2Q1KA

Cyrstal structure of asce from aeromonas hydrophilla
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
PVFARELHAQLVQALGDVKRRLLRGGTQQQYQQWQQEADAIEAGMNIIEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of AscE and induced burial regions in AscE and AscG upon formation of the chaperone needle-subunit complex of type III secretion system in Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Chaperone
molecule keywords AscE
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2q1kA00
2KI7B 1OVUA 2I8DA 2R44A 4EYYQ 4WWIA 1LP1B 2OTKE 2RKLA 3S1KA 5CBNA 2HR3A 1EDLA 1BDCA 3MHVA 4ZNCA 4GODA 2KUBA 2M5AB 1U7MA 2QRXA 1ZXGA 2LXBA 1H0TB 1DEEG 1LT1A 5C39A 2WMMA 4NPFX 1OVRA 2B89A 3FXEA 1H0TA 2ZAEB 4IOIH 5DJTB 4ASVA 2KZJA 4KJMA 2M0BA 1S3JA 2B87B 1EDJA 1EC5A 4BXLA 2JWDA 4JBZA 1FC2C 1Y47A 1ZW0A 4ASWA 4MN4C 5CBOA 4ZMDA 2B87A 3RGUA 2KIKA 3QWOC 4HB1A 5K5GB 1BDDA 4NPEA 2KZIA 1EDKA 1EDIA 2B88A 4NPDA 4HJGH 2UWJE 1MFTA 3MZWB 1U7JA 2LR2A 1JM0A 1LP1A 4HKZH 1Q2NA 5EFWB 5DJUB 3FXDA 4GOFA 3PH0A 1SS1A 2M5AA 4GOEA 2KS1B 3ZDMA 4CPGA 1OVVA 2K3RA 4K35A 1NVOA 2QVAA 1X0TA 2Q1KA 2LXCB 2P58A 2SPZA 4K3AA 1JMBA
chains in the Genus database with same CATH superfamily
1ZMEC 2ZXEB 2XNXA 1HVVA 1QLED 1UIXA 2KI7B 3BCCJ 1NTKG 3CXHE 5APXA 3M0DC 2FFDB 3D70A 1SQXJ 3MUDA 1GK6A 1K05A 1ZN5A 3CL3D 3E7KA 4EYYQ 4Y28J 3L73D 5KLVK 1HGVA 3RL0C 2IYOA 3E1IA 5CJ0A 3OA7A 3EFFK 3H32B 3JC22 3R4YA 1YJNP 3PP5A 4XE5B 5AW7B 1FJKA 3V2RA 1T2KD 1NTZD 1PP9J 1PIXA 1URQA 2OTKE 1BE3E 2QSIA 2E76B 2YO3A 2WSFH 3PJSK 4N3YB 4W7YA 2IZ1A 2YKPA 4KT0J 5CBNA 1HBWA 2KSEA 2OYIA 3CMEP 1SFCC 1NTMD 1NTKJ 1M1KQ 2POHA 4ZKPA 1LJ2A 3H1LE 2FFDC 2A45I 2M5AB 1D7MA 5KKZC 3V2QA 1YJWP 3M9QA 2H8PD 2FBWC 2KYVA 1G2CB 2ZXXA 4PD4H 1SQQE 1PPJE 5CHXA 1VF5D 3BCCG 1LGHB 1VF5B 1AJYA 2D2CD 1NTME 2NPSC 2N1TA 2QG4A 1FZAA 1LT1A 1NU1J 3LIEA 1KTMA 1ZP0C 1S5LE 1KYOH 1LWUB 1U57A 4H0LB 1JY2O 4H0LD 1AVOA 1OX3A 2LKMA 1GL2C 1EZVG 1PP9G 3AE2C 3GG2A 3HRNA 3VYIA 3H1KG 1GTWA 3H1HJ 5KLVD 1BCCJ 3EFGA 3KDPB 2ZAEB 4OGQC 5KAIE 5APSA 3CC2P 1H0TA 1DIPA 3AE5C 2WPVB 1OXZA 2HLOA 5B66E 1M90Q 5APWA 3RK2B 4OGQB 1M57D 4U3FJ 4C7NA 1S3JA 1XTGB 1SQBJ 1ZOYC 2B87B 2NRGA 1BE3J 4LLHA 3CXHH 1JUNA 2RN0A 3TSIA 2HODB 3M91A 2HG5D 5AVXB 4U7JA 1T3JA 1VL2A 4JBZA 4W7ZA 1FU1A 1HTLC 2AXTE 2W6BA 3GF3A 4GDOA 2E74D 2E75C 5APYA 4AUWA 1GU5A 1RE3C 2Y0EA 3OJAB 1DD3A 5AVSB 3A0BH 1USDA 1CI6A 1RHZB 5AW8B 1GD2E 1NO4A 1PFIA 3KQGA 1SFCD 5K5GB 1BGYG 1EZVI 1FZEA 3AEDC 3H1LD 2QJKB 2M3EA 2FYUK 3ITKA 3O6QA 2W83C 3V5BA 3KXDA 2KZIA 4WY4B 2IFNA 2J58A 3CCEP 1FDIA 1QGKB 2OYHA 3H1LG 4OH8B 1JCDA 1SQPE 3H1JD 4GKGA 4PD4E 1FDOA 3RL0D 4D6TE 5GTIH 3Q2YA 1GU4A 3H1HE 4HJGH 1SQBE 1IFMA 2WSEJ 2H7HA 2E43A 4UB6H 1SP4A 1ZRTD 3N7NA 4PJ0H 4TLFA 2WSCH 2DW3A 1PGOA 1URQB 2R5BA 3V6IA 5AW4B 1QVFO 2ZT9C 2BEQD 3SWYA 2YNYA 5EFWB 1Q86Q 2IBZI 1BE3D 2KOGA 3WUUA 3RK2D 2QJPB 3L70D 4D6TD 1H89A 3GHGC 1L2PA 4IL6E 2NZ2A 3SWKA 3P8CE 2YXQB 1NAFA 3RK3B 2Z4EA 3Q5SA 4GOEA 2NPSD 2BCCE 3AEGC 2NPSB 3CWBE 3B8EB 2C9LY 1VF5C 2IFMA 4UB6E 1A02F 1HF9A 1G2CA 2FFDA 1DEBA 1SQVK 1QL2A 3VMAA 1OVVA 2ZVNB 1SQXK 1JTHA 2AXCA 1J1DC 1KB9E 3AEFC 1NVOA 4GIFA 2QVAA 3L75J 2OTJP 1EZVD 1FBMA 1L0NE 1NTZJ 1PP9D 2Q1KA 1MZ9A 3HE4B 3JCUH 3IR9A 1KILB 2YIUB 5KLIC 2V7QH 4H44C 2P67A 5KAFH 2QEXP 1FOSE 3L70J 5CCGA 1Q7YQ 2OYHC 1AVYA 1NYHA 2QM7A 3HE5A 3L74G 5CJ4A 3AEEC 5CCHC 2OYHB 3BATA 2OYIC 1RE4C 4O9BA 1H88A 3BCCD 5CCHA 1E79H 4BRYB 1RF1C 3ABVC 5KJ7A 2PP6A 3V4WA 1JO5A 2VRSA 4N6JA 4C7NB 1BGYE 2RKLA 1T6AA 3L71E 3H1JJ 3L35A 3S1KA 3H1IE 4Y99C 1NWQA 3WUTA 3QH9A 1CW5A 1MKMA 4JF7A 1NU1K 2W8ZA 3R2PA 1SLQA 4DCKA 4ZNCA 2PGDA 4KHXA 1SQPG 3WU2E 3IFMA 1IK7A 4PD4I 2WTYA 3Q5RA 1RH5B 2KLVA 3IN6A 3MD0A 2Z5IA 4D6TG 1QL1A 4L75A 2Z5HA 1K9MQ 3H1JE 1VQ9P 1SQQK 2QIWA 3VMZA 2E5TA 1KMIZ 5H2FE 4A7PA 1VQ8P 4TT3H 1S9KE 3L36A 2HPCA 4L76A 1J1EC 4XFJA 1L4AB 2FYUD 3LW5J 4PJ0E 4YPCA 1NHLA 5APTA 2FKWB 3W67A 1N7SA 5AW0B 4YTPC 2O3JA 2KB7P 1N7SC 2H43A 1RY3A 2IPPA 2QE7H 3K5BA 3C8VA 4NPFX 3L72D 2KK7A 2B89A 5AW9B 2E42A 1BSHA 3CCMP 1L0LK 1KILD 2Q3EA 3E1RA 3CWBG 2JP3A 1OW8A 1DH3A 5GTHH 3HTKB 5M1BA 3CX5E 1LTJB 2FY8A 2KZJA 1AA0A 3HD7D 3HD7B 4U3FG 1NTZG 5B5EE 1X22A 2O01N 3JCUE 2FYZA 2ZVOB 3L72E 3F5HA 5TISE 1L0NG 1N86A 2E5YA 1CZQA 1HJBA 4IFDK 1LTBC 1PGJA 1AFOA 3RBZA 5KTBA 2D2CB 2Q7CA 5DJUB 2QJYC 3G4SP 1OW6A 3CX5D 2ZT9D 5KAFE 3UIAA 1SQQJ 1VDFA 3VMYA 3G71P 1PGPA 2FYUJ 2WVRA 2G8YA 5KLVG 1FS0E 4WY4A 4Z1MH 3C1LA 4ZMDA 2Q3IA 1DX7A 1JTHB 2GM4A 4PV1B 3M0AA 1QVGO 5AVZB 1X9VA 1M1JB 4N78D 4HB1A 4RKUJ 4WB4A 3L71G 3D71A 1P84H 2GA1A 2W27A 3D6YA 1KYOE 1N7LA 2WT7B 2O01J 3U1CA 3WU2H 3B5NA 4OGQD 1T8ZA 3L4FA 1YITP 2YO2A 1EQ7A 1EDKA 1VQ5P 1PPJD 3HUSA 3CCSP 2QA4P 3T97B 1GL2D 1GL2B 1OFCX 2JDIH 1FOSF 2C9NY 5AVTB 1SQBK 3CCVP 2XU6A 4I2LC 4YXWH 1PPJG 1NU1D 3A2AA 3BCCE 5AVVB 1FZBA 1JM0A 1LP1A 1NTMG 2LR2A 3A0HH 4HKZH 3AE4C 1YJ9P 2WWWA 1KORA 3V2NA 1RF0C 2QJYB 3L75G 1VPCA 2P1JA 3L71D 2J5UA 4UB8E 3FXDA 4N78E 4PV1D 2YXRB 3H1KJ 4GOFA 1ZLLA 4RO0A 3RBXA 3TDKA 1S1CX 3VMXA 1RF0A 1Q90D 2A45H 3LW5H 2P2UA 1JCCA 3H1KE 5CCGC 1SS1A 2CPSA 3HUSC 3W68A 3TF5A 1FZCA 3P8MC 3L74J 2A06G 2Q9IA 3BVHA 4I7ZC 5AVUB 1JEKA 3B5NC 3Q1MA 1L4AD 4QMAA 1SQVE 2AEFA 3MGNA 3V2PA 1Y9BA 3TGUE 1LTAC 1E5WA 2ZYGA 2K3RA 1G1IA 3CXHD 2A06D 3PLNA 3PHLA 2O1JA 1HJ0A 3G9RA 5GTHE 1YHQP 4H13C 4C7RA 1S4XA 1VQLP 4UB8H 1EXIA 1QEXA 1PGQA 1YTZI 1IC2A 1OIPA 4IL6X 5E79E 1SQVD 2FXPA 3TNUA 4OVNF 1J1EB 1OVUA 1N73C 2B9BA 2R44A 1KILE 4C46A 2K1AA 1GMJA 3A3YB 1ZV8A 3M9BA 1VQMP 1A02J 1LTIC 1P84E 1R5LA 3KHUA 1PL5A 1YYCA 4WWIA 1LP1B 2ITAA 1M7LA 1KFMA 1N2DC 2GUVA 4R4MA 2FYUG 5BU8B 3I55P 1EDLA 2IBZG 1RQUA 3MHVA 1KQFB 2FYNB 4I1LA 1NU1E 1NKZB 2MJZA 1JY3O 3F89A 2V4HA 1HGZA 4XA4A 1FZCB 3AE8C 4JYBA 5APUA 1K8AQ 3H1HG 3RK3E 1LT9A 3H1IJ 1URQD 2KS1A 1JY2N 1YQ4C 3SFEC 4JQ0D 1NGMB 1IO4A 2LXBA 4JPZB 1H0TB 1DEEG 1OWAA 2FXOA 3BRTB 3HTKA 3VTPC 1N8RQ 2WSSH 1NJIQ 5C39A 2WMMA 1W5CE 4H44B 2AEMA 3B5NB 1SQBD 1UIIA 4I7ZB 1KFNA 3CCQP 1MUUA 2K37A 2OGUA 4PD4D 1OVRA 3HUSB 3VP8A 3FWNA 3T97A 2FYNC 1L0LE 3B71A 2BCCG 3FXEA 2WSCJ 2A45G 2PAJA 2YMYA 4U3FD 4IOIH 2Y9ZA 5DJTB 2O01H 4ASVA 3D6ZA 3I56P 1KD1Q 3L74D 1SQVG 4M3LA 1GW4A 2WSEH 3TGUG 1FZGA 3IF4A 1SQXG 1KQLA 2D2CC 1H8AA 2K9JB 3NMDA 1WT6A 2M0BA 3II6A 2Y0CA 1EDJA 1YQ3C 4EI2A 2JWAA 2P10A 1EC5A 4LGDE 1S2EA 1SFCA 3NTNA 2Q5UA 1AQTA 1RE4A 2I1JA 2HYNA 2OTLP 1KB9I 2JWDA 1NTKK 3MTUE 1VQPP 1ZW0A 1URQC 1J2JB 4ASWA 3O6QB 4DJGA 4W80A 2H89C 4MN4C 5E79H 1OW7A 2FXMA 2OARA 1JB0J 3GLMA 4HH2A 1IFPA 3JSVC 1IK9A 2K88A 2KIKA 3QWOC 1T2KC 5B5EH 3U1AA 5BU5A 5AW2B 2PFXA 1SQPD 3L75D 3A0BE 2HODA 1BE3G 2CPBA 3CCRP 2KSJA 2WITA 2IBZE 1BDDA 1KYOD 1SQPJ 3AE1C 1ZRTE 1NU1G 2N9BA 2E74C 2E75D 2QJKC 1S72P 1LTGC 1EDIA 1CSBA 3CLQA 4H44D 2G3AA 1RE3A 1KQGB 2B88A 3N4XA 1G1JA 1IFNA 3P7KA 3TYYA 4NPDA 2HFED 1MFTA 1XTCC 3H1JG 1VQ6P 3MZWB 1SQQG 2N9YB 1WRGA 3CC4P 4IFFA 2N1TD 3FGAD 1N73A 1HUCA 2XV5A 1TU3F 1LTJC 2H88C 3HD7C 3CMAP 3CCJP 1SQQD 3WMM0 3GHGA 2Q6QA 3KZIE 3A5TA 2XZRA 2YKOA 5AVQB 1AQ5A 1PZQA 2WPQA 3PH0A 5APVA 2OYOA 1KB9D 1L0LG 3RK2C 1W2BO 1KILA 3AECC 4IL6H 1NAYA 2XDJA 3L73E 3WUVA 5CCGD 3CCUP 2KLUA 2KS1B 4GT1A 5CMZA 1M56D 3TNUB 3HE5B 3OAKA 4U3FE 2YIUC 1L0NJ 1LT9C 1NTZE 1BCCD 4K35A 3P32A 1P84D 2AEJA 2IX7C 4BRYA 3CCLP 1VQNP 3LIDA 3SWFA 2LXCB 2P58A 1BCCG 2BCCJ 2W6JH 2YMKA 3L70G 5AVRB 2NPSA 1JMBA 2QM8A 4DOJA 1RF1B 3OW2O 5KJ7C 1S9KD 2I8DA 4L74A 1KC8Q 5KLVE 4EOTA 1KQSO 3Q3DA 1JY3P 2ZYDA 1L0LD 3RK3C 2V7QJ 1FDMA 2XKMA 1K73Q 1VQ4P 3CXHI 3HE4A 1NOHA 3RK3D 1VQKP 5KKZB 2K9JA 1MV8A 1N73B 3CPWO 1LT9B 1S5LX 2XNDH 1X79B 3TK1A 4BWNA 2E76D 1Q81Q 3S4RA 2HR3A 4JYCA 1SFCB 3GF7A 1YIJP 1BDCA 1BSNA 1KV4A 1FE6A 3G6EP 2BASA 1YI2P 1EXJA 2C0WA 2ZYAA 2E76C 1Y8AA 2RH0A 4GODA 5CCHD 4YXDC 4D6TJ 4H13B 1BGYD 3P8CD 1N7SB 1JY2P 2KUBA 1U7MA 2QRXA 1ZXGA 2M3BA 3AE6C 3BASA 3KPEA 5H2FH 5KJ7D 1SQBG 1KILC 1USEA 3AE3C 3M0DA 1L4AC 2Y0DA 3RL0B 5KAIH 1FZCC 4DZOA 3M06A 2JR8A 2L5GB 1NTMK 1J1DB 1NH4A 1SQVJ 3NXSA 3TGUJ 1PV3A 5B66H 3L37A 1ZR4A 3KZIH 1HWTC 1KN7A 1JY3N 1LNQA 1GDTA 3EQ2A 4ZKUA 3L75E 1LTJA 2WSFJ 3HD7A 5AVWB 4AQRD 2CK3H 3BRVB 1IFIA 2RMZA 2PRRA 3GW6A 5L8RJ 3USSA 3O8ZA 3CC7P 1K04A 5GTIE 2R3SA 4HYTB 1R5SA 2I1KA 2KNCA 1IZNB 2E74B 2A06E 2N1TC 3L73G 1BGYJ 1HH0A 3SFDC 2HPCB 2QJPC 1L4AA 1JNMA 1NTKD 1YTZT 2WQYC 2JO1A 5AW1B 4R4LA 4KJMA 3GMAA 5BVZA 3CX5H 1IJDB 3H1KD 3IAOA 5TJHA 1FAVA 1RQVA 1GK4A 2W90A 3L71J 1GZLA 1BCCE 1LTTC 2WPSA 3RL0g 3L70E 4BXLA 4DT0A 2AXTH 3PTZA 1SQXD 5TISH 2W6AA 2OYIB 4WBAA 3CD6P 3TGUD 2J59M 2ZFCA 3MP7B 3MUDC 1FC2C 1NTKE 1Y47A 3AE9C 3L73J 3L74E 2R3CA 3MIWA 1R8EA 4WY4C 1M1JC 2BCCD 3I5CA 3CWBD 1IFDA 2JEEA 3FX0A 3VP9A 5CBOA 4EIJA 5KLIB 2JJLA 1ZR2A 1FJPA 2B87A 5AW3B 3RGUA 1SVFA 1Z56A 3A7OA 3H25A 4WVZA 3Q5PA 1KYOI 1QX8A 3C9IA 3H1IG 1W2EA 2KXPB 2FYUE 2YKQA 2GUSA 2K9YA 4I6MC 4IFMA 4NPEA 1LWUA 4AYCA 3VN0A 2IDBA 1M8OB 2E75B 1LTSC 4WY4D 3S9OA 4Y99B 2OQQA 1SQPK 1CI6B 3GHGB 3H1HD 2KNCB 3H1LJ 1M1JA 1L0LJ 1WMKA 2UWJE 3EWKA 3L72J 3CI9A 4OWFA 4EDFA 2ZT9B 3H32A 2O1KA 2ZJSE 3KYQA 4L73A 5AW5B 1DD4A 2WPRA 3AEBC 1U7JA 1X8YA 3M9HA 5AW6B 1S5LH 3SSUA 2IBZD 2WT7A 3FWLA 3B5ND 3VOPA 1KZUB 1AV1A 1NKNA 1T3UA 2R32A 1P84I 1OZHA 1Q2NA 1IFJA 1N7SD 3A0HE 2JKVA 3B4SA 2R5DA 3H1ID 4H13D 1GL2A 3H6PA 4RESB 4RJTA 4K3AA 1EZVE 1L0ND 1PP9E 4PV1C 2KP8A 3AEAC 3NFQA 2M5AA 3CX5I 3AE7C 1GW3A 2C0XA 2MKVA 4H0LC 1LWUC 2BEZF 1RF1A 1YBKA 3PRJA 1KB9H 2WZ7A 3ZDMA 2IYPA 4CPGA 1NTMJ 2M8RA 1VQOP 1SQXE 2L91A 1FZFA 2N1TB 1NTZK 2IZ0A 3U59A 3V4QA 1MFZA 2P7JA 3G3ZA 5KLVJ 1OMIA 3L72G 4LC1A 1L0NK 1X0TA 4B86A 2Y9YA 5APQA 2SPZA 3CWBJ 1Q82Q 5AVYB 1JOCA 1JMMA 1VQ7P
chains in the Genus database with same CATH topology
2KI7B 1OVUA 2I8DA 2R44A 4EYYQ 4WWIA 1LP1B 2OTKE 2RKLA 3S1KA 5CBNA 2HR3A 1EDLA 1BDCA 3MHVA 4ZNCA 4GODA 2KUBA 2M5AB 1U7MA 2QRXA 1ZXGA 2LXBA 1H0TB 1DEEG 1LT1A 5C39A 2WMMA 4NPFX 1OVRA 2B89A 3FXEA 1H0TA 2ZAEB 4IOIH 5DJTB 4ASVA 2KZJA 4KJMA 2M0BA 1S3JA 2B87B 1EDJA 1EC5A 4BXLA 2JWDA 4JBZA 1FC2C 1Y47A 1ZW0A 4ASWA 4MN4C 5CBOA 4ZMDA 2B87A 3RGUA 2KIKA 3QWOC 4HB1A 5K5GB 1BDDA 4NPEA 2KZIA 1EDKA 1EDIA 2B88A 4NPDA 4HJGH 2UWJE 1MFTA 3MZWB 1U7JA 2LR2A 1JM0A 1LP1A 4HKZH 1Q2NA 5EFWB 5DJUB 3FXDA 4GOFA 3PH0A 1SS1A 2M5AA 4GOEA 2KS1B 3ZDMA 4CPGA 1OVVA 2K3RA 4K35A 1NVOA 2QVAA 1X0TA 2Q1KA 2LXCB 2P58A 2SPZA 4K3AA 1JMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 B;  1OVU A;  2I8D A;  2R44 A;  4EYY Q;  4WWI A;  1LP1 B;  2OTK E;  2RKL A;  3S1K A;  5CBN A;  2HR3 A;  1EDL A;  1BDC A;  3MHV A;  4ZNC A;  4GOD A;  2KUB A;  2M5A B;  1U7M A;  2QRX A;  1ZXG A;  2LXB A;  1H0T B;  1DEE G;  1LT1 A;  5C39 A;  2WMM A;  4NPF X;  1OVR A;  2B89 A;  3FXE A;  1H0T A;  2ZAE B;  4IOI H;  5DJT B;  4ASV A;  2KZJ A;  4KJM A;  2M0B A;  1S3J A;  2B87 B;  1EDJ A;  1EC5 A;  4BXL A;  2JWD A;  4JBZ A;  1FC2 C;  1Y47 A;  1ZW0 A;  4ASW A;  4MN4 C;  5CBO A;  4ZMD A;  2B87 A;  3RGU A;  2KIK A;  3QWO C;  4HB1 A;  5K5G B;  1BDD A;  4NPE A;  2KZI A;  1EDK A;  1EDI A;  2B88 A;  4NPD A;  4HJG H;  2UWJ E;  1MFT A;  3MZW B;  1U7J A;  2LR2 A;  1JM0 A;  1LP1 A;  4HKZ H;  1Q2N A;  5EFW B;  5DJU B;  3FXD A;  4GOF A;  3PH0 A;  1SS1 A;  2M5A A;  4GOE A;  2KS1 B;  3ZDM A;  4CPG A;  1OVV A;  2K3R A;  4K35 A;  1NVO A;  2QVA A;  1X0T A;  2Q1K A;  2LXC B;  2P58 A;  2SPZ A;  4K3A A;  1JMB A; 
#chains in the Genus database with same CATH topology
 1ZME C;  2ZXE B;  2XNX A;  1HVV A;  1QLE D;  1UIX A;  2KI7 B;  3BCC J;  1NTK G;  3CXH E;  5APX A;  3M0D C;  2FFD B;  3D70 A;  1SQX J;  3MUD A;  1GK6 A;  1K05 A;  1ZN5 A;  3CL3 D;  3E7K A;  4EYY Q;  4Y28 J;  3L73 D;  5KLV K;  1HGV A;  3RL0 C;  2IYO A;  3E1I A;  5CJ0 A;  3OA7 A;  3EFF K;  3H32 B;  3JC2 2;  3R4Y A;  1YJN P;  3PP5 A;  4XE5 B;  5AW7 B;  1FJK A;  3V2R A;  1T2K D;  1NTZ D;  1PP9 J;  1PIX A;  1URQ A;  2OTK E;  1BE3 E;  2QSI A;  2E76 B;  2YO3 A;  2WSF H;  3PJS K;  4N3Y B;  4W7Y A;  2IZ1 A;  2YKP A;  4KT0 J;  5CBN A;  1HBW A;  2KSE A;  2OYI A;  3CME P;  1SFC C;  1NTM D;  1NTK J;  1M1K Q;  2POH A;  4ZKP A;  1LJ2 A;  3H1L E;  2FFD C;  2A45 I;  2M5A B;  1D7M A;  5KKZ C;  3V2Q A;  1YJW P;  3M9Q A;  2H8P D;  2FBW C;  2KYV A;  1G2C B;  2ZXX A;  4PD4 H;  1SQQ E;  1PPJ E;  5CHX A;  1VF5 D;  3BCC G;  1LGH B;  1VF5 B;  1AJY A;  2D2C D;  1NTM E;  2NPS C;  2N1T A;  2QG4 A;  1FZA A;  1LT1 A;  1NU1 J;  3LIE A;  1KTM A;  1ZP0 C;  1S5L E;  1KYO H;  1LWU B;  1U57 A;  4H0L B;  1JY2 O;  4H0L D;  1AVO A;  1OX3 A;  2LKM A;  1GL2 C;  1EZV G;  1PP9 G;  3AE2 C;  3GG2 A;  3HRN A;  3VYI A;  3H1K G;  1GTW A;  3H1H J;  5KLV D;  1BCC J;  3EFG A;  3KDP B;  2ZAE B;  4OGQ C;  5KAI E;  5APS A;  3CC2 P;  1H0T A;  1DIP A;  3AE5 C;  2WPV B;  1OXZ A;  2HLO A;  5B66 E;  1M90 Q;  5APW A;  3RK2 B;  4OGQ B;  1M57 D;  4U3F J;  4C7N A;  1S3J A;  1XTG B;  1SQB J;  1ZOY C;  2B87 B;  2NRG A;  1BE3 J;  4LLH A;  3CXH H;  1JUN A;  2RN0 A;  3TSI A;  2HOD B;  3M91 A;  2HG5 D;  5AVX B;  4U7J A;  1T3J A;  1VL2 A;  4JBZ A;  4W7Z A;  1FU1 A;  1HTL C;  2AXT E;  2W6B A;  3GF3 A;  4GDO A;  2E74 D;  2E75 C;  5APY A;  4AUW A;  1GU5 A;  1RE3 C;  2Y0E A;  3OJA B;  1DD3 A;  5AVS B;  3A0B H;  1USD A;  1CI6 A;  1RHZ B;  5AW8 B;  1GD2 E;  1NO4 A;  1PFI A;  3KQG A;  1SFC D;  5K5G B;  1BGY G;  1EZV I;  1FZE A;  3AED C;  3H1L D;  2QJK B;  2M3E A;  2FYU K;  3ITK A;  3O6Q A;  2W83 C;  3V5B A;  3KXD A;  2KZI A;  4WY4 B;  2IFN A;  2J58 A;  3CCE P;  1FDI A;  1QGK B;  2OYH A;  3H1L G;  4OH8 B;  1JCD A;  1SQP E;  3H1J D;  4GKG A;  4PD4 E;  1FDO A;  3RL0 D;  4D6T E;  5GTI H;  3Q2Y A;  1GU4 A;  3H1H E;  4HJG H;  1SQB E;  1IFM A;  2WSE J;  2H7H A;  2E43 A;  4UB6 H;  1SP4 A;  1ZRT D;  3N7N A;  4PJ0 H;  4TLF A;  2WSC H;  2DW3 A;  1PGO A;  1URQ B;  2R5B A;  3V6I A;  5AW4 B;  1QVF O;  2ZT9 C;  2BEQ D;  3SWY A;  2YNY A;  5EFW B;  1Q86 Q;  2IBZ I;  1BE3 D;  2KOG A;  3WUU A;  3RK2 D;  2QJP B;  3L70 D;  4D6T D;  1H89 A;  3GHG C;  1L2P A;  4IL6 E;  2NZ2 A;  3SWK A;  3P8C E;  2YXQ B;  1NAF A;  3RK3 B;  2Z4E A;  3Q5S A;  4GOE A;  2NPS D;  2BCC E;  3AEG C;  2NPS B;  3CWB E;  3B8E B;  2C9L Y;  1VF5 C;  2IFM A;  4UB6 E;  1A02 F;  1HF9 A;  1G2C A;  2FFD A;  1DEB A;  1SQV K;  1QL2 A;  3VMA A;  1OVV A;  2ZVN B;  1SQX K;  1JTH A;  2AXC A;  1J1D C;  1KB9 E;  3AEF C;  1NVO A;  4GIF A;  2QVA A;  3L75 J;  2OTJ P;  1EZV D;  1FBM A;  1L0N E;  1NTZ J;  1PP9 D;  2Q1K A;  1MZ9 A;  3HE4 B;  3JCU H;  3IR9 A;  1KIL B;  2YIU B;  5KLI C;  2V7Q H;  4H44 C;  2P67 A;  5KAF H;  2QEX P;  1FOS E;  3L70 J;  5CCG A;  1Q7Y Q;  2OYH C;  1AVY A;  1NYH A;  2QM7 A;  3HE5 A;  3L74 G;  5CJ4 A;  3AEE C;  5CCH C;  2OYH B;  3BAT A;  2OYI C;  1RE4 C;  4O9B A;  1H88 A;  3BCC D;  5CCH A;  1E79 H;  4BRY B;  1RF1 C;  3ABV C;  5KJ7 A;  2PP6 A;  3V4W A;  1JO5 A;  2VRS A;  4N6J A;  4C7N B;  1BGY E;  2RKL A;  1T6A A;  3L71 E;  3H1J J;  3L35 A;  3S1K A;  3H1I E;  4Y99 C;  1NWQ A;  3WUT A;  3QH9 A;  1CW5 A;  1MKM A;  4JF7 A;  1NU1 K;  2W8Z A;  3R2P A;  1SLQ A;  4DCK A;  4ZNC A;  2PGD A;  4KHX A;  1SQP G;  3WU2 E;  3IFM A;  1IK7 A;  4PD4 I;  2WTY A;  3Q5R A;  1RH5 B;  2KLV A;  3IN6 A;  3MD0 A;  2Z5I A;  4D6T G;  1QL1 A;  4L75 A;  2Z5H A;  1K9M Q;  3H1J E;  1VQ9 P;  1SQQ K;  2QIW A;  3VMZ A;  2E5T A;  1KMI Z;  5H2F E;  4A7P A;  1VQ8 P;  4TT3 H;  1S9K E;  3L36 A;  2HPC A;  4L76 A;  1J1E C;  4XFJ A;  1L4A B;  2FYU D;  3LW5 J;  4PJ0 E;  4YPC A;  1NHL A;  5APT A;  2FKW B;  3W67 A;  1N7S A;  5AW0 B;  4YTP C;  2O3J A;  2KB7 P;  1N7S C;  2H43 A;  1RY3 A;  2IPP A;  2QE7 H;  3K5B A;  3C8V A;  4NPF X;  3L72 D;  2KK7 A;  2B89 A;  5AW9 B;  2E42 A;  1BSH A;  3CCM P;  1L0L K;  1KIL D;  2Q3E A;  3E1R A;  3CWB G;  2JP3 A;  1OW8 A;  1DH3 A;  5GTH H;  3HTK B;  5M1B A;  3CX5 E;  1LTJ B;  2FY8 A;  2KZJ A;  1AA0 A;  3HD7 D;  3HD7 B;  4U3F G;  1NTZ G;  5B5E E;  1X22 A;  2O01 N;  3JCU E;  2FYZ A;  2ZVO B;  3L72 E;  3F5H A;  5TIS E;  1L0N G;  1N86 A;  2E5Y A;  1CZQ A;  1HJB A;  4IFD K;  1LTB C;  1PGJ A;  1AFO A;  3RBZ A;  5KTB A;  2D2C B;  2Q7C A;  5DJU B;  2QJY C;  3G4S P;  1OW6 A;  3CX5 D;  2ZT9 D;  5KAF E;  3UIA A;  1SQQ J;  1VDF A;  3VMY A;  3G71 P;  1PGP A;  2FYU J;  2WVR A;  2G8Y A;  5KLV G;  1FS0 E;  4WY4 A;  4Z1M H;  3C1L A;  4ZMD A;  2Q3I A;  1DX7 A;  1JTH B;  2GM4 A;  4PV1 B;  3M0A A;  1QVG O;  5AVZ B;  1X9V A;  1M1J B;  4N78 D;  4HB1 A;  4RKU J;  4WB4 A;  3L71 G;  3D71 A;  1P84 H;  2GA1 A;  2W27 A;  3D6Y A;  1KYO E;  1N7L A;  2WT7 B;  2O01 J;  3U1C A;  3WU2 H;  3B5N A;  4OGQ D;  1T8Z A;  3L4F A;  1YIT P;  2YO2 A;  1EQ7 A;  1EDK A;  1VQ5 P;  1PPJ D;  3HUS A;  3CCS P;  2QA4 P;  3T97 B;  1GL2 D;  1GL2 B;  1OFC X;  2JDI H;  1FOS F;  2C9N Y;  5AVT B;  1SQB K;  3CCV P;  2XU6 A;  4I2L C;  4YXW H;  1PPJ G;  1NU1 D;  3A2A A;  3BCC E;  5AVV B;  1FZB A;  1JM0 A;  1LP1 A;  1NTM G;  2LR2 A;  3A0H H;  4HKZ H;  3AE4 C;  1YJ9 P;  2WWW A;  1KOR A;  3V2N A;  1RF0 C;  2QJY B;  3L75 G;  1VPC A;  2P1J A;  3L71 D;  2J5U A;  4UB8 E;  3FXD A;  4N78 E;  4PV1 D;  2YXR B;  3H1K J;  4GOF A;  1ZLL A;  4RO0 A;  3RBX A;  3TDK A;  1S1C X;  3VMX A;  1RF0 A;  1Q90 D;  2A45 H;  3LW5 H;  2P2U A;  1JCC A;  3H1K E;  5CCG C;  1SS1 A;  2CPS A;  3HUS C;  3W68 A;  3TF5 A;  1FZC A;  3P8M C;  3L74 J;  2A06 G;  2Q9I A;  3BVH A;  4I7Z C;  5AVU B;  1JEK A;  3B5N C;  3Q1M A;  1L4A D;  4QMA A;  1SQV E;  2AEF A;  3MGN A;  3V2P A;  1Y9B A;  3TGU E;  1LTA C;  1E5W A;  2ZYG A;  2K3R A;  1G1I A;  3CXH D;  2A06 D;  3PLN A;  3PHL A;  2O1J A;  1HJ0 A;  3G9R A;  5GTH E;  1YHQ P;  4H13 C;  4C7R A;  1S4X A;  1VQL P;  4UB8 H;  1EXI A;  1QEX A;  1PGQ A;  1YTZ I;  1IC2 A;  1OIP A;  4IL6 X;  5E79 E;  1SQV D;  2FXP A;  3TNU A;  4OVN F;  1J1E B;  1OVU A;  1N73 C;  2B9B A;  2R44 A;  1KIL E;  4C46 A;  2K1A A;  1GMJ A;  3A3Y B;  1ZV8 A;  3M9B A;  1VQM P;  1A02 J;  1LTI C;  1P84 E;  1R5L A;  3KHU A;  1PL5 A;  1YYC A;  4WWI A;  1LP1 B;  2ITA A;  1M7L A;  1KFM A;  1N2D C;  2GUV A;  4R4M A;  2FYU G;  5BU8 B;  3I55 P;  1EDL A;  2IBZ G;  1RQU A;  3MHV A;  1KQF B;  2FYN B;  4I1L A;  1NU1 E;  1NKZ B;  2MJZ A;  1JY3 O;  3F89 A;  2V4H A;  1HGZ A;  4XA4 A;  1FZC B;  3AE8 C;  4JYB A;  5APU A;  1K8A Q;  3H1H G;  3RK3 E;  1LT9 A;  3H1I J;  1URQ D;  2KS1 A;  1JY2 N;  1YQ4 C;  3SFE C;  4JQ0 D;  1NGM B;  1IO4 A;  2LXB A;  4JPZ B;  1H0T B;  1DEE G;  1OWA A;  2FXO A;  3BRT B;  3HTK A;  3VTP C;  1N8R Q;  2WSS H;  1NJI Q;  5C39 A;  2WMM A;  1W5C E;  4H44 B;  2AEM A;  3B5N B;  1SQB D;  1UII A;  4I7Z B;  1KFN A;  3CCQ P;  1MUU A;  2K37 A;  2OGU A;  4PD4 D;  1OVR A;  3HUS B;  3VP8 A;  3FWN A;  3T97 A;  2FYN C;  1L0L E;  3B71 A;  2BCC G;  3FXE A;  2WSC J;  2A45 G;  2PAJ A;  2YMY A;  4U3F D;  4IOI H;  2Y9Z A;  5DJT B;  2O01 H;  4ASV A;  3D6Z A;  3I56 P;  1KD1 Q;  3L74 D;  1SQV G;  4M3L A;  1GW4 A;  2WSE H;  3TGU G;  1FZG A;  3IF4 A;  1SQX G;  1KQL A;  2D2C C;  1H8A A;  2K9J B;  3NMD A;  1WT6 A;  2M0B A;  3II6 A;  2Y0C A;  1EDJ A;  1YQ3 C;  4EI2 A;  2JWA A;  2P10 A;  1EC5 A;  4LGD E;  1S2E A;  1SFC A;  3NTN A;  2Q5U A;  1AQT A;  1RE4 A;  2I1J A;  2HYN A;  2OTL P;  1KB9 I;  2JWD A;  1NTK K;  3MTU E;  1VQP P;  1ZW0 A;  1URQ C;  1J2J B;  4ASW A;  3O6Q B;  4DJG A;  4W80 A;  2H89 C;  4MN4 C;  5E79 H;  1OW7 A;  2FXM A;  2OAR A;  1JB0 J;  3GLM A;  4HH2 A;  1IFP A;  3JSV C;  1IK9 A;  2K88 A;  2KIK A;  3QWO C;  1T2K C;  5B5E H;  3U1A A;  5BU5 A;  5AW2 B;  2PFX A;  1SQP D;  3L75 D;  3A0B E;  2HOD A;  1BE3 G;  2CPB A;  3CCR P;  2KSJ A;  2WIT A;  2IBZ E;  1BDD A;  1KYO D;  1SQP J;  3AE1 C;  1ZRT E;  1NU1 G;  2N9B A;  2E74 C;  2E75 D;  2QJK C;  1S72 P;  1LTG C;  1EDI A;  1CSB A;  3CLQ A;  4H44 D;  2G3A A;  1RE3 A;  1KQG B;  2B88 A;  3N4X A;  1G1J A;  1IFN A;  3P7K A;  3TYY A;  4NPD A;  2HFE D;  1MFT A;  1XTC C;  3H1J G;  1VQ6 P;  3MZW B;  1SQQ G;  2N9Y B;  1WRG A;  3CC4 P;  4IFF A;  2N1T D;  3FGA D;  1N73 A;  1HUC A;  2XV5 A;  1TU3 F;  1LTJ C;  2H88 C;  3HD7 C;  3CMA P;  3CCJ P;  1SQQ D;  3WMM 0;  3GHG A;  2Q6Q A;  3KZI E;  3A5T A;  2XZR A;  2YKO A;  5AVQ B;  1AQ5 A;  1PZQ A;  2WPQ A;  3PH0 A;  5APV A;  2OYO A;  1KB9 D;  1L0L G;  3RK2 C;  1W2B O;  1KIL A;  3AEC C;  4IL6 H;  1NAY A;  2XDJ A;  3L73 E;  3WUV A;  5CCG D;  3CCU P;  2KLU A;  2KS1 B;  4GT1 A;  5CMZ A;  1M56 D;  3TNU B;  3HE5 B;  3OAK A;  4U3F E;  2YIU C;  1L0N J;  1LT9 C;  1NTZ E;  1BCC D;  4K35 A;  3P32 A;  1P84 D;  2AEJ A;  2IX7 C;  4BRY A;  3CCL P;  1VQN P;  3LID A;  3SWF A;  2LXC B;  2P58 A;  1BCC G;  2BCC J;  2W6J H;  2YMK A;  3L70 G;  5AVR B;  2NPS A;  1JMB A;  2QM8 A;  4DOJ A;  1RF1 B;  3OW2 O;  5KJ7 C;  1S9K D;  2I8D A;  4L74 A;  1KC8 Q;  5KLV E;  4EOT A;  1KQS O;  3Q3D A;  1JY3 P;  2ZYD A;  1L0L D;  3RK3 C;  2V7Q J;  1FDM A;  2XKM A;  1K73 Q;  1VQ4 P;  3CXH I;  3HE4 A;  1NOH A;  3RK3 D;  1VQK P;  5KKZ B;  2K9J A;  1MV8 A;  1N73 B;  3CPW O;  1LT9 B;  1S5L X;  2XND H;  1X79 B;  3TK1 A;  4BWN A;  2E76 D;  1Q81 Q;  3S4R A;  2HR3 A;  4JYC A;  1SFC B;  3GF7 A;  1YIJ P;  1BDC A;  1BSN A;  1KV4 A;  1FE6 A;  3G6E P;  2BAS A;  1YI2 P;  1EXJ A;  2C0W A;  2ZYA A;  2E76 C;  1Y8A A;  2RH0 A;  4GOD A;  5CCH D;  4YXD C;  4D6T J;  4H13 B;  1BGY D;  3P8C D;  1N7S B;  1JY2 P;  2KUB A;  1U7M A;  2QRX A;  1ZXG A;  2M3B A;  3AE6 C;  3BAS A;  3KPE A;  5H2F H;  5KJ7 D;  1SQB G;  1KIL C;  1USE A;  3AE3 C;  3M0D A;  1L4A C;  2Y0D A;  3RL0 B;  5KAI H;  1FZC C;  4DZO A;  3M06 A;  2JR8 A;  2L5G B;  1NTM K;  1J1D B;  1NH4 A;  1SQV J;  3NXS A;  3TGU J;  1PV3 A;  5B66 H;  3L37 A;  1ZR4 A;  3KZI H;  1HWT C;  1KN7 A;  1JY3 N;  1LNQ A;  1GDT A;  3EQ2 A;  4ZKU A;  3L75 E;  1LTJ A;  2WSF J;  3HD7 A;  5AVW B;  4AQR D;  2CK3 H;  3BRV B;  1IFI A;  2RMZ A;  2PRR A;  3GW6 A;  5L8R J;  3USS A;  3O8Z A;  3CC7 P;  1K04 A;  5GTI E;  2R3S A;  4HYT B;  1R5S A;  2I1K A;  2KNC A;  1IZN B;  2E74 B;  2A06 E;  2N1T C;  3L73 G;  1BGY J;  1HH0 A;  3SFD C;  2HPC B;  2QJP C;  1L4A A;  1JNM A;  1NTK D;  1YTZ T;  2WQY C;  2JO1 A;  5AW1 B;  4R4L A;  4KJM A;  3GMA A;  5BVZ A;  3CX5 H;  1IJD B;  3H1K D;  3IAO A;  5TJH A;  1FAV A;  1RQV A;  1GK4 A;  2W90 A;  3L71 J;  1GZL A;  1BCC E;  1LTT C;  2WPS A;  3RL0 g;  3L70 E;  4BXL A;  4DT0 A;  2AXT H;  3PTZ A;  1SQX D;  5TIS H;  2W6A A;  2OYI B;  4WBA A;  3CD6 P;  3TGU D;  2J59 M;  2ZFC A;  3MP7 B;  3MUD C;  1FC2 C;  1NTK E;  1Y47 A;  3AE9 C;  3L73 J;  3L74 E;  2R3C A;  3MIW A;  1R8E A;  4WY4 C;  1M1J C;  2BCC D;  3I5C A;  3CWB D;  1IFD A;  2JEE A;  3FX0 A;  3VP9 A;  5CBO A;  4EIJ A;  5KLI B;  2JJL A;  1ZR2 A;  1FJP A;  2B87 A;  5AW3 B;  3RGU A;  1SVF A;  1Z56 A;  3A7O A;  3H25 A;  4WVZ A;  3Q5P A;  1KYO I;  1QX8 A;  3C9I A;  3H1I G;  1W2E A;  2KXP B;  2FYU E;  2YKQ A;  2GUS A;  2K9Y A;  4I6M C;  4IFM A;  4NPE A;  1LWU A;  4AYC A;  3VN0 A;  2IDB A;  1M8O B;  2E75 B;  1LTS C;  4WY4 D;  3S9O A;  4Y99 B;  2OQQ A;  1SQP K;  1CI6 B;  3GHG B;  3H1H D;  2KNC B;  3H1L J;  1M1J A;  1L0L J;  1WMK A;  2UWJ E;  3EWK A;  3L72 J;  3CI9 A;  4OWF A;  4EDF A;  2ZT9 B;  3H32 A;  2O1K A;  2ZJS E;  3KYQ A;  4L73 A;  5AW5 B;  1DD4 A;  2WPR A;  3AEB C;  1U7J A;  1X8Y A;  3M9H A;  5AW6 B;  1S5L H;  3SSU A;  2IBZ D;  2WT7 A;  3FWL A;  3B5N D;  3VOP A;  1KZU B;  1AV1 A;  1NKN A;  1T3U A;  2R32 A;  1P84 I;  1OZH A;  1Q2N A;  1IFJ A;  1N7S D;  3A0H E;  2JKV A;  3B4S A;  2R5D A;  3H1I D;  4H13 D;  1GL2 A;  3H6P A;  4RES B;  4RJT A;  4K3A A;  1EZV E;  1L0N D;  1PP9 E;  4PV1 C;  2KP8 A;  3AEA C;  3NFQ A;  2M5A A;  3CX5 I;  3AE7 C;  1GW3 A;  2C0X A;  2MKV A;  4H0L C;  1LWU C;  2BEZ F;  1RF1 A;  1YBK A;  3PRJ A;  1KB9 H;  2WZ7 A;  3ZDM A;  2IYP A;  4CPG A;  1NTM J;  2M8R A;  1VQO P;  1SQX E;  2L91 A;  1FZF A;  2N1T B;  1NTZ K;  2IZ0 A;  3U59 A;  3V4Q A;  1MFZ A;  2P7J A;  3G3Z A;  5KLV J;  1OMI A;  3L72 G;  4LC1 A;  1L0N K;  1X0T A;  4B86 A;  2Y9Y A;  5APQ A;  2SPZ A;  3CWB J;  1Q82 Q;  5AVY B;  1JOC A;  1JMM A;  1VQ7 P; 
#chains in the Genus database with same CATH homology
 2KI7 B;  1OVU A;  2I8D A;  2R44 A;  4EYY Q;  4WWI A;  1LP1 B;  2OTK E;  2RKL A;  3S1K A;  5CBN A;  2HR3 A;  1EDL A;  1BDC A;  3MHV A;  4ZNC A;  4GOD A;  2KUB A;  2M5A B;  1U7M A;  2QRX A;  1ZXG A;  2LXB A;  1H0T B;  1DEE G;  1LT1 A;  5C39 A;  2WMM A;  4NPF X;  1OVR A;  2B89 A;  3FXE A;  1H0T A;  2ZAE B;  4IOI H;  5DJT B;  4ASV A;  2KZJ A;  4KJM A;  2M0B A;  1S3J A;  2B87 B;  1EDJ A;  1EC5 A;  4BXL A;  2JWD A;  4JBZ A;  1FC2 C;  1Y47 A;  1ZW0 A;  4ASW A;  4MN4 C;  5CBO A;  4ZMD A;  2B87 A;  3RGU A;  2KIK A;  3QWO C;  4HB1 A;  5K5G B;  1BDD A;  4NPE A;  2KZI A;  1EDK A;  1EDI A;  2B88 A;  4NPD A;  4HJG H;  2UWJ E;  1MFT A;  3MZW B;  1U7J A;  2LR2 A;  1JM0 A;  1LP1 A;  4HKZ H;  1Q2N A;  5EFW B;  5DJU B;  3FXD A;  4GOF A;  3PH0 A;  1SS1 A;  2M5A A;  4GOE A;  2KS1 B;  3ZDM A;  4CPG A;  1OVV A;  2K3R A;  4K35 A;  1NVO A;  2QVA A;  1X0T A;  2Q1K A;  2LXC B;  2P58 A;  2SPZ A;  4K3A A;  1JMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...