1EZVG

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ezvG00
3CX5H 1SQBG 3H1JG 1BGYG 2IBZG 1NTZG 1PPJG 3H1IG 3H1KG 1SQPG 1SQXG 4U3FG 3H1HG 3L74G 1BCCG 3CWBG 1BE3G 5KLVG 1NTKG 3BCCG 2A06G 3L71G 3CXHH 1KB9H 3L75G 3H1LG 3L73G 1KYOH 1L0NG 4D6TG 1EZVG 3TGUG 1SQVG 1P84H 4PD4H 1PP9G 1SQQG 2BCCG 1NTMG 3L72G 1NU1G 2FYUG 3L70G 1L0LG
chains in the Genus database with same CATH superfamily
2V7QJ 1MFZA 4BRYA 1SQBD 1VQ9P 1W2BO 1DD3A 2ZXEB 2JO1A 1QEXA 3A7OA 1J1EB 2SPZA 3II6A 1VQKP 2Z4EA 5AVTB 2OTLP 2FFDA 3H1LG 2LR2A 1VDFA 1J1DC 1SFCD 3KZIE 5AW1B 1URQD 1URQA 4PD4D 3KXDA 1UIXA 4H0LB 1Q90D 1Q2NA 1ZXGA 4GODA 3EQ2A 1KYOE 1N73A 2A06D 3B71A 2AXCA 1AV1A 3PRJA 1SLQA 2YMKA 4RESB 3CCMP 3O6QA 2QG4A 1NU1G 3VMZA 1KILE 2QSIA 2O01H 1L4AB 2E5YA 3H1HJ 3HUSA 1LGHB 3CWBD 4H0LC 2YKPA 2BEZF 1EDLA 1KYOI 2P2UA 3L75D 1X22A 3RL0g 2Q9IA 1N7SD 4ZNCA 1N7SA 1Q81Q 3CCLP 3Q5RA 1NTKE 1LTAC 1DD4A 2R5BA 3RK3B 3SFEC 1QVGO 2FKWB 3FX0A 1FZCB 4GKGA 1NH4A 5C39A 3HRNA 2E75B 3E1RA 3CC4P 1CW5A 3GHGB 1BGYJ 2WVRA 1FDIA 1M1JB 5KLIB 1HBWA 1HUCA 1SQPD 4BWNA 3OAKA 1BSNA 1IJDB 5KLVD 3L71D 3RK3C 3H1JJ 3D6YA 1G1IA 2GUVA 3QH9A 1BCCG 1EZVE 1M1JC 5KAFH 4Y28J 1ZOYC 2FYUE 1FZGA 1NU1K 4ASVA 5AW2B 3AEAC 3M0AA 2NPSC 1L0LG 3CX5H 3EFFK 5APXA 4XE5B 3P8CD 4IL6E 3HD7B 3CCSP 1PP9E 4H0LD 4WY4C 1EZVI 4WBAA 2IBZE 2KYVA 1NTZE 1P84H 4IL6X 4C46A 3AE6C 1RY3A 3B5NC 1ZN5A 3CX5D 3T97B 1N7LA 3TGUE 1L4AD 3HD7C 2PAJA 1L4AA 1ZV8A 2C9NY 3GW6A 1ZRTD 2QVAA 1H0TA 3H6PA 1NAYA 1NU1J 3CCJP 3AEDC 3I56P 3I55P 3QWOC 2IBZI 3TNUB 1NOHA 2KB7P 3PP5A 2XKMA 2R32A 1ZLLA 1MUUA 3VMYA 3ABVC 5CBOA 3A0HH 1FZFA 2JDIH 2WSFJ 2DW3A 5AW0B 1NKZB 3L72D 1WT6A 2E75D 4EYYQ 4U3FG 1CI6B 5BU5A 2IYOA 3GHGA 1M1JA 5CHXA 1L0LK 3LIDA 5APWA 1T2KD 3WU2H 3H1KE 1SQQD 1IFPA 2QJYB 1OMIA 2NPSA 1NVOA 3MTUE 3A3YB 1KILC 3MZWB 5H2FE 1IFMA 2WPSA 4RJTA 1H88A 4PD4E 2ZAEB 1U7MA 2YKQA 2Q3IA 4HB1A 1KV4A 3CPWO 2AEMA 1HH0A 3B5NA 4AQRD 1OWAA 2J58A 4H44D 3HD7A 4B86A 3BRTB 4PD4I 1H89A 2W83C 4DT0A 4DZOA 3VTPC 1DX7A 3HE5B 3M0DC 1M57D 2P7JA 1NTKG 2POHA 3S1KA 1GU4A 4HKZH 5AW5B 2QEXP 1FZEA 3T97A 1FZBA 1L0ND 2D2CB 2KI7B 4EOTA 1S5LH 3RK2C 3L70D 3CCEP 3C9IA 3KQGA 2E74C 3HTKA 5CCGC 3TNUA 1ZMEC 4N78E 3AE1C 5AW4B 4HJGH 1JTHB 1VL2A 3PTZA 2AEFA 4DCKA 2K88A 5KLVE 2P67A 2D2CC 2MJZA 3TSIA 2WPQA 3V4WA 2WTYA 3U59A 5CBNA 4CPGA 3N7NA 1EZVG 2Z5IA 3LIEA 3G71P 2BASA 2FYUG 3BCCE 4U3FJ 1J2JB 3AECC 1LP1B 4I7ZB 3L74D 2WSEH 4UB6E 1EDJA 2YIUC 3FXDA 3FGAD 2B87A 1PP9G 3B4SA 1Y8AA 3H1IJ 1NTKK 2IBZG 1NTZG 5KAFE 1VQLP 3WMM0 3GG2A 3LW5H 4RKUJ 3TGUG 3CX5E 1OXZA 1PPJE 3CCQP 4D6TD 3EWKA 3M9QA 4DOJA 2E76B 3CCRP 1KC8Q 1GL2C 5CCGA 3GF3A 3HE5A 1P84E 3D70A 3L73G 1GZLA 2JEEA 3OJAB 1LTTC 2R5DA 2NRGA 3CX5I 1USDA 4L73A 1NGMB 3AEGC 1RF1B 1NTKJ 3PLNA 5AW9B 2OQQA 1SQVE 1N2DC 3L72E 2E76C 2FYUK 3M06A 1P84I 5KKZB 4DJGA 2LKMA 2OYIC 2L5GB 5AVRB 4PV1C 1WMKA 2HODB 2RKLA 1JTHA 1N8RQ 4OVNF 1SQXJ 1JMBA 1PGPA 2W90A 3H1KG 3A0HE 1IK7A 2WITA 1A02J 1KB9H 2Y9ZA 1E79H 3MP7B 5K5GB 2YXQB 1LJ2A 3AE3C 1NTZK 1ZR2A 3CMAP 5E79H 4JYBA 3MUDC 3BRVB 1RQVA 2YMYA 2O1JA 1DH3A 2A45H 1IO4A 2Y9YA 3H1HD 2N1TC 1J1DB 3WU2E 2M8RA 4KHXA 2QJKC 1LP1A 4C7RA 4K35A 4O9BA 1BE3E 1LT1A 3JSVC 3TF5A 1KTMA 4L74A 2JKVA 1KFNA 3P7KA 1K04A 4IFFA 1S72P 2QJPC 1EQ7A 4RO0A 1AA0A 1QL2A 4YXDC 1HGVA 3E7KA 1G1JA 1NTZJ 1MV8A 1BGYD 3V2QA 5B5EH 2QM7A 3CCVP 3VP9A 4EI2A 3S9OA 1IFDA 2Y0EA 3L70E 3TGUJ 2OYHC 3A5TA 1FOSF 4N6JA 2OYIA 3H1JD 2KK7A 3M9BA 2KXPB 4H13D 2WSCH 1GD2E 1H0TB 2UWJE 4YXWH 1S3JA 5KLVG 3I5CA 1YTZI 4GOFA 1RF1A 4EIJA 2CPSA 4UB8H 1S5LE 5BVZA 4M3LA 4K3AA 2IFNA 3V6IA 2XV5A 5DJUB 3MUDA 2PRRA 2OTKE 5CJ0A 4OWFA 1S5LX 3BCCG 1S9KD 3M91A 2HODA 3N4XA 3A0BH 3JC22 3EFGA 1JCDA 1MZ9A 3IAOA 3L74E 5L8RJ 2J59M 3O8ZA 1FAVA 2E43A 2Q3EA 3H1KJ 2BCCE 1CSBA 4YPCA 1NKNA 2NPSB 5KJ7C 2FYZA 1RE4C 2FXPA 1NU1D 1YYCA 3JCUH 2HFED 2WPVB 1PPJG 3BVHA 4WY4B 4D6TE 3S4RA 2G8YA 2GUSA 1HVVA 4NPEA 3P32A 3B5NB 2OYHA 1M8OB 5GTHH 5KLVK 5B66H 3SFDC 1SS1A 4GOEA 2JWDA 1Q82Q 3H1LJ 1PGQA 4TT3H 1FU1A 1YQ3C 1T6AA 2KUBA 2W6JH 2KZIA 1FDMA 3VOPA 1SQVG 2QE7H 3HE4B 3L72G 2FYNB 2RMZA 1K8AQ 1KFMA 3ITKA 1FBMA 2KS1B 2FXOA 3MD0A 2K3RA 1KORA 3K5BA 1XTGB 4C7NB 2ZJSE 3HTKB 1K05A 3C8VA 1LTSC 3G9RA 2FYNC 2VRSA 3L73E 3L4FA 3AEBC 4Z1MH 2HG5D 1YIJP 3USSA 4LLHA 1NTME 2N9BA 3H25A 1YJ9P 3Q5SA 1N86A 5AVVB 5AW8B 3RK3D 2R3CA 1KILB 1VQ6P 1NWQA 3TDKA 1LWUC 3CD6P 3BCCJ 1KB9E 2H7HA 1BE3G 4Y99C 1YHQP 2ZYGA 2H88C 3C1LA 5E79E 1LT9B 2IPPA 1SQBE 1BDCA 3AE7C 3G3ZA 2Q6QA 2NPSD 3U1CA 5GTIH 1USEA 1VPCA 2B87B 2Q5UA 1KB9I 1T8ZA 1SQVK 1T3UA 4WY4D 1BGYE 4WY4A 4AUWA 3RL0C 2W8ZA 3L70G 1LT9C 1VQ8P 4EDFA 2AXTH 3M9HA 2A06E 2R3SA 1IK9A 3B5ND 1BCCJ 2A45I 1Z56A 1JY3P 2OARA 1JO5A 2M0BA 1RHZB 3OA7A 1GW4A 3HD7D 4WB4A 3GF7A 3RK2B 2QRXA 4JF7A 1L0LJ 3CWBE 2E74B 2ZT9C 1LTBC 1RF0C 2KZJA 2ZYDA 2WZ7A 3L75E 5APUA 1KD1Q 3HE4A 1JCCA 3SSUA 3NFQA 1SQVJ 1AVOA 1M1KQ 2HYNA 1FJKA 5CCHC 2KS1A 5AVWB 1EDIA 2IFMA 3PHLA 4OGQC 4C7NA 2H43A 2PP6A 3FWLA 3H1ID 3L74G 1A02F 3VMXA 2IX7C 4UB8E 2Z5HA 2ZXXA 1QX8A 2BCCG 1KYOD 5CJ4A 1SQPE 1YBKA 5CMZA 1KQSO 3IFMA 1VQ7P 3L71E 2GA1A 2YIUB 1VF5B 2IDBA 3A0BE 1KILD 1KILA 3VN0A 2IYPA 2MKVA 4N3YB 4D6TG 5APYA 1Y9BA 1PL5A 1YJWP 3D6ZA 1LT9A 4WVZA 1BE3J 2PFXA 2K37A 2NZ2A 2ZVOB 4LC1A 1IC2A 1NTKD 1GK6A 4XFJA 1VF5C 3IF4A 1ZR4A 3P8CE 1FZAA 1M7LA 3JCUE 1OW6A 3AE8C 2JWAA 4A7PA 1QL1A 1W2EA 3WUUA 1JY2P 1JOCA 1GL2B 2M5AB 1RF0A 1WRGA 1SQXD 3NMDA 5AVQB 1KQGB 3M0DA 2RN0A 3CLQA 1VQ4P 5GTHE 5B66E 1W5CE 2V7QH 2KSJA 3RK2D 1ZRTE 4R4LA 3AE5C 2OGUA 2JR8A 2E74D 3RBZA 5CCGD 2OYIB 4PV1B 2FBWC 1SVFA 5AVZB 1EZVD 1NTMG 2AEJA 1VQOP 1H8AA 4HH2A 1VQNP 1SP4A 2D2CD 2FFDC 5KAIH 1JUNA 3RK3E 3BATA 2RH0A 1M56D 3E1IA 1HF9A 3TK1A 4IFDK 2CPBA 2LXBA 2O1KA 2C0WA 1SFCC 3KDPB 2XU6A 5TJHA 1URQC 4U7JA 3OW2O 4PJ0H 1SQBG 2N1TB 1NTZD 1GTWA 1JMMA 3H32B 4AYCA 1BDDA 3CCUP 2A45G 1SQQE 2P10A 2QJKB 1PZQA 2BCCJ 1VF5D 1DEEG 1OVVA 3TGUD 1EDKA 1BGYG 1YJNP 2ZFCA 4MN4C 1EXJA 2XDJA 2I1KA 1KQLA 2QJPB 5TISH 2A06G 1XTCC 2XNDH 3VP8A 4KT0J 1N7SC 2YKOA 2FYUJ 4JPZB 5GTIE 3R2PA 3AE4C 3CWBG 4L76A 3MHVA 2KNCA 4ZKUA 2OYHB 3CXHH 2XZRA 3L75G 1NTMK 5H2FH 1GL2D 1GL2A 2M5AA 1PP9J 1TU3F 2AXTE 1VQ5P 2B89A 1HJ0A 1GMJA 2B88A 2G3AA 1E5WA 5APQA 3H1KD 1JM0A 1L0NE 1FJPA 1OW8A 1RH5B 2IZ0A 3SWFA 2GM4A 1SQBK 4GIFA 2E76D 3CXHD 1LTJC 3H1IE 1SFCA 1AQTA 2WWWA 4PV1D 3CC2P 2ZYAA 3MGNA 1IFNA 1NHLA 1SQPG 2WT7B 3L71G 3Q5PA 3L73J 3PH0A 1J1EC 4NPDA 3AE2C 1NTMJ 1QGKB 1YTZT 3F5HA 1K9MQ 3WUTA 5APSA 2WQYC 2KIKA 2K1AA 1PFIA 2N1TD 1R8EA 2N1TA 1T3JA 3H1LD 2YNYA 1FC2C 3CL3D 3H32A 3V2RA 1SQBJ 3KPEA 1FS0E 2BEQD 1QLED 1PIXA 1X9VA 2KLVA 2KSEA 1L2PA 2L91A 4W7ZA 1L4AC 2OYOA 4IFMA 2O3JA 2WSFH 1R5SA 1SQXE 4N78D 1U57A 1CZQA 3G6EP 3KHUA 1OIPA 1OW7A 2HPCA 1LNQA 1JY3O 1GW3A 2YXRB 4GT1A 4UB6H 1FZCC 3FXEA 1LTJA 1PGOA 2E75C 1SQPK 5M1BA 1AVYA 5BU8B 3CWBJ 3GHGC 1HJBA 2C9LY 5KLIC 1RQUA 2JP3A 3L75J 3BCCD 5AW7B 3G4SP 1T2KC 1HTLC 3RGUA 3D71A 1NJIQ 3KYQA 4L75A 3AE9C 3CMEP 1G2CB 2O01J 4H44B 2WSCJ 3IN6A 2E42A 1IZNB 1KMIZ 5DJTB 1OZHA 4KJMA 3Q2YA 1MKMA 3L35A 2WPRA 4HYTB 2HLOA 2WT7A 5AVXB 1SQQG 1JY3N 1NYHA 1LWUB 3AEEC 5KAIE 1SQPJ 1KQFB 2JJLA 4I1LA 4Y99B 1PPJD 3V2PA 3W68A 1FDOA 4GDOA 5KLVJ 3L71J 1ZP0C 3NXSA 2I8DA 1BCCD 3GMAA 4H44C 1VQMP 1K73Q 4PJ0E 3A2AA 1Y47A 1GK4A 3H1HE 1P84D 5KJ7D 5KJ7A 3CI9A 3SWKA 1L0LD 1RE4A 4NPFX 4ZMDA 2V4HA 4I2LC 5AVSB 2W27A 3RL0B 4I6MC 1X8YA 1BSHA 1SQVD 1FZCA 1UIIA 2QIWA 1S2EA 5TISE 1JY2O 3TYYA 2WMMA 1LTGC 2E5TA 1L0NG 3Q3DA 2ZT9B 5AW3B 3V5BA 3H1IG 1DEBA 2B9BA 2H89C 3CXHE 2H8PD 2XNXA 1GDTA 1SQQK 2K9YA 2HR3A 2K9JB 2FY8A 3H1JE 2R44A 1U7JA 4OGQB 1LTIC 1NAFA 1EC5A 5B5EE 2QJYC 3KZIH 1G2CA 2Q7CA 4U3FD 1RE3C 2PGDA 1BE3D 3CXHI 3Q1MA 4JQ0D 4ASWA 1JY2N 1KYOH 1YI2P 2KLUA 3L72J 5AW6B 2N9YB 3FWNA 4W7YA 5KTBA 2CK3H 1S9KE 1DIPA 2C0XA 3H1LE 1OX3A 1LWUA 4QMAA 4WWIA 2QA4P 1SQQJ 2KOGA 1EXIA 1SQXG 1X0TA 1L0NK 1OVUA 1NU1E 1FOSE 1JB0J 2YO2A 1PGJA 3V2NA 2P1JA 3RL0D 5APVA 3F89A 2J5UA 4R4MA 1GU5A 1M90Q 3UIAA 2IZ1A 3L37A 2O01N 1HWTC 1CI6A 3AEFC 2KNCB 1QVFO 5AVUB 3SWYA 2ZT9D 2Q1KA 2LXCB 1S4XA 4TLFA 1AQ5A 1JEKA 1RE3A 1L0NJ 4BRYB 1FE6A 4LGDE 3RBXA 1KN7A 2Y0DA 3L70J 3IR9A 2BCCD 3B8EB 1NO4A 3CC7P 2K9JA 5CCHD 5CCHA 2FFDB 5APTA 4OGQD 4IL6H 1VQPP 1SFCB 1URQB 4I7ZC 1AFOA 3R4YA 1ZW0A 4IOIH 1SQXK 3BASA 1BCCE 1N73B 2FYUD 3GLMA 3H1HG 1KZUB 1YQ4C 3O6QB 4W80A 3U1AA 1L0LE 2M3BA 4H13B 2ITAA 3HUSB 2OTJP 1PP9D 1OVRA 1R5LA 1MFTA 2IBZD 3L74J 1N73C 1IFJA 2W6AA 2Y0CA 4BXLA 3V4QA 1Q7YQ 1N7SB 1S1CX 1D7MA 1OFCX 4H13C 2I1JA 1Q86Q 5AVYB 4JYCA 3VYIA 3HUSC 1PV3A 2ZVNB 1HGZA 2QM8A 4OH8B 4ZKPA 4XA4A 1RF1C 3MIWA 4JBZA 4YTPC 2WSEJ 2M3EA 4D6TJ 1AJYA 3L73D 3NTNA 2HPCB 3ZDMA 5KKZC 2FXMA 1NTMD 1YITP 3H1JG 3L36A 1JNMA 1IFIA 3VMAA 3PJSK 2P58A 2WSSH 2YO3A 2KP8A 3LW5J 1LTJB 3WUVA 1X79B 1KB9D 3W67A 5EFWB 4PD4H 2W6BA 3P8MC 4U3FE
chains in the Genus database with same CATH topology
3CX5H 1SQBG 3H1JG 1BGYG 2IBZG 1NTZG 1PPJG 3H1IG 3H1KG 1SQPG 1SQXG 4U3FG 3H1HG 3L74G 1BCCG 3CWBG 1BE3G 5KLVG 1NTKG 3BCCG 2A06G 3L71G 3CXHH 1KB9H 3L75G 3H1LG 3L73G 1KYOH 1L0NG 4D6TG 1EZVG 3TGUG 1SQVG 1P84H 4PD4H 1PP9G 1SQQG 2BCCG 1NTMG 3L72G 1NU1G 2FYUG 3L70G 1L0LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 H;  1SQB G;  3H1J G;  1BGY G;  2IBZ G;  1NTZ G;  1PPJ G;  3H1I G;  3H1K G;  1SQP G;  1SQX G;  4U3F G;  3H1H G;  3L74 G;  1BCC G;  3CWB G;  1BE3 G;  5KLV G;  1NTK G;  3BCC G;  2A06 G;  3L71 G;  3CXH H;  1KB9 H;  3L75 G;  3H1L G;  3L73 G;  1KYO H;  1L0N G;  4D6T G;  1EZV G;  3TGU G;  1SQV G;  1P84 H;  4PD4 H;  1PP9 G;  1SQQ G;  2BCC G;  1NTM G;  3L72 G;  1NU1 G;  2FYU G;  3L70 G;  1L0L G; 
#chains in the Genus database with same CATH topology
 2V7Q J;  1MFZ A;  4BRY A;  1SQB D;  1VQ9 P;  1W2B O;  1DD3 A;  2ZXE B;  2JO1 A;  1QEX A;  3A7O A;  1J1E B;  2SPZ A;  3II6 A;  1VQK P;  2Z4E A;  5AVT B;  2OTL P;  2FFD A;  3H1L G;  2LR2 A;  1VDF A;  1J1D C;  1SFC D;  3KZI E;  5AW1 B;  1URQ D;  1URQ A;  4PD4 D;  3KXD A;  1UIX A;  4H0L B;  1Q90 D;  1Q2N A;  1ZXG A;  4GOD A;  3EQ2 A;  1KYO E;  1N73 A;  2A06 D;  3B71 A;  2AXC A;  1AV1 A;  3PRJ A;  1SLQ A;  2YMK A;  4RES B;  3CCM P;  3O6Q A;  2QG4 A;  1NU1 G;  3VMZ A;  1KIL E;  2QSI A;  2O01 H;  1L4A B;  2E5Y A;  3H1H J;  3HUS A;  1LGH B;  3CWB D;  4H0L C;  2YKP A;  2BEZ F;  1EDL A;  1KYO I;  2P2U A;  3L75 D;  1X22 A;  3RL0 g;  2Q9I A;  1N7S D;  4ZNC A;  1N7S A;  1Q81 Q;  3CCL P;  3Q5R A;  1NTK E;  1LTA C;  1DD4 A;  2R5B A;  3RK3 B;  3SFE C;  1QVG O;  2FKW B;  3FX0 A;  1FZC B;  4GKG A;  1NH4 A;  5C39 A;  3HRN A;  2E75 B;  3E1R A;  3CC4 P;  1CW5 A;  3GHG B;  1BGY J;  2WVR A;  1FDI A;  1M1J B;  5KLI B;  1HBW A;  1HUC A;  1SQP D;  4BWN A;  3OAK A;  1BSN A;  1IJD B;  5KLV D;  3L71 D;  3RK3 C;  3H1J J;  3D6Y A;  1G1I A;  2GUV A;  3QH9 A;  1BCC G;  1EZV E;  1M1J C;  5KAF H;  4Y28 J;  1ZOY C;  2FYU E;  1FZG A;  1NU1 K;  4ASV A;  5AW2 B;  3AEA C;  3M0A A;  2NPS C;  1L0L G;  3CX5 H;  3EFF K;  5APX A;  4XE5 B;  3P8C D;  4IL6 E;  3HD7 B;  3CCS P;  1PP9 E;  4H0L D;  4WY4 C;  1EZV I;  4WBA A;  2IBZ E;  2KYV A;  1NTZ E;  1P84 H;  4IL6 X;  4C46 A;  3AE6 C;  1RY3 A;  3B5N C;  1ZN5 A;  3CX5 D;  3T97 B;  1N7L A;  3TGU E;  1L4A D;  3HD7 C;  2PAJ A;  1L4A A;  1ZV8 A;  2C9N Y;  3GW6 A;  1ZRT D;  2QVA A;  1H0T A;  3H6P A;  1NAY A;  1NU1 J;  3CCJ P;  3AED C;  3I56 P;  3I55 P;  3QWO C;  2IBZ I;  3TNU B;  1NOH A;  2KB7 P;  3PP5 A;  2XKM A;  2R32 A;  1ZLL A;  1MUU A;  3VMY A;  3ABV C;  5CBO A;  3A0H H;  1FZF A;  2JDI H;  2WSF J;  2DW3 A;  5AW0 B;  1NKZ B;  3L72 D;  1WT6 A;  2E75 D;  4EYY Q;  4U3F G;  1CI6 B;  5BU5 A;  2IYO A;  3GHG A;  1M1J A;  5CHX A;  1L0L K;  3LID A;  5APW A;  1T2K D;  3WU2 H;  3H1K E;  1SQQ D;  1IFP A;  2QJY B;  1OMI A;  2NPS A;  1NVO A;  3MTU E;  3A3Y B;  1KIL C;  3MZW B;  5H2F E;  1IFM A;  2WPS A;  4RJT A;  1H88 A;  4PD4 E;  2ZAE B;  1U7M A;  2YKQ A;  2Q3I A;  4HB1 A;  1KV4 A;  3CPW O;  2AEM A;  1HH0 A;  3B5N A;  4AQR D;  1OWA A;  2J58 A;  4H44 D;  3HD7 A;  4B86 A;  3BRT B;  4PD4 I;  1H89 A;  2W83 C;  4DT0 A;  4DZO A;  3VTP C;  1DX7 A;  3HE5 B;  3M0D C;  1M57 D;  2P7J A;  1NTK G;  2POH A;  3S1K A;  1GU4 A;  4HKZ H;  5AW5 B;  2QEX P;  1FZE A;  3T97 A;  1FZB A;  1L0N D;  2D2C B;  2KI7 B;  4EOT A;  1S5L H;  3RK2 C;  3L70 D;  3CCE P;  3C9I A;  3KQG A;  2E74 C;  3HTK A;  5CCG C;  3TNU A;  1ZME C;  4N78 E;  3AE1 C;  5AW4 B;  4HJG H;  1JTH B;  1VL2 A;  3PTZ A;  2AEF A;  4DCK A;  2K88 A;  5KLV E;  2P67 A;  2D2C C;  2MJZ A;  3TSI A;  2WPQ A;  3V4W A;  2WTY A;  3U59 A;  5CBN A;  4CPG A;  3N7N A;  1EZV G;  2Z5I A;  3LIE A;  3G71 P;  2BAS A;  2FYU G;  3BCC E;  4U3F J;  1J2J B;  3AEC C;  1LP1 B;  4I7Z B;  3L74 D;  2WSE H;  4UB6 E;  1EDJ A;  2YIU C;  3FXD A;  3FGA D;  2B87 A;  1PP9 G;  3B4S A;  1Y8A A;  3H1I J;  1NTK K;  2IBZ G;  1NTZ G;  5KAF E;  1VQL P;  3WMM 0;  3GG2 A;  3LW5 H;  4RKU J;  3TGU G;  3CX5 E;  1OXZ A;  1PPJ E;  3CCQ P;  4D6T D;  3EWK A;  3M9Q A;  4DOJ A;  2E76 B;  3CCR P;  1KC8 Q;  1GL2 C;  5CCG A;  3GF3 A;  3HE5 A;  1P84 E;  3D70 A;  3L73 G;  1GZL A;  2JEE A;  3OJA B;  1LTT C;  2R5D A;  2NRG A;  3CX5 I;  1USD A;  4L73 A;  1NGM B;  3AEG C;  1RF1 B;  1NTK J;  3PLN A;  5AW9 B;  2OQQ A;  1SQV E;  1N2D C;  3L72 E;  2E76 C;  2FYU K;  3M06 A;  1P84 I;  5KKZ B;  4DJG A;  2LKM A;  2OYI C;  2L5G B;  5AVR B;  4PV1 C;  1WMK A;  2HOD B;  2RKL A;  1JTH A;  1N8R Q;  4OVN F;  1SQX J;  1JMB A;  1PGP A;  2W90 A;  3H1K G;  3A0H E;  1IK7 A;  2WIT A;  1A02 J;  1KB9 H;  2Y9Z A;  1E79 H;  3MP7 B;  5K5G B;  2YXQ B;  1LJ2 A;  3AE3 C;  1NTZ K;  1ZR2 A;  3CMA P;  5E79 H;  4JYB A;  3MUD C;  3BRV B;  1RQV A;  2YMY A;  2O1J A;  1DH3 A;  2A45 H;  1IO4 A;  2Y9Y A;  3H1H D;  2N1T C;  1J1D B;  3WU2 E;  2M8R A;  4KHX A;  2QJK C;  1LP1 A;  4C7R A;  4K35 A;  4O9B A;  1BE3 E;  1LT1 A;  3JSV C;  3TF5 A;  1KTM A;  4L74 A;  2JKV A;  1KFN A;  3P7K A;  1K04 A;  4IFF A;  1S72 P;  2QJP C;  1EQ7 A;  4RO0 A;  1AA0 A;  1QL2 A;  4YXD C;  1HGV A;  3E7K A;  1G1J A;  1NTZ J;  1MV8 A;  1BGY D;  3V2Q A;  5B5E H;  2QM7 A;  3CCV P;  3VP9 A;  4EI2 A;  3S9O A;  1IFD A;  2Y0E A;  3L70 E;  3TGU J;  2OYH C;  3A5T A;  1FOS F;  4N6J A;  2OYI A;  3H1J D;  2KK7 A;  3M9B A;  2KXP B;  4H13 D;  2WSC H;  1GD2 E;  1H0T B;  2UWJ E;  4YXW H;  1S3J A;  5KLV G;  3I5C A;  1YTZ I;  4GOF A;  1RF1 A;  4EIJ A;  2CPS A;  4UB8 H;  1S5L E;  5BVZ A;  4M3L A;  4K3A A;  2IFN A;  3V6I A;  2XV5 A;  5DJU B;  3MUD A;  2PRR A;  2OTK E;  5CJ0 A;  4OWF A;  1S5L X;  3BCC G;  1S9K D;  3M91 A;  2HOD A;  3N4X A;  3A0B H;  3JC2 2;  3EFG A;  1JCD A;  1MZ9 A;  3IAO A;  3L74 E;  5L8R J;  2J59 M;  3O8Z A;  1FAV A;  2E43 A;  2Q3E A;  3H1K J;  2BCC E;  1CSB A;  4YPC A;  1NKN A;  2NPS B;  5KJ7 C;  2FYZ A;  1RE4 C;  2FXP A;  1NU1 D;  1YYC A;  3JCU H;  2HFE D;  2WPV B;  1PPJ G;  3BVH A;  4WY4 B;  4D6T E;  3S4R A;  2G8Y A;  2GUS A;  1HVV A;  4NPE A;  3P32 A;  3B5N B;  2OYH A;  1M8O B;  5GTH H;  5KLV K;  5B66 H;  3SFD C;  1SS1 A;  4GOE A;  2JWD A;  1Q82 Q;  3H1L J;  1PGQ A;  4TT3 H;  1FU1 A;  1YQ3 C;  1T6A A;  2KUB A;  2W6J H;  2KZI A;  1FDM A;  3VOP A;  1SQV G;  2QE7 H;  3HE4 B;  3L72 G;  2FYN B;  2RMZ A;  1K8A Q;  1KFM A;  3ITK A;  1FBM A;  2KS1 B;  2FXO A;  3MD0 A;  2K3R A;  1KOR A;  3K5B A;  1XTG B;  4C7N B;  2ZJS E;  3HTK B;  1K05 A;  3C8V A;  1LTS C;  3G9R A;  2FYN C;  2VRS A;  3L73 E;  3L4F A;  3AEB C;  4Z1M H;  2HG5 D;  1YIJ P;  3USS A;  4LLH A;  1NTM E;  2N9B A;  3H25 A;  1YJ9 P;  3Q5S A;  1N86 A;  5AVV B;  5AW8 B;  3RK3 D;  2R3C A;  1KIL B;  1VQ6 P;  1NWQ A;  3TDK A;  1LWU C;  3CD6 P;  3BCC J;  1KB9 E;  2H7H A;  1BE3 G;  4Y99 C;  1YHQ P;  2ZYG A;  2H88 C;  3C1L A;  5E79 E;  1LT9 B;  2IPP A;  1SQB E;  1BDC A;  3AE7 C;  3G3Z A;  2Q6Q A;  2NPS D;  3U1C A;  5GTI H;  1USE A;  1VPC A;  2B87 B;  2Q5U A;  1KB9 I;  1T8Z A;  1SQV K;  1T3U A;  4WY4 D;  1BGY E;  4WY4 A;  4AUW A;  3RL0 C;  2W8Z A;  3L70 G;  1LT9 C;  1VQ8 P;  4EDF A;  2AXT H;  3M9H A;  2A06 E;  2R3S A;  1IK9 A;  3B5N D;  1BCC J;  2A45 I;  1Z56 A;  1JY3 P;  2OAR A;  1JO5 A;  2M0B A;  1RHZ B;  3OA7 A;  1GW4 A;  3HD7 D;  4WB4 A;  3GF7 A;  3RK2 B;  2QRX A;  4JF7 A;  1L0L J;  3CWB E;  2E74 B;  2ZT9 C;  1LTB C;  1RF0 C;  2KZJ A;  2ZYD A;  2WZ7 A;  3L75 E;  5APU A;  1KD1 Q;  3HE4 A;  1JCC A;  3SSU A;  3NFQ A;  1SQV J;  1AVO A;  1M1K Q;  2HYN A;  1FJK A;  5CCH C;  2KS1 A;  5AVW B;  1EDI A;  2IFM A;  3PHL A;  4OGQ C;  4C7N A;  2H43 A;  2PP6 A;  3FWL A;  3H1I D;  3L74 G;  1A02 F;  3VMX A;  2IX7 C;  4UB8 E;  2Z5H A;  2ZXX A;  1QX8 A;  2BCC G;  1KYO D;  5CJ4 A;  1SQP E;  1YBK A;  5CMZ A;  1KQS O;  3IFM A;  1VQ7 P;  3L71 E;  2GA1 A;  2YIU B;  1VF5 B;  2IDB A;  3A0B E;  1KIL D;  1KIL A;  3VN0 A;  2IYP A;  2MKV A;  4N3Y B;  4D6T G;  5APY A;  1Y9B A;  1PL5 A;  1YJW P;  3D6Z A;  1LT9 A;  4WVZ A;  1BE3 J;  2PFX A;  2K37 A;  2NZ2 A;  2ZVO B;  4LC1 A;  1IC2 A;  1NTK D;  1GK6 A;  4XFJ A;  1VF5 C;  3IF4 A;  1ZR4 A;  3P8C E;  1FZA A;  1M7L A;  3JCU E;  1OW6 A;  3AE8 C;  2JWA A;  4A7P A;  1QL1 A;  1W2E A;  3WUU A;  1JY2 P;  1JOC A;  1GL2 B;  2M5A B;  1RF0 A;  1WRG A;  1SQX D;  3NMD A;  5AVQ B;  1KQG B;  3M0D A;  2RN0 A;  3CLQ A;  1VQ4 P;  5GTH E;  5B66 E;  1W5C E;  2V7Q H;  2KSJ A;  3RK2 D;  1ZRT E;  4R4L A;  3AE5 C;  2OGU A;  2JR8 A;  2E74 D;  3RBZ A;  5CCG D;  2OYI B;  4PV1 B;  2FBW C;  1SVF A;  5AVZ B;  1EZV D;  1NTM G;  2AEJ A;  1VQO P;  1H8A A;  4HH2 A;  1VQN P;  1SP4 A;  2D2C D;  2FFD C;  5KAI H;  1JUN A;  3RK3 E;  3BAT A;  2RH0 A;  1M56 D;  3E1I A;  1HF9 A;  3TK1 A;  4IFD K;  2CPB A;  2LXB A;  2O1K A;  2C0W A;  1SFC C;  3KDP B;  2XU6 A;  5TJH A;  1URQ C;  4U7J A;  3OW2 O;  4PJ0 H;  1SQB G;  2N1T B;  1NTZ D;  1GTW A;  1JMM A;  3H32 B;  4AYC A;  1BDD A;  3CCU P;  2A45 G;  1SQQ E;  2P10 A;  2QJK B;  1PZQ A;  2BCC J;  1VF5 D;  1DEE G;  1OVV A;  3TGU D;  1EDK A;  1BGY G;  1YJN P;  2ZFC A;  4MN4 C;  1EXJ A;  2XDJ A;  2I1K A;  1KQL A;  2QJP B;  5TIS H;  2A06 G;  1XTC C;  2XND H;  3VP8 A;  4KT0 J;  1N7S C;  2YKO A;  2FYU J;  4JPZ B;  5GTI E;  3R2P A;  3AE4 C;  3CWB G;  4L76 A;  3MHV A;  2KNC A;  4ZKU A;  2OYH B;  3CXH H;  2XZR A;  3L75 G;  1NTM K;  5H2F H;  1GL2 D;  1GL2 A;  2M5A A;  1PP9 J;  1TU3 F;  2AXT E;  1VQ5 P;  2B89 A;  1HJ0 A;  1GMJ A;  2B88 A;  2G3A A;  1E5W A;  5APQ A;  3H1K D;  1JM0 A;  1L0N E;  1FJP A;  1OW8 A;  1RH5 B;  2IZ0 A;  3SWF A;  2GM4 A;  1SQB K;  4GIF A;  2E76 D;  3CXH D;  1LTJ C;  3H1I E;  1SFC A;  1AQT A;  2WWW A;  4PV1 D;  3CC2 P;  2ZYA A;  3MGN A;  1IFN A;  1NHL A;  1SQP G;  2WT7 B;  3L71 G;  3Q5P A;  3L73 J;  3PH0 A;  1J1E C;  4NPD A;  3AE2 C;  1NTM J;  1QGK B;  1YTZ T;  3F5H A;  1K9M Q;  3WUT A;  5APS A;  2WQY C;  2KIK A;  2K1A A;  1PFI A;  2N1T D;  1R8E A;  2N1T A;  1T3J A;  3H1L D;  2YNY A;  1FC2 C;  3CL3 D;  3H32 A;  3V2R A;  1SQB J;  3KPE A;  1FS0 E;  2BEQ D;  1QLE D;  1PIX A;  1X9V A;  2KLV A;  2KSE A;  1L2P A;  2L91 A;  4W7Z A;  1L4A C;  2OYO A;  4IFM A;  2O3J A;  2WSF H;  1R5S A;  1SQX E;  4N78 D;  1U57 A;  1CZQ A;  3G6E P;  3KHU A;  1OIP A;  1OW7 A;  2HPC A;  1LNQ A;  1JY3 O;  1GW3 A;  2YXR B;  4GT1 A;  4UB6 H;  1FZC C;  3FXE A;  1LTJ A;  1PGO A;  2E75 C;  1SQP K;  5M1B A;  1AVY A;  5BU8 B;  3CWB J;  3GHG C;  1HJB A;  2C9L Y;  5KLI C;  1RQU A;  2JP3 A;  3L75 J;  3BCC D;  5AW7 B;  3G4S P;  1T2K C;  1HTL C;  3RGU A;  3D71 A;  1NJI Q;  3KYQ A;  4L75 A;  3AE9 C;  3CME P;  1G2C B;  2O01 J;  4H44 B;  2WSC J;  3IN6 A;  2E42 A;  1IZN B;  1KMI Z;  5DJT B;  1OZH A;  4KJM A;  3Q2Y A;  1MKM A;  3L35 A;  2WPR A;  4HYT B;  2HLO A;  2WT7 A;  5AVX B;  1SQQ G;  1JY3 N;  1NYH A;  1LWU B;  3AEE C;  5KAI E;  1SQP J;  1KQF B;  2JJL A;  4I1L A;  4Y99 B;  1PPJ D;  3V2P A;  3W68 A;  1FDO A;  4GDO A;  5KLV J;  3L71 J;  1ZP0 C;  3NXS A;  2I8D A;  1BCC D;  3GMA A;  4H44 C;  1VQM P;  1K73 Q;  4PJ0 E;  3A2A A;  1Y47 A;  1GK4 A;  3H1H E;  1P84 D;  5KJ7 D;  5KJ7 A;  3CI9 A;  3SWK A;  1L0L D;  1RE4 A;  4NPF X;  4ZMD A;  2V4H A;  4I2L C;  5AVS B;  2W27 A;  3RL0 B;  4I6M C;  1X8Y A;  1BSH A;  1SQV D;  1FZC A;  1UII A;  2QIW A;  1S2E A;  5TIS E;  1JY2 O;  3TYY A;  2WMM A;  1LTG C;  2E5T A;  1L0N G;  3Q3D A;  2ZT9 B;  5AW3 B;  3V5B A;  3H1I G;  1DEB A;  2B9B A;  2H89 C;  3CXH E;  2H8P D;  2XNX A;  1GDT A;  1SQQ K;  2K9Y A;  2HR3 A;  2K9J B;  2FY8 A;  3H1J E;  2R44 A;  1U7J A;  4OGQ B;  1LTI C;  1NAF A;  1EC5 A;  5B5E E;  2QJY C;  3KZI H;  1G2C A;  2Q7C A;  4U3F D;  1RE3 C;  2PGD A;  1BE3 D;  3CXH I;  3Q1M A;  4JQ0 D;  4ASW A;  1JY2 N;  1KYO H;  1YI2 P;  2KLU A;  3L72 J;  5AW6 B;  2N9Y B;  3FWN A;  4W7Y A;  5KTB A;  2CK3 H;  1S9K E;  1DIP A;  2C0X A;  3H1L E;  1OX3 A;  1LWU A;  4QMA A;  4WWI A;  2QA4 P;  1SQQ J;  2KOG A;  1EXI A;  1SQX G;  1X0T A;  1L0N K;  1OVU A;  1NU1 E;  1FOS E;  1JB0 J;  2YO2 A;  1PGJ A;  3V2N A;  2P1J A;  3RL0 D;  5APV A;  3F89 A;  2J5U A;  4R4M A;  1GU5 A;  1M90 Q;  3UIA A;  2IZ1 A;  3L37 A;  2O01 N;  1HWT C;  1CI6 A;  3AEF C;  2KNC B;  1QVF O;  5AVU B;  3SWY A;  2ZT9 D;  2Q1K A;  2LXC B;  1S4X A;  4TLF A;  1AQ5 A;  1JEK A;  1RE3 A;  1L0N J;  4BRY B;  1FE6 A;  4LGD E;  3RBX A;  1KN7 A;  2Y0D A;  3L70 J;  3IR9 A;  2BCC D;  3B8E B;  1NO4 A;  3CC7 P;  2K9J A;  5CCH D;  5CCH A;  2FFD B;  5APT A;  4OGQ D;  4IL6 H;  1VQP P;  1SFC B;  1URQ B;  4I7Z C;  1AFO A;  3R4Y A;  1ZW0 A;  4IOI H;  1SQX K;  3BAS A;  1BCC E;  1N73 B;  2FYU D;  3GLM A;  3H1H G;  1KZU B;  1YQ4 C;  3O6Q B;  4W80 A;  3U1A A;  1L0L E;  2M3B A;  4H13 B;  2ITA A;  3HUS B;  2OTJ P;  1PP9 D;  1OVR A;  1R5L A;  1MFT A;  2IBZ D;  3L74 J;  1N73 C;  1IFJ A;  2W6A A;  2Y0C A;  4BXL A;  3V4Q A;  1Q7Y Q;  1N7S B;  1S1C X;  1D7M A;  1OFC X;  4H13 C;  2I1J A;  1Q86 Q;  5AVY B;  4JYC A;  3VYI A;  3HUS C;  1PV3 A;  2ZVN B;  1HGZ A;  2QM8 A;  4OH8 B;  4ZKP A;  4XA4 A;  1RF1 C;  3MIW A;  4JBZ A;  4YTP C;  2WSE J;  2M3E A;  4D6T J;  1AJY A;  3L73 D;  3NTN A;  2HPC B;  3ZDM A;  5KKZ C;  2FXM A;  1NTM D;  1YIT P;  3H1J G;  3L36 A;  1JNM A;  1IFI A;  3VMA A;  3PJS K;  2P58 A;  2WSS H;  2YO3 A;  2KP8 A;  3LW5 J;  1LTJ B;  3WUV A;  1X79 B;  1KB9 D;  3W67 A;  5EFW B;  4PD4 H;  2W6B A;  3P8M C;  4U3F E; 
#chains in the Genus database with same CATH homology
 3CX5 H;  1SQB G;  3H1J G;  1BGY G;  2IBZ G;  1NTZ G;  1PPJ G;  3H1I G;  3H1K G;  1SQP G;  1SQX G;  4U3F G;  3H1H G;  3L74 G;  1BCC G;  3CWB G;  1BE3 G;  5KLV G;  1NTK G;  3BCC G;  2A06 G;  3L71 G;  3CXH H;  1KB9 H;  3L75 G;  3H1L G;  3L73 G;  1KYO H;  1L0N G;  4D6T G;  1EZV G;  3TGU G;  1SQV G;  1P84 H;  4PD4 H;  1PP9 G;  1SQQ G;  2BCC G;  1NTM G;  3L72 G;  1NU1 G;  2FYU G;  3L70 G;  1L0L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...