1NTZK

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
b'MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ntzK00
2FYUK 3G3ZA 1SQPK 2OARA 5KLVK 1NTKK 1SQQK 2LKMA 3CLQA 3LW5H 2WSCH 1NTMK 2J59M 1SQVK 3M9QA 2WSEH 1SQBK 1NTZK 2WSFH 1NU1K 1L0NK 1SQXK 2O01H 1L0LK 4IFDK
chains in the Genus database with same CATH superfamily
1S5LE 2FYUD 1T2KC 2OYIB 4D6TE 3PRJA 2WT7B 2VRSA 3AEFC 4H13C 4NPDA 3H1KJ 3A2AA 3CCLP 2YXRB 2Q9IA 2HLOA 3Q1MA 3A5TA 1SLQA 4DOJA 2HYNA 2QA4P 1LGHB 1SQXE 3HUSB 3RK3D 3B5NB 3BRTB 4ZMDA 3Q5PA 3VP8A 1BCCD 2KB7P 5B5EH 1URQB 1SQPG 3H1LE 2OYOA 1OXZA 1NHLA 1SQVE 1YQ4C 1UIXA 1FZEA 3CXHD 2A06G 4GIFA 2R32A 1SVFA 3H1KG 3GLMA 1N73B 1UIIA 4O9BA 1X0TA 1SFCD 4DJGA 1NKNA 2IZ1A 2KS1A 1LP1A 2JR8A 1IFMA 3L70D 3V2NA 1KQLA 3PTZA 2I1JA 2FXMA 2RH0A 1GD2E 2E75C 5AW1B 1N7SB 4LGDE 5AVYB 1S1CX 3CX5I 1RE3C 2H89C 3S9OA 2BCCE 3H1JJ 1M1JC 3BRVB 2YO2A 2FYNB 1SQBD 3A0BH 2IFMA 3ABVC 1QL2A 1BSNA 1YQ3C 1DD3A 3JC22 3RK3B 1EZVD 1NYHA 1SQQK 2ZYGA 1PP9E 1YHQP 3IF4A 1HVVA 5APYA 5KLVE 2E76C 1PIXA 4I7ZC 4Y99C 3FXDA 1RE4A 1ZW0A 3M0DA 1NTZD 3CWBJ 3KYQA 5CJ0A 1NTKD 3H1JG 5CCGD 1S4XA 4N3YB 1U7JA 3M9HA 2FYUK 3NXSA 2WPSA 1QGKB 1XTCC 2ZVOB 2B9BA 5CMZA 4WY4C 1YITP 5AW8B 1DX7A 3LW5H 1FBMA 2OTJP 2BEZF 3O6QB 1EQ7A 3CWBG 1NTME 1R5LA 5AVQB 2K37A 1HBWA 3II6A 3BCCJ 1YJ9P 3AEGC 1L4AD 2M5AB 5BU5A 2N1TA 4PD4D 3M9QA 1RQVA 4BRYA 1ZRTD 3VTPC 2H88C 3P8CE 1PFIA 3CMAP 1BDDA 5AVWB 1EZVE 3HTKA 4PJ0E 1EXIA 1KMIZ 3GHGA 1S9KD 3AEBC 2QG4A 1H0TA 4U7JA 5M1BA 1SQQG 1OVVA 1NTZE 1LTJC 2Y0DA 3I55P 1BE3E 5GTHE 2HPCB 2JWDA 3RBXA 2P2UA 1S5LX 1HJBA 3H1IJ 1OFCX 4BWNA 3CXHH 1DH3A 1Q86Q 4WBAA 2B87A 3PHLA 3H1HJ 1BCCJ 3F5HA 1N7LA 3U1AA 2WMMA 1M57D 5KLIC 3VOPA 2A06D 2J59M 1SQBK 2FYUG 2W8ZA 3SSUA 3L4FA 4XFJA 3H6PA 1KILC 1AQTA 3SWKA 2FFDC 2NPSD 1MFZA 4R4MA 4IL6X 1EDJA 4U3FE 5APWA 2ZYDA 5CBNA 3SWFA 1GL2A 2Z4EA 3H1IG 1FZCA 4HB1A 1KB9E 1N2DC 1LTSC 3GMAA 3H1HG 1BCCG 4JYBA 4RO0A 2ITAA 1XTGB 4GODA 1NTKK 3H25A 2Y0CA 2H7HA 1AQ5A 1K9MQ 1IZNB 3T97A 2OYIA 3L74J 1A02F 3CL3D 2WT7A 1YJNP 2RKLA 1VQ4P 1QL1A 2LR2A 4BXLA 4H0LD 1AJYA 3AE8C 3K5BA 1RF0C 1TU3F 1LWUB 2GM4A 1SQBJ 2QM7A 4AYCA 1MFTA 3G4SP 5AW3B 3AEDC 5AVRB 3L70G 3HUSA 3IN6A 3B5NA 2N9BA 1L0LK 1T2KD 1L2PA 1VQ5P 2E5YA 4L76A 3JSVC 1URQA 4EOTA 2OYHC 5C39A 1SQPE 1FZBA 3G71P 5BVZA 2QJYC 4YPCA 1L0NJ 3L74G 4EIJA 2YKPA 3H1KE 1NU1K 3EWKA 1N73A 1NTKJ 2JP3A 1JTHB 3U1CA 1JY2P 1SQBG 2PP6A 2RMZA 1T3UA 1QEXA 5GTIH 2WSFH 4UB6H 1NOHA 1LT1A 1JNMA 3CWBD 2W27A 4PD4H 3CCUP 1KB9H 1L0NG 1N86A 2V7QJ 1K8AQ 1N7SA 2KP8A 2GUVA 1L0LJ 3O8ZA 4W80A 3AEEC 2ZYAA 1NTKG 2WTYA 3VMXA 5B5EE 1IFPA 2NPSC 2P7JA 1EXJA 2YMKA 3TDKA 1YTZI 1NU1J 2ZXXA 2E75D 3BASA 1JEKA 1AVYA 3HD7B 1WT6A 1EDIA 5CCHA 1VDFA 2XV5A 1NKZB 4H13B 1OWAA 3BCCD 3C1LA 3EFFK 3R4YA 1P84D 1NVOA 2O01N 2WSCJ 4JQ0D 3KHUA 1L0LG 1KORA 2QJPC 3B8EB 3SWYA 2XZRA 3H1JE 3D6YA 5L8RJ 1LTBC 1SFCA 1KFNA 2BEQD 1Q81Q 1USEA 2E76D 3QH9A 2WPRA 1NU1G 4H0LC 1OW8A 1KB9I 3L71J 1WMKA 4N78E 3W68A 3T97B 2A45I 4H44C 3TF5A 2GA1A 1ZR2A 2JKVA 2KSJA 1HGVA 3A0BE 1FE6A 4JBZA 3O6QA 2WSSH 2H8PD 2L91A 1HH0A 2W6JH 1Y47A 2M5AA 1OX3A 3H1ID 1NH4A 3P7KA 3L73J 3VYIA 2GUSA 2ZT9B 2C9LY 4WY4D 1LNQA 2D2CD 1Q82Q 4OGQC 3H32B 2M3EA 3H1HD 2HFED 4WB4A 3P8MC 1N8RQ 1M56D 1VPCA 1YYCA 3MIWA 2E75B 1GL2C 1VQPP 1U7MA 1IK7A 4GT1A 2O1JA 1FZCC 5B66E 1S72P 4PV1C 2YO3A 2IBZD 2ZFCA 1SQQE 3USSA 1GTWA 3RBZA 2OGUA 3V2PA 3L73G 1G1JA 5KJ7C 2HPCA 3AEAC 5CCGA 2KYVA 1W2EA 2Q7CA 3CCRP 2E76B 2E74B 4I7ZB 2JWAA 1OVUA 4Y99B 2KZJA 1KQFB 1HF9A 3TNUB 2QEXP 5TISE 3L74D 5KKZC 2Q3IA 2FYUE 3IAOA 1IFNA 5H2FH 1GK4A 1URQC 2KUBA 3L75J 1X9VA 3HE4B 3GW6A 1KC8Q 4WY4B 3NFQA 1Y8AA 3RK3E 2KIKA 3MUDA 1X8YA 3H1HE 1BCCE 1SQVK 3WUUA 1USDA 1VQ8P 1KILD 2K9YA 2O3JA 1L0ND 2G3AA 3A0HH 4QMAA 1LT9C 1DEBA 1DD4A 3B4SA 3CXHE 1J1DC 1IC2A 1PGPA 3L75G 3CCJP 2G8YA 3CPWO 4D6TJ 4OWFA 1SFCB 3L37A 1JMMA 5B66H 2P58A 1GW3A 1RH5B 2ZAEB 1CZQA 4TT3H 2AEFA 4ASWA 1W5CE 5CJ4A 1X79B 2W83C 3FGAD 1LWUA 4GKGA 1OW6A 1P84H 1SS1A 1MZ9A 2XNDH 3L70E 1M7LA 2D2CC 3NTNA 2L5GB 1D7MA 1VF5C 3V2RA 1H88A 2XNXA 3KDPB 3SFDC 4NPFX 1J1EC 1LTJB 1Z56A 1L0LD 3V4QA 2OARA 3L74E 1IJDB 2R44A 1PGJA 3AE3C 3H1LJ 4L73A 2FBWC 4XE5B 5AW6B 3IR9A 1SQVJ 2ZVNB 4D6TG 2P10A 1OIPA 5TISH 3KQGA 3Q2YA 1JTHA 1KYOD 1NU1D 1M1KQ 1SQBE 2R3CA 1JB0J 1JY3P 5AVVB 4A7PA 2B88A 1K73Q 1RF1B 1ZLLA 2LKMA 5KLIB 1BDCA 1PPJD 3CCQP 3U59A 1KILB 2ZJSE 2AEJA 2FFDB 3BCCG 4XA4A 3OA7A 3H1LG 1T6AA 3M06A 1SQVG 3BATA 2QM8A 4AUWA 1NTKE 1VQ6P 1OMIA 4N6JA 4JPZB 1OZHA 2R3SA 4KT0J 3TGUD 3L71D 2BCCJ 1QVGO 3AE7C 1G2CB 1ZP0C 5CHXA 1FZGA 3D6ZA 2M8RA 2PAJA 4K3AA 3HD7A 3MD0A 2I1KA 3HRNA 1VQNP 1PP9J 3D71A 1KFMA 5KLVJ 1GU5A 5GTIE 5DJTB 1LJ2A 3D70A 2YIUC 4DZOA 2IDBA 5APVA 4UB6E 1L4AB 3L73D 3G6EP 3L72J 2IYOA 3WUVA 3PLNA 4YXWH 3M0AA 3I5CA 2KOGA 2WSEJ 3EFGA 3S1KA 1AA0A 1HTLC 3EQ2A 4WVZA 4PD4E 1L0NK 3Q3DA 2HR3A 2PRRA 3E1RA 3FWNA 1ZRTE 2OQQA 1T8ZA 2OYHB 2QJYB 3CCVP 1OVRA 1HJ0A 1S9KE 1H8AA 2PGDA 2XKMA 3CXHI 1KV4A 2FXPA 2IBZG 3L72G 1JY2O 3CX5D 3RK2C 3NMDA 2K9JB 1NTMJ 5APXA 2Q1KA 1IFJA 4ZNCA 4TLFA 4I1LA 2UWJE 1IFIA 1GMJA 3RL0g 3H32A 4H44D 5AW2B 1VL2A 2FYZA 5KAIH 2N9YB 2DW3A 4L75A 3AE9C 5KAFH 1RY3A 2A06E 4RKUJ 3L75D 4GDOA 5APQA 2NPSB 1RE3A 1QX8A 1JCCA 1RE4C 2JDIH 3M0DC 5K5GB 1KN7A 5AW7B 4OGQD 1IFDA 3M91A 2P67A 3L73E 1NAYA 2Q5UA 2V7QH 1PZQA 4C7NB 1GL2D 2XDJA 1YTZT 1G1IA 1AVOA 1EDKA 2HODB 3G3ZA 1Q2NA 2IZ0A 1EZVI 3VMAA 1K04A 4PV1D 5AW5B 4L74A 4W7YA 5AW9B 1X22A 3VMZA 1T3JA 3TNUA 2CK3H 1KYOH 2QJPB 3GF7A 3LIEA 4D6TD 5KJ7D 4HH2A 3CC4P 2B89A 1VQLP 1JOCA 1HGZA 5AW4B 3AE5C 2R5BA 1FZFA 2KSEA 3HE4A 1MUUA 3CX5E 4H0LB 3A3YB 5APSA 2WSCH 1DIPA 1E5WA 1JO5A 3RL0C 3TYYA 3C9IA 2Q6QA 4WY4A 2N1TC 2O01H 1YI2P 1NGMB 4H44B 3WMM0 1W2BO 1Q90D 1GU4A 3Q5SA 2QJKC 1URQD 4GOFA 4UB8H 3H1LD 2PFXA 3FX0A 1BGYJ 2QE7H 3Q5RA 1SQVD 4AQRD 2O01J 3GHGC 3KXDA 3WU2H 3PP5A 4MN4C 3V4WA 1E79H 4GOEA 5AVXB 1S3JA 4B86A 2KNCB 4PD4I 1QVFO 4RJTA 3BVHA 3TGUJ 4OH8B 5H2FE 4KHXA 2CPBA 2XU6A 4I2LC 4Y28J 1ZMEC 1PPJG 3CMEP 2I8DA 4PV1B 3CWBE 1BGYG 1LTJA 2IX7C 1KTMA 1WRGA 3CI9A 2KZIA 1SQPJ 3HD7C 4JYCA 1A02J 4NPEA 2J5UA 3WUTA 2BCCD 3A0HE 1VF5D 3TGUG 3L71G 1PGOA 4LC1A 4EDFA 4DCKA 1RF1A 3CX5H 2QVAA 5KKZB 2WWWA 1PP9D 3RGUA 1CSBA 5KLVD 5CCHD 1M8OB 1KILA 2JEEA 4IL6E 2FFDA 3BCCE 1M1JB 3FWLA 2JO1A 3L72D 3M9BA 1P84E 1LTGC 2M0BA 3L36A 4IFDK 3P32A 4Z1MH 1GDTA 2KXPB 1JY2N 3V6IA 2OYIC 3CCMP 2KLUA 2W6AA 2QSIA 1R8EA 2MKVA 4LLHA 1G2CA 4IFFA 1LT9B 3OAKA 2ZT9C 4IOIH 3HUSC 2WITA 3B5NC 1YJWP 1J1DB 3VMYA 3PH0A 1NTMD 2HG5D 4EI2A 3E1IA 1SQXK 2O1KA 3N4XA 2Z5HA 4KJMA 1GZLA 1L4AA 3MTUE 5BU8B 5APTA 1LTIC 1RHZB 1RF0A 1NWQA 3H1IE 4EYYQ 1FAVA 1K05A 2D2CB 2NRGA 1N73C 1FC2C 1VF5B 2KLVA 1S5LH 3P8CD 2W6BA 3LIDA 3ITKA 2OYHA 1FDOA 2E5TA 1J1EB 1FDMA 5AVTB 3GF3A 1AV1A 5TJHA 1CI6B 1GK6A 1FDIA 2AEMA 3TK1A 2E74C 2E43A 4C7RA 2IBZE 2YKQA 3L72E 3TSIA 2QIWA 2K9JA 1VQKP 1N7SC 1JY3O 4IL6H 1BE3D 1KQSO 1NO4A 1ZOYC 1SQXJ 5APUA 2FYNC 3HE5B 1ZXGA 3KZIE 3C8VA 4R4LA 3RK3C 5AW0B 3RK2D 4YXDC 1FJKA 3UIAA 5CCHC 3QWOC 3ZDMA 5EFWB 3SFEC 2YXQB 2NPSA 2BASA 3AE1C 5AVUB 2AXTE 1JUNA 3VN0A 1JMBA 1SQQJ 3AE6C 4U3FD 3V5BA 5KLVK 1HWTC 3A7OA 3B71A 2NZ2A 3N7NA 4C7NA 5CBOA 3LW5J 3E7KA 1SQXG 2C9NY 1KB9D 2HODA 2CPSA 1SFCC 2Y9YA 1MKMA 1EDLA 2OTLP 1BGYD 1VQ7P 1KILE 1PV3A 1L0NE 3IFMA 2YIUB 1P84I 3F89A 5KAIE 4ASVA 2FYUJ 1BSHA 3JCUE 1KZUB 5KAFE 2WZ7A 1PGQA 3OW2O 2POHA 2KS1B 1LP1B 3CCSP 1S2EA 1NTMK 2WSEH 1IK9A 1SP4A 1VQ9P 3S4RA 1VQOP 1SQPD 2Y9ZA 3RK2B 2H43A 1RF1C 1L0LE 3GG2A 5E79E 1QLED 2QRXA 3CLQA 1GW4A 3H1KD 2YMYA 2E42A 3KZIH 3RL0D 1FJPA 3VP9A 5AVZB 2N1TD 4ZKPA 2BCCG 1KYOE 4W7ZA 1NU1E 2KNCA 3MGNA 5CCGC 2AXTH 4ZKUA 2WVRA 1KQGB 1NTZK 1YIJP 1PP9G 1JM0A 1JCDA 1PPJE 3L70J 1Y9BA 5KLVG 4JF7A 3W67A 4DT0A 1BGYE 1RQUA 1FS0E 2IBZI 5KJ7A 1FU1A 3G9RA 2FXOA 2LXBA 4PJ0H 3CD6P 1ZN5A 4UB8E 1NAFA 2WQYC 1M90Q 2SPZA 3TGUE 3L71E 1H89A 2K3RA 3OJAB 1L4AC 4HYTB 2MJZA 2AXCA 2Z5IA 3JCUH 3WU2E 1YBKA 3HD7D 3MUDC 2C0XA 5GTHH 1ZV8A 4H13D 1M1JA 1NTMG 3CC2P 1NTZJ 3R2PA 2ZXEB 3RL0B 3H1JD 2N1TB 5DJUB 4WWIA 5E79H 1BE3J 2W90A 1JY3N 2IFNA 1Q7YQ 2V4HA 4BRYB 3AE2C 1LTAC 3L35A 4K35A 2Y0EA 1HUCA 2QJKB 4IFMA 1FOSF 2WPQA 3FXEA 1LWUC 1NJIQ 4N78D 1LT9A 2FY8A 1EZVG 3HTKB 2YKOA 3CCEP 4RESB 3GHGB 4HJGH 1J2JB 1H0TB 1VQMP 3MZWB 5KTBA 2IPPA 1NTZG 2K88A 4C46A 3MHVA 1KD1Q 1U57A 2WSFJ 1BE3G 2Q3EA 1OW7A 1R5SA 2A45H 4U3FJ 1SQXD 3MP7B 2ZT9D 1SQPK 3B5ND 1FOSE 2IYPA 1FZAA 1LTTC 2B87B 1CW5A 2FKWB 4CPGA 2JJLA 4M3LA 1CI6A 5AVSB 2OTKE 3AECC 2J58A 4OVNF 3L75E 2C0WA 2RN0A 3AE4C 4OGQB 3V2QA 1SQQD 2K1AA 2YNYA 1AFOA 4I6MC 4U3FG 2WPVB 1KYOI 1MV8A 1ZR4A 2LXCB 1GL2B 4YTPC 1DEEG 2M3BA 1IO4A 2P1JA 1FZCB 3KPEA 2KI7B 2R5DA 2KK7A 2E74D 3HE5A 4HKZH 1PL5A 2A45G 3PJSK 1EC5A 3I56P 1N7SD 3CC7P
chains in the Genus database with same CATH topology
1FDMA 1N73A 5AVTB 1T2KC 2OYIB 1CI6B 1JTHB 2WT7B 3U1CA 1JY2P 2VRSA 1GK6A 1G2CB 3A2AA 5CHXA 1FZGA 3TK1A 2M8RA 2PAJA 3HD7A 3MD0A 2E43A 2PP6A 2Q9IA 2HLOA 1T3UA 2I1KA 4C7RA 3HRNA 2WSFH 2YKQA 3A5TA 1SLQA 3TSIA 1NOHA 4DOJA 1KFMA 2HYNA 1N7SC 1GU5A 1JY3O 1LGHB 1JNMA 3HUSB 3RK3D 3B5NB 3BRTB 4DZOA 5APVA 1L4AB 2W27A 3VP8A 1NO4A 2KB7P 1N86A 3M0AA 1N7SA 1URQB 3I5CA 2KOGA 2KP8A 3EFGA 2GUVA 1HTLC 3EQ2A 5APUA 3HE5B 1L0NK 3O8ZA 4W80A 2WTYA 3VMXA 1OXZA 1NHLA 1FZEA 2NPSC 4GIFA 2P7JA 3RK3C 1T8ZA 5AW0B 3RK2D 2R32A 1SVFA 2OYHB 1FJKA 1N73B 3UIAA 5CCHC 1YTZI 4O9BA 1SFCD 2NPSA 2BASA 1NKNA 1S9KE 3BASA 5AVUB 3HD7B 1H8AA 1WT6A 2XKMA 1JUNA 5CCHA 1VDFA 3VN0A 2XV5A 3V5BA 1IFMA 1NKZB 3V2NA 5KLVK 1KQLA 1HWTC 1JY2O 1OWAA 3RK2C 3A7OA 3NMDA 3N7NA 4C7NA 2I1JA 5APXA 2FXMA 1IFJA 2C9NY 2HODA 2CPSA 1SFCC 1GD2E 4I1LA 1IFIA 3B8EB 5AW1B 1N7SB 3H32A 2XZRA 3SWYA 4LGDE 5AVYB 5AW2B 2FYZA 3IFMA 1LTBC 1SFCA 1KFNA 1RE3C 2WPRA 1M1JC 1RY3A 3BRVB 2YO2A 2IFMA 1QL2A 4N78E 5APQA 2A45I 1KZUB 2NPSB 2WZ7A 1RE3A 1JCCA 1RE4C 2POHA 3M0DC 3RK3B 1ZR2A 2KSJA 1HGVA 5AW7B 1SQQK 1IFDA 3M91A 1HVVA 5APYA 2P67A 2Q5UA 1NTMK 4Y99C 2H8PD 4C7NB 1RE4A 2WSEH 3M0DA 1IK9A 1GL2D 2XDJA 1YTZT 1HH0A 1G1IA 1SP4A 1NH4A 2HODB 3G3ZA 3P7KA 3KYQA 3VYIA 2GUSA 5CJ0A 2C9LY 4WY4D 3RK2B 2H43A 1RF1C 3H32B 5AW5B 4W7YA 5AW9B 2HFED 4WB4A 3VMZA 5CCGD 3P8MC 1T3JA 3CLQA 3TNUA 1GW4A 1VPCA 1YYCA 4N3YB 2YMYA 2E42A 3RL0D 1FJPA 3VP9A 3MIWA 5AVZB 2N1TD 1GL2C 3LIEA 3M9HA 4ZKPA 5KJ7D 4HH2A 2FYUK 3NXSA 2WPSA 1XTCC 4GT1A 4W7ZA 2O1JA 1FZCC 5CMZA 1JOCA 4WY4C 1HGZA 5AW4B 3MGNA 2R5BA 1FZFA 3HE4A 1MUUA 2YO3A 5AW8B 1DX7A 2ZFCA 1FBMA 3A3YB 3LW5H 5APSA 5CCGC 2WSCH 4ZKUA 1GTWA 1E5WA 1NTZK 1JO5A 3RL0C 3TYYA 3C9IA 1JCDA 1EQ7A 4WY4A 2N1TC 2O01H 3V2PA 4JF7A 1G1JA 5AVQB 5KJ7C 3WMM0 1HBWA 3II6A 2HPCA 5CCGA 2KYVA 1W2EA 2Q7CA 1GU4A 1L4AD 5BU5A 2N1TA 1URQD 4Y99B 5KJ7A 3M9QA 1FU1A 4AQRD 3TNUB 3GHGC 3VTPC 3P8CE 1ZN5A 1PFIA 1NAFA 3PP5A 1H89A 2Q3IA 3V4WA 3OJAB 5AVWB 1L4AC 4HYTB 1IFNA 2MJZA 3HTKA 5AVXB 4B86A 2Z5IA 3GHGA 1S9KD 1GK4A 1URQC 3BVHA 1X9VA 3HE4B 3HD7D 4OH8B 2C0XA 4KHXA 1ZV8A 2XU6A 2CPBA 4I2LC 1LTJC 4WY4B 3NFQA 1M1JA 2HPCB 3MUDA 1X8YA 2P2UA 3R2PA 2ZXEB 1HJBA 1LTJA 1SQVK 2IX7C 1WRGA 3CI9A 3RL0B 1KILD 2N1TB 1DH3A 3HD7C 1JY3N 2IFNA 4JYCA 4WBAA 1A02J 1LT9C 1DEBA 1LTAC 3L35A 1N7LA 3U1AA 1HUCA 1J1DC 4IFMA 1IC2A 1FOSF 2WPQA 3VOPA 1LWUC 2J59M 4N78D 1LT9A 1SFCB 1SQBK 3L37A 1JMMA 3HTKB 2YKOA 3L4FA 4LC1A 1GW3A 1KILC 3H6PA 4RESB 3GHGB 1RF1A 1CZQA 2FFDC 2NPSD 1MFZA 5CJ4A 1X79B 2WWWA 1LWUA 1J2JB 1CSBA 4GKGA 5CCHD 5APWA 1MZ9A 5KTBA 1M7LA 2IPPA 3NTNA 1KILA 1GL2A 2JEEA 3SWFA 2Z4EA 4C46A 2L5GB 2FFDA 1M1JB 3M9BA 3V2RA 1H88A 1FZCA 2XNXA 3KDPB 1LTGC 2A45H 1N2DC 1LTSC 3L36A 4IFDK 3P32A 1J1EC 1LTJB 1Z56A 4JYBA 3V4QA 1SQPK 1GDTA 1JY2N 3B5ND 2OYIC 1XTGB 2OARA 1NTKK 1IJDB 1FOSE 2H7HA 1FZAA 4XE5B 1AQ5A 1LTTC 5AW6B 3IR9A 1CW5A 2W6AA 3T97A 2FKWB 3KQGA 2JJLA 2OYIA 4M3LA 1CI6A 1JTHA 1A02F 4LLHA 3CL3D 5AVSB 2WT7A 1G2CA 4IFFA 2R3CA 2J58A 1JY3P 1LT9B 5AVVB 3OAKA 1QL1A 3HUSC 2C0WA 2WITA 3B5NC 1RF1B 3V2QA 1J1DB 2YNYA 3VMYA 1ZLLA 2LKMA 1RF0C 2GM4A 1LWUB 2QM7A 4AYCA 1AFOA 5AW3B 4I6MC 3U59A 5AVRB 2HG5D 1MV8A 3HUSA 1ZR4A 3E1IA 1KILB 1GL2B 3B5NA 1SQXK 2O1KA 2N9BA 3N4XA 1L0LK 2Z5HA 2FFDB 1GZLA 1L4AA 3MTUE 4XA4A 5BU8B 1T2KD 2M3BA 1LTIC 5APTA 1IO4A 1RF0A 1NWQA 3OA7A 2P1JA 1FZCB 3KPEA 1URQA 4EOTA 1FAVA 2R5DA 2OYHC 3M06A 1FZBA 3BATA 1N73C 2QM8A 3HE5A 4AUWA 5BVZA 2KLVA 2A45G 4EIJA 2YKPA 4N6JA 3P8CD 2W6BA 1NU1K 3LIDA 2OYHA 1N7SD 1J1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU K;  3G3Z A;  1SQP K;  2OAR A;  5KLV K;  1NTK K;  1SQQ K;  2LKM A;  3CLQ A;  3LW5 H;  2WSC H;  1NTM K;  2J59 M;  1SQV K;  3M9Q A;  2WSE H;  1SQB K;  1NTZ K;  2WSF H;  1NU1 K;  1L0N K;  1SQX K;  2O01 H;  1L0L K;  4IFD K; 
#chains in the Genus database with same CATH topology
 1S5L E;  2FYU D;  1T2K C;  2OYI B;  4D6T E;  3PRJ A;  2WT7 B;  2VRS A;  3AEF C;  4H13 C;  4NPD A;  3H1K J;  3A2A A;  3CCL P;  2YXR B;  2Q9I A;  2HLO A;  3Q1M A;  3A5T A;  1SLQ A;  4DOJ A;  2HYN A;  2QA4 P;  1LGH B;  1SQX E;  3HUS B;  3RK3 D;  3B5N B;  3BRT B;  4ZMD A;  3Q5P A;  3VP8 A;  1BCC D;  2KB7 P;  5B5E H;  1URQ B;  1SQP G;  3H1L E;  2OYO A;  1OXZ A;  1NHL A;  1SQV E;  1YQ4 C;  1UIX A;  1FZE A;  3CXH D;  2A06 G;  4GIF A;  2R32 A;  1SVF A;  3H1K G;  3GLM A;  1N73 B;  1UII A;  4O9B A;  1X0T A;  1SFC D;  4DJG A;  1NKN A;  2IZ1 A;  2KS1 A;  1LP1 A;  2JR8 A;  1IFM A;  3L70 D;  3V2N A;  1KQL A;  3PTZ A;  2I1J A;  2FXM A;  2RH0 A;  1GD2 E;  2E75 C;  5AW1 B;  1N7S B;  4LGD E;  5AVY B;  1S1C X;  3CX5 I;  1RE3 C;  2H89 C;  3S9O A;  2BCC E;  3H1J J;  1M1J C;  3BRV B;  2YO2 A;  2FYN B;  1SQB D;  3A0B H;  2IFM A;  3ABV C;  1QL2 A;  1BSN A;  1YQ3 C;  1DD3 A;  3JC2 2;  3RK3 B;  1EZV D;  1NYH A;  1SQQ K;  2ZYG A;  1PP9 E;  1YHQ P;  3IF4 A;  1HVV A;  5APY A;  5KLV E;  2E76 C;  1PIX A;  4I7Z C;  4Y99 C;  3FXD A;  1RE4 A;  1ZW0 A;  3M0D A;  1NTZ D;  3CWB J;  3KYQ A;  5CJ0 A;  1NTK D;  3H1J G;  5CCG D;  1S4X A;  4N3Y B;  1U7J A;  3M9H A;  2FYU K;  3NXS A;  2WPS A;  1QGK B;  1XTC C;  2ZVO B;  2B9B A;  5CMZ A;  4WY4 C;  1YIT P;  5AW8 B;  1DX7 A;  3LW5 H;  1FBM A;  2OTJ P;  2BEZ F;  3O6Q B;  1EQ7 A;  3CWB G;  1NTM E;  1R5L A;  5AVQ B;  2K37 A;  1HBW A;  3II6 A;  3BCC J;  1YJ9 P;  3AEG C;  1L4A D;  2M5A B;  5BU5 A;  2N1T A;  4PD4 D;  3M9Q A;  1RQV A;  4BRY A;  1ZRT D;  3VTP C;  2H88 C;  3P8C E;  1PFI A;  3CMA P;  1BDD A;  5AVW B;  1EZV E;  3HTK A;  4PJ0 E;  1EXI A;  1KMI Z;  3GHG A;  1S9K D;  3AEB C;  2QG4 A;  1H0T A;  4U7J A;  5M1B A;  1SQQ G;  1OVV A;  1NTZ E;  1LTJ C;  2Y0D A;  3I55 P;  1BE3 E;  5GTH E;  2HPC B;  2JWD A;  3RBX A;  2P2U A;  1S5L X;  1HJB A;  3H1I J;  1OFC X;  4BWN A;  3CXH H;  1DH3 A;  1Q86 Q;  4WBA A;  2B87 A;  3PHL A;  3H1H J;  1BCC J;  3F5H A;  1N7L A;  3U1A A;  2WMM A;  1M57 D;  5KLI C;  3VOP A;  2A06 D;  2J59 M;  1SQB K;  2FYU G;  2W8Z A;  3SSU A;  3L4F A;  4XFJ A;  3H6P A;  1KIL C;  1AQT A;  3SWK A;  2FFD C;  2NPS D;  1MFZ A;  4R4M A;  4IL6 X;  1EDJ A;  4U3F E;  5APW A;  2ZYD A;  5CBN A;  3SWF A;  1GL2 A;  2Z4E A;  3H1I G;  1FZC A;  4HB1 A;  1KB9 E;  1N2D C;  1LTS C;  3GMA A;  3H1H G;  1BCC G;  4JYB A;  4RO0 A;  2ITA A;  1XTG B;  4GOD A;  1NTK K;  3H25 A;  2Y0C A;  2H7H A;  1AQ5 A;  1K9M Q;  1IZN B;  3T97 A;  2OYI A;  3L74 J;  1A02 F;  3CL3 D;  2WT7 A;  1YJN P;  2RKL A;  1VQ4 P;  1QL1 A;  2LR2 A;  4BXL A;  4H0L D;  1AJY A;  3AE8 C;  3K5B A;  1RF0 C;  1TU3 F;  1LWU B;  2GM4 A;  1SQB J;  2QM7 A;  4AYC A;  1MFT A;  3G4S P;  5AW3 B;  3AED C;  5AVR B;  3L70 G;  3HUS A;  3IN6 A;  3B5N A;  2N9B A;  1L0L K;  1T2K D;  1L2P A;  1VQ5 P;  2E5Y A;  4L76 A;  3JSV C;  1URQ A;  4EOT A;  2OYH C;  5C39 A;  1SQP E;  1FZB A;  3G71 P;  5BVZ A;  2QJY C;  4YPC A;  1L0N J;  3L74 G;  4EIJ A;  2YKP A;  3H1K E;  1NU1 K;  3EWK A;  1N73 A;  1NTK J;  2JP3 A;  1JTH B;  3U1C A;  1JY2 P;  1SQB G;  2PP6 A;  2RMZ A;  1T3U A;  1QEX A;  5GTI H;  2WSF H;  4UB6 H;  1NOH A;  1LT1 A;  1JNM A;  3CWB D;  2W27 A;  4PD4 H;  3CCU P;  1KB9 H;  1L0N G;  1N86 A;  2V7Q J;  1K8A Q;  1N7S A;  2KP8 A;  2GUV A;  1L0L J;  3O8Z A;  4W80 A;  3AEE C;  2ZYA A;  1NTK G;  2WTY A;  3VMX A;  5B5E E;  1IFP A;  2NPS C;  2P7J A;  1EXJ A;  2YMK A;  3TDK A;  1YTZ I;  1NU1 J;  2ZXX A;  2E75 D;  3BAS A;  1JEK A;  1AVY A;  3HD7 B;  1WT6 A;  1EDI A;  5CCH A;  1VDF A;  2XV5 A;  1NKZ B;  4H13 B;  1OWA A;  3BCC D;  3C1L A;  3EFF K;  3R4Y A;  1P84 D;  1NVO A;  2O01 N;  2WSC J;  4JQ0 D;  3KHU A;  1L0L G;  1KOR A;  2QJP C;  3B8E B;  3SWY A;  2XZR A;  3H1J E;  3D6Y A;  5L8R J;  1LTB C;  1SFC A;  1KFN A;  2BEQ D;  1Q81 Q;  1USE A;  2E76 D;  3QH9 A;  2WPR A;  1NU1 G;  4H0L C;  1OW8 A;  1KB9 I;  3L71 J;  1WMK A;  4N78 E;  3W68 A;  3T97 B;  2A45 I;  4H44 C;  3TF5 A;  2GA1 A;  1ZR2 A;  2JKV A;  2KSJ A;  1HGV A;  3A0B E;  1FE6 A;  4JBZ A;  3O6Q A;  2WSS H;  2H8P D;  2L91 A;  1HH0 A;  2W6J H;  1Y47 A;  2M5A A;  1OX3 A;  3H1I D;  1NH4 A;  3P7K A;  3L73 J;  3VYI A;  2GUS A;  2ZT9 B;  2C9L Y;  4WY4 D;  1LNQ A;  2D2C D;  1Q82 Q;  4OGQ C;  3H32 B;  2M3E A;  3H1H D;  2HFE D;  4WB4 A;  3P8M C;  1N8R Q;  1M56 D;  1VPC A;  1YYC A;  3MIW A;  2E75 B;  1GL2 C;  1VQP P;  1U7M A;  1IK7 A;  4GT1 A;  2O1J A;  1FZC C;  5B66 E;  1S72 P;  4PV1 C;  2YO3 A;  2IBZ D;  2ZFC A;  1SQQ E;  3USS A;  1GTW A;  3RBZ A;  2OGU A;  3V2P A;  3L73 G;  1G1J A;  5KJ7 C;  2HPC A;  3AEA C;  5CCG A;  2KYV A;  1W2E A;  2Q7C A;  3CCR P;  2E76 B;  2E74 B;  4I7Z B;  2JWA A;  1OVU A;  4Y99 B;  2KZJ A;  1KQF B;  1HF9 A;  3TNU B;  2QEX P;  5TIS E;  3L74 D;  5KKZ C;  2Q3I A;  2FYU E;  3IAO A;  1IFN A;  5H2F H;  1GK4 A;  1URQ C;  2KUB A;  3L75 J;  1X9V A;  3HE4 B;  3GW6 A;  1KC8 Q;  4WY4 B;  3NFQ A;  1Y8A A;  3RK3 E;  2KIK A;  3MUD A;  1X8Y A;  3H1H E;  1BCC E;  1SQV K;  3WUU A;  1USD A;  1VQ8 P;  1KIL D;  2K9Y A;  2O3J A;  1L0N D;  2G3A A;  3A0H H;  4QMA A;  1LT9 C;  1DEB A;  1DD4 A;  3B4S A;  3CXH E;  1J1D C;  1IC2 A;  1PGP A;  3L75 G;  3CCJ P;  2G8Y A;  3CPW O;  4D6T J;  4OWF A;  1SFC B;  3L37 A;  1JMM A;  5B66 H;  2P58 A;  1GW3 A;  1RH5 B;  2ZAE B;  1CZQ A;  4TT3 H;  2AEF A;  4ASW A;  1W5C E;  5CJ4 A;  1X79 B;  2W83 C;  3FGA D;  1LWU A;  4GKG A;  1OW6 A;  1P84 H;  1SS1 A;  1MZ9 A;  2XND H;  3L70 E;  1M7L A;  2D2C C;  3NTN A;  2L5G B;  1D7M A;  1VF5 C;  3V2R A;  1H88 A;  2XNX A;  3KDP B;  3SFD C;  4NPF X;  1J1E C;  1LTJ B;  1Z56 A;  1L0L D;  3V4Q A;  2OAR A;  3L74 E;  1IJD B;  2R44 A;  1PGJ A;  3AE3 C;  3H1L J;  4L73 A;  2FBW C;  4XE5 B;  5AW6 B;  3IR9 A;  1SQV J;  2ZVN B;  4D6T G;  2P10 A;  1OIP A;  5TIS H;  3KQG A;  3Q2Y A;  1JTH A;  1KYO D;  1NU1 D;  1M1K Q;  1SQB E;  2R3C A;  1JB0 J;  1JY3 P;  5AVV B;  4A7P A;  2B88 A;  1K73 Q;  1RF1 B;  1ZLL A;  2LKM A;  5KLI B;  1BDC A;  1PPJ D;  3CCQ P;  3U59 A;  1KIL B;  2ZJS E;  2AEJ A;  2FFD B;  3BCC G;  4XA4 A;  3OA7 A;  3H1L G;  1T6A A;  3M06 A;  1SQV G;  3BAT A;  2QM8 A;  4AUW A;  1NTK E;  1VQ6 P;  1OMI A;  4N6J A;  4JPZ B;  1OZH A;  2R3S A;  4KT0 J;  3TGU D;  3L71 D;  2BCC J;  1QVG O;  3AE7 C;  1G2C B;  1ZP0 C;  5CHX A;  1FZG A;  3D6Z A;  2M8R A;  2PAJ A;  4K3A A;  3HD7 A;  3MD0 A;  2I1K A;  3HRN A;  1VQN P;  1PP9 J;  3D71 A;  1KFM A;  5KLV J;  1GU5 A;  5GTI E;  5DJT B;  1LJ2 A;  3D70 A;  2YIU C;  4DZO A;  2IDB A;  5APV A;  4UB6 E;  1L4A B;  3L73 D;  3G6E P;  3L72 J;  2IYO A;  3WUV A;  3PLN A;  4YXW H;  3M0A A;  3I5C A;  2KOG A;  2WSE J;  3EFG A;  3S1K A;  1AA0 A;  1HTL C;  3EQ2 A;  4WVZ A;  4PD4 E;  1L0N K;  3Q3D A;  2HR3 A;  2PRR A;  3E1R A;  3FWN A;  1ZRT E;  2OQQ A;  1T8Z A;  2OYH B;  2QJY B;  3CCV P;  1OVR A;  1HJ0 A;  1S9K E;  1H8A A;  2PGD A;  2XKM A;  3CXH I;  1KV4 A;  2FXP A;  2IBZ G;  3L72 G;  1JY2 O;  3CX5 D;  3RK2 C;  3NMD A;  2K9J B;  1NTM J;  5APX A;  2Q1K A;  1IFJ A;  4ZNC A;  4TLF A;  4I1L A;  2UWJ E;  1IFI A;  1GMJ A;  3RL0 g;  3H32 A;  4H44 D;  5AW2 B;  1VL2 A;  2FYZ A;  5KAI H;  2N9Y B;  2DW3 A;  4L75 A;  3AE9 C;  5KAF H;  1RY3 A;  2A06 E;  4RKU J;  3L75 D;  4GDO A;  5APQ A;  2NPS B;  1RE3 A;  1QX8 A;  1JCC A;  1RE4 C;  2JDI H;  3M0D C;  5K5G B;  1KN7 A;  5AW7 B;  4OGQ D;  1IFD A;  3M91 A;  2P67 A;  3L73 E;  1NAY A;  2Q5U A;  2V7Q H;  1PZQ A;  4C7N B;  1GL2 D;  2XDJ A;  1YTZ T;  1G1I A;  1AVO A;  1EDK A;  2HOD B;  3G3Z A;  1Q2N A;  2IZ0 A;  1EZV I;  3VMA A;  1K04 A;  4PV1 D;  5AW5 B;  4L74 A;  4W7Y A;  5AW9 B;  1X22 A;  3VMZ A;  1T3J A;  3TNU A;  2CK3 H;  1KYO H;  2QJP B;  3GF7 A;  3LIE A;  4D6T D;  5KJ7 D;  4HH2 A;  3CC4 P;  2B89 A;  1VQL P;  1JOC A;  1HGZ A;  5AW4 B;  3AE5 C;  2R5B A;  1FZF A;  2KSE A;  3HE4 A;  1MUU A;  3CX5 E;  4H0L B;  3A3Y B;  5APS A;  2WSC H;  1DIP A;  1E5W A;  1JO5 A;  3RL0 C;  3TYY A;  3C9I A;  2Q6Q A;  4WY4 A;  2N1T C;  2O01 H;  1YI2 P;  1NGM B;  4H44 B;  3WMM 0;  1W2B O;  1Q90 D;  1GU4 A;  3Q5S A;  2QJK C;  1URQ D;  4GOF A;  4UB8 H;  3H1L D;  2PFX A;  3FX0 A;  1BGY J;  2QE7 H;  3Q5R A;  1SQV D;  4AQR D;  2O01 J;  3GHG C;  3KXD A;  3WU2 H;  3PP5 A;  4MN4 C;  3V4W A;  1E79 H;  4GOE A;  5AVX B;  1S3J A;  4B86 A;  2KNC B;  4PD4 I;  1QVF O;  4RJT A;  3BVH A;  3TGU J;  4OH8 B;  5H2F E;  4KHX A;  2CPB A;  2XU6 A;  4I2L C;  4Y28 J;  1ZME C;  1PPJ G;  3CME P;  2I8D A;  4PV1 B;  3CWB E;  1BGY G;  1LTJ A;  2IX7 C;  1KTM A;  1WRG A;  3CI9 A;  2KZI A;  1SQP J;  3HD7 C;  4JYC A;  1A02 J;  4NPE A;  2J5U A;  3WUT A;  2BCC D;  3A0H E;  1VF5 D;  3TGU G;  3L71 G;  1PGO A;  4LC1 A;  4EDF A;  4DCK A;  1RF1 A;  3CX5 H;  2QVA A;  5KKZ B;  2WWW A;  1PP9 D;  3RGU A;  1CSB A;  5KLV D;  5CCH D;  1M8O B;  1KIL A;  2JEE A;  4IL6 E;  2FFD A;  3BCC E;  1M1J B;  3FWL A;  2JO1 A;  3L72 D;  3M9B A;  1P84 E;  1LTG C;  2M0B A;  3L36 A;  4IFD K;  3P32 A;  4Z1M H;  1GDT A;  2KXP B;  1JY2 N;  3V6I A;  2OYI C;  3CCM P;  2KLU A;  2W6A A;  2QSI A;  1R8E A;  2MKV A;  4LLH A;  1G2C A;  4IFF A;  1LT9 B;  3OAK A;  2ZT9 C;  4IOI H;  3HUS C;  2WIT A;  3B5N C;  1YJW P;  1J1D B;  3VMY A;  3PH0 A;  1NTM D;  2HG5 D;  4EI2 A;  3E1I A;  1SQX K;  2O1K A;  3N4X A;  2Z5H A;  4KJM A;  1GZL A;  1L4A A;  3MTU E;  5BU8 B;  5APT A;  1LTI C;  1RHZ B;  1RF0 A;  1NWQ A;  3H1I E;  4EYY Q;  1FAV A;  1K05 A;  2D2C B;  2NRG A;  1N73 C;  1FC2 C;  1VF5 B;  2KLV A;  1S5L H;  3P8C D;  2W6B A;  3LID A;  3ITK A;  2OYH A;  1FDO A;  2E5T A;  1J1E B;  1FDM A;  5AVT B;  3GF3 A;  1AV1 A;  5TJH A;  1CI6 B;  1GK6 A;  1FDI A;  2AEM A;  3TK1 A;  2E74 C;  2E43 A;  4C7R A;  2IBZ E;  2YKQ A;  3L72 E;  3TSI A;  2QIW A;  2K9J A;  1VQK P;  1N7S C;  1JY3 O;  4IL6 H;  1BE3 D;  1KQS O;  1NO4 A;  1ZOY C;  1SQX J;  5APU A;  2FYN C;  3HE5 B;  1ZXG A;  3KZI E;  3C8V A;  4R4L A;  3RK3 C;  5AW0 B;  3RK2 D;  4YXD C;  1FJK A;  3UIA A;  5CCH C;  3QWO C;  3ZDM A;  5EFW B;  3SFE C;  2YXQ B;  2NPS A;  2BAS A;  3AE1 C;  5AVU B;  2AXT E;  1JUN A;  3VN0 A;  1JMB A;  1SQQ J;  3AE6 C;  4U3F D;  3V5B A;  5KLV K;  1HWT C;  3A7O A;  3B71 A;  2NZ2 A;  3N7N A;  4C7N A;  5CBO A;  3LW5 J;  3E7K A;  1SQX G;  2C9N Y;  1KB9 D;  2HOD A;  2CPS A;  1SFC C;  2Y9Y A;  1MKM A;  1EDL A;  2OTL P;  1BGY D;  1VQ7 P;  1KIL E;  1PV3 A;  1L0N E;  3IFM A;  2YIU B;  1P84 I;  3F89 A;  5KAI E;  4ASV A;  2FYU J;  1BSH A;  3JCU E;  1KZU B;  5KAF E;  2WZ7 A;  1PGQ A;  3OW2 O;  2POH A;  2KS1 B;  1LP1 B;  3CCS P;  1S2E A;  1NTM K;  2WSE H;  1IK9 A;  1SP4 A;  1VQ9 P;  3S4R A;  1VQO P;  1SQP D;  2Y9Z A;  3RK2 B;  2H43 A;  1RF1 C;  1L0L E;  3GG2 A;  5E79 E;  1QLE D;  2QRX A;  3CLQ A;  1GW4 A;  3H1K D;  2YMY A;  2E42 A;  3KZI H;  3RL0 D;  1FJP A;  3VP9 A;  5AVZ B;  2N1T D;  4ZKP A;  2BCC G;  1KYO E;  4W7Z A;  1NU1 E;  2KNC A;  3MGN A;  5CCG C;  2AXT H;  4ZKU A;  2WVR A;  1KQG B;  1NTZ K;  1YIJ P;  1PP9 G;  1JM0 A;  1JCD A;  1PPJ E;  3L70 J;  1Y9B A;  5KLV G;  4JF7 A;  3W67 A;  4DT0 A;  1BGY E;  1RQU A;  1FS0 E;  2IBZ I;  5KJ7 A;  1FU1 A;  3G9R A;  2FXO A;  2LXB A;  4PJ0 H;  3CD6 P;  1ZN5 A;  4UB8 E;  1NAF A;  2WQY C;  1M90 Q;  2SPZ A;  3TGU E;  3L71 E;  1H89 A;  2K3R A;  3OJA B;  1L4A C;  4HYT B;  2MJZ A;  2AXC A;  2Z5I A;  3JCU H;  3WU2 E;  1YBK A;  3HD7 D;  3MUD C;  2C0X A;  5GTH H;  1ZV8 A;  4H13 D;  1M1J A;  1NTM G;  3CC2 P;  1NTZ J;  3R2P A;  2ZXE B;  3RL0 B;  3H1J D;  2N1T B;  5DJU B;  4WWI A;  5E79 H;  1BE3 J;  2W90 A;  1JY3 N;  2IFN A;  1Q7Y Q;  2V4H A;  4BRY B;  3AE2 C;  1LTA C;  3L35 A;  4K35 A;  2Y0E A;  1HUC A;  2QJK B;  4IFM A;  1FOS F;  2WPQ A;  3FXE A;  1LWU C;  1NJI Q;  4N78 D;  1LT9 A;  2FY8 A;  1EZV G;  3HTK B;  2YKO A;  3CCE P;  4RES B;  3GHG B;  4HJG H;  1J2J B;  1H0T B;  1VQM P;  3MZW B;  5KTB A;  2IPP A;  1NTZ G;  2K88 A;  4C46 A;  3MHV A;  1KD1 Q;  1U57 A;  2WSF J;  1BE3 G;  2Q3E A;  1OW7 A;  1R5S A;  2A45 H;  4U3F J;  1SQX D;  3MP7 B;  2ZT9 D;  1SQP K;  3B5N D;  1FOS E;  2IYP A;  1FZA A;  1LTT C;  2B87 B;  1CW5 A;  2FKW B;  4CPG A;  2JJL A;  4M3L A;  1CI6 A;  5AVS B;  2OTK E;  3AEC C;  2J58 A;  4OVN F;  3L75 E;  2C0W A;  2RN0 A;  3AE4 C;  4OGQ B;  3V2Q A;  1SQQ D;  2K1A A;  2YNY A;  1AFO A;  4I6M C;  4U3F G;  2WPV B;  1KYO I;  1MV8 A;  1ZR4 A;  2LXC B;  1GL2 B;  4YTP C;  1DEE G;  2M3B A;  1IO4 A;  2P1J A;  1FZC B;  3KPE A;  2KI7 B;  2R5D A;  2KK7 A;  2E74 D;  3HE5 A;  4HKZ H;  1PL5 A;  2A45 G;  3PJS K;  1EC5 A;  3I56 P;  1N7S D;  3CC7 P; 
#chains in the Genus database with same CATH homology
 1FDM A;  1N73 A;  5AVT B;  1T2K C;  2OYI B;  1CI6 B;  1JTH B;  2WT7 B;  3U1C A;  1JY2 P;  2VRS A;  1GK6 A;  1G2C B;  3A2A A;  5CHX A;  1FZG A;  3TK1 A;  2M8R A;  2PAJ A;  3HD7 A;  3MD0 A;  2E43 A;  2PP6 A;  2Q9I A;  2HLO A;  1T3U A;  2I1K A;  4C7R A;  3HRN A;  2WSF H;  2YKQ A;  3A5T A;  1SLQ A;  3TSI A;  1NOH A;  4DOJ A;  1KFM A;  2HYN A;  1N7S C;  1GU5 A;  1JY3 O;  1LGH B;  1JNM A;  3HUS B;  3RK3 D;  3B5N B;  3BRT B;  4DZO A;  5APV A;  1L4A B;  2W27 A;  3VP8 A;  1NO4 A;  2KB7 P;  1N86 A;  3M0A A;  1N7S A;  1URQ B;  3I5C A;  2KOG A;  2KP8 A;  3EFG A;  2GUV A;  1HTL C;  3EQ2 A;  5APU A;  3HE5 B;  1L0N K;  3O8Z A;  4W80 A;  2WTY A;  3VMX A;  1OXZ A;  1NHL A;  1FZE A;  2NPS C;  4GIF A;  2P7J A;  3RK3 C;  1T8Z A;  5AW0 B;  3RK2 D;  2R32 A;  1SVF A;  2OYH B;  1FJK A;  1N73 B;  3UIA A;  5CCH C;  1YTZ I;  4O9B A;  1SFC D;  2NPS A;  2BAS A;  1NKN A;  1S9K E;  3BAS A;  5AVU B;  3HD7 B;  1H8A A;  1WT6 A;  2XKM A;  1JUN A;  5CCH A;  1VDF A;  3VN0 A;  2XV5 A;  3V5B A;  1IFM A;  1NKZ B;  3V2N A;  5KLV K;  1KQL A;  1HWT C;  1JY2 O;  1OWA A;  3RK2 C;  3A7O A;  3NMD A;  3N7N A;  4C7N A;  2I1J A;  5APX A;  2FXM A;  1IFJ A;  2C9N Y;  2HOD A;  2CPS A;  1SFC C;  1GD2 E;  4I1L A;  1IFI A;  3B8E B;  5AW1 B;  1N7S B;  3H32 A;  2XZR A;  3SWY A;  4LGD E;  5AVY B;  5AW2 B;  2FYZ A;  3IFM A;  1LTB C;  1SFC A;  1KFN A;  1RE3 C;  2WPR A;  1M1J C;  1RY3 A;  3BRV B;  2YO2 A;  2IFM A;  1QL2 A;  4N78 E;  5APQ A;  2A45 I;  1KZU B;  2NPS B;  2WZ7 A;  1RE3 A;  1JCC A;  1RE4 C;  2POH A;  3M0D C;  3RK3 B;  1ZR2 A;  2KSJ A;  1HGV A;  5AW7 B;  1SQQ K;  1IFD A;  3M91 A;  1HVV A;  5APY A;  2P67 A;  2Q5U A;  1NTM K;  4Y99 C;  2H8P D;  4C7N B;  1RE4 A;  2WSE H;  3M0D A;  1IK9 A;  1GL2 D;  2XDJ A;  1YTZ T;  1HH0 A;  1G1I A;  1SP4 A;  1NH4 A;  2HOD B;  3G3Z A;  3P7K A;  3KYQ A;  3VYI A;  2GUS A;  5CJ0 A;  2C9L Y;  4WY4 D;  3RK2 B;  2H43 A;  1RF1 C;  3H32 B;  5AW5 B;  4W7Y A;  5AW9 B;  2HFE D;  4WB4 A;  3VMZ A;  5CCG D;  3P8M C;  1T3J A;  3CLQ A;  3TNU A;  1GW4 A;  1VPC A;  1YYC A;  4N3Y B;  2YMY A;  2E42 A;  3RL0 D;  1FJP A;  3VP9 A;  3MIW A;  5AVZ B;  2N1T D;  1GL2 C;  3LIE A;  3M9H A;  4ZKP A;  5KJ7 D;  4HH2 A;  2FYU K;  3NXS A;  2WPS A;  1XTC C;  4GT1 A;  4W7Z A;  2O1J A;  1FZC C;  5CMZ A;  1JOC A;  4WY4 C;  1HGZ A;  5AW4 B;  3MGN A;  2R5B A;  1FZF A;  3HE4 A;  1MUU A;  2YO3 A;  5AW8 B;  1DX7 A;  2ZFC A;  1FBM A;  3A3Y B;  3LW5 H;  5APS A;  5CCG C;  2WSC H;  4ZKU A;  1GTW A;  1E5W A;  1NTZ K;  1JO5 A;  3RL0 C;  3TYY A;  3C9I A;  1JCD A;  1EQ7 A;  4WY4 A;  2N1T C;  2O01 H;  3V2P A;  4JF7 A;  1G1J A;  5AVQ B;  5KJ7 C;  3WMM 0;  1HBW A;  3II6 A;  2HPC A;  5CCG A;  2KYV A;  1W2E A;  2Q7C A;  1GU4 A;  1L4A D;  5BU5 A;  2N1T A;  1URQ D;  4Y99 B;  5KJ7 A;  3M9Q A;  1FU1 A;  4AQR D;  3TNU B;  3GHG C;  3VTP C;  3P8C E;  1ZN5 A;  1PFI A;  1NAF A;  3PP5 A;  1H89 A;  2Q3I A;  3V4W A;  3OJA B;  5AVW B;  1L4A C;  4HYT B;  1IFN A;  2MJZ A;  3HTK A;  5AVX B;  4B86 A;  2Z5I A;  3GHG A;  1S9K D;  1GK4 A;  1URQ C;  3BVH A;  1X9V A;  3HE4 B;  3HD7 D;  4OH8 B;  2C0X A;  4KHX A;  1ZV8 A;  2XU6 A;  2CPB A;  4I2L C;  1LTJ C;  4WY4 B;  3NFQ A;  1M1J A;  2HPC B;  3MUD A;  1X8Y A;  2P2U A;  3R2P A;  2ZXE B;  1HJB A;  1LTJ A;  1SQV K;  2IX7 C;  1WRG A;  3CI9 A;  3RL0 B;  1KIL D;  2N1T B;  1DH3 A;  3HD7 C;  1JY3 N;  2IFN A;  4JYC A;  4WBA A;  1A02 J;  1LT9 C;  1DEB A;  1LTA C;  3L35 A;  1N7L A;  3U1A A;  1HUC A;  1J1D C;  4IFM A;  1IC2 A;  1FOS F;  2WPQ A;  3VOP A;  1LWU C;  2J59 M;  4N78 D;  1LT9 A;  1SFC B;  1SQB K;  3L37 A;  1JMM A;  3HTK B;  2YKO A;  3L4F A;  4LC1 A;  1GW3 A;  1KIL C;  3H6P A;  4RES B;  3GHG B;  1RF1 A;  1CZQ A;  2FFD C;  2NPS D;  1MFZ A;  5CJ4 A;  1X79 B;  2WWW A;  1LWU A;  1J2J B;  1CSB A;  4GKG A;  5CCH D;  5APW A;  1MZ9 A;  5KTB A;  1M7L A;  2IPP A;  3NTN A;  1KIL A;  1GL2 A;  2JEE A;  3SWF A;  2Z4E A;  4C46 A;  2L5G B;  2FFD A;  1M1J B;  3M9B A;  3V2R A;  1H88 A;  1FZC A;  2XNX A;  3KDP B;  1LTG C;  2A45 H;  1N2D C;  1LTS C;  3L36 A;  4IFD K;  3P32 A;  1J1E C;  1LTJ B;  1Z56 A;  4JYB A;  3V4Q A;  1SQP K;  1GDT A;  1JY2 N;  3B5N D;  2OYI C;  1XTG B;  2OAR A;  1NTK K;  1IJD B;  1FOS E;  2H7H A;  1FZA A;  4XE5 B;  1AQ5 A;  1LTT C;  5AW6 B;  3IR9 A;  1CW5 A;  2W6A A;  3T97 A;  2FKW B;  3KQG A;  2JJL A;  2OYI A;  4M3L A;  1CI6 A;  1JTH A;  1A02 F;  4LLH A;  3CL3 D;  5AVS B;  2WT7 A;  1G2C A;  4IFF A;  2R3C A;  2J58 A;  1JY3 P;  1LT9 B;  5AVV B;  3OAK A;  1QL1 A;  3HUS C;  2C0W A;  2WIT A;  3B5N C;  1RF1 B;  3V2Q A;  1J1D B;  2YNY A;  3VMY A;  1ZLL A;  2LKM A;  1RF0 C;  2GM4 A;  1LWU B;  2QM7 A;  4AYC A;  1AFO A;  5AW3 B;  4I6M C;  3U59 A;  5AVR B;  2HG5 D;  1MV8 A;  3HUS A;  1ZR4 A;  3E1I A;  1KIL B;  1GL2 B;  3B5N A;  1SQX K;  2O1K A;  2N9B A;  3N4X A;  1L0L K;  2Z5H A;  2FFD B;  1GZL A;  1L4A A;  3MTU E;  4XA4 A;  5BU8 B;  1T2K D;  2M3B A;  1LTI C;  5APT A;  1IO4 A;  1RF0 A;  1NWQ A;  3OA7 A;  2P1J A;  1FZC B;  3KPE A;  1URQ A;  4EOT A;  1FAV A;  2R5D A;  2OYH C;  3M06 A;  1FZB A;  3BAT A;  1N73 C;  2QM8 A;  3HE5 A;  4AUW A;  5BVZ A;  2KLV A;  2A45 G;  4EIJ A;  2YKP A;  4N6J A;  3P8C D;  2W6B A;  1NU1 K;  3LID A;  2OYH A;  1N7S D;  1J1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...