2O01H

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
75
structure length
75
Chain Sequence
WDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLPITRGPQQPPKLGPRGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
total genus 3
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2o01H01
5KLVK 2WSCH 1SQVK 2O01H 3G3ZA 1SQXK 1NTKK 1NU1K 2FYUK 2J59M 2WSFH 1NTMK 2WSEH 1NTZK 3M9QA 2LKMA 1SQQK 4IFDK 1L0NK 1L0LK 3CLQA 2OARA 3LW5H 1SQBK 1SQPK
chains in the Genus database with same CATH superfamily
1W2EA 2L5GB 3H1HJ 1LTTC 2NZ2A 1PZQA 2Y0CA 1GZLA 2R3SA 1GL2D 3SSUA 2Q6QA 1HF9A 1KZUB 3A7OA 3V2QA 4IFDK 1NTKK 3RL0D 1J1EC 3AE9C 2QJKC 3GHGB 1HGVA 1M1JB 2FYZA 2E75B 3H1JG 3RK3C 2W27A 2H7HA 1YTZT 2OYOA 1FZCC 2YKPA 3BCCE 3CXHE 3H1LE 1CW5A 1BCCD 2Y9YA 4Y99B 2IBZG 3B5NC 1EXIA 3ABVC 1L4AD 1BGYE 4I6MC 1NTZJ 2N1TC 1FZCA 3AE6C 2IDBA 3FX0A 2HG5D 4KHXA 1YITP 3U1CA 1EDLA 3RK2D 3B5NA 2YXQB 5CCHD 3TGUG 1Y9BA 2B89A 3KYQA 2NRGA 2N1TA 2KS1A 3L72E 3BVHA 5C39A 4NPDA 1AVYA 2KUBA 1BCCE 2ZVOB 2QM7A 5KJ7C 2FFDB 1KB9D 1KC8Q 1OW7A 4LGDE 4PV1C 3AECC 4H44B 3H1HD 3AE7C 1RQUA 2O01J 3L74G 2OTKE 5KJ7A 1EXJA 1NU1G 4RESB 2ITAA 3CC2P 1SQQJ 2E76C 2WSCH 3CI9A 1Z56A 1NYHA 3E1RA 3VN0A 1YJNP 3VP8A 1YJWP 3TNUB 5KAIE 2A06D 5B66H 2KZJA 2GUSA 1KB9E 1CI6B 5AW5B 4U3FE 1GK4A 1RY3A 2G3AA 5APYA 4YXDC 3KHUA 5APTA 4C46A 3IR9A 1JTHA 5B5EE 1NTZD 2ZYAA 2JJLA 4WY4D 1FJPA 1IK7A 1MKMA 1J1DC 1L0LJ 5CMZA 3HD7D 1KILB 2M5AB 1P84D 1WMKA 1ZN5A 4LC1A 3CC7P 2AEJA 2QRXA 4D6TG 2ZT9B 2WSEH 4C7NA 2A06E 5K5GB 1EDIA 2JO1A 3CLQA 2KLVA 1LTAC 2SPZA 2R5DA 2W83C 1SQBJ 3Q5RA 4Z1MH 1CSBA 2R5BA 3M0DC 4K3AA 3RGUA 1ZXGA 5AVVB 1NOHA 1RE4C 1EC5A 2O01N 1NTZE 2LXBA 4MN4C 2K88A 2K37A 1FJKA 2PFXA 2YMKA 2N9BA 2YO3A 2B87A 5EFWB 2GM4A 2YMYA 5KAIH 2E74B 3M0DA 4KJMA 4H13B 1RE4A 2KSEA 4OWFA 1BDDA 1SQQK 3G71P 1SQQD 3A0HE 3B8EB 3GHGC 1FZBA 1M1JC 1JY3O 1OXZA 3A2AA 3V2NA 2IYOA 2J5UA 2BEZF 5B5EH 4WBAA 2FYNC 3D71A 3HUSB 4Y99C 2W8ZA 2XV5A 2OYHB 1L0NK 5CJ0A 2I8DA 3EFFK 2BCCJ 4PD4D 1S9KD 3GHGA 3CCMP 4I2LC 1M1JA 1Q2NA 1W2BO 2FBWC 1EZVD 3NMDA 1LP1B 1T3UA 2UWJE 1NJIQ 1QL1A 2LKMA 1L0LK 1L0LD 2YKOA 4C7RA 5M1BA 4BRYB 1VQ9P 5E79E 3L73G 1VQ6P 5AW9B 3L35A 1SQXE 5KAFE 1SFCD 3CCJP 2WSFH 1YHQP 4JBZA 1VQ7P 1SQPG 2AXTE 1GL2B 4RKUJ 2WPQA 5BU5A 1QVGO 2FFDC 1SQBK 4PD4E 3O8ZA 1S9KE 1SQBD 1BE3G 3H1IJ 1S1CX 1VPCA 2YNYA 3G3ZA 1K9MQ 1EZVE 1PP9G 3HRNA 3RL0B 4H44C 3A0HH 2QJYB 1T3JA 1SQVG 4EOTA 3H32B 2OYIB 1WT6A 1VQOP 3W68A 3AEEC 1JM0A 1EZVI 2FFDA 4OVNF 1G1IA 3L71J 2QEXP 1VQNP 1AA0A 2E42A 3S1KA 2HLOA 2LR2A 3MGNA 3HE4B 4DCKA 2IPPA 5AVRB 1L4AB 2NPSC 3CCLP 1KMIZ 1H0TA 1PGPA 3R2PA 1R8EA 3PRJA 1KV4A 1MUUA 1HWTC 2K1AA 2KLUA 1VDFA 3CCUP 1MFZA 2WVRA 3M0AA 2WSCJ 3RK2B 3IAOA 3IFMA 1OX3A 3M9BA 2O1JA 2NPSA 5BU8B 5E79H 1BGYJ 2FXOA 1HH0A 1KN7A 3Q3DA 4HB1A 1X0TA 3H1JD 3VMAA 1CI6A 1KQLA 4LLHA 2CPSA 3MTUE 1HJ0A 2AXTH 4GIFA 2C9LY 2N9YB 3NFQA 4NPFX 3TSIA 5GTIE 1W5CE 3JC22 3VMZA 2WITA 3CMEP 4KT0J 3L72J 2Q3IA 1S5LE 1K8AQ 1M56D 1VQKP 5AW4B 4OGQC 1N86A 1KILA 1OVRA 3GF3A 3M9QA 3H1ID 3L4FA 3B4SA 2WSEJ 1PGJA 3FWLA 1A02J 2K9JB 5AVSB 3H1JE 2KYVA 4B86A 4I7ZB 2E74C 3L70G 1HBWA 3L71D 3SWYA 4H13C 1X8YA 5CCGC 2IBZE 5DJUB 2D2CD 2WPVB 1IFMA 3MUDC 4H0LD 3MD0A 4IFMA 1LTIC 4Y28J 4EIJA 2IBZI 4WY4B 3U1AA 3VTPC 3H1IE 5CCGA 2OTLP 3HUSC 4U3FJ 2OYHC 2V4HA 1M90Q 5KLIB 2E5TA 3RBZA 3MUDA 5KLVJ 3TGUE 1Y47A 5CBNA 1T2KC 1DEEG 1USEA 5GTIH 1BGYD 2XNDH 4L76A 2OTJP 3L71E 3CCEP 1HGZA 1S5LH 1LJ2A 3HUSA 2OYHA 1FE6A 3MZWB 3RK3D 1GD2E 1NHLA 4A7PA 1QGKB 1VQLP 2Q1KA 1JNMA 2FYUG 3L72D 1PPJD 3B71A 2WT7B 3B5ND 3CCRP 1KFMA 3WUTA 1NU1E 2N1TD 3RL0C 3CMAP 5B66E 3AEBC 4JF7A 2WSFJ 3PJSK 3LW5H 5H2FH 2QJYC 2IFMA 3AE1C 1URQB 1LTGC 4ZNCA 4OH8B 2J59M 3RK3E 2MKVA 2Y9ZA 1PL5A 4QMAA 1AJYA 1N7SC 3CX5I 3P8MC 1PPJE 1NTMG 5KJ7D 1A02F 1D7MA 2OYIA 2YO2A 2R32A 4XA4A 3V4WA 1NGMB 4EDFA 4GKGA 2B88A 4PV1D 2FXPA 1N7SA 2IZ1A 3H1KG 4U3FD 3HE4A 3U59A 1FZFA 3RK2C 1G2CB 5KLVD 1H89A 1JMBA 5AVUB 4JPZB 2JR8A 5KKZB 1SVFA 1NWQA 1YYCA 1ZR2A 1SFCB 3CCVP 3SFEC 3L36A 4XE5B 1VF5B 2K9YA 1JY2O 4HH2A 2KB7P 1OVVA 1G1JA 3BCCG 3L75G 1SQXJ 2M8RA 1USDA 1E5WA 3CX5H 3OAKA 2RH0A 1NH4A 4EI2A 4WVZA 5CBOA 5KTBA 5KLVE 2VRSA 2C0XA 3E1IA 1GK6A 5AVZB 1DH3A 2Y0DA 1JY2N 3HTKA 1NTZK 1KFNA 1NTKG 1KYOI 1NO4A 2MJZA 4I7ZC 5APUA 2KP8A 2QJPC 1VQ4P 3BRVB 2V7QJ 2GA1A 1QX8A 2K9JA 2WZ7A 3GMAA 1GU4A 2KNCB 1ZRTE 2Q3EA 3AE4C 2Q9IA 2OQQA 3D6ZA 4JQ0D 4WY4C 5L8RJ 1S72P 1OW8A 3WUVA 1JMMA 3L70J 5KLIC 4GDOA 1AQTA 2RKLA 3L73E 4AUWA 1BSHA 3GG2A 3Q2YA 2JEEA 2H8PD 1SQPE 3VMXA 1FS0E 4WY4A 3WU2E 3KQGA 4GT1A 3KDPB 3I55P 1DIPA 2HR3A 1EDKA 2C0WA 1YQ4C 1LT1A 1UIIA 1KYOH 1Q81Q 2ZVNB 2WSSH 2W6JH 1SQXK 2E75C 2WTYA 1ZP0C 1SQXD 3M91A 2IZ0A 3PTZA 5APQA 1JCCA 2J58A 4DJGA 4GOFA 3H1HG 1M57D 1QL2A 1S2EA 3MIWA 2AXCA 1JB0J 1IZNB 5CHXA 3F89A 1MZ9A 3G4SP 1URQC 4H0LB 1GW3A 3H1JJ 2WT7A 3G6EP 1LTJB 2KSJA 1JY3N 1IFPA 2ZXEB 3D6YA 2R3CA 3CCQP 1BDCA 3T97B 3TDKA 2A06G 3LIEA 2QM8A 4W7YA 4ASWA 2RN0A 3FWNA 3LW5J 1RF0C 1LWUB 1URQA 2RMZA 1R5SA 1GDTA 1AV1A 3RL0g 2JDIH 4GOEA 1M1KQ 1J1EB 1E79H 2QVAA 2ZXXA 3GF7A 3S4RA 2GUVA 1IO4A 2BASA 2FKWB 3L70D 3WU2H 1S5LX 1RF0A 2FXMA 3VOPA 1PFIA 3TGUJ 1OMIA 2JWAA 4RJTA 1LTSC 3M9HA 3VP9A 3C8VA 1N2DC 1SFCC 3P32A 3O6QB 1S4XA 3SWKA 3JSVC 2WQYC 1VF5C 4UB8E 2NPSD 3ITKA 3LIDA 1G2CA 2QE7H 1YQ3C 3E7KA 3A0BH 1SFCA 1ZLLA 3M06A 3II6A 2PGDA 3L74J 3QH9A 3L70E 2W6BA 4HYTB 4R4LA 1L2PA 1NU1J 5AVYB 4L74A 3AE8C 4L73A 1FZEA 3TNUA 4AYCA 3HE5B 1LT9B 3UIAA 1TU3F 1ZV8A 3SFDC 1SQQG 1HJBA 5TISE 1GU5A 1KILC 2G8YA 1NAFA 2P10A 1VQ5P 4PV1B 1M7LA 1FBMA 2IBZD 4N3YB 3A3YB 2ZT9C 1JOCA 4OGQD 4NPEA 2A45G 1L0NG 2KOGA 1NTKJ 1IJDB 2M5AA 2HFED 1ZR4A 1KQGB 1VQPP 4R4MA 2H43A 2Q5UA 1RE3C 2V7QH 1KILE 4UB8H 1NKZB 2AEFA 4N78D 4D6TJ 3TGUD 2KNCA 1YJ9P 3PHLA 1L0LG 4H13D 2FYUE 1FOSF 3GLMA 1ZMEC 2E5YA 3Q5SA 3W67A 1RE3A 4UB6E 3CWBG 5H2FE 3CPWO 1LGHB 2H88C 2XKMA 4IL6H 4ZKUA 4TLFA 2POHA 3C1LA 1SQBG 1FOSE 1J1DB 2QSIA 1RH5B 2XU6A 1H88A 5TJHA 3EFGA 3L74D 1T2KD 5TISH 1ZOYC 4YXWH 3HD7B 1NU1K 4EYYQ 1NU1D 4W80A 4N78E 3EWKA 4ZMDA 1AFOA 1NTME 2B87B 3AE2C 4H0LC 1LTJC 3CX5D 2AEMA 1EQ7A 1MV8A 3V5BA 2I1JA 2ZJSE 3WUUA 5AW6B 2WMMA 2YXRB 3H1KE 5APVA 2XZRA 3TYYA 2IFNA 1LP1A 1LWUC 2HODB 4DZOA 1KQSO 2W6AA 1LTJA 1GL2C 4HKZH 3L74E 2BCCG 1NTKD 3S9OA 3V4QA 5APSA 1X9VA 3T97A 4BRYA 1CZQA 1SP4A 2WPSA 3KPEA 2IX7C 1LWUA 1R5LA 5AW3B 4O9BA 1WRGA 3KZIE 4BWNA 3L73J 4UB6H 3L75E 4D6TD 1N73B 3CX5E 3FGAD 1GL2A 3N4XA 2OYIC 2FYNB 3P7KA 1N7SD 1SQPJ 1J2JB 1IFNA 4AQRD 3OA7A 1BE3J 3CXHI 4YPCA 4GODA 1PP9J 3V6IA 3PH0A 1FDOA 4I1LA 1Q86Q 1L4AC 3H32A 2CPBA 1NTKE 3H1IG 3O6QA 3TK1A 1SQVJ 1FC2C 2P1JA 4L75A 2QA4P 2OARA 3CD6P 4WWIA 5KLVK 1KYOD 1S3JA 4D6TE 5CCHC 1L4AA 3KXDA 3L71G 1PGOA 2XDJA 1LT9C 1JY3P 2E76D 3AE5C 2JWDA 3VYIA 4BXLA 3EQ2A 1RQVA 4ZKPA 1XTGB 3R4YA 5CCHA 3AEFC 5APXA 3OW2O 1H0TB 3HE5A 1LT9A 3H1LG 1XTCC 1QLED 3KZIH 2Q7CA 3CXHH 1ZRTD 1FZAA 1HUCA 2B9BA 1K04A 3L37A 1VQ8P 4IFFA 5GTHE 1KYOE 3K5BA 1YIJP 1BGYG 4YTPC 2O3JA 2KZIA 2NPSB 1DX7A 1T8ZA 3PLNA 1DD3A 3TF5A 3L73D 1QVFO 2C9NY 1SQPK 1L0NJ 2P67A 2YIUB 1SQPD 1KORA 3CCSP 2Y0EA 1Y8AA 3H1HE 1HVVA 2CK3H 3IN6A 3A5TA 2HPCB 1OIPA 1OVUA 1YTZI 1IFDA 4ASVA 1K05A 2ZFCA 1KB9I 3L72G 1PPJG 1BE3D 1GTWA 1PP9D 3BRTB 1DD4A 1KTMA 1BCCG 3AE3C 3C9IA 1T6AA 4HJGH 1SQVK 4DOJA 1SQVD 1NAYA 5AW7B 2O1KA 3HD7C 1MFTA 1FU1A 1M8OB 1FAVA 3CWBJ 2FY8A 2M0BA 2M3BA 1N8RQ 2KXPB 4OGQB 1ZW0A 3MHVA 2Z5IA 2QIWA 1Q7YQ 4TT3H 5AW1B 1BE3E 1JO5A 3HD7A 2E43A 3FXDA 2E75D 1PV3A 4W7ZA 1PP9E 4XFJA 5GTHH 5AW2B 1RF1B 3G9RA 2W90A 2ZYGA 3SWFA 1Q82Q 1JEKA 1P84E 3PP5A 1SQVE 4U3FG 2P2UA 1KB9H 2LXCB 5KLVG 1HTLC 1URQD 1P84I 3AEAC 1H8AA 3A0BE 3JCUE 2D2CB 1PIXA 4JYBA 2HODA 1YI2P 2M3EA 1N73C 1KD1Q 4IOIH 2FYUJ 4IL6X 1L0ND 2P7JA 4PJ0E 3AEDC 2BEQD 1KQFB 2I1KA 3I5CA 3H25A 5AVXB 1PGQA 1GMJA 1N73A 1IFIA 3AEGC 2DW3A 1SQQE 1EDJA 3NTNA 1X22A 2QJKB 4H44D 2QG4A 3P8CD 3H6PA 1NTZG 1LNQA 1OZHA 1UIXA 3RK3B 3Q5PA 5BVZA 1FZCB 4RO0A 2KI7B 3CWBD 5KKZC 1FZGA 3ZDMA 3FXEA 1IK9A 1NTMJ 1L0NE 1VF5D 5AVQB 2HYNA 1P84H 2OGUA 1QEXA 3WMM0 3GW6A 3B5NB 3MP7B 1DEBA 2K3RA 2N1TB 3H1KJ 2KS1B 2A45I 1OWAA 1U7MA 4PD4I 2ZYDA 1Q90D 1L0LE 3N7NA 3JCUH 2Z5HA 3IF4A 1LTBC 3P8CE 1N7SB 5AVTB 2P58A 4IL6E 4WB4A 3CWBE 1X79B 1NKNA 4PJ0H 5AW0B 3D70A 1SQBE 1KILD 2O01H 3OJAB 3BCCJ 3L75J 1SS1A 3CL3D 2KIKA 3H1LJ 2IYPA 2FYUK 2Z4EA 2YIUC 2FYUD 3BASA 2ZT9D 2BCCD 2JP3A 4M3LA 1SLQA 2JKVA 1SQXG 1U7JA 3V2PA 5KAFH 2L91A 1AVOA 2R44A 1NVOA 2YKQA 2PRRA 1FDIA 1IC2A 2A45H 3QWOC 2HPCA 2E76B 1EZVG 4PD4H 4DT0A 1OFCX 1U57A 1AQ5A 4JYCA 5CJ4A 1JTHB 4CPGA 3NXSA 2PP6A 3HTKB 2PAJA 3USSA 2E74D 3RBXA 1VQMP 1JUNA 5APWA 1K73Q 5CCGD 1NTMK 1BCCJ 5DJTB 1NTMD 2BCCE 4K35A 1FDMA 3CC4P 1YBKA 1N7LA 5AW8B 2WPRA 4C7NB 1RF1C 3H1KD 2H89C 3V2RA 2ZAEB 1BSNA 3Q1MA 5AVWB 4N6JA 2QJPB 4U7JA 2XNXA 1IFJA 3F5HA 1JCDA 2KK7A 1RF1A 2D2CC 1GW4A 1JY2P 1OW6A 1VL2A 1RHZB 3I56P 3BATA 2WWWA 3VMYA 3BCCD 3CXHD 3L75D 3H1LD
chains in the Genus database with same CATH topology
1W2EA 1XTGB 1MUUA 1SQXK 2WTYA 3M91A 1HWTC 5CCHA 2L5GB 5APQA 1LTTC 1VDFA 1JCCA 1MFZA 2J58A 5APXA 3M0AA 3HE5A 1LT9A 1GZLA 3RK2B 1GL2D 1XTCC 2Q7CA 3IFMA 1FZAA 1HUCA 1QL2A 1KZUB 2O1JA 3A7OA 2NPSA 3M9BA 5BU8B 3MIWA 3V2QA 3L37A 4IFDK 4IFFA 5CHXA 1HH0A 1CI6A 1NTKK 1MZ9A 1KQLA 4LLHA 2CPSA 3MTUE 3RL0D 1J1EC 1URQC 2NPSB 1DX7A 1GW3A 1T8ZA 4GIFA 3GHGB 2C9LY 2WT7A 1HGVA 1LTJB 1M1JB 2KSJA 3NFQA 1JY3N 2FYZA 3RK3C 3TSIA 2ZXEB 2W27A 2R3CA 1YTZT 2H7HA 1FZCC 2YKPA 2C9NY 3VMZA 1SQPK 2P67A 2WITA 3LIEA 2QM8A 4W7YA 1CW5A 1HVVA 3A5TA 2Q3IA 2HPCB 1YTZI 4Y99B 1IFDA 1RF0C 2ZFCA 1LWUB 5AW4B 1URQA 1N86A 1KILA 3M9QA 3B5NC 1GDTA 1GTWA 3BRTB 1L4AD 4I6MC 2N1TC 3L4FA 1J1EB 1FZCA 3C9IA 1SQVK 2GUVA 1IO4A 4DOJA 2BASA 2FKWB 1A02J 5AVSB 2HG5D 4KHXA 2KYVA 5AW7B 1RF0A 2FXMA 3VOPA 3U1CA 1PFIA 2O1KA 3RK2D 3HD7C 1LTSC 4B86A 1FU1A 3M9HA 3VP9A 3B5NA 5CCHD 1N2DC 1FAVA 1SFCC 1HBWA 3SWYA 3P32A 1X8YA 3KYQA 5CCGC 2N1TA 2M3BA 3BVHA 2Z5IA 1IFMA 2NPSD 5AW1B 3LIDA 3MD0A 1G2CA 2QM7A 5KJ7C 2FFDB 4IFMA 3HD7A 1LTIC 2E43A 1JO5A 4EIJA 4W7ZA 4WY4B 3U1AA 3VTPC 1SFCA 1ZLLA 5AW2B 1RF1B 5CCGA 3M06A 3HUSC 3II6A 3SWFA 4LGDE 2OYHC 3PP5A 2W6BA 3MUDA 4HYTB 2P2UA 1T2KC 5AVYB 5KJ7A 1HTLC 4RESB 1FZEA 1URQD 1HGZA 3TNUA 4AYCA 1H8AA 3HUSA 2WSCH 3HE5B 3CI9A 1LT9B 3UIAA 4JYBA 2OYHA 1Z56A 1ZV8A 2HODA 1HJBA 3VN0A 3RK3D 1GD2E 3VP8A 1N73C 1NHLA 3TNUB 1GU5A 1KILC 1NAFA 2GUSA 1JNMA 1CI6B 5AW5B 1M7LA 1FBMA 1GK4A 4N3YB 3A3YB 1JOCA 1RY3A 2P7JA 2WT7B 3B5ND 1KFMA 5APYA 2I1KA 3I5CA 5AVXB 2A45G 5APTA 2KOGA 4C46A 3IR9A 2N1TD 1JTHA 1N73A 1IJDB 1IFIA 2HFED 1ZR4A 2JJLA 3RL0C 4WY4D 1FJPA 4JF7A 3NTNA 2H43A 3LW5H 2Q5UA 1RE3C 2IFMA 1J1DC 1URQB 3HD7D 5CMZA 3P8CD 1KILB 3H6PA 1LTGC 1NKZB 4N78D 1ZN5A 4LC1A 4OH8B 2J59M 3RK3B 5BVZA 1FZCB 2WSEH 4C7NA 1FOSF 1FZGA 1N7SC 3CLQA 2KLVA 1IK9A 3P8MC 1LTAC 5AVQB 2HYNA 1RE3A 1A02F 5KJ7D 2R5DA 3WMM0 2OYIA 2YO2A 2R32A 1LGHB 3B5NB 1CSBA 2R5BA 4XA4A 3V4WA 2XKMA 3M0DC 4ZKUA 1DEBA 4GKGA 5AVVB 1NOHA 2POHA 1RE4C 2N1TB 2A45I 1OWAA 1FOSE 1J1DB 2XU6A 1H88A 1N7SA 3N7NA 3HE4A 3U59A 3EFGA 1FZFA 2Z5HA 3RK2C 1FJKA 1T2KD 1G2CB 1H89A 2N9BA 2YO3A 5AVUB 1LTBC 3HD7B 3P8CE 1NU1K 2GM4A 1SVFA 2YMYA 1N7SB 4W80A 5AVTB 4N78E 1NWQA 1YYCA 1AFOA 3M0DA 1ZR2A 1SFCB 1RE4A 4WB4A 1SQQK 1X79B 1NKNA 3B8EB 3L36A 3GHGC 5AW0B 1FZBA 4XE5B 1LTJC 1M1JC 1EQ7A 1JY2O 1MV8A 3V5BA 1KILD 1JY3O 2I1JA 4HH2A 1OXZA 2KB7P 2O01H 3A2AA 3OJAB 3V2NA 3CL3D 5AW6B 1G1JA 2FYUK 2Z4EA 5APVA 2XZRA 3BASA 2M8RA 4WBAA 3TYYA 4M3LA 2IFNA 3HUSB 4Y99C 2XV5A 1SLQA 1LWUC 1L0NK 2OYHB 1E5WA 5CJ0A 2HODB 4DZOA 3OAKA 1S9KD 3GHGA 2W6AA 1NH4A 3V2PA 4I2LC 1LTJA 1M1JA 1GL2C 5KTBA 3NMDA 2VRSA 2C0XA 1T3UA 3V4QA 3E1IA 1GK6A 5AVZB 2YKQA 1DH3A 5APSA 1X9VA 3T97A 1IC2A 1QL1A 1CZQA 1SP4A 1JY2N 2A45H 3HTKA 1NTZK 2WPSA 2LKMA 2HPCA 3KPEA 2IX7C 1L0LK 1KFNA 1LWUA 2YKOA 5AW3B 1AQ5A 4O9BA 1WRGA 1NO4A 4JYCA 4C7RA 5CJ4A 1JTHB 2MJZA 3NXSA 1N73B 2PP6A 3HTKB 5APUA 1GL2A 2KP8A 3N4XA 2OYIC 3P7KA 5AW9B 2PAJA 1N7SD 3L35A 3BRVB 1JUNA 1J2JB 1IFNA 1SFCD 2WSFH 5APWA 5CCGD 4AQRD 1NTMK 1GL2B 2WZ7A 3OA7A 1GU4A 1FDMA 2WPQA 5BU5A 2FFDC 1SQBK 3O8ZA 1S9KE 1N7LA 2Q9IA 4I1LA 1VPCA 2YNYA 4WY4C 3G3ZA 5AW8B 1L4AC 2WPRA 3H32A 4C7NB 1RF1C 2CPBA 3HRNA 3RL0B 3TK1A 1JMMA 2P1JA 3V2RA 1T3JA 4N6JA 5AVWB 4EOTA 3H32B 2OYIB 4AUWA 1WT6A 2OARA 2XNXA 1IFJA 2JEEA 2FFDA 1G1IA 2H8PD 5KLVK 3VMXA 4WY4A 5CCHC 2E42A 1L4AA 1JCDA 2HLOA 1RF1A 2XDJA 3MGNA 3HE4B 3KQGA 1LT9C 4GT1A 1GW4A 3KDPB 1JY2P 1JY3P 2C0WA 2IPPA 5AVRB 3VYIA 3BATA 1L4AB 2WWWA 2NPSC 3EQ2A 3VMYA 3R2PA 4ZKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV K;  2WSC H;  1SQV K;  2O01 H;  3G3Z A;  1SQX K;  1NTK K;  1NU1 K;  2FYU K;  2J59 M;  2WSF H;  1NTM K;  2WSE H;  1NTZ K;  3M9Q A;  2LKM A;  1SQQ K;  4IFD K;  1L0N K;  1L0L K;  3CLQ A;  2OAR A;  3LW5 H;  1SQB K;  1SQP K; 
#chains in the Genus database with same CATH topology
 1W2E A;  2L5G B;  3H1H J;  1LTT C;  2NZ2 A;  1PZQ A;  2Y0C A;  1GZL A;  2R3S A;  1GL2 D;  3SSU A;  2Q6Q A;  1HF9 A;  1KZU B;  3A7O A;  3V2Q A;  4IFD K;  1NTK K;  3RL0 D;  1J1E C;  3AE9 C;  2QJK C;  3GHG B;  1HGV A;  1M1J B;  2FYZ A;  2E75 B;  3H1J G;  3RK3 C;  2W27 A;  2H7H A;  1YTZ T;  2OYO A;  1FZC C;  2YKP A;  3BCC E;  3CXH E;  3H1L E;  1CW5 A;  1BCC D;  2Y9Y A;  4Y99 B;  2IBZ G;  3B5N C;  1EXI A;  3ABV C;  1L4A D;  1BGY E;  4I6M C;  1NTZ J;  2N1T C;  1FZC A;  3AE6 C;  2IDB A;  3FX0 A;  2HG5 D;  4KHX A;  1YIT P;  3U1C A;  1EDL A;  3RK2 D;  3B5N A;  2YXQ B;  5CCH D;  3TGU G;  1Y9B A;  2B89 A;  3KYQ A;  2NRG A;  2N1T A;  2KS1 A;  3L72 E;  3BVH A;  5C39 A;  4NPD A;  1AVY A;  2KUB A;  1BCC E;  2ZVO B;  2QM7 A;  5KJ7 C;  2FFD B;  1KB9 D;  1KC8 Q;  1OW7 A;  4LGD E;  4PV1 C;  3AEC C;  4H44 B;  3H1H D;  3AE7 C;  1RQU A;  2O01 J;  3L74 G;  2OTK E;  5KJ7 A;  1EXJ A;  1NU1 G;  4RES B;  2ITA A;  3CC2 P;  1SQQ J;  2E76 C;  2WSC H;  3CI9 A;  1Z56 A;  1NYH A;  3E1R A;  3VN0 A;  1YJN P;  3VP8 A;  1YJW P;  3TNU B;  5KAI E;  2A06 D;  5B66 H;  2KZJ A;  2GUS A;  1KB9 E;  1CI6 B;  5AW5 B;  4U3F E;  1GK4 A;  1RY3 A;  2G3A A;  5APY A;  4YXD C;  3KHU A;  5APT A;  4C46 A;  3IR9 A;  1JTH A;  5B5E E;  1NTZ D;  2ZYA A;  2JJL A;  4WY4 D;  1FJP A;  1IK7 A;  1MKM A;  1J1D C;  1L0L J;  5CMZ A;  3HD7 D;  1KIL B;  2M5A B;  1P84 D;  1WMK A;  1ZN5 A;  4LC1 A;  3CC7 P;  2AEJ A;  2QRX A;  4D6T G;  2ZT9 B;  2WSE H;  4C7N A;  2A06 E;  5K5G B;  1EDI A;  2JO1 A;  3CLQ A;  2KLV A;  1LTA C;  2SPZ A;  2R5D A;  2W83 C;  1SQB J;  3Q5R A;  4Z1M H;  1CSB A;  2R5B A;  3M0D C;  4K3A A;  3RGU A;  1ZXG A;  5AVV B;  1NOH A;  1RE4 C;  1EC5 A;  2O01 N;  1NTZ E;  2LXB A;  4MN4 C;  2K88 A;  2K37 A;  1FJK A;  2PFX A;  2YMK A;  2N9B A;  2YO3 A;  2B87 A;  5EFW B;  2GM4 A;  2YMY A;  5KAI H;  2E74 B;  3M0D A;  4KJM A;  4H13 B;  1RE4 A;  2KSE A;  4OWF A;  1BDD A;  1SQQ K;  3G71 P;  1SQQ D;  3A0H E;  3B8E B;  3GHG C;  1FZB A;  1M1J C;  1JY3 O;  1OXZ A;  3A2A A;  3V2N A;  2IYO A;  2J5U A;  2BEZ F;  5B5E H;  4WBA A;  2FYN C;  3D71 A;  3HUS B;  4Y99 C;  2W8Z A;  2XV5 A;  2OYH B;  1L0N K;  5CJ0 A;  2I8D A;  3EFF K;  2BCC J;  4PD4 D;  1S9K D;  3GHG A;  3CCM P;  4I2L C;  1M1J A;  1Q2N A;  1W2B O;  2FBW C;  1EZV D;  3NMD A;  1LP1 B;  1T3U A;  2UWJ E;  1NJI Q;  1QL1 A;  2LKM A;  1L0L K;  1L0L D;  2YKO A;  4C7R A;  5M1B A;  4BRY B;  1VQ9 P;  5E79 E;  3L73 G;  1VQ6 P;  5AW9 B;  3L35 A;  1SQX E;  5KAF E;  1SFC D;  3CCJ P;  2WSF H;  1YHQ P;  4JBZ A;  1VQ7 P;  1SQP G;  2AXT E;  1GL2 B;  4RKU J;  2WPQ A;  5BU5 A;  1QVG O;  2FFD C;  1SQB K;  4PD4 E;  3O8Z A;  1S9K E;  1SQB D;  1BE3 G;  3H1I J;  1S1C X;  1VPC A;  2YNY A;  3G3Z A;  1K9M Q;  1EZV E;  1PP9 G;  3HRN A;  3RL0 B;  4H44 C;  3A0H H;  2QJY B;  1T3J A;  1SQV G;  4EOT A;  3H32 B;  2OYI B;  1WT6 A;  1VQO P;  3W68 A;  3AEE C;  1JM0 A;  1EZV I;  2FFD A;  4OVN F;  1G1I A;  3L71 J;  2QEX P;  1VQN P;  1AA0 A;  2E42 A;  3S1K A;  2HLO A;  2LR2 A;  3MGN A;  3HE4 B;  4DCK A;  2IPP A;  5AVR B;  1L4A B;  2NPS C;  3CCL P;  1KMI Z;  1H0T A;  1PGP A;  3R2P A;  1R8E A;  3PRJ A;  1KV4 A;  1MUU A;  1HWT C;  2K1A A;  2KLU A;  1VDF A;  3CCU P;  1MFZ A;  2WVR A;  3M0A A;  2WSC J;  3RK2 B;  3IAO A;  3IFM A;  1OX3 A;  3M9B A;  2O1J A;  2NPS A;  5BU8 B;  5E79 H;  1BGY J;  2FXO A;  1HH0 A;  1KN7 A;  3Q3D A;  4HB1 A;  1X0T A;  3H1J D;  3VMA A;  1CI6 A;  1KQL A;  4LLH A;  2CPS A;  3MTU E;  1HJ0 A;  2AXT H;  4GIF A;  2C9L Y;  2N9Y B;  3NFQ A;  4NPF X;  3TSI A;  5GTI E;  1W5C E;  3JC2 2;  3VMZ A;  2WIT A;  3CME P;  4KT0 J;  3L72 J;  2Q3I A;  1S5L E;  1K8A Q;  1M56 D;  1VQK P;  5AW4 B;  4OGQ C;  1N86 A;  1KIL A;  1OVR A;  3GF3 A;  3M9Q A;  3H1I D;  3L4F A;  3B4S A;  2WSE J;  1PGJ A;  3FWL A;  1A02 J;  2K9J B;  5AVS B;  3H1J E;  2KYV A;  4B86 A;  4I7Z B;  2E74 C;  3L70 G;  1HBW A;  3L71 D;  3SWY A;  4H13 C;  1X8Y A;  5CCG C;  2IBZ E;  5DJU B;  2D2C D;  2WPV B;  1IFM A;  3MUD C;  4H0L D;  3MD0 A;  4IFM A;  1LTI C;  4Y28 J;  4EIJ A;  2IBZ I;  4WY4 B;  3U1A A;  3VTP C;  3H1I E;  5CCG A;  2OTL P;  3HUS C;  4U3F J;  2OYH C;  2V4H A;  1M90 Q;  5KLI B;  2E5T A;  3RBZ A;  3MUD A;  5KLV J;  3TGU E;  1Y47 A;  5CBN A;  1T2K C;  1DEE G;  1USE A;  5GTI H;  1BGY D;  2XND H;  4L76 A;  2OTJ P;  3L71 E;  3CCE P;  1HGZ A;  1S5L H;  1LJ2 A;  3HUS A;  2OYH A;  1FE6 A;  3MZW B;  3RK3 D;  1GD2 E;  1NHL A;  4A7P A;  1QGK B;  1VQL P;  2Q1K A;  1JNM A;  2FYU G;  3L72 D;  1PPJ D;  3B71 A;  2WT7 B;  3B5N D;  3CCR P;  1KFM A;  3WUT A;  1NU1 E;  2N1T D;  3RL0 C;  3CMA P;  5B66 E;  3AEB C;  4JF7 A;  2WSF J;  3PJS K;  3LW5 H;  5H2F H;  2QJY C;  2IFM A;  3AE1 C;  1URQ B;  1LTG C;  4ZNC A;  4OH8 B;  2J59 M;  3RK3 E;  2MKV A;  2Y9Z A;  1PL5 A;  4QMA A;  1AJY A;  1N7S C;  3CX5 I;  3P8M C;  1PPJ E;  1NTM G;  5KJ7 D;  1A02 F;  1D7M A;  2OYI A;  2YO2 A;  2R32 A;  4XA4 A;  3V4W A;  1NGM B;  4EDF A;  4GKG A;  2B88 A;  4PV1 D;  2FXP A;  1N7S A;  2IZ1 A;  3H1K G;  4U3F D;  3HE4 A;  3U59 A;  1FZF A;  3RK2 C;  1G2C B;  5KLV D;  1H89 A;  1JMB A;  5AVU B;  4JPZ B;  2JR8 A;  5KKZ B;  1SVF A;  1NWQ A;  1YYC A;  1ZR2 A;  1SFC B;  3CCV P;  3SFE C;  3L36 A;  4XE5 B;  1VF5 B;  2K9Y A;  1JY2 O;  4HH2 A;  2KB7 P;  1OVV A;  1G1J A;  3BCC G;  3L75 G;  1SQX J;  2M8R A;  1USD A;  1E5W A;  3CX5 H;  3OAK A;  2RH0 A;  1NH4 A;  4EI2 A;  4WVZ A;  5CBO A;  5KTB A;  5KLV E;  2VRS A;  2C0X A;  3E1I A;  1GK6 A;  5AVZ B;  1DH3 A;  2Y0D A;  1JY2 N;  3HTK A;  1NTZ K;  1KFN A;  1NTK G;  1KYO I;  1NO4 A;  2MJZ A;  4I7Z C;  5APU A;  2KP8 A;  2QJP C;  1VQ4 P;  3BRV B;  2V7Q J;  2GA1 A;  1QX8 A;  2K9J A;  2WZ7 A;  3GMA A;  1GU4 A;  2KNC B;  1ZRT E;  2Q3E A;  3AE4 C;  2Q9I A;  2OQQ A;  3D6Z A;  4JQ0 D;  4WY4 C;  5L8R J;  1S72 P;  1OW8 A;  3WUV A;  1JMM A;  3L70 J;  5KLI C;  4GDO A;  1AQT A;  2RKL A;  3L73 E;  4AUW A;  1BSH A;  3GG2 A;  3Q2Y A;  2JEE A;  2H8P D;  1SQP E;  3VMX A;  1FS0 E;  4WY4 A;  3WU2 E;  3KQG A;  4GT1 A;  3KDP B;  3I55 P;  1DIP A;  2HR3 A;  1EDK A;  2C0W A;  1YQ4 C;  1LT1 A;  1UII A;  1KYO H;  1Q81 Q;  2ZVN B;  2WSS H;  2W6J H;  1SQX K;  2E75 C;  2WTY A;  1ZP0 C;  1SQX D;  3M91 A;  2IZ0 A;  3PTZ A;  5APQ A;  1JCC A;  2J58 A;  4DJG A;  4GOF A;  3H1H G;  1M57 D;  1QL2 A;  1S2E A;  3MIW A;  2AXC A;  1JB0 J;  1IZN B;  5CHX A;  3F89 A;  1MZ9 A;  3G4S P;  1URQ C;  4H0L B;  1GW3 A;  3H1J J;  2WT7 A;  3G6E P;  1LTJ B;  2KSJ A;  1JY3 N;  1IFP A;  2ZXE B;  3D6Y A;  2R3C A;  3CCQ P;  1BDC A;  3T97 B;  3TDK A;  2A06 G;  3LIE A;  2QM8 A;  4W7Y A;  4ASW A;  2RN0 A;  3FWN A;  3LW5 J;  1RF0 C;  1LWU B;  1URQ A;  2RMZ A;  1R5S A;  1GDT A;  1AV1 A;  3RL0 g;  2JDI H;  4GOE A;  1M1K Q;  1J1E B;  1E79 H;  2QVA A;  2ZXX A;  3GF7 A;  3S4R A;  2GUV A;  1IO4 A;  2BAS A;  2FKW B;  3L70 D;  3WU2 H;  1S5L X;  1RF0 A;  2FXM A;  3VOP A;  1PFI A;  3TGU J;  1OMI A;  2JWA A;  4RJT A;  1LTS C;  3M9H A;  3VP9 A;  3C8V A;  1N2D C;  1SFC C;  3P32 A;  3O6Q B;  1S4X A;  3SWK A;  3JSV C;  2WQY C;  1VF5 C;  4UB8 E;  2NPS D;  3ITK A;  3LID A;  1G2C A;  2QE7 H;  1YQ3 C;  3E7K A;  3A0B H;  1SFC A;  1ZLL A;  3M06 A;  3II6 A;  2PGD A;  3L74 J;  3QH9 A;  3L70 E;  2W6B A;  4HYT B;  4R4L A;  1L2P A;  1NU1 J;  5AVY B;  4L74 A;  3AE8 C;  4L73 A;  1FZE A;  3TNU A;  4AYC A;  3HE5 B;  1LT9 B;  3UIA A;  1TU3 F;  1ZV8 A;  3SFD C;  1SQQ G;  1HJB A;  5TIS E;  1GU5 A;  1KIL C;  2G8Y A;  1NAF A;  2P10 A;  1VQ5 P;  4PV1 B;  1M7L A;  1FBM A;  2IBZ D;  4N3Y B;  3A3Y B;  2ZT9 C;  1JOC A;  4OGQ D;  4NPE A;  2A45 G;  1L0N G;  2KOG A;  1NTK J;  1IJD B;  2M5A A;  2HFE D;  1ZR4 A;  1KQG B;  1VQP P;  4R4M A;  2H43 A;  2Q5U A;  1RE3 C;  2V7Q H;  1KIL E;  4UB8 H;  1NKZ B;  2AEF A;  4N78 D;  4D6T J;  3TGU D;  2KNC A;  1YJ9 P;  3PHL A;  1L0L G;  4H13 D;  2FYU E;  1FOS F;  3GLM A;  1ZME C;  2E5Y A;  3Q5S A;  3W67 A;  1RE3 A;  4UB6 E;  3CWB G;  5H2F E;  3CPW O;  1LGH B;  2H88 C;  2XKM A;  4IL6 H;  4ZKU A;  4TLF A;  2POH A;  3C1L A;  1SQB G;  1FOS E;  1J1D B;  2QSI A;  1RH5 B;  2XU6 A;  1H88 A;  5TJH A;  3EFG A;  3L74 D;  1T2K D;  5TIS H;  1ZOY C;  4YXW H;  3HD7 B;  1NU1 K;  4EYY Q;  1NU1 D;  4W80 A;  4N78 E;  3EWK A;  4ZMD A;  1AFO A;  1NTM E;  2B87 B;  3AE2 C;  4H0L C;  1LTJ C;  3CX5 D;  2AEM A;  1EQ7 A;  1MV8 A;  3V5B A;  2I1J A;  2ZJS E;  3WUU A;  5AW6 B;  2WMM A;  2YXR B;  3H1K E;  5APV A;  2XZR A;  3TYY A;  2IFN A;  1LP1 A;  1LWU C;  2HOD B;  4DZO A;  1KQS O;  2W6A A;  1LTJ A;  1GL2 C;  4HKZ H;  3L74 E;  2BCC G;  1NTK D;  3S9O A;  3V4Q A;  5APS A;  1X9V A;  3T97 A;  4BRY A;  1CZQ A;  1SP4 A;  2WPS A;  3KPE A;  2IX7 C;  1LWU A;  1R5L A;  5AW3 B;  4O9B A;  1WRG A;  3KZI E;  4BWN A;  3L73 J;  4UB6 H;  3L75 E;  4D6T D;  1N73 B;  3CX5 E;  3FGA D;  1GL2 A;  3N4X A;  2OYI C;  2FYN B;  3P7K A;  1N7S D;  1SQP J;  1J2J B;  1IFN A;  4AQR D;  3OA7 A;  1BE3 J;  3CXH I;  4YPC A;  4GOD A;  1PP9 J;  3V6I A;  3PH0 A;  1FDO A;  4I1L A;  1Q86 Q;  1L4A C;  3H32 A;  2CPB A;  1NTK E;  3H1I G;  3O6Q A;  3TK1 A;  1SQV J;  1FC2 C;  2P1J A;  4L75 A;  2QA4 P;  2OAR A;  3CD6 P;  4WWI A;  5KLV K;  1KYO D;  1S3J A;  4D6T E;  5CCH C;  1L4A A;  3KXD A;  3L71 G;  1PGO A;  2XDJ A;  1LT9 C;  1JY3 P;  2E76 D;  3AE5 C;  2JWD A;  3VYI A;  4BXL A;  3EQ2 A;  1RQV A;  4ZKP A;  1XTG B;  3R4Y A;  5CCH A;  3AEF C;  5APX A;  3OW2 O;  1H0T B;  3HE5 A;  1LT9 A;  3H1L G;  1XTC C;  1QLE D;  3KZI H;  2Q7C A;  3CXH H;  1ZRT D;  1FZA A;  1HUC A;  2B9B A;  1K04 A;  3L37 A;  1VQ8 P;  4IFF A;  5GTH E;  1KYO E;  3K5B A;  1YIJ P;  1BGY G;  4YTP C;  2O3J A;  2KZI A;  2NPS B;  1DX7 A;  1T8Z A;  3PLN A;  1DD3 A;  3TF5 A;  3L73 D;  1QVF O;  2C9N Y;  1SQP K;  1L0N J;  2P67 A;  2YIU B;  1SQP D;  1KOR A;  3CCS P;  2Y0E A;  1Y8A A;  3H1H E;  1HVV A;  2CK3 H;  3IN6 A;  3A5T A;  2HPC B;  1OIP A;  1OVU A;  1YTZ I;  1IFD A;  4ASV A;  1K05 A;  2ZFC A;  1KB9 I;  3L72 G;  1PPJ G;  1BE3 D;  1GTW A;  1PP9 D;  3BRT B;  1DD4 A;  1KTM A;  1BCC G;  3AE3 C;  3C9I A;  1T6A A;  4HJG H;  1SQV K;  4DOJ A;  1SQV D;  1NAY A;  5AW7 B;  2O1K A;  3HD7 C;  1MFT A;  1FU1 A;  1M8O B;  1FAV A;  3CWB J;  2FY8 A;  2M0B A;  2M3B A;  1N8R Q;  2KXP B;  4OGQ B;  1ZW0 A;  3MHV A;  2Z5I A;  2QIW A;  1Q7Y Q;  4TT3 H;  5AW1 B;  1BE3 E;  1JO5 A;  3HD7 A;  2E43 A;  3FXD A;  2E75 D;  1PV3 A;  4W7Z A;  1PP9 E;  4XFJ A;  5GTH H;  5AW2 B;  1RF1 B;  3G9R A;  2W90 A;  2ZYG A;  3SWF A;  1Q82 Q;  1JEK A;  1P84 E;  3PP5 A;  1SQV E;  4U3F G;  2P2U A;  1KB9 H;  2LXC B;  5KLV G;  1HTL C;  1URQ D;  1P84 I;  3AEA C;  1H8A A;  3A0B E;  3JCU E;  2D2C B;  1PIX A;  4JYB A;  2HOD A;  1YI2 P;  2M3E A;  1N73 C;  1KD1 Q;  4IOI H;  2FYU J;  4IL6 X;  1L0N D;  2P7J A;  4PJ0 E;  3AED C;  2BEQ D;  1KQF B;  2I1K A;  3I5C A;  3H25 A;  5AVX B;  1PGQ A;  1GMJ A;  1N73 A;  1IFI A;  3AEG C;  2DW3 A;  1SQQ E;  1EDJ A;  3NTN A;  1X22 A;  2QJK B;  4H44 D;  2QG4 A;  3P8C D;  3H6P A;  1NTZ G;  1LNQ A;  1OZH A;  1UIX A;  3RK3 B;  3Q5P A;  5BVZ A;  1FZC B;  4RO0 A;  2KI7 B;  3CWB D;  5KKZ C;  1FZG A;  3ZDM A;  3FXE A;  1IK9 A;  1NTM J;  1L0N E;  1VF5 D;  5AVQ B;  2HYN A;  1P84 H;  2OGU A;  1QEX A;  3WMM 0;  3GW6 A;  3B5N B;  3MP7 B;  1DEB A;  2K3R A;  2N1T B;  3H1K J;  2KS1 B;  2A45 I;  1OWA A;  1U7M A;  4PD4 I;  2ZYD A;  1Q90 D;  1L0L E;  3N7N A;  3JCU H;  2Z5H A;  3IF4 A;  1LTB C;  3P8C E;  1N7S B;  5AVT B;  2P58 A;  4IL6 E;  4WB4 A;  3CWB E;  1X79 B;  1NKN A;  4PJ0 H;  5AW0 B;  3D70 A;  1SQB E;  1KIL D;  2O01 H;  3OJA B;  3BCC J;  3L75 J;  1SS1 A;  3CL3 D;  2KIK A;  3H1L J;  2IYP A;  2FYU K;  2Z4E A;  2YIU C;  2FYU D;  3BAS A;  2ZT9 D;  2BCC D;  2JP3 A;  4M3L A;  1SLQ A;  2JKV A;  1SQX G;  1U7J A;  3V2P A;  5KAF H;  2L91 A;  1AVO A;  2R44 A;  1NVO A;  2YKQ A;  2PRR A;  1FDI A;  1IC2 A;  2A45 H;  3QWO C;  2HPC A;  2E76 B;  1EZV G;  4PD4 H;  4DT0 A;  1OFC X;  1U57 A;  1AQ5 A;  4JYC A;  5CJ4 A;  1JTH B;  4CPG A;  3NXS A;  2PP6 A;  3HTK B;  2PAJ A;  3USS A;  2E74 D;  3RBX A;  1VQM P;  1JUN A;  5APW A;  1K73 Q;  5CCG D;  1NTM K;  1BCC J;  5DJT B;  1NTM D;  2BCC E;  4K35 A;  1FDM A;  3CC4 P;  1YBK A;  1N7L A;  5AW8 B;  2WPR A;  4C7N B;  1RF1 C;  3H1K D;  2H89 C;  3V2R A;  2ZAE B;  1BSN A;  3Q1M A;  5AVW B;  4N6J A;  2QJP B;  4U7J A;  2XNX A;  1IFJ A;  3F5H A;  1JCD A;  2KK7 A;  1RF1 A;  2D2C C;  1GW4 A;  1JY2 P;  1OW6 A;  1VL2 A;  1RHZ B;  3I56 P;  3BAT A;  2WWW A;  3VMY A;  3BCC D;  3CXH D;  3L75 D;  3H1L D; 
#chains in the Genus database with same CATH homology
 1W2E A;  1XTG B;  1MUU A;  1SQX K;  2WTY A;  3M91 A;  1HWT C;  5CCH A;  2L5G B;  5APQ A;  1LTT C;  1VDF A;  1JCC A;  1MFZ A;  2J58 A;  5APX A;  3M0A A;  3HE5 A;  1LT9 A;  1GZL A;  3RK2 B;  1GL2 D;  1XTC C;  2Q7C A;  3IFM A;  1FZA A;  1HUC A;  1QL2 A;  1KZU B;  2O1J A;  3A7O A;  2NPS A;  3M9B A;  5BU8 B;  3MIW A;  3V2Q A;  3L37 A;  4IFD K;  4IFF A;  5CHX A;  1HH0 A;  1CI6 A;  1NTK K;  1MZ9 A;  1KQL A;  4LLH A;  2CPS A;  3MTU E;  3RL0 D;  1J1E C;  1URQ C;  2NPS B;  1DX7 A;  1GW3 A;  1T8Z A;  4GIF A;  3GHG B;  2C9L Y;  2WT7 A;  1HGV A;  1LTJ B;  1M1J B;  2KSJ A;  3NFQ A;  1JY3 N;  2FYZ A;  3RK3 C;  3TSI A;  2ZXE B;  2W27 A;  2R3C A;  1YTZ T;  2H7H A;  1FZC C;  2YKP A;  2C9N Y;  3VMZ A;  1SQP K;  2P67 A;  2WIT A;  3LIE A;  2QM8 A;  4W7Y A;  1CW5 A;  1HVV A;  3A5T A;  2Q3I A;  2HPC B;  1YTZ I;  4Y99 B;  1IFD A;  1RF0 C;  2ZFC A;  1LWU B;  5AW4 B;  1URQ A;  1N86 A;  1KIL A;  3M9Q A;  3B5N C;  1GDT A;  1GTW A;  3BRT B;  1L4A D;  4I6M C;  2N1T C;  3L4F A;  1J1E B;  1FZC A;  3C9I A;  1SQV K;  2GUV A;  1IO4 A;  4DOJ A;  2BAS A;  2FKW B;  1A02 J;  5AVS B;  2HG5 D;  4KHX A;  2KYV A;  5AW7 B;  1RF0 A;  2FXM A;  3VOP A;  3U1C A;  1PFI A;  2O1K A;  3RK2 D;  3HD7 C;  1LTS C;  4B86 A;  1FU1 A;  3M9H A;  3VP9 A;  3B5N A;  5CCH D;  1N2D C;  1FAV A;  1SFC C;  1HBW A;  3SWY A;  3P32 A;  1X8Y A;  3KYQ A;  5CCG C;  2N1T A;  2M3B A;  3BVH A;  2Z5I A;  1IFM A;  2NPS D;  5AW1 B;  3LID A;  3MD0 A;  1G2C A;  2QM7 A;  5KJ7 C;  2FFD B;  4IFM A;  3HD7 A;  1LTI C;  2E43 A;  1JO5 A;  4EIJ A;  4W7Z A;  4WY4 B;  3U1A A;  3VTP C;  1SFC A;  1ZLL A;  5AW2 B;  1RF1 B;  5CCG A;  3M06 A;  3HUS C;  3II6 A;  3SWF A;  4LGD E;  2OYH C;  3PP5 A;  2W6B A;  3MUD A;  4HYT B;  2P2U A;  1T2K C;  5AVY B;  5KJ7 A;  1HTL C;  4RES B;  1FZE A;  1URQ D;  1HGZ A;  3TNU A;  4AYC A;  1H8A A;  3HUS A;  2WSC H;  3HE5 B;  3CI9 A;  1LT9 B;  3UIA A;  4JYB A;  2OYH A;  1Z56 A;  1ZV8 A;  2HOD A;  1HJB A;  3VN0 A;  3RK3 D;  1GD2 E;  3VP8 A;  1N73 C;  1NHL A;  3TNU B;  1GU5 A;  1KIL C;  1NAF A;  2GUS A;  1JNM A;  1CI6 B;  5AW5 B;  1M7L A;  1FBM A;  1GK4 A;  4N3Y B;  3A3Y B;  1JOC A;  1RY3 A;  2P7J A;  2WT7 B;  3B5N D;  1KFM A;  5APY A;  2I1K A;  3I5C A;  5AVX B;  2A45 G;  5APT A;  2KOG A;  4C46 A;  3IR9 A;  2N1T D;  1JTH A;  1N73 A;  1IJD B;  1IFI A;  2HFE D;  1ZR4 A;  2JJL A;  3RL0 C;  4WY4 D;  1FJP A;  4JF7 A;  3NTN A;  2H43 A;  3LW5 H;  2Q5U A;  1RE3 C;  2IFM A;  1J1D C;  1URQ B;  3HD7 D;  5CMZ A;  3P8C D;  1KIL B;  3H6P A;  1LTG C;  1NKZ B;  4N78 D;  1ZN5 A;  4LC1 A;  4OH8 B;  2J59 M;  3RK3 B;  5BVZ A;  1FZC B;  2WSE H;  4C7N A;  1FOS F;  1FZG A;  1N7S C;  3CLQ A;  2KLV A;  1IK9 A;  3P8M C;  1LTA C;  5AVQ B;  2HYN A;  1RE3 A;  1A02 F;  5KJ7 D;  2R5D A;  3WMM 0;  2OYI A;  2YO2 A;  2R32 A;  1LGH B;  3B5N B;  1CSB A;  2R5B A;  4XA4 A;  3V4W A;  2XKM A;  3M0D C;  4ZKU A;  1DEB A;  4GKG A;  5AVV B;  1NOH A;  2POH A;  1RE4 C;  2N1T B;  2A45 I;  1OWA A;  1FOS E;  1J1D B;  2XU6 A;  1H88 A;  1N7S A;  3N7N A;  3HE4 A;  3U59 A;  3EFG A;  1FZF A;  2Z5H A;  3RK2 C;  1FJK A;  1T2K D;  1G2C B;  1H89 A;  2N9B A;  2YO3 A;  5AVU B;  1LTB C;  3HD7 B;  3P8C E;  1NU1 K;  2GM4 A;  1SVF A;  2YMY A;  1N7S B;  4W80 A;  5AVT B;  4N78 E;  1NWQ A;  1YYC A;  1AFO A;  3M0D A;  1ZR2 A;  1SFC B;  1RE4 A;  4WB4 A;  1SQQ K;  1X79 B;  1NKN A;  3B8E B;  3L36 A;  3GHG C;  5AW0 B;  1FZB A;  4XE5 B;  1LTJ C;  1M1J C;  1EQ7 A;  1JY2 O;  1MV8 A;  3V5B A;  1KIL D;  1JY3 O;  2I1J A;  4HH2 A;  1OXZ A;  2KB7 P;  2O01 H;  3A2A A;  3OJA B;  3V2N A;  3CL3 D;  5AW6 B;  1G1J A;  2FYU K;  2Z4E A;  5APV A;  2XZR A;  3BAS A;  2M8R A;  4WBA A;  3TYY A;  4M3L A;  2IFN A;  3HUS B;  4Y99 C;  2XV5 A;  1SLQ A;  1LWU C;  1L0N K;  2OYH B;  1E5W A;  5CJ0 A;  2HOD B;  4DZO A;  3OAK A;  1S9K D;  3GHG A;  2W6A A;  1NH4 A;  3V2P A;  4I2L C;  1LTJ A;  1M1J A;  1GL2 C;  5KTB A;  3NMD A;  2VRS A;  2C0X A;  1T3U A;  3V4Q A;  3E1I A;  1GK6 A;  5AVZ B;  2YKQ A;  1DH3 A;  5APS A;  1X9V A;  3T97 A;  1IC2 A;  1QL1 A;  1CZQ A;  1SP4 A;  1JY2 N;  2A45 H;  3HTK A;  1NTZ K;  2WPS A;  2LKM A;  2HPC A;  3KPE A;  2IX7 C;  1L0L K;  1KFN A;  1LWU A;  2YKO A;  5AW3 B;  1AQ5 A;  4O9B A;  1WRG A;  1NO4 A;  4JYC A;  4C7R A;  5CJ4 A;  1JTH B;  2MJZ A;  3NXS A;  1N73 B;  2PP6 A;  3HTK B;  5APU A;  1GL2 A;  2KP8 A;  3N4X A;  2OYI C;  3P7K A;  5AW9 B;  2PAJ A;  1N7S D;  3L35 A;  3BRV B;  1JUN A;  1J2J B;  1IFN A;  1SFC D;  2WSF H;  5APW A;  5CCG D;  4AQR D;  1NTM K;  1GL2 B;  2WZ7 A;  3OA7 A;  1GU4 A;  1FDM A;  2WPQ A;  5BU5 A;  2FFD C;  1SQB K;  3O8Z A;  1S9K E;  1N7L A;  2Q9I A;  4I1L A;  1VPC A;  2YNY A;  4WY4 C;  3G3Z A;  5AW8 B;  1L4A C;  2WPR A;  3H32 A;  4C7N B;  1RF1 C;  2CPB A;  3HRN A;  3RL0 B;  3TK1 A;  1JMM A;  2P1J A;  3V2R A;  1T3J A;  4N6J A;  5AVW B;  4EOT A;  3H32 B;  2OYI B;  4AUW A;  1WT6 A;  2OAR A;  2XNX A;  1IFJ A;  2JEE A;  2FFD A;  1G1I A;  2H8P D;  5KLV K;  3VMX A;  4WY4 A;  5CCH C;  2E42 A;  1L4A A;  1JCD A;  2HLO A;  1RF1 A;  2XDJ A;  3MGN A;  3HE4 B;  3KQG A;  1LT9 C;  4GT1 A;  1GW4 A;  3KDP B;  1JY2 P;  1JY3 P;  2C0W A;  2IPP A;  5AVR B;  3VYI A;  3BAT A;  1L4A B;  2WWW A;  2NPS C;  3EQ2 A;  3VMY A;  3R2P A;  4ZKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...