2Q1KA

Cyrstal structure of asce from aeromonas hydrophilla
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
PVFARELHAQLVQALGDVKRRLLRGGTQQQYQQWQQEADAIEAGMNIIEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords AscE
publication title Structure of AscE and induced burial regions in AscE and AscG upon formation of the chaperone needle-subunit complex of type III secretion system in Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2q1kA00
5DJTB 1OVRA 2KI7B 2K3RA 4ASVA 4ZNCA 2P58A 3MHVA 3MZWB 2OTKE 4K3AA 1Q2NA 1BDCA 2UWJE 2B87B 1EDLA 2B87A 4NPFX 3FXDA 2KUBA 3ZDMA 1S3JA 4JBZA 2QVAA 1U7JA 4NPDA 2QRXA 2LXCB 4GOEA 3QWOC 4HJGH 2B88A 3FXEA 3RGUA 1EDJA 1MFTA 2WMMA 2ZAEB 4CPGA 5CBOA 4MN4C 2KS1B 5DJUB 4EYYQ 4BXLA 4IOIH 5K5GB 4GOFA 4HB1A 5C39A 4KJMA 4ASWA 1LT1A 2R44A 2M5AB 1NVOA 4NPEA 2M5AA 2LXBA 2JWDA 1X0TA 5CBNA 1JMBA 1EDIA 1EDKA 1H0TB 1ZXGA 1OVUA 2KIKA 2SPZA 1ZW0A 1DEEG 1Y47A 1U7MA 1H0TA 2Q1KA 1EC5A 2KZIA 1BDDA 4GODA 2LR2A 2I8DA 2KZJA 1LP1B 4WWIA 2B89A 5EFWB 1FC2C 4ZMDA 4HKZH 1LP1A 2RKLA 3PH0A 2M0BA 1JM0A 1OVVA 2HR3A 3S1KA 1SS1A 4K35A
chains in the Genus database with same CATH superfamily
3B5NC 1SFCC 2KLUA 3TNUB 1NHLA 3E1RA 5GTIE 2J5UA 2UWJE 2ZYDA 2O01N 1IFJA 2Q6QA 3RK3C 1KYOE 1SQXD 4R4MA 3V2PA 1ZRTE 5CJ0A 2QVAA 1GK4A 3LW5H 3H1LE 1LT9B 1QVFO 2E75D 1GL2B 1GMJA 1L4AC 2K88A 1QEXA 2BCCJ 3HD7A 1HVVA 1RHZB 5BVZA 5CHXA 1OW6A 3VYIA 2JWAA 3RBXA 1URQC 4PV1D 3M0AA 1DX7A 3HUSC 4O9BA 3Q5RA 4DCKA 1FZBA 1JY2N 2LKMA 3AE2C 4BRYA 4EDFA 1T8ZA 3U1AA 1EC5A 4YXDC 3A3YB 1AFOA 2I8DA 1BSNA 3USSA 2WITA 1L0LG 1RF1C 1SQXJ 2M0BA 2CPBA 2OYHA 4RO0A 1FZEA 4N3YB 4C7RA 3CX5H 2ZT9D 2N9BA 1ZV8A 3G6EP 4TT3H 3VP9A 1M7LA 3L70E 1N2DC 3L74E 4H13D 1PPJE 3WMM0 2K3RA 4Y99B 2E75B 3MZWB 2FFDC 3WUVA 3RK3D 1R5LA 3F89A 5BU5A 4PV1B 1HTLC 2AXCA 1OX3A 3H1LJ 1SQVK 2HFED 1JY2P 2DW3A 3L74D 2K1AA 2V7QH 5AW9B 1EDJA 1PPJD 2O1KA 2GM4A 3V2NA 1FDIA 3EFGA 3GHGB 1JNMA 3HRNA 3GG2A 1T2KC 1L2PA 5AW6B 1URQD 1VQKP 1N7SB 2IYOA 2FBWC 3D6ZA 3RK2D 4JQ0D 5E79H 1ZW0A 5APVA 4I2LC 1KMIZ 1NTZE 3CCJP 3BCCD 3PLNA 4H13B 3M0DC 3SWKA 1LWUC 1FC2C 3MUDA 4N78E 3CCVP 2A06D 1FU1A 2C9NY 1LTJB 1KN7A 3HE4B 1W2BO 3AEEC 1NAYA 3L72E 2PGDA 2K9JA 1VPCA 3L70J 3L74J 3WUUA 2AEFA 3H1ID 3ITKA 3V6IA 2KI7B 1NU1K 2YMKA 2P58A 3MHVA 2KYVA 1L0NG 1JEKA 3M91A 1M1JB 5KLVG 1VF5C 4N78D 4UB8E 4PJ0H 1A02J 3TSIA 3IF4A 2FXMA 4WY4A 4HH2A 3L72D 1X79B 3C9IA 1M57D 2Y0DA 3RK2B 3EFFK 5AW0B 4CPGA 3BRTB 5CBOA 1PFIA 1BE3E 4H44D 4AYCA 1H8AA 4GOFA 3GMAA 4XFJA 1DH3A 3S4RA 1USDA 1S4XA 1FBMA 1FJPA 3BVHA 1T2KD 1OFCX 4YXWH 2ZVNB 4ZKPA 1YTZT 4DT0A 5KKZC 2K9YA 1BGYD 1JB0J 3E7KA 3O6QA 2W83C 1Y47A 1U7MA 3H1IJ 1H0TA 1FZCC 1MKMA 2NPSA 5AVRB 3L71D 2AXTH 3CXHI 1BE3D 3L35A 5CCHA 2OYOA 4BRYB 1USEA 2FFDB 3JSVC 3A0HH 1SQPK 3L72J 4U7JA 3JCUE 2Z5HA 3G3ZA 2A45G 3CC4P 1RE3C 1BCCE 3PTZA 1FDMA 1W5CE 1SQQE 4ASVA 2PRRA 3TNUA 2WTYA 4M3LA 2KOGA 2ZXEB 4H44B 3BCCG 3L4FA 4NPFX 2C0XA 5AW4B 1Q86Q 1VF5D 3L75D 2WQYC 1RE4A 1BGYJ 1GTWA 2QRXA 4GOEA 3P8CD 3H1KE 1LT9A 1G2CB 1ZOYC 3L71J 2ZAEB 2A06G 1GL2A 1BE3J 1GZLA 1SQQD 2BASA 1NYHA 3CCMP 1AQ5A 4EOTA 4YTPC 1WT6A 3RL0B 3OAKA 1RQUA 3H1IG 1ZR2A 1LWUB 1YBKA 4IFFA 1EDKA 2M3EA 1IFIA 2Q1KA 3H1KD 2KZIA 1KQFB 2Q7CA 2FYNC 3HE5B 2IYPA 4HKZH 1JOCA 3CCSP 4IFMA 1SQBD 1ZMEC 1SS1A 3OW2O 3TGUG 4K35A 5KAFE 1KZUB 5AW3B 1PZQA 2I1JA 1DD4A 3CXHH 1VQ8P 1SQQJ 2OTKE 1Q2NA 2W6BA 1GU4A 1BGYG 3L36A 3Q3DA 5CCGC 1L0LE 3L71G 1M1KQ 1CZQA 3KDPB 3EQ2A 1N73C 1YQ4C 2E5YA 3H1KJ 3A2AA 1OMIA 3BASA 1KV4A 3N7NA 1PGQA 2ZFCA 4XE5B 4HB1A 2R44A 2H8PD 2M5AB 3FWNA 1KORA 4WB4A 1DEBA 3VMAA 1D7MA 3GHGA 5CBNA 3CD6P 3KXDA 1L0LD 1TU3F 2IBZI 4U3FD 1YJNP 1MFZA 1J1DC 4WVZA 3A5TA 1FE6A 1SP4A 1UIXA 5KAIE 3NTNA 3K5BA 3L75G 3D6YA 3CX5E 1IK9A 4OGQC 4DZOA 2HR3A 2QE7H 1KQGB 1LTJA 3HE4A 2QJKB 1RH5B 2H43A 1KB9I 1S1CX 2WSFH 1SQPD 1E5WA 4OVNF 1NGMB 4A7PA 3LW5J 2BEZF 3A7OA 1GW3A 1M1JA 2QG4A 1L0LJ 2G8YA 5CCGD 2YIUC 4JBZA 5H2FH 3O8ZA 5AVTB 3G71P 1VQ9P 5AVQB 4U3FJ 1QLED 1URQA 1P84I 3MP7B 3HUSA 4LLHA 1NTZK 1AJYA 1CI6A 1DD3A 4C46A 1SQBG 2QM7A 4IL6X 2E76D 1IFMA 1KD1Q 2FYNB 1QGKB 1YJ9P 3NFQA 1L0NE 2J59M 5E79E 1EZVI 1S5LX 2WSEJ 2KSEA 1KILE 5KLVE 2YKQA 3AE5C 1P84D 2YO2A 2YNYA 3SSUA 3FGAD 1IJDB 1NU1G 2E74C 1KYOI 1FZFA 5L8RJ 3M9QA 1BSHA 5KJ7D 1AV1A 2R3SA 3Q5SA 3C1LA 4OGQD 1FOSE 2R5BA 1GDTA 1L0ND 3M9BA 3H1HD 2OYIC 1S5LH 1NTKD 2PP6A 3AEDC 1KILD 5KLVD 2FFDA 1E79H 1PP9D 3P8MC 4EIJA 1NTMD 1PGJA 1M8OB 2OTJP 3RK3E 4PJ0E 1JY2O 1Y9BA 5KLIC 4U3FG 5AVXB 1PIXA 3AE3C 2E76B 4I6MC 2KUBA 4B86A 2R3CA 1NOHA 1KB9H 4KT0J 2V7QJ 2KLVA 4HJGH 3B5ND 1SFCD 3C8VA 2YKPA 1JCCA 3HD7C 2ZJSE 4ZKUA 1G2CA 2OQQA 1J1DB 3VMYA 1L0NJ 4L75A 2H7HA 3B71A 3M0DA 1SQPG 3W68A 5KLVJ 3BCCE 4LGDE 2FYUD 1P84H 1LWUA 4UB6E 2AXTE 1OVUA 2FY8A 3KZIH 2G3AA 1L4AD 1KILB 1G1JA 1PP9J 3CMEP 1NKZB 1LTSC 3P7KA 1H89A 1OW7A 2KZJA 3I5CA 2A06E 3HE5A 2QSIA 3KYQA 3AE1C 2PFXA 3L73E 2FXOA 3A0HE 2GUVA 1VL2A 2ZT9B 4GT1A 3H1IE 3F5HA 1KYOH 2YIUB 1QL1A 2N1TC 3BATA 3B5NB 1SFCB 2W8ZA 3E1IA 2O1JA 2B87B 1YITP 1HGVA 1T6AA 2POHA 3L73D 3RK3B 3TYYA 1Q90D 2FYUJ 4KHXA 1OZHA 2ZVOB 2WZ7A 1GW4A 3TGUE 3W67A 2IZ1A 3H1HG 1L4AB 1HJBA 1FDOA 1NTKG 1ZLLA 1A02F 4D6TG 1NVOA 4GIFA 3MD0A 1J1EC 2LXBA 1LTIC 1BGYE 2M5AA 1PP9G 1URQB 1NTMG 3HUSB 3BCCJ 1CI6B 3I55P 3L71E 1ZXGA 1WRGA 2OYIB 2D2CC 3TGUD 1NO4A 2W6AA 2LR2A 2O01H 2Q3IA 3MUDC 4PD4I 1IFNA 2KB7P 4N6JA 4JF7A 3PH0A 2Q9IA 1RF1B 3L73J 3CCLP 2JO1A 1VQPP 1VQLP 2QJYC 3CXHE 3SWFA 3IN6A 1IC2A 2WT7B 1XTGB 2N1TD 1FZAA 3VMZA 4PD4D 3V2RA 1HH0A 5AW1B 2FYUG 1NAFA 2L5GB 1S9KD 2V4HA 1Q81Q 3L75E 3T97A 1LTBC 1HUCA 1EDLA 5AVZB 3MIWA 3P8CE 4WY4C 3GF7A 4OH8B 3KPEA 2P1JA 3CXHD 1G1IA 5B66H 2WSSH 1NKNA 1RF0C 3TGUJ 2WMMA 4L74A 4W7ZA 5K5GB 1JY3N 3V4WA 5APQA 1HJ0A 2I1KA 1EDIA 3H32B 2HODA 2JEEA 2NPSC 2KIKA 3AE9C 1VQMP 2Y0EA 1SQVD 1VQNP 3L73G 5GTHE 3FX0A 3CCUP 1ZR4A 3RL0g 1FJKA 2XV5A 4RJTA 3CCRP 3CCEP 2W90A 2WSCH 1SQXK 3KHUA 5EFWB 2HPCB 5B5EH 5TISH 1SQBE 1OW8A 4I7ZC 1KQLA 3D70A 2HLOA 3NMDA 1LGHB 1N86A 2CPSA 1RQVA 3U1CA 3CMAP 5CCGA 3TF5A 4L76A 2QM8A 2M3BA 4PD4H 4ZNCA 1NU1E 2FKWB 3V2QA 1PGPA 3A0BE 2KP8A 3L75J 5H2FE 4I1LA 1JY3P 1RE4C 1W2EA 3II6A 1VF5B 2KXPB 1DIPA 3SFDC 4NPDA 1J1EB 3GW6A 2OARA 3AEBC 1VQ5P 2RN0A 1LNQA 4YPCA 1MFTA 4MN4C 3VOPA 3Q1MA 1NU1D 1WMKA 5M1BA 5KJ7A 4U3FE 3EWKA 2B9BA 3H25A 2IX7C 5KKZB 2P10A 1IFDA 1S72P 1KILA 1FZCB 3Q5PA 1T3UA 3MGNA 1T3JA 3AEFC 2WVRA 2R32A 1SQBJ 2W27A 2Y0CA 2NZ2A 2Q5UA 3PJSK 3U59A 2WSFJ 1SQPE 5AVWB 1OVRA 3LIDA 4Y99C 1Q7YQ 1HWTC 3IFMA 1CSBA 2QA4P 3B5NA 1SFCA 1OIPA 2P7JA 1NU1J 2PAJA 1K8AQ 1JUNA 4GKGA 2E42A 1LTGC 2IBZD 2B87A 1SQVG 3CWBG 3PRJA 3H6PA 2ZYGA 4PV1C 4TLFA 3IAOA 3VP8A 2M8RA 3AE4C 1YI2P 3HTKB 3AE6C 3T97B 3CI9A 4EYYQ 4IOIH 1L4AA 1IZNB 3GHGC 1LT1A 2AEJA 2IDBA 2BCCD 3IR9A 4NPEA 3CL3D 3CC7P 1P84E 1N7SC 2OTLP 1KB9D 2QJPC 4AUWA 1LTAC 2SPZA 2Q3EA 4H0LC 3GF3A 2OYIA 1BDDA 4H13C 4GODA 5KAFH 3H1HE 2B89A 1NTKE 5AVUB 2MJZA 4D6TE 2HODB 3OA7A 4WBAA 1JM0A 1LTJC 1RF1A 3TDKA 1PGOA 3S1KA 2GA1A 3V5BA 1PP9E 1NTME 1JO5A 1SVFA 2GUSA 1SQPJ 4IL6H 1N7LA 2WT7A 1IO4A 3M9HA 1EZVD 5APTA 3PHLA 1BDCA 1M1JC 3B4SA 3H1JG 3BRVB 1KQSO 1AVOA 2C0WA 1Q82Q 5KTBA 1UIIA 4D6TD 2XKMA 1FZGA 1OXZA 2H89C 1KYOD 2LXCB 2RMZA 5AVSB 1ZRTD 3RK2C 2IZ0A 1N73B 4C7NB 3RGUA 3H1LD 1PV3A 3I56P 2WSEH 3MTUE 4BWNA 4W7YA 3WU2H 1J2JB 2FYUE 2R5DA 1HF9A 1X0TA 4JPZB 1N7SD 5KAIH 2XNDH 3GLMA 4LC1A 4QMAA 3H32A 1LTTC 1DEEG 3OJAB 5CMZA 3CPWO 2IBZG 5AW5B 4H0LD 2IFNA 1K73Q 1OWAA 1AQTA 1LP1B 3H1HJ 1SLQA 1N8RQ 4OGQB 1NTKJ 2YXQB 5APWA 2N1TA 2RKLA 2YMYA 1NWQA 4D6TJ 2HPCA 1EQ7A 2E43A 3UIAA 2A45I 2ITAA 2J58A 1NTMJ 1X8YA 2BCCG 2E74D 1SQQK 2N9YB 1FOSF 2OYHC 3VTPC 2XNXA 3L70D 4H44C 5GTIH 2KK7A 1CW5A 1KTMA 2KS1A 3AEGC 5B66E 3ZDMA 3SWYA 5APUA 2P67A 2B88A 2QJPB 4DJGA 3PP5A 3R2PA 4H0LB 2K37A 1K05A 1SQXG 1PL5A 4IFDK 3RL0C 2O3JA 3R4YA 3L37A 1K9MQ 2JWDA 1SQBK 1RY3A 2HYNA 1MZ9A 3Q2YA 4EI2A 1EZVG 4R4LA 3HD7D 2O01J 2KNCB 4Y28J 3VN0A 2JP3A 2KSJA 5B5EE 1YHQP 2E74B 5TISE 2YO3A 1FZCA 1NTZD 1YJWP 2YKOA 1AVYA 1MUUA 3B8EB 3FWLA 4L73A 3H1LG 3NXSA 4PD4E 2XU6A 2W6JH 2CK3H 1S9KE 1VQ4P 1RE3A 5AW8B 1S2EA 4K3AA 2WPQA 1JTHA 1RF0A 3AE7C 2ZXXA 5KLIB 1L0LK 5APYA 4JYCA 1K04A 3FXDA 2A45H 4RESB 1NH4A 2VRSA 3QWOC 2OGUA 4AQRD 2P2UA 3AEAC 3FXEA 3HD7B 1VQ7P 3HTKA 3G9RA 1NTZJ 2RH0A 1FS0E 1H88A 4UB6H 4KJMA 3G4SP 1IFPA 3RL0D 5AW7B 1GU5A 5AW2B 1JMBA 1SQVE 3L70G 3L74G 3CWBE 1PPJG 2IFMA 1R5SA 2WPVB 5AVYB 4GDOA 1VQOP 3JC22 2WSCJ 2YXRB 2QEXP 1IK7A 1HGZA 4OWFA 2OYHB 5CJ4A 1YTZI 2H88C 2Y9YA 1EXIA 1OVVA 4JYBA 1KFMA 2WWWA 1JMMA 2QJKC 1KC8Q 2D2CD 3CWBD 1JY3O 5CCHC 3V4QA 2BEQD 5DJTB 2HG5D 2C9LY 2N1TB 1BCCD 2AEMA 3ABVC 4HYTB 2IPPA 3P32A 1YIJP 1S3JA 1GK6A 1NTZG 4UB8H 5APXA 3S9OA 1U57A 1VQ6P 1N73A 4C7NA 1X9VA 2KS1B 1ZP0C 5DJUB 1VDFA 4BXLA 2XZRA 3CC2P 5C39A 1L0NK 4WY4D 1NTKK 4XA4A 1LT9C 3L72G 3H1JE 5KLVK 2WPSA 1GL2C 1SQVJ 3CWBJ 1QVGO 1NTMK 2JR8A 2D2CB 2FXPA 2Z5IA 1BCCJ 2E5TA 3WUTA 1NJIQ 2WPRA 2JKVA 5APSA 1X22A 1KFNA 3N4XA 1YYCA 1LP1A 3CLQA 3VMXA 3H1JD 2NPSD 2K9JB 2QIWA 3M06A 2QJYB 4Z1MH 1HBWA 4IL6E 1BE3G 5TJHA 5CCHD 3JCUH 2JDIH 2NRGA 3CCQP 2JJLA 1S5LE 2IBZE 3D71A 3LIEA 1M90Q 1R8EA 2E76C 1Y8AA 2FYUK 4WY4B 2Y9ZA 1U7JA 2FYZA 3TK1A 3AECC 3SFEC 2E75C 1N7SA 2ZYAA 1LJ2A 1XTCC 1JTHB 2L91A 1JCDA 3WU2E 2BCCE 2Z4EA 3AE8C 4ASWA 2XDJA 1KB9E 4W80A 5KJ7C 3QH9A 5BU8B 1M56D 5AVVB 1GD2E 4DOJA 5GTHH 1EXJA 3H1JJ 1QX8A 1BCCG 1ZN5A 3CX5I 3O6QB 1GL2D 1H0TB 1MV8A 1KILC 1SQQG 2NPSB 3RBZA 2MKVA 4RKUJ 1Z56A 2KNCA 1AA0A 1YQ3C 4WWIA 4ZMDA 3KZIE 1SQXE 1FAVA 3CX5D 4I7ZB 3KQGA 2ZT9C 3H1KG 3A0BH 1QL2A 1EZVE
chains in the Genus database with same CATH topology
5DJTB 1OVRA 2KI7B 2K3RA 4ASVA 4ZNCA 2P58A 3MHVA 3MZWB 2OTKE 4K3AA 1Q2NA 1BDCA 2UWJE 2B87B 1EDLA 2B87A 4NPFX 3FXDA 2KUBA 3ZDMA 1S3JA 4JBZA 2QVAA 1U7JA 4NPDA 2QRXA 2LXCB 4GOEA 3QWOC 4HJGH 2B88A 3FXEA 3RGUA 1EDJA 1MFTA 2WMMA 2ZAEB 4CPGA 5CBOA 4MN4C 2KS1B 5DJUB 4EYYQ 4BXLA 4IOIH 5K5GB 4GOFA 4HB1A 5C39A 4KJMA 4ASWA 1LT1A 2R44A 2M5AB 1NVOA 4NPEA 2M5AA 2LXBA 2JWDA 1X0TA 5CBNA 1JMBA 1EDIA 1EDKA 1H0TB 1ZXGA 1OVUA 2KIKA 2SPZA 1ZW0A 1DEEG 1Y47A 1U7MA 1H0TA 2Q1KA 1EC5A 2KZIA 1BDDA 4GODA 2LR2A 2I8DA 2KZJA 1LP1B 4WWIA 2B89A 5EFWB 1FC2C 4ZMDA 4HKZH 1LP1A 2RKLA 3PH0A 2M0BA 1JM0A 1OVVA 2HR3A 3S1KA 1SS1A 4K35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJT B;  1OVR A;  2KI7 B;  2K3R A;  4ASV A;  4ZNC A;  2P58 A;  3MHV A;  3MZW B;  2OTK E;  4K3A A;  1Q2N A;  1BDC A;  2UWJ E;  2B87 B;  1EDL A;  2B87 A;  4NPF X;  3FXD A;  2KUB A;  3ZDM A;  1S3J A;  4JBZ A;  2QVA A;  1U7J A;  4NPD A;  2QRX A;  2LXC B;  4GOE A;  3QWO C;  4HJG H;  2B88 A;  3FXE A;  3RGU A;  1EDJ A;  1MFT A;  2WMM A;  2ZAE B;  4CPG A;  5CBO A;  4MN4 C;  2KS1 B;  5DJU B;  4EYY Q;  4BXL A;  4IOI H;  5K5G B;  4GOF A;  4HB1 A;  5C39 A;  4KJM A;  4ASW A;  1LT1 A;  2R44 A;  2M5A B;  1NVO A;  4NPE A;  2M5A A;  2LXB A;  2JWD A;  1X0T A;  5CBN A;  1JMB A;  1EDI A;  1EDK A;  1H0T B;  1ZXG A;  1OVU A;  2KIK A;  2SPZ A;  1ZW0 A;  1DEE G;  1Y47 A;  1U7M A;  1H0T A;  2Q1K A;  1EC5 A;  2KZI A;  1BDD A;  4GOD A;  2LR2 A;  2I8D A;  2KZJ A;  1LP1 B;  4WWI A;  2B89 A;  5EFW B;  1FC2 C;  4ZMD A;  4HKZ H;  1LP1 A;  2RKL A;  3PH0 A;  2M0B A;  1JM0 A;  1OVV A;  2HR3 A;  3S1K A;  1SS1 A;  4K35 A; 
#chains in the Genus database with same CATH topology
 3B5N C;  1SFC C;  2KLU A;  3TNU B;  1NHL A;  3E1R A;  5GTI E;  2J5U A;  2UWJ E;  2ZYD A;  2O01 N;  1IFJ A;  2Q6Q A;  3RK3 C;  1KYO E;  1SQX D;  4R4M A;  3V2P A;  1ZRT E;  5CJ0 A;  2QVA A;  1GK4 A;  3LW5 H;  3H1L E;  1LT9 B;  1QVF O;  2E75 D;  1GL2 B;  1GMJ A;  1L4A C;  2K88 A;  1QEX A;  2BCC J;  3HD7 A;  1HVV A;  1RHZ B;  5BVZ A;  5CHX A;  1OW6 A;  3VYI A;  2JWA A;  3RBX A;  1URQ C;  4PV1 D;  3M0A A;  1DX7 A;  3HUS C;  4O9B A;  3Q5R A;  4DCK A;  1FZB A;  1JY2 N;  2LKM A;  3AE2 C;  4BRY A;  4EDF A;  1T8Z A;  3U1A A;  1EC5 A;  4YXD C;  3A3Y B;  1AFO A;  2I8D A;  1BSN A;  3USS A;  2WIT A;  1L0L G;  1RF1 C;  1SQX J;  2M0B A;  2CPB A;  2OYH A;  4RO0 A;  1FZE A;  4N3Y B;  4C7R A;  3CX5 H;  2ZT9 D;  2N9B A;  1ZV8 A;  3G6E P;  4TT3 H;  3VP9 A;  1M7L A;  3L70 E;  1N2D C;  3L74 E;  4H13 D;  1PPJ E;  3WMM 0;  2K3R A;  4Y99 B;  2E75 B;  3MZW B;  2FFD C;  3WUV A;  3RK3 D;  1R5L A;  3F89 A;  5BU5 A;  4PV1 B;  1HTL C;  2AXC A;  1OX3 A;  3H1L J;  1SQV K;  2HFE D;  1JY2 P;  2DW3 A;  3L74 D;  2K1A A;  2V7Q H;  5AW9 B;  1EDJ A;  1PPJ D;  2O1K A;  2GM4 A;  3V2N A;  1FDI A;  3EFG A;  3GHG B;  1JNM A;  3HRN A;  3GG2 A;  1T2K C;  1L2P A;  5AW6 B;  1URQ D;  1VQK P;  1N7S B;  2IYO A;  2FBW C;  3D6Z A;  3RK2 D;  4JQ0 D;  5E79 H;  1ZW0 A;  5APV A;  4I2L C;  1KMI Z;  1NTZ E;  3CCJ P;  3BCC D;  3PLN A;  4H13 B;  3M0D C;  3SWK A;  1LWU C;  1FC2 C;  3MUD A;  4N78 E;  3CCV P;  2A06 D;  1FU1 A;  2C9N Y;  1LTJ B;  1KN7 A;  3HE4 B;  1W2B O;  3AEE C;  1NAY A;  3L72 E;  2PGD A;  2K9J A;  1VPC A;  3L70 J;  3L74 J;  3WUU A;  2AEF A;  3H1I D;  3ITK A;  3V6I A;  2KI7 B;  1NU1 K;  2YMK A;  2P58 A;  3MHV A;  2KYV A;  1L0N G;  1JEK A;  3M91 A;  1M1J B;  5KLV G;  1VF5 C;  4N78 D;  4UB8 E;  4PJ0 H;  1A02 J;  3TSI A;  3IF4 A;  2FXM A;  4WY4 A;  4HH2 A;  3L72 D;  1X79 B;  3C9I A;  1M57 D;  2Y0D A;  3RK2 B;  3EFF K;  5AW0 B;  4CPG A;  3BRT B;  5CBO A;  1PFI A;  1BE3 E;  4H44 D;  4AYC A;  1H8A A;  4GOF A;  3GMA A;  4XFJ A;  1DH3 A;  3S4R A;  1USD A;  1S4X A;  1FBM A;  1FJP A;  3BVH A;  1T2K D;  1OFC X;  4YXW H;  2ZVN B;  4ZKP A;  1YTZ T;  4DT0 A;  5KKZ C;  2K9Y A;  1BGY D;  1JB0 J;  3E7K A;  3O6Q A;  2W83 C;  1Y47 A;  1U7M A;  3H1I J;  1H0T A;  1FZC C;  1MKM A;  2NPS A;  5AVR B;  3L71 D;  2AXT H;  3CXH I;  1BE3 D;  3L35 A;  5CCH A;  2OYO A;  4BRY B;  1USE A;  2FFD B;  3JSV C;  3A0H H;  1SQP K;  3L72 J;  4U7J A;  3JCU E;  2Z5H A;  3G3Z A;  2A45 G;  3CC4 P;  1RE3 C;  1BCC E;  3PTZ A;  1FDM A;  1W5C E;  1SQQ E;  4ASV A;  2PRR A;  3TNU A;  2WTY A;  4M3L A;  2KOG A;  2ZXE B;  4H44 B;  3BCC G;  3L4F A;  4NPF X;  2C0X A;  5AW4 B;  1Q86 Q;  1VF5 D;  3L75 D;  2WQY C;  1RE4 A;  1BGY J;  1GTW A;  2QRX A;  4GOE A;  3P8C D;  3H1K E;  1LT9 A;  1G2C B;  1ZOY C;  3L71 J;  2ZAE B;  2A06 G;  1GL2 A;  1BE3 J;  1GZL A;  1SQQ D;  2BAS A;  1NYH A;  3CCM P;  1AQ5 A;  4EOT A;  4YTP C;  1WT6 A;  3RL0 B;  3OAK A;  1RQU A;  3H1I G;  1ZR2 A;  1LWU B;  1YBK A;  4IFF A;  1EDK A;  2M3E A;  1IFI A;  2Q1K A;  3H1K D;  2KZI A;  1KQF B;  2Q7C A;  2FYN C;  3HE5 B;  2IYP A;  4HKZ H;  1JOC A;  3CCS P;  4IFM A;  1SQB D;  1ZME C;  1SS1 A;  3OW2 O;  3TGU G;  4K35 A;  5KAF E;  1KZU B;  5AW3 B;  1PZQ A;  2I1J A;  1DD4 A;  3CXH H;  1VQ8 P;  1SQQ J;  2OTK E;  1Q2N A;  2W6B A;  1GU4 A;  1BGY G;  3L36 A;  3Q3D A;  5CCG C;  1L0L E;  3L71 G;  1M1K Q;  1CZQ A;  3KDP B;  3EQ2 A;  1N73 C;  1YQ4 C;  2E5Y A;  3H1K J;  3A2A A;  1OMI A;  3BAS A;  1KV4 A;  3N7N A;  1PGQ A;  2ZFC A;  4XE5 B;  4HB1 A;  2R44 A;  2H8P D;  2M5A B;  3FWN A;  1KOR A;  4WB4 A;  1DEB A;  3VMA A;  1D7M A;  3GHG A;  5CBN A;  3CD6 P;  3KXD A;  1L0L D;  1TU3 F;  2IBZ I;  4U3F D;  1YJN P;  1MFZ A;  1J1D C;  4WVZ A;  3A5T A;  1FE6 A;  1SP4 A;  1UIX A;  5KAI E;  3NTN A;  3K5B A;  3L75 G;  3D6Y A;  3CX5 E;  1IK9 A;  4OGQ C;  4DZO A;  2HR3 A;  2QE7 H;  1KQG B;  1LTJ A;  3HE4 A;  2QJK B;  1RH5 B;  2H43 A;  1KB9 I;  1S1C X;  2WSF H;  1SQP D;  1E5W A;  4OVN F;  1NGM B;  4A7P A;  3LW5 J;  2BEZ F;  3A7O A;  1GW3 A;  1M1J A;  2QG4 A;  1L0L J;  2G8Y A;  5CCG D;  2YIU C;  4JBZ A;  5H2F H;  3O8Z A;  5AVT B;  3G71 P;  1VQ9 P;  5AVQ B;  4U3F J;  1QLE D;  1URQ A;  1P84 I;  3MP7 B;  3HUS A;  4LLH A;  1NTZ K;  1AJY A;  1CI6 A;  1DD3 A;  4C46 A;  1SQB G;  2QM7 A;  4IL6 X;  2E76 D;  1IFM A;  1KD1 Q;  2FYN B;  1QGK B;  1YJ9 P;  3NFQ A;  1L0N E;  2J59 M;  5E79 E;  1EZV I;  1S5L X;  2WSE J;  2KSE A;  1KIL E;  5KLV E;  2YKQ A;  3AE5 C;  1P84 D;  2YO2 A;  2YNY A;  3SSU A;  3FGA D;  1IJD B;  1NU1 G;  2E74 C;  1KYO I;  1FZF A;  5L8R J;  3M9Q A;  1BSH A;  5KJ7 D;  1AV1 A;  2R3S A;  3Q5S A;  3C1L A;  4OGQ D;  1FOS E;  2R5B A;  1GDT A;  1L0N D;  3M9B A;  3H1H D;  2OYI C;  1S5L H;  1NTK D;  2PP6 A;  3AED C;  1KIL D;  5KLV D;  2FFD A;  1E79 H;  1PP9 D;  3P8M C;  4EIJ A;  1NTM D;  1PGJ A;  1M8O B;  2OTJ P;  3RK3 E;  4PJ0 E;  1JY2 O;  1Y9B A;  5KLI C;  4U3F G;  5AVX B;  1PIX A;  3AE3 C;  2E76 B;  4I6M C;  2KUB A;  4B86 A;  2R3C A;  1NOH A;  1KB9 H;  4KT0 J;  2V7Q J;  2KLV A;  4HJG H;  3B5N D;  1SFC D;  3C8V A;  2YKP A;  1JCC A;  3HD7 C;  2ZJS E;  4ZKU A;  1G2C A;  2OQQ A;  1J1D B;  3VMY A;  1L0N J;  4L75 A;  2H7H A;  3B71 A;  3M0D A;  1SQP G;  3W68 A;  5KLV J;  3BCC E;  4LGD E;  2FYU D;  1P84 H;  1LWU A;  4UB6 E;  2AXT E;  1OVU A;  2FY8 A;  3KZI H;  2G3A A;  1L4A D;  1KIL B;  1G1J A;  1PP9 J;  3CME P;  1NKZ B;  1LTS C;  3P7K A;  1H89 A;  1OW7 A;  2KZJ A;  3I5C A;  2A06 E;  3HE5 A;  2QSI A;  3KYQ A;  3AE1 C;  2PFX A;  3L73 E;  2FXO A;  3A0H E;  2GUV A;  1VL2 A;  2ZT9 B;  4GT1 A;  3H1I E;  3F5H A;  1KYO H;  2YIU B;  1QL1 A;  2N1T C;  3BAT A;  3B5N B;  1SFC B;  2W8Z A;  3E1I A;  2O1J A;  2B87 B;  1YIT P;  1HGV A;  1T6A A;  2POH A;  3L73 D;  3RK3 B;  3TYY A;  1Q90 D;  2FYU J;  4KHX A;  1OZH A;  2ZVO B;  2WZ7 A;  1GW4 A;  3TGU E;  3W67 A;  2IZ1 A;  3H1H G;  1L4A B;  1HJB A;  1FDO A;  1NTK G;  1ZLL A;  1A02 F;  4D6T G;  1NVO A;  4GIF A;  3MD0 A;  1J1E C;  2LXB A;  1LTI C;  1BGY E;  2M5A A;  1PP9 G;  1URQ B;  1NTM G;  3HUS B;  3BCC J;  1CI6 B;  3I55 P;  3L71 E;  1ZXG A;  1WRG A;  2OYI B;  2D2C C;  3TGU D;  1NO4 A;  2W6A A;  2LR2 A;  2O01 H;  2Q3I A;  3MUD C;  4PD4 I;  1IFN A;  2KB7 P;  4N6J A;  4JF7 A;  3PH0 A;  2Q9I A;  1RF1 B;  3L73 J;  3CCL P;  2JO1 A;  1VQP P;  1VQL P;  2QJY C;  3CXH E;  3SWF A;  3IN6 A;  1IC2 A;  2WT7 B;  1XTG B;  2N1T D;  1FZA A;  3VMZ A;  4PD4 D;  3V2R A;  1HH0 A;  5AW1 B;  2FYU G;  1NAF A;  2L5G B;  1S9K D;  2V4H A;  1Q81 Q;  3L75 E;  3T97 A;  1LTB C;  1HUC A;  1EDL A;  5AVZ B;  3MIW A;  3P8C E;  4WY4 C;  3GF7 A;  4OH8 B;  3KPE A;  2P1J A;  3CXH D;  1G1I A;  5B66 H;  2WSS H;  1NKN A;  1RF0 C;  3TGU J;  2WMM A;  4L74 A;  4W7Z A;  5K5G B;  1JY3 N;  3V4W A;  5APQ A;  1HJ0 A;  2I1K A;  1EDI A;  3H32 B;  2HOD A;  2JEE A;  2NPS C;  2KIK A;  3AE9 C;  1VQM P;  2Y0E A;  1SQV D;  1VQN P;  3L73 G;  5GTH E;  3FX0 A;  3CCU P;  1ZR4 A;  3RL0 g;  1FJK A;  2XV5 A;  4RJT A;  3CCR P;  3CCE P;  2W90 A;  2WSC H;  1SQX K;  3KHU A;  5EFW B;  2HPC B;  5B5E H;  5TIS H;  1SQB E;  1OW8 A;  4I7Z C;  1KQL A;  3D70 A;  2HLO A;  3NMD A;  1LGH B;  1N86 A;  2CPS A;  1RQV A;  3U1C A;  3CMA P;  5CCG A;  3TF5 A;  4L76 A;  2QM8 A;  2M3B A;  4PD4 H;  4ZNC A;  1NU1 E;  2FKW B;  3V2Q A;  1PGP A;  3A0B E;  2KP8 A;  3L75 J;  5H2F E;  4I1L A;  1JY3 P;  1RE4 C;  1W2E A;  3II6 A;  1VF5 B;  2KXP B;  1DIP A;  3SFD C;  4NPD A;  1J1E B;  3GW6 A;  2OAR A;  3AEB C;  1VQ5 P;  2RN0 A;  1LNQ A;  4YPC A;  1MFT A;  4MN4 C;  3VOP A;  3Q1M A;  1NU1 D;  1WMK A;  5M1B A;  5KJ7 A;  4U3F E;  3EWK A;  2B9B A;  3H25 A;  2IX7 C;  5KKZ B;  2P10 A;  1IFD A;  1S72 P;  1KIL A;  1FZC B;  3Q5P A;  1T3U A;  3MGN A;  1T3J A;  3AEF C;  2WVR A;  2R32 A;  1SQB J;  2W27 A;  2Y0C A;  2NZ2 A;  2Q5U A;  3PJS K;  3U59 A;  2WSF J;  1SQP E;  5AVW B;  1OVR A;  3LID A;  4Y99 C;  1Q7Y Q;  1HWT C;  3IFM A;  1CSB A;  2QA4 P;  3B5N A;  1SFC A;  1OIP A;  2P7J A;  1NU1 J;  2PAJ A;  1K8A Q;  1JUN A;  4GKG A;  2E42 A;  1LTG C;  2IBZ D;  2B87 A;  1SQV G;  3CWB G;  3PRJ A;  3H6P A;  2ZYG A;  4PV1 C;  4TLF A;  3IAO A;  3VP8 A;  2M8R A;  3AE4 C;  1YI2 P;  3HTK B;  3AE6 C;  3T97 B;  3CI9 A;  4EYY Q;  4IOI H;  1L4A A;  1IZN B;  3GHG C;  1LT1 A;  2AEJ A;  2IDB A;  2BCC D;  3IR9 A;  4NPE A;  3CL3 D;  3CC7 P;  1P84 E;  1N7S C;  2OTL P;  1KB9 D;  2QJP C;  4AUW A;  1LTA C;  2SPZ A;  2Q3E A;  4H0L C;  3GF3 A;  2OYI A;  1BDD A;  4H13 C;  4GOD A;  5KAF H;  3H1H E;  2B89 A;  1NTK E;  5AVU B;  2MJZ A;  4D6T E;  2HOD B;  3OA7 A;  4WBA A;  1JM0 A;  1LTJ C;  1RF1 A;  3TDK A;  1PGO A;  3S1K A;  2GA1 A;  3V5B A;  1PP9 E;  1NTM E;  1JO5 A;  1SVF A;  2GUS A;  1SQP J;  4IL6 H;  1N7L A;  2WT7 A;  1IO4 A;  3M9H A;  1EZV D;  5APT A;  3PHL A;  1BDC A;  1M1J C;  3B4S A;  3H1J G;  3BRV B;  1KQS O;  1AVO A;  2C0W A;  1Q82 Q;  5KTB A;  1UII A;  4D6T D;  2XKM A;  1FZG A;  1OXZ A;  2H89 C;  1KYO D;  2LXC B;  2RMZ A;  5AVS B;  1ZRT D;  3RK2 C;  2IZ0 A;  1N73 B;  4C7N B;  3RGU A;  3H1L D;  1PV3 A;  3I56 P;  2WSE H;  3MTU E;  4BWN A;  4W7Y A;  3WU2 H;  1J2J B;  2FYU E;  2R5D A;  1HF9 A;  1X0T A;  4JPZ B;  1N7S D;  5KAI H;  2XND H;  3GLM A;  4LC1 A;  4QMA A;  3H32 A;  1LTT C;  1DEE G;  3OJA B;  5CMZ A;  3CPW O;  2IBZ G;  5AW5 B;  4H0L D;  2IFN A;  1K73 Q;  1OWA A;  1AQT A;  1LP1 B;  3H1H J;  1SLQ A;  1N8R Q;  4OGQ B;  1NTK J;  2YXQ B;  5APW A;  2N1T A;  2RKL A;  2YMY A;  1NWQ A;  4D6T J;  2HPC A;  1EQ7 A;  2E43 A;  3UIA A;  2A45 I;  2ITA A;  2J58 A;  1NTM J;  1X8Y A;  2BCC G;  2E74 D;  1SQQ K;  2N9Y B;  1FOS F;  2OYH C;  3VTP C;  2XNX A;  3L70 D;  4H44 C;  5GTI H;  2KK7 A;  1CW5 A;  1KTM A;  2KS1 A;  3AEG C;  5B66 E;  3ZDM A;  3SWY A;  5APU A;  2P67 A;  2B88 A;  2QJP B;  4DJG A;  3PP5 A;  3R2P A;  4H0L B;  2K37 A;  1K05 A;  1SQX G;  1PL5 A;  4IFD K;  3RL0 C;  2O3J A;  3R4Y A;  3L37 A;  1K9M Q;  2JWD A;  1SQB K;  1RY3 A;  2HYN A;  1MZ9 A;  3Q2Y A;  4EI2 A;  1EZV G;  4R4L A;  3HD7 D;  2O01 J;  2KNC B;  4Y28 J;  3VN0 A;  2JP3 A;  2KSJ A;  5B5E E;  1YHQ P;  2E74 B;  5TIS E;  2YO3 A;  1FZC A;  1NTZ D;  1YJW P;  2YKO A;  1AVY A;  1MUU A;  3B8E B;  3FWL A;  4L73 A;  3H1L G;  3NXS A;  4PD4 E;  2XU6 A;  2W6J H;  2CK3 H;  1S9K E;  1VQ4 P;  1RE3 A;  5AW8 B;  1S2E A;  4K3A A;  2WPQ A;  1JTH A;  1RF0 A;  3AE7 C;  2ZXX A;  5KLI B;  1L0L K;  5APY A;  4JYC A;  1K04 A;  3FXD A;  2A45 H;  4RES B;  1NH4 A;  2VRS A;  3QWO C;  2OGU A;  4AQR D;  2P2U A;  3AEA C;  3FXE A;  3HD7 B;  1VQ7 P;  3HTK A;  3G9R A;  1NTZ J;  2RH0 A;  1FS0 E;  1H88 A;  4UB6 H;  4KJM A;  3G4S P;  1IFP A;  3RL0 D;  5AW7 B;  1GU5 A;  5AW2 B;  1JMB A;  1SQV E;  3L70 G;  3L74 G;  3CWB E;  1PPJ G;  2IFM A;  1R5S A;  2WPV B;  5AVY B;  4GDO A;  1VQO P;  3JC2 2;  2WSC J;  2YXR B;  2QEX P;  1IK7 A;  1HGZ A;  4OWF A;  2OYH B;  5CJ4 A;  1YTZ I;  2H88 C;  2Y9Y A;  1EXI A;  1OVV A;  4JYB A;  1KFM A;  2WWW A;  1JMM A;  2QJK C;  1KC8 Q;  2D2C D;  3CWB D;  1JY3 O;  5CCH C;  3V4Q A;  2BEQ D;  5DJT B;  2HG5 D;  2C9L Y;  2N1T B;  1BCC D;  2AEM A;  3ABV C;  4HYT B;  2IPP A;  3P32 A;  1YIJ P;  1S3J A;  1GK6 A;  1NTZ G;  4UB8 H;  5APX A;  3S9O A;  1U57 A;  1VQ6 P;  1N73 A;  4C7N A;  1X9V A;  2KS1 B;  1ZP0 C;  5DJU B;  1VDF A;  4BXL A;  2XZR A;  3CC2 P;  5C39 A;  1L0N K;  4WY4 D;  1NTK K;  4XA4 A;  1LT9 C;  3L72 G;  3H1J E;  5KLV K;  2WPS A;  1GL2 C;  1SQV J;  3CWB J;  1QVG O;  1NTM K;  2JR8 A;  2D2C B;  2FXP A;  2Z5I A;  1BCC J;  2E5T A;  3WUT A;  1NJI Q;  2WPR A;  2JKV A;  5APS A;  1X22 A;  1KFN A;  3N4X A;  1YYC A;  1LP1 A;  3CLQ A;  3VMX A;  3H1J D;  2NPS D;  2K9J B;  2QIW A;  3M06 A;  2QJY B;  4Z1M H;  1HBW A;  4IL6 E;  1BE3 G;  5TJH A;  5CCH D;  3JCU H;  2JDI H;  2NRG A;  3CCQ P;  2JJL A;  1S5L E;  2IBZ E;  3D71 A;  3LIE A;  1M90 Q;  1R8E A;  2E76 C;  1Y8A A;  2FYU K;  4WY4 B;  2Y9Z A;  1U7J A;  2FYZ A;  3TK1 A;  3AEC C;  3SFE C;  2E75 C;  1N7S A;  2ZYA A;  1LJ2 A;  1XTC C;  1JTH B;  2L91 A;  1JCD A;  3WU2 E;  2BCC E;  2Z4E A;  3AE8 C;  4ASW A;  2XDJ A;  1KB9 E;  4W80 A;  5KJ7 C;  3QH9 A;  5BU8 B;  1M56 D;  5AVV B;  1GD2 E;  4DOJ A;  5GTH H;  1EXJ A;  3H1J J;  1QX8 A;  1BCC G;  1ZN5 A;  3CX5 I;  3O6Q B;  1GL2 D;  1H0T B;  1MV8 A;  1KIL C;  1SQQ G;  2NPS B;  3RBZ A;  2MKV A;  4RKU J;  1Z56 A;  2KNC A;  1AA0 A;  1YQ3 C;  4WWI A;  4ZMD A;  3KZI E;  1SQX E;  1FAV A;  3CX5 D;  4I7Z B;  3KQG A;  2ZT9 C;  3H1K G;  3A0B H;  1QL2 A;  1EZV E; 
#chains in the Genus database with same CATH homology
 5DJT B;  1OVR A;  2KI7 B;  2K3R A;  4ASV A;  4ZNC A;  2P58 A;  3MHV A;  3MZW B;  2OTK E;  4K3A A;  1Q2N A;  1BDC A;  2UWJ E;  2B87 B;  1EDL A;  2B87 A;  4NPF X;  3FXD A;  2KUB A;  3ZDM A;  1S3J A;  4JBZ A;  2QVA A;  1U7J A;  4NPD A;  2QRX A;  2LXC B;  4GOE A;  3QWO C;  4HJG H;  2B88 A;  3FXE A;  3RGU A;  1EDJ A;  1MFT A;  2WMM A;  2ZAE B;  4CPG A;  5CBO A;  4MN4 C;  2KS1 B;  5DJU B;  4EYY Q;  4BXL A;  4IOI H;  5K5G B;  4GOF A;  4HB1 A;  5C39 A;  4KJM A;  4ASW A;  1LT1 A;  2R44 A;  2M5A B;  1NVO A;  4NPE A;  2M5A A;  2LXB A;  2JWD A;  1X0T A;  5CBN A;  1JMB A;  1EDI A;  1EDK A;  1H0T B;  1ZXG A;  1OVU A;  2KIK A;  2SPZ A;  1ZW0 A;  1DEE G;  1Y47 A;  1U7M A;  1H0T A;  2Q1K A;  1EC5 A;  2KZI A;  1BDD A;  4GOD A;  2LR2 A;  2I8D A;  2KZJ A;  1LP1 B;  4WWI A;  2B89 A;  5EFW B;  1FC2 C;  4ZMD A;  4HKZ H;  1LP1 A;  2RKL A;  3PH0 A;  2M0B A;  1JM0 A;  1OVV A;  2HR3 A;  3S1K A;  1SS1 A;  4K35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...