2O01H

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
75
structure length
75
Chain Sequence
WDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLPITRGPQQPPKLGPRGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 3
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2o01H01
1SQBK 2FYUK 1SQXK 2O01H 1L0NK 5KLVK 2WSFH 3G3ZA 2WSCH 1SQVK 2LKMA 2WSEH 3M9QA 1NTZK 1L0LK 4IFDK 1NTMK 1SQPK 2J59M 3CLQA 3LW5H 2OARA 1NTKK 1SQQK 1NU1K
chains in the Genus database with same CATH superfamily
2WMMA 1G2CA 1KV4A 1NU1J 3KYQA 4JYCA 2Q9IA 2KK7A 3CCQP 1JY3O 3TSIA 1LT9C 3AEGC 3P8CD 5TISE 1NU1D 1BDCA 3A0HE 5APWA 1SQBE 3A3YB 1GL2A 1FOSE 4IFMA 3BASA 3MZWB 2E43A 1G2CB 3G9RA 1IC2A 2M0BA 1HJBA 1R5LA 2RN0A 3BRVB 1P84I 3EQ2A 1NTZK 1NKZB 2IX7C 3BCCG 3BRTB 1KMIZ 3GW6A 1ZN5A 3RK3E 2QRXA 4HKZH 4QMAA 1LWUC 5AVSB 3SFEC 3USSA 3G6EP 1YJWP 1LNQA 2KI7B 2E42A 2OTJP 1FJKA 1N7LA 1H89A 4H0LB 3GF3A 1FZCC 1ZRTD 3L70G 1U57A 2HPCA 2N9YB 2RH0A 1QLED 2JJLA 3WUUA 2AXTE 3H1IE 1RF0A 1ZV8A 2NPSD 4BRYA 1FBMA 2M3EA 1URQA 1JM0A 3MGNA 1OXZA 1YTZI 2HPCB 2KOGA 2D2CB 1M1JC 2YO3A 3B5NC 1ZMEC 2R3SA 4AQRD 3TGUG 1HGVA 3HD7B 4BRYB 3A0BE 3E1IA 2IYPA 3L75D 3NMDA 2WPSA 3L72E 2KZIA 1EQ7A 2LXBA 4HYTB 2OYHA 1CSBA 3L36A 2Y0CA 2OTKE 1HJ0A 3O6QA 1QL2A 3A7OA 4I1LA 5TISH 1YBKA 2K3RA 1YITP 3AE4C 3OA7A 1KB9D 2OYHB 2C0WA 3CX5I 3B71A 3H25A 4H0LD 3O6QB 4N3YB 2W83C 5KTBA 2R3CA 1ZOYC 2PGDA 4D6TE 1NTMJ 3L73J 3CCUP 3CXHD 3RK2D 2QVAA 2G8YA 1NTKJ 2J5UA 5DJTB 2IBZE 1NTMD 3CD6P 1PGQA 1MFTA 1T3JA 1NTKD 1KD1Q 3GHGA 3U59A 4U3FE 2D2CD 2OTLP 4WVZA 3IN6A 1KORA 3HD7D 1NTZE 1YQ3C 2YIUB 1PPJG 3HE4A 1LTJA 3GHGB 4L74A 3L73G 3H1LE 4I2LC 3T97A 1CZQA 2YKQA 1N73B 2E76C 3CC4P 3RL0B 1KILB 3HE4B 1JMMA 1LTJB 2YMKA 1SQVJ 3EFGA 1EC5A 2CK3H 3T97B 2IZ1A 1GMJA 3M0DC 1SQVD 2KB7P 2YXQB 3VN0A 1SFCA 4DJGA 3PLNA 3Q5SA 2O01H 2OYIB 4LGDE 1T8ZA 1PP9D 1IFIA 1H8AA 1AFOA 1P84D 5KKZC 5B66H 3VOPA 2OQQA 5KAFH 4PD4E 4GOFA 4MN4C 1PFIA 2FYNC 1SFCB 2XNDH 1EDJA 3Q2YA 1DX7A 2B88A 1SQVG 3BCCE 1VF5B 3AE7C 1L2PA 1S4XA 1L4AB 2ZT9B 2Y9ZA 1J1EC 5GTIH 4EIJA 1M8OB 3CCVP 2B89A 1LGHB 1KQGB 1WRGA 2GA1A 3L70E 3B8EB 1AV1A 5TJHA 3H1HG 3LIDA 4OVNF 3VP9A 2E75D 1D7MA 2JDIH 3M9BA 1EXJA 1RF1C 2P2UA 2M8RA 3RL0D 3S4RA 1KILD 4K35A 3JC22 5KLVG 3W68A 2P58A 2BCCJ 3M91A 1S5LH 4YTPC 2QJPC 4OWFA 3TGUE 4JF7A 2BCCD 3ZDMA 2KNCA 3H1ID 3H6PA 5KLIB 5CCGD 4BWNA 4LLHA 1SQVK 1S9KE 5AW4B 1LTIC 3CWBJ 1M1KQ 3N7NA 4H13B 3C1LA 1VQPP 3CWBD 1M7LA 1SFCD 3V2RA 4C46A 3GF7A 1SLQA 3L71J 1LP1A 3CX5D 1L0NJ 2R5DA 3VYIA 5KJ7A 2WT7A 1L4AD 3H1JJ 1RE4C 2ZT9D 1VQMP 3F5HA 1L0ND 5KAIH 3OW2O 1SQXE 3KQGA 3QWOC 3VMYA 1SQPJ 4HB1A 1NYHA 1H0TA 5AW9B 1LTAC 5KLVK 1MFZA 4ZKUA 1NAFA 1LP1B 2CPBA 1USDA 2J58A 3F89A 2WT7B 1G1IA 2HFED 5C39A 4JQ0D 1JNMA 3CLQA 5AW0B 2JR8A 3L71G 2FFDA 4XE5B 2XV5A 3ABVC 3H1JG 2H43A 1S72P 2OGUA 4M3LA 2FYZA 1PV3A 1VQ6P 1SQPG 2G3AA 1KB9I 5AW5B 2HLOA 1PPJE 1FZGA 1CW5A 1OW7A 1SQQK 2FFDB 1GL2C 2QEXP 4ZNCA 3A5TA 3RBXA 3ITKA 5APUA 1EDLA 3M9HA 3HUSA 1BCCJ 3U1CA 1JO5A 1X0TA 2HODB 3M0AA 1JY2P 4H13D 2Q1KA 2YKOA 1BCCD 5CBOA 1SS1A 1GK4A 2GUSA 1VQ7P 1KYOH 2FXMA 3CC7P 1DEEG 1UIIA 3IF4A 1T6AA 5APQA 1LJ2A 2K37A 1OVRA 2BASA 1FJPA 3KXDA 2L91A 1FZBA 1NHLA 2E5YA 1LTGC 3AEAC 2NPSA 3AEFC 3H1LD 1FDIA 4C7RA 2ZYDA 1OFCX 3Q3DA 3GLMA 1NVOA 4GKGA 2MKVA 3PHLA 5CHXA 2QJKB 1BE3G 4XA4A 2WSSH 3P7KA 1VQNP 3EFFK 5KJ7D 2N1TC 2K1AA 1RF0C 1SQPK 4IOIH 2O3JA 1IFMA 2N9BA 1AQ5A 1BGYJ 1URQC 2FYUJ 1DEBA 1BGYD 1Q86Q 1A02J 2V7QJ 1GU5A 2FYUD 4UB8H 2JO1A 4PD4D 1KB9H 1Q2NA 2L5GB 2H89C 4R4LA 3H1HE 2C9NY 2OYHC 1DIPA 3HRNA 3CL3D 3MHVA 1KFMA 2A06D 1IJDB 1BGYG 3V2PA 4B86A 1W2BO 5KLVE 1FDMA 4WB4A 1NU1G 2FYUG 4IFFA 1RH5B 3CXHH 4H44C 5AVYB 5AW6B 1R8EA 2ZFCA 2O01N 3M06A 4W7YA 1FZFA 1ZW0A 2YKPA 5CMZA 2XNXA 4EDFA 1LT1A 3U1AA 3MIWA 5APXA 4JBZA 2A06G 1M90Q 3Q1MA 2YMYA 3H1KJ 1QGKB 4EYYQ 4PJ0H 1S2EA 3OJAB 3RK2B 4CPGA 3HD7A 5CJ0A 1YIJP 2QJYC 3H1KD 1GK6A 2YIUC 1SQQE 4OGQB 1KFNA 1IZNB 3GHGC 3R2PA 2H7HA 4ASVA 3NXSA 2WPQA 1ZR4A 1MKMA 1N7SD 4WY4D 2ZVOB 1S9KD 3L75J 1VL2A 1J1DB 3Q5RA 2VRSA 1GD2E 3II6A 2J59M 2KLVA 3K5BA 1LTJC 1E5WA 2FXPA 3TK1A 2PFXA 4YXDC 3EWKA 1NU1K 1JCCA 4GODA 1GDTA 3M9QA 3E7KA 1AVOA 1SQXD 1K8AQ 3AE5C 5B66E 1P84H 3CCRP 5KAFE 4Y99B 2I1JA 3L75G 1EZVE 3S1KA 4RESB 3I55P 1ZXGA 1YHQP 2KUBA 2Y9YA 1VF5C 1L0LJ 1N8RQ 4L75A 2YXRB 1QVFO 3CCLP 5GTIE 1L0LD 1IFJA 3FXEA 3BVHA 2PP6A 5BVZA 2PRRA 5APYA 3WU2E 2LR2A 1H88A 4OGQD 1PIXA 1RE3A 2E74D 1N73A 1UIXA 2K88A 2RKLA 2GUVA 1HF9A 1LTTC 1KILA 1KTMA 1K9MQ 5AVQB 2Q3EA 1S5LE 1NTMG 1X79B 4I6MC 1FAVA 3A2AA 3O8ZA 2KS1B 1NTKG 1BE3E 3L74J 2E75B 5CCHA 2R44A 5APVA 1JY2N 1T2KD 3RK3B 1OVVA 3L74D 2OYIA 1FZAA 3S9OA 5CCGA 5CBNA 3B5NB 3MTUE 2M3BA 3FX0A 1YTZT 3KHUA 2Z5IA 1PP9J 5L8RJ 4N78E 4OH8B 4K3AA 3SWFA 2KYVA 3CX5H 3L74G 1HH0A 1VQOP 1R5SA 2B9BA 5KAIE 1L4AA 3OAKA 2KIKA 2WSCJ 1VQ5P 1E79H 2AEJA 1SQBJ 2OYOA 2C9LY 1JCDA 1NU1E 1SQBD 1VQ4P 1NTMK 1IK9A 4PV1B 3D6YA 2WITA 4IL6H 1PP9G 1VQ8P 1NTKK 1Q81Q 5AW7B 5E79H 5AVVB 1S3JA 5AVWB 1BSNA 5AW3B 1Y8AA 1KZUB 3WU2H 2FY8A 4PD4I 2Q5UA 1JY3P 2W90A 1NOHA 1KC8Q 3VMAA 1SQBG 3RK3D 3TF5A 2ZYGA 4W7ZA 2NZ2A 2YO2A 2XU6A 4ZKPA 2Q6QA 2O1JA 2FFDC 1KQLA 3B5ND 2XKMA 3KZIH 3H1IJ 5CCHD 1GW3A 1KYOE 2P1JA 4UB6H 1W2EA 1YJNP 4DZOA 1T3UA 3FWLA 4LC1A 1SP4A 3TYYA 5AW2B 1LTSC 3HUSC 1ZP0C 3W67A 3JCUH 3QH9A 3BATA 5BU8B 2ZVNB 3L72J 2BCCG 1U7MA 3H1IG 3JSVC 2QJKC 4PV1D 3L72D 4GOEA 2BEZF 2NPSC 4I7ZB 2QIWA 3LIEA 2Q3IA 3G3ZA 3CWBG 3TNUA 1MUUA 2ZXXA 1RY3A 3AE3C 1HBWA 1YI2P 4UB8E 1IFNA 3R4YA 2V7QH 1X9VA 1KB9E 1EZVD 1M56D 3VMZA 2IFMA 1LTBC 1L0NG 1KN7A 4RO0A 1GTWA 4D6TJ 3AE2C 3TNUB 4EOTA 1YQ4C 1XTGB 2HODA 1IO4A 4D6TD 4RKUJ 3PRJA 1PZQA 1GU4A 2P7JA 3VP8A 3AE6C 4HJGH 2IBZD 3CXHE 5B5EH 3PTZA 1X8YA 1NTME 2E76D 1QL1A 4U3FJ 3L73E 3FWNA 3CC2P 1NTKE 5EFWB 2C0XA 4IFDK 4L76A 4U3FD 4Z1MH 1S1CX 1NTZJ 4R4MA 2QA4P 2AEMA 2WSFJ 1PGJA 4H0LC 1VPCA 1NGMB 1QEXA 1NTZD 2Y0EA 4PJ0E 3IAOA 3H1LJ 2JKVA 1Q82Q 4KHXA 3RK2C 2QM7A 2AXCA 2Y0DA 2KZJA 1RQVA 1FC2C 2JP3A 1BCCG 1NKNA 1L0NK 3SWKA 2D2CC 1DD4A 3RL0g 1N7SA 3V4QA 4WY4A 1ZR2A 1OMIA 1RHZB 1NO4A 3HD7C 1J1DC 1SQVE 3H1LG 2WTYA 1TU3F 1N7SB 1AJYA 4WY4B 5H2FH 4TLFA 1P84E 3BCCJ 2WSEJ 1FE6A 1Y9BA 1OVUA 4DT0A 3BCCD 4YPCA 1HUCA 4Y99C 2KSEA 3LW5J 3MUDA 2WVRA 1CI6A 3MD0A 2B87B 1AVYA 3L35A 3VTPC 3L70J 1S5LX 2DW3A 1DH3A 3L70D 1CI6B 1GL2B 3CMAP 2H8PD 1NH4A 1U7JA 3HTKA 1KILE 1JY3N 1N86A 1GW4A 3TGUJ 1K05A 3V2QA 1JEKA 3AEDC 3WMM0 3D70A 3G4SP 2O1KA 4WBAA 3FXDA 1JTHA 3TGUD 5AVZB 1KYOD 4O9BA 5GTHH 4EI2A 2BCCE 1WMKA 2N1TA 1FS0E 3SFDC 2E74B 1RE3C 3HTKB 1N73C 2POHA 2E75C 3RK3C 1NAYA 3RL0C 1JTHB 1KILC 3C9IA 3H1KG 4DCKA 4GT1A 3CWBE 2N1TB 2WWWA 3VMXA 1LT9A 2FYUK 5CCHC 3CCJP 2A45I 1SQXJ 1BSHA 3PP5A 2I8DA 3CX5E 1Q7YQ 2LXCB 1K04A 3L71E 2OYIC 1DD3A 1URQB 5CCGC 1L0NE 3H1JE 2IYOA 2IZ0A 4RJTA 1LT9B 2H88C 1SQPE 2WSCH 2XZRA 1GL2D 1SFCC 3N4XA 3C8VA 3A0HH 5CJ4A 1KQSO 1LWUA 4IL6E 2OARA 1OW8A 2WPVB 4N6JA 2KXPB 3E1RA 4PV1C 1SQXG 5E79E 1L4AC 2HG5D 1JY2O 4ZMDA 2ZT9C 1FDOA 4AYCA 5AVUB 3V2NA 1FZCA 2QSIA 4H44B 3AEEC 1JUNA 1PPJD 1EZVI 1LWUB 2KS1A 1VQKP 1HTLC 2QE7H 3AEBC 2I1KA 1EDKA 1YJ9P 3L73D 2FKWB 3IR9A 3RGUA 1A02F 2SPZA 1YYCA 4NPEA 1NJIQ 1L0LG 1FZCB 1M1JA 3B5NA 3KZIE 1G1JA 2IBZI 1BCCE 2N1TD 2ZXEB 2BEQD 4JPZB 3D71A 4Y28J 2QJYB 2KP8A 3V4WA 2AXTH 2NRGA 4UB6E 2ZYAA 5AVTB 3IFMA 4DOJA 3NFQA 3GG2A 3AE1C 5KLIC 2MJZA 1URQD 1M1JB 1OW6A 2A45H 4W80A 3JCUE 3I5CA 2QM8A 5APSA 4H13C 1SQXK 2W6AA 3A0BH 1Q90D 1Y47A 1IFDA 2V4HA 3HE5A 1PGPA 1USEA 2ITAA 3MP7B 1M57D 2HR3A 3L4FA 1FU1A 3P32A 4I7ZC 2GM4A 1BGYE 1QX8A 4H44D 1L0LK 1QVGO 1N2DC 3P8CE 3RBZA 2FYUE 3HE5B 4C7NA 5BU5A 3H1HJ 3CCMP 1IK7A 5KJ7C 4YXWH 4XFJA 3H1HD 2K9JA 1OX3A 3G71P 5KLVJ 2HYNA 2W8ZA 3SWYA 2A06E 1EDIA 2W6JH 2IDBA 1JB0J 4L73A 5KLVD 4C7NB 3SSUA 3I56P 3PJSK 2Q7CA 3D6ZA 5B5EE 3TDKA 2K9JB 2PAJA 2JWAA 2K9YA 5AW1B 4KT0J 4JYBA 3B4SA 1X22A 2KSJA 1GZLA 1ZRTE 2FBWC 1SQQJ 3FGAD 2WSFH 1IFPA 2E76B 2CPSA 3H1KE 1SQQD 3M0DA 1AA0A 3L37A 2WZ7A 2RMZA 5APTA 2R32A 3GMAA 2IFNA 2E5TA 3KPEA 2WQYC 4HH2A 2IPPA 2ZAEB 1KYOI 2M5AA 3L75E 3AE8C 2O01J 1J2JB 1SQQG 2KNCB 1OWAA 2A45G 1SQBK 1VF5D 1PL5A 1EXIA 1HGZA 2ZJSE 1OIPA 2Z5HA 3WUTA 5KKZB 3L71D 3UIAA 2XDJA 2M5AB 5H2FE 1BDDA 2FYNB 4GIFA 1HVVA 1N7SC 3H32A 4WY4C 3H1JD 4PD4H 1W5CE 3L72G 3CMEP 1SQPD 2KLUA 3P8MC 2WSEH 1RF1A 1PGOA 3WUVA 1HWTC 1J1EB 1MV8A 2W27A 2JWDA 1Z56A 2W6BA 1OZHA 4ASWA 3H32B 3LW5H 4A7PA 2Z4EA 1H0TB 1KQFB 1VQLP 1SVFA 1L0LE 4NPFX 3AE9C 2R5BA 1EZVG 1RF1B 1AQTA 2QG4A 1K73Q 1NWQA 3CCSP 3MUDC 4NPDA 3V5BA 1XTCC 4D6TG 5DJUB 1FOSF 5AVXB 2P10A 2QJPB 3CI9A 1BE3J 5AW8B 2IBZG 4BXLA 2P67A 3CXHI 4WWIA 4GDOA 1BE3D 3CCEP 5AVRB 5GTHE 2AEFA 4U3FG 3NTNA 4KJMA 4AUWA 5M1BA 4OGQC 1RE4A 5K5GB 4TT3H 3L74E 3HUSB 3Q5PA 2E74C 2WPRA 1NTZG 1WT6A 1JMBA 2UWJE 3V6IA 1JOCA 4U7JA 2YNYA 4N78D 1ZLLA 3CPWO 1FZEA 3AECC 2LKMA 2JEEA 2NPSB 4IL6X 1MZ9A 3KDPB 1PP9E 1VQ9P 1T2KC 2B87A 3PH0A 1VDFA 1RQUA 2FXOA
chains in the Genus database with same CATH topology
1G2CA 1LTAC 1LT9B 3KYQA 5KLVK 4JYCA 2Q9IA 1MFZA 4ZKUA 1NAFA 2WSCH 1JY3O 2C9LY 2XZRA 2CPBA 3TSIA 1LT9C 3P8CD 1GL2D 1SFCC 3N4XA 1JCDA 2J58A 2WT7B 1G1IA 2HFED 5APWA 1NTMK 3A3YB 1IK9A 1GL2A 5CJ4A 1FOSE 1JNMA 3CLQA 2WITA 1LWUA 4IFMA 5AW0B 2OARA 1NTKK 3BASA 4N6JA 2FFDA 4XE5B 2E43A 5AW7B 2XV5A 1G2CB 1L4AC 2HG5D 1JY2O 5AVVB 1IC2A 1HJBA 5AVWB 2H43A 5AW3B 4M3LA 2FYZA 4AYCA 3BRVB 5AVUB 3V2NA 1FZCA 1KZUB 3EQ2A 1NTZK 1NKZB 2Q5UA 2IX7C 5AW5B 1JY3P 1JUNA 1NOHA 2HLOA 3BRTB 1LWUB 1FZGA 1HTLC 1CW5A 3RK3D 1ZN5A 1SQQK 2FFDB 2I1KA 1GL2C 4W7ZA 3A5TA 1LWUC 5AVSB 5APUA 2FKWB 3IR9A 2YO2A 1A02F 2XU6A 2E42A 4ZKPA 3M9HA 2O1JA 2FFDC 3HUSA 1YYCA 3U1CA 1JO5A 1KQLA 3B5ND 2HODB 1FJKA 1FZCB 3M0AA 1JY2P 1N7LA 1H89A 1M1JA 2XKMA 3B5NA 1G1JA 2YKOA 5CCHD 2N1TD 1GK4A 1FZCC 2ZXEB 1GW3A 2GUSA 2HPCA 2FXMA 2P1JA 2KP8A 2JJLA 3V4WA 5APQA 1W2EA 1RF0A 2BASA 1FJPA 5AVTB 3IFMA 4DOJA 1ZV8A 2NPSD 3NFQA 1FZBA 1NHLA 4DZOA 1FBMA 1LTGC 1T3UA 2NPSA 2MJZA 4LC1A 1SP4A 1URQD 1M1JB 3TYYA 5AW2B 4C7RA 2A45H 1LTSC 4W80A 3HUSC 1URQA 3MGNA 1OXZA 1YTZI 3I5CA 2HPCB 2KOGA 4GKGA 1M1JC 2YO3A 3B5NC 3BATA 2QM8A 5BU8B 5APSA 4AQRD 1HGVA 1SQXK 5CHXA 4XA4A 3HD7B 3P7KA 2W6AA 5KJ7D 2N1TC 1IFDA 1RF0C 3E1IA 3NMDA 2WPSA 1SQPK 3HE5A 1EQ7A 2NPSC 4HYTB 1IFMA 2N9BA 3LIEA 1AQ5A 2OYHA 1CSBA 3L36A 1URQC 2Q3IA 3L4FA 1FU1A 3P32A 2GM4A 3G3ZA 1DEBA 3TNUA 1MUUA 1RY3A 1HBWA 1A02J 1QL2A 1L0LK 3A7OA 4I1LA 1GU5A 1N2DC 3P8CE 3HE5B 4C7NA 5BU5A 1IFNA 3OA7A 5KJ7C 1X9VA 2OYHB 2C0WA 2L5GB 3VMZA 2IFMA 1LTBC 2C9NY 1GTWA 2OYHC 3TNUB 4EOTA 2HYNA 3HRNA 3CL3D 2HODA 1XTGB 4N3YB 3SWYA 1IO4A 1KFMA 5KTBA 2R3CA 1IJDB 3V2PA 4C7NB 4B86A 1GU4A 2P7JA 1FDMA 3VP8A 4WB4A 2Q7CA 3RK2D 4IFFA 5AVYB 1X8YA 5AW6B 2PAJA 2ZFCA 1QL1A 3M06A 1T3JA 4W7YA 5AW1B 1FZFA 2YKPA 2C0XA 3GHGA 3U59A 5CMZA 4IFDK 2XNXA 4JYBA 3U1AA 3MIWA 5APXA 2KSJA 1GZLA 1VPCA 3HD7D 2YMYA 3OJAB 3RK2B 2WSFH 3HD7A 3HE4A 5CJ0A 1LTJA 2CPSA 1GK6A 3M0DA 4KHXA 3GHGB 3RK2C 3L37A 2WZ7A 4I2LC 3T97A 1CZQA 2QM7A 2YKQA 5APTA 1N73B 2R32A 2IFNA 1KFNA 3GHGC 3R2PA 2H7HA 3KPEA 3NXSA 2WPQA 1ZR4A 1NKNA 1N7SD 3RL0B 4WY4D 1L0NK 1S9KD 4HH2A 1KILB 3HE4B 1JMMA 2IPPA 1LTJB 1N7SA 3V4QA 4WY4A 1J1DB 2VRSA 1ZR2A 1GD2E 3EFGA 1NO4A 3II6A 2J59M 2KLVA 3HD7C 1LTJC 1E5WA 1J1DC 1J2JB 3TK1A 3M0DC 2KB7P 1OWAA 1NU1K 3VN0A 2A45G 1SFCA 2WTYA 1SQBK 1JCCA 1GDTA 2O01H 2OYIB 1HGZA 4LGDE 1T8ZA 2Z5HA 1N7SB 4WY4B 1IFIA 3M9QA 3UIAA 2XDJA 1H8AA 1AFOA 4GIFA 1HVVA 1N7SC 3H32A 4WY4C 3VOPA 4Y99B 2I1JA 1PFIA 1SFCB 1DX7A 1HUCA 4Y99C 4RESB 3P8MC 2WSEH 1RF1A 3MUDA 1HWTC 1CI6A 3MD0A 1J1EB 1MV8A 2W27A 1Z56A 1L4AB 2W6BA 3H32B 3L35A 3LW5H 2Z4EA 1J1EC 1IFJA 3VTPC 1SVFA 4EIJA 3BVHA 2PP6A 5BVZA 5APYA 1DH3A 1LGHB 1WRGA 2R5BA 1H88A 1RF1B 3B8EB 1CI6B 3LIDA 1GL2B 3VP9A 1RE3A 1NWQA 1N73A 3M9BA 1RF1C 2P2UA 2H8PD 2M8RA 1NH4A 3V5BA 3RL0D 1XTCC 3HTKA 1KILD 2GUVA 1FOSF 5AVXB 1JY3N 1LTTC 1N86A 1KILA 1GW4A 3CI9A 3V2QA 5AW8B 5AVQB 3WMM0 3M91A 2O1KA 4WBAA 1X79B 2P67A 1JTHA 4I6MC 1FAVA 3A2AA 5AVZB 3O8ZA 4O9BA 4JF7A 5AVRB 5CCHA 2N1TA 5APVA 1JY2N 1T2KD 1RE3C 3NTNA 3H6PA 3HTKB 4AUWA 3RK3B 5CCGD 2POHA 1N73C 1RE4A 2OYIA 1FZAA 4LLHA 3HUSB 1SQVK 2WPRA 5CCGA 1S9KE 5AW4B 3RK3C 1WT6A 1LTIC 3B5NB 3N7NA 3MTUE 3RL0C 1JTHB 2M3BA 1KILC 1YTZT 1JOCA 3C9IA 4GT1A 1M7LA 1SFCD 2YNYA 3V2RA 2N1TB 4C46A 2WWWA 3VMXA 1LT9A 2FYUK 4N78D 2Z5IA 1SLQA 1ZLLA 4N78E 4OH8B 1FZEA 5CCHC 3SWFA 2A45I 2KYVA 2LKMA 2JEEA 2R5DA 2NPSB 3PP5A 3VYIA 5KJ7A 1MZ9A 3KDPB 2WT7A 1L4AD 1RE4C 1HH0A 1T2KC 2OYIC 1URQB 1VDFA 1L4AA 5CCGC 3KQGA 3OAKA 3VMYA 5AW9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB K;  2FYU K;  1SQX K;  2O01 H;  1L0N K;  5KLV K;  2WSF H;  3G3Z A;  2WSC H;  1SQV K;  2LKM A;  2WSE H;  3M9Q A;  1NTZ K;  1L0L K;  4IFD K;  1NTM K;  1SQP K;  2J59 M;  3CLQ A;  3LW5 H;  2OAR A;  1NTK K;  1SQQ K;  1NU1 K; 
#chains in the Genus database with same CATH topology
 2WMM A;  1G2C A;  1KV4 A;  1NU1 J;  3KYQ A;  4JYC A;  2Q9I A;  2KK7 A;  3CCQ P;  1JY3 O;  3TSI A;  1LT9 C;  3AEG C;  3P8C D;  5TIS E;  1NU1 D;  1BDC A;  3A0H E;  5APW A;  1SQB E;  3A3Y B;  1GL2 A;  1FOS E;  4IFM A;  3BAS A;  3MZW B;  2E43 A;  1G2C B;  3G9R A;  1IC2 A;  2M0B A;  1HJB A;  1R5L A;  2RN0 A;  3BRV B;  1P84 I;  3EQ2 A;  1NTZ K;  1NKZ B;  2IX7 C;  3BCC G;  3BRT B;  1KMI Z;  3GW6 A;  1ZN5 A;  3RK3 E;  2QRX A;  4HKZ H;  4QMA A;  1LWU C;  5AVS B;  3SFE C;  3USS A;  3G6E P;  1YJW P;  1LNQ A;  2KI7 B;  2E42 A;  2OTJ P;  1FJK A;  1N7L A;  1H89 A;  4H0L B;  3GF3 A;  1FZC C;  1ZRT D;  3L70 G;  1U57 A;  2HPC A;  2N9Y B;  2RH0 A;  1QLE D;  2JJL A;  3WUU A;  2AXT E;  3H1I E;  1RF0 A;  1ZV8 A;  2NPS D;  4BRY A;  1FBM A;  2M3E A;  1URQ A;  1JM0 A;  3MGN A;  1OXZ A;  1YTZ I;  2HPC B;  2KOG A;  2D2C B;  1M1J C;  2YO3 A;  3B5N C;  1ZME C;  2R3S A;  4AQR D;  3TGU G;  1HGV A;  3HD7 B;  4BRY B;  3A0B E;  3E1I A;  2IYP A;  3L75 D;  3NMD A;  2WPS A;  3L72 E;  2KZI A;  1EQ7 A;  2LXB A;  4HYT B;  2OYH A;  1CSB A;  3L36 A;  2Y0C A;  2OTK E;  1HJ0 A;  3O6Q A;  1QL2 A;  3A7O A;  4I1L A;  5TIS H;  1YBK A;  2K3R A;  1YIT P;  3AE4 C;  3OA7 A;  1KB9 D;  2OYH B;  2C0W A;  3CX5 I;  3B71 A;  3H25 A;  4H0L D;  3O6Q B;  4N3Y B;  2W83 C;  5KTB A;  2R3C A;  1ZOY C;  2PGD A;  4D6T E;  1NTM J;  3L73 J;  3CCU P;  3CXH D;  3RK2 D;  2QVA A;  2G8Y A;  1NTK J;  2J5U A;  5DJT B;  2IBZ E;  1NTM D;  3CD6 P;  1PGQ A;  1MFT A;  1T3J A;  1NTK D;  1KD1 Q;  3GHG A;  3U59 A;  4U3F E;  2D2C D;  2OTL P;  4WVZ A;  3IN6 A;  1KOR A;  3HD7 D;  1NTZ E;  1YQ3 C;  2YIU B;  1PPJ G;  3HE4 A;  1LTJ A;  3GHG B;  4L74 A;  3L73 G;  3H1L E;  4I2L C;  3T97 A;  1CZQ A;  2YKQ A;  1N73 B;  2E76 C;  3CC4 P;  3RL0 B;  1KIL B;  3HE4 B;  1JMM A;  1LTJ B;  2YMK A;  1SQV J;  3EFG A;  1EC5 A;  2CK3 H;  3T97 B;  2IZ1 A;  1GMJ A;  3M0D C;  1SQV D;  2KB7 P;  2YXQ B;  3VN0 A;  1SFC A;  4DJG A;  3PLN A;  3Q5S A;  2O01 H;  2OYI B;  4LGD E;  1T8Z A;  1PP9 D;  1IFI A;  1H8A A;  1AFO A;  1P84 D;  5KKZ C;  5B66 H;  3VOP A;  2OQQ A;  5KAF H;  4PD4 E;  4GOF A;  4MN4 C;  1PFI A;  2FYN C;  1SFC B;  2XND H;  1EDJ A;  3Q2Y A;  1DX7 A;  2B88 A;  1SQV G;  3BCC E;  1VF5 B;  3AE7 C;  1L2P A;  1S4X A;  1L4A B;  2ZT9 B;  2Y9Z A;  1J1E C;  5GTI H;  4EIJ A;  1M8O B;  3CCV P;  2B89 A;  1LGH B;  1KQG B;  1WRG A;  2GA1 A;  3L70 E;  3B8E B;  1AV1 A;  5TJH A;  3H1H G;  3LID A;  4OVN F;  3VP9 A;  2E75 D;  1D7M A;  2JDI H;  3M9B A;  1EXJ A;  1RF1 C;  2P2U A;  2M8R A;  3RL0 D;  3S4R A;  1KIL D;  4K35 A;  3JC2 2;  5KLV G;  3W68 A;  2P58 A;  2BCC J;  3M91 A;  1S5L H;  4YTP C;  2QJP C;  4OWF A;  3TGU E;  4JF7 A;  2BCC D;  3ZDM A;  2KNC A;  3H1I D;  3H6P A;  5KLI B;  5CCG D;  4BWN A;  4LLH A;  1SQV K;  1S9K E;  5AW4 B;  1LTI C;  3CWB J;  1M1K Q;  3N7N A;  4H13 B;  3C1L A;  1VQP P;  3CWB D;  1M7L A;  1SFC D;  3V2R A;  4C46 A;  3GF7 A;  1SLQ A;  3L71 J;  1LP1 A;  3CX5 D;  1L0N J;  2R5D A;  3VYI A;  5KJ7 A;  2WT7 A;  1L4A D;  3H1J J;  1RE4 C;  2ZT9 D;  1VQM P;  3F5H A;  1L0N D;  5KAI H;  3OW2 O;  1SQX E;  3KQG A;  3QWO C;  3VMY A;  1SQP J;  4HB1 A;  1NYH A;  1H0T A;  5AW9 B;  1LTA C;  5KLV K;  1MFZ A;  4ZKU A;  1NAF A;  1LP1 B;  2CPB A;  1USD A;  2J58 A;  3F89 A;  2WT7 B;  1G1I A;  2HFE D;  5C39 A;  4JQ0 D;  1JNM A;  3CLQ A;  5AW0 B;  2JR8 A;  3L71 G;  2FFD A;  4XE5 B;  2XV5 A;  3ABV C;  3H1J G;  2H43 A;  1S72 P;  2OGU A;  4M3L A;  2FYZ A;  1PV3 A;  1VQ6 P;  1SQP G;  2G3A A;  1KB9 I;  5AW5 B;  2HLO A;  1PPJ E;  1FZG A;  1CW5 A;  1OW7 A;  1SQQ K;  2FFD B;  1GL2 C;  2QEX P;  4ZNC A;  3A5T A;  3RBX A;  3ITK A;  5APU A;  1EDL A;  3M9H A;  3HUS A;  1BCC J;  3U1C A;  1JO5 A;  1X0T A;  2HOD B;  3M0A A;  1JY2 P;  4H13 D;  2Q1K A;  2YKO A;  1BCC D;  5CBO A;  1SS1 A;  1GK4 A;  2GUS A;  1VQ7 P;  1KYO H;  2FXM A;  3CC7 P;  1DEE G;  1UII A;  3IF4 A;  1T6A A;  5APQ A;  1LJ2 A;  2K37 A;  1OVR A;  2BAS A;  1FJP A;  3KXD A;  2L91 A;  1FZB A;  1NHL A;  2E5Y A;  1LTG C;  3AEA C;  2NPS A;  3AEF C;  3H1L D;  1FDI A;  4C7R A;  2ZYD A;  1OFC X;  3Q3D A;  3GLM A;  1NVO A;  4GKG A;  2MKV A;  3PHL A;  5CHX A;  2QJK B;  1BE3 G;  4XA4 A;  2WSS H;  3P7K A;  1VQN P;  3EFF K;  5KJ7 D;  2N1T C;  2K1A A;  1RF0 C;  1SQP K;  4IOI H;  2O3J A;  1IFM A;  2N9B A;  1AQ5 A;  1BGY J;  1URQ C;  2FYU J;  1DEB A;  1BGY D;  1Q86 Q;  1A02 J;  2V7Q J;  1GU5 A;  2FYU D;  4UB8 H;  2JO1 A;  4PD4 D;  1KB9 H;  1Q2N A;  2L5G B;  2H89 C;  4R4L A;  3H1H E;  2C9N Y;  2OYH C;  1DIP A;  3HRN A;  3CL3 D;  3MHV A;  1KFM A;  2A06 D;  1IJD B;  1BGY G;  3V2P A;  4B86 A;  1W2B O;  5KLV E;  1FDM A;  4WB4 A;  1NU1 G;  2FYU G;  4IFF A;  1RH5 B;  3CXH H;  4H44 C;  5AVY B;  5AW6 B;  1R8E A;  2ZFC A;  2O01 N;  3M06 A;  4W7Y A;  1FZF A;  1ZW0 A;  2YKP A;  5CMZ A;  2XNX A;  4EDF A;  1LT1 A;  3U1A A;  3MIW A;  5APX A;  4JBZ A;  2A06 G;  1M90 Q;  3Q1M A;  2YMY A;  3H1K J;  1QGK B;  4EYY Q;  4PJ0 H;  1S2E A;  3OJA B;  3RK2 B;  4CPG A;  3HD7 A;  5CJ0 A;  1YIJ P;  2QJY C;  3H1K D;  1GK6 A;  2YIU C;  1SQQ E;  4OGQ B;  1KFN A;  1IZN B;  3GHG C;  3R2P A;  2H7H A;  4ASV A;  3NXS A;  2WPQ A;  1ZR4 A;  1MKM A;  1N7S D;  4WY4 D;  2ZVO B;  1S9K D;  3L75 J;  1VL2 A;  1J1D B;  3Q5R A;  2VRS A;  1GD2 E;  3II6 A;  2J59 M;  2KLV A;  3K5B A;  1LTJ C;  1E5W A;  2FXP A;  3TK1 A;  2PFX A;  4YXD C;  3EWK A;  1NU1 K;  1JCC A;  4GOD A;  1GDT A;  3M9Q A;  3E7K A;  1AVO A;  1SQX D;  1K8A Q;  3AE5 C;  5B66 E;  1P84 H;  3CCR P;  5KAF E;  4Y99 B;  2I1J A;  3L75 G;  1EZV E;  3S1K A;  4RES B;  3I55 P;  1ZXG A;  1YHQ P;  2KUB A;  2Y9Y A;  1VF5 C;  1L0L J;  1N8R Q;  4L75 A;  2YXR B;  1QVF O;  3CCL P;  5GTI E;  1L0L D;  1IFJ A;  3FXE A;  3BVH A;  2PP6 A;  5BVZ A;  2PRR A;  5APY A;  3WU2 E;  2LR2 A;  1H88 A;  4OGQ D;  1PIX A;  1RE3 A;  2E74 D;  1N73 A;  1UIX A;  2K88 A;  2RKL A;  2GUV A;  1HF9 A;  1LTT C;  1KIL A;  1KTM A;  1K9M Q;  5AVQ B;  2Q3E A;  1S5L E;  1NTM G;  1X79 B;  4I6M C;  1FAV A;  3A2A A;  3O8Z A;  2KS1 B;  1NTK G;  1BE3 E;  3L74 J;  2E75 B;  5CCH A;  2R44 A;  5APV A;  1JY2 N;  1T2K D;  3RK3 B;  1OVV A;  3L74 D;  2OYI A;  1FZA A;  3S9O A;  5CCG A;  5CBN A;  3B5N B;  3MTU E;  2M3B A;  3FX0 A;  1YTZ T;  3KHU A;  2Z5I A;  1PP9 J;  5L8R J;  4N78 E;  4OH8 B;  4K3A A;  3SWF A;  2KYV A;  3CX5 H;  3L74 G;  1HH0 A;  1VQO P;  1R5S A;  2B9B A;  5KAI E;  1L4A A;  3OAK A;  2KIK A;  2WSC J;  1VQ5 P;  1E79 H;  2AEJ A;  1SQB J;  2OYO A;  2C9L Y;  1JCD A;  1NU1 E;  1SQB D;  1VQ4 P;  1NTM K;  1IK9 A;  4PV1 B;  3D6Y A;  2WIT A;  4IL6 H;  1PP9 G;  1VQ8 P;  1NTK K;  1Q81 Q;  5AW7 B;  5E79 H;  5AVV B;  1S3J A;  5AVW B;  1BSN A;  5AW3 B;  1Y8A A;  1KZU B;  3WU2 H;  2FY8 A;  4PD4 I;  2Q5U A;  1JY3 P;  2W90 A;  1NOH A;  1KC8 Q;  3VMA A;  1SQB G;  3RK3 D;  3TF5 A;  2ZYG A;  4W7Z A;  2NZ2 A;  2YO2 A;  2XU6 A;  4ZKP A;  2Q6Q A;  2O1J A;  2FFD C;  1KQL A;  3B5N D;  2XKM A;  3KZI H;  3H1I J;  5CCH D;  1GW3 A;  1KYO E;  2P1J A;  4UB6 H;  1W2E A;  1YJN P;  4DZO A;  1T3U A;  3FWL A;  4LC1 A;  1SP4 A;  3TYY A;  5AW2 B;  1LTS C;  3HUS C;  1ZP0 C;  3W67 A;  3JCU H;  3QH9 A;  3BAT A;  5BU8 B;  2ZVN B;  3L72 J;  2BCC G;  1U7M A;  3H1I G;  3JSV C;  2QJK C;  4PV1 D;  3L72 D;  4GOE A;  2BEZ F;  2NPS C;  4I7Z B;  2QIW A;  3LIE A;  2Q3I A;  3G3Z A;  3CWB G;  3TNU A;  1MUU A;  2ZXX A;  1RY3 A;  3AE3 C;  1HBW A;  1YI2 P;  4UB8 E;  1IFN A;  3R4Y A;  2V7Q H;  1X9V A;  1KB9 E;  1EZV D;  1M56 D;  3VMZ A;  2IFM A;  1LTB C;  1L0N G;  1KN7 A;  4RO0 A;  1GTW A;  4D6T J;  3AE2 C;  3TNU B;  4EOT A;  1YQ4 C;  1XTG B;  2HOD A;  1IO4 A;  4D6T D;  4RKU J;  3PRJ A;  1PZQ A;  1GU4 A;  2P7J A;  3VP8 A;  3AE6 C;  4HJG H;  2IBZ D;  3CXH E;  5B5E H;  3PTZ A;  1X8Y A;  1NTM E;  2E76 D;  1QL1 A;  4U3F J;  3L73 E;  3FWN A;  3CC2 P;  1NTK E;  5EFW B;  2C0X A;  4IFD K;  4L76 A;  4U3F D;  4Z1M H;  1S1C X;  1NTZ J;  4R4M A;  2QA4 P;  2AEM A;  2WSF J;  1PGJ A;  4H0L C;  1VPC A;  1NGM B;  1QEX A;  1NTZ D;  2Y0E A;  4PJ0 E;  3IAO A;  3H1L J;  2JKV A;  1Q82 Q;  4KHX A;  3RK2 C;  2QM7 A;  2AXC A;  2Y0D A;  2KZJ A;  1RQV A;  1FC2 C;  2JP3 A;  1BCC G;  1NKN A;  1L0N K;  3SWK A;  2D2C C;  1DD4 A;  3RL0 g;  1N7S A;  3V4Q A;  4WY4 A;  1ZR2 A;  1OMI A;  1RHZ B;  1NO4 A;  3HD7 C;  1J1D C;  1SQV E;  3H1L G;  2WTY A;  1TU3 F;  1N7S B;  1AJY A;  4WY4 B;  5H2F H;  4TLF A;  1P84 E;  3BCC J;  2WSE J;  1FE6 A;  1Y9B A;  1OVU A;  4DT0 A;  3BCC D;  4YPC A;  1HUC A;  4Y99 C;  2KSE A;  3LW5 J;  3MUD A;  2WVR A;  1CI6 A;  3MD0 A;  2B87 B;  1AVY A;  3L35 A;  3VTP C;  3L70 J;  1S5L X;  2DW3 A;  1DH3 A;  3L70 D;  1CI6 B;  1GL2 B;  3CMA P;  2H8P D;  1NH4 A;  1U7J A;  3HTK A;  1KIL E;  1JY3 N;  1N86 A;  1GW4 A;  3TGU J;  1K05 A;  3V2Q A;  1JEK A;  3AED C;  3WMM 0;  3D70 A;  3G4S P;  2O1K A;  4WBA A;  3FXD A;  1JTH A;  3TGU D;  5AVZ B;  1KYO D;  4O9B A;  5GTH H;  4EI2 A;  2BCC E;  1WMK A;  2N1T A;  1FS0 E;  3SFD C;  2E74 B;  1RE3 C;  3HTK B;  1N73 C;  2POH A;  2E75 C;  3RK3 C;  1NAY A;  3RL0 C;  1JTH B;  1KIL C;  3C9I A;  3H1K G;  4DCK A;  4GT1 A;  3CWB E;  2N1T B;  2WWW A;  3VMX A;  1LT9 A;  2FYU K;  5CCH C;  3CCJ P;  2A45 I;  1SQX J;  1BSH A;  3PP5 A;  2I8D A;  3CX5 E;  1Q7Y Q;  2LXC B;  1K04 A;  3L71 E;  2OYI C;  1DD3 A;  1URQ B;  5CCG C;  1L0N E;  3H1J E;  2IYO A;  2IZ0 A;  4RJT A;  1LT9 B;  2H88 C;  1SQP E;  2WSC H;  2XZR A;  1GL2 D;  1SFC C;  3N4X A;  3C8V A;  3A0H H;  5CJ4 A;  1KQS O;  1LWU A;  4IL6 E;  2OAR A;  1OW8 A;  2WPV B;  4N6J A;  2KXP B;  3E1R A;  4PV1 C;  1SQX G;  5E79 E;  1L4A C;  2HG5 D;  1JY2 O;  4ZMD A;  2ZT9 C;  1FDO A;  4AYC A;  5AVU B;  3V2N A;  1FZC A;  2QSI A;  4H44 B;  3AEE C;  1JUN A;  1PPJ D;  1EZV I;  1LWU B;  2KS1 A;  1VQK P;  1HTL C;  2QE7 H;  3AEB C;  2I1K A;  1EDK A;  1YJ9 P;  3L73 D;  2FKW B;  3IR9 A;  3RGU A;  1A02 F;  2SPZ A;  1YYC A;  4NPE A;  1NJI Q;  1L0L G;  1FZC B;  1M1J A;  3B5N A;  3KZI E;  1G1J A;  2IBZ I;  1BCC E;  2N1T D;  2ZXE B;  2BEQ D;  4JPZ B;  3D71 A;  4Y28 J;  2QJY B;  2KP8 A;  3V4W A;  2AXT H;  2NRG A;  4UB6 E;  2ZYA A;  5AVT B;  3IFM A;  4DOJ A;  3NFQ A;  3GG2 A;  3AE1 C;  5KLI C;  2MJZ A;  1URQ D;  1M1J B;  1OW6 A;  2A45 H;  4W80 A;  3JCU E;  3I5C A;  2QM8 A;  5APS A;  4H13 C;  1SQX K;  2W6A A;  3A0B H;  1Q90 D;  1Y47 A;  1IFD A;  2V4H A;  3HE5 A;  1PGP A;  1USE A;  2ITA A;  3MP7 B;  1M57 D;  2HR3 A;  3L4F A;  1FU1 A;  3P32 A;  4I7Z C;  2GM4 A;  1BGY E;  1QX8 A;  4H44 D;  1L0L K;  1QVG O;  1N2D C;  3P8C E;  3RBZ A;  2FYU E;  3HE5 B;  4C7N A;  5BU5 A;  3H1H J;  3CCM P;  1IK7 A;  5KJ7 C;  4YXW H;  4XFJ A;  3H1H D;  2K9J A;  1OX3 A;  3G71 P;  5KLV J;  2HYN A;  2W8Z A;  3SWY A;  2A06 E;  1EDI A;  2W6J H;  2IDB A;  1JB0 J;  4L73 A;  5KLV D;  4C7N B;  3SSU A;  3I56 P;  3PJS K;  2Q7C A;  3D6Z A;  5B5E E;  3TDK A;  2K9J B;  2PAJ A;  2JWA A;  2K9Y A;  5AW1 B;  4KT0 J;  4JYB A;  3B4S A;  1X22 A;  2KSJ A;  1GZL A;  1ZRT E;  2FBW C;  1SQQ J;  3FGA D;  2WSF H;  1IFP A;  2E76 B;  2CPS A;  3H1K E;  1SQQ D;  3M0D A;  1AA0 A;  3L37 A;  2WZ7 A;  2RMZ A;  5APT A;  2R32 A;  3GMA A;  2IFN A;  2E5T A;  3KPE A;  2WQY C;  4HH2 A;  2IPP A;  2ZAE B;  1KYO I;  2M5A A;  3L75 E;  3AE8 C;  2O01 J;  1J2J B;  1SQQ G;  2KNC B;  1OWA A;  2A45 G;  1SQB K;  1VF5 D;  1PL5 A;  1EXI A;  1HGZ A;  2ZJS E;  1OIP A;  2Z5H A;  3WUT A;  5KKZ B;  3L71 D;  3UIA A;  2XDJ A;  2M5A B;  5H2F E;  1BDD A;  2FYN B;  4GIF A;  1HVV A;  1N7S C;  3H32 A;  4WY4 C;  3H1J D;  4PD4 H;  1W5C E;  3L72 G;  3CME P;  1SQP D;  2KLU A;  3P8M C;  2WSE H;  1RF1 A;  1PGO A;  3WUV A;  1HWT C;  1J1E B;  1MV8 A;  2W27 A;  2JWD A;  1Z56 A;  2W6B A;  1OZH A;  4ASW A;  3H32 B;  3LW5 H;  4A7P A;  2Z4E A;  1H0T B;  1KQF B;  1VQL P;  1SVF A;  1L0L E;  4NPF X;  3AE9 C;  2R5B A;  1EZV G;  1RF1 B;  1AQT A;  2QG4 A;  1K73 Q;  1NWQ A;  3CCS P;  3MUD C;  4NPD A;  3V5B A;  1XTC C;  4D6T G;  5DJU B;  1FOS F;  5AVX B;  2P10 A;  2QJP B;  3CI9 A;  1BE3 J;  5AW8 B;  2IBZ G;  4BXL A;  2P67 A;  3CXH I;  4WWI A;  4GDO A;  1BE3 D;  3CCE P;  5AVR B;  5GTH E;  2AEF A;  4U3F G;  3NTN A;  4KJM A;  4AUW A;  5M1B A;  4OGQ C;  1RE4 A;  5K5G B;  4TT3 H;  3L74 E;  3HUS B;  3Q5P A;  2E74 C;  2WPR A;  1NTZ G;  1WT6 A;  1JMB A;  2UWJ E;  3V6I A;  1JOC A;  4U7J A;  2YNY A;  4N78 D;  1ZLL A;  3CPW O;  1FZE A;  3AEC C;  2LKM A;  2JEE A;  2NPS B;  4IL6 X;  1MZ9 A;  3KDP B;  1PP9 E;  1VQ9 P;  1T2K C;  2B87 A;  3PH0 A;  1VDF A;  1RQU A;  2FXO A; 
#chains in the Genus database with same CATH homology
 1G2C A;  1LTA C;  1LT9 B;  3KYQ A;  5KLV K;  4JYC A;  2Q9I A;  1MFZ A;  4ZKU A;  1NAF A;  2WSC H;  1JY3 O;  2C9L Y;  2XZR A;  2CPB A;  3TSI A;  1LT9 C;  3P8C D;  1GL2 D;  1SFC C;  3N4X A;  1JCD A;  2J58 A;  2WT7 B;  1G1I A;  2HFE D;  5APW A;  1NTM K;  3A3Y B;  1IK9 A;  1GL2 A;  5CJ4 A;  1FOS E;  1JNM A;  3CLQ A;  2WIT A;  1LWU A;  4IFM A;  5AW0 B;  2OAR A;  1NTK K;  3BAS A;  4N6J A;  2FFD A;  4XE5 B;  2E43 A;  5AW7 B;  2XV5 A;  1G2C B;  1L4A C;  2HG5 D;  1JY2 O;  5AVV B;  1IC2 A;  1HJB A;  5AVW B;  2H43 A;  5AW3 B;  4M3L A;  2FYZ A;  4AYC A;  3BRV B;  5AVU B;  3V2N A;  1FZC A;  1KZU B;  3EQ2 A;  1NTZ K;  1NKZ B;  2Q5U A;  2IX7 C;  5AW5 B;  1JY3 P;  1JUN A;  1NOH A;  2HLO A;  3BRT B;  1LWU B;  1FZG A;  1HTL C;  1CW5 A;  3RK3 D;  1ZN5 A;  1SQQ K;  2FFD B;  2I1K A;  1GL2 C;  4W7Z A;  3A5T A;  1LWU C;  5AVS B;  5APU A;  2FKW B;  3IR9 A;  2YO2 A;  1A02 F;  2XU6 A;  2E42 A;  4ZKP A;  3M9H A;  2O1J A;  2FFD C;  3HUS A;  1YYC A;  3U1C A;  1JO5 A;  1KQL A;  3B5N D;  2HOD B;  1FJK A;  1FZC B;  3M0A A;  1JY2 P;  1N7L A;  1H89 A;  1M1J A;  2XKM A;  3B5N A;  1G1J A;  2YKO A;  5CCH D;  2N1T D;  1GK4 A;  1FZC C;  2ZXE B;  1GW3 A;  2GUS A;  2HPC A;  2FXM A;  2P1J A;  2KP8 A;  2JJL A;  3V4W A;  5APQ A;  1W2E A;  1RF0 A;  2BAS A;  1FJP A;  5AVT B;  3IFM A;  4DOJ A;  1ZV8 A;  2NPS D;  3NFQ A;  1FZB A;  1NHL A;  4DZO A;  1FBM A;  1LTG C;  1T3U A;  2NPS A;  2MJZ A;  4LC1 A;  1SP4 A;  1URQ D;  1M1J B;  3TYY A;  5AW2 B;  4C7R A;  2A45 H;  1LTS C;  4W80 A;  3HUS C;  1URQ A;  3MGN A;  1OXZ A;  1YTZ I;  3I5C A;  2HPC B;  2KOG A;  4GKG A;  1M1J C;  2YO3 A;  3B5N C;  3BAT A;  2QM8 A;  5BU8 B;  5APS A;  4AQR D;  1HGV A;  1SQX K;  5CHX A;  4XA4 A;  3HD7 B;  3P7K A;  2W6A A;  5KJ7 D;  2N1T C;  1IFD A;  1RF0 C;  3E1I A;  3NMD A;  2WPS A;  1SQP K;  3HE5 A;  1EQ7 A;  2NPS C;  4HYT B;  1IFM A;  2N9B A;  3LIE A;  1AQ5 A;  2OYH A;  1CSB A;  3L36 A;  1URQ C;  2Q3I A;  3L4F A;  1FU1 A;  3P32 A;  2GM4 A;  3G3Z A;  1DEB A;  3TNU A;  1MUU A;  1RY3 A;  1HBW A;  1A02 J;  1QL2 A;  1L0L K;  3A7O A;  4I1L A;  1GU5 A;  1N2D C;  3P8C E;  3HE5 B;  4C7N A;  5BU5 A;  1IFN A;  3OA7 A;  5KJ7 C;  1X9V A;  2OYH B;  2C0W A;  2L5G B;  3VMZ A;  2IFM A;  1LTB C;  2C9N Y;  1GTW A;  2OYH C;  3TNU B;  4EOT A;  2HYN A;  3HRN A;  3CL3 D;  2HOD A;  1XTG B;  4N3Y B;  3SWY A;  1IO4 A;  1KFM A;  5KTB A;  2R3C A;  1IJD B;  3V2P A;  4C7N B;  4B86 A;  1GU4 A;  2P7J A;  1FDM A;  3VP8 A;  4WB4 A;  2Q7C A;  3RK2 D;  4IFF A;  5AVY B;  1X8Y A;  5AW6 B;  2PAJ A;  2ZFC A;  1QL1 A;  3M06 A;  1T3J A;  4W7Y A;  5AW1 B;  1FZF A;  2YKP A;  2C0X A;  3GHG A;  3U59 A;  5CMZ A;  4IFD K;  2XNX A;  4JYB A;  3U1A A;  3MIW A;  5APX A;  2KSJ A;  1GZL A;  1VPC A;  3HD7 D;  2YMY A;  3OJA B;  3RK2 B;  2WSF H;  3HD7 A;  3HE4 A;  5CJ0 A;  1LTJ A;  2CPS A;  1GK6 A;  3M0D A;  4KHX A;  3GHG B;  3RK2 C;  3L37 A;  2WZ7 A;  4I2L C;  3T97 A;  1CZQ A;  2QM7 A;  2YKQ A;  5APT A;  1N73 B;  2R32 A;  2IFN A;  1KFN A;  3GHG C;  3R2P A;  2H7H A;  3KPE A;  3NXS A;  2WPQ A;  1ZR4 A;  1NKN A;  1N7S D;  3RL0 B;  4WY4 D;  1L0N K;  1S9K D;  4HH2 A;  1KIL B;  3HE4 B;  1JMM A;  2IPP A;  1LTJ B;  1N7S A;  3V4Q A;  4WY4 A;  1J1D B;  2VRS A;  1ZR2 A;  1GD2 E;  3EFG A;  1NO4 A;  3II6 A;  2J59 M;  2KLV A;  3HD7 C;  1LTJ C;  1E5W A;  1J1D C;  1J2J B;  3TK1 A;  3M0D C;  2KB7 P;  1OWA A;  1NU1 K;  3VN0 A;  2A45 G;  1SFC A;  2WTY A;  1SQB K;  1JCC A;  1GDT A;  2O01 H;  2OYI B;  1HGZ A;  4LGD E;  1T8Z A;  2Z5H A;  1N7S B;  4WY4 B;  1IFI A;  3M9Q A;  3UIA A;  2XDJ A;  1H8A A;  1AFO A;  4GIF A;  1HVV A;  1N7S C;  3H32 A;  4WY4 C;  3VOP A;  4Y99 B;  2I1J A;  1PFI A;  1SFC B;  1DX7 A;  1HUC A;  4Y99 C;  4RES B;  3P8M C;  2WSE H;  1RF1 A;  3MUD A;  1HWT C;  1CI6 A;  3MD0 A;  1J1E B;  1MV8 A;  2W27 A;  1Z56 A;  1L4A B;  2W6B A;  3H32 B;  3L35 A;  3LW5 H;  2Z4E A;  1J1E C;  1IFJ A;  3VTP C;  1SVF A;  4EIJ A;  3BVH A;  2PP6 A;  5BVZ A;  5APY A;  1DH3 A;  1LGH B;  1WRG A;  2R5B A;  1H88 A;  1RF1 B;  3B8E B;  1CI6 B;  3LID A;  1GL2 B;  3VP9 A;  1RE3 A;  1NWQ A;  1N73 A;  3M9B A;  1RF1 C;  2P2U A;  2H8P D;  2M8R A;  1NH4 A;  3V5B A;  3RL0 D;  1XTC C;  3HTK A;  1KIL D;  2GUV A;  1FOS F;  5AVX B;  1JY3 N;  1LTT C;  1N86 A;  1KIL A;  1GW4 A;  3CI9 A;  3V2Q A;  5AW8 B;  5AVQ B;  3WMM 0;  3M91 A;  2O1K A;  4WBA A;  1X79 B;  2P67 A;  1JTH A;  4I6M C;  1FAV A;  3A2A A;  5AVZ B;  3O8Z A;  4O9B A;  4JF7 A;  5AVR B;  5CCH A;  2N1T A;  5APV A;  1JY2 N;  1T2K D;  1RE3 C;  3NTN A;  3H6P A;  3HTK B;  4AUW A;  3RK3 B;  5CCG D;  2POH A;  1N73 C;  1RE4 A;  2OYI A;  1FZA A;  4LLH A;  3HUS B;  1SQV K;  2WPR A;  5CCG A;  1S9K E;  5AW4 B;  3RK3 C;  1WT6 A;  1LTI C;  3B5N B;  3N7N A;  3MTU E;  3RL0 C;  1JTH B;  2M3B A;  1KIL C;  1YTZ T;  1JOC A;  3C9I A;  4GT1 A;  1M7L A;  1SFC D;  2YNY A;  3V2R A;  2N1T B;  4C46 A;  2WWW A;  3VMX A;  1LT9 A;  2FYU K;  4N78 D;  2Z5I A;  1SLQ A;  1ZLL A;  4N78 E;  4OH8 B;  1FZE A;  5CCH C;  3SWF A;  2A45 I;  2KYV A;  2LKM A;  2JEE A;  2R5D A;  2NPS B;  3PP5 A;  3VYI A;  5KJ7 A;  1MZ9 A;  3KDP B;  2WT7 A;  1L4A D;  1RE4 C;  1HH0 A;  1T2K C;  2OYI C;  1URQ B;  1VDF A;  1L4A A;  5CCG C;  3KQG A;  3OAK A;  3VMY A;  5AW9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...