2Q1KA

Cyrstal structure of asce from aeromonas hydrophilla
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
PVFARELHAQLVQALGDVKRRLLRGGTQQQYQQWQQEADAIEAGMNIIEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of AscE and induced burial regions in AscE and AscG upon formation of the chaperone needle-subunit complex of type III secretion system in Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Chaperone
molecule keywords AscE
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2q1kA00
4KJMA 1Q2NA 1X0TA 4HJGH 2LXCB 3MZWB 1EDKA 4GOEA 1OVUA 3PH0A 1EDLA 1JM0A 2B87A 4ZMDA 1MFTA 3S1KA 5CBNA 1EDJA 5K5GB 4IOIH 2I8DA 1ZXGA 4MN4C 4NPDA 1LP1A 2Q1KA 3RGUA 4GOFA 2LR2A 1LT1A 5DJTB 4CPGA 2HR3A 4HB1A 2RKLA 1BDDA 4ZNCA 1Y47A 1OVRA 2OTKE 5CBOA 4K35A 1LP1B 2LXBA 1EC5A 4NPFX 2M0BA 2KZJA 2B88A 1SS1A 4EYYQ 1FC2C 2B89A 2M5AB 1OVVA 3MHVA 4HKZH 4ASVA 1BDCA 2JWDA 2KUBA 4K3AA 4GODA 1U7MA 1NVOA 1H0TA 1ZW0A 2KS1B 1EDIA 5EFWB 1S3JA 2QRXA 2M5AA 1DEEG 2SPZA 2P58A 2QVAA 3QWOC 3FXEA 4ASWA 2KI7B 2K3RA 1H0TB 4JBZA 5DJUB 2KZIA 3FXDA 4NPEA 2WMMA 2ZAEB 3ZDMA 5C39A 2B87B 2KIKA 4WWIA 1JMBA 4BXLA 2UWJE 2R44A 1U7JA
chains in the Genus database with same CATH superfamily
3G6EP 3HUSA 2WT7B 2W8ZA 5CCGD 3CCUP 1SVFA 1JY3P 4HJGH 4PD4I 5AVRB 2LXCB 1RE4A 1R5SA 2N9YB 3M9QA 4GOEA 2E75B 3SFEC 1UIXA 3KQGA 2E76D 1IFPA 1GU5A 1GW4A 2K1AA 3BVHA 3CCEP 4DZOA 1QL1A 2A06E 3L72E 1MV8A 1FZEA 4IFFA 1N7SD 1DD4A 1SQXG 1SFCC 1NTZG 3OA7A 3USSA 2OYIA 1NU1D 2A06G 1J2JB 1NU1G 1OXZA 3F89A 1L0LD 5APQA 1LTJC 2BEZF 1G2CB 2O1JA 3FWLA 2RH0A 3RBXA 3VN0A 1FJKA 1IFMA 2BEQD 3V2RA 1L0LJ 2P7JA 4M3LA 4U3FE 4Y99C 5KLVD 3TNUB 2Y0EA 3Q3DA 1VQNP 2I8DA 1ZXGA 1LP1A 3I55P 1KORA 1SQQK 1BGYD 3RK3E 1K05A 2GM4A 1EQ7A 3AEAC 2QIWA 1TU3F 4GOFA 4OH8B 3S4RA 3RBZA 1VQ4P 1S5LX 2LR2A 2PGDA 5KJ7C 3H1KD 5H2FE 2R3SA 3MIWA 3H1KE 2WPSA 4U7JA 1Y8AA 5APYA 3VMYA 1DIPA 2LKMA 4H13D 2HR3A 1NAFA 1NTMJ 1RQUA 3B4SA 2PRRA 3MUDC 1GL2D 3L75J 3Q2YA 2XNDH 1KILC 1Y47A 2YIUB 3RL0D 1S4XA 2D2CB 4H13C 2QEXP 1KC8Q 3CCVP 2OTKE 3AE8C 1IO4A 2AEJA 1LP1B 2QE7H 3GHGB 3PRJA 1URQC 1YJNP 2GUSA 1AA0A 3HRNA 2MJZA 1OW7A 2RN0A 1Z56A 2D2CD 2N1TA 4EDFA 1NGMB 2H89C 1BE3J 1Y9BA 3L75E 3Q5PA 1SS1A 1P84D 3CXHE 3II6A 3A0BE 1BSNA 1SQVD 2W27A 1BCCJ 4PV1D 2KB7P 5AVSB 3VMZA 1GDTA 1ZMEC 2M5AB 3VYIA 1FJPA 2ZT9B 2IPPA 2J58A 1HGZA 1LNQA 1M56D 3M9HA 3S9OA 3BRVB 1QLED 1LTTC 1KB9E 1J1DC 2CPBA 4H44B 1IZNB 2JWDA 4PV1C 5TISH 2FFDC 2KUBA 2RMZA 2HLOA 1IJDB 3CWBG 1BGYG 5APSA 4OGQC 1L0NJ 1RE3C 2JDIH 4GIFA 1NVOA 1KILE 5AW2B 5CCHD 1ZR2A 1SQQE 3P7KA 2C9LY 4BWNA 1H0TA 4GDOA 2N1TB 1SQPG 4I6MC 5AVWB 1D7MA 2E76C 3V4WA 3LW5H 2C0WA 3L74G 1W2BO 2G3AA 2O01J 3L72D 1JOCA 1Q82Q 1T6AA 1IFJA 1LGHB 2QJKB 3ITKA 5EFWB 3SWYA 3PTZA 2ZYDA 2QRXA 2CK3H 3MTUE 2WSEJ 2QM8A 3AE5C 1L4AD 1NU1J 4H0LC 3HD7C 2P58A 3CLQA 4I2LC 3M9BA 4JYCA 3CWBE 1LJ2A 1BE3G 1SQXJ 4OWFA 4BRYB 2KLUA 2YXRB 3A5TA 5APXA 2K9JB 2K3RA 2P2UA 3P8CE 3HUSB 5AVYB 1KQFB 1T3UA 3SFDC 2BCCD 3Q5RA 4D6TD 1PPJG 2QJKC 2R3CA 3A7OA 1VQ9P 1N86A 1H0TB 5DJUB 1KFMA 2KS1A 3H1JE 1N7LA 2J5UA 3M0DC 2FXPA 1M8OB 3CXHH 1VQ8P 4IFDK 4YXDC 2QSIA 1LTIC 3CWBJ 3HE4A 2B9BA 3ZDMA 2FYNC 1KFNA 1FOSF 1S9KE 2N1TC 3TGUJ 3N7NA 2ZVNB 3G9RA 1S9KD 2HODB 3HD7A 2FXOA 2JR8A 4U3FJ 4A7PA 2HPCB 1JMBA 1M57D 1YBKA 2N1TD 2Q3IA 3H1IE 1KQGB 2UWJE 3BCCG 3L72J 1G2CA 4LLHA 1NKZB 5KLVG 2ZXXA 1K04A 1FDOA 3KZIH 2IYOA 2W83C 4DT0A 5CCGC 1JUNA 2PAJA 1KILD 3RL0C 1N73B 4XFJA 2K9JA 3CCMP 5B66E 1X0TA 4I7ZB 4AUWA 1N2DC 1Q81Q 1K73Q 2E42A 1L0NG 1L0ND 2JJLA 2NZ2A 2YIUC 2GUVA 1VQKP 1LWUA 1SQQJ 3MUDA 1KB9I 3L72G 5KLVJ 1NYHA 1OZHA 4N3YB 1OX3A 1MZ9A 4N78E 2DW3A 3KPEA 2A45I 1NKNA 3TGUG 5AW5B 1NTKD 1ZN5A 1N73C 2KSEA 1JY3N 2C0XA 3A0BH 3L73D 3QH9A 3R4YA 5CCGA 1YTZT 3NFQA 1T2KD 5CBNA 3MD0A 1S5LE 1VPCA 3H1HE 4RKUJ 1YQ4C 5AVXB 5KLVE 1CSBA 3FGAD 4PD4H 3I5CA 3L70J 2FYUK 3JSVC 3H1HG 4LGDE 3UIAA 2VRSA 3WU2E 1SP4A 2I1JA 5KJ7A 5GTIE 2PFXA 3AEBC 1HJ0A 1IFNA 1KYOI 1ZV8A 2A45G 2FYUE 2P67A 2WSFH 2Y0CA 3GHGA 3IN6A 3AE7C 1DD3A 1YI2P 2E5TA 3WUVA 4YTPC 3L75G 3TDKA 1PGJA 1SQVG 2P10A 3PLNA 1ZR4A 3AE9C 3CC2P 1M1KQ 1U57A 1XTGB 2AXTH 3L70E 5GTHE 3M0DA 1HJBA 1LT1A 5KLIC 3TGUE 1NTZE 1EZVI 1USEA 3GLMA 3L35A 1G1IA 4PJ0E 5DJTB 3GF7A 5APWA 4CPGA 1VQPP 1YJ9P 4HB1A 1NTMD 2K9YA 1KQLA 3AE1C 1DH3A 3GMAA 2RKLA 1X79B 1Q7YQ 4WVZA 2WPRA 2YO2A 3U1AA 1BGYJ 1JY2N 4L75A 3B8EB 1P84I 1SQPE 3SWKA 2KNCA 4B86A 1M90Q 2AXCA 2W6AA 3RK2D 1R5LA 1KMIZ 3Q5SA 3EFFK 3G3ZA 3L73E 3O6QA 1S2EA 3PHLA 1IK7A 2HG5D 2YNYA 4R4LA 3V4QA 4EI2A 5KLVK 3H1KG 1GZLA 2WSCH 2J59M 3L73G 5APTA 2FFDA 1RQVA 1CI6A 1NOHA 3AE4C 3RK2B 4DCKA 3R2PA 4UB8E 5KAIE 2XDJA 1OIPA 2YKOA 2HPCA 5TISE 1EXIA 1NTKJ 4BRYA 3CD6P 4H44C 3VP9A 1SQBJ 3LIEA 5KTBA 3BASA 4IL6H 2FYZA 4IL6E 3CCQP 5BU5A 1FAVA 1M7LA 2FYUJ 2POHA 1Q86Q 2KNCB 2XV5A 1OMIA 1S72P 3AEFC 1VQLP 3L74E 2WSSH 1HTLC 2KS1B 4R4MA 3P8MC 3V2QA 3CC7P 2Q9IA 3C1LA 1ZRTD 3M0AA 3O6QB 4ZKUA 1FZGA 2E76B 1IFDA 1E79H 3HE4B 4W7YA 3WMM0 1NTKE 1FE6A 1SQBD 1WRGA 1NAYA 4UB6E 1QL2A 1DEEG 2FXMA 2HODA 2SPZA 1CI6B 2WPQA 1FZAA 3BCCE 3HD7B 1L0LK 4WB4A 3CWBD 5TJHA 2OYHB 1FZCA 1VQ6P 2IBZD 1DX7A 1J1EB 4OVNF 3TSIA 2Y9YA 1VQMP 1RHZB 4U3FD 2KYVA 4IFMA 2BCCE 1GTWA 1N73A 1N7SA 2FKWB 2WZ7A 2R5DA 3LW5J 1PPJD 2Z5IA 3WU2H 1FS0E 2BCCG 3E1IA 1YIJP 2H88C 1CZQA 1LWUB 1L2PA 1GL2C 2BASA 2K88A 2KZIA 2ZYAA 3C9IA 3H25A 2N9BA 4NPEA 2WMMA 1ZOYC 3H1LJ 2ZT9C 4C46A 5C39A 3CI9A 5AW1B 1NU1E 1FZCC 5GTHH 3AE2C 3H1ID 3SSUA 2E75C 2IFNA 3VOPA 2OYHA 2OGUA 1L0LE 1RF0C 3CX5E 3TGUD 1JEKA 5AW4B 5KJ7D 2HFED 1NTME 1OFCX 5APUA 2IZ1A 2YMKA 1HH0A 2R44A 5E79H 3D6ZA 1KQSO 3HE5B 1KTMA 1N7SB 4KJMA 1Q2NA 3MGNA 3JCUE 1GU4A 3BRTB 1J1EC 3KHUA 4Y28J 2YKPA 3AEGC 1A02J 1NH4A 1QX8A 1EDKA 1SQPD 1GK6A 3CXHI 3MZWB 5KKZC 1RH5B 2O1KA 2NPSD 2XNXA 3IF4A 1IC2A 3PH0A 5M1BA 1GL2A 4WBAA 3RL0g 2Z4EA 1EDLA 2E5YA 2OTJP 5AW6B 1JM0A 2WSEH 4GT1A 5CJ4A 1QEXA 2ZXEB 4ZMDA 5CCHC 3V2PA 2QA4P 1KYOE 1FBMA 4KHXA 1QVFO 1PZQA 3H1LD 3HUSC 2CPSA 1OW6A 2ZJSE 3A3YB 3HE5A 4IOIH 3H1JJ 1L4AA 4JPZB 5AVTB 3H1KJ 3KZIE 3RK3C 1USDA 4MN4C 1MKMA 4WY4C 1PP9J 1SQPK 1L0NE 4L73A 4EOTA 3CMEP 1MFZA 1UIIA 5AW3B 1LTJB 3B71A 1JTHA 2ZYGA 3W68A 1BSHA 3CX5D 3O8ZA 2IYPA 1JCCA 3AECC 1SQVE 1JO5A 3F5HA 1NU1K 4I1LA 3CCRP 3BCCD 2FFDB 1KB9H 4WY4B 1W2EA 1SQXK 2YXQB 1FDIA 2IBZE 1T2KC 3HD7D 2L91A 2KP8A 1R8EA 1EZVD 2FY8A 1EZVE 5APVA 3V5BA 4EIJA 4Z1MH 3E1RA 1NTKK 4K35A 3CX5I 4U3FG 3VMXA 1SQBK 4C7NB 2LXBA 2O01H 1FU1A 2ZFCA 1SLQA 2A45H 2YKQA 1AVOA 1SQQD 2WWWA 2M0BA 4NPFX 5AW9B 2XKMA 3E7KA 3L71G 2KZJA 3AEEC 3EQ2A 1LTAC 2O3JA 2ZT9D 2B88A 1VF5D 1SQBG 2OQQA 1URQA 2V7QH 1FZBA 1NTKG 1SFCD 2WSFJ 4EYYQ 5KAFH 1AFOA 1K8AQ 1FC2C 1YHQP 3KXDA 3L70D 5L8RJ 3RK2C 3SWFA 1LT9C 3K5BA 2Y9ZA 3IR9A 1GD2E 2IZ0A 1OVVA 1BE3D 3MHVA 1S5LH 1YITP 1FZCB 1BE3E 1GMJA 4ASVA 3IFMA 1YQ3C 3OJAB 1X8YA 2KLVA 4RESB 1BDCA 3L37A 4K3AA 1VQOP 1OWAA 1JCDA 1Q90D 3L4FA 1AV1A 4GODA 2Q7CA 4C7RA 2V4HA 4H0LB 4XA4A 1RF1B 1IFIA 3I56P 1ZRTE 4GKGA 4D6TE 2QJPB 1X9VA 1JB0J 1ZW0A 2Q3EA 3L74J 1M1JC 1SQQG 2NPSC 3MP7B 5AW7B 3H1JD 5H2FH 5KLIB 1URQB 3L71D 1GW3A 1S3JA 1ZP0C 1PGPA 1JY2O 1WT6A 3H1IJ 4TLFA 2E43A 2AEMA 3N4XA 1JMMA 1VQ5P 3FX0A 1KB9D 2AEFA 3C8VA 3NXSA 1SFCB 3BCCJ 5E79E 2W6BA 1VQ7P 2FYNB 2G8YA 4PD4D 1LT9B 3QWOC 4ASWA 4PD4E 1NTZK 1PPJE 2E75D 2XU6A 1JNMA 2Q5UA 1H8AA 1SQVJ 3B5NC 1BCCG 1LWUC 3KDPB 1YJWP 1RF1A 2PP6A 4JBZA 2R5BA 1FZFA 4ZKPA 4LC1A 5AVVB 2WPVB 3RL0B 3B5NA 2NRGA 5KAFE 1SQXE 1GL2B 4L76A 5CJ0A 4W7ZA 2QJPC 3H6PA 1KN7A 2B87B 3H1IG 2KIKA 1ZLLA 3KYQA 4BXLA 3U1CA 2ITAA 4L74A 2QM7A 3TYYA 1N8RQ 4XE5B 1U7JA 3VP8A 1VF5C 1JY3O 1L4AB 3H1LG 3IAOA 3P8CD 2QG4A 2H7HA 1PP9G 2Q6QA 4H44D 5AW8B 5B5EH 3A0HH 3AE6C 1OVUA 3P32A 5BU8B 1SQPJ 1RE3A 3VTPC 1PGOA 4TT3H 3B5NB 4W80A 3H1JG 3OW2O 2XZRA 2OTLP 1LTJA 1NO4A 1JTHB 2OYOA 3T97A 3G71P 3CCJP 1KYOD 2E74C 1KZUB 2B87A 2M3BA 1VF5B 1MFTA 3D70A 1MUUA 2WTYA 2MKVA 2V7QJ 3S1KA 2I1KA 4WY4A 1L0LG 2KK7A 1AVYA 1NTMK 1EDJA 2JEEA 1OW8A 4UB8H 5K5GB 5KAIH 4HH2A 1NWQA 4YPCA 1BCCD 1RE4C 3WUUA 1RY3A 2WT7A 4DJGA 5CBOA 2IDBA 2KOGA 2K37A 4NPDA 4DOJA 4C7NA 4PV1B 2Q1KA 3TF5A 1SQXD 1FOSE 3PP5A 2FYUG 4WY4D 3RGUA 2IBZI 1HVVA 2JWAA 2ZVOB 3L70G 2WVRA 3A0HE 1P84E 3CXHD 4N78D 4AQRD 3OAKA 3JC22 1K9MQ 1H88A 1H89A 3TNUA 1T3JA 1KD1Q 2OYIB 3W67A 2AXTE 1YYCA 1HGVA 5CMZA 3V6IA 3M91A 2Y0DA 1PIXA 1KILB 1EZVG 2JO1A 5BVZA 3GG2A 1BDDA 4ZNCA 3CMAP 1OVRA 4AYCA 2IBZG 3GHGC 5KKZB 2FYUD 4IL6X 2P1JA 3L36A 1EXJA 1XTCC 5B5EE 2KXPB 1T8ZA 2D2CC 1L0NK 1EC5A 4H13B 2YMYA 3CC4P 2BCCJ 4JYBA 2FBWC 2M8RA 1FDMA 3M06A 1A02F 3CPWO 1X22A 3GF3A 3TK1A 4HYTB 1RF0A 2OYHC 2A06D 1GK4A 4UB6H 1IK9A 1S1CX 2E74D 1NTZD 1M1JA 2NPSA 2QJYB 3LIDA 1KYOH 2WITA 4JQ0D 1SQBE 5GTIH 2C9NY 2B89A 1HWTC 1CW5A 4Y99B 2O01N 4YXWH 1J1DB 1KILA 3CL3D 3H32B 3L71J 4PJ0H 1WMKA 1SFCA 3WUTA 5CCHA 2OYIC 4HKZH 2W6JH 2KSJA 3GW6A 1LT9A 3A2AA 1E5WA 1LTSC 3NMDA 3BATA 1RF1C 5B66H 1U7MA 1SQVK 2JKVA 3JCUH 1DEBA 1PGQA 1PP9D 1BGYE 3HTKA 5AVUB 4OGQD 3RK3D 3VMAA 1VL2A 2L5GB 5AVQB 2H43A 4D6TJ 4N6JA 2HYNA 4I7ZC 3L71E 1PFIA 4D6TG 1HF9A 3H1HJ 1EDIA 2IX7C 1M1JB 1LTGC 2GA1A 2NPSB 3CX5H 3D6YA 2OARA 2W90A 1HBWA 5AW0B 2H8PD 1PV3A 3PJSK 2M5AA 2WQYC 3V2NA 3L73J 1NJIQ 1NTMG 3AE3C 2QJYC 3H32A 4JF7A 2WSCJ 2E74B 3CCLP 1AQ5A 2QVAA 1QGKB 1BCCE 3FXEA 4QMAA 5AVZB 3EFGA 2KI7B 2JP3A 2Z5HA 3G4SP 3Q1MA 2YO3A 1G1JA 1URQD 3D71A 3L74D 3HTKB 1QVGO 3AEDC 3EWKA 4O9BA 1VDFA 1AJYA 1W5CE 3FXDA 4H0LD 1N7SC 2ZAEB 1KV4A 1YTZI 3L75D 4RO0A 2M3EA 3T97B 1P84H 3NTNA 3FWNA 3CCSP 1NHLA 3U59A 4KT0J 3B5ND 4WWIA 1HUCA 3ABVC 5CHXA 3H1HD 4OGQB 2R32A 3RK3B 2IFMA 4RJTA 1L4AC 1PL5A 3H1LE 1NTZJ 1JY2P 1LTBC 1PP9E 1AQTA
chains in the Genus database with same CATH topology
4KJMA 1Q2NA 1X0TA 4HJGH 2LXCB 3MZWB 1EDKA 4GOEA 1OVUA 3PH0A 1EDLA 1JM0A 2B87A 4ZMDA 1MFTA 3S1KA 5CBNA 1EDJA 5K5GB 4IOIH 2I8DA 1ZXGA 4MN4C 4NPDA 1LP1A 2Q1KA 3RGUA 4GOFA 2LR2A 1LT1A 5DJTB 4CPGA 2HR3A 4HB1A 2RKLA 1BDDA 4ZNCA 1Y47A 1OVRA 2OTKE 5CBOA 4K35A 1LP1B 2LXBA 1EC5A 4NPFX 2M0BA 2KZJA 2B88A 1SS1A 4EYYQ 1FC2C 2B89A 2M5AB 1OVVA 3MHVA 4HKZH 4ASVA 1BDCA 2JWDA 2KUBA 4K3AA 4GODA 1U7MA 1NVOA 1H0TA 1ZW0A 2KS1B 1EDIA 5EFWB 1S3JA 2QRXA 2M5AA 1DEEG 2SPZA 2P58A 2QVAA 3QWOC 3FXEA 4ASWA 2KI7B 2K3RA 1H0TB 4JBZA 5DJUB 2KZIA 3FXDA 4NPEA 2WMMA 2ZAEB 3ZDMA 5C39A 2B87B 2KIKA 4WWIA 1JMBA 4BXLA 2UWJE 2R44A 1U7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJM A;  1Q2N A;  1X0T A;  4HJG H;  2LXC B;  3MZW B;  1EDK A;  4GOE A;  1OVU A;  3PH0 A;  1EDL A;  1JM0 A;  2B87 A;  4ZMD A;  1MFT A;  3S1K A;  5CBN A;  1EDJ A;  5K5G B;  4IOI H;  2I8D A;  1ZXG A;  4MN4 C;  4NPD A;  1LP1 A;  2Q1K A;  3RGU A;  4GOF A;  2LR2 A;  1LT1 A;  5DJT B;  4CPG A;  2HR3 A;  4HB1 A;  2RKL A;  1BDD A;  4ZNC A;  1Y47 A;  1OVR A;  2OTK E;  5CBO A;  4K35 A;  1LP1 B;  2LXB A;  1EC5 A;  4NPF X;  2M0B A;  2KZJ A;  2B88 A;  1SS1 A;  4EYY Q;  1FC2 C;  2B89 A;  2M5A B;  1OVV A;  3MHV A;  4HKZ H;  4ASV A;  1BDC A;  2JWD A;  2KUB A;  4K3A A;  4GOD A;  1U7M A;  1NVO A;  1H0T A;  1ZW0 A;  2KS1 B;  1EDI A;  5EFW B;  1S3J A;  2QRX A;  2M5A A;  1DEE G;  2SPZ A;  2P58 A;  2QVA A;  3QWO C;  3FXE A;  4ASW A;  2KI7 B;  2K3R A;  1H0T B;  4JBZ A;  5DJU B;  2KZI A;  3FXD A;  4NPE A;  2WMM A;  2ZAE B;  3ZDM A;  5C39 A;  2B87 B;  2KIK A;  4WWI A;  1JMB A;  4BXL A;  2UWJ E;  2R44 A;  1U7J A; 
#chains in the Genus database with same CATH topology
 3G6E P;  3HUS A;  2WT7 B;  2W8Z A;  5CCG D;  3CCU P;  1SVF A;  1JY3 P;  4HJG H;  4PD4 I;  5AVR B;  2LXC B;  1RE4 A;  1R5S A;  2N9Y B;  3M9Q A;  4GOE A;  2E75 B;  3SFE C;  1UIX A;  3KQG A;  2E76 D;  1IFP A;  1GU5 A;  1GW4 A;  2K1A A;  3BVH A;  3CCE P;  4DZO A;  1QL1 A;  2A06 E;  3L72 E;  1MV8 A;  1FZE A;  4IFF A;  1N7S D;  1DD4 A;  1SQX G;  1SFC C;  1NTZ G;  3OA7 A;  3USS A;  2OYI A;  1NU1 D;  2A06 G;  1J2J B;  1NU1 G;  1OXZ A;  3F89 A;  1L0L D;  5APQ A;  1LTJ C;  2BEZ F;  1G2C B;  2O1J A;  3FWL A;  2RH0 A;  3RBX A;  3VN0 A;  1FJK A;  1IFM A;  2BEQ D;  3V2R A;  1L0L J;  2P7J A;  4M3L A;  4U3F E;  4Y99 C;  5KLV D;  3TNU B;  2Y0E A;  3Q3D A;  1VQN P;  2I8D A;  1ZXG A;  1LP1 A;  3I55 P;  1KOR A;  1SQQ K;  1BGY D;  3RK3 E;  1K05 A;  2GM4 A;  1EQ7 A;  3AEA C;  2QIW A;  1TU3 F;  4GOF A;  4OH8 B;  3S4R A;  3RBZ A;  1VQ4 P;  1S5L X;  2LR2 A;  2PGD A;  5KJ7 C;  3H1K D;  5H2F E;  2R3S A;  3MIW A;  3H1K E;  2WPS A;  4U7J A;  1Y8A A;  5APY A;  3VMY A;  1DIP A;  2LKM A;  4H13 D;  2HR3 A;  1NAF A;  1NTM J;  1RQU A;  3B4S A;  2PRR A;  3MUD C;  1GL2 D;  3L75 J;  3Q2Y A;  2XND H;  1KIL C;  1Y47 A;  2YIU B;  3RL0 D;  1S4X A;  2D2C B;  4H13 C;  2QEX P;  1KC8 Q;  3CCV P;  2OTK E;  3AE8 C;  1IO4 A;  2AEJ A;  1LP1 B;  2QE7 H;  3GHG B;  3PRJ A;  1URQ C;  1YJN P;  2GUS A;  1AA0 A;  3HRN A;  2MJZ A;  1OW7 A;  2RN0 A;  1Z56 A;  2D2C D;  2N1T A;  4EDF A;  1NGM B;  2H89 C;  1BE3 J;  1Y9B A;  3L75 E;  3Q5P A;  1SS1 A;  1P84 D;  3CXH E;  3II6 A;  3A0B E;  1BSN A;  1SQV D;  2W27 A;  1BCC J;  4PV1 D;  2KB7 P;  5AVS B;  3VMZ A;  1GDT A;  1ZME C;  2M5A B;  3VYI A;  1FJP A;  2ZT9 B;  2IPP A;  2J58 A;  1HGZ A;  1LNQ A;  1M56 D;  3M9H A;  3S9O A;  3BRV B;  1QLE D;  1LTT C;  1KB9 E;  1J1D C;  2CPB A;  4H44 B;  1IZN B;  2JWD A;  4PV1 C;  5TIS H;  2FFD C;  2KUB A;  2RMZ A;  2HLO A;  1IJD B;  3CWB G;  1BGY G;  5APS A;  4OGQ C;  1L0N J;  1RE3 C;  2JDI H;  4GIF A;  1NVO A;  1KIL E;  5AW2 B;  5CCH D;  1ZR2 A;  1SQQ E;  3P7K A;  2C9L Y;  4BWN A;  1H0T A;  4GDO A;  2N1T B;  1SQP G;  4I6M C;  5AVW B;  1D7M A;  2E76 C;  3V4W A;  3LW5 H;  2C0W A;  3L74 G;  1W2B O;  2G3A A;  2O01 J;  3L72 D;  1JOC A;  1Q82 Q;  1T6A A;  1IFJ A;  1LGH B;  2QJK B;  3ITK A;  5EFW B;  3SWY A;  3PTZ A;  2ZYD A;  2QRX A;  2CK3 H;  3MTU E;  2WSE J;  2QM8 A;  3AE5 C;  1L4A D;  1NU1 J;  4H0L C;  3HD7 C;  2P58 A;  3CLQ A;  4I2L C;  3M9B A;  4JYC A;  3CWB E;  1LJ2 A;  1BE3 G;  1SQX J;  4OWF A;  4BRY B;  2KLU A;  2YXR B;  3A5T A;  5APX A;  2K9J B;  2K3R A;  2P2U A;  3P8C E;  3HUS B;  5AVY B;  1KQF B;  1T3U A;  3SFD C;  2BCC D;  3Q5R A;  4D6T D;  1PPJ G;  2QJK C;  2R3C A;  3A7O A;  1VQ9 P;  1N86 A;  1H0T B;  5DJU B;  1KFM A;  2KS1 A;  3H1J E;  1N7L A;  2J5U A;  3M0D C;  2FXP A;  1M8O B;  3CXH H;  1VQ8 P;  4IFD K;  4YXD C;  2QSI A;  1LTI C;  3CWB J;  3HE4 A;  2B9B A;  3ZDM A;  2FYN C;  1KFN A;  1FOS F;  1S9K E;  2N1T C;  3TGU J;  3N7N A;  2ZVN B;  3G9R A;  1S9K D;  2HOD B;  3HD7 A;  2FXO A;  2JR8 A;  4U3F J;  4A7P A;  2HPC B;  1JMB A;  1M57 D;  1YBK A;  2N1T D;  2Q3I A;  3H1I E;  1KQG B;  2UWJ E;  3BCC G;  3L72 J;  1G2C A;  4LLH A;  1NKZ B;  5KLV G;  2ZXX A;  1K04 A;  1FDO A;  3KZI H;  2IYO A;  2W83 C;  4DT0 A;  5CCG C;  1JUN A;  2PAJ A;  1KIL D;  3RL0 C;  1N73 B;  4XFJ A;  2K9J A;  3CCM P;  5B66 E;  1X0T A;  4I7Z B;  4AUW A;  1N2D C;  1Q81 Q;  1K73 Q;  2E42 A;  1L0N G;  1L0N D;  2JJL A;  2NZ2 A;  2YIU C;  2GUV A;  1VQK P;  1LWU A;  1SQQ J;  3MUD A;  1KB9 I;  3L72 G;  5KLV J;  1NYH A;  1OZH A;  4N3Y B;  1OX3 A;  1MZ9 A;  4N78 E;  2DW3 A;  3KPE A;  2A45 I;  1NKN A;  3TGU G;  5AW5 B;  1NTK D;  1ZN5 A;  1N73 C;  2KSE A;  1JY3 N;  2C0X A;  3A0B H;  3L73 D;  3QH9 A;  3R4Y A;  5CCG A;  1YTZ T;  3NFQ A;  1T2K D;  5CBN A;  3MD0 A;  1S5L E;  1VPC A;  3H1H E;  4RKU J;  1YQ4 C;  5AVX B;  5KLV E;  1CSB A;  3FGA D;  4PD4 H;  3I5C A;  3L70 J;  2FYU K;  3JSV C;  3H1H G;  4LGD E;  3UIA A;  2VRS A;  3WU2 E;  1SP4 A;  2I1J A;  5KJ7 A;  5GTI E;  2PFX A;  3AEB C;  1HJ0 A;  1IFN A;  1KYO I;  1ZV8 A;  2A45 G;  2FYU E;  2P67 A;  2WSF H;  2Y0C A;  3GHG A;  3IN6 A;  3AE7 C;  1DD3 A;  1YI2 P;  2E5T A;  3WUV A;  4YTP C;  3L75 G;  3TDK A;  1PGJ A;  1SQV G;  2P10 A;  3PLN A;  1ZR4 A;  3AE9 C;  3CC2 P;  1M1K Q;  1U57 A;  1XTG B;  2AXT H;  3L70 E;  5GTH E;  3M0D A;  1HJB A;  1LT1 A;  5KLI C;  3TGU E;  1NTZ E;  1EZV I;  1USE A;  3GLM A;  3L35 A;  1G1I A;  4PJ0 E;  5DJT B;  3GF7 A;  5APW A;  4CPG A;  1VQP P;  1YJ9 P;  4HB1 A;  1NTM D;  2K9Y A;  1KQL A;  3AE1 C;  1DH3 A;  3GMA A;  2RKL A;  1X79 B;  1Q7Y Q;  4WVZ A;  2WPR A;  2YO2 A;  3U1A A;  1BGY J;  1JY2 N;  4L75 A;  3B8E B;  1P84 I;  1SQP E;  3SWK A;  2KNC A;  4B86 A;  1M90 Q;  2AXC A;  2W6A A;  3RK2 D;  1R5L A;  1KMI Z;  3Q5S A;  3EFF K;  3G3Z A;  3L73 E;  3O6Q A;  1S2E A;  3PHL A;  1IK7 A;  2HG5 D;  2YNY A;  4R4L A;  3V4Q A;  4EI2 A;  5KLV K;  3H1K G;  1GZL A;  2WSC H;  2J59 M;  3L73 G;  5APT A;  2FFD A;  1RQV A;  1CI6 A;  1NOH A;  3AE4 C;  3RK2 B;  4DCK A;  3R2P A;  4UB8 E;  5KAI E;  2XDJ A;  1OIP A;  2YKO A;  2HPC A;  5TIS E;  1EXI A;  1NTK J;  4BRY A;  3CD6 P;  4H44 C;  3VP9 A;  1SQB J;  3LIE A;  5KTB A;  3BAS A;  4IL6 H;  2FYZ A;  4IL6 E;  3CCQ P;  5BU5 A;  1FAV A;  1M7L A;  2FYU J;  2POH A;  1Q86 Q;  2KNC B;  2XV5 A;  1OMI A;  1S72 P;  3AEF C;  1VQL P;  3L74 E;  2WSS H;  1HTL C;  2KS1 B;  4R4M A;  3P8M C;  3V2Q A;  3CC7 P;  2Q9I A;  3C1L A;  1ZRT D;  3M0A A;  3O6Q B;  4ZKU A;  1FZG A;  2E76 B;  1IFD A;  1E79 H;  3HE4 B;  4W7Y A;  3WMM 0;  1NTK E;  1FE6 A;  1SQB D;  1WRG A;  1NAY A;  4UB6 E;  1QL2 A;  1DEE G;  2FXM A;  2HOD A;  2SPZ A;  1CI6 B;  2WPQ A;  1FZA A;  3BCC E;  3HD7 B;  1L0L K;  4WB4 A;  3CWB D;  5TJH A;  2OYH B;  1FZC A;  1VQ6 P;  2IBZ D;  1DX7 A;  1J1E B;  4OVN F;  3TSI A;  2Y9Y A;  1VQM P;  1RHZ B;  4U3F D;  2KYV A;  4IFM A;  2BCC E;  1GTW A;  1N73 A;  1N7S A;  2FKW B;  2WZ7 A;  2R5D A;  3LW5 J;  1PPJ D;  2Z5I A;  3WU2 H;  1FS0 E;  2BCC G;  3E1I A;  1YIJ P;  2H88 C;  1CZQ A;  1LWU B;  1L2P A;  1GL2 C;  2BAS A;  2K88 A;  2KZI A;  2ZYA A;  3C9I A;  3H25 A;  2N9B A;  4NPE A;  2WMM A;  1ZOY C;  3H1L J;  2ZT9 C;  4C46 A;  5C39 A;  3CI9 A;  5AW1 B;  1NU1 E;  1FZC C;  5GTH H;  3AE2 C;  3H1I D;  3SSU A;  2E75 C;  2IFN A;  3VOP A;  2OYH A;  2OGU A;  1L0L E;  1RF0 C;  3CX5 E;  3TGU D;  1JEK A;  5AW4 B;  5KJ7 D;  2HFE D;  1NTM E;  1OFC X;  5APU A;  2IZ1 A;  2YMK A;  1HH0 A;  2R44 A;  5E79 H;  3D6Z A;  1KQS O;  3HE5 B;  1KTM A;  1N7S B;  4KJM A;  1Q2N A;  3MGN A;  3JCU E;  1GU4 A;  3BRT B;  1J1E C;  3KHU A;  4Y28 J;  2YKP A;  3AEG C;  1A02 J;  1NH4 A;  1QX8 A;  1EDK A;  1SQP D;  1GK6 A;  3CXH I;  3MZW B;  5KKZ C;  1RH5 B;  2O1K A;  2NPS D;  2XNX A;  3IF4 A;  1IC2 A;  3PH0 A;  5M1B A;  1GL2 A;  4WBA A;  3RL0 g;  2Z4E A;  1EDL A;  2E5Y A;  2OTJ P;  5AW6 B;  1JM0 A;  2WSE H;  4GT1 A;  5CJ4 A;  1QEX A;  2ZXE B;  4ZMD A;  5CCH C;  3V2P A;  2QA4 P;  1KYO E;  1FBM A;  4KHX A;  1QVF O;  1PZQ A;  3H1L D;  3HUS C;  2CPS A;  1OW6 A;  2ZJS E;  3A3Y B;  3HE5 A;  4IOI H;  3H1J J;  1L4A A;  4JPZ B;  5AVT B;  3H1K J;  3KZI E;  3RK3 C;  1USD A;  4MN4 C;  1MKM A;  4WY4 C;  1PP9 J;  1SQP K;  1L0N E;  4L73 A;  4EOT A;  3CME P;  1MFZ A;  1UII A;  5AW3 B;  1LTJ B;  3B71 A;  1JTH A;  2ZYG A;  3W68 A;  1BSH A;  3CX5 D;  3O8Z A;  2IYP A;  1JCC A;  3AEC C;  1SQV E;  1JO5 A;  3F5H A;  1NU1 K;  4I1L A;  3CCR P;  3BCC D;  2FFD B;  1KB9 H;  4WY4 B;  1W2E A;  1SQX K;  2YXQ B;  1FDI A;  2IBZ E;  1T2K C;  3HD7 D;  2L91 A;  2KP8 A;  1R8E A;  1EZV D;  2FY8 A;  1EZV E;  5APV A;  3V5B A;  4EIJ A;  4Z1M H;  3E1R A;  1NTK K;  4K35 A;  3CX5 I;  4U3F G;  3VMX A;  1SQB K;  4C7N B;  2LXB A;  2O01 H;  1FU1 A;  2ZFC A;  1SLQ A;  2A45 H;  2YKQ A;  1AVO A;  1SQQ D;  2WWW A;  2M0B A;  4NPF X;  5AW9 B;  2XKM A;  3E7K A;  3L71 G;  2KZJ A;  3AEE C;  3EQ2 A;  1LTA C;  2O3J A;  2ZT9 D;  2B88 A;  1VF5 D;  1SQB G;  2OQQ A;  1URQ A;  2V7Q H;  1FZB A;  1NTK G;  1SFC D;  2WSF J;  4EYY Q;  5KAF H;  1AFO A;  1K8A Q;  1FC2 C;  1YHQ P;  3KXD A;  3L70 D;  5L8R J;  3RK2 C;  3SWF A;  1LT9 C;  3K5B A;  2Y9Z A;  3IR9 A;  1GD2 E;  2IZ0 A;  1OVV A;  1BE3 D;  3MHV A;  1S5L H;  1YIT P;  1FZC B;  1BE3 E;  1GMJ A;  4ASV A;  3IFM A;  1YQ3 C;  3OJA B;  1X8Y A;  2KLV A;  4RES B;  1BDC A;  3L37 A;  4K3A A;  1VQO P;  1OWA A;  1JCD A;  1Q90 D;  3L4F A;  1AV1 A;  4GOD A;  2Q7C A;  4C7R A;  2V4H A;  4H0L B;  4XA4 A;  1RF1 B;  1IFI A;  3I56 P;  1ZRT E;  4GKG A;  4D6T E;  2QJP B;  1X9V A;  1JB0 J;  1ZW0 A;  2Q3E A;  3L74 J;  1M1J C;  1SQQ G;  2NPS C;  3MP7 B;  5AW7 B;  3H1J D;  5H2F H;  5KLI B;  1URQ B;  3L71 D;  1GW3 A;  1S3J A;  1ZP0 C;  1PGP A;  1JY2 O;  1WT6 A;  3H1I J;  4TLF A;  2E43 A;  2AEM A;  3N4X A;  1JMM A;  1VQ5 P;  3FX0 A;  1KB9 D;  2AEF A;  3C8V A;  3NXS A;  1SFC B;  3BCC J;  5E79 E;  2W6B A;  1VQ7 P;  2FYN B;  2G8Y A;  4PD4 D;  1LT9 B;  3QWO C;  4ASW A;  4PD4 E;  1NTZ K;  1PPJ E;  2E75 D;  2XU6 A;  1JNM A;  2Q5U A;  1H8A A;  1SQV J;  3B5N C;  1BCC G;  1LWU C;  3KDP B;  1YJW P;  1RF1 A;  2PP6 A;  4JBZ A;  2R5B A;  1FZF A;  4ZKP A;  4LC1 A;  5AVV B;  2WPV B;  3RL0 B;  3B5N A;  2NRG A;  5KAF E;  1SQX E;  1GL2 B;  4L76 A;  5CJ0 A;  4W7Z A;  2QJP C;  3H6P A;  1KN7 A;  2B87 B;  3H1I G;  2KIK A;  1ZLL A;  3KYQ A;  4BXL A;  3U1C A;  2ITA A;  4L74 A;  2QM7 A;  3TYY A;  1N8R Q;  4XE5 B;  1U7J A;  3VP8 A;  1VF5 C;  1JY3 O;  1L4A B;  3H1L G;  3IAO A;  3P8C D;  2QG4 A;  2H7H A;  1PP9 G;  2Q6Q A;  4H44 D;  5AW8 B;  5B5E H;  3A0H H;  3AE6 C;  1OVU A;  3P32 A;  5BU8 B;  1SQP J;  1RE3 A;  3VTP C;  1PGO A;  4TT3 H;  3B5N B;  4W80 A;  3H1J G;  3OW2 O;  2XZR A;  2OTL P;  1LTJ A;  1NO4 A;  1JTH B;  2OYO A;  3T97 A;  3G71 P;  3CCJ P;  1KYO D;  2E74 C;  1KZU B;  2B87 A;  2M3B A;  1VF5 B;  1MFT A;  3D70 A;  1MUU A;  2WTY A;  2MKV A;  2V7Q J;  3S1K A;  2I1K A;  4WY4 A;  1L0L G;  2KK7 A;  1AVY A;  1NTM K;  1EDJ A;  2JEE A;  1OW8 A;  4UB8 H;  5K5G B;  5KAI H;  4HH2 A;  1NWQ A;  4YPC A;  1BCC D;  1RE4 C;  3WUU A;  1RY3 A;  2WT7 A;  4DJG A;  5CBO A;  2IDB A;  2KOG A;  2K37 A;  4NPD A;  4DOJ A;  4C7N A;  4PV1 B;  2Q1K A;  3TF5 A;  1SQX D;  1FOS E;  3PP5 A;  2FYU G;  4WY4 D;  3RGU A;  2IBZ I;  1HVV A;  2JWA A;  2ZVO B;  3L70 G;  2WVR A;  3A0H E;  1P84 E;  3CXH D;  4N78 D;  4AQR D;  3OAK A;  3JC2 2;  1K9M Q;  1H88 A;  1H89 A;  3TNU A;  1T3J A;  1KD1 Q;  2OYI B;  3W67 A;  2AXT E;  1YYC A;  1HGV A;  5CMZ A;  3V6I A;  3M91 A;  2Y0D A;  1PIX A;  1KIL B;  1EZV G;  2JO1 A;  5BVZ A;  3GG2 A;  1BDD A;  4ZNC A;  3CMA P;  1OVR A;  4AYC A;  2IBZ G;  3GHG C;  5KKZ B;  2FYU D;  4IL6 X;  2P1J A;  3L36 A;  1EXJ A;  1XTC C;  5B5E E;  2KXP B;  1T8Z A;  2D2C C;  1L0N K;  1EC5 A;  4H13 B;  2YMY A;  3CC4 P;  2BCC J;  4JYB A;  2FBW C;  2M8R A;  1FDM A;  3M06 A;  1A02 F;  3CPW O;  1X22 A;  3GF3 A;  3TK1 A;  4HYT B;  1RF0 A;  2OYH C;  2A06 D;  1GK4 A;  4UB6 H;  1IK9 A;  1S1C X;  2E74 D;  1NTZ D;  1M1J A;  2NPS A;  2QJY B;  3LID A;  1KYO H;  2WIT A;  4JQ0 D;  1SQB E;  5GTI H;  2C9N Y;  2B89 A;  1HWT C;  1CW5 A;  4Y99 B;  2O01 N;  4YXW H;  1J1D B;  1KIL A;  3CL3 D;  3H32 B;  3L71 J;  4PJ0 H;  1WMK A;  1SFC A;  3WUT A;  5CCH A;  2OYI C;  4HKZ H;  2W6J H;  2KSJ A;  3GW6 A;  1LT9 A;  3A2A A;  1E5W A;  1LTS C;  3NMD A;  3BAT A;  1RF1 C;  5B66 H;  1U7M A;  1SQV K;  2JKV A;  3JCU H;  1DEB A;  1PGQ A;  1PP9 D;  1BGY E;  3HTK A;  5AVU B;  4OGQ D;  3RK3 D;  3VMA A;  1VL2 A;  2L5G B;  5AVQ B;  2H43 A;  4D6T J;  4N6J A;  2HYN A;  4I7Z C;  3L71 E;  1PFI A;  4D6T G;  1HF9 A;  3H1H J;  1EDI A;  2IX7 C;  1M1J B;  1LTG C;  2GA1 A;  2NPS B;  3CX5 H;  3D6Y A;  2OAR A;  2W90 A;  1HBW A;  5AW0 B;  2H8P D;  1PV3 A;  3PJS K;  2M5A A;  2WQY C;  3V2N A;  3L73 J;  1NJI Q;  1NTM G;  3AE3 C;  2QJY C;  3H32 A;  4JF7 A;  2WSC J;  2E74 B;  3CCL P;  1AQ5 A;  2QVA A;  1QGK B;  1BCC E;  3FXE A;  4QMA A;  5AVZ B;  3EFG A;  2KI7 B;  2JP3 A;  2Z5H A;  3G4S P;  3Q1M A;  2YO3 A;  1G1J A;  1URQ D;  3D71 A;  3L74 D;  3HTK B;  1QVG O;  3AED C;  3EWK A;  4O9B A;  1VDF A;  1AJY A;  1W5C E;  3FXD A;  4H0L D;  1N7S C;  2ZAE B;  1KV4 A;  1YTZ I;  3L75 D;  4RO0 A;  2M3E A;  3T97 B;  1P84 H;  3NTN A;  3FWN A;  3CCS P;  1NHL A;  3U59 A;  4KT0 J;  3B5N D;  4WWI A;  1HUC A;  3ABV C;  5CHX A;  3H1H D;  4OGQ B;  2R32 A;  3RK3 B;  2IFM A;  4RJT A;  1L4A C;  1PL5 A;  3H1L E;  1NTZ J;  1JY2 P;  1LTB C;  1PP9 E;  1AQT A; 
#chains in the Genus database with same CATH homology
 4KJM A;  1Q2N A;  1X0T A;  4HJG H;  2LXC B;  3MZW B;  1EDK A;  4GOE A;  1OVU A;  3PH0 A;  1EDL A;  1JM0 A;  2B87 A;  4ZMD A;  1MFT A;  3S1K A;  5CBN A;  1EDJ A;  5K5G B;  4IOI H;  2I8D A;  1ZXG A;  4MN4 C;  4NPD A;  1LP1 A;  2Q1K A;  3RGU A;  4GOF A;  2LR2 A;  1LT1 A;  5DJT B;  4CPG A;  2HR3 A;  4HB1 A;  2RKL A;  1BDD A;  4ZNC A;  1Y47 A;  1OVR A;  2OTK E;  5CBO A;  4K35 A;  1LP1 B;  2LXB A;  1EC5 A;  4NPF X;  2M0B A;  2KZJ A;  2B88 A;  1SS1 A;  4EYY Q;  1FC2 C;  2B89 A;  2M5A B;  1OVV A;  3MHV A;  4HKZ H;  4ASV A;  1BDC A;  2JWD A;  2KUB A;  4K3A A;  4GOD A;  1U7M A;  1NVO A;  1H0T A;  1ZW0 A;  2KS1 B;  1EDI A;  5EFW B;  1S3J A;  2QRX A;  2M5A A;  1DEE G;  2SPZ A;  2P58 A;  2QVA A;  3QWO C;  3FXE A;  4ASW A;  2KI7 B;  2K3R A;  1H0T B;  4JBZ A;  5DJU B;  2KZI A;  3FXD A;  4NPE A;  2WMM A;  2ZAE B;  3ZDM A;  5C39 A;  2B87 B;  2KIK A;  4WWI A;  1JMB A;  4BXL A;  2UWJ E;  2R44 A;  1U7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...