1EZVG

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ezvG00
2A06G 3H1JG 1PPJG 3H1LG 1NTKG 3CXHH 1KYOH 1NTMG 3L71G 1SQBG 3TGUG 1EZVG 2BCCG 3H1KG 2IBZG 3L73G 3BCCG 2FYUG 1BCCG 1BGYG 3L74G 4U3FG 1PP9G 3L75G 1SQPG 3H1IG 1SQQG 3CX5H 5KLVG 1SQVG 1NTZG 3H1HG 1L0LG 1P84H 3CWBG 4PD4H 4D6TG 1BE3G 1L0NG 3L72G 3L70G 1NU1G 1KB9H 1SQXG
chains in the Genus database with same CATH superfamily
5TISH 3GG2A 5KLVD 1ZP0C 1BGYJ 4IOIH 1T8ZA 1EDLA 1M1KQ 3OJAB 3CD6P 1FOSF 5B66H 1DEEG 3V5BA 3EFGA 2E74C 2HG5D 1BGYD 2NPSD 3VMYA 2HPCB 4RO0A 1X79B 1YYCA 3HE4A 1ZXGA 3AE4C 3HE5A 1EDIA 3B5NB 1JEKA 1VQPP 1L4AB 4NPDA 2Q9IA 2Q3EA 1RF1A 2QSIA 3RL0D 1SFCD 1IFNA 4K3AA 1FZAA 3H1JG 2JEEA 4L74A 2WSCH 2O3JA 3I5CA 2AEFA 3RK3C 3Q5RA 2W8ZA 2OQQA 2E43A 4PD4H 1PGQA 1QL2A 2K9YA 4IL6E 2P2UA 2P67A 3IR9A 3HD7D 3VOPA 3MHVA 2E76B 1HBWA 5GTHH 2D2CD 2KIKA 1URQB 4EIJA 1PGJA 1NTMJ 1OW7A 2YO2A 1ZR2A 5APSA 1GL2A 3HUSB 1OW6A 2DW3A 1NTMD 4Y99B 3Q1MA 1VF5B 2IBZE 1HGVA 3WU2E 2OYHA 3L75E 3AE6C 3OA7A 2B9BA 1EZVI 1YBKA 2L5GB 1LP1B 3H25A 2ZT9B 4H13B 1EZVE 4IFMA 1ZR4A 1IZNB 2PRRA 2XNDH 2QE7H 4WB4A 3G71P 2IYPA 1K05A 1OZHA 1K8AQ 2KLVA 5GTIE 4GKGA 3ZDMA 3NMDA 5AVWB 5TISE 2YMYA 2R44A 3T97A 1HWTC 4GT1A 4N6JA 5B66E 1DD4A 5AW6B 1M7LA 3L70J 1SS1A 3AEAC 1FZCA 2MJZA 3JC22 2WPRA 3PP5A 3L70D 2IZ0A 2QJKB 2WPSA 4N3YB 1FZBA 3L73E 3B4SA 4PD4I 1KMIZ 3C8VA 3A0BH 1Q7YQ 1QVFO 3FX0A 2KXPB 4PD4E 3PH0A 1VQ8P 5APUA 2A06E 4DOJA 1LJ2A 2HODA 3CI9A 1N86A 1HJBA 1LGHB 1E79H 3E7KA 2KSJA 3PJSK 3A3YB 1L0LE 5GTHE 5CCHA 1SQPJ 4EYYQ 1S5LH 3V4WA 1YQ3C 3SWKA 1AFOA 2G8YA 4OWFA 2IZ1A 1SQPD 2YKOA 2WMMA 2N1TC 3P7KA 1VQMP 1T3UA 2IBZG 2N9BA 3CL3D 3HRNA 1OVVA 3L75G 2FXPA 4LGDE 1LNQA 1KQLA 5AW9B 1VQ5P 3VMXA 1FBMA 4EOTA 1PV3A 1RF0A 5KJ7A 4YPCA 2YNYA 3C1LA 1EZVG 1S9KE 4RKUJ 1DD3A 2IFMA 1NTZG 2E42A 3F5HA 1JMMA 1Q90D 2HR3A 2FBWC 5KLVE 1RHZB 1N8RQ 1R5SA 3TSIA 1GTWA 1NTZJ 2B87A 5APXA 1D7MA 1HGZA 1EZVD 3MIWA 3CMAP 3Q3DA 1BGYE 3L36A 2ITAA 3JCUH 3CC7P 1H0TB 1NTZD 1J1DB 4R4MA 3E1IA 3VTPC 2OTKE 1FS0E 3GW6A 2Z4EA 1KILB 1PGOA 1BDCA 2NZ2A 1JY2O 3II6A 2QJPC 1KILC 5CCGA 2ZXEB 2E74D 2K37A 3BATA 3TDKA 3G3ZA 1IFDA 1M1JB 3O8ZA 1GL2B 4JYCA 3A0BE 2E75B 3L37A 1M1JC 2KNCB 4OVNF 5DJUB 2K1AA 3AEDC 3UIAA 2A06G 4KHXA 1RE4A 5KJ7D 2Q5UA 5CMZA 3FXEA 4WY4B 3NFQA 3BRTB 2WSCJ 3AE3C 3JSVC 4L75A 3VP8A 4GIFA 1CZQA 2H7HA 1L0LG 3VYIA 2OYIC 2IYOA 1H88A 3RK3D 5EFWB 1LTBC 2HFED 4O9BA 2FKWB 4WBAA 2LKMA 1N7SB 4GOFA 1NGMB 5DJTB 4ZNCA 1S5LE 1QL1A 4EDFA 2V7QJ 4PD4D 4OH8B 2A06D 1NTME 1NAYA 1WRGA 1NJIQ 3M06A 2NPSA 2H43A 2JKVA 3T97B 1PZQA 1N73C 2ZVOB 3IFMA 3CCSP 3NTNA 5AW8B 3CX5I 5BU8B 3M9QA 4PV1D 1R5LA 3IAOA 1Y8AA 3M91A 1U7JA 3L71J 1JCDA 2LR2A 3CX5E 1RQVA 1SVFA 3I56P 4H44C 4C7NB 5KLVG 1ZN5A 3L71D 1FOSE 1RE3C 2ZVNB 1VQ4P 3VMAA 1L0LK 1XTCC 3RBXA 1SQVE 5APWA 3HD7A 2XNXA 1HTLC 4OGQB 2K9JA 1FZFA 3BRVB 2Q7CA 3JCUE 1NKNA 1S72P 5APYA 2QA4P 2P10A 1NO4A 4W80A 5B5EH 1KYOI 1LTAC 3L70E 1NU1E 2E5YA 1H89A 2YXRB 1YITP 4XE5B 1KYOE 3VN0A 4ZKUA 1JY3P 2KSEA 1LTIC 2Y0DA 3RBZA 1Q86Q 1FDOA 1G2CB 1P84H 1L0NG 3B5NC 5AW5B 5KLVK 3IF4A 1L4AC 2AEMA 3I55P 1LTJA 2O01N 2R32A 1IO4A 2FFDB 4K35A 5AVXB 1OMIA 2VRSA 4N78D 2OARA 3A7OA 3CC2P 2FFDC 1HH0A 1QLED 4UB8H 1L0NJ 3RK2B 1UIXA 1SQPE 2M8RA 4Z1MH 1NTMG 3ABVC 1VQLP 1GK4A 1LT9A 1L0ND 2V7QH 5K5GB 1OWAA 2OTJP 2KS1B 2E76C 3H32B 1YQ4C 2P58A 3H1LJ 3LW5J 3RL0g 4IL6X 1FJPA 1G1IA 2Q1KA 1URQC 4AQRD 1BCCJ 3TNUA 5KKZB 1ZV8A 1EDJA 2N1TD 2P1JA 2WT7A 3H1LD 2XKMA 2W27A 2O1JA 3MZWB 1BCCD 3HUSC 1JTHA 4Y99C 1VF5C 2OYOA 4R4LA 4H0LB 2J59M 1SQVG 1X0TA 3OAKA 4HYTB 2KI7B 2IX7C 3O6QB 4H0LC 2ZT9C 2GUSA 4H13C 2O1KA 4TLFA 3MGNA 3C9IA 1NTZE 2W6AA 3CX5D 4ZMDA 2ZFCA 1NTMK 2R3CA 3GHGA 2G3AA 1AQTA 2JWDA 1M8OB 1SQVJ 1KN7A 2LXCB 1L2PA 5B5EE 1NWQA 3L70G 5BU5A 4JF7A 1NU1G 2B88A 1JNMA 2ZYDA 4XFJA 1YJWP 2JP3A 2O01J 1SQVD 2AXTH 2JO1A 2KZJA 5BVZA 2R5BA 1YIJP 3E1RA 1CI6A 3AECC 1NU1J 1P84I 3SSUA 1S3JA 2NPSB 1FE6A 1KFNA 2W83C 2I1KA 4HJGH 5AVQB 1EC5A 1P84E 2Y9ZA 1NU1D 1SQQJ 2RH0A 3RK3E 1KYOD 1OXZA 2QJKC 1SQVK 3K5BA 3RL0B 3PTZA 1SFCB 1W2BO 1SQQD 1LWUB 3CCEP 1DIPA 1OIPA 2M3EA 2PGDA 3G6EP 1SFCC 3GMAA 4UB8E 1SQPG 3EWKA 1LWUC 2J5UA 2H88C 2FY8A 3MUDA 4Y28J 2XDJA 3L72J 1Q2NA 1J1EB 2XV5A 2WTYA 2C9LY 1CW5A 1J1EC 1NU1K 3H1KJ 3PLNA 2OTLP 3HD7B 3AE9C 3KPEA 2KUBA 5AVTB 3L4FA 3M0DC 4L73A 3L72D 4JPZB 4M3LA 5C39A 1IFMA 1QVGO 2WITA 1KD1Q 4ASWA 2D2CB 1BE3G 3LW5H 5AVYB 3AE1C 2NRGA 3L71E 4UB6E 1BE3J 2HPCA 1KZUB 1VQ6P 4JBZA 1VQKP 3U1AA 2ZAEB 3V4QA 4I7ZB 3VMZA 3VP9A 3FWLA 1AVOA 2KK7A 3HE4B 1BE3D 3HE5B 2SPZA 3N4XA 2QJYB 3CX5H 1OVUA 3CMEP 1SQPK 3EFFK 1RF1B 4H44D 3SWFA 4B86A 3M9HA 5APVA 1VQ9P 2QG4A 1H8AA 1LTJB 1RF1C 3ITKA 5AW0B 1T6AA 1SQBE 3TGUE 2BCCE 3GF3A 2C0WA 2AXTE 1YI2P 2W6JH 3F89A 1M57D 2O01H 2WZ7A 2H89C 1LT9B 1JY2N 1AQ5A 4U7JA 5AVRB 2PP6A 1J1DC 1URQA 5AW7B 1UIIA 1IK9A 1QEXA 1KB9H 1KYOH 1KTMA 1M90Q 5CJ4A 3L74J 2W90A 2WVRA 3TNUB 2KOGA 5AW1B 3CCQP 3B71A 4N78E 3AEGC 1FC2C 1EXJA 2JJLA 2P7JA 1X8YA 3L74D 1GL2C 1KORA 4WWIA 2POHA 1NTZK 4LLHA 2OYHB 2E75C 4AYCA 3WMM0 1LP1A 1GW4A 3B5ND 2OYHC 1L0NE 1IFPA 1P84D 4WY4C 4C7RA 1L4AD 3AEFC 2AXCA 1HJ0A 1NTKJ 1MFTA 2YIUB 1R8EA 4DZOA 2YIUC 1RH5B 1N7SC 3H1LE 1NTKD 4HH2A 1ZMEC 1BCCE 1JY2P 4AUWA 2QIWA 5AVVB 3KDPB 3L71G 2FXMA 2RMZA 5CBNA 3AE8C 2MKVA 2E76D 1N7LA 4XA4A 4W7ZA 1S5LX 4PJ0H 3NXSA 1URQD 2ZXXA 1MUUA 2AEJA 1CI6B 2QEXP 1K73Q 3TK1A 3M0AA 3AEBC 4HKZH 4A7PA 3HTKA 3A2AA 1FZCB 1ZOYC 1T2KC 3W68A 2ZJSE 4ZKPA 1FZCC 5H2FE 2XU6A 1VF5D 3CPWO 1MV8A 1ZRTE 1JOCA 1JO5A 1PP9E 4QMAA 1IFJA 2M0BA 3S1KA 2Z5HA 1SQBG 3TGUG 2BCCG 2YMKA 1M56D 4I2LC 2YKQA 1U7MA 2ZT9D 3GLMA 1IFIA 3OW2O 2QRXA 4YXDC 4H13D 1PPJD 1T3JA 1MZ9A 1WT6A 2YXQB 2HODB 3M0DA 4OGQC 1KB9I 3BVHA 1SQBJ 4NPFX 3TGUJ 2BCCJ 1NAFA 3IN6A 4KT0J 3H1IG 1JM0A 2N9YB 1KB9E 2N1TA 1KILE 5CCHC 1K04A 1SQBD 3TGUD 2BCCD 3MP7B 1SLQA 2J58A 3CLQA 2CPBA 1SQQE 2BASA 2K3RA 3P8MC 2Y0CA 1HUCA 1LT1A 2KLUA 2E74B 2IDBA 3H1IJ 2YO3A 2Y9YA 2JR8A 1LTSC 4BRYA 3M9BA 1EDKA 3AE2C 3CCJP 1G1JA 3H1ID 5E79E 2FYZA 3AE5C 3KHUA 3V2RA 1OX3A 3L72E 1S1CX 1RF0C 2R5DA 1SQBK 1RQUA 5KJ7C 3MTUE 4BWNA 1VQOP 1GDTA 2WSEJ 1HF9A 3H1KE 5AW2B 2PAJA 3RK3B 4NPEA 3FGAD 3H1LG 1N2DC 1GW3A 3RK2C 1YJNP 1BCCG 1OW8A 4KJMA 1MFZA 3V2QA 2B87B 1KC8Q 1USDA 4U3FE 1EXIA 2W6BA 4DT0A 1KQSO 3H1JJ 2WQYC 3PHLA 3WUUA 3CCUP 2M3BA 1H0TA 1SP4A 4PJ0E 2QM8A 1MKMA 3V2NA 2A45H 1BE3E 2E5TA 3H1JD 4BXLA 2PFXA 1KILA 3V6IA 2WSFH 2FYUE 5KKZC 1CSBA 3CCMP 2C9NY 3KZIH 4PV1B 3D70A 1NOHA 4UB6H 1OFCX 3SFEC 4JYBA 1L0NK 2IBZI 3CC4P 4PV1C 1M1JA 1PP9G 1K9MQ 2GA1A 2ZYGA 3U1CA 1FZEA 1U57A 2C0XA 5CCGC 2KNCA 2K88A 1AV1A 1RY3A 1YHQP 4YXWH 4WY4A 3BASA 1Q81Q 3Q5PA 2GM4A 3CXHI 1GU4A 2FYNB 2OYIA 1PP9J 3R2PA 1RE4C 5APQA 5AW4B 2FYNC 3CXHE 1ZRTD 1PP9D 1N7SA 1XTGB 3H6PA 3P32A 2LXBA 1PFIA 1SQQG 5KAFH 4I1LA 1VQ7P 1QX8A 3SFDC 3L74E 1N73A 1AJYA 2WWWA 1Y47A 3G9RA 1X22A 4DCKA 3D71A 2WPQA 5AVSB 1FAVA 2NPSC 1KB9D 1KILD 2V4HA 1AVYA 4ASVA 3PRJA 3L72G 3P8CE 1A02F 3HTKB 1X9VA 3H1KG 3Q2YA 1GU5A 3L35A 5AW3B 1RE3A 3RL0C 1GL2D 4C7NA 3CCVP 1AA0A 2FXOA 2WSEH 1FDIA 2E75D 1NTKE 4DJGA 3S4RA 1E5WA 3N7NA 4GOEA 4RESB 3BCCE 3TYYA 3G4SP 3LIDA 3A0HH 1KFMA 4WY4D 2GUVA 1NVOA 2HYNA 4WVZA 2Z5IA 2M5AA 4U3FG 3KQGA 2A45I 3HD7C 3EQ2A 2K9JB 1VDFA 1SQQK 3H1KD 2IPPA 1GK6A 1N7SD 2I1JA 2D2CC 1EQ7A 2FYUG 4U3FJ 1SQXE 3R4YA 3KZIE 3MD0A 4EI2A 3KYQA 2N1TB 2WPVB 3AE7C 5L8RJ 2BEZF 3S9OA 4U3FD 1FZGA 2KZIA 1YTZI 2FYUJ 3CWBE 3V2PA 3B5NA 3W67A 1DX7A 2IFNA 4I7ZC 3A5TA 1PPJE 1QGKB 1G2CA 1BDDA 1GMJA 1L4AA 4RJTA 4BRYB 1T2KD 2CK3H 2FYUD 5H2FH 2QJYC 1DH3A 1PGPA 1FU1A 3H1HE 2FFDA 5KAIH 4D6TE 3L75J 5CHXA 2HLOA 1NH4A 1LTJC 2JDIH 3TF5A 2L91A 1S2EA 3KXDA 2IBZD 1TU3F 3L75D 3D6ZA 3RGUA 3WUVA 4IFFA 5KAFE 3L74G 1HVVA 4MN4C 1IC2A 3AEEC 1IJDB 4OGQD 1KQFB 1GD2E 4C46A 1A02J 2FYUK 3USSA 5TJHA 2KS1A 2Q6QA 3H32A 2Q3IA 1ZW0A 3CXHD 5AVZB 1LT9C 1FDMA 2UWJE 2CPSA 3H1IE 4TT3H 1NYHA 3CCRP 5CCHD 5M1BA 2H8PD 2BEQD 2ZYAA 3HUSA 5CJ0A 1JUNA 2WT7B 2QJPB 1GZLA 1LTGC 2OGUA 2R3SA 2KB7P 1NTKG 1JTHB 1Q82Q 3L73G 1USEA 3BCCG 1WMKA 2I8DA 3WUTA 5E79H 5KTBA 1BSHA 1J2JB 1LTTC 3A0HE 3O6QA 3D6YA 3P8CD 1PIXA 3FWNA 1Z56A 3L73J 3BCCJ 1JB0J 2KYVA 2OYIB 1W5CE 1JCCA 2A45G 3GHGB 3H1JE 3QH9A 4IFDK 3RK2D 1ZLLA 3L73D 3GHGC 3BCCD 1NKZB 1SQXG 2KP8A 5APTA 4IL6H 1OVRA 4LC1A 2RKLA 2QVAA 3GF7A 1L0LJ 4GDOA 3CWBG 3LIEA 1W2EA 2WSFJ 1N73B 1SQXJ 1PPJG 1IK7A 5AVUB 4CPGA 1L0LD 1VQNP 1NTKK 1FJKA 1NHLA 4GODA 1JY3N 2WSSH 1KQGB 1S4XA 1SQXD 3H1HG 4JQ0D 3B8EB 3CWBJ 4D6TG 4L76A 5KAIE 1SFCA 5KLIB 4H44B 1JY3O 1LWUA 5CCGD 3WU2H 4I6MC 5KLIC 3CWBD 4H0LD 3Q5SA 3U59A 1Y9BA 3H1HJ 2YKPA 4D6TJ 3SWYA 1YJ9P 1JMBA 4HB1A 3CXHH 2QM7A 3MUDC 4YTPC 3CCLP 3QWOC 5CBOA 1S9KD 1SQXK 2JWAA 2M5AB 3H1HD 1BGYG 3FXDA 1PL5A 4D6TD 1YTZT 2XZRA 5KLVJ 2Y0EA 5GTIH 1BSNA 1DEBA 1VPCA 4W7YA 2RN0A 1KV4A 2B89A 1VL2A
chains in the Genus database with same CATH topology
2A06G 3H1JG 1PPJG 3H1LG 1NTKG 3CXHH 1KYOH 1NTMG 3L71G 1SQBG 3TGUG 1EZVG 2BCCG 3H1KG 2IBZG 3L73G 3BCCG 2FYUG 1BCCG 1BGYG 3L74G 4U3FG 1PP9G 3L75G 1SQPG 3H1IG 1SQQG 3CX5H 5KLVG 1SQVG 1NTZG 3H1HG 1L0LG 1P84H 3CWBG 4PD4H 4D6TG 1BE3G 1L0NG 3L72G 3L70G 1NU1G 1KB9H 1SQXG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  3H1J G;  1PPJ G;  3H1L G;  1NTK G;  3CXH H;  1KYO H;  1NTM G;  3L71 G;  1SQB G;  3TGU G;  1EZV G;  2BCC G;  3H1K G;  2IBZ G;  3L73 G;  3BCC G;  2FYU G;  1BCC G;  1BGY G;  3L74 G;  4U3F G;  1PP9 G;  3L75 G;  1SQP G;  3H1I G;  1SQQ G;  3CX5 H;  5KLV G;  1SQV G;  1NTZ G;  3H1H G;  1L0L G;  1P84 H;  3CWB G;  4PD4 H;  4D6T G;  1BE3 G;  1L0N G;  3L72 G;  3L70 G;  1NU1 G;  1KB9 H;  1SQX G; 
#chains in the Genus database with same CATH topology
 5TIS H;  3GG2 A;  5KLV D;  1ZP0 C;  1BGY J;  4IOI H;  1T8Z A;  1EDL A;  1M1K Q;  3OJA B;  3CD6 P;  1FOS F;  5B66 H;  1DEE G;  3V5B A;  3EFG A;  2E74 C;  2HG5 D;  1BGY D;  2NPS D;  3VMY A;  2HPC B;  4RO0 A;  1X79 B;  1YYC A;  3HE4 A;  1ZXG A;  3AE4 C;  3HE5 A;  1EDI A;  3B5N B;  1JEK A;  1VQP P;  1L4A B;  4NPD A;  2Q9I A;  2Q3E A;  1RF1 A;  2QSI A;  3RL0 D;  1SFC D;  1IFN A;  4K3A A;  1FZA A;  3H1J G;  2JEE A;  4L74 A;  2WSC H;  2O3J A;  3I5C A;  2AEF A;  3RK3 C;  3Q5R A;  2W8Z A;  2OQQ A;  2E43 A;  4PD4 H;  1PGQ A;  1QL2 A;  2K9Y A;  4IL6 E;  2P2U A;  2P67 A;  3IR9 A;  3HD7 D;  3VOP A;  3MHV A;  2E76 B;  1HBW A;  5GTH H;  2D2C D;  2KIK A;  1URQ B;  4EIJ A;  1PGJ A;  1NTM J;  1OW7 A;  2YO2 A;  1ZR2 A;  5APS A;  1GL2 A;  3HUS B;  1OW6 A;  2DW3 A;  1NTM D;  4Y99 B;  3Q1M A;  1VF5 B;  2IBZ E;  1HGV A;  3WU2 E;  2OYH A;  3L75 E;  3AE6 C;  3OA7 A;  2B9B A;  1EZV I;  1YBK A;  2L5G B;  1LP1 B;  3H25 A;  2ZT9 B;  4H13 B;  1EZV E;  4IFM A;  1ZR4 A;  1IZN B;  2PRR A;  2XND H;  2QE7 H;  4WB4 A;  3G71 P;  2IYP A;  1K05 A;  1OZH A;  1K8A Q;  2KLV A;  5GTI E;  4GKG A;  3ZDM A;  3NMD A;  5AVW B;  5TIS E;  2YMY A;  2R44 A;  3T97 A;  1HWT C;  4GT1 A;  4N6J A;  5B66 E;  1DD4 A;  5AW6 B;  1M7L A;  3L70 J;  1SS1 A;  3AEA C;  1FZC A;  2MJZ A;  3JC2 2;  2WPR A;  3PP5 A;  3L70 D;  2IZ0 A;  2QJK B;  2WPS A;  4N3Y B;  1FZB A;  3L73 E;  3B4S A;  4PD4 I;  1KMI Z;  3C8V A;  3A0B H;  1Q7Y Q;  1QVF O;  3FX0 A;  2KXP B;  4PD4 E;  3PH0 A;  1VQ8 P;  5APU A;  2A06 E;  4DOJ A;  1LJ2 A;  2HOD A;  3CI9 A;  1N86 A;  1HJB A;  1LGH B;  1E79 H;  3E7K A;  2KSJ A;  3PJS K;  3A3Y B;  1L0L E;  5GTH E;  5CCH A;  1SQP J;  4EYY Q;  1S5L H;  3V4W A;  1YQ3 C;  3SWK A;  1AFO A;  2G8Y A;  4OWF A;  2IZ1 A;  1SQP D;  2YKO A;  2WMM A;  2N1T C;  3P7K A;  1VQM P;  1T3U A;  2IBZ G;  2N9B A;  3CL3 D;  3HRN A;  1OVV A;  3L75 G;  2FXP A;  4LGD E;  1LNQ A;  1KQL A;  5AW9 B;  1VQ5 P;  3VMX A;  1FBM A;  4EOT A;  1PV3 A;  1RF0 A;  5KJ7 A;  4YPC A;  2YNY A;  3C1L A;  1EZV G;  1S9K E;  4RKU J;  1DD3 A;  2IFM A;  1NTZ G;  2E42 A;  3F5H A;  1JMM A;  1Q90 D;  2HR3 A;  2FBW C;  5KLV E;  1RHZ B;  1N8R Q;  1R5S A;  3TSI A;  1GTW A;  1NTZ J;  2B87 A;  5APX A;  1D7M A;  1HGZ A;  1EZV D;  3MIW A;  3CMA P;  3Q3D A;  1BGY E;  3L36 A;  2ITA A;  3JCU H;  3CC7 P;  1H0T B;  1NTZ D;  1J1D B;  4R4M A;  3E1I A;  3VTP C;  2OTK E;  1FS0 E;  3GW6 A;  2Z4E A;  1KIL B;  1PGO A;  1BDC A;  2NZ2 A;  1JY2 O;  3II6 A;  2QJP C;  1KIL C;  5CCG A;  2ZXE B;  2E74 D;  2K37 A;  3BAT A;  3TDK A;  3G3Z A;  1IFD A;  1M1J B;  3O8Z A;  1GL2 B;  4JYC A;  3A0B E;  2E75 B;  3L37 A;  1M1J C;  2KNC B;  4OVN F;  5DJU B;  2K1A A;  3AED C;  3UIA A;  2A06 G;  4KHX A;  1RE4 A;  5KJ7 D;  2Q5U A;  5CMZ A;  3FXE A;  4WY4 B;  3NFQ A;  3BRT B;  2WSC J;  3AE3 C;  3JSV C;  4L75 A;  3VP8 A;  4GIF A;  1CZQ A;  2H7H A;  1L0L G;  3VYI A;  2OYI C;  2IYO A;  1H88 A;  3RK3 D;  5EFW B;  1LTB C;  2HFE D;  4O9B A;  2FKW B;  4WBA A;  2LKM A;  1N7S B;  4GOF A;  1NGM B;  5DJT B;  4ZNC A;  1S5L E;  1QL1 A;  4EDF A;  2V7Q J;  4PD4 D;  4OH8 B;  2A06 D;  1NTM E;  1NAY A;  1WRG A;  1NJI Q;  3M06 A;  2NPS A;  2H43 A;  2JKV A;  3T97 B;  1PZQ A;  1N73 C;  2ZVO B;  3IFM A;  3CCS P;  3NTN A;  5AW8 B;  3CX5 I;  5BU8 B;  3M9Q A;  4PV1 D;  1R5L A;  3IAO A;  1Y8A A;  3M91 A;  1U7J A;  3L71 J;  1JCD A;  2LR2 A;  3CX5 E;  1RQV A;  1SVF A;  3I56 P;  4H44 C;  4C7N B;  5KLV G;  1ZN5 A;  3L71 D;  1FOS E;  1RE3 C;  2ZVN B;  1VQ4 P;  3VMA A;  1L0L K;  1XTC C;  3RBX A;  1SQV E;  5APW A;  3HD7 A;  2XNX A;  1HTL C;  4OGQ B;  2K9J A;  1FZF A;  3BRV B;  2Q7C A;  3JCU E;  1NKN A;  1S72 P;  5APY A;  2QA4 P;  2P10 A;  1NO4 A;  4W80 A;  5B5E H;  1KYO I;  1LTA C;  3L70 E;  1NU1 E;  2E5Y A;  1H89 A;  2YXR B;  1YIT P;  4XE5 B;  1KYO E;  3VN0 A;  4ZKU A;  1JY3 P;  2KSE A;  1LTI C;  2Y0D A;  3RBZ A;  1Q86 Q;  1FDO A;  1G2C B;  1P84 H;  1L0N G;  3B5N C;  5AW5 B;  5KLV K;  3IF4 A;  1L4A C;  2AEM A;  3I55 P;  1LTJ A;  2O01 N;  2R32 A;  1IO4 A;  2FFD B;  4K35 A;  5AVX B;  1OMI A;  2VRS A;  4N78 D;  2OAR A;  3A7O A;  3CC2 P;  2FFD C;  1HH0 A;  1QLE D;  4UB8 H;  1L0N J;  3RK2 B;  1UIX A;  1SQP E;  2M8R A;  4Z1M H;  1NTM G;  3ABV C;  1VQL P;  1GK4 A;  1LT9 A;  1L0N D;  2V7Q H;  5K5G B;  1OWA A;  2OTJ P;  2KS1 B;  2E76 C;  3H32 B;  1YQ4 C;  2P58 A;  3H1L J;  3LW5 J;  3RL0 g;  4IL6 X;  1FJP A;  1G1I A;  2Q1K A;  1URQ C;  4AQR D;  1BCC J;  3TNU A;  5KKZ B;  1ZV8 A;  1EDJ A;  2N1T D;  2P1J A;  2WT7 A;  3H1L D;  2XKM A;  2W27 A;  2O1J A;  3MZW B;  1BCC D;  3HUS C;  1JTH A;  4Y99 C;  1VF5 C;  2OYO A;  4R4L A;  4H0L B;  2J59 M;  1SQV G;  1X0T A;  3OAK A;  4HYT B;  2KI7 B;  2IX7 C;  3O6Q B;  4H0L C;  2ZT9 C;  2GUS A;  4H13 C;  2O1K A;  4TLF A;  3MGN A;  3C9I A;  1NTZ E;  2W6A A;  3CX5 D;  4ZMD A;  2ZFC A;  1NTM K;  2R3C A;  3GHG A;  2G3A A;  1AQT A;  2JWD A;  1M8O B;  1SQV J;  1KN7 A;  2LXC B;  1L2P A;  5B5E E;  1NWQ A;  3L70 G;  5BU5 A;  4JF7 A;  1NU1 G;  2B88 A;  1JNM A;  2ZYD A;  4XFJ A;  1YJW P;  2JP3 A;  2O01 J;  1SQV D;  2AXT H;  2JO1 A;  2KZJ A;  5BVZ A;  2R5B A;  1YIJ P;  3E1R A;  1CI6 A;  3AEC C;  1NU1 J;  1P84 I;  3SSU A;  1S3J A;  2NPS B;  1FE6 A;  1KFN A;  2W83 C;  2I1K A;  4HJG H;  5AVQ B;  1EC5 A;  1P84 E;  2Y9Z A;  1NU1 D;  1SQQ J;  2RH0 A;  3RK3 E;  1KYO D;  1OXZ A;  2QJK C;  1SQV K;  3K5B A;  3RL0 B;  3PTZ A;  1SFC B;  1W2B O;  1SQQ D;  1LWU B;  3CCE P;  1DIP A;  1OIP A;  2M3E A;  2PGD A;  3G6E P;  1SFC C;  3GMA A;  4UB8 E;  1SQP G;  3EWK A;  1LWU C;  2J5U A;  2H88 C;  2FY8 A;  3MUD A;  4Y28 J;  2XDJ A;  3L72 J;  1Q2N A;  1J1E B;  2XV5 A;  2WTY A;  2C9L Y;  1CW5 A;  1J1E C;  1NU1 K;  3H1K J;  3PLN A;  2OTL P;  3HD7 B;  3AE9 C;  3KPE A;  2KUB A;  5AVT B;  3L4F A;  3M0D C;  4L73 A;  3L72 D;  4JPZ B;  4M3L A;  5C39 A;  1IFM A;  1QVG O;  2WIT A;  1KD1 Q;  4ASW A;  2D2C B;  1BE3 G;  3LW5 H;  5AVY B;  3AE1 C;  2NRG A;  3L71 E;  4UB6 E;  1BE3 J;  2HPC A;  1KZU B;  1VQ6 P;  4JBZ A;  1VQK P;  3U1A A;  2ZAE B;  3V4Q A;  4I7Z B;  3VMZ A;  3VP9 A;  3FWL A;  1AVO A;  2KK7 A;  3HE4 B;  1BE3 D;  3HE5 B;  2SPZ A;  3N4X A;  2QJY B;  3CX5 H;  1OVU A;  3CME P;  1SQP K;  3EFF K;  1RF1 B;  4H44 D;  3SWF A;  4B86 A;  3M9H A;  5APV A;  1VQ9 P;  2QG4 A;  1H8A A;  1LTJ B;  1RF1 C;  3ITK A;  5AW0 B;  1T6A A;  1SQB E;  3TGU E;  2BCC E;  3GF3 A;  2C0W A;  2AXT E;  1YI2 P;  2W6J H;  3F89 A;  1M57 D;  2O01 H;  2WZ7 A;  2H89 C;  1LT9 B;  1JY2 N;  1AQ5 A;  4U7J A;  5AVR B;  2PP6 A;  1J1D C;  1URQ A;  5AW7 B;  1UII A;  1IK9 A;  1QEX A;  1KB9 H;  1KYO H;  1KTM A;  1M90 Q;  5CJ4 A;  3L74 J;  2W90 A;  2WVR A;  3TNU B;  2KOG A;  5AW1 B;  3CCQ P;  3B71 A;  4N78 E;  3AEG C;  1FC2 C;  1EXJ A;  2JJL A;  2P7J A;  1X8Y A;  3L74 D;  1GL2 C;  1KOR A;  4WWI A;  2POH A;  1NTZ K;  4LLH A;  2OYH B;  2E75 C;  4AYC A;  3WMM 0;  1LP1 A;  1GW4 A;  3B5N D;  2OYH C;  1L0N E;  1IFP A;  1P84 D;  4WY4 C;  4C7R A;  1L4A D;  3AEF C;  2AXC A;  1HJ0 A;  1NTK J;  1MFT A;  2YIU B;  1R8E A;  4DZO A;  2YIU C;  1RH5 B;  1N7S C;  3H1L E;  1NTK D;  4HH2 A;  1ZME C;  1BCC E;  1JY2 P;  4AUW A;  2QIW A;  5AVV B;  3KDP B;  3L71 G;  2FXM A;  2RMZ A;  5CBN A;  3AE8 C;  2MKV A;  2E76 D;  1N7L A;  4XA4 A;  4W7Z A;  1S5L X;  4PJ0 H;  3NXS A;  1URQ D;  2ZXX A;  1MUU A;  2AEJ A;  1CI6 B;  2QEX P;  1K73 Q;  3TK1 A;  3M0A A;  3AEB C;  4HKZ H;  4A7P A;  3HTK A;  3A2A A;  1FZC B;  1ZOY C;  1T2K C;  3W68 A;  2ZJS E;  4ZKP A;  1FZC C;  5H2F E;  2XU6 A;  1VF5 D;  3CPW O;  1MV8 A;  1ZRT E;  1JOC A;  1JO5 A;  1PP9 E;  4QMA A;  1IFJ A;  2M0B A;  3S1K A;  2Z5H A;  1SQB G;  3TGU G;  2BCC G;  2YMK A;  1M56 D;  4I2L C;  2YKQ A;  1U7M A;  2ZT9 D;  3GLM A;  1IFI A;  3OW2 O;  2QRX A;  4YXD C;  4H13 D;  1PPJ D;  1T3J A;  1MZ9 A;  1WT6 A;  2YXQ B;  2HOD B;  3M0D A;  4OGQ C;  1KB9 I;  3BVH A;  1SQB J;  4NPF X;  3TGU J;  2BCC J;  1NAF A;  3IN6 A;  4KT0 J;  3H1I G;  1JM0 A;  2N9Y B;  1KB9 E;  2N1T A;  1KIL E;  5CCH C;  1K04 A;  1SQB D;  3TGU D;  2BCC D;  3MP7 B;  1SLQ A;  2J58 A;  3CLQ A;  2CPB A;  1SQQ E;  2BAS A;  2K3R A;  3P8M C;  2Y0C A;  1HUC A;  1LT1 A;  2KLU A;  2E74 B;  2IDB A;  3H1I J;  2YO3 A;  2Y9Y A;  2JR8 A;  1LTS C;  4BRY A;  3M9B A;  1EDK A;  3AE2 C;  3CCJ P;  1G1J A;  3H1I D;  5E79 E;  2FYZ A;  3AE5 C;  3KHU A;  3V2R A;  1OX3 A;  3L72 E;  1S1C X;  1RF0 C;  2R5D A;  1SQB K;  1RQU A;  5KJ7 C;  3MTU E;  4BWN A;  1VQO P;  1GDT A;  2WSE J;  1HF9 A;  3H1K E;  5AW2 B;  2PAJ A;  3RK3 B;  4NPE A;  3FGA D;  3H1L G;  1N2D C;  1GW3 A;  3RK2 C;  1YJN P;  1BCC G;  1OW8 A;  4KJM A;  1MFZ A;  3V2Q A;  2B87 B;  1KC8 Q;  1USD A;  4U3F E;  1EXI A;  2W6B A;  4DT0 A;  1KQS O;  3H1J J;  2WQY C;  3PHL A;  3WUU A;  3CCU P;  2M3B A;  1H0T A;  1SP4 A;  4PJ0 E;  2QM8 A;  1MKM A;  3V2N A;  2A45 H;  1BE3 E;  2E5T A;  3H1J D;  4BXL A;  2PFX A;  1KIL A;  3V6I A;  2WSF H;  2FYU E;  5KKZ C;  1CSB A;  3CCM P;  2C9N Y;  3KZI H;  4PV1 B;  3D70 A;  1NOH A;  4UB6 H;  1OFC X;  3SFE C;  4JYB A;  1L0N K;  2IBZ I;  3CC4 P;  4PV1 C;  1M1J A;  1PP9 G;  1K9M Q;  2GA1 A;  2ZYG A;  3U1C A;  1FZE A;  1U57 A;  2C0X A;  5CCG C;  2KNC A;  2K88 A;  1AV1 A;  1RY3 A;  1YHQ P;  4YXW H;  4WY4 A;  3BAS A;  1Q81 Q;  3Q5P A;  2GM4 A;  3CXH I;  1GU4 A;  2FYN B;  2OYI A;  1PP9 J;  3R2P A;  1RE4 C;  5APQ A;  5AW4 B;  2FYN C;  3CXH E;  1ZRT D;  1PP9 D;  1N7S A;  1XTG B;  3H6P A;  3P32 A;  2LXB A;  1PFI A;  1SQQ G;  5KAF H;  4I1L A;  1VQ7 P;  1QX8 A;  3SFD C;  3L74 E;  1N73 A;  1AJY A;  2WWW A;  1Y47 A;  3G9R A;  1X22 A;  4DCK A;  3D71 A;  2WPQ A;  5AVS B;  1FAV A;  2NPS C;  1KB9 D;  1KIL D;  2V4H A;  1AVY A;  4ASV A;  3PRJ A;  3L72 G;  3P8C E;  1A02 F;  3HTK B;  1X9V A;  3H1K G;  3Q2Y A;  1GU5 A;  3L35 A;  5AW3 B;  1RE3 A;  3RL0 C;  1GL2 D;  4C7N A;  3CCV P;  1AA0 A;  2FXO A;  2WSE H;  1FDI A;  2E75 D;  1NTK E;  4DJG A;  3S4R A;  1E5W A;  3N7N A;  4GOE A;  4RES B;  3BCC E;  3TYY A;  3G4S P;  3LID A;  3A0H H;  1KFM A;  4WY4 D;  2GUV A;  1NVO A;  2HYN A;  4WVZ A;  2Z5I A;  2M5A A;  4U3F G;  3KQG A;  2A45 I;  3HD7 C;  3EQ2 A;  2K9J B;  1VDF A;  1SQQ K;  3H1K D;  2IPP A;  1GK6 A;  1N7S D;  2I1J A;  2D2C C;  1EQ7 A;  2FYU G;  4U3F J;  1SQX E;  3R4Y A;  3KZI E;  3MD0 A;  4EI2 A;  3KYQ A;  2N1T B;  2WPV B;  3AE7 C;  5L8R J;  2BEZ F;  3S9O A;  4U3F D;  1FZG A;  2KZI A;  1YTZ I;  2FYU J;  3CWB E;  3V2P A;  3B5N A;  3W67 A;  1DX7 A;  2IFN A;  4I7Z C;  3A5T A;  1PPJ E;  1QGK B;  1G2C A;  1BDD A;  1GMJ A;  1L4A A;  4RJT A;  4BRY B;  1T2K D;  2CK3 H;  2FYU D;  5H2F H;  2QJY C;  1DH3 A;  1PGP A;  1FU1 A;  3H1H E;  2FFD A;  5KAI H;  4D6T E;  3L75 J;  5CHX A;  2HLO A;  1NH4 A;  1LTJ C;  2JDI H;  3TF5 A;  2L91 A;  1S2E A;  3KXD A;  2IBZ D;  1TU3 F;  3L75 D;  3D6Z A;  3RGU A;  3WUV A;  4IFF A;  5KAF E;  3L74 G;  1HVV A;  4MN4 C;  1IC2 A;  3AEE C;  1IJD B;  4OGQ D;  1KQF B;  1GD2 E;  4C46 A;  1A02 J;  2FYU K;  3USS A;  5TJH A;  2KS1 A;  2Q6Q A;  3H32 A;  2Q3I A;  1ZW0 A;  3CXH D;  5AVZ B;  1LT9 C;  1FDM A;  2UWJ E;  2CPS A;  3H1I E;  4TT3 H;  1NYH A;  3CCR P;  5CCH D;  5M1B A;  2H8P D;  2BEQ D;  2ZYA A;  3HUS A;  5CJ0 A;  1JUN A;  2WT7 B;  2QJP B;  1GZL A;  1LTG C;  2OGU A;  2R3S A;  2KB7 P;  1NTK G;  1JTH B;  1Q82 Q;  3L73 G;  1USE A;  3BCC G;  1WMK A;  2I8D A;  3WUT A;  5E79 H;  5KTB A;  1BSH A;  1J2J B;  1LTT C;  3A0H E;  3O6Q A;  3D6Y A;  3P8C D;  1PIX A;  3FWN A;  1Z56 A;  3L73 J;  3BCC J;  1JB0 J;  2KYV A;  2OYI B;  1W5C E;  1JCC A;  2A45 G;  3GHG B;  3H1J E;  3QH9 A;  4IFD K;  3RK2 D;  1ZLL A;  3L73 D;  3GHG C;  3BCC D;  1NKZ B;  1SQX G;  2KP8 A;  5APT A;  4IL6 H;  1OVR A;  4LC1 A;  2RKL A;  2QVA A;  3GF7 A;  1L0L J;  4GDO A;  3CWB G;  3LIE A;  1W2E A;  2WSF J;  1N73 B;  1SQX J;  1PPJ G;  1IK7 A;  5AVU B;  4CPG A;  1L0L D;  1VQN P;  1NTK K;  1FJK A;  1NHL A;  4GOD A;  1JY3 N;  2WSS H;  1KQG B;  1S4X A;  1SQX D;  3H1H G;  4JQ0 D;  3B8E B;  3CWB J;  4D6T G;  4L76 A;  5KAI E;  1SFC A;  5KLI B;  4H44 B;  1JY3 O;  1LWU A;  5CCG D;  3WU2 H;  4I6M C;  5KLI C;  3CWB D;  4H0L D;  3Q5S A;  3U59 A;  1Y9B A;  3H1H J;  2YKP A;  4D6T J;  3SWY A;  1YJ9 P;  1JMB A;  4HB1 A;  3CXH H;  2QM7 A;  3MUD C;  4YTP C;  3CCL P;  3QWO C;  5CBO A;  1S9K D;  1SQX K;  2JWA A;  2M5A B;  3H1H D;  1BGY G;  3FXD A;  1PL5 A;  4D6T D;  1YTZ T;  2XZR A;  5KLV J;  2Y0E A;  5GTI H;  1BSN A;  1DEB A;  1VPC A;  4W7Y A;  2RN0 A;  1KV4 A;  2B89 A;  1VL2 A; 
#chains in the Genus database with same CATH homology
 2A06 G;  3H1J G;  1PPJ G;  3H1L G;  1NTK G;  3CXH H;  1KYO H;  1NTM G;  3L71 G;  1SQB G;  3TGU G;  1EZV G;  2BCC G;  3H1K G;  2IBZ G;  3L73 G;  3BCC G;  2FYU G;  1BCC G;  1BGY G;  3L74 G;  4U3F G;  1PP9 G;  3L75 G;  1SQP G;  3H1I G;  1SQQ G;  3CX5 H;  5KLV G;  1SQV G;  1NTZ G;  3H1H G;  1L0L G;  1P84 H;  3CWB G;  4PD4 H;  4D6T G;  1BE3 G;  1L0N G;  3L72 G;  3L70 G;  1NU1 G;  1KB9 H;  1SQX G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...