ZKP A;  2SPZ A;  3RL0 B;  2QA4 P;  1Q2N A;  5B5E H;  1RHZ B;  3Q5P A;  2IFM A;  4EIJ A;  2QG4 A;  1FAV A;  1T3U A;  1NOH A;  2O1K A;  1N7S D;  3H1K G;  3TGU D;  2D2C B;  5B66 H;  1J1D C;  1K05 A;  2KNC B;  2O01 H;  2QVA A;  3PLN A;  3CC7 P;  1RF1 C;  1P84 D;  1LNQ A;  1N8R Q;  2BEZ F;  5GTH H;  2M5A B;  1JOC A;  1L4A B;  3I55 P;  2K1A A;  1T6A A;  2Q5U A;  1MZ9 A;  3CC2 P;  1CSB A;  3H32 A;  2UWJ E;  5APY A;  4ZMD A;  2P2U A;  1ZRT E;  3IN6 A;  5CHX A;  1KMI Z;  1NH4 A;  2HOD A;  2KI7 B;  1KN7 A;  2JEE A;  2E5T A;  1KFM A;  1DH3 A;  5TIS H;  3CX5 D;  1JO5 A;  4EOT A;  3A2A A;  4L76 A;  1A02 F;  1U57 A;  2WT7 B;  3IAO A;  1L0N G;  1FZE A;  1TU3 F;  4HKZ H;  1NTK K;  1JY2 N;  4WWI A;  2IBZ D;  2K9J B;  3AE1 C;  1VQM P;  1Q81 Q;  2GUS A;  4H13 C;  4H13 D;  2E76 C;  5APX A;  1ZME C;  2E76 D;  2J59 M;  1YIT P;  1P84 I;  1SQP K;  3KXD A;  4Y99 C;  3CL3 D;  1NTZ J;  2Q3E A;  4BRY B;  1SFC C;  1LTT C;  3BCC J;  1SFC D;  1LWU C;  3LW5 H;  1FZF A;  2A06 D;  3SFD C;  5KLV E;  1IFI A;  2B89 A;  1NTZ E;  2NPS D;  1AVY A;  3AEE C;  3BCC E;  3CX5 I;  2JDI H;  2OYO A;  1VDF A;  3L71 D;  3L72 D;  3T97 A;  2NRG A;  2XZR A;  3FXD A;  3LIE A;  1DD4 A;  2IBZ I;  1EDL A;  5APT A;  5C39 A;  3CCR P;  4D6T J;  3KYQ A;  3AEF C;  2OYI C;  1YYC A;  2KZJ A;  3VP9 A;  1BCC G;  2R3S A;  3TGU G;  3PH0 A;  1ZXG A;  1BGY D;  1H88 A;  2KLU A;  4D6T E;  5BU5 A;  1L0L J;  1JY3 O;  3VMX A;  1PP9 J;  2B9B A;  1KYO E;  2IX7 C;  5APS A;  2BCC G;  2O1J A;  1SLQ A;  3U59 A;  1NTM J;  1OMI A;  1SQV G;  3BRV B;  1HH0 A;  4EYY Q;  3H1L D;  1CZQ A;  1KB9 D;  2KNC A;  1KC8 Q;  2WIT A;  3H1I D;  4OVN F;  1L0L E;  2WMM A;  2HLO A;  3HUS C;  5KAF H;  4I1L A;  2G3A A;  1PP9 E;  3GW6 A;  2MKV A;  1K73 Q;  1NTM E;  5GTI H;  4WY4 A;  3A0H E;  1N73 B;  1VQL P;  3P8C D;  1Y47 A;  3I56 P;  1E5W A;  4GKG A;  3FWL A;  2QJP B;  3BRT B;  1VQ8 P;  3AEC C;  2WPR A;  2QE7 H;  2GM4 A;  2C9N Y;  3AE4 C;  4TT3 H;  1VQ7 P;  1DEE G;  1FC2 C;  2FBW C;  3Q5R A;  1IFP A;  1R5S A;  3VP8 A;  1U7M A;  2KSJ A;  1SQX J;  1LTJ C;  3RK3 D;  2WT7 A;  2FXO A;  3L74 J;  3USS A;  5AW3 B;  2K9J A;  1NAY A;  4N78 D;  1GDT A;  5B66 E;  1IK9 A;  1KB9 I;  1NKN A;  5DJT B;  2A06 G;  2M0B A;  4U7J A;  1DIP A;  3L74 E;  2ZT9 B;  1FS0 E;  5AW6 B;  3N7N A;  5GTH E;  1SQB E;  3II6 A;  4YPC A;  3E7K A;  1BSH A;  5KLV K;  5CBO A;  5K5G B;  3P32 A;  1G2C B;  3L71 G;  3RBX A;  1KIL B;  3HRN A;  3MGN A;  1GW4 A;  3SSU A;  1VQN P;  1Q82 Q;  5AVY B;  5TIS E;  2V7Q H;  3IR9 A;  1VF5 D;  3CD6 P;  1QLE D;  1W5C E;  2W8Z A;  2YKO A;  3G3Z A;  4LLH A;  1BGY G;  2AXT H;  4DCK A;  1J1E C;  3L75 J;  4IL6 E;  1PGO A;  4NPE A;  2C0W A;  2IZ1 A;  1K8A Q;  2JJL A;  1GL2 B;  3H1L G;  1BDC A;  1T2K C;  5KTB A;  3H1I G;  1T2K D;  1YJN P;  5KJ7 A;  2FYN C;  3M9Q A;  1NO4 A;  4DOJ A;  4AYC A;  3V6I A;  1S5L H;  2A45 H;  5KLI B;  2RKL A;  1AFO A;  2LR2 A;  1KZU B;  1LT9 A;  1ZN5 A;  1VQO P;  5AW1 B;  1ZOY C;  3RL0 g;  5APV A;  1OIP A;  2HYN A;  2N9B A;  3V2P A;  3AE6 C;  1N73 A;  2FYU J;  2Q7C A;  1VQ5 P;  1N7L A;  2KB7 P;  2DW3 A;  2PAJ A;  2CK3 H;  3A0B H;  1YJW P;  1NTZ D;  3M91 A;  1IK7 A;  3AEB C;  1LT1 A;  2JP3 A;  1JY2 O;  3BCC D;  2K88 A;  1OWA A;  2LKM A;  1ZR2 A;  1HWT C;  1KQF B;  4EDF A;  1NTK J;  3RL0 C;  4I7Z B;  3RL0 D;  4GT1 A;  4JYB A;  3EFF K;  2FXP A;  1SQB K;  2O01 N;  5KAF E;  1SQP J;  4GDO A;  1BE3 J;  3MIW A;  1DD3 A;  3SWK A;  1NTK E;  2E74 B;  2D2C D;  5GTI E;  3GMA A;  2KUB A;  3L70 E;  1KYO D;  1A02 J;  2M3B A;  1IZN B;  5AW8 B;  1UIX A;  1NU1 K;  2YKQ A;  1BE3 E;  4WY4 C;  1G2C A;  4OGQ B;  4JQ0 D;  4WY4 D;  4KJM A;  1KIL A;  1CI6 B;  4H44 B;  1YHQ P;  3CCS P;  2OQQ A;  1PP9 D;  1M57 D;  3S9O A;  2ITA A;  2HPC B;  1M1J A;  1PIX A;  3EWK A;  3MP7 B;  1PPJ E;  4IFM A;  5M1B A;  1HJ0 A;  5AVV B;  1PL5 A;  1M1K Q;  2J5U A;  1OVR A;  1QX8 A;  1S2E A;  1RE3 C;  2XU6 A;  2N9Y B;  1GL2 A;  1EQ7 A;  3BAS A;  1FDI A;  2FFD B;  2AEJ A;  1KYO I;  2V7Q J;  1IFM A;  2B87 B;  3VOP A;  1AV1 A;  2XV5 A;  4AQR D;  1KTM A;  2JWA A;  3CXH H;  2POH A;  3HE4 B;  4HYT B;  2NZ2 A;  3D6Z A;  1SQX D;  2R5D A;  2W90 A;  3QWO C;  1N7S C;  1BCC D;  1N2D C;  3U1A A;  5CBN A;  2QM8 A;  1NTZ G;  1PV3 A;  3RK2 B;  3HTK B;  1MUU A;  2QM7 A;  4RO0 A;  3BCC G;  3A5T A;  3MUD A;  2BCC D;  2JWD A;  2AXT E;  1MFT A;  1SQV D;  1ZLL A;  1USE A;  3H1J E;  5BU8 B;  2KK7 A;  1SQQ K;  1HVV A;  1GU5 A;  2GUV A;  2Y9Z A;  4PD4 H;  4M3L A;  1AVO A;  2KLV A;  5KAI H;  1FZC B;  1P84 H;  3ABV C;  1W2B O;  3O6Q B;  4D6T G;  2YKP A;  5KJ7 C;  1S5L E;  5KJ7 D;  1ZR4 A;  3RBZ A;  3L73 J;  2AEM A;  1LTS C;  4L73 A;  1GW3 A;  3IF4 A;  4IL6 H;  4Z1M H;  2IFN A;  1LT9 C;  1L0L G;  1IJD B;  5KLV J;  3L75 D;  1PP9 G;  3GHG C;  1GTW A;  3L73 E;  2WSF H;  2MJZ A;  1NTM G;  5KKZ B;  1RQU A;  3G6E P;  2IYO A;  3A0B E;  1N73 C;  1UII A;  2OYH B;  4NPD A;  2N1T C;  2XKM A;  2N1T D;  2NPS C;  2HPC A;  2KS1 B;  3B8E B;  3S4R A;  1Q86 Q;  1JNM A;  1J1D B;  3V4Q A;  4KHX A;  1X9V A;  3I5C A;  3S1K A;  1RF1 B;  2FYU D;  2W83 C;  1SQX G;  2OTK E;  1WMK A;  2Z5I A;  3E1R A;  3L74 G;  2FFD A;  2B88 A;  1IFN A;  3K5B A;  4MN4 C;  3MHV A;  2L91 A;  3N4X A;  1T8Z A;  1FDO A;  1MFZ A;  2QEX P;  1L2P A;  3B5N B;  3GLM A;  4PJ0 H;  4HJG H;  1Z56 A;  1CW5 A;  1KIL C;  3V2N A;  1KIL D;  1FBM A;  4DZO A;  3JC2 2;  2QJK C;  2Q6Q A;  4PV1 C;  3VMA A;  4PV1 D;  3CMA P;  5H2F H;  1M1J C;  4K35 A;  5AW9 B;  4H13 B;  1SQP D;  2M5A A;  1L4A A;  2E76 B;  3P7K A;  3M9B A;  1FZA A;  1YTZ T;  1HUC A;  4Y99 B;  3AEG C;  2E42 A;  3KQG A;  3TK1 A;  3WUT A;  1SFC B;  3MZW B;  1PPJ D;  1FZC A;  1RQV A;  1LWU B;  2KP8 A;  5BVZ A;  2JO1 A;  3O6Q A;  1EZV E;  1FDM A;  1RF0 A;  2O01 J;  4XA4 A;  3RK3 C;  3CXH E;  1GL2 D;  3TYY A;  4ASV A;  4I6M C;  1SS1 A;  3L75 G;  3VMZ A;  1HF9 A;  1K9M Q;  1BSN A;  1SQB J;  2VRS A;  3EQ2 A;  1EXI A;  4IFF A;  2ZVN B;  1VQ9 P;  1VQK P;  2ZYA A;  3A3Y B;  1K04 A;  1QEX A;  1YI2 P;  3HD7 B;  3VMY A;  2ZFC A;  2QRX A;  2E75 C;  1RE4 A;  3SWF A;  3C1L A;  4Y28 J;  2OYI B;  1NU1 J;  2E75 D;  4BRY A;  2XDJ A;  1DX7 A;  2YO3 A;  3CCQ P;  1IFJ A;  1QL1 A;  4I2L C;  4A7P A;  2Q9I A;  3CWB J;  4HH2 A;  2O3J A;  2LXB A;  4PD4 E;  4KT0 J;  1KQG B;  5KAI E;  4UB6 H;  1NU1 E;  1P84 E;  4U3F J;  5AVQ B;  2HFE D;  2JR8 A;  1VF5 C;  2FYU G;  3KDP B;  1JY3 P;  2KS1 A;  3H1H J;  3CWB E;  2KOG A;  3TDK A;  1S4X A;  3HUS B;  4U3F E;  2WSF J;  5AVZ B;  1NHL A;  1NGM B;  1LJ2 A;  1ZRT D;  3LW5 J;  5AVS B;  3H1H E;  4C7N B;  2HR3 A;  2KSE A;  4R4M A;  1NTK G;  1KFN A;  3TSI A;  4XFJ A;  2E74 D;  3AE5 C;  3CCL P;  2IBZ E;  2ZXE B;  3E1I A;  1L0N K;  4RES B;  1SP4 A;  1SQP G;  1BE3 G;  3B5N A;  4OGQ C;  1LTJ B;  1NWQ A;  1AA0 A;  4OGQ D;  1ZV8 A;  3CCV P;  4H44 D;  1QVG O;  2CPB A;  2KIK A;  1NVO A;  3M06 A;  1PPJ G;  2GA1 A;  4OH8 B;  1PFI A;  3A7O A;  4H0L C;  4H0L D;  1SQQ J;  4IOI H;  3ZDM A;  1LTI C;  3L72 J;  3IFM A;  5KLV D;  3FGA D;  3L37 A;  5AVW B;  1S3J A;  2QIW A;  4L74 A;  1YIJ P;  1SQQ E;  2H89 C;  2Y0D A;  4BWN A;  1LGH B;  3L72 E;  1QL2 A;  1ZP0 C;  2YIU B;  3H32 B;  3FX0 A;  1NKZ B;  5CCG A;  1YBK A;  1OZH A;  4PJ0 E;  4R4L A;  3L70 J;  2G8Y A;  2E5Y A;  3Q2Y A;  1MV8 A;  2J58 A;  1FOS E;  3L36 A;  3HD7 A;  2YXQ B;  5H2F E;  2D2C C;  1OVU A;  1BGY E;  1D7M A;  4LGD E;  4D6T D;  1J1E B;  5DJU B;  3MD0 A;  3AEA C;  1BDD A;  3AED C;  3Q3D A;  3O8Z A;  1L4A C;  3B4S A;  1L4A D;  3H1I E;  1L0L D;  5AW0 B;  1SQV K;  2CPS A;  2M8R A;  4XE5 B;  2FYN B;  2RH0 A;  1S72 P;  4YTP C;  1NTM D;  2H88 C;  1FZC C;  1Y8A A;  3NFQ A;  2C0X A;  3P8C E;  1M56 D;  3C9I A;  2YXR B;  2W6A A;  1NJI Q;  2P58 A;  2QSI A;  3CCE P;  3WU2 H;  2A45 G;  1EC5 A;  2Y0C A;  1EZV D;  4DT0 A;  3W68 A;  3CXH D;  3L73 G;  3R4Y A;  4DJG A;  1RE4 C;  4N78 E;  3UIA A;  1SVF A;  5KKZ C;  4EI2 A;  1Y9B A;  2P10 A;  3Q5S A;  2IDB A;  4UB6 E;  3L74 D;  3H1J J;  5KLV G;  2Z4E A;  4GOD A;  1URQ B;  2WQY C;  1X8Y A;  1XTC C;  1SQB D;  1H0T B;  1FJK A;  1FE6 A;  2OAR A;  1HGZ A;  3D70 A;  2K37 A;  1FOS F;  1EDJ A;  5CJ0 A;  1FZB A;  2W27 A;  1AQ5 A;  1PGJ A;  2OTJ P;  3AE9 C;  1FU1 A;  1WRG A;  1JEK A;  1R8E A;  3R2P A;  2BAS A;  4WB4 A;  4PD4 D;  1NU1 D;  3MTU E;  3H6P A;  1EZV I;  3CXH I;  4WY4 B;  1S9K E;  3CWB D;  1HGV A;  2WWW A;  2FYU K;  1VQ6 P;  4C46 A;  1NYH A;  3KHU A;  1HTL C; 
#chains in the Genus database with same CATH homology
 2LXB A;  2P58 A;  2QVA A;  2B87 A;  2B87 B;  2B89 A;  1S3J A;  4K3A A;  1DEE G;  1FC2 C;  4BXL A;  1EC5 A;  4K35 A;  4NPE A;  1X0T A;  2M5A A;  3QWO C;  1U7M A;  2M5A B;  2I8D A;  2Q1K A;  5CBN A;  1BDC A;  3FXD A;  1OVV A;  4NPD A;  1EDL A;  3RGU A;  1H0T A;  2UWJ E;  5C39 A;  4ZMD A;  4ASW A;  3FXE A;  2KUB A;  4ZNC A;  2ZAE B;  1EDK A;  3MZW B;  1JM0 A;  2KI7 B;  2KZJ A;  1U7J A;  2KS1 B;  2JWD A;  2HR3 A;  1MFT A;  5DJT B;  2RKL A;  2R44 A;  2M0B A;  4KJM A;  4NPF X;  2LR2 A;  3PH0 A;  4GOD A;  1ZXG A;  4ASV A;  1OVU A;  5EFW B;  1EDI A;  3S1K A;  1SS1 A;  5DJU B;  4HKZ H;  1H0T B;  4WWI A;  1LP1 A;  1BDD A;  4GOF A;  5CBO A;  1EDJ A;  4CPG A;  5K5G B;  2OTK E;  2LXC B;  4EYY Q;  2KZI A;  4HB1 A;  2B88 A;  2SPZ A;  2WMM A;  4MN4 C;  2KIK A;  1NVO A;  3MHV A;  1Q2N A;  1LT1 A;  2QRX A;  2K3R A;  4GOE A;  1LP1 B;  1OVR A;  1Y47 A;  1ZW0 A;  4IOI H;  3ZDM A;  4HJG H;  4JBZ A;  1JMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...