1ZXGA

Solution structure of a219
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein A
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system/protein binding
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1zxgA00
2KZIA 2K3RA 4BXLA 1EDLA 2LXCB 2KI7B 2LXBA 1JMBA 4ASVA 2M5AA 2KUBA 2JWDA 1ZW0A 4K35A 2Q1KA 2KIKA 1ZXGA 2I8DA 4EYYQ 4ZNCA 1BDDA 1FC2C 2R44A 4HB1A 1S3JA 1DEEG 4GOFA 4WWIA 5EFWB 3MHVA 1JM0A 2OTKE 1EDIA 4IOIH 2B87B 3QWOC 5CBOA 1OVVA 1EDKA 2B89A 4JBZA 1Y47A 4NPDA 1LP1B 1MFTA 2HR3A 4NPEA 1LT1A 3RGUA 4K3AA 3PH0A 2B87A 1NVOA 5CBNA 1EDJA 3ZDMA 4ZMDA 4GODA 1SS1A 2RKLA 5C39A 2QRXA 5DJTB 2KS1B 2ZAEB 2KZJA 4NPFX 1BDCA 5DJUB 2P58A 2WMMA 1H0TB 4MN4C 2M5AB 1H0TA 3S1KA 1OVUA 1U7JA 2SPZA 4KJMA 2LR2A 1LP1A 1Q2NA 1U7MA 5K5GB 4GOEA 3FXEA 4HKZH 2UWJE 2QVAA 2M0BA 4CPGA 1OVRA 1EC5A 4HJGH 1X0TA 3FXDA 2B88A 3MZWB 4ASWA
chains in the Genus database with same CATH superfamily
2D2CC 1GU4A 2A45H 2QM8A 4KT0J 1M57D 1LTJC 2ZYDA 3G71P 2KIKA 1HBWA 1SFCC 4GT1A 5KLVD 3GF3A 3AE8C 2WZ7A 3H1HE 3VMXA 3MP7B 3IR9A 3L72J 5BVZA 1N7SC 3I55P 3CX5I 1KILB 1SQBK 4XFJA 3H1IE 1L0LJ 1NTZG 4JBZA 1L0NE 3M0DA 5CHXA 1S5LX 1OIPA 3AE4C 3BCCD 2KP8A 3LW5J 1E5WA 1KTMA 2B87A 1N86A 2CK3H 2BEQD 3WU2E 3CLQA 1AVOA 2QM7A 3CC4P 4YTPC 2XNDH 1OVUA 1VL2A 2FYNB 1U7JA 4OGQC 1GW3A 3L73G 1NTME 1AVYA 1RH5B 1EZVI 3RK2B 3LW5H 4CPGA 1X0TA 3BRVB 3HUSB 3Q3DA 2FXOA 3A0HE 2V7QJ 1SQBJ 1NGMB 4WY4D 4XA4A 1QL2A 1D7MA 1FC2C 3KYQA 2YMKA 1KQSO 2QSIA 4JQ0D 5AVQB 5GTIH 3MHVA 3A0BH 3OAKA 3R2PA 2HLOA 2AXTH 1GL2A 1LTGC 3L72G 1U57A 3RK3E 3GMAA 1DX7A 1Y8AA 1GTWA 2Q6QA 1NAYA 3L71E 2NRGA 3A0HH 1KD1Q 1Q7YQ 1SQVK 4YXDC 1HUCA 1L0LG 4O9BA 4AUWA 1JY2N 5E79E 1YYCA 1NVOA 2H43A 1LWUC 3CCUP 2N1TD 3G9RA 4WY4A 5CCHD 1IFJA 4A7PA 2FYUE 2ZT9D 2KZJA 2FXMA 3MUDC 4Y28J 5AW9B 3HE5B 2BCCE 1XTCC 4D6TD 3M9HA 3CI9A 3VOPA 1JUNA 1VDFA 1P84E 3CXHD 1JB0J 3SFDC 2RMZA 5AW0B 2OQQA 1X8YA 3H1LJ 3M06A 5E79H 2IBZE 5KLVK 1Q90D 3D6ZA 1PGJA 3K5BA 4EI2A 2WSEH 1E79H 3L75J 4AQRD 3TGUJ 1ZRTD 1T3JA 3TNUB 2QJYC 4QMAA 2O1KA 3PLNA 2IFMA 4PV1D 2KNCA 5CCHA 2YKOA 1VQOP 4LC1A 1PGOA 1NTZD 1LTIC 3M91A 4AYCA 5AW1B 1G2CB 2WSSH 3GHGA 3QWOC 3AEFC 1KYOH 1LTTC 2I1JA 3H32A 1SQXE 5KLIB 2WSFJ 1S4XA 4BRYA 4RO0A 1NYHA 2K1AA 1YI2P 3E1IA 3EFFK 3TF5A 1M1JB 1FOSE 1HVVA 2OYIB 4TLFA 5CCGA 4JYCA 2OTJP 4PD4E 2N1TB 2NPSD 2KS1B 1JEKA 2ZT9B 4RKUJ 2P58A 5AVUB 3CCQP 3F5HA 2WSFH 2H89C 1JY3P 1BGYG 1RF0C 1SFCB 5AW5B 1NH4A 5AW2B 1RF1A 3VMYA 1MKMA 1KILC 3SWKA 1AJYA 2LXBA 3BCCJ 3ABVC 3WUTA 2M5AA 3BVHA 1DEBA 4PD4H 2KUBA 3CWBE 4L74A 1AQTA 2PRRA 5AW8B 3CMAP 1BDDA 3L75G 1S9KD 1NO4A 1JY2P 3TGUG 1IFPA 1URQD 3HRNA 2RN0A 1BCCD 2FYNC 3A3YB 1VQ7P 2FYZA 2Z5HA 2Y0EA 3RK2C 1K8AQ 1SQQD 4IFMA 1S1CX 4PJ0E 2V4HA 4NPEA 1JY3O 2Y9YA 2OTLP 3KPEA 1R8EA 1DH3A 1N73B 4EDFA 1SS1A 1EXIA 2ZAEB 2K9JA 2WMMA 5APSA 3AE7C 3L70E 1OVRA 1NTKE 1BE3E 3HD7D 1CI6B 3MZWB 1T3UA 1NU1E 2QJPB 2FKWB 4BXLA 5KAIE 1JY2O 3T97B 1W2BO 1N8RQ 3V2QA 1K73Q 2JWDA 2FBWC 1WRGA 1NTZK 3AE5C 2O01H 3CCVP 1SLQA 1NKZB 3CX5E 5B66H 1SP4A 4D6TJ 3E1RA 1JM0A 5GTHE 2KK7A 3R4YA 3L74E 1IZNB 1YTZT 5KAIH 1S2EA 4UB6H 1FZGA 2P67A 4IL6E 3H1KE 2E76D 3N4XA 5AVRB 2Q3IA 2WPRA 1NJIQ 1PP9E 1BGYD 2HFED 1L4AD 1EZVE 4UB8E 1PZQA 1FZEA 5TJHA 2QE7H 2OYHB 2R3SA 3FX0A 1M90Q 3ITKA 1OW8A 2SPZA 1Q81Q 3AE2C 3FXEA 1M8OB 4IL6H 1KYOD 2KB7P 3I5CA 1SQPE 2WSCJ 2HODA 3AEGC 4TT3H 1YHQP 2K3RA 3L75D 4DZOA 3CCEP 2YO2A 4ZKPA 1VQLP 2HPCB 1L0LK 3M0AA 3TDKA 1QVGO 2KLVA 1L4AA 1LT9B 2FY8A 2W90A 1AV1A 1HGZA 2WQYC 2N1TC 1Y9BA 4D6TG 1OFCX 5CCHC 1SQQK 2ZT9C 3H1JD 4IOIH 5H2FE 3GHGC 3OJAB 1LTSC 1M1KQ 3MIWA 5TISH 2YXQB 2WPVB 3P32A 3B4SA 1YIJP 2C0XA 2P1JA 1YJ9P 2E76B 1NWQA 1T2KD 3G4SP 1RE3A 1FDMA 2E5YA 3P8CE 3IF4A 4OWFA 2I1KA 3NMDA 1J2JB 1MUUA 3L72E 3I56P 1OXZA 1NOHA 2E75D 1FZFA 5H2FH 4H0LD 1BCCJ 3SSUA 5AVZB 4Z1MH 4PV1C 1LP1A 4N78D 1L0NJ 1JCCA 4H44D 3CXHI 1SQQJ 2QG4A 1YITP 2KSJA 2ZFCA 2H88C 3HUSA 3GW6A 5AVSB 1GL2D 2A45G 3CCMP 1ZW0A 1WMKA 3MD0A 1FAVA 1YJWP 3B5ND 4C7NA 2ZVNB 4IL6X 4WWIA 2OARA 1N73C 4U3FE 2NPSC 1CW5A 2B9BA 1KB9E 2YO3A 1A02F 3O8ZA 3WU2H 2B87B 1T6AA 3IAOA 3OA7A 2RH0A 1N7LA 1VF5D 1SQBE 1OMIA 3F89A 1JY3N 2B89A 3P7KA 1Q82Q 2YKQA 2QJPC 2W6BA 2OYOA 1KQGB 1ZLLA 5AVVB 1FZCA 3PH0A 2A45I 3H1HG 1KB9H 2E75B 2WT7A 1K05A 1KFMA 3B5NA 4B86A 2P7JA 2AEJA 2VRSA 3HE5A 4H0LB 4HYTB 1BCCG 3AE6C 2LR2A 3H25A 2FFDA 3L71J 1BE3D 1URQC 2W8ZA 1G1JA 2C9NY 2UWJE 2ZXEB 1JOCA 1A02J 3CD6P 1L0NG 4I7ZC 2IX7C 1SQQG 3O6QA 3KDPB 1VQ9P 2YMYA 3CMEP 4HH2A 1GL2B 1BGYJ 3USSA 2E5TA 2FYUJ 2WSEJ 3CCJP 3FWNA 4ZNCA 2M3BA 1FJKA 1KILE 3TNUA 3Q5PA 3Q5SA 3L74D 1WT6A 2OYHC 4L76A 2JDIH 2R5BA 2BASA 5CCGD 1EDIA 1PGPA 3H1LE 4WY4B 1FOSF 4DOJA 1ZMEC 2Y0CA 2A06E 1HF9A 1VF5B 1IK9A 1SQVE 4W7YA 1N7SD 2Q3EA 3HD7C 1P84H 3B71A 3TGUE 1J1DB 1LT1A 1PPJE 1OW7A 3IFMA 2JR8A 1JMMA 3RBXA 3ZDMA 4ZMDA 2RKLA 5DJTB 4WB4A 1LT9C 2JEEA 3AE1C 2J58A 1H0TB 3H1JJ 1SQXJ 1KN7A 3BASA 1LTJA 3L71G 2KXPB 2M0BA 2WTYA 2YNYA 1LNQA 4L73A 4GKGA 3N7NA 2KNCB 1FBMA 4WBAA 3MTUE 1EDLA 2W6AA 3HE4A 2LXCB 1N7SA 1IFIA 5KLVE 1USEA 1KV4A 2E76C 3GHGB 2Z5IA 5APVA 2FYUG 3CC2P 3H32B 1RQVA 2BCCG 1LGHB 4HB1A 1L4AC 2O1JA 3KZIE 4BRYB 1JTHB 1LJ2A 1M7LA 1VQPP 2XV5A 5AW3B 2JP3A 3BCCE 1RE4A 3AEBC 5KJ7D 2IBZG 3H1HD 1VPCA 1EDKA 4RESB 1PFIA 2XU6A 2K37A 4NPDA 4PV1B 3V2RA 5L8RJ 1H89A 1GU5A 1RF1B 1EXJA 3H1ID 1EDJA 1IFMA 4DT0A 1L0ND 1JNMA 3A7OA 3GLMA 3II6A 2M5AB 3S1KA 1NKNA 3H1JG 2M8RA 3M0DC 1SQXG 5BU8B 3V2NA 1U7MA 3WUUA 1GK4A 4OVNF 4HJGH 5APUA 2KLUA 1KYOI 1K9MQ 2NPSB 1VQ6P 5KJ7A 3AECC 1NTMD 3SWYA 1RHZB 3T97A 2O01N 1R5LA 2O01J 3M9BA 2IDBA 5KTBA 1L2PA 1T2KC 4U3FD 1S3JA 1DEEG 4PJ0H 1KB9D 1OX3A 4LGDE 2AEMA 3S4RA 5AW6B 1BE3J 2KYVA 3PJSK 3KHUA 2E75C 3JCUE 4KHXA 2CPBA 3CCSP 2OTKE 3CC7P 1NU1J 4H0LC 1LWUA 4OH8B 1H88A 2K9YA 2N9BA 5AW7B 4H44C 1NHLA 2K9JB 3MUDA 2J5UA 3CWBG 5KAFE 2JKVA 3SFEC 3H6PA 3WUVA 1URQB 1USDA 3RK3D 3LIDA 2HR3A 1YTZI 1GL2C 1GMJA 4I7ZB 4D6TE 3GF7A 3L71D 1FE6A 3HTKA 3L74J 3B5NC 5AVYB 1ZR2A 3CX5H 2GA1A 1K04A 2BEZF 1HJ0A 3TSIA 1S72P 2FYUD 3L4FA 2E74D 1CZQA 2ITAA 5GTHH 4WY4C 2BCCD 1PP9J 1VF5C 1P84D 4YPCA 2KI7B 1ZRTE 1JMBA 1IFDA 1ZN5A 1NTZE 3NTNA 4K35A 2W27A 2Y0DA 1J1DC 1QL1A 2N9YB 3V6IA 3PHLA 3HD7B 2IBZD 3L70G 4GOFA 2IZ1A 2QJKC 2IYPA 4JF7A 1NTKG 4N6JA 1BE3G 4UB8H 1CSBA 3AEAC 2CPSA 1NU1G 2GUSA 3VP8A 3D6YA 1OVVA 5AW4B 3L73E 4H13D 2QA4P 4GDOA 1FS0E 1VQNP 1FJPA 1JO5A 1Y47A 3RL0D 1L0NK 1RF0A 3RK3B 2Y9ZA 3RGUA 1SQXD 1Q86Q 2M3EA 2HODB 1QGKB 1KILA 1GZLA 5C39A 4ZKUA 3L74G 4IFFA 1FZAA 2XNXA 3B8EB 4EOTA 4DJGA 2WVRA 3TYYA 1J1EC 1M56D 2NZ2A 1Q2NA 4PD4D 2IFNA 1NTMK 3H1KG 1RY3A 2W6JH 3H1HJ 1L4AB 5CCGC 1IO4A 1OW6A 4Y99C 2E74B 1QX8A 2XDJA 1PP9G 2JO1A 2W83C 1GDTA 1EZVG 1S9KE 4ASVA 2PFXA 4W80A 5KKZB 3H1IJ 1L0LE 1ZR4A 1RQUA 4W7ZA 3V4QA 1YBKA 1BCCE 3U59A 3UIAA 2ZYGA 1RF1C 3A2AA 1NAFA 5AVWB 1SQQE 5CMZA 3IN6A 3CWBD 1SQPG 1FU1A 2HG5D 1X22A 3AE9C 2POHA 1ZP0C 1R5SA 2L91A 4N3YB 1RE4C 2ZYAA 4H13B 2P2UA 1NTMJ 2J59M 1VQ5P 3RL0B 1LP1B 2QEXP 1MFTA 5GTIE 3A0BE 2ZVOB 1OWAA 1VQ8P 1ZV8A 4U3FJ 2AXTE 1X9VA 1BSNA 3VYIA 1DD4A 4GODA 3VTPC 2C0WA 2FYUK 4NPFX 5DJUB 2Q7CA 1XTGB 3SWFA 2E42A 4RJTA 4R4MA 2C9LY 4C7NB 3FXDA 3PTZA 1KC8Q 4BWNA 5KJ7C 3L70D 5APWA 1NTKD 2R32A 2V7QH 3H1IG 4EYYQ 1NU1D 4H44B 3L36A 1KQFB 3PP5A 1GD2E 1GW4A 3FWLA 3RBZA 3MGNA 1FZCB 3P8MC 4XE5B 3CX5D 1GK6A 1MFZA 5APXA 1YQ4C 3AEEC 3V4WA 1QEXA 2BCCJ 1BGYE 2D2CD 1PL5A 1SQXK 2AXCA 1IJDB 5APYA 2WT7B 2E43A 3B5NB 1KQLA 3C8VA 1NTMG 1LTAC 3EQ2A 2YIUC 2FFDB 4I6MC 1H8AA 2H8PD 1SFCD 3OW2O 2WITA 2R3CA 2JJLA 1G2CA 3W67A 4EIJA 1HTLC 4U3FG 5CBNA 1SVFA 3H1KD 3O6QB 3AEDC 2H7HA 1KFNA 1KYOE 1PP9D 1H0TA 1ZOYC 4KJMA 1HJBA 1EZVD 3L75E 4IFDK 1SQVJ 1SQBG 1M1JA 4HKZH 2OYIA 3G3ZA 1EC5A 3V2PA 3D71A 2QJKB 2N1TA 1QVFO 3CCLP 2KS1A 1T8ZA 2IZ0A 1IK7A 3TK1A 1N2DC 3VN0A 1SQPD 3RK3C 1SFCA 3D70A 2I8DA 3H1JE 2XZRA 4OGQD 3RL0g 2FXPA 5EFWB 5CJ4A 1JTHA 1KZUB 3AE3C 1AQ5A 1KB9I 3CL3D 2G8YA 3NXSA 3L73D 5M1BA 3A5TA 5APTA 4GIFA 3Q2YA 3L35A 5CBOA 2P10A 4I1LA 5KLVJ 4YXWH 2D2CB 2ZXXA 1DD3A 2JWAA 2E74C 1J1EB 1LTJB 1BSHA 1TU3F 2G3AA 5APQA 4DCKA 1PIXA 1EQ7A 3CCRP 2PAJA 4Y99B 4N78E 5KKZC 3V5BA 1PV3A 3JSVC 2QRXA 4M3LA 3HE4B 3CWBJ 1N7SB 2QIWA 3P8CD 4MN4C 3H1LG 3VMZA 2A06G 2LKMA 3NFQA 3L72D 1SQVG 1RE3C 4I2LC 3M9QA 2HYNA 2K88A 2QVAA 3KZIH 1NTKK 1N73A 5CJ0A 1PPJG 2NPSA 2KZIA 1NU1K 4H13C 1AFOA 1L0LD 4JYBA 3U1AA 1HGVA 3C9IA 1P84I 3RL0C 1MV8A 2Q1KA 5BU5A 4C7RA 1AA0A 2WPQA 2XKMA 1JCDA 1CI6A 4OGQB 3HUSC 2IBZI 3G6EP 2R5DA 1QLED 3WMM0 1G1IA 3CPWO 1KMIZ 1UIIA 4WVZA 5KLVG 3QH9A 3L70J 2IYOA 1NTKJ 1X79B 5B66E 1OZHA 1URQA 3Q5RA 1W2EA 5B5EE 4R4LA 2WPSA 1VQMP 1SQBD 3C1LA 3BATA 2YKPA 4U7JA 1BDCA 2Q9IA 4UB6E 3BCCG 1S5LE 3EFGA 1PGQA 4GOEA 1FZCC 4LLHA 1IC2A 4PD4I 3CXHE 3KQGA 3VMAA 4JPZB 1SQPK 2OYHA 3JCUH 3VP9A 5B5EH 2AEFA 1MZ9A 1YJNP 1LWUB 2DW3A 2FFDC 3H1KJ 3W68A 2PGDA 3KXDA 1YQ3C 1ZXGA 2GUVA 3S9OA 2R44A 5KAFH 1S5LH 2YXRB 3HD7A 3PRJA 2YIUB 1DIPA 2KOGA 3Q1MA 2O3JA 3U1CA 3CXHH 1VQKP 2IPPA 1W5CE 3JC22 2PP6A 3FGAD 1KILD 2Q5UA 3HTKB 2OGUA 2HPCA 3L37A 1HH0A 1LT9A 1NTZJ 5AVTB 3BRTB 1IFNA 4C46A 1SQPJ 3H1LD 3EWKA 1HWTC 4K3AA 2GM4A 2A06D 1KORA 2KSEA 1UIXA 1SQVD 1LTBC 2MKVA 2QJYB 3LIEA 2ZJSE 1FDOA 5AVXB 2L5GB 1FZBA 5KLIC 3TGUD 5TISE 1PPJD 1VQ4P 3L73J 3GG2A 2Z4EA 2WWWA 1Z56A 2MJZA 5K5GB 3RK2D 4L75A 1M1JC 2OYIC 1FDIA 2B88A 3E7KA 4ASWA 2WSCH
chains in the Genus database with same CATH topology
2KZIA 2K3RA 4BXLA 1EDLA 2LXCB 2KI7B 2LXBA 1JMBA 4ASVA 2M5AA 2KUBA 2JWDA 1ZW0A 4K35A 2Q1KA 2KIKA 1ZXGA 2I8DA 4EYYQ 4ZNCA 1BDDA 1FC2C 2R44A 4HB1A 1S3JA 1DEEG 4GOFA 4WWIA 5EFWB 3MHVA 1JM0A 2OTKE 1EDIA 4IOIH 2B87B 3QWOC 5CBOA 1OVVA 1EDKA 2B89A 4JBZA 1Y47A 4NPDA 1LP1B 1MFTA 2HR3A 4NPEA 1LT1A 3RGUA 4K3AA 3PH0A 2B87A 1NVOA 5CBNA 1EDJA 3ZDMA 4ZMDA 4GODA 1SS1A 2RKLA 5C39A 2QRXA 5DJTB 2KS1B 2ZAEB 2KZJA 4NPFX 1BDCA 5DJUB 2P58A 2WMMA 1H0TB 4MN4C 2M5AB 1H0TA 3S1KA 1OVUA 1U7JA 2SPZA 4KJMA 2LR2A 1LP1A 1Q2NA 1U7MA 5K5GB 4GOEA 3FXEA 4HKZH 2UWJE 2QVAA 2M0BA 4CPGA 1OVRA 1EC5A 4HJGH 1X0TA 3FXDA 2B88A 3MZWB 4ASWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZI A;  2K3R A;  4BXL A;  1EDL A;  2LXC B;  2KI7 B;  2LXB A;  1JMB A;  4ASV A;  2M5A A;  2KUB A;  2JWD A;  1ZW0 A;  4K35 A;  2Q1K A;  2KIK A;  1ZXG A;  2I8D A;  4EYY Q;  4ZNC A;  1BDD A;  1FC2 C;  2R44 A;  4HB1 A;  1S3J A;  1DEE G;  4GOF A;  4WWI A;  5EFW B;  3MHV A;  1JM0 A;  2OTK E;  1EDI A;  4IOI H;  2B87 B;  3QWO C;  5CBO A;  1OVV A;  1EDK A;  2B89 A;  4JBZ A;  1Y47 A;  4NPD A;  1LP1 B;  1MFT A;  2HR3 A;  4NPE A;  1LT1 A;  3RGU A;  4K3A A;  3PH0 A;  2B87 A;  1NVO A;  5CBN A;  1EDJ A;  3ZDM A;  4ZMD A;  4GOD A;  1SS1 A;  2RKL A;  5C39 A;  2QRX A;  5DJT B;  2KS1 B;  2ZAE B;  2KZJ A;  4NPF X;  1BDC A;  5DJU B;  2P58 A;  2WMM A;  1H0T B;  4MN4 C;  2M5A B;  1H0T A;  3S1K A;  1OVU A;  1U7J A;  2SPZ A;  4KJM A;  2LR2 A;  1LP1 A;  1Q2N A;  1U7M A;  5K5G B;  4GOE A;  3FXE A;  4HKZ H;  2UWJ E;  2QVA A;  2M0B A;  4CPG A;  1OVR A;  1EC5 A;  4HJG H;  1X0T A;  3FXD A;  2B88 A;  3MZW B;  4ASW A; 
#chains in the Genus database with same CATH topology
 2D2C C;  1GU4 A;  2A45 H;  2QM8 A;  4KT0 J;  1M57 D;  1LTJ C;  2ZYD A;  3G71 P;  2KIK A;  1HBW A;  1SFC C;  4GT1 A;  5KLV D;  3GF3 A;  3AE8 C;  2WZ7 A;  3H1H E;  3VMX A;  3MP7 B;  3IR9 A;  3L72 J;  5BVZ A;  1N7S C;  3I55 P;  3CX5 I;  1KIL B;  1SQB K;  4XFJ A;  3H1I E;  1L0L J;  1NTZ G;  4JBZ A;  1L0N E;  3M0D A;  5CHX A;  1S5L X;  1OIP A;  3AE4 C;  3BCC D;  2KP8 A;  3LW5 J;  1E5W A;  1KTM A;  2B87 A;  1N86 A;  2CK3 H;  2BEQ D;  3WU2 E;  3CLQ A;  1AVO A;  2QM7 A;  3CC4 P;  4YTP C;  2XND H;  1OVU A;  1VL2 A;  2FYN B;  1U7J A;  4OGQ C;  1GW3 A;  3L73 G;  1NTM E;  1AVY A;  1RH5 B;  1EZV I;  3RK2 B;  3LW5 H;  4CPG A;  1X0T A;  3BRV B;  3HUS B;  3Q3D A;  2FXO A;  3A0H E;  2V7Q J;  1SQB J;  1NGM B;  4WY4 D;  4XA4 A;  1QL2 A;  1D7M A;  1FC2 C;  3KYQ A;  2YMK A;  1KQS O;  2QSI A;  4JQ0 D;  5AVQ B;  5GTI H;  3MHV A;  3A0B H;  3OAK A;  3R2P A;  2HLO A;  2AXT H;  1GL2 A;  1LTG C;  3L72 G;  1U57 A;  3RK3 E;  3GMA A;  1DX7 A;  1Y8A A;  1GTW A;  2Q6Q A;  1NAY A;  3L71 E;  2NRG A;  3A0H H;  1KD1 Q;  1Q7Y Q;  1SQV K;  4YXD C;  1HUC A;  1L0L G;  4O9B A;  4AUW A;  1JY2 N;  5E79 E;  1YYC A;  1NVO A;  2H43 A;  1LWU C;  3CCU P;  2N1T D;  3G9R A;  4WY4 A;  5CCH D;  1IFJ A;  4A7P A;  2FYU E;  2ZT9 D;  2KZJ A;  2FXM A;  3MUD C;  4Y28 J;  5AW9 B;  3HE5 B;  2BCC E;  1XTC C;  4D6T D;  3M9H A;  3CI9 A;  3VOP A;  1JUN A;  1VDF A;  1P84 E;  3CXH D;  1JB0 J;  3SFD C;  2RMZ A;  5AW0 B;  2OQQ A;  1X8Y A;  3H1L J;  3M06 A;  5E79 H;  2IBZ E;  5KLV K;  1Q90 D;  3D6Z A;  1PGJ A;  3K5B A;  4EI2 A;  2WSE H;  1E79 H;  3L75 J;  4AQR D;  3TGU J;  1ZRT D;  1T3J A;  3TNU B;  2QJY C;  4QMA A;  2O1K A;  3PLN A;  2IFM A;  4PV1 D;  2KNC A;  5CCH A;  2YKO A;  1VQO P;  4LC1 A;  1PGO A;  1NTZ D;  1LTI C;  3M91 A;  4AYC A;  5AW1 B;  1G2C B;  2WSS H;  3GHG A;  3QWO C;  3AEF C;  1KYO H;  1LTT C;  2I1J A;  3H32 A;  1SQX E;  5KLI B;  2WSF J;  1S4X A;  4BRY A;  4RO0 A;  1NYH A;  2K1A A;  1YI2 P;  3E1I A;  3EFF K;  3TF5 A;  1M1J B;  1FOS E;  1HVV A;  2OYI B;  4TLF A;  5CCG A;  4JYC A;  2OTJ P;  4PD4 E;  2N1T B;  2NPS D;  2KS1 B;  1JEK A;  2ZT9 B;  4RKU J;  2P58 A;  5AVU B;  3CCQ P;  3F5H A;  2WSF H;  2H89 C;  1JY3 P;  1BGY G;  1RF0 C;  1SFC B;  5AW5 B;  1NH4 A;  5AW2 B;  1RF1 A;  3VMY A;  1MKM A;  1KIL C;  3SWK A;  1AJY A;  2LXB A;  3BCC J;  3ABV C;  3WUT A;  2M5A A;  3BVH A;  1DEB A;  4PD4 H;  2KUB A;  3CWB E;  4L74 A;  1AQT A;  2PRR A;  5AW8 B;  3CMA P;  1BDD A;  3L75 G;  1S9K D;  1NO4 A;  1JY2 P;  3TGU G;  1IFP A;  1URQ D;  3HRN A;  2RN0 A;  1BCC D;  2FYN C;  3A3Y B;  1VQ7 P;  2FYZ A;  2Z5H A;  2Y0E A;  3RK2 C;  1K8A Q;  1SQQ D;  4IFM A;  1S1C X;  4PJ0 E;  2V4H A;  4NPE A;  1JY3 O;  2Y9Y A;  2OTL P;  3KPE A;  1R8E A;  1DH3 A;  1N73 B;  4EDF A;  1SS1 A;  1EXI A;  2ZAE B;  2K9J A;  2WMM A;  5APS A;  3AE7 C;  3L70 E;  1OVR A;  1NTK E;  1BE3 E;  3HD7 D;  1CI6 B;  3MZW B;  1T3U A;  1NU1 E;  2QJP B;  2FKW B;  4BXL A;  5KAI E;  1JY2 O;  3T97 B;  1W2B O;  1N8R Q;  3V2Q A;  1K73 Q;  2JWD A;  2FBW C;  1WRG A;  1NTZ K;  3AE5 C;  2O01 H;  3CCV P;  1SLQ A;  1NKZ B;  3CX5 E;  5B66 H;  1SP4 A;  4D6T J;  3E1R A;  1JM0 A;  5GTH E;  2KK7 A;  3R4Y A;  3L74 E;  1IZN B;  1YTZ T;  5KAI H;  1S2E A;  4UB6 H;  1FZG A;  2P67 A;  4IL6 E;  3H1K E;  2E76 D;  3N4X A;  5AVR B;  2Q3I A;  2WPR A;  1NJI Q;  1PP9 E;  1BGY D;  2HFE D;  1L4A D;  1EZV E;  4UB8 E;  1PZQ A;  1FZE A;  5TJH A;  2QE7 H;  2OYH B;  2R3S A;  3FX0 A;  1M90 Q;  3ITK A;  1OW8 A;  2SPZ A;  1Q81 Q;  3AE2 C;  3FXE A;  1M8O B;  4IL6 H;  1KYO D;  2KB7 P;  3I5C A;  1SQP E;  2WSC J;  2HOD A;  3AEG C;  4TT3 H;  1YHQ P;  2K3R A;  3L75 D;  4DZO A;  3CCE P;  2YO2 A;  4ZKP A;  1VQL P;  2HPC B;  1L0L K;  3M0A A;  3TDK A;  1QVG O;  2KLV A;  1L4A A;  1LT9 B;  2FY8 A;  2W90 A;  1AV1 A;  1HGZ A;  2WQY C;  2N1T C;  1Y9B A;  4D6T G;  1OFC X;  5CCH C;  1SQQ K;  2ZT9 C;  3H1J D;  4IOI H;  5H2F E;  3GHG C;  3OJA B;  1LTS C;  1M1K Q;  3MIW A;  5TIS H;  2YXQ B;  2WPV B;  3P32 A;  3B4S A;  1YIJ P;  2C0X A;  2P1J A;  1YJ9 P;  2E76 B;  1NWQ A;  1T2K D;  3G4S P;  1RE3 A;  1FDM A;  2E5Y A;  3P8C E;  3IF4 A;  4OWF A;  2I1K A;  3NMD A;  1J2J B;  1MUU A;  3L72 E;  3I56 P;  1OXZ A;  1NOH A;  2E75 D;  1FZF A;  5H2F H;  4H0L D;  1BCC J;  3SSU A;  5AVZ B;  4Z1M H;  4PV1 C;  1LP1 A;  4N78 D;  1L0N J;  1JCC A;  4H44 D;  3CXH I;  1SQQ J;  2QG4 A;  1YIT P;  2KSJ A;  2ZFC A;  2H88 C;  3HUS A;  3GW6 A;  5AVS B;  1GL2 D;  2A45 G;  3CCM P;  1ZW0 A;  1WMK A;  3MD0 A;  1FAV A;  1YJW P;  3B5N D;  4C7N A;  2ZVN B;  4IL6 X;  4WWI A;  2OAR A;  1N73 C;  4U3F E;  2NPS C;  1CW5 A;  2B9B A;  1KB9 E;  2YO3 A;  1A02 F;  3O8Z A;  3WU2 H;  2B87 B;  1T6A A;  3IAO A;  3OA7 A;  2RH0 A;  1N7L A;  1VF5 D;  1SQB E;  1OMI A;  3F89 A;  1JY3 N;  2B89 A;  3P7K A;  1Q82 Q;  2YKQ A;  2QJP C;  2W6B A;  2OYO A;  1KQG B;  1ZLL A;  5AVV B;  1FZC A;  3PH0 A;  2A45 I;  3H1H G;  1KB9 H;  2E75 B;  2WT7 A;  1K05 A;  1KFM A;  3B5N A;  4B86 A;  2P7J A;  2AEJ A;  2VRS A;  3HE5 A;  4H0L B;  4HYT B;  1BCC G;  3AE6 C;  2LR2 A;  3H25 A;  2FFD A;  3L71 J;  1BE3 D;  1URQ C;  2W8Z A;  1G1J A;  2C9N Y;  2UWJ E;  2ZXE B;  1JOC A;  1A02 J;  3CD6 P;  1L0N G;  4I7Z C;  2IX7 C;  1SQQ G;  3O6Q A;  3KDP B;  1VQ9 P;  2YMY A;  3CME P;  4HH2 A;  1GL2 B;  1BGY J;  3USS A;  2E5T A;  2FYU J;  2WSE J;  3CCJ P;  3FWN A;  4ZNC A;  2M3B A;  1FJK A;  1KIL E;  3TNU A;  3Q5P A;  3Q5S A;  3L74 D;  1WT6 A;  2OYH C;  4L76 A;  2JDI H;  2R5B A;  2BAS A;  5CCG D;  1EDI A;  1PGP A;  3H1L E;  4WY4 B;  1FOS F;  4DOJ A;  1ZME C;  2Y0C A;  2A06 E;  1HF9 A;  1VF5 B;  1IK9 A;  1SQV E;  4W7Y A;  1N7S D;  2Q3E A;  3HD7 C;  1P84 H;  3B71 A;  3TGU E;  1J1D B;  1LT1 A;  1PPJ E;  1OW7 A;  3IFM A;  2JR8 A;  1JMM A;  3RBX A;  3ZDM A;  4ZMD A;  2RKL A;  5DJT B;  4WB4 A;  1LT9 C;  2JEE A;  3AE1 C;  2J58 A;  1H0T B;  3H1J J;  1SQX J;  1KN7 A;  3BAS A;  1LTJ A;  3L71 G;  2KXP B;  2M0B A;  2WTY A;  2YNY A;  1LNQ A;  4L73 A;  4GKG A;  3N7N A;  2KNC B;  1FBM A;  4WBA A;  3MTU E;  1EDL A;  2W6A A;  3HE4 A;  2LXC B;  1N7S A;  1IFI A;  5KLV E;  1USE A;  1KV4 A;  2E76 C;  3GHG B;  2Z5I A;  5APV A;  2FYU G;  3CC2 P;  3H32 B;  1RQV A;  2BCC G;  1LGH B;  4HB1 A;  1L4A C;  2O1J A;  3KZI E;  4BRY B;  1JTH B;  1LJ2 A;  1M7L A;  1VQP P;  2XV5 A;  5AW3 B;  2JP3 A;  3BCC E;  1RE4 A;  3AEB C;  5KJ7 D;  2IBZ G;  3H1H D;  1VPC A;  1EDK A;  4RES B;  1PFI A;  2XU6 A;  2K37 A;  4NPD A;  4PV1 B;  3V2R A;  5L8R J;  1H89 A;  1GU5 A;  1RF1 B;  1EXJ A;  3H1I D;  1EDJ A;  1IFM A;  4DT0 A;  1L0N D;  1JNM A;  3A7O A;  3GLM A;  3II6 A;  2M5A B;  3S1K A;  1NKN A;  3H1J G;  2M8R A;  3M0D C;  1SQX G;  5BU8 B;  3V2N A;  1U7M A;  3WUU A;  1GK4 A;  4OVN F;  4HJG H;  5APU A;  2KLU A;  1KYO I;  1K9M Q;  2NPS B;  1VQ6 P;  5KJ7 A;  3AEC C;  1NTM D;  3SWY A;  1RHZ B;  3T97 A;  2O01 N;  1R5L A;  2O01 J;  3M9B A;  2IDB A;  5KTB A;  1L2P A;  1T2K C;  4U3F D;  1S3J A;  1DEE G;  4PJ0 H;  1KB9 D;  1OX3 A;  4LGD E;  2AEM A;  3S4R A;  5AW6 B;  1BE3 J;  2KYV A;  3PJS K;  3KHU A;  2E75 C;  3JCU E;  4KHX A;  2CPB A;  3CCS P;  2OTK E;  3CC7 P;  1NU1 J;  4H0L C;  1LWU A;  4OH8 B;  1H88 A;  2K9Y A;  2N9B A;  5AW7 B;  4H44 C;  1NHL A;  2K9J B;  3MUD A;  2J5U A;  3CWB G;  5KAF E;  2JKV A;  3SFE C;  3H6P A;  3WUV A;  1URQ B;  1USD A;  3RK3 D;  3LID A;  2HR3 A;  1YTZ I;  1GL2 C;  1GMJ A;  4I7Z B;  4D6T E;  3GF7 A;  3L71 D;  1FE6 A;  3HTK A;  3L74 J;  3B5N C;  5AVY B;  1ZR2 A;  3CX5 H;  2GA1 A;  1K04 A;  2BEZ F;  1HJ0 A;  3TSI A;  1S72 P;  2FYU D;  3L4F A;  2E74 D;  1CZQ A;  2ITA A;  5GTH H;  4WY4 C;  2BCC D;  1PP9 J;  1VF5 C;  1P84 D;  4YPC A;  2KI7 B;  1ZRT E;  1JMB A;  1IFD A;  1ZN5 A;  1NTZ E;  3NTN A;  4K35 A;  2W27 A;  2Y0D A;  1J1D C;  1QL1 A;  2N9Y B;  3V6I A;  3PHL A;  3HD7 B;  2IBZ D;  3L70 G;  4GOF A;  2IZ1 A;  2QJK C;  2IYP A;  4JF7 A;  1NTK G;  4N6J A;  1BE3 G;  4UB8 H;  1CSB A;  3AEA C;  2CPS A;  1NU1 G;  2GUS A;  3VP8 A;  3D6Y A;  1OVV A;  5AW4 B;  3L73 E;  4H13 D;  2QA4 P;  4GDO A;  1FS0 E;  1VQN P;  1FJP A;  1JO5 A;  1Y47 A;  3RL0 D;  1L0N K;  1RF0 A;  3RK3 B;  2Y9Z A;  3RGU A;  1SQX D;  1Q86 Q;  2M3E A;  2HOD B;  1QGK B;  1KIL A;  1GZL A;  5C39 A;  4ZKU A;  3L74 G;  4IFF A;  1FZA A;  2XNX A;  3B8E B;  4EOT A;  4DJG A;  2WVR A;  3TYY A;  1J1E C;  1M56 D;  2NZ2 A;  1Q2N A;  4PD4 D;  2IFN A;  1NTM K;  3H1K G;  1RY3 A;  2W6J H;  3H1H J;  1L4A B;  5CCG C;  1IO4 A;  1OW6 A;  4Y99 C;  2E74 B;  1QX8 A;  2XDJ A;  1PP9 G;  2JO1 A;  2W83 C;  1GDT A;  1EZV G;  1S9K E;  4ASV A;  2PFX A;  4W80 A;  5KKZ B;  3H1I J;  1L0L E;  1ZR4 A;  1RQU A;  4W7Z A;  3V4Q A;  1YBK A;  1BCC E;  3U59 A;  3UIA A;  2ZYG A;  1RF1 C;  3A2A A;  1NAF A;  5AVW B;  1SQQ E;  5CMZ A;  3IN6 A;  3CWB D;  1SQP G;  1FU1 A;  2HG5 D;  1X22 A;  3AE9 C;  2POH A;  1ZP0 C;  1R5S A;  2L91 A;  4N3Y B;  1RE4 C;  2ZYA A;  4H13 B;  2P2U A;  1NTM J;  2J59 M;  1VQ5 P;  3RL0 B;  1LP1 B;  2QEX P;  1MFT A;  5GTI E;  3A0B E;  2ZVO B;  1OWA A;  1VQ8 P;  1ZV8 A;  4U3F J;  2AXT E;  1X9V A;  1BSN A;  3VYI A;  1DD4 A;  4GOD A;  3VTP C;  2C0W A;  2FYU K;  4NPF X;  5DJU B;  2Q7C A;  1XTG B;  3SWF A;  2E42 A;  4RJT A;  4R4M A;  2C9L Y;  4C7N B;  3FXD A;  3PTZ A;  1KC8 Q;  4BWN A;  5KJ7 C;  3L70 D;  5APW A;  1NTK D;  2R32 A;  2V7Q H;  3H1I G;  4EYY Q;  1NU1 D;  4H44 B;  3L36 A;  1KQF B;  3PP5 A;  1GD2 E;  1GW4 A;  3FWL A;  3RBZ A;  3MGN A;  1FZC B;  3P8M C;  4XE5 B;  3CX5 D;  1GK6 A;  1MFZ A;  5APX A;  1YQ4 C;  3AEE C;  3V4W A;  1QEX A;  2BCC J;  1BGY E;  2D2C D;  1PL5 A;  1SQX K;  2AXC A;  1IJD B;  5APY A;  2WT7 B;  2E43 A;  3B5N B;  1KQL A;  3C8V A;  1NTM G;  1LTA C;  3EQ2 A;  2YIU C;  2FFD B;  4I6M C;  1H8A A;  2H8P D;  1SFC D;  3OW2 O;  2WIT A;  2R3C A;  2JJL A;  1G2C A;  3W67 A;  4EIJ A;  1HTL C;  4U3F G;  5CBN A;  1SVF A;  3H1K D;  3O6Q B;  3AED C;  2H7H A;  1KFN A;  1KYO E;  1PP9 D;  1H0T A;  1ZOY C;  4KJM A;  1HJB A;  1EZV D;  3L75 E;  4IFD K;  1SQV J;  1SQB G;  1M1J A;  4HKZ H;  2OYI A;  3G3Z A;  1EC5 A;  3V2P A;  3D71 A;  2QJK B;  2N1T A;  1QVF O;  3CCL P;  2KS1 A;  1T8Z A;  2IZ0 A;  1IK7 A;  3TK1 A;  1N2D C;  3VN0 A;  1SQP D;  3RK3 C;  1SFC A;  3D70 A;  2I8D A;  3H1J E;  2XZR A;  4OGQ D;  3RL0 g;  2FXP A;  5EFW B;  5CJ4 A;  1JTH A;  1KZU B;  3AE3 C;  1AQ5 A;  1KB9 I;  3CL3 D;  2G8Y A;  3NXS A;  3L73 D;  5M1B A;  3A5T A;  5APT A;  4GIF A;  3Q2Y A;  3L35 A;  5CBO A;  2P10 A;  4I1L A;  5KLV J;  4YXW H;  2D2C B;  2ZXX A;  1DD3 A;  2JWA A;  2E74 C;  1J1E B;  1LTJ B;  1BSH A;  1TU3 F;  2G3A A;  5APQ A;  4DCK A;  1PIX A;  1EQ7 A;  3CCR P;  2PAJ A;  4Y99 B;  4N78 E;  5KKZ C;  3V5B A;  1PV3 A;  3JSV C;  2QRX A;  4M3L A;  3HE4 B;  3CWB J;  1N7S B;  2QIW A;  3P8C D;  4MN4 C;  3H1L G;  3VMZ A;  2A06 G;  2LKM A;  3NFQ A;  3L72 D;  1SQV G;  1RE3 C;  4I2L C;  3M9Q A;  2HYN A;  2K88 A;  2QVA A;  3KZI H;  1NTK K;  1N73 A;  5CJ0 A;  1PPJ G;  2NPS A;  2KZI A;  1NU1 K;  4H13 C;  1AFO A;  1L0L D;  4JYB A;  3U1A A;  1HGV A;  3C9I A;  1P84 I;  3RL0 C;  1MV8 A;  2Q1K A;  5BU5 A;  4C7R A;  1AA0 A;  2WPQ A;  2XKM A;  1JCD A;  1CI6 A;  4OGQ B;  3HUS C;  2IBZ I;  3G6E P;  2R5D A;  1QLE D;  3WMM 0;  1G1I A;  3CPW O;  1KMI Z;  1UII A;  4WVZ A;  5KLV G;  3QH9 A;  3L70 J;  2IYO A;  1NTK J;  1X79 B;  5B66 E;  1OZH A;  1URQ A;  3Q5R A;  1W2E A;  5B5E E;  4R4L A;  2WPS A;  1VQM P;  1SQB D;  3C1L A;  3BAT A;  2YKP A;  4U7J A;  1BDC A;  2Q9I A;  4UB6 E;  3BCC G;  1S5L E;  3EFG A;  1PGQ A;  4GOE A;  1FZC C;  4LLH A;  1IC2 A;  4PD4 I;  3CXH E;  3KQG A;  3VMA A;  4JPZ B;  1SQP K;  2OYH A;  3JCU H;  3VP9 A;  5B5E H;  2AEF A;  1MZ9 A;  1YJN P;  1LWU B;  2DW3 A;  2FFD C;  3H1K J;  3W68 A;  2PGD A;  3KXD A;  1YQ3 C;  1ZXG A;  2GUV A;  3S9O A;  2R44 A;  5KAF H;  1S5L H;  2YXR B;  3HD7 A;  3PRJ A;  2YIU B;  1DIP A;  2KOG A;  3Q1M A;  2O3J A;  3U1C A;  3CXH H;  1VQK P;  2IPP A;  1W5C E;  3JC2 2;  2PP6 A;  3FGA D;  1KIL D;  2Q5U A;  3HTK B;  2OGU A;  2HPC A;  3L37 A;  1HH0 A;  1LT9 A;  1NTZ J;  5AVT B;  3BRT B;  1IFN A;  4C46 A;  1SQP J;  3H1L D;  3EWK A;  1HWT C;  4K3A A;  2GM4 A;  2A06 D;  1KOR A;  2KSE A;  1UIX A;  1SQV D;  1LTB C;  2MKV A;  2QJY B;  3LIE A;  2ZJS E;  1FDO A;  5AVX B;  2L5G B;  1FZB A;  5KLI C;  3TGU D;  5TIS E;  1PPJ D;  1VQ4 P;  3L73 J;  3GG2 A;  2Z4E A;  2WWW A;  1Z56 A;  2MJZ A;  5K5G B;  3RK2 D;  4L75 A;  1M1J C;  2OYI C;  1FDI A;  2B88 A;  3E7K A;  4ASW A;  2WSC H; 
#chains in the Genus database with same CATH homology
 2KZI A;  2K3R A;  4BXL A;  1EDL A;  2LXC B;  2KI7 B;  2LXB A;  1JMB A;  4ASV A;  2M5A A;  2KUB A;  2JWD A;  1ZW0 A;  4K35 A;  2Q1K A;  2KIK A;  1ZXG A;  2I8D A;  4EYY Q;  4ZNC A;  1BDD A;  1FC2 C;  2R44 A;  4HB1 A;  1S3J A;  1DEE G;  4GOF A;  4WWI A;  5EFW B;  3MHV A;  1JM0 A;  2OTK E;  1EDI A;  4IOI H;  2B87 B;  3QWO C;  5CBO A;  1OVV A;  1EDK A;  2B89 A;  4JBZ A;  1Y47 A;  4NPD A;  1LP1 B;  1MFT A;  2HR3 A;  4NPE A;  1LT1 A;  3RGU A;  4K3A A;  3PH0 A;  2B87 A;  1NVO A;  5CBN A;  1EDJ A;  3ZDM A;  4ZMD A;  4GOD A;  1SS1 A;  2RKL A;  5C39 A;  2QRX A;  5DJT B;  2KS1 B;  2ZAE B;  2KZJ A;  4NPF X;  1BDC A;  5DJU B;  2P58 A;  2WMM A;  1H0T B;  4MN4 C;  2M5A B;  1H0T A;  3S1K A;  1OVU A;  1U7J A;  2SPZ A;  4KJM A;  2LR2 A;  1LP1 A;  1Q2N A;  1U7M A;  5K5G B;  4GOE A;  3FXE A;  4HKZ H;  2UWJ E;  2QVA A;  2M0B A;  4CPG A;  1OVR A;  1EC5 A;  4HJG H;  1X0T A;  3FXD A;  2B88 A;  3MZW B;  4ASW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...