1ZXGA

Solution structure of a219
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system/protein binding
molecule keywords Immunoglobulin G binding protein A
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1zxgA00
4ZMDA 1MFTA 1EDIA 2M0BA 1ZW0A 2KZIA 1OVRA 4GODA 1LT1A 5CBNA 2QRXA 2UWJE 4EYYQ 3QWOC 4NPDA 2P58A 1NVOA 1LP1B 2R44A 1EDLA 5DJTB 2B87A 2RKLA 2K3RA 2LXCB 4K35A 4KJMA 4ASVA 4BXLA 5C39A 2B87B 1U7MA 4ASWA 3ZDMA 5CBOA 4HB1A 1EDJA 4GOFA 2B88A 2HR3A 1Q2NA 4IOIH 2M5AA 4GOEA 1SS1A 1Y47A 4WWIA 5EFWB 1JMBA 4ZNCA 2I8DA 1BDDA 4NPFX 3MHVA 2KS1B 4HKZH 1S3JA 4JBZA 1LP1A 2LR2A 2WMMA 3FXEA 4CPGA 2JWDA 1OVVA 1BDCA 1EC5A 1OVUA 4K3AA 1EDKA 1DEEG 1ZXGA 2LXBA 5K5GB 1U7JA 4MN4C 4NPEA 3MZWB 1JM0A 2OTKE 3S1KA 2KUBA 1X0TA 2B89A 4HJGH 2QVAA 2SPZA 1H0TB 2Q1KA 2ZAEB 3PH0A 3RGUA 2KZJA 1H0TA 5DJUB 2M5AB 2KIKA 1FC2C 3FXDA 2KI7B
chains in the Genus database with same CATH superfamily
2IYOA 1HF9A 3M0AA 2M3EA 1OIPA 1X8YA 3KYQA 2AXTH 1QL2A 1BE3D 3L75D 3RBZA 3RL0D 3SFDC 5KLVG 1Y9BA 2AXCA 2G3AA 1EDIA 3N4XA 3BCCE 1KILE 5AVRB 1KQLA 2A06D 1DH3A 3GG2A 1JMMA 3W67A 2NPSC 3M0DA 2H88C 1LJ2A 5CJ4A 2XZRA 2QJYB 4I2LC 5TISE 1L0NJ 2NPSB 4ZKUA 5B5EE 3H1LE 1KYOI 1QEXA 1KILA 1X79B 4GODA 4OGQB 4WY4A 3RL0B 2IPPA 2FYNB 1HH0A 2GUSA 2IBZD 3E1IA 3M9BA 4I1LA 4L74A 4U3FD 1GW4A 1FE6A 1QX8A 3CXHH 2E74D 2P58A 3VP9A 1A02F 4Y28J 2C0XA 2N1TC 2P1JA 1PFIA 2R44A 1D7MA 2WSSH 5KTBA 1GMJA 3H1LG 3L73E 1DX7A 2C9LY 4LLHA 5BU5A 2B87A 1YBKA 1GL2D 1PP9G 4HYTB 5B5EH 3Q3DA 2LXCB 3R4YA 2AEJA 3HRNA 2W90A 1FDIA 5KLVE 4BWNA 3FGAD 2KK7A 2R5DA 3L70G 3L75J 1SQPJ 1J1DC 4IFFA 1U57A 2A45H 2Q5UA 2W8ZA 3V5BA 2KXPB 1VQKP 4UB8E 3ZDMA 1J1DB 1EXJA 1OZHA 2YKQA 3CC2P 1VDFA 2YXQB 3CXHD 4HB1A 2NZ2A 4EOTA 1SQXE 2W6AA 1SFCC 3CPWO 1H88A 1IO4A 2B88A 2XNXA 5KAFH 2FYUE 2RH0A 1ZMEC 1K05A 4PD4E 5APXA 2GM4A 2HR3A 4IOIH 1KV4A 5GTHE 2Q6QA 4DOJA 2POHA 2W6BA 4AQRD 1SQVG 1R5SA 2K9JB 1VQOP 2A45G 3LIEA 4U3FJ 3AE5C 2JR8A 3D71A 5H2FH 2FYNC 3CD6P 4M3LA 5APQA 1JNMA 2JP3A 5KAIH 3BVHA 3HUSC 5CMZA 1URQC 1RY3A 1NO4A 4H0LB 5AVTB 1DD4A 3CX5H 1BGYJ 3KZIE 5AVQB 1LGHB 1FS0E 1BCCG 4H0LC 2FY8A 2WITA 5AVZB 4EI2A 1NWQA 1LTJA 2Z5IA 1S9KE 3CC4P 3MHVA 1YQ3C 1P84H 2MJZA 3B4SA 1QL1A 1LTJB 2ZYDA 2N9BA 3NMDA 1VF5D 1S3JA 1OW7A 3AEDC 5AW6B 3WU2E 1LP1A 2PGDA 2RMZA 2OYHC 2QJPC 1AQ5A 3RBXA 3H1HG 1VQ4P 3Q1MA 1AQTA 3AECC 3L71D 1SQPD 3FWLA 1OVUA 4K3AA 2PP6A 1N73A 3BASA 1L4AC 1NU1G 2D2CD 1YITP 1U7JA 1SFCA 1G2CB 1N73B 4WY4C 3U1CA 4N78D 2BASA 4RO0A 4PJ0E 2GA1A 2H7HA 2QJKC 1PPJG 1LTBC 1NTMD 3G71P 3AE3C 3S1KA 1J1EB 4W7YA 1MZ9A 2QJKB 1PZQA 3H1IG 4HH2A 3CCVP 2KUBA 4D6TJ 1L0LK 1GK4A 2P67A 1BCCE 2QSIA 3HUSA 3IFMA 1BE3G 3L74J 3VOPA 1VF5C 2KLVA 4HJGH 5KLIC 5L8RJ 1H0TB 2Q1KA 3IF4A 2BCCJ 5KLVK 4PD4H 1NKNA 3AEFC 3B5ND 1L0ND 3H1LD 3PH0A 4BRYB 2Y9YA 2KLUA 1K9MQ 3H1KG 2YIUC 3M91A 3RGUA 2YO2A 2OGUA 4BRYA 1PGJA 4KT0J 3JCUH 1PP9D 2BCCG 2YIUB 3TSIA 1RQUA 3O6QB 2M5AB 2KIKA 5APTA 2IBZG 3H1IE 1KILD 2V7QH 2E75D 1DIPA 2PRRA 2YXRB 3H1KD 1H89A 1KYOD 3H1JE 1NTKJ 1CW5A 1S72P 1PPJE 2QEXP 1VQ9P 2KS1A 1N7SC 3MP7B 1SQBD 1UIXA 1IFJA 1NTKK 2E76D 2N1TD 5AVXB 2W27A 5BVZA 3SWFA 1USEA 1JY2N 2E74C 1FZCA 4H13C 1KQFB 2ZFCA 1NTZJ 1NTKG 2P7JA 2A45I 4WY4B 1VQ6P 4JYCA 4IFDK 3V2RA 3L70E 4L73A 4PV1D 2Y0EA 3P8CE 2H89C 1OVRA 1LWUA 3HE5B 3L72J 3NXSA 2E42A 1URQA 5CCGA 1BCCJ 1MFZA 2WSEJ 4IL6E 4U7JA 1WRGA 2OYIB 1HBWA 1KFNA 3CXHE 3KPEA 1T3JA 3GW6A 1N7LA 1JUNA 2KYVA 5CHXA 5APYA 3H1HJ 1H8AA 1HGVA 1L0LJ 1RE4C 1KB9E 2QIWA 2QM7A 3CI9A 5AVUB 3VMAA 1RQVA 1FDMA 1SQQE 1HJBA 4JQ0D 3WUUA 3SWKA 1XTGB 2E5YA 2Q3EA 1ZR2A 1M56D 3CXHI 1L0LG 3PLNA 4RESB 1USDA 3CCJP 3TNUA 3AEEC 3KDPB 1EZVE 1L4AA 4K35A 4I7ZB 4ASVA 3L73D 1BSHA 1BGYD 1J2JB 3PTZA 4H44B 3VMYA 1A02J 4I7ZC 4DT0A 2ZYAA 1TU3F 3AEAC 4H44C 2Q7CA 1KILC 1T6AA 1SQPG 3TGUJ 1NAFA 3HTKB 1FU1A 1PIXA 3MTUE 3VMZA 1NHLA 4U3FE 2WZ7A 2R32A 1BGYG 1LTAC 1OW8A 1SQXG 2YO3A 1FZFA 2O3JA 1KZUB 1ZV8A 3M9QA 5CCHD 2OARA 3P8CD 2WTYA 2V7QJ 4RJTA 3L72G 1BSNA 1X9VA 1CZQA 4LC1A 4W7ZA 2WT7B 4YPCA 3OW2O 3TF5A 5GTHH 4WB4A 3WUVA 3EFGA 2V4HA 1EZVI 2K1AA 2FBWC 2FYUD 1GU5A 3H1HE 4YTPC 2BEZF 1JMBA 3TK1A 1JB0J 2JJLA 3F89A 5AW2B 3BCCJ 3MUDA 2C0WA 2JDIH 2I8DA 3GHGC 4W80A 1OX3A 4C46A 4OH8B 1NH4A 1BDDA 1LTIC 2IBZI 2XV5A 3P7KA 1VQ5P 1L0NG 1KB9I 3F5HA 1GL2C 3BCCD 4WY4D 3OJAB 3WU2H 4HKZH 1EZVD 2ZXEB 3BATA 4WBAA 3FXEA 2LR2A 1LT9A 4JBZA 2FYUK 1OVVA 1SLQA 2Z4EA 3RK2C 2N1TB 3HD7D 2PAJA 2NPSA 1AVOA 1SFCD 3M0DC 4GDOA 4R4LA 3I56P 2N1TA 3H32A 1KILB 1ZXGA 2M3BA 3CL3D 4XFJA 1GK6A 3PP5A 1NTZK 3H32B 1VQMP 1YJWP 4UB8H 3LIDA 2ZT9B 1VQPP 1S4XA 3AE8C 1VQLP 3H25A 2HYNA 3CC7P 1FZEA 2PFXA 3ABVC 3B5NA 4JPZB 3CCRP 3A0HH 1YTZT 4JF7A 1EXIA 1P84D 1WMKA 2OTLP 3VN0A 1DEBA 2YMKA 1IFPA 3AE6C 3C8VA 1SQBE 1JY3N 3B8EB 3N7NA 3CX5D 4Y99B 1BE3J 2L5GB 1X0TA 4IL6X 4UB6E 3WMM0 2NPSD 1Q82Q 1K73Q 2B89A 1NTMK 3A0BE 3PJSK 1M1KQ 2W6JH 1N2DC 1QVFO 1IK7A 2O1KA 2ZAEB 2K88A 2GUVA 1SQVD 1M57D 3A3YB 4H0LD 1WT6A 2IX7C 3CX5I 4OVNF 1SQXJ 1ZRTE 1GL2A 1T8ZA 2P2UA 1JTHA 4C7NA 1NGMB 3QH9A 4IFMA 1Y8AA 1L0LD 2L91A 1R8EA 1PGOA 2D2CB 2E75B 5KKZC 1FC2C 1VL2A 3G4SP 2HG5D 1N7SA 2HODB 3L70J 2ZJSE 2D2CC 3KHUA 1MKMA 2KI7B 4IL6H 4KHXA 3RK2B 5KKZB 1LTGC 3MIWA 1KC8Q 3ITKA 3D6YA 2OYHA 5TJHA 2ITAA 5AW3B 3SWYA 1MFTA 3V6IA 2AXTE 2M0BA 2WWWA 1M1JC 1LTJC 3CCLP 2ZT9C 5AVWB 1M90Q 2CPSA 2OYOA 4PV1B 5AW9B 3AE7C 2KZIA 1M1JB 1JY3O 2P10A 3W68A 1YHQP 1YJ9P 3AEGC 4PD4D 4B86A 1SQBK 1NTKD 5APWA 5CBNA 1E79H 3V2NA 2QRXA 4EYYQ 2J5UA 1GDTA 1FDOA 1S2EA 2CPBA 2JKVA 1PP9J 3K5BA 4NPDA 5E79E 3CWBG 1LP1B 2XU6A 1IFNA 2AEFA 2G8YA 3HD7A 3L75G 3VMXA 5CCHA 2C9NY 5DJTB 1EDLA 1KYOE 4H13D 1SQPE 1T2KC 1SFCB 4GIFA 3NTNA 4D6TG 2QJYC 3G6EP 2IDBA 1AVYA 2R3CA 1J1EC 5AW1B 1W5CE 3PHLA 1MV8A 3R2PA 3LW5J 4U3FG 2WSEH 1S9KD 1Q81Q 4OGQC 1AFOA 1G2CA 1RF0A 3RK3E 3RL0C 2HPCB 1SQQD 3JC22 2E75C 4D6TD 2HPCA 3T97A 1VF5B 1S5LH 3TGUG 1L4AD 2W83C 1N86A 2WPQA 1FBMA 3L74E 2IFMA 5CJ0A 1RF0C 2QG4A 3L71G 1M8OB 4GKGA 4GT1A 3AE1C 3HUSB 1SQQG 2QA4P 1BCCD 2QM8A 5CBOA 2E76B 2B9BA 2A06E 4GOFA 5KAFE 5CCGD 2WSCJ 2YKPA 3CCMP 2O01J 2WVRA 1HGZA 4PV1C 3U59A 1LNQA 1Q2NA 2NRGA 2FXMA 4JYBA 1NTME 1IFDA 1SQQK 1ZP0C 1HVVA 2N9YB 2ZT9D 5TISH 3RK3B 4TT3H 1KD1Q 2I1JA 1KFMA 2KNCB 3H1JJ 1GZLA 1S5LX 4TLFA 4Z1MH 3RK3C 1GW3A 2KNCA 2J59M 1ZOYC 5AW4B 1OW6A 2E74B 5B66E 1CI6A 1T3UA 2YMYA 3GF7A 1HJ0A 3H1JD 2Q9IA 1KORA 2O01H 3AE4C 3HE4A 2I1KA 3CCSP 1P84E 1NU1K 3VYIA 1W2EA 1Q90D 3H6PA 3MGNA 4NPFX 1N73C 2YKOA 3KZIH 5AVVB 2KS1B 3OAKA 1NU1J 2MKVA 1HTLC 1SP4A 3A7OA 3H1JG 3H1LJ 2FXOA 1KMIZ 3M06A 3P32A 5BU8B 1T2KD 1ZLLA 1KN7A 2JO1A 2M8RA 2BCCD 2A06G 2WMMA 3VP8A 1PV3A 4CPGA 1N7SD 3V4WA 5AW8B 3D70A 1BDCA 3L35A 3HE5A 1VQ8P 3L71E 1URQB 1RH5B 2ZYGA 2FXPA 1OFCX 3WUTA 2OYIA 1L0LE 1SQQJ 1QLED 5KLIB 1MUUA 4N78E 3Q5PA 1NTMJ 3RK3D 4AYCA 4YXWH 1GD2E 3TDKA 4NPEA 3L70D 5AW0B 1SVFA 3VTPC 1YJNP 1URQD 3MZWB 3IN6A 4N3YB 1JM0A 2Y0DA 4AUWA 1IZNB 3I5CA 3V4QA 3FWNA 5GTIE 2QJPB 2KP8A 3MD0A 1SQVK 3L75E 1AV1A 1SQPK 3L4FA 2JEEA 3B71A 1KB9H 4YXDC 1SQVJ 5H2FE 3KXDA 1ZR4A 1P84I 2SPZA 3NFQA 1L4AB 4L76A 2HFED 3H1IJ 1NU1E 3IR9A 4RKUJ 3JSVC 2K9JA 1NTKE 1RF1A 1FJKA 2Q3IA 1HUCA 3II6A 1GU4A 1EQ7A 1KQSO 5DJUB 1FJPA 2BEQD 2K37A 1UIIA 3JCUE 5KJ7A 3CLQA 3FXDA 3FX0A 2J58A 3EQ2A 1NYHA 2Y0CA 3H1ID 1NAYA 3L73G 4A7PA 3CCQP 1YI2P 1FOSF 5APVA 3TGUD 2QE7H 5KLVJ 3GHGB 1QGKB 1Z56A 3AE2C 4QMAA 2O01N 3BRTB 3G9RA 4ZMDA 3GLMA 3LW5H 3USSA 1EZVG 2CK3H 3AEBC 3SFEC 1NKZB 1ZW0A 5KAIE 2KOGA 2XKMA 2ZVNB 3EFFK 2VRSA 1BE3E 1S1CX 1ZRTD 3GMAA 1SQVE 1LT1A 1IFIA 2ZVOB 3AE9C 3EWKA 4H44D 3OA7A 3G3ZA 4N6JA 1LT9B 2UWJE 3BCCG 5M1BA 1IJDB 3QWOC 2FYUG 3RL0g 5AVYB 3V2QA 2H43A 1NVOA 1JO5A 3PRJA 3CMEP 1JCDA 1JY3P 4H13B 5KLVD 2IFNA 3GF3A 1L0NK 3IAOA 3U1AA 1W2BO 3A5TA 3UIAA 3T97B 4ASWA 3L72D 5APSA 2RKLA 5AVSB 1IFMA 2K3RA 3A0BH 3CWBD 3B5NB 4PJ0H 3P8MC 2WPSA 5KJ7C 2IZ0A 2WSFH 4UB6H 1KQGB 1X22A 2RN0A 4KJMA 3SSUA 4BXLA 1GTWA 1Q7YQ 2XNDH 4XE5B 5C39A 2B87B 3V2PA 2E5TA 3L73J 3Q5RA 4WVZA 2OTJP 2IZ1A 1JCCA 1PPJD 1U7MA 2KSJA 2Y9ZA 1Q86Q 1N8RQ 1YTZI 1VQ7P 3A0HE 1LTTC 2IBZE 2WSFJ 3Q2YA 1NJIQ 5B66H 1VQNP 1AJYA 1EDJA 2WPRA 3O6QA 2BCCE 1LTSC 3TYYA 3Q5SA 1FZGA 2FYZA 3CCEP 1R5LA 1RE3A 1E5WA 3H1KE 1G1JA 1GL2B 1FZBA 3HD7C 1JTHB 2M5AA 4GOEA 1SS1A 1Y47A 1PGQA 3RK2D 3A2AA 1CI6B 4R4MA 4WWIA 5EFWB 3TGUE 1M7LA 1FAVA 1JY2O 1RE3C 2FKWB 2HLOA 3HE4B 2FFDA 1RF1C 4C7NB 3M9HA 2FFDB 1LT9C 1JEKA 2FYUJ 3CX5E 5CCGC 3C1LA 2H8PD 2E43A 1KB9D 2IYPA 4PD4I 1LWUB 4D6TE 2FFDC 1FZCB 2WSCH 1N7SB 1PGPA 2HODA 4ZNCA 1NOHA 3I55P 2WQYC 3CCUP 1NTZD 4OGQD 1OMIA 4ZKPA 1FZCC 3CWBE 1NTZE 5AW5B 4EDFA 2KSEA 2R5BA 1XTCC 1SQBG 2AEMA 1OWAA 2YNYA 3L72E 4L75A 2OYHB 2K9YA 4C7RA 3B5NC 3L37A 1FZAA 1YIJP 1NTZG 1K04A 1NU1D 1BGYE 2JWDA 1PL5A 1RHZB 2KB7P 4EIJA 4O9BA 1M1JA 3KQGA 1JOCA 3S9OA 3CMAP 2OYIC 1AA0A 1EC5A 3MUDC 2O1JA 2OQQA 1EDKA 2XDJA 1DEEG 2ZXXA 4XA4A 4DZOA 1RE4A 1PP9E 1OXZA 1NTMG 1SQBJ 2LXBA 5K5GB 1QVGO 4DCKA 1S5LE 4MN4C 1DD3A 1ZN5A 3TNUB 3H1KJ 1IC2A 2DW3A 3HD7B 4OWFA 2OTKE 5GTIH 3D6ZA 3E1RA 5CCHC 1SQXK 5AW7B 1L0NE 3L74G 1KYOH 2R3SA 2WPVB 3E7KA 3H1HD 3HTKA 5E79H 1RF1B 2JWAA 2QVAA 2E76C 5APUA 3CWBJ 3S4RA 1LWUC 1YQ4C 2LKMA 1YYCA 3L74D 3O8ZA 4I6MC 4LGDE 1KTMA 4DJGA 2KZJA 1CSBA 2WT7A 1H0TA 3GHGA 1SQXD 1G1IA 3L36A 3L71J 1VPCA 1FOSE 1JY2P 3BRVB 4Y99C 1IK9A 1K8AQ 2Z5HA 1HWTC 3C9IA 1L2PA 5KJ7D
chains in the Genus database with same CATH topology
4ZMDA 1MFTA 1EDIA 2M0BA 1ZW0A 2KZIA 1OVRA 4GODA 1LT1A 5CBNA 2QRXA 2UWJE 4EYYQ 3QWOC 4NPDA 2P58A 1NVOA 1LP1B 2R44A 1EDLA 5DJTB 2B87A 2RKLA 2K3RA 2LXCB 4K35A 4KJMA 4ASVA 4BXLA 5C39A 2B87B 1U7MA 4ASWA 3ZDMA 5CBOA 4HB1A 1EDJA 4GOFA 2B88A 2HR3A 1Q2NA 4IOIH 2M5AA 4GOEA 1SS1A 1Y47A 4WWIA 5EFWB 1JMBA 4ZNCA 2I8DA 1BDDA 4NPFX 3MHVA 2KS1B 4HKZH 1S3JA 4JBZA 1LP1A 2LR2A 2WMMA 3FXEA 4CPGA 2JWDA 1OVVA 1BDCA 1EC5A 1OVUA 4K3AA 1EDKA 1DEEG 1ZXGA 2LXBA 5K5GB 1U7JA 4MN4C 4NPEA 3MZWB 1JM0A 2OTKE 3S1KA 2KUBA 1X0TA 2B89A 4HJGH 2QVAA 2SPZA 1H0TB 2Q1KA 2ZAEB 3PH0A 3RGUA 2KZJA 1H0TA 5DJUB 2M5AB 2KIKA 1FC2C 3FXDA 2KI7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZMD A;  1MFT A;  1EDI A;  2M0B A;  1ZW0 A;  2KZI A;  1OVR A;  4GOD A;  1LT1 A;  5CBN A;  2QRX A;  2UWJ E;  4EYY Q;  3QWO C;  4NPD A;  2P58 A;  1NVO A;  1LP1 B;  2R44 A;  1EDL A;  5DJT B;  2B87 A;  2RKL A;  2K3R A;  2LXC B;  4K35 A;  4KJM A;  4ASV A;  4BXL A;  5C39 A;  2B87 B;  1U7M A;  4ASW A;  3ZDM A;  5CBO A;  4HB1 A;  1EDJ A;  4GOF A;  2B88 A;  2HR3 A;  1Q2N A;  4IOI H;  2M5A A;  4GOE A;  1SS1 A;  1Y47 A;  4WWI A;  5EFW B;  1JMB A;  4ZNC A;  2I8D A;  1BDD A;  4NPF X;  3MHV A;  2KS1 B;  4HKZ H;  1S3J A;  4JBZ A;  1LP1 A;  2LR2 A;  2WMM A;  3FXE A;  4CPG A;  2JWD A;  1OVV A;  1BDC A;  1EC5 A;  1OVU A;  4K3A A;  1EDK A;  1DEE G;  1ZXG A;  2LXB A;  5K5G B;  1U7J A;  4MN4 C;  4NPE A;  3MZW B;  1JM0 A;  2OTK E;  3S1K A;  2KUB A;  1X0T A;  2B89 A;  4HJG H;  2QVA A;  2SPZ A;  1H0T B;  2Q1K A;  2ZAE B;  3PH0 A;  3RGU A;  2KZJ A;  1H0T A;  5DJU B;  2M5A B;  2KIK A;  1FC2 C;  3FXD A;  2KI7 B; 
#chains in the Genus database with same CATH topology
 2IYO A;  1HF9 A;  3M0A A;  2M3E A;  1OIP A;  1X8Y A;  3KYQ A;  2AXT H;  1QL2 A;  1BE3 D;  3L75 D;  3RBZ A;  3RL0 D;  3SFD C;  5KLV G;  1Y9B A;  2AXC A;  2G3A A;  1EDI A;  3N4X A;  3BCC E;  1KIL E;  5AVR B;  1KQL A;  2A06 D;  1DH3 A;  3GG2 A;  1JMM A;  3W67 A;  2NPS C;  3M0D A;  2H88 C;  1LJ2 A;  5CJ4 A;  2XZR A;  2QJY B;  4I2L C;  5TIS E;  1L0N J;  2NPS B;  4ZKU A;  5B5E E;  3H1L E;  1KYO I;  1QEX A;  1KIL A;  1X79 B;  4GOD A;  4OGQ B;  4WY4 A;  3RL0 B;  2IPP A;  2FYN B;  1HH0 A;  2GUS A;  2IBZ D;  3E1I A;  3M9B A;  4I1L A;  4L74 A;  4U3F D;  1GW4 A;  1FE6 A;  1QX8 A;  3CXH H;  2E74 D;  2P58 A;  3VP9 A;  1A02 F;  4Y28 J;  2C0X A;  2N1T C;  2P1J A;  1PFI A;  2R44 A;  1D7M A;  2WSS H;  5KTB A;  1GMJ A;  3H1L G;  3L73 E;  1DX7 A;  2C9L Y;  4LLH A;  5BU5 A;  2B87 A;  1YBK A;  1GL2 D;  1PP9 G;  4HYT B;  5B5E H;  3Q3D A;  2LXC B;  3R4Y A;  2AEJ A;  3HRN A;  2W90 A;  1FDI A;  5KLV E;  4BWN A;  3FGA D;  2KK7 A;  2R5D A;  3L70 G;  3L75 J;  1SQP J;  1J1D C;  4IFF A;  1U57 A;  2A45 H;  2Q5U A;  2W8Z A;  3V5B A;  2KXP B;  1VQK P;  4UB8 E;  3ZDM A;  1J1D B;  1EXJ A;  1OZH A;  2YKQ A;  3CC2 P;  1VDF A;  2YXQ B;  3CXH D;  4HB1 A;  2NZ2 A;  4EOT A;  1SQX E;  2W6A A;  1SFC C;  3CPW O;  1H88 A;  1IO4 A;  2B88 A;  2XNX A;  5KAF H;  2FYU E;  2RH0 A;  1ZME C;  1K05 A;  4PD4 E;  5APX A;  2GM4 A;  2HR3 A;  4IOI H;  1KV4 A;  5GTH E;  2Q6Q A;  4DOJ A;  2POH A;  2W6B A;  4AQR D;  1SQV G;  1R5S A;  2K9J B;  1VQO P;  2A45 G;  3LIE A;  4U3F J;  3AE5 C;  2JR8 A;  3D71 A;  5H2F H;  2FYN C;  3CD6 P;  4M3L A;  5APQ A;  1JNM A;  2JP3 A;  5KAI H;  3BVH A;  3HUS C;  5CMZ A;  1URQ C;  1RY3 A;  1NO4 A;  4H0L B;  5AVT B;  1DD4 A;  3CX5 H;  1BGY J;  3KZI E;  5AVQ B;  1LGH B;  1FS0 E;  1BCC G;  4H0L C;  2FY8 A;  2WIT A;  5AVZ B;  4EI2 A;  1NWQ A;  1LTJ A;  2Z5I A;  1S9K E;  3CC4 P;  3MHV A;  1YQ3 C;  1P84 H;  2MJZ A;  3B4S A;  1QL1 A;  1LTJ B;  2ZYD A;  2N9B A;  3NMD A;  1VF5 D;  1S3J A;  1OW7 A;  3AED C;  5AW6 B;  3WU2 E;  1LP1 A;  2PGD A;  2RMZ A;  2OYH C;  2QJP C;  1AQ5 A;  3RBX A;  3H1H G;  1VQ4 P;  3Q1M A;  1AQT A;  3AEC C;  3L71 D;  1SQP D;  3FWL A;  1OVU A;  4K3A A;  2PP6 A;  1N73 A;  3BAS A;  1L4A C;  1NU1 G;  2D2C D;  1YIT P;  1U7J A;  1SFC A;  1G2C B;  1N73 B;  4WY4 C;  3U1C A;  4N78 D;  2BAS A;  4RO0 A;  4PJ0 E;  2GA1 A;  2H7H A;  2QJK C;  1PPJ G;  1LTB C;  1NTM D;  3G71 P;  3AE3 C;  3S1K A;  1J1E B;  4W7Y A;  1MZ9 A;  2QJK B;  1PZQ A;  3H1I G;  4HH2 A;  3CCV P;  2KUB A;  4D6T J;  1L0L K;  1GK4 A;  2P67 A;  1BCC E;  2QSI A;  3HUS A;  3IFM A;  1BE3 G;  3L74 J;  3VOP A;  1VF5 C;  2KLV A;  4HJG H;  5KLI C;  5L8R J;  1H0T B;  2Q1K A;  3IF4 A;  2BCC J;  5KLV K;  4PD4 H;  1NKN A;  3AEF C;  3B5N D;  1L0N D;  3H1L D;  3PH0 A;  4BRY B;  2Y9Y A;  2KLU A;  1K9M Q;  3H1K G;  2YIU C;  3M91 A;  3RGU A;  2YO2 A;  2OGU A;  4BRY A;  1PGJ A;  4KT0 J;  3JCU H;  1PP9 D;  2BCC G;  2YIU B;  3TSI A;  1RQU A;  3O6Q B;  2M5A B;  2KIK A;  5APT A;  2IBZ G;  3H1I E;  1KIL D;  2V7Q H;  2E75 D;  1DIP A;  2PRR A;  2YXR B;  3H1K D;  1H89 A;  1KYO D;  3H1J E;  1NTK J;  1CW5 A;  1S72 P;  1PPJ E;  2QEX P;  1VQ9 P;  2KS1 A;  1N7S C;  3MP7 B;  1SQB D;  1UIX A;  1IFJ A;  1NTK K;  2E76 D;  2N1T D;  5AVX B;  2W27 A;  5BVZ A;  3SWF A;  1USE A;  1JY2 N;  2E74 C;  1FZC A;  4H13 C;  1KQF B;  2ZFC A;  1NTZ J;  1NTK G;  2P7J A;  2A45 I;  4WY4 B;  1VQ6 P;  4JYC A;  4IFD K;  3V2R A;  3L70 E;  4L73 A;  4PV1 D;  2Y0E A;  3P8C E;  2H89 C;  1OVR A;  1LWU A;  3HE5 B;  3L72 J;  3NXS A;  2E42 A;  1URQ A;  5CCG A;  1BCC J;  1MFZ A;  2WSE J;  4IL6 E;  4U7J A;  1WRG A;  2OYI B;  1HBW A;  1KFN A;  3CXH E;  3KPE A;  1T3J A;  3GW6 A;  1N7L A;  1JUN A;  2KYV A;  5CHX A;  5APY A;  3H1H J;  1H8A A;  1HGV A;  1L0L J;  1RE4 C;  1KB9 E;  2QIW A;  2QM7 A;  3CI9 A;  5AVU B;  3VMA A;  1RQV A;  1FDM A;  1SQQ E;  1HJB A;  4JQ0 D;  3WUU A;  3SWK A;  1XTG B;  2E5Y A;  2Q3E A;  1ZR2 A;  1M56 D;  3CXH I;  1L0L G;  3PLN A;  4RES B;  1USD A;  3CCJ P;  3TNU A;  3AEE C;  3KDP B;  1EZV E;  1L4A A;  4K35 A;  4I7Z B;  4ASV A;  3L73 D;  1BSH A;  1BGY D;  1J2J B;  3PTZ A;  4H44 B;  3VMY A;  1A02 J;  4I7Z C;  4DT0 A;  2ZYA A;  1TU3 F;  3AEA C;  4H44 C;  2Q7C A;  1KIL C;  1T6A A;  1SQP G;  3TGU J;  1NAF A;  3HTK B;  1FU1 A;  1PIX A;  3MTU E;  3VMZ A;  1NHL A;  4U3F E;  2WZ7 A;  2R32 A;  1BGY G;  1LTA C;  1OW8 A;  1SQX G;  2YO3 A;  1FZF A;  2O3J A;  1KZU B;  1ZV8 A;  3M9Q A;  5CCH D;  2OAR A;  3P8C D;  2WTY A;  2V7Q J;  4RJT A;  3L72 G;  1BSN A;  1X9V A;  1CZQ A;  4LC1 A;  4W7Z A;  2WT7 B;  4YPC A;  3OW2 O;  3TF5 A;  5GTH H;  4WB4 A;  3WUV A;  3EFG A;  2V4H A;  1EZV I;  2K1A A;  2FBW C;  2FYU D;  1GU5 A;  3H1H E;  4YTP C;  2BEZ F;  1JMB A;  3TK1 A;  1JB0 J;  2JJL A;  3F89 A;  5AW2 B;  3BCC J;  3MUD A;  2C0W A;  2JDI H;  2I8D A;  3GHG C;  4W80 A;  1OX3 A;  4C46 A;  4OH8 B;  1NH4 A;  1BDD A;  1LTI C;  2IBZ I;  2XV5 A;  3P7K A;  1VQ5 P;  1L0N G;  1KB9 I;  3F5H A;  1GL2 C;  3BCC D;  4WY4 D;  3OJA B;  3WU2 H;  4HKZ H;  1EZV D;  2ZXE B;  3BAT A;  4WBA A;  3FXE A;  2LR2 A;  1LT9 A;  4JBZ A;  2FYU K;  1OVV A;  1SLQ A;  2Z4E A;  3RK2 C;  2N1T B;  3HD7 D;  2PAJ A;  2NPS A;  1AVO A;  1SFC D;  3M0D C;  4GDO A;  4R4L A;  3I56 P;  2N1T A;  3H32 A;  1KIL B;  1ZXG A;  2M3B A;  3CL3 D;  4XFJ A;  1GK6 A;  3PP5 A;  1NTZ K;  3H32 B;  1VQM P;  1YJW P;  4UB8 H;  3LID A;  2ZT9 B;  1VQP P;  1S4X A;  3AE8 C;  1VQL P;  3H25 A;  2HYN A;  3CC7 P;  1FZE A;  2PFX A;  3ABV C;  3B5N A;  4JPZ B;  3CCR P;  3A0H H;  1YTZ T;  4JF7 A;  1EXI A;  1P84 D;  1WMK A;  2OTL P;  3VN0 A;  1DEB A;  2YMK A;  1IFP A;  3AE6 C;  3C8V A;  1SQB E;  1JY3 N;  3B8E B;  3N7N A;  3CX5 D;  4Y99 B;  1BE3 J;  2L5G B;  1X0T A;  4IL6 X;  4UB6 E;  3WMM 0;  2NPS D;  1Q82 Q;  1K73 Q;  2B89 A;  1NTM K;  3A0B E;  3PJS K;  1M1K Q;  2W6J H;  1N2D C;  1QVF O;  1IK7 A;  2O1K A;  2ZAE B;  2K88 A;  2GUV A;  1SQV D;  1M57 D;  3A3Y B;  4H0L D;  1WT6 A;  2IX7 C;  3CX5 I;  4OVN F;  1SQX J;  1ZRT E;  1GL2 A;  1T8Z A;  2P2U A;  1JTH A;  4C7N A;  1NGM B;  3QH9 A;  4IFM A;  1Y8A A;  1L0L D;  2L91 A;  1R8E A;  1PGO A;  2D2C B;  2E75 B;  5KKZ C;  1FC2 C;  1VL2 A;  3G4S P;  2HG5 D;  1N7S A;  2HOD B;  3L70 J;  2ZJS E;  2D2C C;  3KHU A;  1MKM A;  2KI7 B;  4IL6 H;  4KHX A;  3RK2 B;  5KKZ B;  1LTG C;  3MIW A;  1KC8 Q;  3ITK A;  3D6Y A;  2OYH A;  5TJH A;  2ITA A;  5AW3 B;  3SWY A;  1MFT A;  3V6I A;  2AXT E;  2M0B A;  2WWW A;  1M1J C;  1LTJ C;  3CCL P;  2ZT9 C;  5AVW B;  1M90 Q;  2CPS A;  2OYO A;  4PV1 B;  5AW9 B;  3AE7 C;  2KZI A;  1M1J B;  1JY3 O;  2P10 A;  3W68 A;  1YHQ P;  1YJ9 P;  3AEG C;  4PD4 D;  4B86 A;  1SQB K;  1NTK D;  5APW A;  5CBN A;  1E79 H;  3V2N A;  2QRX A;  4EYY Q;  2J5U A;  1GDT A;  1FDO A;  1S2E A;  2CPB A;  2JKV A;  1PP9 J;  3K5B A;  4NPD A;  5E79 E;  3CWB G;  1LP1 B;  2XU6 A;  1IFN A;  2AEF A;  2G8Y A;  3HD7 A;  3L75 G;  3VMX A;  5CCH A;  2C9N Y;  5DJT B;  1EDL A;  1KYO E;  4H13 D;  1SQP E;  1T2K C;  1SFC B;  4GIF A;  3NTN A;  4D6T G;  2QJY C;  3G6E P;  2IDB A;  1AVY A;  2R3C A;  1J1E C;  5AW1 B;  1W5C E;  3PHL A;  1MV8 A;  3R2P A;  3LW5 J;  4U3F G;  2WSE H;  1S9K D;  1Q81 Q;  4OGQ C;  1AFO A;  1G2C A;  1RF0 A;  3RK3 E;  3RL0 C;  2HPC B;  1SQQ D;  3JC2 2;  2E75 C;  4D6T D;  2HPC A;  3T97 A;  1VF5 B;  1S5L H;  3TGU G;  1L4A D;  2W83 C;  1N86 A;  2WPQ A;  1FBM A;  3L74 E;  2IFM A;  5CJ0 A;  1RF0 C;  2QG4 A;  3L71 G;  1M8O B;  4GKG A;  4GT1 A;  3AE1 C;  3HUS B;  1SQQ G;  2QA4 P;  1BCC D;  2QM8 A;  5CBO A;  2E76 B;  2B9B A;  2A06 E;  4GOF A;  5KAF E;  5CCG D;  2WSC J;  2YKP A;  3CCM P;  2O01 J;  2WVR A;  1HGZ A;  4PV1 C;  3U59 A;  1LNQ A;  1Q2N A;  2NRG A;  2FXM A;  4JYB A;  1NTM E;  1IFD A;  1SQQ K;  1ZP0 C;  1HVV A;  2N9Y B;  2ZT9 D;  5TIS H;  3RK3 B;  4TT3 H;  1KD1 Q;  2I1J A;  1KFM A;  2KNC B;  3H1J J;  1GZL A;  1S5L X;  4TLF A;  4Z1M H;  3RK3 C;  1GW3 A;  2KNC A;  2J59 M;  1ZOY C;  5AW4 B;  1OW6 A;  2E74 B;  5B66 E;  1CI6 A;  1T3U A;  2YMY A;  3GF7 A;  1HJ0 A;  3H1J D;  2Q9I A;  1KOR A;  2O01 H;  3AE4 C;  3HE4 A;  2I1K A;  3CCS P;  1P84 E;  1NU1 K;  3VYI A;  1W2E A;  1Q90 D;  3H6P A;  3MGN A;  4NPF X;  1N73 C;  2YKO A;  3KZI H;  5AVV B;  2KS1 B;  3OAK A;  1NU1 J;  2MKV A;  1HTL C;  1SP4 A;  3A7O A;  3H1J G;  3H1L J;  2FXO A;  1KMI Z;  3M06 A;  3P32 A;  5BU8 B;  1T2K D;  1ZLL A;  1KN7 A;  2JO1 A;  2M8R A;  2BCC D;  2A06 G;  2WMM A;  3VP8 A;  1PV3 A;  4CPG A;  1N7S D;  3V4W A;  5AW8 B;  3D70 A;  1BDC A;  3L35 A;  3HE5 A;  1VQ8 P;  3L71 E;  1URQ B;  1RH5 B;  2ZYG A;  2FXP A;  1OFC X;  3WUT A;  2OYI A;  1L0L E;  1SQQ J;  1QLE D;  5KLI B;  1MUU A;  4N78 E;  3Q5P A;  1NTM J;  3RK3 D;  4AYC A;  4YXW H;  1GD2 E;  3TDK A;  4NPE A;  3L70 D;  5AW0 B;  1SVF A;  3VTP C;  1YJN P;  1URQ D;  3MZW B;  3IN6 A;  4N3Y B;  1JM0 A;  2Y0D A;  4AUW A;  1IZN B;  3I5C A;  3V4Q A;  3FWN A;  5GTI E;  2QJP B;  2KP8 A;  3MD0 A;  1SQV K;  3L75 E;  1AV1 A;  1SQP K;  3L4F A;  2JEE A;  3B71 A;  1KB9 H;  4YXD C;  1SQV J;  5H2F E;  3KXD A;  1ZR4 A;  1P84 I;  2SPZ A;  3NFQ A;  1L4A B;  4L76 A;  2HFE D;  3H1I J;  1NU1 E;  3IR9 A;  4RKU J;  3JSV C;  2K9J A;  1NTK E;  1RF1 A;  1FJK A;  2Q3I A;  1HUC A;  3II6 A;  1GU4 A;  1EQ7 A;  1KQS O;  5DJU B;  1FJP A;  2BEQ D;  2K37 A;  1UII A;  3JCU E;  5KJ7 A;  3CLQ A;  3FXD A;  3FX0 A;  2J58 A;  3EQ2 A;  1NYH A;  2Y0C A;  3H1I D;  1NAY A;  3L73 G;  4A7P A;  3CCQ P;  1YI2 P;  1FOS F;  5APV A;  3TGU D;  2QE7 H;  5KLV J;  3GHG B;  1QGK B;  1Z56 A;  3AE2 C;  4QMA A;  2O01 N;  3BRT B;  3G9R A;  4ZMD A;  3GLM A;  3LW5 H;  3USS A;  1EZV G;  2CK3 H;  3AEB C;  3SFE C;  1NKZ B;  1ZW0 A;  5KAI E;  2KOG A;  2XKM A;  2ZVN B;  3EFF K;  2VRS A;  1BE3 E;  1S1C X;  1ZRT D;  3GMA A;  1SQV E;  1LT1 A;  1IFI A;  2ZVO B;  3AE9 C;  3EWK A;  4H44 D;  3OA7 A;  3G3Z A;  4N6J A;  1LT9 B;  2UWJ E;  3BCC G;  5M1B A;  1IJD B;  3QWO C;  2FYU G;  3RL0 g;  5AVY B;  3V2Q A;  2H43 A;  1NVO A;  1JO5 A;  3PRJ A;  3CME P;  1JCD A;  1JY3 P;  4H13 B;  5KLV D;  2IFN A;  3GF3 A;  1L0N K;  3IAO A;  3U1A A;  1W2B O;  3A5T A;  3UIA A;  3T97 B;  4ASW A;  3L72 D;  5APS A;  2RKL A;  5AVS B;  1IFM A;  2K3R A;  3A0B H;  3CWB D;  3B5N B;  4PJ0 H;  3P8M C;  2WPS A;  5KJ7 C;  2IZ0 A;  2WSF H;  4UB6 H;  1KQG B;  1X22 A;  2RN0 A;  4KJM A;  3SSU A;  4BXL A;  1GTW A;  1Q7Y Q;  2XND H;  4XE5 B;  5C39 A;  2B87 B;  3V2P A;  2E5T A;  3L73 J;  3Q5R A;  4WVZ A;  2OTJ P;  2IZ1 A;  1JCC A;  1PPJ D;  1U7M A;  2KSJ A;  2Y9Z A;  1Q86 Q;  1N8R Q;  1YTZ I;  1VQ7 P;  3A0H E;  1LTT C;  2IBZ E;  2WSF J;  3Q2Y A;  1NJI Q;  5B66 H;  1VQN P;  1AJY A;  1EDJ A;  2WPR A;  3O6Q A;  2BCC E;  1LTS C;  3TYY A;  3Q5S A;  1FZG A;  2FYZ A;  3CCE P;  1R5L A;  1RE3 A;  1E5W A;  3H1K E;  1G1J A;  1GL2 B;  1FZB A;  3HD7 C;  1JTH B;  2M5A A;  4GOE A;  1SS1 A;  1Y47 A;  1PGQ A;  3RK2 D;  3A2A A;  1CI6 B;  4R4M A;  4WWI A;  5EFW B;  3TGU E;  1M7L A;  1FAV A;  1JY2 O;  1RE3 C;  2FKW B;  2HLO A;  3HE4 B;  2FFD A;  1RF1 C;  4C7N B;  3M9H A;  2FFD B;  1LT9 C;  1JEK A;  2FYU J;  3CX5 E;  5CCG C;  3C1L A;  2H8P D;  2E43 A;  1KB9 D;  2IYP A;  4PD4 I;  1LWU B;  4D6T E;  2FFD C;  1FZC B;  2WSC H;  1N7S B;  1PGP A;  2HOD A;  4ZNC A;  1NOH A;  3I55 P;  2WQY C;  3CCU P;  1NTZ D;  4OGQ D;  1OMI A;  4ZKP A;  1FZC C;  3CWB E;  1NTZ E;  5AW5 B;  4EDF A;  2KSE A;  2R5B A;  1XTC C;  1SQB G;  2AEM A;  1OWA A;  2YNY A;  3L72 E;  4L75 A;  2OYH B;  2K9Y A;  4C7R A;  3B5N C;  3L37 A;  1FZA A;  1YIJ P;  1NTZ G;  1K04 A;  1NU1 D;  1BGY E;  2JWD A;  1PL5 A;  1RHZ B;  2KB7 P;  4EIJ A;  4O9B A;  1M1J A;  3KQG A;  1JOC A;  3S9O A;  3CMA P;  2OYI C;  1AA0 A;  1EC5 A;  3MUD C;  2O1J A;  2OQQ A;  1EDK A;  2XDJ A;  1DEE G;  2ZXX A;  4XA4 A;  4DZO A;  1RE4 A;  1PP9 E;  1OXZ A;  1NTM G;  1SQB J;  2LXB A;  5K5G B;  1QVG O;  4DCK A;  1S5L E;  4MN4 C;  1DD3 A;  1ZN5 A;  3TNU B;  3H1K J;  1IC2 A;  2DW3 A;  3HD7 B;  4OWF A;  2OTK E;  5GTI H;  3D6Z A;  3E1R A;  5CCH C;  1SQX K;  5AW7 B;  1L0N E;  3L74 G;  1KYO H;  2R3S A;  2WPV B;  3E7K A;  3H1H D;  3HTK A;  5E79 H;  1RF1 B;  2JWA A;  2QVA A;  2E76 C;  5APU A;  3CWB J;  3S4R A;  1LWU C;  1YQ4 C;  2LKM A;  1YYC A;  3L74 D;  3O8Z A;  4I6M C;  4LGD E;  1KTM A;  4DJG A;  2KZJ A;  1CSB A;  2WT7 A;  1H0T A;  3GHG A;  1SQX D;  1G1I A;  3L36 A;  3L71 J;  1VPC A;  1FOS E;  1JY2 P;  3BRV B;  4Y99 C;  1IK9 A;  1K8A Q;  2Z5H A;  1HWT C;  3C9I A;  1L2P A;  5KJ7 D; 
#chains in the Genus database with same CATH homology
 4ZMD A;  1MFT A;  1EDI A;  2M0B A;  1ZW0 A;  2KZI A;  1OVR A;  4GOD A;  1LT1 A;  5CBN A;  2QRX A;  2UWJ E;  4EYY Q;  3QWO C;  4NPD A;  2P58 A;  1NVO A;  1LP1 B;  2R44 A;  1EDL A;  5DJT B;  2B87 A;  2RKL A;  2K3R A;  2LXC B;  4K35 A;  4KJM A;  4ASV A;  4BXL A;  5C39 A;  2B87 B;  1U7M A;  4ASW A;  3ZDM A;  5CBO A;  4HB1 A;  1EDJ A;  4GOF A;  2B88 A;  2HR3 A;  1Q2N A;  4IOI H;  2M5A A;  4GOE A;  1SS1 A;  1Y47 A;  4WWI A;  5EFW B;  1JMB A;  4ZNC A;  2I8D A;  1BDD A;  4NPF X;  3MHV A;  2KS1 B;  4HKZ H;  1S3J A;  4JBZ A;  1LP1 A;  2LR2 A;  2WMM A;  3FXE A;  4CPG A;  2JWD A;  1OVV A;  1BDC A;  1EC5 A;  1OVU A;  4K3A A;  1EDK A;  1DEE G;  1ZXG A;  2LXB A;  5K5G B;  1U7J A;  4MN4 C;  4NPE A;  3MZW B;  1JM0 A;  2OTK E;  3S1K A;  2KUB A;  1X0T A;  2B89 A;  4HJG H;  2QVA A;  2SPZ A;  1H0T B;  2Q1K A;  2ZAE B;  3PH0 A;  3RGU A;  2KZJ A;  1H0T A;  5DJU B;  2M5A B;  2KIK A;  1FC2 C;  3FXD A;  2KI7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...