1CSBA

Crystal structure of cathepsin b inhibited with ca030 at 2.1 angstroms resolution: a basis for the design of specific epoxysuccinyl inhibitors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATHEPSIN B light chain
publication title Crystal structure of cathepsin B inhibited with CA030 at 2.0-A resolution: A basis for the design of specific epoxysuccinyl inhibitors.
pubmed doi rcsb
total genus 11
structure length 47
sequence length 47
chains with identical sequence D
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1994-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1csbA01
3TYYA 2XU6A 1HJBA 4AYCA 3M9HA 4JYCA 3M9BA 3TNUB 1H88A 1GK4A 3KDPB 1KQLA 2BASA 4LC1A 1GD2E 2H7HA 5AVXB 3NXSA 2Z5HA 2E43A 3L36A 1OXZA 5AW9B 2Q3IA 2VRSA 1SP4A 5AVRB 1H8AA 5AW5B 3P8MC 5AVTB 3HTKA 2P2UA 3T97A 1IO4A 3L37A 2WT7A 2IPPA 2ZFCA 3TK1A 5AW0B 1NAFA 3MGNA 3M0DA 4JYBA 5CMZA 3LIDA 3V4QA 4B86A 5AVWB 2Z5IA 4I6MC 5AW4B 1FAVA 5APXA 3OAKA 1NWQA 1HUCA 3IR9A 4GT1A 4GKGA 5APTA 3O8ZA 5AVVB 4M3LA 3VN0A 2WT7B 4EOTA 1H89A 2YO3A 1MUUA 3P32A 4RESB 4DZOA 5APVA 3NTNA 5AW2B 5AVSB 3A5TA 3V5BA 2QM7A 3M06A 3V4WA 5AW8B 3B8EB 3A3YB 2XV5A 2WTYA 4C46A 1MV8A 3VMZA 3VYIA 1GZLA 3VMYA 5APQA 3I5CA 2WWWA 3MD0A 2YO2A 3LIEA 5AVUB 2KP8A 3NFQA 1X8YA 5AW3B 2R5BA 3HE4B 2WPRA 2W27A 1HWTC 1OWAA 1S9KE 4C7NA 5APYA 1DH3A 1CI6A 3KQGA 2N9BA 1GK6A 1CSBA 2R5DA 1J2JB 1HBWA 5APSA 5AW6B 1FOSF 3HE4A 5AVZB 3M91A 1GU5A 3SWFA 1T2KD 3A2AA 1FOSE 1CZQA 1JUNA 2P7JA 4C7NB 4KHXA 3M0AA 3VTPC 2XZRA 2C9NY 1CI6B 1G2CB 1GU4A 3NMDA 4HYTB 1A02J 4I2LC 2WPSA 1GTWA 3HE5A 2R3CA 4AUWA 2Q5UA 4AQRD 4XE5B 1YYCA 2R32A 2QM8A 5AW1B 2W6AA 5APUA 3VMXA 1JNMA 2E42A 5AW7B 1A02F 3A7OA 2ZXEB 2JJLA 2YNYA 5AVQB 1SLQA 2P67A 3UIAA 3L35A 2WPQA 3TNUA 3HE5B 1MFZA 3P7KA 2Q7CA 5AVYB 5APWA 2C9LY 1T2KC 1S9KD
chains in the Genus database with same CATH superfamily
1NVOA 3L75G 1L0LE 4AYCA 1L0LK 4RO0A 3VP9A 1VQOP 3ZDMA 1LTGC 4HKZH 1M1JC 2O3JA 1BE3E 2ZJSE 3L75E 1Q86Q 1EXIA 1PPJD 3KZIH 1S5LE 1KQFB 1QX8A 2P1JA 2QJYB 3H1IE 4H13D 2Z4EA 1KV4A 3L75D 4D6TE 3IF4A 1FAVA 2POHA 1Q82Q 3D70A 3H1ID 4ASWA 1ZRTE 3M06A 4I1LA 2OTJP 3WUTA 1HH0A 1S3JA 1G1IA 1R5LA 1ZRTD 2WWWA 2L5GB 5KJ7C 2HPCA 4BWNA 3MUDC 3HUSA 3BCCG 1AFOA 3BVHA 3CC4P 1N7SB 2XZRA 3H1LJ 1NU1J 1USDA 2WPSA 4A7PA 2BEZF 3VP8A 1SFCD 3V6IA 3RK3D 2E76D 1TU3F 5AW7B 3BCCD 1RQVA 1WRGA 1VF5D 1MFZA 4H0LD 1AVYA 2QG4A 3HUSC 2FYUJ 1SQQJ 3OA7A 3GHGB 1VQ5P 1OMIA 4JYCA 2GM4A 2BASA 1JOCA 2A45I 1L0LJ 2FY8A 5CCGA 1MFTA 5AW5B 1Y9BA 1EC5A 1ZN5A 1BE3J 2IZ1A 1PGQA 1UIXA 2IBZE 4B86A 5AVWB 3H1KG 3JCUE 1VQ7P 1NJIQ 2AXTE 1U57A 3AE8C 2HLOA 4D6TJ 3A5TA 2IBZD 1KQSO 3CWBJ 2OGUA 5KLVE 2KLUA 1E79H 1IFJA 4KJMA 5B5EH 5KLVK 1M1KQ 3L72J 5CCGC 1KB9E 2FBWC 1JMMA 2M3EA 2Y0EA 3RBZA 3A0BE 1FZCB 1KB9D 3AE2C 1JUNA 1GMJA 4DJGA 3CCSP 4PV1B 1RY3A 3HE5A 1VQNP 1AA0A 2K3RA 1NTKE 3AE6C 1IFNA 4NPEA 4OGQB 2K9YA 4W7ZA 1JCCA 5KLIC 4W80A 2H8PD 2W6BA 4JBZA 1EZVE 1X0TA 1YI2P 2QJPB 4NPFX 1OXZA 2WPVB 1XTGB 4IL6X 3L70E 3HTKA 2KSJA 4U3FE 3FGAD 1W2BO 1VQPP 3E7KA 3WU2E 1FZGA 2K9JA 4IFDK 4WY4A 2WMMA 1RF1B 1LGHB 3CCUP 5KAFE 3B4SA 3L74E 1LNQA 1S4XA 5KLVJ 3GW6A 2KXPB 1SQVK 2LXBA 4K35A 4EIJA 5AVZB 3L74D 1GU5A 1FE6A 2E75B 3B71A 3MZWB 4WY4C 3VTPC 1JY3P 2FKWB 1GU4A 2H43A 1A02J 2ZXXA 4OH8B 2D2CC 5TJHA 2M3BA 2QM8A 5KTBA 3F5HA 1M56D 3H6PA 1KORA 2YNYA 1NTMK 1NAYA 3P7KA 1NTZE 1L0NG 1KQGB 3LW5J 2BCCE 1NTKJ 1LTJA 3WUVA 2Q1KA 1Q90D 4GIFA 3M9HA 3GMAA 4GOEA 2H7HA 1NTZD 2V7QJ 1OW7A 1LT1A 1KFMA 3CCVP 3K5BA 1YQ4C 3PP5A 5CCGD 2FYNB 1SQXG 1LWUB 4H13B 3L70J 2E74C 3AE9C 1LTJC 1FJPA 4U3FJ 4UB8H 2Q3EA 2QM7A 1J1EB 1JY2P 2QEXP 1KMIZ 2M5AA 2WTYA 1MV8A 3VMZA 3HRNA 3I5CA 4I7ZB 2MJZA 1YTZT 1JTHA 2ZT9D 1BSHA 2OYIB 2YMKA 1OWAA 2N9BA 4L75A 3S1KA 3P8CE 1FOSE 1SQVJ 2K1AA 1N73A 1BCCE 1URQA 3IAOA 1JO5A 2N1TA 2ZYDA 3II6A 1M7LA 1FDIA 4ZKPA 1SFCB 2RMZA 2SPZA 3RK3B 1X79B 3L35A 2E76B 3U1AA 1VF5B 2QJKB 1NTMJ 1FZEA 4H0LB 5GTIH 3SFDC 3PJSK 1N73C 3L36A 1LJ2A 1URQC 2R44A 5KAIE 3RL0C 2N1TC 4IL6H 1FC2C 2WT7A 3SWYA 3CLQA 3Q5PA 4PJ0E 3USSA 1H0TB 1S5LX 5CCHA 3D71A 1RHZB 1LTIC 1FZFA 2G8YA 1PP9E 2KLVA 2HODB 4WY4D 3V2NA 3E1IA 3GF7A 4U7JA 2IYOA 2O1KA 1ZR2A 1VQ6P 3RK2C 2D2CD 4Z1MH 1IJDB 4WWIA 5B66E 4JQ0D 1KYOD 1MZ9A 3PLNA 3TF5A 3KQGA 3L4FA 5CCHC 2RN0A 4KHXA 3AE5C 5GTHE 4EDFA 1NU1G 1NKNA 4XE5B 2JWAA 3I55P 1P84I 2E42A 2ZAEB 1AV1A 3H1LE 2G3AA 2P67A 1HGVA 2QIWA 4GODA 1BCCJ 2KB7P 1LP1B 2KNCA 1K9MQ 1FBMA 1M1JA 1HJBA 3H1LD 1NU1D 1VQKP 4CPGA 2FYUG 1SQQG 3AE1C 1BGYE 1QL2A 1AQTA 3EQ2A 1NYHA 3L71J 2E43A 3CI9A 5AVRB 2NPSC 1K04A 1SQBE 1RH5B 2WVRA 1L0LG 1SQBK 1IC2A 5CMZA 2YXQB 1EXJA 5AW4B 2Z5IA 4I6MC 1BE3G 2B89A 2FYUD 1JB0J 5KKZC 1SQQD 2KOGA 3V2PA 3D6ZA 3O8ZA 2J5UA 1KYOH 4L76A 3NTNA 3H1IG 1J1DC 4D6TG 1L0LD 2OARA 4ZNCA 2W83C 3FWNA 5KJ7A 1KILE 1RE3A 3VYIA 1BE3D 3MD0A 1OZHA 1JEKA 1PP9J 3CWBE 3MUDA 1LTTC 2A06E 2B88A 1G2CA 3RL0g 3L72E 4D6TD 4OVNF 3TDKA 4IFFA 2JR8A 3CWBD 2AXCA 3TGUJ 2HPCB 1CZQA 1IZNB 1ZW0A 3L72D 3HUSB 1NHLA 1RE3C 1VQMP 1URQD 4XA4A 1SLQA 2N1TD 2ZVNB 2W6JH 2C9LY 3CC7P 3KXDA 4DCKA 4EYYQ 5DJUB 1X9VA 2KIKA 2XNXA 4LC1A 5TISE 2IDBA 3AEBC 3G6EP 1AQ5A 3U59A 3H32A 3CX5I 3VMAA 1BGYJ 3RK2D 1DIPA 4L74A 1K73Q 3M9QA 1SQBJ 2ZVOB 1S5LH 2YO3A 3P32A 5CCHD 1FS0E 2I1KA 2CPSA 1OVRA 2IBZG 1IFMA 2J58A 1GZLA 2Q6QA 2W8ZA 1T6AA 2QE7H 2WSCJ 2GUVA 5AW3B 4GDOA 2IYPA 2W27A 3S9OA 2ZT9B 1GK6A 5KLVG 2FFDA 2DW3A 2YXRB 1KZUB 4LGDE 1JY3N 5KLIB 1RQUA 2KK7A 4PD4I 1YYCA 3VMXA 5KLVD 2KS1A 3O6QA 4YXWH 2RH0A 1W5CE 2PGDA 4HJGH 3HE5B 2Q7CA 2B87A 1U7JA 4R4MA 2IZ0A 2FFDC 1P84E 2FXMA 1ZP0C 1NTKG 3JSVC 1R5SA 1KQLA 2Y9YA 3SWKA 1NO4A 1P84D 1WT6A 1EDIA 3A0HE 2YKOA 2K88A 1YQ3C 4JYBA 1NTKD 2YIUC 1JCDA 1EZVG 3HTKB 3IR9A 3KHUA 3L70G 3G71P 1JY2N 2I1JA 1QVFO 3V4WA 4U3FG 3HD7A 3L73E 2JP3A 2NRGA 3VOPA 2K9JB 1EZVD 3JCUH 2V4HA 5KJ7D 3Q5RA 4WY4B 2AXTH 3L70D 1XTCC 1S9KE 3CL3D 2D2CB 3AEAC 4U3FD 4QMAA 2OYHA 3PHLA 2PFXA 1KB9H 2QVAA 3L74G 2C9NY 3HD7C 5E79E 1SQVG 4HH2A 2YKPA 3A0BH 1S72P 2J59M 1SQVE 3WMM0 2WPQA 2JO1A 3B5NC 1JY3O 3FX0A 5APWA 3H1KJ 1LT9A 3AE7C 3AEEC 3TYYA 1SQVD 1YBKA 2OYHC 4JF7A 1IFIA 3EFFK 1T3JA 4UB6E 1NTZG 1LTJB 3R2PA 4KT0J 2BCCG 1S2EA 1NTME 1SP4A 2V7QH 1IK9A 4YTPC 2P2UA 3SFEC 3G4SP 1OX3A 3AEDC 4GOFA 1NTMD 5APXA 4C7RA 1YHQP 3CX5E 1LT9C 2LR2A 3H1HE 5APTA 2BCCD 2NZ2A 3IFMA 4N6JA 2A45G 1DEEG 1K05A 5AW8B 3CX5D 4WB4A 3QWOC 3WU2H 1L0NK 5AVUB 3AE3C 3L73J 1X8YA 1OFCX 2B9BA 2GUSA 2M5AB 1HWTC 2QA4P 1JY2O 1VL2A 1LTAC 1CSBA 2R5DA 2E75C 1VPCA 1HBWA 2P58A 1JTHB 4JPZB 5KAFH 5C39A 1JMBA 2JEEA 3CCQP 1K8AQ 2WQYC 4AUWA 2R3CA 3F89A 1KILA 2WSEJ 1SQXK 2R32A 3C8VA 3S4RA 5AVQB 1PGJA 1N73B 4PD4E 1URQB 1BCCG 2N1TB 1T2KC 2FXOA 2IFNA 2ZYGA 1ZOYC 3SSUA 2PRRA 4PD4D 1EQ7A 3P8CD 4H44C 2Z5HA 5CHXA 2XKMA 3Q3DA 3CD6P 1KILC 3P8MC 1IO4A 1BCCD 3Q1MA 2IPPA 3EFGA 4H13C 1NAFA 4BRYA 3L71E 1VQ4P 1NWQA 3RK2B 1T8ZA 3ITKA 1RF0A 5AVVB 2WT7B 1MUUA 3CXHE 3H1JE 3L71D 4TT3H 3CCLP 2A45H 3H1HJ 3HD7D 1Y47A 2KP8A 3CMEP 1SQPE 2Y0DA 1M57D 1Z56A 1SQPK 3MTUE 2KI7B 1PP9G 4C7NA 1CI6A 1L0NJ 3BASA 2XDJA 1QLED 1HGZA 4Y99B 1RF0C 2C0XA 3AECC 1KTMA 1L4AA 2O01H 1PGPA 2P7JA 3JC22 4Y28J 5H2FE 5DJTB 2Y9ZA 1PP9D 1ZLLA 3TGUE 3A7OA 1PFIA 3TNUA 3KZIE 1SQXJ 1AVOA 3TGUD 1DD3A 1IK7A 1IFDA 1PZQA 4N78E 1L4AC 1QVGO 1PIXA 1Q7YQ 3M9BA 2NPSA 3H1LG 2WSFH 3GF3A 4DOJA 5KKZB 2KNCB 5AW9B 1M1JB 3EWKA 1UIIA 1YJ9P 1H8AA 1VQ8P 1HF9A 3T97A 1J1DB 3L37A 1GW4A 1FJKA 2ZFCA 1U7MA 4O9BA 3V4QA 1BGYG 2OTLP 2E74D 1HUCA 2ITAA 1ZR4A 1SQBG 5APVA 5KAIH 1KD1Q 4PJ0H 2E5TA 1BGYD 3H1JJ 2MKVA 1OVVA 4DT0A 2KYVA 4L73A 1SQBD 2OTKE 1GL2A 2LKMA 2FYUK 1SQQK 5APSA 2HG5D 1SQPJ 2JDIH 1FOSF 1T2KD 1PPJE 3CWBG 4ZKUA 3CPWO 5B66H 1G2CB 2A06G 1S1CX 1OVUA 3L72G 1M90Q 4H44D 5APUA 3OJAB 4ZMDA 1HJ0A 1KILD 3BRVB 3G9RA 4XFJA 2YMYA 1GL2C 5GTHH 4R4LA 1N8RQ 3Q2YA 2A06D 3FXDA 1GK4A 1GD2E 1DEBA 2Q3IA 3RL0D 2OYOA 1BSNA 1FDMA 4WBAA 3LIDA 2QSIA 5B5EE 2Q9IA 3IN6A 4IOIH 3OW2O 3H32B 4GT1A 4GKGA 1X22A 2QJYC 3V5BA 3GG2A 3MIWA 3RK3E 4RJTA 4K3AA 3A3YB 1RE4A 1QGKB 3BCCE 2YKQA 1G1JA 3N4XA 3CC2P 2R5BA 1GW3A 1VDFA 1N7SA 1DH3A 1R8EA 2WSCH 3GLMA 3RBXA 1HVVA 1ZV8A 1KC8Q 2IX7C 5CJ4A 1L4AD 1EDJA 4HYTB 2FFDB 1RE4C 1KN7A 1E5WA 2W90A 3GHGA 3UIAA 1JM0A 3PH0A 2KZIA 1N7SC 3CCRP 3L75J 5BU5A 1NH4A 2KS1B 3O6QB 2HFED 2AEJA 2KUBA 3H1IJ 2YIUB 4TLFA 2B87B 3H1KE 2NPSD 2VRSA 1Q81Q 5AVTB 4RKUJ 2K37A 2JWDA 3TK1A 1PV3A 3GHGC 3H1KD 5M1BA 5TISH 2FXPA 3D6YA 3PRJA 4M3LA 4RESB 2OQQA 1OIPA 3G3ZA 2RKLA 3VMYA 3CXHI 1FZCA 3AE4C 3NFQA 3RGUA 4OWFA 2ZT9C 3H25A 3HD7B 3BCCJ 3L73G 1NTKK 5CJ0A 1L2PA 2AEFA 1GL2D 3M91A 4N3YB 1AJYA 4YPCA 1NOHA 3B5NB 1FU1A 3CCJP 1SVFA 1YTZI 1GTWA 1W2EA 1YJNP 1N7LA 2OYHB 3L73D 5EFWB 5AW1B 2W6AA 1FZCC 1JNMA 3B5NA 2KZJA 3MP7B 2ZXEB 2JJLA 1EDKA 1FZAA 2WITA 5AVYB 4PV1C 3CMAP 2XNDH 1S9KD 5K5GB 1ZXGA 1KYOI 2O1JA 1OW8A 1PL5A 1Y8AA 4OGQC 1CW5A 1LT9B 3PTZA 1N86A 1IFPA 4UB8E 1P84H 2GA1A 3BATA 5BVZA 3LW5H 1FZBA 1NTMG 2QJPC 1RF1A 1BDDA 4EOTA 2E74B 1KFNA 3A0HH 2WZ7A 4LLHA 2BEQD 2XV5A 4ASVA 3U1CA 2I8DA 1N2DC 3H1HG 3LIEA 3KPEA 4MN4C 5APYA 5L8RJ 3BRTB 1J2JB 1N7SD 5AW6B 1LTSC 1MKMA 1RF1C 4YXDC 1Q2NA 1NTZK 3A2AA 3TSIA 2HYNA 4BXLA 3H1HD 2UWJE 1L0NE 3NMDA 2JKVA 1YIJP 2ZYAA 4AQRD 1YJWP 2M8RA 1A02F 2WSEH 5GTIE 1L0ND 3E1RA 4H44B 1KILB 5E79H 2E5YA 2CPBA 4IL6E 2FYZA 1H88A 1PGOA 1SQXE 3WUUA 1LWUA 5BU8B 1SQXD 5AW0B 3MGNA 3RL0B 5CBNA 2H88C 1BDCA 4UB6H 1H89A 5AW2B 5AVSB 1FDOA 4BRYB 3L74J 4W7YA 2AEMA 2OYIA 1DX7A 3L71G 2M0BA 2FYNC 2QRXA 3B8EB 4C46A 1LWUC 5APQA 4EI2A 3CX5H 2R3SA 2H89C 3MHVA 5CBOA 1QEXA 3H1JG 2WPRA 3FXEA 1EDLA 3CCEP 1J1EC 1VQLP 4PV1D 1DD4A 4WVZA 1USEA 3I56P 1M8OB 4I7ZC 1SQPG 4C7NB 1ZMEC 1SFCA 3N7NA 3M0AA 1CI6B 2PAJA 2IFMA 1YITP 3CXHD 2OYIC 3H1JD 4I2LC 1WMKA 2Q5UA 1NTZJ 4OGQD 2BCCJ 3CCMP 1L4AB 3W68A 2KSEA 3R4YA 3B5ND 2Y0CA 1SQPD 3KYQA 3C1LA 2XU6A 1HTLC 3TGUG 3C9IA 3TNUB 2N9YB 3KDPB 1SFCC 5AVXB 3RK3C 3NXSA 2IBZI 1H0TA 2E76C 4PD4H 3FWLA 1KYOE 1VF5C 2C0WA 2QJKC 2NPSB 3M0DA 4H0LC 4NPDA 3OAKA 2HODA 1NGMB 3T97B 3VN0A 4DZOA 2O01J 3AEFC 1KB9I 2P10A 2WSSH 4N78D 2YO2A 3HE4B 3CXHH 3M0DC 1VQ9P 4Y99C 1OW6A 2E75D 3ABVC 1NU1E 1NU1K 4IFMA 3HE4A 1SS1A 2HR3A 3SWFA 3QH9A 3V2QA 1D7MA 1GL2B 1LTBC 2L91A 2WSFJ 2LXCB 1LP1A 2O01N 3Q5SA 2CK3H 3W67A 2FYUE 1NKZB 3V2RA 4HB1A 1SQQE 1PPJG 1GDTA 3AEGC 5H2FH 1QL1A 2PP6A 1T3UA 1EZVI
chains in the Genus database with same CATH topology
3TYYA 2HFED 4AYCA 2OYHC 1L0LK 1FZEA 4JF7A 3VP9A 1IFIA 1LTGC 1M1JC 1T3JA 1N73C 1LTJB 3R2PA 3L36A 2NPSD 2VRSA 1SP4A 1URQC 1IK9A 5AVTB 2P1JA 3RL0C 2N1TC 2P2UA 2Z4EA 2WT7A 3TK1A 3SWYA 3CLQA 3GHGC 1FAVA 5APXA 4C7RA 2POHA 5CCHA 1LT9C 5APTA 4M3LA 4RESB 1LTIC 1FZFA 3IFMA 4N6JA 3M06A 2KLVA 4I1LA 3G3ZA 2A45G 5AW8B 2HODB 4WY4D 3V2NA 3E1IA 4WB4A 1HH0A 2O1KA 1ZR2A 3VMYA 1G1IA 1FZCA 2WWWA 3RK2C 1L0NK 5AVUB 2L5GB 3NFQA 1IJDB 5KJ7C 1X8YA 3HD7B 2GUSA 2HPCA 1HWTC 1MZ9A 1JY2O 1NTKK 5CJ0A 3KQGA 3L4FA 1LTAC 1CSBA 2R5DA 3HUSA 5CCHC 1GL2D 1VPCA 1HBWA 1JTHB 3M91A 4N3YB 1AFOA 3BVHA 1NOHA 3B5NB 1N7SB 1FU1A 2JEEA 2XZRA 4KHXA 1SVFA 1YTZI 2WPSA 3VP8A 1GTWA 1W2EA 4AUWA 2R3CA 1SFCD 3RK3D 1KILA 1N7LA 1NKNA 4XE5B 2OYHB 1SQXK 2R32A 5AW1B 2W6AA 1FZCC 1JNMA 2E42A 3B5NA 5AW7B 2ZXEB 2JJLA 5AVQB 2P67A 1HGVA 1WRGA 1N73B 1FZAA 2WITA 1MFZA 5AVYB 2KB7P 1URQB 2N1TB 3HUSC 1T2KC 2IFNA 1S9KD 1FBMA 1M1JA 1HJBA 3OA7A 3GHGB 4JYCA 2O1JA 2GM4A 2BASA 1CW5A 1QL2A 1JOCA 1EQ7A 3P8CD 3EQ2A 1LT9B 2A45I 2Z5HA 3CI9A 2E43A 5CHXA 2XKMA 5AVRB 1N86A 2NPSC 5CCGA 1KILC 5AW5B 3P8MC 1SQBK 1IO4A 1ZN5A 1IC2A 2IPPA 3EFGA 3BATA 1NAFA 5CMZA 5BVZA 4B86A 5AVWB 2Z5IA 4I6MC 5AW4B 3LW5H 1FZBA 1NWQA 3RK2B 1T8ZA 2KOGA 3V2PA 1RF0A 1RF1A 5AVVB 3O8ZA 2WT7B 2HLOA 4EOTA 1MUUA 1KFNA 3NTNA 3A5TA 2WZ7A 1J1DC 4LLHA 2OARA 2A45H 2XV5A 5KJ7A 1IFJA 5KLVK 1RE3A 3HD7D 3VYIA 5CCGC 3U1CA 1N2DC 3MD0A 1JMMA 3LIEA 2KP8A 3KPEA 3MUDA 1Z56A 1SQPK 3MTUE 1LTTC 4C7NA 5APYA 3BRTB 1CI6A 1G2CA 3BASA 1FZCB 1J2JB 2XDJA 4IFFA 1HGZA 1N7SD 5AW6B 1LTSC 4Y99B 1RF0C 2C0XA 1RF1C 1L4AA 2O01H 1NTZK 3A2AA 2HPCB 3TSIA 1CZQA 1JUNA 2P7JA 2HYNA 3NMDA 3HUSB 1RY3A 3HE5A 1NHLA 4AQRD 1RE3C 1ZLLA 2M8RA 1IFNA 1A02F 1URQD 3A7OA 2WSEH 4XA4A 1SLQA 2N1TD 1PFIA 4W7ZA 1JCCA 3TNUA 4W80A 1KILB 2C9LY 2CPBA 2H8PD 2W6BA 1IFDA 4N78E 1X9VA 2FYZA 1L4AC 2XNXA 3M9BA 1H88A 2NPSA 2WSFH 4LC1A 4DOJA 1LWUA 1OXZA 5BU8B 5AW9B 1M1JB 1XTGB 1H8AA 1AQ5A 3U59A 3H32A 3HTKA 3T97A 2KSJA 1J1DB 3L37A 1GW4A 1FJKA 2ZFCA 5AW0B 3MGNA 3RK2D 3RL0B 4O9BA 3V4QA 3M9QA 1FZGA 1HUCA 1ZR4A 1H89A 2YO3A 3P32A 5APVA 5AW2B 5CCHD 5AVSB 4IFDK 2I1KA 2CPSA 4WY4A 4W7YA 2OYIA 1DX7A 1IFMA 3B8EB 4C46A 2J58A 1LWUC 1RF1B 1LGHB 1GZLA 5APQA 5AW3B 2GUVA 2WPRA 2KYVA 2W27A 1GL2A 1J1EC 2LKMA 1GK6A 1SQVK 2FFDA 2FYUK 1SQQK 5APSA 4EIJA 2HG5D 1FOSF 5AVZB 1KZUB 1GU5A 1T2KD 4LGDE 1JY3N 4C7NB 1SFCA 3N7NA 3M0AA 4WY4C 3VTPC 4ZKUA 1JY3P 1CI6B 2PAJA 1G2CB 2FKWB 2IFMA 1GU4A 2H43A 2OYIC 1A02J 4I2LC 4OH8B 2Q5UA 1YYCA 1L4AB 2M3BA 2QM8A 5APUA 3VMXA 5KTBA 3OJAB 3H6PA 1KILD 3BRVB 2YNYA 1NTMK 2YMYA 3B5ND 3HE5B 1GL2C 3P7KA 2Q7CA 3KYQA 2FFDC 1LTJA 2FXMA 2XU6A 4GIFA 3M9HA 1HTLC 3C9IA 3TNUB 1GK4A 3KDPB 1KQLA 1GD2E 1SFCC 2H7HA 5AVXB 3RK3C 1NO4A 3NXSA 1DEBA 2Q3IA 1KFMA 1WT6A 3RL0D 2C0WA 2YKOA 3PP5A 2NPSB 5CCGD 4WBAA 1FDMA 3M0DA 4JYBA 3LIDA 1LWUB 2Q9IA 1JCDA 3OAKA 2HODA 3H32B 3HTKB 1LTJC 3IR9A 1FJPA 4GT1A 4GKGA 3VN0A 4DZOA 3V5BA 1JY2N 2QM7A 2I1JA 3MIWA 1J1EB 3V4WA 1JY2P 3HD7A 4N78D 3A3YB 1RE4A 2WTYA 1MV8A 3VOPA 3VMZA 3HRNA 2YKQA 3I5CA 1G1JA 3N4XA 2YO2A 2MJZA 1YTZT 5KJ7D 1JTHA 4WY4B 2R5BA 3HE4B 2OYIB 1GW3A 1XTCC 1OWAA 1VDFA 3M0DC 3CL3D 1S9KE 1N7SA 1DH3A 4Y99C 2WSCH 2N9BA 1HVVA 1NU1K 1ZV8A 4IFMA 3HE4A 2OYHA 3P8CE 3SWFA 2IX7C 3V2QA 1FOSE 5CJ4A 1GL2B 1LTBC 2C9NY 1L4AD 3HD7C 4HYTB 2FFDB 1N73A 4HH2A 1RE4C 2YKPA 1URQA 1JO5A 2J59M 2N1TA 3II6A 1M7LA 4ZKPA 1SFCB 1NKZB 1E5WA 3RK3B 3V2RA 3WMM0 3GHGA 3UIAA 1X79B 3L35A 2WPQA 1GDTA 3B5NC 1JY3O 1N7SC 1QL1A 2PP6A 1T3UA 5APWA 5BU5A 1LT9A 1NH4A 3U1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYY A;  2XU6 A;  1HJB A;  4AYC A;  3M9H A;  4JYC A;  3M9B A;  3TNU B;  1H88 A;  1GK4 A;  3KDP B;  1KQL A;  2BAS A;  4LC1 A;  1GD2 E;  2H7H A;  5AVX B;  3NXS A;  2Z5H A;  2E43 A;  3L36 A;  1OXZ A;  5AW9 B;  2Q3I A;  2VRS A;  1SP4 A;  5AVR B;  1H8A A;  5AW5 B;  3P8M C;  5AVT B;  3HTK A;  2P2U A;  3T97 A;  1IO4 A;  3L37 A;  2WT7 A;  2IPP A;  2ZFC A;  3TK1 A;  5AW0 B;  1NAF A;  3MGN A;  3M0D A;  4JYB A;  5CMZ A;  3LID A;  3V4Q A;  4B86 A;  5AVW B;  2Z5I A;  4I6M C;  5AW4 B;  1FAV A;  5APX A;  3OAK A;  1NWQ A;  1HUC A;  3IR9 A;  4GT1 A;  4GKG A;  5APT A;  3O8Z A;  5AVV B;  4M3L A;  3VN0 A;  2WT7 B;  4EOT A;  1H89 A;  2YO3 A;  1MUU A;  3P32 A;  4RES B;  4DZO A;  5APV A;  3NTN A;  5AW2 B;  5AVS B;  3A5T A;  3V5B A;  2QM7 A;  3M06 A;  3V4W A;  5AW8 B;  3B8E B;  3A3Y B;  2XV5 A;  2WTY A;  4C46 A;  1MV8 A;  3VMZ A;  3VYI A;  1GZL A;  3VMY A;  5APQ A;  3I5C A;  2WWW A;  3MD0 A;  2YO2 A;  3LIE A;  5AVU B;  2KP8 A;  3NFQ A;  1X8Y A;  5AW3 B;  2R5B A;  3HE4 B;  2WPR A;  2W27 A;  1HWT C;  1OWA A;  1S9K E;  4C7N A;  5APY A;  1DH3 A;  1CI6 A;  3KQG A;  2N9B A;  1GK6 A;  1CSB A;  2R5D A;  1J2J B;  1HBW A;  5APS A;  5AW6 B;  1FOS F;  3HE4 A;  5AVZ B;  3M91 A;  1GU5 A;  3SWF A;  1T2K D;  3A2A A;  1FOS E;  1CZQ A;  1JUN A;  2P7J A;  4C7N B;  4KHX A;  3M0A A;  3VTP C;  2XZR A;  2C9N Y;  1CI6 B;  1G2C B;  1GU4 A;  3NMD A;  4HYT B;  1A02 J;  4I2L C;  2WPS A;  1GTW A;  3HE5 A;  2R3C A;  4AUW A;  2Q5U A;  4AQR D;  4XE5 B;  1YYC A;  2R32 A;  2QM8 A;  5AW1 B;  2W6A A;  5APU A;  3VMX A;  1JNM A;  2E42 A;  5AW7 B;  1A02 F;  3A7O A;  2ZXE B;  2JJL A;  2YNY A;  5AVQ B;  1SLQ A;  2P67 A;  3UIA A;  3L35 A;  2WPQ A;  3TNU A;  3HE5 B;  1MFZ A;  3P7K A;  2Q7C A;  5AVY B;  5APW A;  2C9L Y;  1T2K C;  1S9K D; 
#chains in the Genus database with same CATH topology
 1NVO A;  3L75 G;  1L0L E;  4AYC A;  1L0L K;  4RO0 A;  3VP9 A;  1VQO P;  3ZDM A;  1LTG C;  4HKZ H;  1M1J C;  2O3J A;  1BE3 E;  2ZJS E;  3L75 E;  1Q86 Q;  1EXI A;  1PPJ D;  3KZI H;  1S5L E;  1KQF B;  1QX8 A;  2P1J A;  2QJY B;  3H1I E;  4H13 D;  2Z4E A;  1KV4 A;  3L75 D;  4D6T E;  3IF4 A;  1FAV A;  2POH A;  1Q82 Q;  3D70 A;  3H1I D;  4ASW A;  1ZRT E;  3M06 A;  4I1L A;  2OTJ P;  3WUT A;  1HH0 A;  1S3J A;  1G1I A;  1R5L A;  1ZRT D;  2WWW A;  2L5G B;  5KJ7 C;  2HPC A;  4BWN A;  3MUD C;  3HUS A;  3BCC G;  1AFO A;  3BVH A;  3CC4 P;  1N7S B;  2XZR A;  3H1L J;  1NU1 J;  1USD A;  2WPS A;  4A7P A;  2BEZ F;  3VP8 A;  1SFC D;  3V6I A;  3RK3 D;  2E76 D;  1TU3 F;  5AW7 B;  3BCC D;  1RQV A;  1WRG A;  1VF5 D;  1MFZ A;  4H0L D;  1AVY A;  2QG4 A;  3HUS C;  2FYU J;  1SQQ J;  3OA7 A;  3GHG B;  1VQ5 P;  1OMI A;  4JYC A;  2GM4 A;  2BAS A;  1JOC A;  2A45 I;  1L0L J;  2FY8 A;  5CCG A;  1MFT A;  5AW5 B;  1Y9B A;  1EC5 A;  1ZN5 A;  1BE3 J;  2IZ1 A;  1PGQ A;  1UIX A;  2IBZ E;  4B86 A;  5AVW B;  3H1K G;  3JCU E;  1VQ7 P;  1NJI Q;  2AXT E;  1U57 A;  3AE8 C;  2HLO A;  4D6T J;  3A5T A;  2IBZ D;  1KQS O;  3CWB J;  2OGU A;  5KLV E;  2KLU A;  1E79 H;  1IFJ A;  4KJM A;  5B5E H;  5KLV K;  1M1K Q;  3L72 J;  5CCG C;  1KB9 E;  2FBW C;  1JMM A;  2M3E A;  2Y0E A;  3RBZ A;  3A0B E;  1FZC B;  1KB9 D;  3AE2 C;  1JUN A;  1GMJ A;  4DJG A;  3CCS P;  4PV1 B;  1RY3 A;  3HE5 A;  1VQN P;  1AA0 A;  2K3R A;  1NTK E;  3AE6 C;  1IFN A;  4NPE A;  4OGQ B;  2K9Y A;  4W7Z A;  1JCC A;  5KLI C;  4W80 A;  2H8P D;  2W6B A;  4JBZ A;  1EZV E;  1X0T A;  1YI2 P;  2QJP B;  4NPF X;  1OXZ A;  2WPV B;  1XTG B;  4IL6 X;  3L70 E;  3HTK A;  2KSJ A;  4U3F E;  3FGA D;  1W2B O;  1VQP P;  3E7K A;  3WU2 E;  1FZG A;  2K9J A;  4IFD K;  4WY4 A;  2WMM A;  1RF1 B;  1LGH B;  3CCU P;  5KAF E;  3B4S A;  3L74 E;  1LNQ A;  1S4X A;  5KLV J;  3GW6 A;  2KXP B;  1SQV K;  2LXB A;  4K35 A;  4EIJ A;  5AVZ B;  3L74 D;  1GU5 A;  1FE6 A;  2E75 B;  3B71 A;  3MZW B;  4WY4 C;  3VTP C;  1JY3 P;  2FKW B;  1GU4 A;  2H43 A;  1A02 J;  2ZXX A;  4OH8 B;  2D2C C;  5TJH A;  2M3B A;  2QM8 A;  5KTB A;  3F5H A;  1M56 D;  3H6P A;  1KOR A;  2YNY A;  1NTM K;  1NAY A;  3P7K A;  1NTZ E;  1L0N G;  1KQG B;  3LW5 J;  2BCC E;  1NTK J;  1LTJ A;  3WUV A;  2Q1K A;  1Q90 D;  4GIF A;  3M9H A;  3GMA A;  4GOE A;  2H7H A;  1NTZ D;  2V7Q J;  1OW7 A;  1LT1 A;  1KFM A;  3CCV P;  3K5B A;  1YQ4 C;  3PP5 A;  5CCG D;  2FYN B;  1SQX G;  1LWU B;  4H13 B;  3L70 J;  2E74 C;  3AE9 C;  1LTJ C;  1FJP A;  4U3F J;  4UB8 H;  2Q3E A;  2QM7 A;  1J1E B;  1JY2 P;  2QEX P;  1KMI Z;  2M5A A;  2WTY A;  1MV8 A;  3VMZ A;  3HRN A;  3I5C A;  4I7Z B;  2MJZ A;  1YTZ T;  1JTH A;  2ZT9 D;  1BSH A;  2OYI B;  2YMK A;  1OWA A;  2N9B A;  4L75 A;  3S1K A;  3P8C E;  1FOS E;  1SQV J;  2K1A A;  1N73 A;  1BCC E;  1URQ A;  3IAO A;  1JO5 A;  2N1T A;  2ZYD A;  3II6 A;  1M7L A;  1FDI A;  4ZKP A;  1SFC B;  2RMZ A;  2SPZ A;  3RK3 B;  1X79 B;  3L35 A;  2E76 B;  3U1A A;  1VF5 B;  2QJK B;  1NTM J;  1FZE A;  4H0L B;  5GTI H;  3SFD C;  3PJS K;  1N73 C;  3L36 A;  1LJ2 A;  1URQ C;  2R44 A;  5KAI E;  3RL0 C;  2N1T C;  4IL6 H;  1FC2 C;  2WT7 A;  3SWY A;  3CLQ A;  3Q5P A;  4PJ0 E;  3USS A;  1H0T B;  1S5L X;  5CCH A;  3D71 A;  1RHZ B;  1LTI C;  1FZF A;  2G8Y A;  1PP9 E;  2KLV A;  2HOD B;  4WY4 D;  3V2N A;  3E1I A;  3GF7 A;  4U7J A;  2IYO A;  2O1K A;  1ZR2 A;  1VQ6 P;  3RK2 C;  2D2C D;  4Z1M H;  1IJD B;  4WWI A;  5B66 E;  4JQ0 D;  1KYO D;  1MZ9 A;  3PLN A;  3TF5 A;  3KQG A;  3L4F A;  5CCH C;  2RN0 A;  4KHX A;  3AE5 C;  5GTH E;  4EDF A;  1NU1 G;  1NKN A;  4XE5 B;  2JWA A;  3I55 P;  1P84 I;  2E42 A;  2ZAE B;  1AV1 A;  3H1L E;  2G3A A;  2P67 A;  1HGV A;  2QIW A;  4GOD A;  1BCC J;  2KB7 P;  1LP1 B;  2KNC A;  1K9M Q;  1FBM A;  1M1J A;  1HJB A;  3H1L D;  1NU1 D;  1VQK P;  4CPG A;  2FYU G;  1SQQ G;  3AE1 C;  1BGY E;  1QL2 A;  1AQT A;  3EQ2 A;  1NYH A;  3L71 J;  2E43 A;  3CI9 A;  5AVR B;  2NPS C;  1K04 A;  1SQB E;  1RH5 B;  2WVR A;  1L0L G;  1SQB K;  1IC2 A;  5CMZ A;  2YXQ B;  1EXJ A;  5AW4 B;  2Z5I A;  4I6M C;  1BE3 G;  2B89 A;  2FYU D;  1JB0 J;  5KKZ C;  1SQQ D;  2KOG A;  3V2P A;  3D6Z A;  3O8Z A;  2J5U A;  1KYO H;  4L76 A;  3NTN A;  3H1I G;  1J1D C;  4D6T G;  1L0L D;  2OAR A;  4ZNC A;  2W83 C;  3FWN A;  5KJ7 A;  1KIL E;  1RE3 A;  3VYI A;  1BE3 D;  3MD0 A;  1OZH A;  1JEK A;  1PP9 J;  3CWB E;  3MUD A;  1LTT C;  2A06 E;  2B88 A;  1G2C A;  3RL0 g;  3L72 E;  4D6T D;  4OVN F;  3TDK A;  4IFF A;  2JR8 A;  3CWB D;  2AXC A;  3TGU J;  2HPC B;  1CZQ A;  1IZN B;  1ZW0 A;  3L72 D;  3HUS B;  1NHL A;  1RE3 C;  1VQM P;  1URQ D;  4XA4 A;  1SLQ A;  2N1T D;  2ZVN B;  2W6J H;  2C9L Y;  3CC7 P;  3KXD A;  4DCK A;  4EYY Q;  5DJU B;  1X9V A;  2KIK A;  2XNX A;  4LC1 A;  5TIS E;  2IDB A;  3AEB C;  3G6E P;  1AQ5 A;  3U59 A;  3H32 A;  3CX5 I;  3VMA A;  1BGY J;  3RK2 D;  1DIP A;  4L74 A;  1K73 Q;  3M9Q A;  1SQB J;  2ZVO B;  1S5L H;  2YO3 A;  3P32 A;  5CCH D;  1FS0 E;  2I1K A;  2CPS A;  1OVR A;  2IBZ G;  1IFM A;  2J58 A;  1GZL A;  2Q6Q A;  2W8Z A;  1T6A A;  2QE7 H;  2WSC J;  2GUV A;  5AW3 B;  4GDO A;  2IYP A;  2W27 A;  3S9O A;  2ZT9 B;  1GK6 A;  5KLV G;  2FFD A;  2DW3 A;  2YXR B;  1KZU B;  4LGD E;  1JY3 N;  5KLI B;  1RQU A;  2KK7 A;  4PD4 I;  1YYC A;  3VMX A;  5KLV D;  2KS1 A;  3O6Q A;  4YXW H;  2RH0 A;  1W5C E;  2PGD A;  4HJG H;  3HE5 B;  2Q7C A;  2B87 A;  1U7J A;  4R4M A;  2IZ0 A;  2FFD C;  1P84 E;  2FXM A;  1ZP0 C;  1NTK G;  3JSV C;  1R5S A;  1KQL A;  2Y9Y A;  3SWK A;  1NO4 A;  1P84 D;  1WT6 A;  1EDI A;  3A0H E;  2YKO A;  2K88 A;  1YQ3 C;  4JYB A;  1NTK D;  2YIU C;  1JCD A;  1EZV G;  3HTK B;  3IR9 A;  3KHU A;  3L70 G;  3G71 P;  1JY2 N;  2I1J A;  1QVF O;  3V4W A;  4U3F G;  3HD7 A;  3L73 E;  2JP3 A;  2NRG A;  3VOP A;  2K9J B;  1EZV D;  3JCU H;  2V4H A;  5KJ7 D;  3Q5R A;  4WY4 B;  2AXT H;  3L70 D;  1XTC C;  1S9K E;  3CL3 D;  2D2C B;  3AEA C;  4U3F D;  4QMA A;  2OYH A;  3PHL A;  2PFX A;  1KB9 H;  2QVA A;  3L74 G;  2C9N Y;  3HD7 C;  5E79 E;  1SQV G;  4HH2 A;  2YKP A;  3A0B H;  1S72 P;  2J59 M;  1SQV E;  3WMM 0;  2WPQ A;  2JO1 A;  3B5N C;  1JY3 O;  3FX0 A;  5APW A;  3H1K J;  1LT9 A;  3AE7 C;  3AEE C;  3TYY A;  1SQV D;  1YBK A;  2OYH C;  4JF7 A;  1IFI A;  3EFF K;  1T3J A;  4UB6 E;  1NTZ G;  1LTJ B;  3R2P A;  4KT0 J;  2BCC G;  1S2E A;  1NTM E;  1SP4 A;  2V7Q H;  1IK9 A;  4YTP C;  2P2U A;  3SFE C;  3G4S P;  1OX3 A;  3AED C;  4GOF A;  1NTM D;  5APX A;  4C7R A;  1YHQ P;  3CX5 E;  1LT9 C;  2LR2 A;  3H1H E;  5APT A;  2BCC D;  2NZ2 A;  3IFM A;  4N6J A;  2A45 G;  1DEE G;  1K05 A;  5AW8 B;  3CX5 D;  4WB4 A;  3QWO C;  3WU2 H;  1L0N K;  5AVU B;  3AE3 C;  3L73 J;  1X8Y A;  1OFC X;  2B9B A;  2GUS A;  2M5A B;  1HWT C;  2QA4 P;  1JY2 O;  1VL2 A;  1LTA C;  1CSB A;  2R5D A;  2E75 C;  1VPC A;  1HBW A;  2P58 A;  1JTH B;  4JPZ B;  5KAF H;  5C39 A;  1JMB A;  2JEE A;  3CCQ P;  1K8A Q;  2WQY C;  4AUW A;  2R3C A;  3F89 A;  1KIL A;  2WSE J;  1SQX K;  2R32 A;  3C8V A;  3S4R A;  5AVQ B;  1PGJ A;  1N73 B;  4PD4 E;  1URQ B;  1BCC G;  2N1T B;  1T2K C;  2FXO A;  2IFN A;  2ZYG A;  1ZOY C;  3SSU A;  2PRR A;  4PD4 D;  1EQ7 A;  3P8C D;  4H44 C;  2Z5H A;  5CHX A;  2XKM A;  3Q3D A;  3CD6 P;  1KIL C;  3P8M C;  1IO4 A;  1BCC D;  3Q1M A;  2IPP A;  3EFG A;  4H13 C;  1NAF A;  4BRY A;  3L71 E;  1VQ4 P;  1NWQ A;  3RK2 B;  1T8Z A;  3ITK A;  1RF0 A;  5AVV B;  2WT7 B;  1MUU A;  3CXH E;  3H1J E;  3L71 D;  4TT3 H;  3CCL P;  2A45 H;  3H1H J;  3HD7 D;  1Y47 A;  2KP8 A;  3CME P;  1SQP E;  2Y0D A;  1M57 D;  1Z56 A;  1SQP K;  3MTU E;  2KI7 B;  1PP9 G;  4C7N A;  1CI6 A;  1L0N J;  3BAS A;  2XDJ A;  1QLE D;  1HGZ A;  4Y99 B;  1RF0 C;  2C0X A;  3AEC C;  1KTM A;  1L4A A;  2O01 H;  1PGP A;  2P7J A;  3JC2 2;  4Y28 J;  5H2F E;  5DJT B;  2Y9Z A;  1PP9 D;  1ZLL A;  3TGU E;  3A7O A;  1PFI A;  3TNU A;  3KZI E;  1SQX J;  1AVO A;  3TGU D;  1DD3 A;  1IK7 A;  1IFD A;  1PZQ A;  4N78 E;  1L4A C;  1QVG O;  1PIX A;  1Q7Y Q;  3M9B A;  2NPS A;  3H1L G;  2WSF H;  3GF3 A;  4DOJ A;  5KKZ B;  2KNC B;  5AW9 B;  1M1J B;  3EWK A;  1UII A;  1YJ9 P;  1H8A A;  1VQ8 P;  1HF9 A;  3T97 A;  1J1D B;  3L37 A;  1GW4 A;  1FJK A;  2ZFC A;  1U7M A;  4O9B A;  3V4Q A;  1BGY G;  2OTL P;  2E74 D;  1HUC A;  2ITA A;  1ZR4 A;  1SQB G;  5APV A;  5KAI H;  1KD1 Q;  4PJ0 H;  2E5T A;  1BGY D;  3H1J J;  2MKV A;  1OVV A;  4DT0 A;  2KYV A;  4L73 A;  1SQB D;  2OTK E;  1GL2 A;  2LKM A;  2FYU K;  1SQQ K;  5APS A;  2HG5 D;  1SQP J;  2JDI H;  1FOS F;  1T2K D;  1PPJ E;  3CWB G;  4ZKU A;  3CPW O;  5B66 H;  1G2C B;  2A06 G;  1S1C X;  1OVU A;  3L72 G;  1M90 Q;  4H44 D;  5APU A;  3OJA B;  4ZMD A;  1HJ0 A;  1KIL D;  3BRV B;  3G9R A;  4XFJ A;  2YMY A;  1GL2 C;  5GTH H;  4R4L A;  1N8R Q;  3Q2Y A;  2A06 D;  3FXD A;  1GK4 A;  1GD2 E;  1DEB A;  2Q3I A;  3RL0 D;  2OYO A;  1BSN A;  1FDM A;  4WBA A;  3LID A;  2QSI A;  5B5E E;  2Q9I A;  3IN6 A;  4IOI H;  3OW2 O;  3H32 B;  4GT1 A;  4GKG A;  1X22 A;  2QJY C;  3V5B A;  3GG2 A;  3MIW A;  3RK3 E;  4RJT A;  4K3A A;  3A3Y B;  1RE4 A;  1QGK B;  3BCC E;  2YKQ A;  1G1J A;  3N4X A;  3CC2 P;  2R5B A;  1GW3 A;  1VDF A;  1N7S A;  1DH3 A;  1R8E A;  2WSC H;  3GLM A;  3RBX A;  1HVV A;  1ZV8 A;  1KC8 Q;  2IX7 C;  5CJ4 A;  1L4A D;  1EDJ A;  4HYT B;  2FFD B;  1RE4 C;  1KN7 A;  1E5W A;  2W90 A;  3GHG A;  3UIA A;  1JM0 A;  3PH0 A;  2KZI A;  1N7S C;  3CCR P;  3L75 J;  5BU5 A;  1NH4 A;  2KS1 B;  3O6Q B;  2HFE D;  2AEJ A;  2KUB A;  3H1I J;  2YIU B;  4TLF A;  2B87 B;  3H1K E;  2NPS D;  2VRS A;  1Q81 Q;  5AVT B;  4RKU J;  2K37 A;  2JWD A;  3TK1 A;  1PV3 A;  3GHG C;  3H1K D;  5M1B A;  5TIS H;  2FXP A;  3D6Y A;  3PRJ A;  4M3L A;  4RES B;  2OQQ A;  1OIP A;  3G3Z A;  2RKL A;  3VMY A;  3CXH I;  1FZC A;  3AE4 C;  3NFQ A;  3RGU A;  4OWF A;  2ZT9 C;  3H25 A;  3HD7 B;  3BCC J;  3L73 G;  1NTK K;  5CJ0 A;  1L2P A;  2AEF A;  1GL2 D;  3M91 A;  4N3Y B;  1AJY A;  4YPC A;  1NOH A;  3B5N B;  1FU1 A;  3CCJ P;  1SVF A;  1YTZ I;  1GTW A;  1W2E A;  1YJN P;  1N7L A;  2OYH B;  3L73 D;  5EFW B;  5AW1 B;  2W6A A;  1FZC C;  1JNM A;  3B5N A;  2KZJ A;  3MP7 B;  2ZXE B;  2JJL A;  1EDK A;  1FZA A;  2WIT A;  5AVY B;  4PV1 C;  3CMA P;  2XND H;  1S9K D;  5K5G B;  1ZXG A;  1KYO I;  2O1J A;  1OW8 A;  1PL5 A;  1Y8A A;  4OGQ C;  1CW5 A;  1LT9 B;  3PTZ A;  1N86 A;  1IFP A;  4UB8 E;  1P84 H;  2GA1 A;  3BAT A;  5BVZ A;  3LW5 H;  1FZB A;  1NTM G;  2QJP C;  1RF1 A;  1BDD A;  4EOT A;  2E74 B;  1KFN A;  3A0H H;  2WZ7 A;  4LLH A;  2BEQ D;  2XV5 A;  4ASV A;  3U1C A;  2I8D A;  1N2D C;  3H1H G;  3LIE A;  3KPE A;  4MN4 C;  5APY A;  5L8R J;  3BRT B;  1J2J B;  1N7S D;  5AW6 B;  1LTS C;  1MKM A;  1RF1 C;  4YXD C;  1Q2N A;  1NTZ K;  3A2A A;  3TSI A;  2HYN A;  4BXL A;  3H1H D;  2UWJ E;  1L0N E;  3NMD A;  2JKV A;  1YIJ P;  2ZYA A;  4AQR D;  1YJW P;  2M8R A;  1A02 F;  2WSE H;  5GTI E;  1L0N D;  3E1R A;  4H44 B;  1KIL B;  5E79 H;  2E5Y A;  2CPB A;  4IL6 E;  2FYZ A;  1H88 A;  1PGO A;  1SQX E;  3WUU A;  1LWU A;  5BU8 B;  1SQX D;  5AW0 B;  3MGN A;  3RL0 B;  5CBN A;  2H88 C;  1BDC A;  4UB6 H;  1H89 A;  5AW2 B;  5AVS B;  1FDO A;  4BRY B;  3L74 J;  4W7Y A;  2AEM A;  2OYI A;  1DX7 A;  3L71 G;  2M0B A;  2FYN C;  2QRX A;  3B8E B;  4C46 A;  1LWU C;  5APQ A;  4EI2 A;  3CX5 H;  2R3S A;  2H89 C;  3MHV A;  5CBO A;  1QEX A;  3H1J G;  2WPR A;  3FXE A;  1EDL A;  3CCE P;  1J1E C;  1VQL P;  4PV1 D;  1DD4 A;  4WVZ A;  1USE A;  3I56 P;  1M8O B;  4I7Z C;  1SQP G;  4C7N B;  1ZME C;  1SFC A;  3N7N A;  3M0A A;  1CI6 B;  2PAJ A;  2IFM A;  1YIT P;  3CXH D;  2OYI C;  3H1J D;  4I2L C;  1WMK A;  2Q5U A;  1NTZ J;  4OGQ D;  2BCC J;  3CCM P;  1L4A B;  3W68 A;  2KSE A;  3R4Y A;  3B5N D;  2Y0C A;  1SQP D;  3KYQ A;  3C1L A;  2XU6 A;  1HTL C;  3TGU G;  3C9I A;  3TNU B;  2N9Y B;  3KDP B;  1SFC C;  5AVX B;  3RK3 C;  3NXS A;  2IBZ I;  1H0T A;  2E76 C;  4PD4 H;  3FWL A;  1KYO E;  1VF5 C;  2C0W A;  2QJK C;  2NPS B;  3M0D A;  4H0L C;  4NPD A;  3OAK A;  2HOD A;  1NGM B;  3T97 B;  3VN0 A;  4DZO A;  2O01 J;  3AEF C;  1KB9 I;  2P10 A;  2WSS H;  4N78 D;  2YO2 A;  3HE4 B;  3CXH H;  3M0D C;  1VQ9 P;  4Y99 C;  1OW6 A;  2E75 D;  3ABV C;  1NU1 E;  1NU1 K;  4IFM A;  3HE4 A;  1SS1 A;  2HR3 A;  3SWF A;  3QH9 A;  3V2Q A;  1D7M A;  1GL2 B;  1LTB C;  2L91 A;  2WSF J;  2LXC B;  1LP1 A;  2O01 N;  3Q5S A;  2CK3 H;  3W67 A;  2FYU E;  1NKZ B;  3V2R A;  4HB1 A;  1SQQ E;  1PPJ G;  1GDT A;  3AEG C;  5H2F H;  1QL1 A;  2PP6 A;  1T3U A;  1EZV I; 
#chains in the Genus database with same CATH homology
 3TYY A;  2HFE D;  4AYC A;  2OYH C;  1L0L K;  1FZE A;  4JF7 A;  3VP9 A;  1IFI A;  1LTG C;  1M1J C;  1T3J A;  1N73 C;  1LTJ B;  3R2P A;  3L36 A;  2NPS D;  2VRS A;  1SP4 A;  1URQ C;  1IK9 A;  5AVT B;  2P1J A;  3RL0 C;  2N1T C;  2P2U A;  2Z4E A;  2WT7 A;  3TK1 A;  3SWY A;  3CLQ A;  3GHG C;  1FAV A;  5APX A;  4C7R A;  2POH A;  5CCH A;  1LT9 C;  5APT A;  4M3L A;  4RES B;  1LTI C;  1FZF A;  3IFM A;  4N6J A;  3M06 A;  2KLV A;  4I1L A;  3G3Z A;  2A45 G;  5AW8 B;  2HOD B;  4WY4 D;  3V2N A;  3E1I A;  4WB4 A;  1HH0 A;  2O1K A;  1ZR2 A;  3VMY A;  1G1I A;  1FZC A;  2WWW A;  3RK2 C;  1L0N K;  5AVU B;  2L5G B;  3NFQ A;  1IJD B;  5KJ7 C;  1X8Y A;  3HD7 B;  2GUS A;  2HPC A;  1HWT C;  1MZ9 A;  1JY2 O;  1NTK K;  5CJ0 A;  3KQG A;  3L4F A;  1LTA C;  1CSB A;  2R5D A;  3HUS A;  5CCH C;  1GL2 D;  1VPC A;  1HBW A;  1JTH B;  3M91 A;  4N3Y B;  1AFO A;  3BVH A;  1NOH A;  3B5N B;  1N7S B;  1FU1 A;  2JEE A;  2XZR A;  4KHX A;  1SVF A;  1YTZ I;  2WPS A;  3VP8 A;  1GTW A;  1W2E A;  4AUW A;  2R3C A;  1SFC D;  3RK3 D;  1KIL A;  1N7L A;  1NKN A;  4XE5 B;  2OYH B;  1SQX K;  2R32 A;  5AW1 B;  2W6A A;  1FZC C;  1JNM A;  2E42 A;  3B5N A;  5AW7 B;  2ZXE B;  2JJL A;  5AVQ B;  2P67 A;  1HGV A;  1WRG A;  1N73 B;  1FZA A;  2WIT A;  1MFZ A;  5AVY B;  2KB7 P;  1URQ B;  2N1T B;  3HUS C;  1T2K C;  2IFN A;  1S9K D;  1FBM A;  1M1J A;  1HJB A;  3OA7 A;  3GHG B;  4JYC A;  2O1J A;  2GM4 A;  2BAS A;  1CW5 A;  1QL2 A;  1JOC A;  1EQ7 A;  3P8C D;  3EQ2 A;  1LT9 B;  2A45 I;  2Z5H A;  3CI9 A;  2E43 A;  5CHX A;  2XKM A;  5AVR B;  1N86 A;  2NPS C;  5CCG A;  1KIL C;  5AW5 B;  3P8M C;  1SQB K;  1IO4 A;  1ZN5 A;  1IC2 A;  2IPP A;  3EFG A;  3BAT A;  1NAF A;  5CMZ A;  5BVZ A;  4B86 A;  5AVW B;  2Z5I A;  4I6M C;  5AW4 B;  3LW5 H;  1FZB A;  1NWQ A;  3RK2 B;  1T8Z A;  2KOG A;  3V2P A;  1RF0 A;  1RF1 A;  5AVV B;  3O8Z A;  2WT7 B;  2HLO A;  4EOT A;  1MUU A;  1KFN A;  3NTN A;  3A5T A;  2WZ7 A;  1J1D C;  4LLH A;  2OAR A;  2A45 H;  2XV5 A;  5KJ7 A;  1IFJ A;  5KLV K;  1RE3 A;  3HD7 D;  3VYI A;  5CCG C;  3U1C A;  1N2D C;  3MD0 A;  1JMM A;  3LIE A;  2KP8 A;  3KPE A;  3MUD A;  1Z56 A;  1SQP K;  3MTU E;  1LTT C;  4C7N A;  5APY A;  3BRT B;  1CI6 A;  1G2C A;  3BAS A;  1FZC B;  1J2J B;  2XDJ A;  4IFF A;  1HGZ A;  1N7S D;  5AW6 B;  1LTS C;  4Y99 B;  1RF0 C;  2C0X A;  1RF1 C;  1L4A A;  2O01 H;  1NTZ K;  3A2A A;  2HPC B;  3TSI A;  1CZQ A;  1JUN A;  2P7J A;  2HYN A;  3NMD A;  3HUS B;  1RY3 A;  3HE5 A;  1NHL A;  4AQR D;  1RE3 C;  1ZLL A;  2M8R A;  1IFN A;  1A02 F;  1URQ D;  3A7O A;  2WSE H;  4XA4 A;  1SLQ A;  2N1T D;  1PFI A;  4W7Z A;  1JCC A;  3TNU A;  4W80 A;  1KIL B;  2C9L Y;  2CPB A;  2H8P D;  2W6B A;  1IFD A;  4N78 E;  1X9V A;  2FYZ A;  1L4A C;  2XNX A;  3M9B A;  1H88 A;  2NPS A;  2WSF H;  4LC1 A;  4DOJ A;  1LWU A;  1OXZ A;  5BU8 B;  5AW9 B;  1M1J B;  1XTG B;  1H8A A;  1AQ5 A;  3U59 A;  3H32 A;  3HTK A;  3T97 A;  2KSJ A;  1J1D B;  3L37 A;  1GW4 A;  1FJK A;  2ZFC A;  5AW0 B;  3MGN A;  3RK2 D;  3RL0 B;  4O9B A;  3V4Q A;  3M9Q A;  1FZG A;  1HUC A;  1ZR4 A;  1H89 A;  2YO3 A;  3P32 A;  5APV A;  5AW2 B;  5CCH D;  5AVS B;  4IFD K;  2I1K A;  2CPS A;  4WY4 A;  4W7Y A;  2OYI A;  1DX7 A;  1IFM A;  3B8E B;  4C46 A;  2J58 A;  1LWU C;  1RF1 B;  1LGH B;  1GZL A;  5APQ A;  5AW3 B;  2GUV A;  2WPR A;  2KYV A;  2W27 A;  1GL2 A;  1J1E C;  2LKM A;  1GK6 A;  1SQV K;  2FFD A;  2FYU K;  1SQQ K;  5APS A;  4EIJ A;  2HG5 D;  1FOS F;  5AVZ B;  1KZU B;  1GU5 A;  1T2K D;  4LGD E;  1JY3 N;  4C7N B;  1SFC A;  3N7N A;  3M0A A;  4WY4 C;  3VTP C;  4ZKU A;  1JY3 P;  1CI6 B;  2PAJ A;  1G2C B;  2FKW B;  2IFM A;  1GU4 A;  2H43 A;  2OYI C;  1A02 J;  4I2L C;  4OH8 B;  2Q5U A;  1YYC A;  1L4A B;  2M3B A;  2QM8 A;  5APU A;  3VMX A;  5KTB A;  3OJA B;  3H6P A;  1KIL D;  3BRV B;  2YNY A;  1NTM K;  2YMY A;  3B5N D;  3HE5 B;  1GL2 C;  3P7K A;  2Q7C A;  3KYQ A;  2FFD C;  1LTJ A;  2FXM A;  2XU6 A;  4GIF A;  3M9H A;  1HTL C;  3C9I A;  3TNU B;  1GK4 A;  3KDP B;  1KQL A;  1GD2 E;  1SFC C;  2H7H A;  5AVX B;  3RK3 C;  1NO4 A;  3NXS A;  1DEB A;  2Q3I A;  1KFM A;  1WT6 A;  3RL0 D;  2C0W A;  2YKO A;  3PP5 A;  2NPS B;  5CCG D;  4WBA A;  1FDM A;  3M0D A;  4JYB A;  3LID A;  1LWU B;  2Q9I A;  1JCD A;  3OAK A;  2HOD A;  3H32 B;  3HTK B;  1LTJ C;  3IR9 A;  1FJP A;  4GT1 A;  4GKG A;  3VN0 A;  4DZO A;  3V5B A;  1JY2 N;  2QM7 A;  2I1J A;  3MIW A;  1J1E B;  3V4W A;  1JY2 P;  3HD7 A;  4N78 D;  3A3Y B;  1RE4 A;  2WTY A;  1MV8 A;  3VOP A;  3VMZ A;  3HRN A;  2YKQ A;  3I5C A;  1G1J A;  3N4X A;  2YO2 A;  2MJZ A;  1YTZ T;  5KJ7 D;  1JTH A;  4WY4 B;  2R5B A;  3HE4 B;  2OYI B;  1GW3 A;  1XTC C;  1OWA A;  1VDF A;  3M0D C;  3CL3 D;  1S9K E;  1N7S A;  1DH3 A;  4Y99 C;  2WSC H;  2N9B A;  1HVV A;  1NU1 K;  1ZV8 A;  4IFM A;  3HE4 A;  2OYH A;  3P8C E;  3SWF A;  2IX7 C;  3V2Q A;  1FOS E;  5CJ4 A;  1GL2 B;  1LTB C;  2C9N Y;  1L4A D;  3HD7 C;  4HYT B;  2FFD B;  1N73 A;  4HH2 A;  1RE4 C;  2YKP A;  1URQ A;  1JO5 A;  2J59 M;  2N1T A;  3II6 A;  1M7L A;  4ZKP A;  1SFC B;  1NKZ B;  1E5W A;  3RK3 B;  3V2R A;  3WMM 0;  3GHG A;  3UIA A;  1X79 B;  3L35 A;  2WPQ A;  1GDT A;  3B5N C;  1JY3 O;  1N7S C;  1QL1 A;  2PP6 A;  1T3U A;  5APW A;  5BU5 A;  1LT9 A;  1NH4 A;  3U1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...