1EZVG

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ezvG00
3H1LG 3H1IG 3H1KG 1L0NG 3L73G 3BCCG 3L70G 3L71G 1BGYG 1EZVG 1KB9H 2IBZG 1KYOH 3TGUG 4U3FG 1L0LG 1P84H 4D6TG 3CXHH 1PPJG 1SQBG 2A06G 3CX5H 1SQPG 1NU1G 1BE3G 4PD4H 1PP9G 3L72G 1NTKG 1BCCG 1SQVG 3H1JG 1NTZG 5KLVG 2BCCG 3L74G 1SQQG 3CWBG 2FYUG 1SQXG 3L75G 3H1HG 1NTMG
chains in the Genus database with same CATH superfamily
1GTWA 1EC5A 1L0NG 1HH0A 2QM8A 2QSIA 3HUSC 4IL6E 1T6AA 2LXCB 1EZVG 1KB9H 2W6AA 3KZIE 1GZLA 2IBZG 3M9HA 3RK2C 5KKZB 3GHGB 1NTKK 3G4SP 3SSUA 2RKLA 1MKMA 2HFED 2N1TD 4PJ0H 4XA4A 4IFMA 3KXDA 5KTBA 3CPWO 3CXHI 3AE5C 1SQVK 2PP6A 4WWIA 3V2RA 5CCHD 1SQPG 3E7KA 4WBAA 5KLVK 4MN4C 4EOTA 4RKUJ 3CX5D 1NTKG 2WWWA 2KLUA 4PD4I 3TGUD 1M56D 5CBNA 2KZJA 2A45H 2NPSC 1NU1K 1RE4C 3L70D 1DEBA 1JNMA 2H88C 1FZCA 2AXCA 2BEQD 3KZIH 5APYA 4OGQD 1BE3J 3P7KA 2QEXP 3WU2E 1MFTA 1K9MQ 1YQ3C 2H8PD 3W68A 3D70A 1DX7A 2V7QH 5TISE 3CCJP 1QVGO 5BU8B 2JJLA 3W67A 2WPQA 2I1KA 1FBMA 1X79B 3HTKB 1RE3A 4I7ZC 4OGQC 3D6YA 3P8CE 2KNCA 3VYIA 4DZOA 3WUTA 1KYOH 3HD7D 1SQQE 2JO1A 3KDPB 2M5AB 1KB9D 1JCCA 2C0XA 2KXPB 1WRGA 1LT1A 2B89A 2QJPB 4ASVA 1FC2C 1FS0E 3CXHE 4GDOA 4ZNCA 1BE3G 1YYCA 1SFCD 4PD4H 3FXDA 4DJGA 3KPEA 2A45I 1M1JA 3P8MC 3RL0C 1XTGB 1CI6B 1SQXK 1AVYA 2BCCG 4GIFA 5C39A 2E43A 1CW5A 1KYOE 2QJYB 2OYHA 3PJSK 3K5BA 2WSEH 3PP5A 3RBXA 1VF5C 2WSFJ 5E79E 1SQQD 2KS1A 2BCCE 1PP9E 5CMZA 1YITP 3SWYA 1ZN5A 2D2CD 3L73G 3OA7A 2ZFCA 4I6MC 1H88A 4PJ0E 1EDJA 3G71P 4Y99B 3CXHD 1BCCE 1L4AA 1NO4A 5GTIE 2FYNB 4A7PA 2ZXXA 1GL2C 4GOFA 1MV8A 4I2LC 2A06G 3H1HJ 1LP1B 5AW7B 3V2PA 2OYHC 1EZVI 2Q7CA 1IFJA 5H2FE 5KJ7A 1G1JA 3L74D 1VQNP 2ITAA 1W5CE 3HE4B 1EDLA 2W27A 1BE3D 1KYOD 1HGVA 4XE5B 3AE7C 3VP9A 2WITA 3L75J 1N73B 1EXJA 2N9BA 3CLQA 4H44C 1U7MA 1PGOA 4NPDA 3V4WA 1R5SA 3AEGC 3VP8A 2OTJP 1AJYA 1LTJB 1N7SC 3RL0g 2G3AA 2D2CB 5AW0B 1KYOI 3L70E 1BCCD 2LXBA 1UIIA 1YTZT 3TNUA 3USSA 2R5DA 4B86A 1AFOA 2AEFA 5AVXB 3RK2B 1J2JB 1NAYA 2QIWA 1KQGB 1L4AC 2AEMA 2FYUE 2WMMA 3AE9C 3H1IJ 3L74E 3V4QA 2JP3A 2W6JH 1CSBA 4HKZH 1PPJG 2K1AA 2K9YA 2PFXA 3B5NC 1FDOA 1SQXJ 3EFGA 3MUDA 4WY4A 3RBZA 1NAFA 5APXA 3BVHA 3RK3C 2FYUK 3NFQA 2WVRA 4L73A 2QA4P 1KB9E 1URQB 2ZVNB 2B9BA 2IYOA 1S5LX 3HE5B 3I5CA 3MGNA 4JF7A 5GTIH 3L73E 3D71A 1WT6A 2IYPA 2IFNA 2M5AA 1IZNB 2JDIH 2XU6A 3MTUE 4JQ0D 5AW1B 1IJDB 1OFCX 1SQPE 2L91A 3IR9A 3TGUJ 3H25A 1LWUC 1Q2NA 1S1CX 2A06E 2PGDA 2YIUC 3BCCJ 1JMBA 4H0LC 3CI9A 1FE6A 1QVFO 2QG4A 4YXDC 2FXMA 3PHLA 4LGDE 1ZOYC 2KOGA 1SLQA 5DJUB 3H1JJ 1CI6A 2FXOA 1LTAC 1BGYG 1R5LA 2ZVOB 5KAIE 5AW5B 3Q1MA 2OYIC 2CK3H 3MP7B 2WZ7A 1L2PA 2K9JB 3AE2C 4IL6H 2BCCD 3S1KA 1PP9D 4EIJA 2NPSD 3HD7A 2BEZF 3CL3D 3L73D 2I1JA 5AVZB 2WSSH 3BRTB 3KQGA 3RL0B 1OW6A 2IZ1A 2KLVA 4H13B 3B5NA 1M7LA 1MZ9A 2HODB 1VF5D 1SFCB 2N1TB 2P58A 2V4HA 1SP4A 5AVUB 5KLVD 3S4RA 4D6TD 1S2EA 2PRRA 1ZR2A 1BE3E 1ZLLA 1J1DC 2E76C 2SPZA 3SFDC 1KILC 2ZXEB 3CX5I 4PD4D 1YJ9P 3CCUP 1G2CB 1NTMG 2RN0A 4H13D 2OTLP 2E74D 3H32A 2L5GB 2KK7A 4YPCA 4JYBA 3L71G 3MZWB 1YQ4C 5CHXA 3SWKA 1S9KD 1QL2A 1NKZB 3EWKA 1Q7YQ 1NJIQ 1L0NE 1LTJA 1SQQJ 4EYYQ 1FZFA 2KUBA 1IC2A 1ZMEC 4WY4D 1JY3N 4OH8B 3L71E 1BDCA 2I8DA 2FYUD 3GG2A 3LW5J 4QMAA 2LR2A 3TYYA 3VMYA 5KJ7C 1N7SD 5KLVE 3NXSA 1GU5A 1T3JA 3OW2O 1N73C 2HODA 1BCCG 1IO4A 1HGZA 3M91A 3O8ZA 4ZKUA 1IFIA 3CC2P 2XNXA 1YBKA 4PD4E 1OXZA 3QWOC 4AUWA 5B66H 1OVUA 2FXPA 3BCCD 1NTKE 1USEA 1RF1C 3V2QA 1KFMA 1LP1A 1NTZD 3OAKA 3HUSA 1PZQA 4JBZA 1YTZI 3L75D 1L0ND 2KZIA 2ZYGA 3R2PA 1AQ5A 2BCCJ 2E75B 1ZW0A 1BDDA 1SQPD 2GA1A 5CCGC 3F89A 1SQQK 3SFEC 3GHGC 2OYIA 3L71D 2A06D 3FX0A 1AVOA 1BCCJ 2Z5HA 4KHXA 3AE1C 1W2BO 2WPVB 1L0LG 3WU2H 3RGUA 1LTSC 2ZAEB 1HBWA 4DT0A 1JOCA 4IFFA 3RK3B 1LWUA 3M9QA 3U1AA 2YO3A 1URQC 1NYHA 2IBZI 1RF0A 2NRGA 3AE4C 2M0BA 1L4AD 2KSJA 1EDIA 4UB8E 2BASA 1J1EB 1VQOP 1Q82Q 1SQVG 1JY2P 3JC22 2FFDC 1LGHB 3GF3A 3L75E 2C0WA 4C7RA 3U1CA 4NPFX 1Z56A 1BSHA 3H6PA 3WUUA 1VQLP 1KMIZ 1DD4A 1LT9C 3A2AA 4H0LB 1NU1J 4KT0J 1A02J 4Y28J 2J59M 1NKNA 1PIXA 1RF0C 3L75G 1URQA 3V6IA 2HPCA 1BSNA 3O6QB 1T8ZA 4U3FE 4D6TE 3IF4A 2OYIB 1U7JA 1SQBK 1SFCA 2YKOA 3GLMA 5AW8B 2MKVA 1E79H 4YTPC 3CCQP 1VQ8P 2C9LY 1JTHB 2W83C 5KAFH 3L74J 1TU3F 4JPZB 2KIKA 4AQRD 3RL0D 2WSCH 1SQXE 2O1JA 3Q3DA 2Q1KA 1AQTA 2O1KA 3E1IA 3T97A 3L4FA 1NU1G 1S9KE 3RK2D 1R8EA 1MFZA 3CD6P 1T3UA 5AVRB 3LW5H 5TISH 2K9JA 2N9YB 3L73J 2HR3A 4WVZA 2Z4EA 4R4LA 4ZKPA 1VQ9P 3P32A 2E76B 1NHLA 2OGUA 3A0HE 1JY2O 2ZYAA 2QJKB 1Y8AA 3B4SA 3CWBG 4W7YA 3VMZA 2WTYA 2QM7A 2G8YA 1RE3C 1JM0A 3M0DC 1N8RQ 3H1HG 3HD7C 3BCCE 3VMAA 3VN0A 1NTKD 1QGKB 1HJ0A 1FZCC 2M3EA 1NTZE 1L0LK 3H1JE 3L70G 2OARA 2FYNC 2WQYC 3KYQA 1HJBA 5AW2B 2VRSA 4U7JA 5CCHA 1RH5B 2R32A 2RMZA 2RH0A 1RF1A 1HWTC 2A45G 2ZYDA 3JSVC 3BATA 3NMDA 5B66E 3SWFA 2OYHB 5H2FH 2KNCB 2NPSA 2IX7C 1BGYJ 2WT7B 1FDIA 3G9RA 3CWBJ 3PH0A 3WUVA 1FZGA 3CMEP 1PP9G 2AXTH 1GW3A 4L74A 4OWFA 1OMIA 2W8ZA 1NU1D 4N3YB 3ABVC 4NPEA 5E79H 1AV1A 3MD0A 3CC4P 2AXTE 1SQVD 1LTJC 1N7SB 1OVVA 1DH3A 1FJPA 1P84I 2D2CC 3ZDMA 3Q5RA 3AE3C 1S3JA 3H1JD 1NOHA 2B87B 5GTHE 3TSIA 1SQXG 2UWJE 4BWNA 2Y0CA 2ZT9C 3VOPA 1Y47A 1PGJA 2FYZA 3B5ND 2P1JA 1ZXGA 3LIEA 4RESB 4AYCA 1KZUB 1P84D 2KS1B 3M0DA 1GK4A 4PV1C 2V7QJ 5AVYB 5L8RJ 1GK6A 4IL6X 1SQBD 4N78E 4YXWH 1X0TA 1M90Q 1L0NJ 1LTBC 4U3FD 1NTMK 2IDBA 1RQUA 5APUA 2E42A 5B5EE 4DCKA 3L71J 1A02F 4KJMA 1SQVE 2JWAA 3JCUE 2FKWB 5BVZA 2FFDB 1VQKP 5KLVJ 3H1KJ 1FU1A 3L72G 5AW4B 3CCRP 1FOSF 1FAVA 1SQXD 5K5GB 3AEFC 3G3ZA 5EFWB 3H1JG 1LJ2A 1OWAA 2M3BA 5M1BA 1KQSO 1S4XA 1NTKJ 2YXRB 4WY4B 2YMYA 2P7JA 2XDJA 1LWUB 3GMAA 3L72E 4W80A 2WSFH 3GHGA 5AW6B 2YO2A 4C46A 2H43A 5CCGA 1P84E 3D6ZA 3H32B 1M1KQ 1DD3A 3L35A 1SQBE 4M3LA 3N4XA 4N78D 4C7NA 1ZR4A 1GL2A 3A0BH 2M8RA 3BRVB 4JYCA 5KAIH 3H1IG 1LNQA 4BRYB 1NWQA 3N7NA 1GD2E 3B8EB 5CCHC 3FWLA 1DEEG 1SQPK 5CBOA 1EQ7A 3CCVP 3LIDA 1NVOA 2Y0DA 4UB6E 5KKZC 2Y9ZA 3MIWA 3TNUB 3S9OA 1YJWP 1GMJA 1RQVA 1H0TA 2J58A 2FFDA 2KSEA 1JY3P 1PL5A 1IFMA 1Q90D 2B88A 1QEXA 1X22A 2WPSA 4GT1A 1L0LJ 2W6BA 3A7OA 3AEAC 3L72D 2N1TC 2K37A 3ITKA 4O9BA 2O01H 1QX8A 5CJ0A 1FOSE 4IFDK 3II6A 2XNDH 1KILB 2P2UA 1VPCA 1K05A 1SQQG 2NPSB 3HD7B 3T97B 1NU1E 3Q5PA 2WT7A 2O3JA 3KHUA 3MHVA 1XTCC 1K73Q 1FZCB 5KLIC 1Q81Q 4IOIH 4BRYA 3H1LG 4U3FJ 4D6TJ 4RJTA 4Z1MH 2C9NY 3F5HA 1EZVD 3FWNA 4UB8H 1N7SA 2WPRA 3A0HH 3AEDC 1H8AA 4R4MA 4GODA 3UIAA 2POHA 1U57A 3HRNA 4OGQB 2E5TA 3H1LE 4I7ZB 1VQ7P 1JY2N 3CMAP 4K3AA 2E74C 1KILE 2LKMA 3M0AA 1YI2P 2KP8A 2QVAA 5TJHA 1GDTA 1PFIA 2YKQA 1KD1Q 1YHQP 1N73A 2QJPC 3PRJA 2OTKE 2IBZE 3M06A 4K35A 1RF1B 5AVVB 1HUCA 2W90A 4HJGH 1OW7A 1UIXA 4DOJA 1N86A 4HYTB 3V5BA 1T2KD 5CCGD 1OX3A 4TT3H 5APVA 3TK1A 1NTMJ 1KFNA 2ZT9B 2HYNA 3QH9A 1VL2A 3A0BE 2HPCB 4EDFA 2E75C 3AEBC 1X9VA 3AE6C 3C1LA 2QRXA 1KQFB 2QJYC 1CZQA 3G6EP 3CCSP 1NTZJ 1JTHA 3H1HD 4TLFA 2XKMA 3CCLP 3HTKA 2JKVA 1JMMA 1Y9BA 4EI2A 1HF9A 4XFJA 2ZT9D 2R5BA 4GOEA 5AW3B 1JCDA 1M1JC 1N7LA 2IBZD 1OVRA 2ZJSE 3B71A 1EXIA 1BGYE 1J1EC 1GL2B 4ASWA 1N2DC 3CWBE 3Q5SA 2H7HA 5AVQB 5APQA 1GW4A 5AVSB 2WSEJ 4CPGA 3CCEP 2Q5UA 3MUDC 1IK7A 1X8YA 3EFFK 2Z5IA 4WY4C 2HLOA 1LT9B 1S5LE 1NTZG 2IFMA 1ZV8A 2GUVA 1URQD 2GUSA 3L74G 2OQQA 3RK3D 1WMKA 2YXQB 1H0TB 2R3SA 1PGQA 1ZP0C 1M57D 2P67A 4UB6H 1JY3O 1H89A 3TDKA 2Y9YA 1K04A 2IPPA 1YIJP 1EDKA 5DJTB 5AVTB 1QLED 3BCCG 2YKPA 2YMKA 2JEEA 3E1RA 1GU4A 3IAOA 1S72P 3HUSB 1RE4A 4H0LD 1OZHA 1P84H 1RY3A 1VQ4P 1SQBG 1L4AB 1IK9A 1EZVE 2N1TA 3AE8C 5AVWB 1RHZB 5KAFE 3I55P 1LTTC 3C8VA 1VQ5P 1M8OB 1SQVJ 4BXLA 1ZRTE 1HTLC 3B5NB 2QE7H 3H1KE 3H1LD 2R44A 1KC8Q 1PGPA 1NTMD 1FZAA 3L37A 1G2CA 1KILD 4OVNF 3HE4A 1OW8A 2PAJA 2QJKC 1IFPA 3EQ2A 3TF5A 4HH2A 5B5EH 5KLVG 1L0LD 2AEJA 3L72J 4LC1A 5KLIB 3GF7A 2Q9IA 2FBWC 2XV5A 5BU5A 2H89C 2KI7B 2OYOA 3IN6A 1NTZK 4WB4A 2WSCJ 1SQBJ 1IFNA 3NTNA 2R3CA 3OJAB 3U59A 1PP9J 2YIUB 1S5LH 1W2EA 4GKGA 1FZBA 1KILA 5KJ7D 4LLHA 2KB7P 4N6JA 2E74B 1ZRTD 2P10A 3CC7P 1LTIC 2KYVA 2K3RA 3I56P 3TGUG 1JUNA 1L0NK 5GTHH 1SVFA 2Q3EA 1QL1A 5CJ4A 3C9IA 3H1HE 3CX5H 1DIPA 1SS1A 1Q86Q 2DW3A 3H1ID 1KB9I 4ZMDA 2CPSA 5AW9B 1K8AQ 1FDMA 1L0LE 2E76D 1D7MA 2O01N 3FXEA 1VQMP 1VQPP 4H13C 1BGYD 2JR8A 3HE5A 4RO0A 3PTZA 3CWBD 3GW6A 1JO5A 3AEEC 1SFCC 2K88A 4W7ZA 1JEKA 2Q3IA 5APTA 4C7NB 1IFDA 2E5YA 3P8CD 3L70J 1J1DB 1JB0J 4H44D 1OIPA 4PV1B 3H1KG 3RK3E 1KV4A 4L76A 1VF5B 3AECC 3A5TA 1LT9A 2Q6QA 1YJNP 2CPBA 2Y0EA 1M1JB 2FYUJ 1PPJD 3H1IE 3M9BA 2O01J 1FZEA 2NZ2A 3FGAD 1KORA 3H1LJ 4U3FG 4D6TG 3CXHH 2B87A 4Y99C 1NGMB 2JWDA 3R4YA 3VMXA 1MUUA 1T2KC 2FY8A 1HVVA 3PLNA 3A3YB 1KQLA 3Q2YA 1VDFA 4I1LA 2IZ0A 4L75A 1KTMA 3WMM0 1VQ6P 3V2NA 2HG5D 2E75D 2J5UA 1G1IA 1GL2D 3JCUH 3L36A 1KN7A 4HB1A 2XZRA 5APWA 2GM4A 3H1KD 2YNYA 3IFMA 2MJZA 1NTME 3CX5E 1SQPJ 4H44B 2FYUG 4PV1D 3TGUE 3BASA 1PV3A 1NH4A 3VTPC 1AA0A 1LTGC 3O6QA 1FJKA 5APSA 3CCMP 1USDA 1PPJE 1E5WA
chains in the Genus database with same CATH topology
3H1LG 3H1IG 3H1KG 1L0NG 3L73G 3BCCG 3L70G 3L71G 1BGYG 1EZVG 1KB9H 2IBZG 1KYOH 3TGUG 4U3FG 1L0LG 1P84H 4D6TG 3CXHH 1PPJG 1SQBG 2A06G 3CX5H 1SQPG 1NU1G 1BE3G 4PD4H 1PP9G 3L72G 1NTKG 1BCCG 1SQVG 3H1JG 1NTZG 5KLVG 2BCCG 3L74G 1SQQG 3CWBG 2FYUG 1SQXG 3L75G 3H1HG 1NTMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L G;  3H1I G;  3H1K G;  1L0N G;  3L73 G;  3BCC G;  3L70 G;  3L71 G;  1BGY G;  1EZV G;  1KB9 H;  2IBZ G;  1KYO H;  3TGU G;  4U3F G;  1L0L G;  1P84 H;  4D6T G;  3CXH H;  1PPJ G;  1SQB G;  2A06 G;  3CX5 H;  1SQP G;  1NU1 G;  1BE3 G;  4PD4 H;  1PP9 G;  3L72 G;  1NTK G;  1BCC G;  1SQV G;  3H1J G;  1NTZ G;  5KLV G;  2BCC G;  3L74 G;  1SQQ G;  3CWB G;  2FYU G;  1SQX G;  3L75 G;  3H1H G;  1NTM G; 
#chains in the Genus database with same CATH topology
 1GTW A;  1EC5 A;  1L0N G;  1HH0 A;  2QM8 A;  2QSI A;  3HUS C;  4IL6 E;  1T6A A;  2LXC B;  1EZV G;  1KB9 H;  2W6A A;  3KZI E;  1GZL A;  2IBZ G;  3M9H A;  3RK2 C;  5KKZ B;  3GHG B;  1NTK K;  3G4S P;  3SSU A;  2RKL A;  1MKM A;  2HFE D;  2N1T D;  4PJ0 H;  4XA4 A;  4IFM A;  3KXD A;  5KTB A;  3CPW O;  3CXH I;  3AE5 C;  1SQV K;  2PP6 A;  4WWI A;  3V2R A;  5CCH D;  1SQP G;  3E7K A;  4WBA A;  5KLV K;  4MN4 C;  4EOT A;  4RKU J;  3CX5 D;  1NTK G;  2WWW A;  2KLU A;  4PD4 I;  3TGU D;  1M56 D;  5CBN A;  2KZJ A;  2A45 H;  2NPS C;  1NU1 K;  1RE4 C;  3L70 D;  1DEB A;  1JNM A;  2H88 C;  1FZC A;  2AXC A;  2BEQ D;  3KZI H;  5APY A;  4OGQ D;  1BE3 J;  3P7K A;  2QEX P;  3WU2 E;  1MFT A;  1K9M Q;  1YQ3 C;  2H8P D;  3W68 A;  3D70 A;  1DX7 A;  2V7Q H;  5TIS E;  3CCJ P;  1QVG O;  5BU8 B;  2JJL A;  3W67 A;  2WPQ A;  2I1K A;  1FBM A;  1X79 B;  3HTK B;  1RE3 A;  4I7Z C;  4OGQ C;  3D6Y A;  3P8C E;  2KNC A;  3VYI A;  4DZO A;  3WUT A;  1KYO H;  3HD7 D;  1SQQ E;  2JO1 A;  3KDP B;  2M5A B;  1KB9 D;  1JCC A;  2C0X A;  2KXP B;  1WRG A;  1LT1 A;  2B89 A;  2QJP B;  4ASV A;  1FC2 C;  1FS0 E;  3CXH E;  4GDO A;  4ZNC A;  1BE3 G;  1YYC A;  1SFC D;  4PD4 H;  3FXD A;  4DJG A;  3KPE A;  2A45 I;  1M1J A;  3P8M C;  3RL0 C;  1XTG B;  1CI6 B;  1SQX K;  1AVY A;  2BCC G;  4GIF A;  5C39 A;  2E43 A;  1CW5 A;  1KYO E;  2QJY B;  2OYH A;  3PJS K;  3K5B A;  2WSE H;  3PP5 A;  3RBX A;  1VF5 C;  2WSF J;  5E79 E;  1SQQ D;  2KS1 A;  2BCC E;  1PP9 E;  5CMZ A;  1YIT P;  3SWY A;  1ZN5 A;  2D2C D;  3L73 G;  3OA7 A;  2ZFC A;  4I6M C;  1H88 A;  4PJ0 E;  1EDJ A;  3G71 P;  4Y99 B;  3CXH D;  1BCC E;  1L4A A;  1NO4 A;  5GTI E;  2FYN B;  4A7P A;  2ZXX A;  1GL2 C;  4GOF A;  1MV8 A;  4I2L C;  2A06 G;  3H1H J;  1LP1 B;  5AW7 B;  3V2P A;  2OYH C;  1EZV I;  2Q7C A;  1IFJ A;  5H2F E;  5KJ7 A;  1G1J A;  3L74 D;  1VQN P;  2ITA A;  1W5C E;  3HE4 B;  1EDL A;  2W27 A;  1BE3 D;  1KYO D;  1HGV A;  4XE5 B;  3AE7 C;  3VP9 A;  2WIT A;  3L75 J;  1N73 B;  1EXJ A;  2N9B A;  3CLQ A;  4H44 C;  1U7M A;  1PGO A;  4NPD A;  3V4W A;  1R5S A;  3AEG C;  3VP8 A;  2OTJ P;  1AJY A;  1LTJ B;  1N7S C;  3RL0 g;  2G3A A;  2D2C B;  5AW0 B;  1KYO I;  3L70 E;  1BCC D;  2LXB A;  1UII A;  1YTZ T;  3TNU A;  3USS A;  2R5D A;  4B86 A;  1AFO A;  2AEF A;  5AVX B;  3RK2 B;  1J2J B;  1NAY A;  2QIW A;  1KQG B;  1L4A C;  2AEM A;  2FYU E;  2WMM A;  3AE9 C;  3H1I J;  3L74 E;  3V4Q A;  2JP3 A;  2W6J H;  1CSB A;  4HKZ H;  1PPJ G;  2K1A A;  2K9Y A;  2PFX A;  3B5N C;  1FDO A;  1SQX J;  3EFG A;  3MUD A;  4WY4 A;  3RBZ A;  1NAF A;  5APX A;  3BVH A;  3RK3 C;  2FYU K;  3NFQ A;  2WVR A;  4L73 A;  2QA4 P;  1KB9 E;  1URQ B;  2ZVN B;  2B9B A;  2IYO A;  1S5L X;  3HE5 B;  3I5C A;  3MGN A;  4JF7 A;  5GTI H;  3L73 E;  3D71 A;  1WT6 A;  2IYP A;  2IFN A;  2M5A A;  1IZN B;  2JDI H;  2XU6 A;  3MTU E;  4JQ0 D;  5AW1 B;  1IJD B;  1OFC X;  1SQP E;  2L91 A;  3IR9 A;  3TGU J;  3H25 A;  1LWU C;  1Q2N A;  1S1C X;  2A06 E;  2PGD A;  2YIU C;  3BCC J;  1JMB A;  4H0L C;  3CI9 A;  1FE6 A;  1QVF O;  2QG4 A;  4YXD C;  2FXM A;  3PHL A;  4LGD E;  1ZOY C;  2KOG A;  1SLQ A;  5DJU B;  3H1J J;  1CI6 A;  2FXO A;  1LTA C;  1BGY G;  1R5L A;  2ZVO B;  5KAI E;  5AW5 B;  3Q1M A;  2OYI C;  2CK3 H;  3MP7 B;  2WZ7 A;  1L2P A;  2K9J B;  3AE2 C;  4IL6 H;  2BCC D;  3S1K A;  1PP9 D;  4EIJ A;  2NPS D;  3HD7 A;  2BEZ F;  3CL3 D;  3L73 D;  2I1J A;  5AVZ B;  2WSS H;  3BRT B;  3KQG A;  3RL0 B;  1OW6 A;  2IZ1 A;  2KLV A;  4H13 B;  3B5N A;  1M7L A;  1MZ9 A;  2HOD B;  1VF5 D;  1SFC B;  2N1T B;  2P58 A;  2V4H A;  1SP4 A;  5AVU B;  5KLV D;  3S4R A;  4D6T D;  1S2E A;  2PRR A;  1ZR2 A;  1BE3 E;  1ZLL A;  1J1D C;  2E76 C;  2SPZ A;  3SFD C;  1KIL C;  2ZXE B;  3CX5 I;  4PD4 D;  1YJ9 P;  3CCU P;  1G2C B;  1NTM G;  2RN0 A;  4H13 D;  2OTL P;  2E74 D;  3H32 A;  2L5G B;  2KK7 A;  4YPC A;  4JYB A;  3L71 G;  3MZW B;  1YQ4 C;  5CHX A;  3SWK A;  1S9K D;  1QL2 A;  1NKZ B;  3EWK A;  1Q7Y Q;  1NJI Q;  1L0N E;  1LTJ A;  1SQQ J;  4EYY Q;  1FZF A;  2KUB A;  1IC2 A;  1ZME C;  4WY4 D;  1JY3 N;  4OH8 B;  3L71 E;  1BDC A;  2I8D A;  2FYU D;  3GG2 A;  3LW5 J;  4QMA A;  2LR2 A;  3TYY A;  3VMY A;  5KJ7 C;  1N7S D;  5KLV E;  3NXS A;  1GU5 A;  1T3J A;  3OW2 O;  1N73 C;  2HOD A;  1BCC G;  1IO4 A;  1HGZ A;  3M91 A;  3O8Z A;  4ZKU A;  1IFI A;  3CC2 P;  2XNX A;  1YBK A;  4PD4 E;  1OXZ A;  3QWO C;  4AUW A;  5B66 H;  1OVU A;  2FXP A;  3BCC D;  1NTK E;  1USE A;  1RF1 C;  3V2Q A;  1KFM A;  1LP1 A;  1NTZ D;  3OAK A;  3HUS A;  1PZQ A;  4JBZ A;  1YTZ I;  3L75 D;  1L0N D;  2KZI A;  2ZYG A;  3R2P A;  1AQ5 A;  2BCC J;  2E75 B;  1ZW0 A;  1BDD A;  1SQP D;  2GA1 A;  5CCG C;  3F89 A;  1SQQ K;  3SFE C;  3GHG C;  2OYI A;  3L71 D;  2A06 D;  3FX0 A;  1AVO A;  1BCC J;  2Z5H A;  4KHX A;  3AE1 C;  1W2B O;  2WPV B;  1L0L G;  3WU2 H;  3RGU A;  1LTS C;  2ZAE B;  1HBW A;  4DT0 A;  1JOC A;  4IFF A;  3RK3 B;  1LWU A;  3M9Q A;  3U1A A;  2YO3 A;  1URQ C;  1NYH A;  2IBZ I;  1RF0 A;  2NRG A;  3AE4 C;  2M0B A;  1L4A D;  2KSJ A;  1EDI A;  4UB8 E;  2BAS A;  1J1E B;  1VQO P;  1Q82 Q;  1SQV G;  1JY2 P;  3JC2 2;  2FFD C;  1LGH B;  3GF3 A;  3L75 E;  2C0W A;  4C7R A;  3U1C A;  4NPF X;  1Z56 A;  1BSH A;  3H6P A;  3WUU A;  1VQL P;  1KMI Z;  1DD4 A;  1LT9 C;  3A2A A;  4H0L B;  1NU1 J;  4KT0 J;  1A02 J;  4Y28 J;  2J59 M;  1NKN A;  1PIX A;  1RF0 C;  3L75 G;  1URQ A;  3V6I A;  2HPC A;  1BSN A;  3O6Q B;  1T8Z A;  4U3F E;  4D6T E;  3IF4 A;  2OYI B;  1U7J A;  1SQB K;  1SFC A;  2YKO A;  3GLM A;  5AW8 B;  2MKV A;  1E79 H;  4YTP C;  3CCQ P;  1VQ8 P;  2C9L Y;  1JTH B;  2W83 C;  5KAF H;  3L74 J;  1TU3 F;  4JPZ B;  2KIK A;  4AQR D;  3RL0 D;  2WSC H;  1SQX E;  2O1J A;  3Q3D A;  2Q1K A;  1AQT A;  2O1K A;  3E1I A;  3T97 A;  3L4F A;  1NU1 G;  1S9K E;  3RK2 D;  1R8E A;  1MFZ A;  3CD6 P;  1T3U A;  5AVR B;  3LW5 H;  5TIS H;  2K9J A;  2N9Y B;  3L73 J;  2HR3 A;  4WVZ A;  2Z4E A;  4R4L A;  4ZKP A;  1VQ9 P;  3P32 A;  2E76 B;  1NHL A;  2OGU A;  3A0H E;  1JY2 O;  2ZYA A;  2QJK B;  1Y8A A;  3B4S A;  3CWB G;  4W7Y A;  3VMZ A;  2WTY A;  2QM7 A;  2G8Y A;  1RE3 C;  1JM0 A;  3M0D C;  1N8R Q;  3H1H G;  3HD7 C;  3BCC E;  3VMA A;  3VN0 A;  1NTK D;  1QGK B;  1HJ0 A;  1FZC C;  2M3E A;  1NTZ E;  1L0L K;  3H1J E;  3L70 G;  2OAR A;  2FYN C;  2WQY C;  3KYQ A;  1HJB A;  5AW2 B;  2VRS A;  4U7J A;  5CCH A;  1RH5 B;  2R32 A;  2RMZ A;  2RH0 A;  1RF1 A;  1HWT C;  2A45 G;  2ZYD A;  3JSV C;  3BAT A;  3NMD A;  5B66 E;  3SWF A;  2OYH B;  5H2F H;  2KNC B;  2NPS A;  2IX7 C;  1BGY J;  2WT7 B;  1FDI A;  3G9R A;  3CWB J;  3PH0 A;  3WUV A;  1FZG A;  3CME P;  1PP9 G;  2AXT H;  1GW3 A;  4L74 A;  4OWF A;  1OMI A;  2W8Z A;  1NU1 D;  4N3Y B;  3ABV C;  4NPE A;  5E79 H;  1AV1 A;  3MD0 A;  3CC4 P;  2AXT E;  1SQV D;  1LTJ C;  1N7S B;  1OVV A;  1DH3 A;  1FJP A;  1P84 I;  2D2C C;  3ZDM A;  3Q5R A;  3AE3 C;  1S3J A;  3H1J D;  1NOH A;  2B87 B;  5GTH E;  3TSI A;  1SQX G;  2UWJ E;  4BWN A;  2Y0C A;  2ZT9 C;  3VOP A;  1Y47 A;  1PGJ A;  2FYZ A;  3B5N D;  2P1J A;  1ZXG A;  3LIE A;  4RES B;  4AYC A;  1KZU B;  1P84 D;  2KS1 B;  3M0D A;  1GK4 A;  4PV1 C;  2V7Q J;  5AVY B;  5L8R J;  1GK6 A;  4IL6 X;  1SQB D;  4N78 E;  4YXW H;  1X0T A;  1M90 Q;  1L0N J;  1LTB C;  4U3F D;  1NTM K;  2IDB A;  1RQU A;  5APU A;  2E42 A;  5B5E E;  4DCK A;  3L71 J;  1A02 F;  4KJM A;  1SQV E;  2JWA A;  3JCU E;  2FKW B;  5BVZ A;  2FFD B;  1VQK P;  5KLV J;  3H1K J;  1FU1 A;  3L72 G;  5AW4 B;  3CCR P;  1FOS F;  1FAV A;  1SQX D;  5K5G B;  3AEF C;  3G3Z A;  5EFW B;  3H1J G;  1LJ2 A;  1OWA A;  2M3B A;  5M1B A;  1KQS O;  1S4X A;  1NTK J;  2YXR B;  4WY4 B;  2YMY A;  2P7J A;  2XDJ A;  1LWU B;  3GMA A;  3L72 E;  4W80 A;  2WSF H;  3GHG A;  5AW6 B;  2YO2 A;  4C46 A;  2H43 A;  5CCG A;  1P84 E;  3D6Z A;  3H32 B;  1M1K Q;  1DD3 A;  3L35 A;  1SQB E;  4M3L A;  3N4X A;  4N78 D;  4C7N A;  1ZR4 A;  1GL2 A;  3A0B H;  2M8R A;  3BRV B;  4JYC A;  5KAI H;  3H1I G;  1LNQ A;  4BRY B;  1NWQ A;  3N7N A;  1GD2 E;  3B8E B;  5CCH C;  3FWL A;  1DEE G;  1SQP K;  5CBO A;  1EQ7 A;  3CCV P;  3LID A;  1NVO A;  2Y0D A;  4UB6 E;  5KKZ C;  2Y9Z A;  3MIW A;  3TNU B;  3S9O A;  1YJW P;  1GMJ A;  1RQV A;  1H0T A;  2J58 A;  2FFD A;  2KSE A;  1JY3 P;  1PL5 A;  1IFM A;  1Q90 D;  2B88 A;  1QEX A;  1X22 A;  2WPS A;  4GT1 A;  1L0L J;  2W6B A;  3A7O A;  3AEA C;  3L72 D;  2N1T C;  2K37 A;  3ITK A;  4O9B A;  2O01 H;  1QX8 A;  5CJ0 A;  1FOS E;  4IFD K;  3II6 A;  2XND H;  1KIL B;  2P2U A;  1VPC A;  1K05 A;  1SQQ G;  2NPS B;  3HD7 B;  3T97 B;  1NU1 E;  3Q5P A;  2WT7 A;  2O3J A;  3KHU A;  3MHV A;  1XTC C;  1K73 Q;  1FZC B;  5KLI C;  1Q81 Q;  4IOI H;  4BRY A;  3H1L G;  4U3F J;  4D6T J;  4RJT A;  4Z1M H;  2C9N Y;  3F5H A;  1EZV D;  3FWN A;  4UB8 H;  1N7S A;  2WPR A;  3A0H H;  3AED C;  1H8A A;  4R4M A;  4GOD A;  3UIA A;  2POH A;  1U57 A;  3HRN A;  4OGQ B;  2E5T A;  3H1L E;  4I7Z B;  1VQ7 P;  1JY2 N;  3CMA P;  4K3A A;  2E74 C;  1KIL E;  2LKM A;  3M0A A;  1YI2 P;  2KP8 A;  2QVA A;  5TJH A;  1GDT A;  1PFI A;  2YKQ A;  1KD1 Q;  1YHQ P;  1N73 A;  2QJP C;  3PRJ A;  2OTK E;  2IBZ E;  3M06 A;  4K35 A;  1RF1 B;  5AVV B;  1HUC A;  2W90 A;  4HJG H;  1OW7 A;  1UIX A;  4DOJ A;  1N86 A;  4HYT B;  3V5B A;  1T2K D;  5CCG D;  1OX3 A;  4TT3 H;  5APV A;  3TK1 A;  1NTM J;  1KFN A;  2ZT9 B;  2HYN A;  3QH9 A;  1VL2 A;  3A0B E;  2HPC B;  4EDF A;  2E75 C;  3AEB C;  1X9V A;  3AE6 C;  3C1L A;  2QRX A;  1KQF B;  2QJY C;  1CZQ A;  3G6E P;  3CCS P;  1NTZ J;  1JTH A;  3H1H D;  4TLF A;  2XKM A;  3CCL P;  3HTK A;  2JKV A;  1JMM A;  1Y9B A;  4EI2 A;  1HF9 A;  4XFJ A;  2ZT9 D;  2R5B A;  4GOE A;  5AW3 B;  1JCD A;  1M1J C;  1N7L A;  2IBZ D;  1OVR A;  2ZJS E;  3B71 A;  1EXI A;  1BGY E;  1J1E C;  1GL2 B;  4ASW A;  1N2D C;  3CWB E;  3Q5S A;  2H7H A;  5AVQ B;  5APQ A;  1GW4 A;  5AVS B;  2WSE J;  4CPG A;  3CCE P;  2Q5U A;  3MUD C;  1IK7 A;  1X8Y A;  3EFF K;  2Z5I A;  4WY4 C;  2HLO A;  1LT9 B;  1S5L E;  1NTZ G;  2IFM A;  1ZV8 A;  2GUV A;  1URQ D;  2GUS A;  3L74 G;  2OQQ A;  3RK3 D;  1WMK A;  2YXQ B;  1H0T B;  2R3S A;  1PGQ A;  1ZP0 C;  1M57 D;  2P67 A;  4UB6 H;  1JY3 O;  1H89 A;  3TDK A;  2Y9Y A;  1K04 A;  2IPP A;  1YIJ P;  1EDK A;  5DJT B;  5AVT B;  1QLE D;  3BCC G;  2YKP A;  2YMK A;  2JEE A;  3E1R A;  1GU4 A;  3IAO A;  1S72 P;  3HUS B;  1RE4 A;  4H0L D;  1OZH A;  1P84 H;  1RY3 A;  1VQ4 P;  1SQB G;  1L4A B;  1IK9 A;  1EZV E;  2N1T A;  3AE8 C;  5AVW B;  1RHZ B;  5KAF E;  3I55 P;  1LTT C;  3C8V A;  1VQ5 P;  1M8O B;  1SQV J;  4BXL A;  1ZRT E;  1HTL C;  3B5N B;  2QE7 H;  3H1K E;  3H1L D;  2R44 A;  1KC8 Q;  1PGP A;  1NTM D;  1FZA A;  3L37 A;  1G2C A;  1KIL D;  4OVN F;  3HE4 A;  1OW8 A;  2PAJ A;  2QJK C;  1IFP A;  3EQ2 A;  3TF5 A;  4HH2 A;  5B5E H;  5KLV G;  1L0L D;  2AEJ A;  3L72 J;  4LC1 A;  5KLI B;  3GF7 A;  2Q9I A;  2FBW C;  2XV5 A;  5BU5 A;  2H89 C;  2KI7 B;  2OYO A;  3IN6 A;  1NTZ K;  4WB4 A;  2WSC J;  1SQB J;  1IFN A;  3NTN A;  2R3C A;  3OJA B;  3U59 A;  1PP9 J;  2YIU B;  1S5L H;  1W2E A;  4GKG A;  1FZB A;  1KIL A;  5KJ7 D;  4LLH A;  2KB7 P;  4N6J A;  2E74 B;  1ZRT D;  2P10 A;  3CC7 P;  1LTI C;  2KYV A;  2K3R A;  3I56 P;  3TGU G;  1JUN A;  1L0N K;  5GTH H;  1SVF A;  2Q3E A;  1QL1 A;  5CJ4 A;  3C9I A;  3H1H E;  3CX5 H;  1DIP A;  1SS1 A;  1Q86 Q;  2DW3 A;  3H1I D;  1KB9 I;  4ZMD A;  2CPS A;  5AW9 B;  1K8A Q;  1FDM A;  1L0L E;  2E76 D;  1D7M A;  2O01 N;  3FXE A;  1VQM P;  1VQP P;  4H13 C;  1BGY D;  2JR8 A;  3HE5 A;  4RO0 A;  3PTZ A;  3CWB D;  3GW6 A;  1JO5 A;  3AEE C;  1SFC C;  2K88 A;  4W7Z A;  1JEK A;  2Q3I A;  5APT A;  4C7N B;  1IFD A;  2E5Y A;  3P8C D;  3L70 J;  1J1D B;  1JB0 J;  4H44 D;  1OIP A;  4PV1 B;  3H1K G;  3RK3 E;  1KV4 A;  4L76 A;  1VF5 B;  3AEC C;  3A5T A;  1LT9 A;  2Q6Q A;  1YJN P;  2CPB A;  2Y0E A;  1M1J B;  2FYU J;  1PPJ D;  3H1I E;  3M9B A;  2O01 J;  1FZE A;  2NZ2 A;  3FGA D;  1KOR A;  3H1L J;  4U3F G;  4D6T G;  3CXH H;  2B87 A;  4Y99 C;  1NGM B;  2JWD A;  3R4Y A;  3VMX A;  1MUU A;  1T2K C;  2FY8 A;  1HVV A;  3PLN A;  3A3Y B;  1KQL A;  3Q2Y A;  1VDF A;  4I1L A;  2IZ0 A;  4L75 A;  1KTM A;  3WMM 0;  1VQ6 P;  3V2N A;  2HG5 D;  2E75 D;  2J5U A;  1G1I A;  1GL2 D;  3JCU H;  3L36 A;  1KN7 A;  4HB1 A;  2XZR A;  5APW A;  2GM4 A;  3H1K D;  2YNY A;  3IFM A;  2MJZ A;  1NTM E;  3CX5 E;  1SQP J;  4H44 B;  2FYU G;  4PV1 D;  3TGU E;  3BAS A;  1PV3 A;  1NH4 A;  3VTP C;  1AA0 A;  1LTG C;  3O6Q A;  1FJK A;  5APS A;  3CCM P;  1USD A;  1PPJ E;  1E5W A; 
#chains in the Genus database with same CATH homology
 3H1L G;  3H1I G;  3H1K G;  1L0N G;  3L73 G;  3BCC G;  3L70 G;  3L71 G;  1BGY G;  1EZV G;  1KB9 H;  2IBZ G;  1KYO H;  3TGU G;  4U3F G;  1L0L G;  1P84 H;  4D6T G;  3CXH H;  1PPJ G;  1SQB G;  2A06 G;  3CX5 H;  1SQP G;  1NU1 G;  1BE3 G;  4PD4 H;  1PP9 G;  3L72 G;  1NTK G;  1BCC G;  1SQV G;  3H1J G;  1NTZ G;  5KLV G;  2BCC G;  3L74 G;  1SQQ G;  3CWB G;  2FYU G;  1SQX G;  3L75 G;  3H1H G;  1NTM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...