1CSBA

Crystal structure of cathepsin b inhibited with ca030 at 2.1 angstroms resolution: a basis for the design of specific epoxysuccinyl inhibitors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B light chain
publication title Crystal structure of cathepsin B inhibited with CA030 at 2.0-A resolution: A basis for the design of specific epoxysuccinyl inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 11
structure length 47
sequence length 47
chains with identical sequence D
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1994-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1csbA01
3P32A 1CSBA 2QM8A 2WWWA 4XE5B 4GT1A 1FOSE 4B86A 4C7NA 4M3LA 1X8YA 3VTPC 3NTNA 2P67A 4JYCA 4JYBA 3SWFA 5AVSB 3P8MC 2WPSA 3LIDA 2WT7A 3B8EB 3V4WA 5CMZA 3HE4B 4AUWA 2N9BA 5AW9B 3MD0A 2WPQA 1GK6A 1MV8A 1H89A 3M9HA 4EOTA 2E42A 5AVXB 2W27A 3M9BA 4C46A 1HUCA 3M06A 3VMYA 4I2LC 2R32A 2QM7A 1T2KD 1SP4A 3M0DA 1GTWA 2XZRA 1CI6A 3NMDA 5AVWB 5APWA 5AW4B 5AVYB 1JNMA 5AW0B 2IPPA 1FAVA 2JJLA 3HE5A 2E43A 1J2JB 3VYIA 4DZOA 5AVZB 1GU5A 3L37A 1HBWA 3UIAA 1G2CB 3A5TA 1H88A 2C9NY 3HTKA 1MFZA 5AW1B 3TNUA 4C7NB 1OXZA 5AW7B 2R5DA 2ZXEB 1JUNA 1OWAA 3TK1A 4AYCA 1HWTC 2H7HA 2WT7B 5AVUB 1GK4A 3L35A 2VRSA 5APSA 1FOSF 2R3CA 5APUA 5APTA 3NFQA 5AVQB 3LIEA 3IR9A 2R5BA 2XV5A 3A7OA 3M0AA 3HE4A 3VMZA 2Z5HA 1GU4A 2Q7CA 1H8AA 3P7KA 3V4QA 3I5CA 1A02J 1CI6B 2W6AA 5AW2B 5APXA 2P7JA 3L36A 3HE5B 1MUUA 3A2AA 5AVTB 2ZFCA 1GD2E 1CZQA 3MGNA 1NWQA 2BASA 3M91A 1DH3A 1YYCA 1HJBA 1SLQA 3TNUB 3T97A 3VN0A 5AW3B 4RESB 5APVA 4KHXA 5AW5B 1A02F 3OAKA 2YO2A 4HYTB 4I6MC 2WTYA 1KQLA 3VMXA 5AW6B 1NAFA 3V5BA 5APQA 2Q3IA 1S9KD 2YO3A 3KDPB 4AQRD 1IO4A 1GZLA 2XU6A 3O8ZA 4GKGA 4LC1A 5APYA 2P2UA 2WPRA 2YNYA 1S9KE 2KP8A 3A3YB 3KQGA 5AW8B 2C9LY 5AVVB 2Q5UA 5AVRB 1T2KC 3NXSA 2Z5IA 3TYYA
chains in the Genus database with same CATH superfamily
3RL0g 4XE5B 5E79H 1AV1A 3RBZA 2YIUC 4D6TJ 4RJTA 1VQNP 1YJNP 3HE4B 1G1JA 2M5AA 1QL1A 2YKPA 3HUSC 1FZBA 1OW7A 3FX0A 2KSEA 1EZVD 2I1KA 1FS0E 5KKZB 2BCCD 2OYHB 3L74G 3D6ZA 3TNUA 2SPZA 4NPEA 1L4AC 5AW1B 3U59A 3H1HE 1VQKP 5KLVJ 2M3EA 1Z56A 3L71G 1KQSO 1FOSF 1GU4A 1SQXE 3AE1C 5APXA 1LT1A 3IN6A 2E74B 1EDJA 1DH3A 1QVFO 2HG5D 4EI2A 5APVA 1P84D 1A02F 5GTHE 3V5BA 5APQA 1RE3C 1X9VA 2JP3A 2HLOA 3GG2A 3HRNA 4N78D 3AE3C 2KP8A 3KQGA 3A0BH 3Q1MA 2WSCH 1M57D 3RL0B 2Y0DA 1M1JB 1L2PA 1NTMG 1URQA 1AVYA 4TT3H 2O1JA 2HODA 2P10A 1VQMP 2OYIA 4JBZA 1OMIA 1JTHB 3M06A 3V2QA 4C7RA 3M0DA 1OIPA 3CI9A 3H32B 2Z4EA 4UB8H 3WUUA 3WUTA 5BU8B 3AEGC 3AECC 2K3RA 2FYZA 3E1IA 3L4FA 4YPCA 3K5BA 1EZVE 3B5NC 2NRGA 2BCCE 1MKMA 1NTKK 1YBKA 3CC2P 3AE7C 3U1AA 3VMZA 4JF7A 4LLHA 3MHVA 1NU1D 2OTKE 3V6IA 2A45I 4WBAA 2ZT9C 2B89A 2UWJE 4EDFA 1J1DC 4PD4D 5H2FE 1KMIZ 1RF0A 4DT0A 1H0TA 2KUBA 1W2EA 2WSFH 2JR8A 3OJAB 1JY3O 2B87A 2YNYA 2W90A 2C9LY 1LWUA 1K8AQ 1HJ0A 1PGJA 2FXPA 1LT9C 2ZVOB 4OGQC 1HGVA 3ITKA 3L70D 1N73B 1FDIA 2FBWC 4NPFX 5CJ4A 3O6QB 1SQXK 4HB1A 2FFDB 5CMZA 1VQLP 4YXWH 2N9BA 2W6JH 1KB9I 4H13B 1JMBA 3M9BA 4Y99C 1PGPA 2R32A 3SWYA 2E74D 2FYUD 3L72D 3KXDA 1FZGA 1FZCA 2Y9ZA 4WWIA 2KS1A 1KFNA 5K5GB 1DD3A 3CXHH 4AYCA 1FZFA 4WY4D 1VDFA 3LIEA 3HE4A 5TISH 2OTJP 3RL0D 3U1CA 2K9JA 1NU1G 1HH0A 1NGMB 1CZQA 1IFDA 1PGOA 2WPVB 2KB7P 1VQOP 3SWKA 2PGDA 2O01J 3MTUE 1JCDA 1Q81Q 3RK3B 5AW6B 2QJPC 1FBMA 1SQPG 3L75G 1VQPP 1GZLA 2H8PD 1JY2N 3A0HE 4OWFA 1YITP 4WVZA 1S5LE 1K05A 1EDIA 1FJPA 3FXDA 1FOSE 4ZMDA 4Z1MH 1JOCA 2LXCB 3H1LG 4EOTA 4IFMA 2W6BA 4L74A 1SP4A 1CI6A 3NMDA 5AW4B 2IBZD 3G3ZA 1K9MQ 3KZIE 4WY4A 2I8DA 2K1AA 3FWNA 1U7MA 3P8CE 1AQTA 4LGDE 4JPZB 3TK1A 3TGUD 2FXMA 5DJUB 2LXBA 2JKVA 1EDKA 2IFNA 3TGUJ 3WU2E 2ITAA 1EXIA 2GM4A 3B4SA 1YTZT 5KKZC 2OYHC 2PRRA 1JMMA 3LW5H 4RKUJ 2WSSH 2ZYDA 2JDIH 1S1CX 4H13D 2WTYA 5KLIB 1KQLA 3H1KG 5E79E 4GDOA 3G71P 2OGUA 1AJYA 3KDPB 3CCSP 4W7ZA 1KZUB 2I1JA 1FZAA 5CCGD 4K35A 3CCVP 2E74C 2L5GB 3P32A 3CCQP 5KTBA 3EFGA 1YTZI 1NTKD 4IL6E 3LIDA 3KHUA 1BCCG 2E75B 1DEBA 1NU1K 3H1JG 2FY8A 1NTKJ 3C9IA 4WY4C 3H25A 3ZDMA 5AVWB 1BE3G 1FAVA 3D71A 4DZOA 3TDKA 3RL0C 1M1JC 3RK3D 2IBZE 5KJ7D 2R5DA 3GW6A 1ZMEC 1N73A 4Y28J 1EC5A 2G8YA 1IFMA 3TGUE 3M0AA 3L74D 1BGYJ 1WRGA 4L76A 3HE5B 1MZ9A 4A7PA 1SFCB 3L71D 4I1LA 3T97A 1L4AA 1USDA 5KAFH 2YO2A 2HPCB 1KQFB 1YHQP 1SQBG 1N8RQ 3JC22 1VF5B 1SQXJ 4U3FG 2ZYGA 2FYUK 4IL6X 4UB6H 1KYOH 3CX5H 3H6PA 2GUSA 3II6A 2J59M 3VOPA 2V4HA 1GL2B 2WZ7A 3AEEC 4UB8E 1OW6A 3CWBD 1Q86Q 1IFPA 5AW9B 1RE3A 2E42A 5GTIE 1L0LG 1NTKE 2V7QH 1NTMD 2HYNA 1KD1Q 1N73C 1MFZA 3L73G 4C7NB 4DCKA 1WMKA 2C0XA 2ZYAA 2FFDC 2H7HA 1CW5A 2KZIA 2OTLP 1PFIA 1KILA 3NFQA 3HD7A 2Q7CA 1BGYE 3QH9A 4KJMA 3L74E 1Y9BA 3HTKB 5CCGC 2BCCJ 5B5EH 1PZQA 3JSVC 2JWAA 1Y47A 3B5NA 1KILE 4EIJA 5M1BA 2E75D 4KT0J 3L71E 2HR3A 2WSEH 2PP6A 1RF1B 4IFFA 2YKOA 3O8ZA 5APYA 4LC1A 1S72P 2AXCA 1ZXGA 1PIXA 2LR2A 3AE6C 2GUVA 3AE4C 1X8YA 3JCUH 5AVSB 2RKLA 2WPSA 1NYHA 1KTMA 3CWBG 3CXHE 5DJTB 2KI7B 2IX7C 4I2LC 2QM7A 1SFCD 1QEXA 3R2PA 4WB4A 1JY3N 3BASA 1HGZA 1SQVG 1LT9A 1D7MA 2G3AA 5AVZB 3GHGB 2A06G 2ZAEB 1SQBK 1RQVA 1KILC 4H44B 4IFDK 4GIFA 1VF5D 3S1KA 3H1IG 3HD7C 5APSA 3B71A 5APUA 1IK9A 1LP1B 4D6TG 1KV4A 2XNXA 1DIPA 2KNCB 3CCLP 1GL2D 1L0ND 2O01N 1MUUA 3MGNA 1EZVI 3M91A 1X0TA 2KLVA 3CPWO 3FGAD 3N4XA 4GOEA 1WT6A 1FU1A 2ZJSE 1NAFA 2E5YA 5KLVG 2OARA 1XTGB 1W5CE 4BXLA 4K3AA 1BDDA 3V2NA 1LTJB 3D70A 1NU1J 4IOIH 3AEFC 2XDJA 5BVZA 2H43A 1PV3A 2E5TA 2A45G 1SQPD 3L75D 2Y0EA 5KLIC 1P84E 2WT7A 1JY2P 4W7YA 1OVRA 3CMEP 5CCHD 3RBXA 3AEDC 3AE5C 1VQ4P 4N78E 1T2KD 1PPJD 3PJSK 3I56P 1J2JB 4GODA 1M56D 2QRXA 3A5TA 1G2CB 1N7SB 2YXQB 3H1LD 1OXZA 3L70J 4ZNCA 1VL2A 5B66E 3SFDC 2OQQA 2R3CA 3AE9C 2R5BA 1KYOD 3CX5D 1A02J 1XTCC 5C39A 2FYUJ 3F89A 3L72J 5BU5A 3AEAC 1L0NG 3PTZA 1S2EA 2QJYB 1OW8A 2QJKB 2XNDH 3AEBC 5AW5B 2AXTE 2J58A 2Q1KA 2LKMA 1NTZD 2YKQA 4XFJA 1VQ6P 1LJ2A 1S9KD 4AQRD 2QEXP 1SQVK 1NTMK 2KLUA 3GLMA 2P2UA 3M9QA 1M7LA 1NU1E 5AVRB 1PP9G 4H44D 3H1KD 4RESB 3VMYA 2Z5IA 3TYYA 2OYHA 2JEEA 1X79B 4PD4E 3H1KJ 4AUWA 1EDLA 2N1TB 1GK6A 3M9HA 3L75E 1VF5C 3W67A 2D2CB 1GW3A 5CBOA 1R5LA 3G6EP 1JNMA 4HJGH 1PPJG 2CPSA 2C9NY 3KPEA 1GL2C 1BCCD 2GA1A 3L70E 3MIWA 1YQ3C 3H1JD 3EFFK 2B88A 2KXPB 2M5AB 3H1LE 2YMKA 1BE3D 1KC8Q 3V2RA 5KAIH 1ZW0A 3I5CA 1KN7A 2A45H 2BEZF 2FYUE 3L72E 2E76B 4UB6E 3OA7A 1NWQA 1KYOE 2BASA 3CX5E 3TNUB 5H2FH 1M1JA 4NPDA 1G1IA 1VQ8P 1VQ5P 4I7ZB 2XKMA 2Q6QA 1JTHA 1NTZG 1BSNA 4GKGA 2MKVA 1IFIA 1Y8AA 1N7SD 1S9KE 3PHLA 3H32A 1R5SA 2P58A 4H0LB 1T2KC 2W83C 4HKZH 1SQBD 1S5LX 2WSCJ 4GT1A 3IF4A 3MZWB 1EXJA 1M8OB 1FJKA 4U3FD 4JYBA 3H1KE 2RH0A 1J1DB 1SQBJ 1SQQG 1KB9H 3MD0A 1X22A 1Q82Q 4R4MA 1RF1C 1HUCA 5TJHA 1L0NK 1NJIQ 1N86A 1NOHA 4N6JA 1L0LD 1URQB 1PGQA 4OGQB 2HODB 3RK2B 2OYIB 1AQ5A 5B5EE 1BCCE 4EYYQ 2IZ1A 2DW3A 2CK3H 4XA4A 3Q5PA 2Z5HA 1DEEG 3R4YA 3L73D 3GF3A 3V4QA 1BE3E 2NZ2A 5AW2B 1LNQA 2IBZI 2NPSB 4ASVA 1BDCA 1T6AA 1YYCA 1SQPK 3CL3D 3EWKA 3GHGC 3ABVC 2N1TD 2POHA 4H44C 2WQYC 3O6QA 2B9BA 3CCJP 2FFDA 2D2CD 1K04A 4R4LA 2PAJA 3JCUE 1RQUA 1BSHA 1W2BO 1QL2A 1M1KQ 3RGUA 2WSFJ 1UIIA 3IFMA 4ASWA 3L74J 2KYVA 1AFOA 5CJ0A 3A0BE 3WUVA 1QLED 5CCGA 3L71J 4M3LA 3VTPC 2P67A 1JCCA 3P8MC 1SQBE 4BWNA 1H0TB 1NHLA 1HF9A 3TSIA 3F5HA 2E76D 3S4RA 2B87B 1LTIC 1GTWA 1LWUB 2HFED 2IPPA 3KZIH 3C8VA 1GU5A 1NVOA 1FZEA 2OYOA 3MUDC 1NTZK 2O3JA 1HWTC 1E79H 3L35A 2M3BA 4L73A 3CWBJ 5KJ7A 1L0LE 1SQVD 1JM0A 3IR9A 1JY3P 3BCCG 3WU2H 2L91A 4H0LD 2A06D 1GMJA 2QG4A 3SFEC 1NTMJ 2ZFCA 1GD2E 3H1ID 5EFWB 1FZCB 1N7SC 1SLQA 1IFJA 1SQQK 2KS1B 4D6TD 1T8ZA 3CCRP 2O01H 1AA0A 3RK3E 3AE2C 3E7KA 1NH4A 4H13C 4HYTB 3H1IJ 3FXEA 2Q3IA 2YO3A 1QVGO 1IO4A 3AE8C 2JO1A 1RH5B 3SSUA 3A3YB 1ZR4A 2AEFA 4O9BA 2K9JB 1URQD 4OGQD 1BGYG 4PJ0H 3USSA 1OX3A 5KLVD 2QM8A 3CCMP 3RK2D 2QJYC 2QJKC 4IL6H 3H1HG 4JYCA 2Y0CA 1YJWP 2NPSD 1IC2A 1SQXG 4RO0A 3S9OA 3L37A 2IYOA 5AW7B 3VP8A 3RK3C 2ZXEB 5KJ7C 1LTTC 1OWAA 1ZV8A 2IDBA 3CXHI 3CWBE 1QX8A 4HH2A 2WMMA 2N1TC 5AVQB 2D2CC 4PV1B 5TISE 1CI6B 3PLNA 1IJDB 1SQVE 1NTME 2W8ZA 4DOJA 3A2AA 4WY4B 2K88A 2FYNB 2A06E 1YI2P 3V2PA 3VN0A 5AW3B 3LW5J 3H1IE 2KIKA 2QVAA 3VMAA 3KYQA 1YJ9P 1KB9D 4D6TE 1Q7YQ 2J5UA 1LTAC 1ZLLA 2H89C 1J1EB 4ZKPA 1GW4A 2RMZA 2IYPA 2E76C 3NXSA 1L0NJ 1L0LK 1ZOYC 2WWWA 1LTSC 2ZVNB 2NPSA 3SWFA 1EZVG 5KLVE 2BCCG 4I7ZC 1VQ7P 5GTIH 1RHZB 2W27A 1PP9D 3CCUP 4C46A 3GMAA 1KFMA 1RE4A 4CPGA 3HE5A 1PP9J 4H0LC 3VP9A 5KAIE 2N9YB 1SFCA 1VPCA 1P84I 1JUNA 2HPCA 2H88C 1SQPJ 3L75J 2VRSA 3CD6P 5APTA 1H8AA 3CLQA 2P7JA 4YTPC 1U7JA 1Q2NA 2QSIA 2AEJA 1GL2A 2IFMA 1URQC 4KHXA 3H1LJ 3OAKA 2YIUB 2E75C 3RK2C 2OYIC 3VMXA 3Q5SA 1IZNB 1HVVA 2M0BA 3C1LA 2PFXA 2AEMA 3HUSB 3M0DC 1KB9E 4BRYB 4DJGA 3OW2O 2NPSC 1L0NE 1NKZB 4U7JA 2IZ0A 3P8CD 1VQ9P 5GTHH 3T97B 2R3SA 1L4AB 4B86A 4C7NA 3TF5A 3N7NA 3V4WA 1HTLC 1Q90D 2BEQD 1MV8A 1RE4C 4PV1D 2QA4P 3W68A 1NTZJ 5AVXB 1EQ7A 1JO5A 2MJZA 1R8EA 5CCHA 1SFCC 2JWDA 5AVYB 2V7QJ 1PP9E 4OH8B 2JJLA 1DD4A 1LTBC 4L75A 1SQQD 4PD4I 5CHXA 1H88A 1HBWA 1MFTA 3HTKA 3IAOA 3PRJA 1RF0C 1SQPE 1RY3A 1T3JA 1SQQJ 2O1KA 1K73Q 2Q3EA 2XV5A 3A7OA 1RF1A 1SVFA 2FKWB 3P7KA 1NAYA 2W6AA 1LWUC 4GOFA 3L36A 1PPJE 1FE6A 5KLVK 5AVTB 3CC4P 5L8RJ 2KSJA 1BCCJ 5KAFE 1FDMA 3E1RA 1LTGC 1S4XA 3H1JJ 4TLFA 1KILB 3L70G 2WSEJ 1BE3J 4W80A 3HD7B 2XU6A 2WPRA 1KYOI 3CX5I 2M8RA 3I55P 1FZCC 1ZN5A 1CSBA 2CPBA 3GHGA 3FWLA 2WVRA 2FYUG 3L72G 3CCEP 3B5NB 1P84H 1U57A 1DX7A 3B8EB 3PP5A 1H89A 2WPQA 1NTZE 1LP1A 5CCHC 3CC7P 1M90Q 1E5WA 2KNCA 2XZRA 1PL5A 5AW0B 3CMAP 3Q2YA 2ZT9B 3UIAA 2WITA 1NO4A 5B66H 1OFCX 2YXRB 3EQ2A 1SQQE 5AVUB 1GK4A 1ZR2A 4U3FJ 2K37A 4YXDC 1FDOA 1JY2O 2KOGA 2YMYA 1FC2C 1LTJA 3BVHA 1L4AD 4ZKUA 1LT9B 1QGKB 1TU3F 1IFNA 2Y9YA 5CBNA 1HJBA 2QIWA 2AXTH 3BCCD 3MUDA 4PJ0E 2P1JA 1ZRTD 1L0LJ 4I6MC 3H1JE 1AVOA 1OVUA 1S3JA 3MP7B 3BCCJ 3QWOC 4Y99B 4OVNF 4PV1C 2KZJA 2KK7A 3D6YA 5AW8B 5AVVB 3L73J 1N2DC 2FYNC 3Q5RA 1KORA 1G2CA 1N7SA 1GDTA 4PD4H 2IBZG 2RN0A 3NTNA 3A0HH 3G4SP 3G9RA 1SS1A 4JQ0D 1LGHB 1BGYD 1S5LH 4QMAA 1N7LA 3TGUG 1J1EC 5APWA 4MN4C 3H1HD 2R44A 2E43A 3HUSA 3VYIA 4BRYA 1YQ4C 1OVVA 1ZP0C 1KILD 3H1HJ 1KQGB 3BRVB 3GF7A 1OZHA 2WT7B 4U3FE 2ZXXA 3HD7D 3Q3DA 1USEA 1SQXD 2QJPB 1IK7A 2QE7H 1LTJC 3WMM0 3BATA 2K9YA 3PH0A 2Q9IA 1JEKA 2FXOA 3B5ND 1UIXA 2C0WA 3CXHD 2N1TA 3BCCE 1T3UA 3BRTB 1YIJP 1ZRTE 1SQVJ 1NTKG 2ZT9D 1JB0J 3L73E 4N3YB 2Q5UA 1NKNA
chains in the Genus database with same CATH topology
3P32A 1L0LK 2OYHA 2WWWA 4XE5B 1LTSC 2JEEA 5KTBA 2NPSA 3EFGA 1X79B 1YTZI 3SWFA 3LIDA 3HE4B 4AUWA 1G1JA 2N1TB 1GK6A 1QL1A 3M9HA 2W27A 1DEBA 2YKPA 4C46A 1NU1K 3HUSC 3C9IA 4WY4C 1KFMA 1GW3A 1RE4A 1FZBA 5AVWB 1JNMA 1FAVA 3HE5A 4DZOA 2I1KA 3VP9A 2CPSA 3RL0C 2OYHB 1SFCA 1VPCA 2C9NY 3KPEA 3TNUA 5AW1B 1GL2C 1L4AC 1M1JC 3RK3D 3U59A 5KJ7D 2R5DA 1JUNA 3MIWA 2HPCA 1Z56A 1N73A 2VRSA 1FOSF 5APTA 1IFMA 3M0AA 3V2RA 1GU4A 1H8AA 1WRGA 3I5CA 2A45H 5APXA 3CLQA 2P7JA 3HE5B 1MZ9A 3OA7A 1NWQA 1SFCB 2BASA 1DH3A 3TNUB 4I1LA 2HG5D 3T97A 4RESB 1GL2A 1L4AA 1M1JA 1URQC 1G1IA 2IFMA 4KHXA 5APVA 1A02F 3OAKA 2YO2A 2HPCB 3RK2C 2OYIC 3VMXA 2XKMA 3V5BA 5APQA 1RE3C 1X9VA 1HVVA 1JTHA 2HLOA 3HRNA 4N78D 2FYUK 3HUSB 4GKGA 3M0DC 1IFIA 3H6PA 1N7SD 1S9KE 2KP8A 3KQGA 3H32A 2GUSA 3II6A 2WSCH 2J59M 2NPSC 1T2KC 1NKZB 3P8CD 3RL0B 3VOPA 4GT1A 1GL2B 1L4AB 1M1JB 2WZ7A 4B86A 4C7NA 1URQA 1FJKA 2O1JA 2HODA 4JYBA 3N7NA 1J1DB 3V4WA 1HTLC 2OYIA 5AW9B 3MD0A 1MV8A 1JTHB 1RE3A 1RE4C 2E42A 5AVXB 1EQ7A 1RF1C 1JO5A 2MJZA 1HUCA 3M06A 3VMYA 3V2QA 4C7RA 1L0NK 3M0DA 2HYNA 3CI9A 1SFCC 5CCHA 3H32B 5AVYB 2Z4EA 4OH8B 2JJLA 1LTBC 5CHXA 5BU8B 1N86A 1H88A 1HBWA 1N73C 3HTKA 1MFZA 2FYZA 4C7NB 3E1IA 1NOHA 3L4FA 4N6JA 1URQB 2HODB 3B5NC 2C0XA 1RF0C 2FFDC 2H7HA 1CW5A 3RK2B 2OYIB 1NTKK 1RY3A 1T3JA 1AQ5A 2O1KA 1PFIA 1KILA 3NFQA 4XA4A 2XV5A 3A7OA 1RF1A 3U1AA 3VMZA 2Z5HA 1SVFA 3HD7A 2FKWB 2Q7CA 3P7KA 4JF7A 3V4QA 4LLHA 2W6AA 1LWUC 5AW2B 3L36A 2A45I 5KLVK 4WBAA 5AVTB 2NPSB 1YYCA 1SQPK 3CL3D 3GHGC 3HTKB 5CCGC 1J1DC 2N1TD 2POHA 2KSJA 3B5NA 4EIJA 1RF0A 1FDMA 2FFDA 1LTGC 1KILB 2WSEH 2PP6A 2PAJA 1W2EA 2WSFH 4W80A 1RF1B 1QL2A 3HD7B 2XU6A 4IFFA 2YKOA 3O8ZA 5APYA 3OJAB 4LC1A 2WPRA 1JY3O 2YNYA 3IFMA 2C9LY 1LWUA 2KYVA 1LT9C 1AFOA 2M8RA 5CJ0A 1HGVA 1FZCC 1ZN5A 1CSBA 2CPBA 3GHGA 1N73B 5CCGA 2GUVA 5CJ4A 4M3LA 1X8YA 3B5NB 3VTPC 2P67A 1SQXK 1JCCA 5AVSB 3P8MC 2FFDB 1DX7A 2WPSA 3B8EB 5CMZA 3PP5A 2N9BA 1H89A 1NHLA 2WPQA 5CCHC 3TSIA 3M9BA 2IX7C 4Y99C 4I2LC 2R32A 2QM7A 3SWYA 1E5WA 1LTIC 1SFCD 1GTWA 2XZRA 3R2PA 4WB4A 1JY3N 1LWUB 2HFED 2IPPA 3BASA 5AW0B 1FZGA 1HGZA 1LT9A 5AVZB 1GU5A 1FZEA 3UIAA 1FZCA 3GHGB 2WITA 1SQBK 1NO4A 1KFNA 1KILC 4IFDK 4GIFA 1NTZK 4AYCA 1FZFA 1HWTC 3EQ2A 5AVUB 1GK4A 3L35A 1ZR2A 2M3BA 3HD7C 5APSA 5KJ7A 4WY4D 5APUA 1IK9A 1VDFA 3LIEA 3IR9A 1JY3P 1JY2O 3HE4A 2KOGA 2YMYA 2XNXA 3RL0D 1LTJA 3U1CA 1GL2D 1L4AD 3BVHA 4ZKUA 1MUUA 1LT9B 1HH0A 2ZFCA 1IFNA 1GD2E 1CZQA 3MGNA 3M91A 1FZCB 1N7SC 1HJBA 1IFDA 1SLQA 1IFJA 1SQQK 2KLVA 2KB7P 1T8ZA 3N4XA 2O01H 3MUDA 1WT6A 2P1JA 1NH4A 1FU1A 3MTUE 4HYTB 4I6MC 1JCDA 3RK3B 5AW6B 1NAFA 2OARA 1FBMA 2Q3IA 2YO3A 1XTGB 1IO4A 4Y99B 3V2NA 1GZLA 2H8PD 1JY2N 3A3YB 5AW8B 1ZR4A 1LTJB 4O9BA 5AVVB 1N2DC 1URQD 2XDJA 5BVZA 2QM8A 1G2CA 1N7SA 1FJPA 2H43A 3RK2D 1FOSE 1GDTA 2A45G 3NTNA 4JYCA 1JOCA 2WT7A 1JY2P 4W7YA 5CCHD 4EOTA 1LGHB 4IFMA 2W6BA 4N78E 1N7LA 2NPSD 1J1EC 1T2KD 1SP4A 1IC2A 1CI6A 3NMDA 5APWA 5AW4B 3G3ZA 2E43A 1J2JB 3HUSA 3VYIA 4WY4A 3L37A 3A5TA 1G2CB 1N7SB 3P8CE 1OXZA 5AW7B 3VP8A 3RK3C 2ZXEB 1KILD 5KJ7C 1LTTC 4LGDE 1OWAA 1ZV8A 3BRVB 3TK1A 2WT7B 2FXMA 3HD7D 4HH2A 2N1TC 2R3CA 5AVQB 2R5BA 2IFNA 1LTJC 3WMM0 3BATA 1A02J 1CI6B 1XTCC 1IJDB 2GM4A 2Q9IA 1YTZT 4DOJA 3A2AA 4WY4B 5BU5A 3B5ND 2OYHC 1JMMA 3V2PA 3VN0A 5AW3B 3LW5H 5AW5B 2J58A 2WTYA 1KQLA 2C0WA 2LKMA 3KYQA 2YKQA 2N1TA 1S9KD 3KDPB 1T3UA 4AQRD 3BRTB 1LTAC 1SQVK 4W7ZA 1ZLLA 1NTMK 1KZUB 2P2UA 1J1EB 4ZKPA 3M9QA 1GW4A 1M7LA 2I1JA 1FZAA 5CCGD 4N3YB 2Q5UA 5AVRB 2L5GB 3NXSA 2Z5IA 3TYYA 1NKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P32 A;  1CSB A;  2QM8 A;  2WWW A;  4XE5 B;  4GT1 A;  1FOS E;  4B86 A;  4C7N A;  4M3L A;  1X8Y A;  3VTP C;  3NTN A;  2P67 A;  4JYC A;  4JYB A;  3SWF A;  5AVS B;  3P8M C;  2WPS A;  3LID A;  2WT7 A;  3B8E B;  3V4W A;  5CMZ A;  3HE4 B;  4AUW A;  2N9B A;  5AW9 B;  3MD0 A;  2WPQ A;  1GK6 A;  1MV8 A;  1H89 A;  3M9H A;  4EOT A;  2E42 A;  5AVX B;  2W27 A;  3M9B A;  4C46 A;  1HUC A;  3M06 A;  3VMY A;  4I2L C;  2R32 A;  2QM7 A;  1T2K D;  1SP4 A;  3M0D A;  1GTW A;  2XZR A;  1CI6 A;  3NMD A;  5AVW B;  5APW A;  5AW4 B;  5AVY B;  1JNM A;  5AW0 B;  2IPP A;  1FAV A;  2JJL A;  3HE5 A;  2E43 A;  1J2J B;  3VYI A;  4DZO A;  5AVZ B;  1GU5 A;  3L37 A;  1HBW A;  3UIA A;  1G2C B;  3A5T A;  1H88 A;  2C9N Y;  3HTK A;  1MFZ A;  5AW1 B;  3TNU A;  4C7N B;  1OXZ A;  5AW7 B;  2R5D A;  2ZXE B;  1JUN A;  1OWA A;  3TK1 A;  4AYC A;  1HWT C;  2H7H A;  2WT7 B;  5AVU B;  1GK4 A;  3L35 A;  2VRS A;  5APS A;  1FOS F;  2R3C A;  5APU A;  5APT A;  3NFQ A;  5AVQ B;  3LIE A;  3IR9 A;  2R5B A;  2XV5 A;  3A7O A;  3M0A A;  3HE4 A;  3VMZ A;  2Z5H A;  1GU4 A;  2Q7C A;  1H8A A;  3P7K A;  3V4Q A;  3I5C A;  1A02 J;  1CI6 B;  2W6A A;  5AW2 B;  5APX A;  2P7J A;  3L36 A;  3HE5 B;  1MUU A;  3A2A A;  5AVT B;  2ZFC A;  1GD2 E;  1CZQ A;  3MGN A;  1NWQ A;  2BAS A;  3M91 A;  1DH3 A;  1YYC A;  1HJB A;  1SLQ A;  3TNU B;  3T97 A;  3VN0 A;  5AW3 B;  4RES B;  5APV A;  4KHX A;  5AW5 B;  1A02 F;  3OAK A;  2YO2 A;  4HYT B;  4I6M C;  2WTY A;  1KQL A;  3VMX A;  5AW6 B;  1NAF A;  3V5B A;  5APQ A;  2Q3I A;  1S9K D;  2YO3 A;  3KDP B;  4AQR D;  1IO4 A;  1GZL A;  2XU6 A;  3O8Z A;  4GKG A;  4LC1 A;  5APY A;  2P2U A;  2WPR A;  2YNY A;  1S9K E;  2KP8 A;  3A3Y B;  3KQG A;  5AW8 B;  2C9L Y;  5AVV B;  2Q5U A;  5AVR B;  1T2K C;  3NXS A;  2Z5I A;  3TYY A; 
#chains in the Genus database with same CATH topology
 3RL0 g;  4XE5 B;  5E79 H;  1AV1 A;  3RBZ A;  2YIU C;  4D6T J;  4RJT A;  1VQN P;  1YJN P;  3HE4 B;  1G1J A;  2M5A A;  1QL1 A;  2YKP A;  3HUS C;  1FZB A;  1OW7 A;  3FX0 A;  2KSE A;  1EZV D;  2I1K A;  1FS0 E;  5KKZ B;  2BCC D;  2OYH B;  3L74 G;  3D6Z A;  3TNU A;  2SPZ A;  4NPE A;  1L4A C;  5AW1 B;  3U59 A;  3H1H E;  1VQK P;  5KLV J;  2M3E A;  1Z56 A;  3L71 G;  1KQS O;  1FOS F;  1GU4 A;  1SQX E;  3AE1 C;  5APX A;  1LT1 A;  3IN6 A;  2E74 B;  1EDJ A;  1DH3 A;  1QVF O;  2HG5 D;  4EI2 A;  5APV A;  1P84 D;  1A02 F;  5GTH E;  3V5B A;  5APQ A;  1RE3 C;  1X9V A;  2JP3 A;  2HLO A;  3GG2 A;  3HRN A;  4N78 D;  3AE3 C;  2KP8 A;  3KQG A;  3A0B H;  3Q1M A;  2WSC H;  1M57 D;  3RL0 B;  2Y0D A;  1M1J B;  1L2P A;  1NTM G;  1URQ A;  1AVY A;  4TT3 H;  2O1J A;  2HOD A;  2P10 A;  1VQM P;  2OYI A;  4JBZ A;  1OMI A;  1JTH B;  3M06 A;  3V2Q A;  4C7R A;  3M0D A;  1OIP A;  3CI9 A;  3H32 B;  2Z4E A;  4UB8 H;  3WUU A;  3WUT A;  5BU8 B;  3AEG C;  3AEC C;  2K3R A;  2FYZ A;  3E1I A;  3L4F A;  4YPC A;  3K5B A;  1EZV E;  3B5N C;  2NRG A;  2BCC E;  1MKM A;  1NTK K;  1YBK A;  3CC2 P;  3AE7 C;  3U1A A;  3VMZ A;  4JF7 A;  4LLH A;  3MHV A;  1NU1 D;  2OTK E;  3V6I A;  2A45 I;  4WBA A;  2ZT9 C;  2B89 A;  2UWJ E;  4EDF A;  1J1D C;  4PD4 D;  5H2F E;  1KMI Z;  1RF0 A;  4DT0 A;  1H0T A;  2KUB A;  1W2E A;  2WSF H;  2JR8 A;  3OJA B;  1JY3 O;  2B87 A;  2YNY A;  2W90 A;  2C9L Y;  1LWU A;  1K8A Q;  1HJ0 A;  1PGJ A;  2FXP A;  1LT9 C;  2ZVO B;  4OGQ C;  1HGV A;  3ITK A;  3L70 D;  1N73 B;  1FDI A;  2FBW C;  4NPF X;  5CJ4 A;  3O6Q B;  1SQX K;  4HB1 A;  2FFD B;  5CMZ A;  1VQL P;  4YXW H;  2N9B A;  2W6J H;  1KB9 I;  4H13 B;  1JMB A;  3M9B A;  4Y99 C;  1PGP A;  2R32 A;  3SWY A;  2E74 D;  2FYU D;  3L72 D;  3KXD A;  1FZG A;  1FZC A;  2Y9Z A;  4WWI A;  2KS1 A;  1KFN A;  5K5G B;  1DD3 A;  3CXH H;  4AYC A;  1FZF A;  4WY4 D;  1VDF A;  3LIE A;  3HE4 A;  5TIS H;  2OTJ P;  3RL0 D;  3U1C A;  2K9J A;  1NU1 G;  1HH0 A;  1NGM B;  1CZQ A;  1IFD A;  1PGO A;  2WPV B;  2KB7 P;  1VQO P;  3SWK A;  2PGD A;  2O01 J;  3MTU E;  1JCD A;  1Q81 Q;  3RK3 B;  5AW6 B;  2QJP C;  1FBM A;  1SQP G;  3L75 G;  1VQP P;  1GZL A;  2H8P D;  1JY2 N;  3A0H E;  4OWF A;  1YIT P;  4WVZ A;  1S5L E;  1K05 A;  1EDI A;  1FJP A;  3FXD A;  1FOS E;  4ZMD A;  4Z1M H;  1JOC A;  2LXC B;  3H1L G;  4EOT A;  4IFM A;  2W6B A;  4L74 A;  1SP4 A;  1CI6 A;  3NMD A;  5AW4 B;  2IBZ D;  3G3Z A;  1K9M Q;  3KZI E;  4WY4 A;  2I8D A;  2K1A A;  3FWN A;  1U7M A;  3P8C E;  1AQT A;  4LGD E;  4JPZ B;  3TK1 A;  3TGU D;  2FXM A;  5DJU B;  2LXB A;  2JKV A;  1EDK A;  2IFN A;  3TGU J;  3WU2 E;  2ITA A;  1EXI A;  2GM4 A;  3B4S A;  1YTZ T;  5KKZ C;  2OYH C;  2PRR A;  1JMM A;  3LW5 H;  4RKU J;  2WSS H;  2ZYD A;  2JDI H;  1S1C X;  4H13 D;  2WTY A;  5KLI B;  1KQL A;  3H1K G;  5E79 E;  4GDO A;  3G71 P;  2OGU A;  1AJY A;  3KDP B;  3CCS P;  4W7Z A;  1KZU B;  2I1J A;  1FZA A;  5CCG D;  4K35 A;  3CCV P;  2E74 C;  2L5G B;  3P32 A;  3CCQ P;  5KTB A;  3EFG A;  1YTZ I;  1NTK D;  4IL6 E;  3LID A;  3KHU A;  1BCC G;  2E75 B;  1DEB A;  1NU1 K;  3H1J G;  2FY8 A;  1NTK J;  3C9I A;  4WY4 C;  3H25 A;  3ZDM A;  5AVW B;  1BE3 G;  1FAV A;  3D71 A;  4DZO A;  3TDK A;  3RL0 C;  1M1J C;  3RK3 D;  2IBZ E;  5KJ7 D;  2R5D A;  3GW6 A;  1ZME C;  1N73 A;  4Y28 J;  1EC5 A;  2G8Y A;  1IFM A;  3TGU E;  3M0A A;  3L74 D;  1BGY J;  1WRG A;  4L76 A;  3HE5 B;  1MZ9 A;  4A7P A;  1SFC B;  3L71 D;  4I1L A;  3T97 A;  1L4A A;  1USD A;  5KAF H;  2YO2 A;  2HPC B;  1KQF B;  1YHQ P;  1SQB G;  1N8R Q;  3JC2 2;  1VF5 B;  1SQX J;  4U3F G;  2ZYG A;  2FYU K;  4IL6 X;  4UB6 H;  1KYO H;  3CX5 H;  3H6P A;  2GUS A;  3II6 A;  2J59 M;  3VOP A;  2V4H A;  1GL2 B;  2WZ7 A;  3AEE C;  4UB8 E;  1OW6 A;  3CWB D;  1Q86 Q;  1IFP A;  5AW9 B;  1RE3 A;  2E42 A;  5GTI E;  1L0L G;  1NTK E;  2V7Q H;  1NTM D;  2HYN A;  1KD1 Q;  1N73 C;  1MFZ A;  3L73 G;  4C7N B;  4DCK A;  1WMK A;  2C0X A;  2ZYA A;  2FFD C;  2H7H A;  1CW5 A;  2KZI A;  2OTL P;  1PFI A;  1KIL A;  3NFQ A;  3HD7 A;  2Q7C A;  1BGY E;  3QH9 A;  4KJM A;  3L74 E;  1Y9B A;  3HTK B;  5CCG C;  2BCC J;  5B5E H;  1PZQ A;  3JSV C;  2JWA A;  1Y47 A;  3B5N A;  1KIL E;  4EIJ A;  5M1B A;  2E75 D;  4KT0 J;  3L71 E;  2HR3 A;  2WSE H;  2PP6 A;  1RF1 B;  4IFF A;  2YKO A;  3O8Z A;  5APY A;  4LC1 A;  1S72 P;  2AXC A;  1ZXG A;  1PIX A;  2LR2 A;  3AE6 C;  2GUV A;  3AE4 C;  1X8Y A;  3JCU H;  5AVS B;  2RKL A;  2WPS A;  1NYH A;  1KTM A;  3CWB G;  3CXH E;  5DJT B;  2KI7 B;  2IX7 C;  4I2L C;  2QM7 A;  1SFC D;  1QEX A;  3R2P A;  4WB4 A;  1JY3 N;  3BAS A;  1HGZ A;  1SQV G;  1LT9 A;  1D7M A;  2G3A A;  5AVZ B;  3GHG B;  2A06 G;  2ZAE B;  1SQB K;  1RQV A;  1KIL C;  4H44 B;  4IFD K;  4GIF A;  1VF5 D;  3S1K A;  3H1I G;  3HD7 C;  5APS A;  3B71 A;  5APU A;  1IK9 A;  1LP1 B;  4D6T G;  1KV4 A;  2XNX A;  1DIP A;  2KNC B;  3CCL P;  1GL2 D;  1L0N D;  2O01 N;  1MUU A;  3MGN A;  1EZV I;  3M91 A;  1X0T A;  2KLV A;  3CPW O;  3FGA D;  3N4X A;  4GOE A;  1WT6 A;  1FU1 A;  2ZJS E;  1NAF A;  2E5Y A;  5KLV G;  2OAR A;  1XTG B;  1W5C E;  4BXL A;  4K3A A;  1BDD A;  3V2N A;  1LTJ B;  3D70 A;  1NU1 J;  4IOI H;  3AEF C;  2XDJ A;  5BVZ A;  2H43 A;  1PV3 A;  2E5T A;  2A45 G;  1SQP D;  3L75 D;  2Y0E A;  5KLI C;  1P84 E;  2WT7 A;  1JY2 P;  4W7Y A;  1OVR A;  3CME P;  5CCH D;  3RBX A;  3AED C;  3AE5 C;  1VQ4 P;  4N78 E;  1T2K D;  1PPJ D;  3PJS K;  3I56 P;  1J2J B;  4GOD A;  1M56 D;  2QRX A;  3A5T A;  1G2C B;  1N7S B;  2YXQ B;  3H1L D;  1OXZ A;  3L70 J;  4ZNC A;  1VL2 A;  5B66 E;  3SFD C;  2OQQ A;  2R3C A;  3AE9 C;  2R5B A;  1KYO D;  3CX5 D;  1A02 J;  1XTC C;  5C39 A;  2FYU J;  3F89 A;  3L72 J;  5BU5 A;  3AEA C;  1L0N G;  3PTZ A;  1S2E A;  2QJY B;  1OW8 A;  2QJK B;  2XND H;  3AEB C;  5AW5 B;  2AXT E;  2J58 A;  2Q1K A;  2LKM A;  1NTZ D;  2YKQ A;  4XFJ A;  1VQ6 P;  1LJ2 A;  1S9K D;  4AQR D;  2QEX P;  1SQV K;  1NTM K;  2KLU A;  3GLM A;  2P2U A;  3M9Q A;  1M7L A;  1NU1 E;  5AVR B;  1PP9 G;  4H44 D;  3H1K D;  4RES B;  3VMY A;  2Z5I A;  3TYY A;  2OYH A;  2JEE A;  1X79 B;  4PD4 E;  3H1K J;  4AUW A;  1EDL A;  2N1T B;  1GK6 A;  3M9H A;  3L75 E;  1VF5 C;  3W67 A;  2D2C B;  1GW3 A;  5CBO A;  1R5L A;  3G6E P;  1JNM A;  4HJG H;  1PPJ G;  2CPS A;  2C9N Y;  3KPE A;  1GL2 C;  1BCC D;  2GA1 A;  3L70 E;  3MIW A;  1YQ3 C;  3H1J D;  3EFF K;  2B88 A;  2KXP B;  2M5A B;  3H1L E;  2YMK A;  1BE3 D;  1KC8 Q;  3V2R A;  5KAI H;  1ZW0 A;  3I5C A;  1KN7 A;  2A45 H;  2BEZ F;  2FYU E;  3L72 E;  2E76 B;  4UB6 E;  3OA7 A;  1NWQ A;  1KYO E;  2BAS A;  3CX5 E;  3TNU B;  5H2F H;  1M1J A;  4NPD A;  1G1I A;  1VQ8 P;  1VQ5 P;  4I7Z B;  2XKM A;  2Q6Q A;  1JTH A;  1NTZ G;  1BSN A;  4GKG A;  2MKV A;  1IFI A;  1Y8A A;  1N7S D;  1S9K E;  3PHL A;  3H32 A;  1R5S A;  2P58 A;  4H0L B;  1T2K C;  2W83 C;  4HKZ H;  1SQB D;  1S5L X;  2WSC J;  4GT1 A;  3IF4 A;  3MZW B;  1EXJ A;  1M8O B;  1FJK A;  4U3F D;  4JYB A;  3H1K E;  2RH0 A;  1J1D B;  1SQB J;  1SQQ G;  1KB9 H;  3MD0 A;  1X22 A;  1Q82 Q;  4R4M A;  1RF1 C;  1HUC A;  5TJH A;  1L0N K;  1NJI Q;  1N86 A;  1NOH A;  4N6J A;  1L0L D;  1URQ B;  1PGQ A;  4OGQ B;  2HOD B;  3RK2 B;  2OYI B;  1AQ5 A;  5B5E E;  1BCC E;  4EYY Q;  2IZ1 A;  2DW3 A;  2CK3 H;  4XA4 A;  3Q5P A;  2Z5H A;  1DEE G;  3R4Y A;  3L73 D;  3GF3 A;  3V4Q A;  1BE3 E;  2NZ2 A;  5AW2 B;  1LNQ A;  2IBZ I;  2NPS B;  4ASV A;  1BDC A;  1T6A A;  1YYC A;  1SQP K;  3CL3 D;  3EWK A;  3GHG C;  3ABV C;  2N1T D;  2POH A;  4H44 C;  2WQY C;  3O6Q A;  2B9B A;  3CCJ P;  2FFD A;  2D2C D;  1K04 A;  4R4L A;  2PAJ A;  3JCU E;  1RQU A;  1BSH A;  1W2B O;  1QL2 A;  1M1K Q;  3RGU A;  2WSF J;  1UII A;  3IFM A;  4ASW A;  3L74 J;  2KYV A;  1AFO A;  5CJ0 A;  3A0B E;  3WUV A;  1QLE D;  5CCG A;  3L71 J;  4M3L A;  3VTP C;  2P67 A;  1JCC A;  3P8M C;  1SQB E;  4BWN A;  1H0T B;  1NHL A;  1HF9 A;  3TSI A;  3F5H A;  2E76 D;  3S4R A;  2B87 B;  1LTI C;  1GTW A;  1LWU B;  2HFE D;  2IPP A;  3KZI H;  3C8V A;  1GU5 A;  1NVO A;  1FZE A;  2OYO A;  3MUD C;  1NTZ K;  2O3J A;  1HWT C;  1E79 H;  3L35 A;  2M3B A;  4L73 A;  3CWB J;  5KJ7 A;  1L0L E;  1SQV D;  1JM0 A;  3IR9 A;  1JY3 P;  3BCC G;  3WU2 H;  2L91 A;  4H0L D;  2A06 D;  1GMJ A;  2QG4 A;  3SFE C;  1NTM J;  2ZFC A;  1GD2 E;  3H1I D;  5EFW B;  1FZC B;  1N7S C;  1SLQ A;  1IFJ A;  1SQQ K;  2KS1 B;  4D6T D;  1T8Z A;  3CCR P;  2O01 H;  1AA0 A;  3RK3 E;  3AE2 C;  3E7K A;  1NH4 A;  4H13 C;  4HYT B;  3H1I J;  3FXE A;  2Q3I A;  2YO3 A;  1QVG O;  1IO4 A;  3AE8 C;  2JO1 A;  1RH5 B;  3SSU A;  3A3Y B;  1ZR4 A;  2AEF A;  4O9B A;  2K9J B;  1URQ D;  4OGQ D;  1BGY G;  4PJ0 H;  3USS A;  1OX3 A;  5KLV D;  2QM8 A;  3CCM P;  3RK2 D;  2QJY C;  2QJK C;  4IL6 H;  3H1H G;  4JYC A;  2Y0C A;  1YJW P;  2NPS D;  1IC2 A;  1SQX G;  4RO0 A;  3S9O A;  3L37 A;  2IYO A;  5AW7 B;  3VP8 A;  3RK3 C;  2ZXE B;  5KJ7 C;  1LTT C;  1OWA A;  1ZV8 A;  2IDB A;  3CXH I;  3CWB E;  1QX8 A;  4HH2 A;  2WMM A;  2N1T C;  5AVQ B;  2D2C C;  4PV1 B;  5TIS E;  1CI6 B;  3PLN A;  1IJD B;  1SQV E;  1NTM E;  2W8Z A;  4DOJ A;  3A2A A;  4WY4 B;  2K88 A;  2FYN B;  2A06 E;  1YI2 P;  3V2P A;  3VN0 A;  5AW3 B;  3LW5 J;  3H1I E;  2KIK A;  2QVA A;  3VMA A;  3KYQ A;  1YJ9 P;  1KB9 D;  4D6T E;  1Q7Y Q;  2J5U A;  1LTA C;  1ZLL A;  2H89 C;  1J1E B;  4ZKP A;  1GW4 A;  2RMZ A;  2IYP A;  2E76 C;  3NXS A;  1L0N J;  1L0L K;  1ZOY C;  2WWW A;  1LTS C;  2ZVN B;  2NPS A;  3SWF A;  1EZV G;  5KLV E;  2BCC G;  4I7Z C;  1VQ7 P;  5GTI H;  1RHZ B;  2W27 A;  1PP9 D;  3CCU P;  4C46 A;  3GMA A;  1KFM A;  1RE4 A;  4CPG A;  3HE5 A;  1PP9 J;  4H0L C;  3VP9 A;  5KAI E;  2N9Y B;  1SFC A;  1VPC A;  1P84 I;  1JUN A;  2HPC A;  2H88 C;  1SQP J;  3L75 J;  2VRS A;  3CD6 P;  5APT A;  1H8A A;  3CLQ A;  2P7J A;  4YTP C;  1U7J A;  1Q2N A;  2QSI A;  2AEJ A;  1GL2 A;  2IFM A;  1URQ C;  4KHX A;  3H1L J;  3OAK A;  2YIU B;  2E75 C;  3RK2 C;  2OYI C;  3VMX A;  3Q5S A;  1IZN B;  1HVV A;  2M0B A;  3C1L A;  2PFX A;  2AEM A;  3HUS B;  3M0D C;  1KB9 E;  4BRY B;  4DJG A;  3OW2 O;  2NPS C;  1L0N E;  1NKZ B;  4U7J A;  2IZ0 A;  3P8C D;  1VQ9 P;  5GTH H;  3T97 B;  2R3S A;  1L4A B;  4B86 A;  4C7N A;  3TF5 A;  3N7N A;  3V4W A;  1HTL C;  1Q90 D;  2BEQ D;  1MV8 A;  1RE4 C;  4PV1 D;  2QA4 P;  3W68 A;  1NTZ J;  5AVX B;  1EQ7 A;  1JO5 A;  2MJZ A;  1R8E A;  5CCH A;  1SFC C;  2JWD A;  5AVY B;  2V7Q J;  1PP9 E;  4OH8 B;  2JJL A;  1DD4 A;  1LTB C;  4L75 A;  1SQQ D;  4PD4 I;  5CHX A;  1H88 A;  1HBW A;  1MFT A;  3HTK A;  3IAO A;  3PRJ A;  1RF0 C;  1SQP E;  1RY3 A;  1T3J A;  1SQQ J;  2O1K A;  1K73 Q;  2Q3E A;  2XV5 A;  3A7O A;  1RF1 A;  1SVF A;  2FKW B;  3P7K A;  1NAY A;  2W6A A;  1LWU C;  4GOF A;  3L36 A;  1PPJ E;  1FE6 A;  5KLV K;  5AVT B;  3CC4 P;  5L8R J;  2KSJ A;  1BCC J;  5KAF E;  1FDM A;  3E1R A;  1LTG C;  1S4X A;  3H1J J;  4TLF A;  1KIL B;  3L70 G;  2WSE J;  1BE3 J;  4W80 A;  3HD7 B;  2XU6 A;  2WPR A;  1KYO I;  3CX5 I;  2M8R A;  3I55 P;  1FZC C;  1ZN5 A;  1CSB A;  2CPB A;  3GHG A;  3FWL A;  2WVR A;  2FYU G;  3L72 G;  3CCE P;  3B5N B;  1P84 H;  1U57 A;  1DX7 A;  3B8E B;  3PP5 A;  1H89 A;  2WPQ A;  1NTZ E;  1LP1 A;  5CCH C;  3CC7 P;  1M90 Q;  1E5W A;  2KNC A;  2XZR A;  1PL5 A;  5AW0 B;  3CMA P;  3Q2Y A;  2ZT9 B;  3UIA A;  2WIT A;  1NO4 A;  5B66 H;  1OFC X;  2YXR B;  3EQ2 A;  1SQQ E;  5AVU B;  1GK4 A;  1ZR2 A;  4U3F J;  2K37 A;  4YXD C;  1FDO A;  1JY2 O;  2KOG A;  2YMY A;  1FC2 C;  1LTJ A;  3BVH A;  1L4A D;  4ZKU A;  1LT9 B;  1QGK B;  1TU3 F;  1IFN A;  2Y9Y A;  5CBN A;  1HJB A;  2QIW A;  2AXT H;  3BCC D;  3MUD A;  4PJ0 E;  2P1J A;  1ZRT D;  1L0L J;  4I6M C;  3H1J E;  1AVO A;  1OVU A;  1S3J A;  3MP7 B;  3BCC J;  3QWO C;  4Y99 B;  4OVN F;  4PV1 C;  2KZJ A;  2KK7 A;  3D6Y A;  5AW8 B;  5AVV B;  3L73 J;  1N2D C;  2FYN C;  3Q5R A;  1KOR A;  1G2C A;  1N7S A;  1GDT A;  4PD4 H;  2IBZ G;  2RN0 A;  3NTN A;  3A0H H;  3G4S P;  3G9R A;  1SS1 A;  4JQ0 D;  1LGH B;  1BGY D;  1S5L H;  4QMA A;  1N7L A;  3TGU G;  1J1E C;  5APW A;  4MN4 C;  3H1H D;  2R44 A;  2E43 A;  3HUS A;  3VYI A;  4BRY A;  1YQ4 C;  1OVV A;  1ZP0 C;  1KIL D;  3H1H J;  1KQG B;  3BRV B;  3GF7 A;  1OZH A;  2WT7 B;  4U3F E;  2ZXX A;  3HD7 D;  3Q3D A;  1USE A;  1SQX D;  2QJP B;  1IK7 A;  2QE7 H;  1LTJ C;  3WMM 0;  3BAT A;  2K9Y A;  3PH0 A;  2Q9I A;  1JEK A;  2FXO A;  3B5N D;  1UIX A;  2C0W A;  3CXH D;  2N1T A;  3BCC E;  1T3U A;  3BRT B;  1YIJ P;  1ZRT E;  1SQV J;  1NTK G;  2ZT9 D;  1JB0 J;  3L73 E;  4N3Y B;  2Q5U A;  1NKN A; 
#chains in the Genus database with same CATH homology
 3P32 A;  1L0L K;  2OYH A;  2WWW A;  4XE5 B;  1LTS C;  2JEE A;  5KTB A;  2NPS A;  3EFG A;  1X79 B;  1YTZ I;  3SWF A;  3LID A;  3HE4 B;  4AUW A;  1G1J A;  2N1T B;  1GK6 A;  1QL1 A;  3M9H A;  2W27 A;  1DEB A;  2YKP A;  4C46 A;  1NU1 K;  3HUS C;  3C9I A;  4WY4 C;  1KFM A;  1GW3 A;  1RE4 A;  1FZB A;  5AVW B;  1JNM A;  1FAV A;  3HE5 A;  4DZO A;  2I1K A;  3VP9 A;  2CPS A;  3RL0 C;  2OYH B;  1SFC A;  1VPC A;  2C9N Y;  3KPE A;  3TNU A;  5AW1 B;  1GL2 C;  1L4A C;  1M1J C;  3RK3 D;  3U59 A;  5KJ7 D;  2R5D A;  1JUN A;  3MIW A;  2HPC A;  1Z56 A;  1N73 A;  2VRS A;  1FOS F;  5APT A;  1IFM A;  3M0A A;  3V2R A;  1GU4 A;  1H8A A;  1WRG A;  3I5C A;  2A45 H;  5APX A;  3CLQ A;  2P7J A;  3HE5 B;  1MZ9 A;  3OA7 A;  1NWQ A;  1SFC B;  2BAS A;  1DH3 A;  3TNU B;  4I1L A;  2HG5 D;  3T97 A;  4RES B;  1GL2 A;  1L4A A;  1M1J A;  1URQ C;  1G1I A;  2IFM A;  4KHX A;  5APV A;  1A02 F;  3OAK A;  2YO2 A;  2HPC B;  3RK2 C;  2OYI C;  3VMX A;  2XKM A;  3V5B A;  5APQ A;  1RE3 C;  1X9V A;  1HVV A;  1JTH A;  2HLO A;  3HRN A;  4N78 D;  2FYU K;  3HUS B;  4GKG A;  3M0D C;  1IFI A;  3H6P A;  1N7S D;  1S9K E;  2KP8 A;  3KQG A;  3H32 A;  2GUS A;  3II6 A;  2WSC H;  2J59 M;  2NPS C;  1T2K C;  1NKZ B;  3P8C D;  3RL0 B;  3VOP A;  4GT1 A;  1GL2 B;  1L4A B;  1M1J B;  2WZ7 A;  4B86 A;  4C7N A;  1URQ A;  1FJK A;  2O1J A;  2HOD A;  4JYB A;  3N7N A;  1J1D B;  3V4W A;  1HTL C;  2OYI A;  5AW9 B;  3MD0 A;  1MV8 A;  1JTH B;  1RE3 A;  1RE4 C;  2E42 A;  5AVX B;  1EQ7 A;  1RF1 C;  1JO5 A;  2MJZ A;  1HUC A;  3M06 A;  3VMY A;  3V2Q A;  4C7R A;  1L0N K;  3M0D A;  2HYN A;  3CI9 A;  1SFC C;  5CCH A;  3H32 B;  5AVY B;  2Z4E A;  4OH8 B;  2JJL A;  1LTB C;  5CHX A;  5BU8 B;  1N86 A;  1H88 A;  1HBW A;  1N73 C;  3HTK A;  1MFZ A;  2FYZ A;  4C7N B;  3E1I A;  1NOH A;  3L4F A;  4N6J A;  1URQ B;  2HOD B;  3B5N C;  2C0X A;  1RF0 C;  2FFD C;  2H7H A;  1CW5 A;  3RK2 B;  2OYI B;  1NTK K;  1RY3 A;  1T3J A;  1AQ5 A;  2O1K A;  1PFI A;  1KIL A;  3NFQ A;  4XA4 A;  2XV5 A;  3A7O A;  1RF1 A;  3U1A A;  3VMZ A;  2Z5H A;  1SVF A;  3HD7 A;  2FKW B;  2Q7C A;  3P7K A;  4JF7 A;  3V4Q A;  4LLH A;  2W6A A;  1LWU C;  5AW2 B;  3L36 A;  2A45 I;  5KLV K;  4WBA A;  5AVT B;  2NPS B;  1YYC A;  1SQP K;  3CL3 D;  3GHG C;  3HTK B;  5CCG C;  1J1D C;  2N1T D;  2POH A;  2KSJ A;  3B5N A;  4EIJ A;  1RF0 A;  1FDM A;  2FFD A;  1LTG C;  1KIL B;  2WSE H;  2PP6 A;  2PAJ A;  1W2E A;  2WSF H;  4W80 A;  1RF1 B;  1QL2 A;  3HD7 B;  2XU6 A;  4IFF A;  2YKO A;  3O8Z A;  5APY A;  3OJA B;  4LC1 A;  2WPR A;  1JY3 O;  2YNY A;  3IFM A;  2C9L Y;  1LWU A;  2KYV A;  1LT9 C;  1AFO A;  2M8R A;  5CJ0 A;  1HGV A;  1FZC C;  1ZN5 A;  1CSB A;  2CPB A;  3GHG A;  1N73 B;  5CCG A;  2GUV A;  5CJ4 A;  4M3L A;  1X8Y A;  3B5N B;  3VTP C;  2P67 A;  1SQX K;  1JCC A;  5AVS B;  3P8M C;  2FFD B;  1DX7 A;  2WPS A;  3B8E B;  5CMZ A;  3PP5 A;  2N9B A;  1H89 A;  1NHL A;  2WPQ A;  5CCH C;  3TSI A;  3M9B A;  2IX7 C;  4Y99 C;  4I2L C;  2R32 A;  2QM7 A;  3SWY A;  1E5W A;  1LTI C;  1SFC D;  1GTW A;  2XZR A;  3R2P A;  4WB4 A;  1JY3 N;  1LWU B;  2HFE D;  2IPP A;  3BAS A;  5AW0 B;  1FZG A;  1HGZ A;  1LT9 A;  5AVZ B;  1GU5 A;  1FZE A;  3UIA A;  1FZC A;  3GHG B;  2WIT A;  1SQB K;  1NO4 A;  1KFN A;  1KIL C;  4IFD K;  4GIF A;  1NTZ K;  4AYC A;  1FZF A;  1HWT C;  3EQ2 A;  5AVU B;  1GK4 A;  3L35 A;  1ZR2 A;  2M3B A;  3HD7 C;  5APS A;  5KJ7 A;  4WY4 D;  5APU A;  1IK9 A;  1VDF A;  3LIE A;  3IR9 A;  1JY3 P;  1JY2 O;  3HE4 A;  2KOG A;  2YMY A;  2XNX A;  3RL0 D;  1LTJ A;  3U1C A;  1GL2 D;  1L4A D;  3BVH A;  4ZKU A;  1MUU A;  1LT9 B;  1HH0 A;  2ZFC A;  1IFN A;  1GD2 E;  1CZQ A;  3MGN A;  3M91 A;  1FZC B;  1N7S C;  1HJB A;  1IFD A;  1SLQ A;  1IFJ A;  1SQQ K;  2KLV A;  2KB7 P;  1T8Z A;  3N4X A;  2O01 H;  3MUD A;  1WT6 A;  2P1J A;  1NH4 A;  1FU1 A;  3MTU E;  4HYT B;  4I6M C;  1JCD A;  3RK3 B;  5AW6 B;  1NAF A;  2OAR A;  1FBM A;  2Q3I A;  2YO3 A;  1XTG B;  1IO4 A;  4Y99 B;  3V2N A;  1GZL A;  2H8P D;  1JY2 N;  3A3Y B;  5AW8 B;  1ZR4 A;  1LTJ B;  4O9B A;  5AVV B;  1N2D C;  1URQ D;  2XDJ A;  5BVZ A;  2QM8 A;  1G2C A;  1N7S A;  1FJP A;  2H43 A;  3RK2 D;  1FOS E;  1GDT A;  2A45 G;  3NTN A;  4JYC A;  1JOC A;  2WT7 A;  1JY2 P;  4W7Y A;  5CCH D;  4EOT A;  1LGH B;  4IFM A;  2W6B A;  4N78 E;  1N7L A;  2NPS D;  1J1E C;  1T2K D;  1SP4 A;  1IC2 A;  1CI6 A;  3NMD A;  5APW A;  5AW4 B;  3G3Z A;  2E43 A;  1J2J B;  3HUS A;  3VYI A;  4WY4 A;  3L37 A;  3A5T A;  1G2C B;  1N7S B;  3P8C E;  1OXZ A;  5AW7 B;  3VP8 A;  3RK3 C;  2ZXE B;  1KIL D;  5KJ7 C;  1LTT C;  4LGD E;  1OWA A;  1ZV8 A;  3BRV B;  3TK1 A;  2WT7 B;  2FXM A;  3HD7 D;  4HH2 A;  2N1T C;  2R3C A;  5AVQ B;  2R5B A;  2IFN A;  1LTJ C;  3WMM 0;  3BAT A;  1A02 J;  1CI6 B;  1XTC C;  1IJD B;  2GM4 A;  2Q9I A;  1YTZ T;  4DOJ A;  3A2A A;  4WY4 B;  5BU5 A;  3B5N D;  2OYH C;  1JMM A;  3V2P A;  3VN0 A;  5AW3 B;  3LW5 H;  5AW5 B;  2J58 A;  2WTY A;  1KQL A;  2C0W A;  2LKM A;  3KYQ A;  2YKQ A;  2N1T A;  1S9K D;  3KDP B;  1T3U A;  4AQR D;  3BRT B;  1LTA C;  1SQV K;  4W7Z A;  1ZLL A;  1NTM K;  1KZU B;  2P2U A;  1J1E B;  4ZKP A;  3M9Q A;  1GW4 A;  1M7L A;  2I1J A;  1FZA A;  5CCG D;  4N3Y B;  2Q5U A;  5AVR B;  2L5G B;  3NXS A;  2Z5I A;  3TYY A;  1NKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...