1ZXGA

Solution structure of a219
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system/protein binding
molecule keywords Immunoglobulin G binding protein A
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1zxgA00
2WMMA 2B87B 2ZAEB 3PH0A 3S1KA 2HR3A 1LP1A 3FXDA 4IOIH 1OVUA 1LT1A 4HKZH 2QVAA 4NPFX 1FC2C 1U7MA 2P58A 2KS1B 4K35A 2R44A 2KZIA 1NVOA 1LP1B 2B88A 1OVRA 2M5AB 5DJTB 4KJMA 1DEEG 3ZDMA 1S3JA 1ZXGA 1JMBA 1SS1A 4WWIA 2KI7B 4GOEA 3MZWB 1H0TB 2B89A 2B87A 1Q2NA 2Q1KA 5CBNA 3QWOC 4JBZA 1U7JA 1EDLA 1ZW0A 5C39A 1Y47A 1BDCA 2LR2A 2M5AA 2UWJE 1OVVA 1X0TA 4BXLA 4ASVA 2OTKE 2SPZA 4ZNCA 4NPDA 4MN4C 1EDKA 2QRXA 1MFTA 2KIKA 3FXEA 2LXBA 2K3RA 2KUBA 5EFWB 2KZJA 5CBOA 1H0TA 5DJUB 1JM0A 4GODA 2RKLA 1EDIA 2I8DA 3MHVA 4ASWA 4NPEA 1BDDA 4ZMDA 4GOFA 3RGUA 5K5GB 2LXCB 4K3AA 4CPGA 4HB1A 2JWDA 1EC5A 1EDJA 4HJGH 2M0BA 4EYYQ
chains in the Genus database with same CATH superfamily
1WRGA 1JNMA 4GKGA 5KLIB 2H43A 1FOSE 2P7JA 2Y0EA 3H1LJ 3A0BE 3KYQA 3O6QA 4Y28J 2K9JA 2ZT9C 4L75A 5H2FH 1T3JA 1M8OB 1JY2O 2XDJA 4U3FG 2B87B 3SFDC 2ZAEB 5KAIE 3WMM0 2FFDA 3AE5C 3PH0A 5KJ7D 1E79H 1NTZK 2QJYB 1PGPA 3L36A 1WT6A 5B5EE 3VOPA 1PPJG 5KAIH 2NPSA 2Z5IA 3KPEA 3TGUD 2A45G 2E74C 3CX5H 5AVZB 3GMAA 1N2DC 2KP8A 1TU3F 2XKMA 3M0DA 5AVXB 1HBWA 1LTGC 2QA4P 2J58A 2YIUC 2KXPB 4I1LA 4L76A 3CCUP 4GIFA 1OVUA 1SQXD 2OTLP 4IL6X 2A45I 1PPJE 2QVAA 2W90A 5CJ0A 3VMAA 3CCMP 3CX5I 3CCSP 1S4XA 1NTMD 3EQ2A 3Q3DA 1U7MA 1FC2C 1IK7A 1AVYA 4U7JA 3CWBE 2K9JB 2QIWA 4JQ0D 2OYHB 1QL1A 1M7LA 1PZQA 3KZIH 1K05A 1GMJA 1RHZB 2R44A 3CI9A 1S72P 3M06A 3VP9A 1JB0J 1NVOA 3BRTB 3CX5E 1W2BO 2B88A 2WZ7A 5KKZC 4DOJA 5B5EH 1CZQA 3AEGC 2QE7H 1N7SC 1RQUA 2VRSA 3FGAD 5DJTB 3W68A 1BSHA 1KTMA 2BEZF 5H2FE 5KLVE 1OIPA 1HTLC 4KHXA 1AA0A 1KILB 5AVQB 2GUVA 4KT0J 3TGUJ 4C7NA 3II6A 3ZDMA 1SQQE 5CMZA 1JMBA 2KSJA 3I5CA 4UB8E 3TDKA 1BE3D 1MZ9A 1SS1A 2FBWC 3NMDA 5AVWB 5CJ4A 1G1IA 1LNQA 3L73J 2IBZG 1X22A 1L2PA 2JO1A 1NAYA 2WVRA 3A0HE 4GOEA 3G6EP 1P84H 1L0LG 2B87A 2KOGA 1KILE 2A06G 2FYUG 3H1IE 4RESB 1NU1G 2FFDC 2W83C 4PD4E 4BWNA 2OYIC 1RH5B 3N7NA 1JY3N 1NU1D 1ZW0A 5C39A 4YXDC 3BCCE 4PD4H 1N7SA 3CXHD 1YYCA 1VQ9P 3CC7P 1URQC 1FDIA 1NTKG 2M3EA 3BRVB 1X9VA 1JCDA 3IFMA 1X0TA 2RN0A 1QEXA 1SQPE 2WQYC 3BATA 1GL2D 1SQBD 3HUSA 3RK2B 3VMYA 1JTHB 4D6TE 2HPCB 3SFEC 2Q3IA 3R4YA 2IPPA 3M0AA 4BRYA 1GL2A 4EI2A 1FZBA 2WSSH 2AXTE 5KKZB 4UB8H 3D71A 4H0LB 4ASVA 3Q2YA 2OYHA 4AUWA 2HLOA 3CX5D 1KB9I 2N9BA 4D6TJ 1M56D 2HODB 1PP9G 1EZVD 1NTKK 1YBKA 2GA1A 2KNCB 3AE8C 1PP9J 1NJIQ 2K9YA 1R5LA 2QRXA 1P84D 3L4FA 5AW0B 4IFMA 1L0NE 4IFFA 2WT7B 1SQXE 2MJZA 1KQSO 2NPSC 2ZVNB 1Z56A 3AE2C 3L70D 3KZIE 2ITAA 2ZXEB 1HJ0A 4LLHA 2Q7CA 1J1DC 2Z4EA 3AE7C 1U57A 3EFGA 4QMAA 2KS1A 1LWUC 1IK9A 1IJDB 2KUBA 3B8EB 5GTIH 2A06D 1OW8A 1T3UA 1BSNA 1SQXG 2FYUD 5E79E 2WWWA 2QEXP 3H32B 1DIPA 1LTSC 3PLNA 1USDA 1LTBC 4OVNF 5APXA 3UIAA 1QX8A 1SQVG 2Q9IA 1RF1A 1FZGA 4RJTA 3WU2E 2PFXA 3CC4P 1HH0A 2QJPB 1VQMP 3GHGA 4I2LC 2NPSB 3PTZA 2XZRA 3RGUA 2Y0DA 4PD4I 5K5GB 2LXCB 1RF0C 4IL6E 3I55P 4DJGA 3A5TA 3CLQA 2JWDA 4HJGH 3B4SA 3A0BH 5KTBA 2C0WA 2FXOA 2R32A 3B5NB 3SSUA 2WPRA 2QJKB 3CWBJ 2WSCH 2PGDA 3WU2H 3H1HG 3HD7C 3VMZA 1NWQA 1JMMA 3PJSK 2BCCE 3V6IA 2V7QJ 2WMMA 1BCCG 1GW4A 1JY2P 1YIJP 1IC2A 3IR9A 5APYA 1S5LE 4TLFA 1GU5A 5KLVK 1VQ7P 2JR8A 1E5WA 1YQ4C 1OW7A 3IAOA 2ZYGA 3L74J 3RK3D 1NTMG 3EWKA 3USSA 5E79H 1DH3A 2FY8A 3GHGB 2BCCJ 1JY2N 3L71J 1T8ZA 3AEDC 3BCCG 3L71D 2PRRA 2I1KA 1NAFA 3N4XA 5B66H 2BCCG 3AE1C 5APQA 3Q5RA 2H7HA 2FXMA 1VDFA 2N9YB 3WUVA 2WSFJ 3H6PA 2JJLA 1HWTC 3L35A 4HKZH 2P67A 1KB9D 2FYNC 1URQD 3F5HA 5KLIC 4IFDK 5AW3B 4LC1A 4ZKUA 1SQPG 5AW9B 5BU5A 2KS1B 2W6BA 4A7PA 5KLVG 1PGOA 1PGJA 1KYOE 1CSBA 1BE3G 1NU1K 2WSCJ 3GG2A 1GL2B 2KZIA 3H1LG 1MV8A 3RK2D 3CMAP 2QJYC 1GW3A 1LJ2A 1FZCB 1LP1B 1SQQG 3H1ID 4U3FJ 2OQQA 5APUA 4AYCA 2IYPA 2R3CA 3H1LD 2WT7A 2W8ZA 5APSA 3P8MC 2M5AB 3R2PA 1M1JA 1OW6A 1N73B 3L75G 4JYBA 3HTKA 1SQPD 3L70G 1VQPP 3HD7B 2QJPC 4ZKPA 1KQLA 1D7MA 2NPSD 2WPVB 1DEEG 4EOTA 1SLQA 2FXPA 2WSEH 4I7ZC 2B9BA 2O3JA 1OXZA 2E74D 3WUUA 2YO2A 1LGHB 1JO5A 1M57D 3H1KE 2FYZA 1LTIC 1KN7A 3ABVC 1SQXJ 1BCCE 4BRYB 2RH0A 1FS0E 3A2AA 4PJ0H 2E74B 4R4MA 3L74G 2KI7B 3V2NA 2ZT9D 2E75D 1IFJA 2IFMA 2N1TB 3U59A 3D70A 1AJYA 1NTME 3L73G 3FWLA 1Q2NA 2ZYDA 5CBNA 3A0HH 3QWOC 2FKWB 3L70J 1N73C 1GU4A 5AW7B 1LT9A 3Q1MA 1Y47A 1BDCA 2LR2A 2YKQA 1IFPA 4HH2A 3RL0C 4OGQD 5CCGD 1A02J 1SQPJ 2UWJE 3GF7A 2YKOA 1NGMB 1FZFA 2E43A 3H1KD 2YO3A 5KAFE 1OMIA 2WSEJ 4N78D 3L72G 4OH8B 2NRGA 4C46A 1EXIA 3B5NA 1VQOP 1HGVA 5CCHD 3VYIA 2D2CC 2CPBA 1KILC 4WVZA 1KQFB 2AEJA 4JPZB 5CCHC 1SQVJ 1KILD 3C9IA 1KYOI 1IFNA 1YI2P 2QG4A 3P8CD 1J1DB 3CXHE 2WPSA 3G3ZA 5TISH 1ZR2A 3BCCD 1NKNA 1MFTA 1FBMA 4PD4D 5AW4B 3L70E 3SWKA 2FFDB 2OGUA 1Q86Q 3FXEA 2BEQD 1VQNP 1RY3A 1AVOA 1RE4A 1N7SD 3U1CA 4DT0A 3CXHI 1L4AC 1NH4A 2P2UA 4H0LC 1L0NG 1KORA 5AVRB 1BCCJ 1N86A 1NTKD 1VF5D 1BE3E 2A06E 2D2CB 2FYUE 3BASA 1JM0A 3H1KJ 3NTNA 3WUTA 3CCEP 1UIXA 3MTUE 4W7ZA 3GF3A 1EDIA 1SFCB 1USEA 2I8DA 2YKPA 3RK3E 2A45H 4WY4A 1BDDA 2C9LY 3LIEA 4YPCA 2O1JA 4GOFA 1L0ND 2OTJP 1CI6B 4Y99B 2QJKC 3L72E 4I6MC 3E1IA 4H13D 4U3FE 4HB1A 3MD0A 1H8AA 3L75D 3HE5A 3MGNA 1DEBA 1VQ4P 2IFNA 2R5DA 5AW5B 3TNUA 1ZR4A 1HUCA 1LTTC 1W5CE 2JDIH 3NFQA 3RBZA 1GZLA 1Y9BA 4YXWH 3VTPC 2HPCA 2XNDH 2YXRB 1VQKP 1K8AQ 2L5GB 1VQ5P 2BASA 1FE6A 1XTGB 1VL2A 1EQ7A 3T97A 4UB6H 1JEKA 2HR3A 2N1TA 1X79B 2IYOA 3LW5J 4H44C 1KV4A 4L74A 1BGYD 1H89A 3FXDA 2N1TD 3HE4B 3AEAC 3H1LE 2P1JA 3KXDA 2R5BA 1L4AA 3L71E 3P32A 4IOIH 1KMIZ 1NO4A 1IFDA 3RBXA 1LT1A 2IDBA 3L73D 2CK3H 1QLED 2E75C 4RO0A 4HYTB 1DD3A 2AEFA 1QGKB 1RE3A 3MUDA 1VQ8P 1T6AA 1XTCC 1ZV8A 3RK3C 1LTJA 5KJ7A 1VF5B 2D2CD 1G2CA 1FZCA 4XFJA 1IO4A 2OYOA 1KILA 4L73A 1BGYE 2XV5A 1DD4A 1S9KE 1T2KC 3T97B 4UB6E 3O6QB 1OVRA 2FYUJ 5M1BA 3L74D 3TSIA 1OZHA 3PP5A 1RE3C 1CI6A 4KJMA 3M9HA 2XU6A 1OX3A 3GW6A 4N3YB 3FWNA 4Y99C 1L0LD 2YMKA 2KSEA 1HVVA 1SQQK 2E5YA 1S5LH 4H44B 3OAKA 4B86A 1UIIA 1NTZE 3H1HE 3MP7B 1MUUA 2K37A 3H1JG 5AVUB 1H0TB 1H88A 1A02F 5AW1B 1VPCA 3VN0A 1RF1B 4XA4A 2Q1KA 1SQVE 2OYIB 4C7RA 4JF7A 1KYOD 2KK7A 3L72D 4JBZA 4D6TG 3M9QA 2K88A 3TYYA 1KZUB 4OGQB 1K9MQ 4IL6H 3CL3D 1YITP 1PP9E 1ZOYC 4I7ZB 3JC22 3H1JD 3B5ND 2QM8A 2IBZD 1RQVA 1BCCD 1NTKJ 1YJWP 3CMEP 4H13B 1L0LK 3MUDC 3RL0g 1SFCA 2OTKE 1PIXA 1NTKE 2SPZA 3D6YA 1YJ9P 1KFNA 3RK3B 1SQBK 1HGZA 2ZFCA 2AEMA 4EIJA 2H88C 1PFIA 1FJPA 1VF5C 1NTMJ 2Y9YA 2HODA 3O8ZA 4MN4C 4OGQC 5APVA 5CCGC 1SQXK 1EDKA 2NZ2A 3BCCJ 3PRJA 1J1EC 1NYHA 4GDOA 1OWAA 1LWUB 3L75J 1HJBA 3C8VA 1MFZA 3TGUG 5CCGA 2KIKA 3H1IJ 5AVVB 4DCKA 2LXBA 3Q5PA 3HUSB 4U3FD 3H1JJ 1KD1Q 1FZAA 2K3RA 1NTZD 1FDOA 3H1KG 3H1HJ 4DZOA 1NTZJ 5EFWB 1SFCC 2KZJA 3L73E 3M91A 3ITKA 5CBOA 2WPQA 1M1KQ 1M90Q 1Q7YQ 1NTZG 1H0TA 2O1KA 2AXTH 2M8RA 1QVGO 1G2CB 1ZRTD 3AEEC 4GODA 2XNXA 4GT1A 2G3AA 4LGDE 1GTWA 3JCUE 1SQQJ 1ZP0C 1AFOA 2M3BA 2H8PD 2AXCA 1NU1E 2IX7C 1ZLLA 3B71A 3MHVA 2Q5UA 3TGUE 3CC2P 3HE4A 3HD7D 4NPEA 1MKMA 3B5NC 1ZN5A 1SFCD 1SQPK 1IFIA 2O01N 4WY4C 5APWA 1YTZI 1S9KD 3IN6A 3OW2O 4PJ0E 2LKMA 3G9RA 4CPGA 3AE4C 1EDJA 3SWFA 3KDPB 2C9NY 3E7KA 1NKZB 2M0BA 1J2JB 2HG5D 4EYYQ 2QM7A 1VQ6P 1SVFA 2YMYA 1G1JA 3KQGA 3OA7A 2J59M 3IF4A 1X8YA 3CWBD 1OFCX 2ZXXA 3AE3C 3LIDA 1LTJB 4W7YA 3JSVC 2L91A 3VMXA 3JCUH 1EZVE 1FAVA 1SQBG 4XE5B 3G4SP 2Z5HA 4OWFA 1L4AD 3L74E 3H1HD 2RMZA 3M9BA 1L0NK 3S1KA 2Y9ZA 1FDMA 1LP1A 4N6JA 3TF5A 2W27A 4WY4B 1SQQD 3H1IG 3S4RA 2FYNB 1YHQP 2E42A 5AW8B 1Q82Q 1LWUA 4TT3H 3VP8A 4D6TD 2KYVA 4WY4D 1EXJA 2IZ1A 2HFED 3H25A 4H13C 1T2KD 4NPFX 1YJNP 1FZCC 3A7OA 1AQTA 1FZEA 5BU8B 2H89C 2K1AA 3CCJP 2DW3A 2JWAA 3SWYA 1LTJC 2GUSA 1PV3A 2P58A 1KFMA 2MKVA 4PV1C 5KJ7C 1WMKA 4K35A 1JCCA 2Y0CA 2IZ0A 1IZNB 2WITA 3AEBC 1NU1J 3CCQP 3RK2C 3L71G 2Q3EA 2V7QH 2YXQB 3TNUB 3U1AA 3MIWA 3PHLA 3L37A 1W2EA 1K04A 3CXHH 5TISE 2OYHC 2JP3A 1ZMEC 3F89A 5KLVD 3TK1A 1LT9C 1GL2C 1R5SA 1JY3P 2R3SA 4RKUJ 1S2EA 2POHA 1Q81Q 4WBAA 3V5BA 3H1JE 2CPSA 1S3JA 2ZVOB 1L0LE 1ZXGA 2N1TC 3CWBG 3CD6P 2WSFH 2E75B 3K5BA 4JYCA 1JY3O 2PP6A 1BE3J 4PV1B 4WWIA 2QSIA 1EZVG 1SQBE 1L0NJ 3L75E 3KHUA 3H32A 2KLVA 5KAFH 2JEEA 2HYNA 3MZWB 2OYIA 3W67A 2B89A 1KC8Q 4PV1D 1P84I 5TJHA 1YTZT 2PAJA 4Z1MH 2GM4A 2E76B 1GD2E 3RL0B 3AECC 5AW6B 1N7LA 1LT9B 2C0XA 4YTPC 1U7JA 1SP4A 5AVSB 1EDLA 4AQRD 3CCVP 2Q6QA 1M1JC 3HD7A 2E76D 3OJAB 3P8CE 1PGQA 1VQLP 1QVFO 1YQ3C 3HTKB 1S1CX 1PPJD 2W6JH 4O9BA 1NOHA 2M5AA 3EFFK 3P7KA 2YNYA 2IBZE 5GTIE 1OVVA 3D6ZA 3C1LA 1SQVK 2JKVA 2ZYAA 1FU1A 1URQB 4BXLA 3CCRP 1AV1A 1NHLA 3V4QA 1KB9H 1BGYG 1ZRTE 1RF1C 1SQVD 2W6AA 3AE9C 3AEFC 1GDTA 1RE4C 1Y8AA 4H0LD 1GK4A 4ZNCA 2KNCA 5GTHH 5BVZA 3S9OA 4NPDA 5CHXA 2V4HA 1K73Q 3NXSA 1PP9D 1HF9A 2P10A 1PL5A 1L4AB 1N7SB 2J5UA 2O01J 1R8EA 2WTYA 5L8RJ 1JTHA 3I56P 3G71P 1KYOH 5AVYB 4N78E 5GTHE 1FJKA 1JOCA 2E76C 3HE5B 2ZJSE 1NTMK 3M0DC 3V2QA 2FYUK 5CCHA 1JUNA 3A3YB 1KB9E 5KLVJ 1SQBJ 5DJUB 2I1JA 2YIUB 3V4WA 3CPWO 1QL2A 3BVHA 1DX7A 3LW5H 1BGYJ 2IBZI 2RKLA 2BCCD 2ZT9B 1L0LJ 1EZVI 3HRNA 2OARA 1LTAC 3AE6C 2KLUA 4W80A 3V2RA 5B66E 1RF0A 1N8RQ 2E5TA 1J1EB 3FX0A 3GLMA 5AW2B 3RL0D 4ASWA 4ZMDA 1P84E 1FOSF 3GHGC 1S5LX 4C7NB 1GK6A 3CCLP 1IFMA 3E1RA 4EDFA 1CW5A 4M3LA 1KQGB 4R4LA 1M1JB 2G8YA 4K3AA 1N73A 2KB7P 1EC5A 3HUSC 2O01H 1Q90D 4H44D 3QH9A 1AQ5A 3Q5SA 5AVTB 3V2PA 1URQA 4WB4A 3L72J 5APTA
chains in the Genus database with same CATH topology
2WMMA 2B87B 2ZAEB 3PH0A 3S1KA 2HR3A 1LP1A 3FXDA 4IOIH 1OVUA 1LT1A 4HKZH 2QVAA 4NPFX 1FC2C 1U7MA 2P58A 2KS1B 4K35A 2R44A 2KZIA 1NVOA 1LP1B 2B88A 1OVRA 2M5AB 5DJTB 4KJMA 1DEEG 3ZDMA 1S3JA 1ZXGA 1JMBA 1SS1A 4WWIA 2KI7B 4GOEA 3MZWB 1H0TB 2B89A 2B87A 1Q2NA 2Q1KA 5CBNA 3QWOC 4JBZA 1U7JA 1EDLA 1ZW0A 5C39A 1Y47A 1BDCA 2LR2A 2M5AA 2UWJE 1OVVA 1X0TA 4BXLA 4ASVA 2OTKE 2SPZA 4ZNCA 4NPDA 4MN4C 1EDKA 2QRXA 1MFTA 2KIKA 3FXEA 2LXBA 2K3RA 2KUBA 5EFWB 2KZJA 5CBOA 1H0TA 5DJUB 1JM0A 4GODA 2RKLA 1EDIA 2I8DA 3MHVA 4ASWA 4NPEA 1BDDA 4ZMDA 4GOFA 3RGUA 5K5GB 2LXCB 4K3AA 4CPGA 4HB1A 2JWDA 1EC5A 1EDJA 4HJGH 2M0BA 4EYYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMM A;  2B87 B;  2ZAE B;  3PH0 A;  3S1K A;  2HR3 A;  1LP1 A;  3FXD A;  4IOI H;  1OVU A;  1LT1 A;  4HKZ H;  2QVA A;  4NPF X;  1FC2 C;  1U7M A;  2P58 A;  2KS1 B;  4K35 A;  2R44 A;  2KZI A;  1NVO A;  1LP1 B;  2B88 A;  1OVR A;  2M5A B;  5DJT B;  4KJM A;  1DEE G;  3ZDM A;  1S3J A;  1ZXG A;  1JMB A;  1SS1 A;  4WWI A;  2KI7 B;  4GOE A;  3MZW B;  1H0T B;  2B89 A;  2B87 A;  1Q2N A;  2Q1K A;  5CBN A;  3QWO C;  4JBZ A;  1U7J A;  1EDL A;  1ZW0 A;  5C39 A;  1Y47 A;  1BDC A;  2LR2 A;  2M5A A;  2UWJ E;  1OVV A;  1X0T A;  4BXL A;  4ASV A;  2OTK E;  2SPZ A;  4ZNC A;  4NPD A;  4MN4 C;  1EDK A;  2QRX A;  1MFT A;  2KIK A;  3FXE A;  2LXB A;  2K3R A;  2KUB A;  5EFW B;  2KZJ A;  5CBO A;  1H0T A;  5DJU B;  1JM0 A;  4GOD A;  2RKL A;  1EDI A;  2I8D A;  3MHV A;  4ASW A;  4NPE A;  1BDD A;  4ZMD A;  4GOF A;  3RGU A;  5K5G B;  2LXC B;  4K3A A;  4CPG A;  4HB1 A;  2JWD A;  1EC5 A;  1EDJ A;  4HJG H;  2M0B A;  4EYY Q; 
#chains in the Genus database with same CATH topology
 1WRG A;  1JNM A;  4GKG A;  5KLI B;  2H43 A;  1FOS E;  2P7J A;  2Y0E A;  3H1L J;  3A0B E;  3KYQ A;  3O6Q A;  4Y28 J;  2K9J A;  2ZT9 C;  4L75 A;  5H2F H;  1T3J A;  1M8O B;  1JY2 O;  2XDJ A;  4U3F G;  2B87 B;  3SFD C;  2ZAE B;  5KAI E;  3WMM 0;  2FFD A;  3AE5 C;  3PH0 A;  5KJ7 D;  1E79 H;  1NTZ K;  2QJY B;  1PGP A;  3L36 A;  1WT6 A;  5B5E E;  3VOP A;  1PPJ G;  5KAI H;  2NPS A;  2Z5I A;  3KPE A;  3TGU D;  2A45 G;  2E74 C;  3CX5 H;  5AVZ B;  3GMA A;  1N2D C;  2KP8 A;  1TU3 F;  2XKM A;  3M0D A;  5AVX B;  1HBW A;  1LTG C;  2QA4 P;  2J58 A;  2YIU C;  2KXP B;  4I1L A;  4L76 A;  3CCU P;  4GIF A;  1OVU A;  1SQX D;  2OTL P;  4IL6 X;  2A45 I;  1PPJ E;  2QVA A;  2W90 A;  5CJ0 A;  3VMA A;  3CCM P;  3CX5 I;  3CCS P;  1S4X A;  1NTM D;  3EQ2 A;  3Q3D A;  1U7M A;  1FC2 C;  1IK7 A;  1AVY A;  4U7J A;  3CWB E;  2K9J B;  2QIW A;  4JQ0 D;  2OYH B;  1QL1 A;  1M7L A;  1PZQ A;  3KZI H;  1K05 A;  1GMJ A;  1RHZ B;  2R44 A;  3CI9 A;  1S72 P;  3M06 A;  3VP9 A;  1JB0 J;  1NVO A;  3BRT B;  3CX5 E;  1W2B O;  2B88 A;  2WZ7 A;  5KKZ C;  4DOJ A;  5B5E H;  1CZQ A;  3AEG C;  2QE7 H;  1N7S C;  1RQU A;  2VRS A;  3FGA D;  5DJT B;  3W68 A;  1BSH A;  1KTM A;  2BEZ F;  5H2F E;  5KLV E;  1OIP A;  1HTL C;  4KHX A;  1AA0 A;  1KIL B;  5AVQ B;  2GUV A;  4KT0 J;  3TGU J;  4C7N A;  3II6 A;  3ZDM A;  1SQQ E;  5CMZ A;  1JMB A;  2KSJ A;  3I5C A;  4UB8 E;  3TDK A;  1BE3 D;  1MZ9 A;  1SS1 A;  2FBW C;  3NMD A;  5AVW B;  5CJ4 A;  1G1I A;  1LNQ A;  3L73 J;  2IBZ G;  1X22 A;  1L2P A;  2JO1 A;  1NAY A;  2WVR A;  3A0H E;  4GOE A;  3G6E P;  1P84 H;  1L0L G;  2B87 A;  2KOG A;  1KIL E;  2A06 G;  2FYU G;  3H1I E;  4RES B;  1NU1 G;  2FFD C;  2W83 C;  4PD4 E;  4BWN A;  2OYI C;  1RH5 B;  3N7N A;  1JY3 N;  1NU1 D;  1ZW0 A;  5C39 A;  4YXD C;  3BCC E;  4PD4 H;  1N7S A;  3CXH D;  1YYC A;  1VQ9 P;  3CC7 P;  1URQ C;  1FDI A;  1NTK G;  2M3E A;  3BRV B;  1X9V A;  1JCD A;  3IFM A;  1X0T A;  2RN0 A;  1QEX A;  1SQP E;  2WQY C;  3BAT A;  1GL2 D;  1SQB D;  3HUS A;  3RK2 B;  3VMY A;  1JTH B;  4D6T E;  2HPC B;  3SFE C;  2Q3I A;  3R4Y A;  2IPP A;  3M0A A;  4BRY A;  1GL2 A;  4EI2 A;  1FZB A;  2WSS H;  2AXT E;  5KKZ B;  4UB8 H;  3D71 A;  4H0L B;  4ASV A;  3Q2Y A;  2OYH A;  4AUW A;  2HLO A;  3CX5 D;  1KB9 I;  2N9B A;  4D6T J;  1M56 D;  2HOD B;  1PP9 G;  1EZV D;  1NTK K;  1YBK A;  2GA1 A;  2KNC B;  3AE8 C;  1PP9 J;  1NJI Q;  2K9Y A;  1R5L A;  2QRX A;  1P84 D;  3L4F A;  5AW0 B;  4IFM A;  1L0N E;  4IFF A;  2WT7 B;  1SQX E;  2MJZ A;  1KQS O;  2NPS C;  2ZVN B;  1Z56 A;  3AE2 C;  3L70 D;  3KZI E;  2ITA A;  2ZXE B;  1HJ0 A;  4LLH A;  2Q7C A;  1J1D C;  2Z4E A;  3AE7 C;  1U57 A;  3EFG A;  4QMA A;  2KS1 A;  1LWU C;  1IK9 A;  1IJD B;  2KUB A;  3B8E B;  5GTI H;  2A06 D;  1OW8 A;  1T3U A;  1BSN A;  1SQX G;  2FYU D;  5E79 E;  2WWW A;  2QEX P;  3H32 B;  1DIP A;  1LTS C;  3PLN A;  1USD A;  1LTB C;  4OVN F;  5APX A;  3UIA A;  1QX8 A;  1SQV G;  2Q9I A;  1RF1 A;  1FZG A;  4RJT A;  3WU2 E;  2PFX A;  3CC4 P;  1HH0 A;  2QJP B;  1VQM P;  3GHG A;  4I2L C;  2NPS B;  3PTZ A;  2XZR A;  3RGU A;  2Y0D A;  4PD4 I;  5K5G B;  2LXC B;  1RF0 C;  4IL6 E;  3I55 P;  4DJG A;  3A5T A;  3CLQ A;  2JWD A;  4HJG H;  3B4S A;  3A0B H;  5KTB A;  2C0W A;  2FXO A;  2R32 A;  3B5N B;  3SSU A;  2WPR A;  2QJK B;  3CWB J;  2WSC H;  2PGD A;  3WU2 H;  3H1H G;  3HD7 C;  3VMZ A;  1NWQ A;  1JMM A;  3PJS K;  2BCC E;  3V6I A;  2V7Q J;  2WMM A;  1BCC G;  1GW4 A;  1JY2 P;  1YIJ P;  1IC2 A;  3IR9 A;  5APY A;  1S5L E;  4TLF A;  1GU5 A;  5KLV K;  1VQ7 P;  2JR8 A;  1E5W A;  1YQ4 C;  1OW7 A;  3IAO A;  2ZYG A;  3L74 J;  3RK3 D;  1NTM G;  3EWK A;  3USS A;  5E79 H;  1DH3 A;  2FY8 A;  3GHG B;  2BCC J;  1JY2 N;  3L71 J;  1T8Z A;  3AED C;  3BCC G;  3L71 D;  2PRR A;  2I1K A;  1NAF A;  3N4X A;  5B66 H;  2BCC G;  3AE1 C;  5APQ A;  3Q5R A;  2H7H A;  2FXM A;  1VDF A;  2N9Y B;  3WUV A;  2WSF J;  3H6P A;  2JJL A;  1HWT C;  3L35 A;  4HKZ H;  2P67 A;  1KB9 D;  2FYN C;  1URQ D;  3F5H A;  5KLI C;  4IFD K;  5AW3 B;  4LC1 A;  4ZKU A;  1SQP G;  5AW9 B;  5BU5 A;  2KS1 B;  2W6B A;  4A7P A;  5KLV G;  1PGO A;  1PGJ A;  1KYO E;  1CSB A;  1BE3 G;  1NU1 K;  2WSC J;  3GG2 A;  1GL2 B;  2KZI A;  3H1L G;  1MV8 A;  3RK2 D;  3CMA P;  2QJY C;  1GW3 A;  1LJ2 A;  1FZC B;  1LP1 B;  1SQQ G;  3H1I D;  4U3F J;  2OQQ A;  5APU A;  4AYC A;  2IYP A;  2R3C A;  3H1L D;  2WT7 A;  2W8Z A;  5APS A;  3P8M C;  2M5A B;  3R2P A;  1M1J A;  1OW6 A;  1N73 B;  3L75 G;  4JYB A;  3HTK A;  1SQP D;  3L70 G;  1VQP P;  3HD7 B;  2QJP C;  4ZKP A;  1KQL A;  1D7M A;  2NPS D;  2WPV B;  1DEE G;  4EOT A;  1SLQ A;  2FXP A;  2WSE H;  4I7Z C;  2B9B A;  2O3J A;  1OXZ A;  2E74 D;  3WUU A;  2YO2 A;  1LGH B;  1JO5 A;  1M57 D;  3H1K E;  2FYZ A;  1LTI C;  1KN7 A;  3ABV C;  1SQX J;  1BCC E;  4BRY B;  2RH0 A;  1FS0 E;  3A2A A;  4PJ0 H;  2E74 B;  4R4M A;  3L74 G;  2KI7 B;  3V2N A;  2ZT9 D;  2E75 D;  1IFJ A;  2IFM A;  2N1T B;  3U59 A;  3D70 A;  1AJY A;  1NTM E;  3L73 G;  3FWL A;  1Q2N A;  2ZYD A;  5CBN A;  3A0H H;  3QWO C;  2FKW B;  3L70 J;  1N73 C;  1GU4 A;  5AW7 B;  1LT9 A;  3Q1M A;  1Y47 A;  1BDC A;  2LR2 A;  2YKQ A;  1IFP A;  4HH2 A;  3RL0 C;  4OGQ D;  5CCG D;  1A02 J;  1SQP J;  2UWJ E;  3GF7 A;  2YKO A;  1NGM B;  1FZF A;  2E43 A;  3H1K D;  2YO3 A;  5KAF E;  1OMI A;  2WSE J;  4N78 D;  3L72 G;  4OH8 B;  2NRG A;  4C46 A;  1EXI A;  3B5N A;  1VQO P;  1HGV A;  5CCH D;  3VYI A;  2D2C C;  2CPB A;  1KIL C;  4WVZ A;  1KQF B;  2AEJ A;  4JPZ B;  5CCH C;  1SQV J;  1KIL D;  3C9I A;  1KYO I;  1IFN A;  1YI2 P;  2QG4 A;  3P8C D;  1J1D B;  3CXH E;  2WPS A;  3G3Z A;  5TIS H;  1ZR2 A;  3BCC D;  1NKN A;  1MFT A;  1FBM A;  4PD4 D;  5AW4 B;  3L70 E;  3SWK A;  2FFD B;  2OGU A;  1Q86 Q;  3FXE A;  2BEQ D;  1VQN P;  1RY3 A;  1AVO A;  1RE4 A;  1N7S D;  3U1C A;  4DT0 A;  3CXH I;  1L4A C;  1NH4 A;  2P2U A;  4H0L C;  1L0N G;  1KOR A;  5AVR B;  1BCC J;  1N86 A;  1NTK D;  1VF5 D;  1BE3 E;  2A06 E;  2D2C B;  2FYU E;  3BAS A;  1JM0 A;  3H1K J;  3NTN A;  3WUT A;  3CCE P;  1UIX A;  3MTU E;  4W7Z A;  3GF3 A;  1EDI A;  1SFC B;  1USE A;  2I8D A;  2YKP A;  3RK3 E;  2A45 H;  4WY4 A;  1BDD A;  2C9L Y;  3LIE A;  4YPC A;  2O1J A;  4GOF A;  1L0N D;  2OTJ P;  1CI6 B;  4Y99 B;  2QJK C;  3L72 E;  4I6M C;  3E1I A;  4H13 D;  4U3F E;  4HB1 A;  3MD0 A;  1H8A A;  3L75 D;  3HE5 A;  3MGN A;  1DEB A;  1VQ4 P;  2IFN A;  2R5D A;  5AW5 B;  3TNU A;  1ZR4 A;  1HUC A;  1LTT C;  1W5C E;  2JDI H;  3NFQ A;  3RBZ A;  1GZL A;  1Y9B A;  4YXW H;  3VTP C;  2HPC A;  2XND H;  2YXR B;  1VQK P;  1K8A Q;  2L5G B;  1VQ5 P;  2BAS A;  1FE6 A;  1XTG B;  1VL2 A;  1EQ7 A;  3T97 A;  4UB6 H;  1JEK A;  2HR3 A;  2N1T A;  1X79 B;  2IYO A;  3LW5 J;  4H44 C;  1KV4 A;  4L74 A;  1BGY D;  1H89 A;  3FXD A;  2N1T D;  3HE4 B;  3AEA C;  3H1L E;  2P1J A;  3KXD A;  2R5B A;  1L4A A;  3L71 E;  3P32 A;  4IOI H;  1KMI Z;  1NO4 A;  1IFD A;  3RBX A;  1LT1 A;  2IDB A;  3L73 D;  2CK3 H;  1QLE D;  2E75 C;  4RO0 A;  4HYT B;  1DD3 A;  2AEF A;  1QGK B;  1RE3 A;  3MUD A;  1VQ8 P;  1T6A A;  1XTC C;  1ZV8 A;  3RK3 C;  1LTJ A;  5KJ7 A;  1VF5 B;  2D2C D;  1G2C A;  1FZC A;  4XFJ A;  1IO4 A;  2OYO A;  1KIL A;  4L73 A;  1BGY E;  2XV5 A;  1DD4 A;  1S9K E;  1T2K C;  3T97 B;  4UB6 E;  3O6Q B;  1OVR A;  2FYU J;  5M1B A;  3L74 D;  3TSI A;  1OZH A;  3PP5 A;  1RE3 C;  1CI6 A;  4KJM A;  3M9H A;  2XU6 A;  1OX3 A;  3GW6 A;  4N3Y B;  3FWN A;  4Y99 C;  1L0L D;  2YMK A;  2KSE A;  1HVV A;  1SQQ K;  2E5Y A;  1S5L H;  4H44 B;  3OAK A;  4B86 A;  1UII A;  1NTZ E;  3H1H E;  3MP7 B;  1MUU A;  2K37 A;  3H1J G;  5AVU B;  1H0T B;  1H88 A;  1A02 F;  5AW1 B;  1VPC A;  3VN0 A;  1RF1 B;  4XA4 A;  2Q1K A;  1SQV E;  2OYI B;  4C7R A;  4JF7 A;  1KYO D;  2KK7 A;  3L72 D;  4JBZ A;  4D6T G;  3M9Q A;  2K88 A;  3TYY A;  1KZU B;  4OGQ B;  1K9M Q;  4IL6 H;  3CL3 D;  1YIT P;  1PP9 E;  1ZOY C;  4I7Z B;  3JC2 2;  3H1J D;  3B5N D;  2QM8 A;  2IBZ D;  1RQV A;  1BCC D;  1NTK J;  1YJW P;  3CME P;  4H13 B;  1L0L K;  3MUD C;  3RL0 g;  1SFC A;  2OTK E;  1PIX A;  1NTK E;  2SPZ A;  3D6Y A;  1YJ9 P;  1KFN A;  3RK3 B;  1SQB K;  1HGZ A;  2ZFC A;  2AEM A;  4EIJ A;  2H88 C;  1PFI A;  1FJP A;  1VF5 C;  1NTM J;  2Y9Y A;  2HOD A;  3O8Z A;  4MN4 C;  4OGQ C;  5APV A;  5CCG C;  1SQX K;  1EDK A;  2NZ2 A;  3BCC J;  3PRJ A;  1J1E C;  1NYH A;  4GDO A;  1OWA A;  1LWU B;  3L75 J;  1HJB A;  3C8V A;  1MFZ A;  3TGU G;  5CCG A;  2KIK A;  3H1I J;  5AVV B;  4DCK A;  2LXB A;  3Q5P A;  3HUS B;  4U3F D;  3H1J J;  1KD1 Q;  1FZA A;  2K3R A;  1NTZ D;  1FDO A;  3H1K G;  3H1H J;  4DZO A;  1NTZ J;  5EFW B;  1SFC C;  2KZJ A;  3L73 E;  3M91 A;  3ITK A;  5CBO A;  2WPQ A;  1M1K Q;  1M90 Q;  1Q7Y Q;  1NTZ G;  1H0T A;  2O1K A;  2AXT H;  2M8R A;  1QVG O;  1G2C B;  1ZRT D;  3AEE C;  4GOD A;  2XNX A;  4GT1 A;  2G3A A;  4LGD E;  1GTW A;  3JCU E;  1SQQ J;  1ZP0 C;  1AFO A;  2M3B A;  2H8P D;  2AXC A;  1NU1 E;  2IX7 C;  1ZLL A;  3B71 A;  3MHV A;  2Q5U A;  3TGU E;  3CC2 P;  3HE4 A;  3HD7 D;  4NPE A;  1MKM A;  3B5N C;  1ZN5 A;  1SFC D;  1SQP K;  1IFI A;  2O01 N;  4WY4 C;  5APW A;  1YTZ I;  1S9K D;  3IN6 A;  3OW2 O;  4PJ0 E;  2LKM A;  3G9R A;  4CPG A;  3AE4 C;  1EDJ A;  3SWF A;  3KDP B;  2C9N Y;  3E7K A;  1NKZ B;  2M0B A;  1J2J B;  2HG5 D;  4EYY Q;  2QM7 A;  1VQ6 P;  1SVF A;  2YMY A;  1G1J A;  3KQG A;  3OA7 A;  2J59 M;  3IF4 A;  1X8Y A;  3CWB D;  1OFC X;  2ZXX A;  3AE3 C;  3LID A;  1LTJ B;  4W7Y A;  3JSV C;  2L91 A;  3VMX A;  3JCU H;  1EZV E;  1FAV A;  1SQB G;  4XE5 B;  3G4S P;  2Z5H A;  4OWF A;  1L4A D;  3L74 E;  3H1H D;  2RMZ A;  3M9B A;  1L0N K;  3S1K A;  2Y9Z A;  1FDM A;  1LP1 A;  4N6J A;  3TF5 A;  2W27 A;  4WY4 B;  1SQQ D;  3H1I G;  3S4R A;  2FYN B;  1YHQ P;  2E42 A;  5AW8 B;  1Q82 Q;  1LWU A;  4TT3 H;  3VP8 A;  4D6T D;  2KYV A;  4WY4 D;  1EXJ A;  2IZ1 A;  2HFE D;  3H25 A;  4H13 C;  1T2K D;  4NPF X;  1YJN P;  1FZC C;  3A7O A;  1AQT A;  1FZE A;  5BU8 B;  2H89 C;  2K1A A;  3CCJ P;  2DW3 A;  2JWA A;  3SWY A;  1LTJ C;  2GUS A;  1PV3 A;  2P58 A;  1KFM A;  2MKV A;  4PV1 C;  5KJ7 C;  1WMK A;  4K35 A;  1JCC A;  2Y0C A;  2IZ0 A;  1IZN B;  2WIT A;  3AEB C;  1NU1 J;  3CCQ P;  3RK2 C;  3L71 G;  2Q3E A;  2V7Q H;  2YXQ B;  3TNU B;  3U1A A;  3MIW A;  3PHL A;  3L37 A;  1W2E A;  1K04 A;  3CXH H;  5TIS E;  2OYH C;  2JP3 A;  1ZME C;  3F89 A;  5KLV D;  3TK1 A;  1LT9 C;  1GL2 C;  1R5S A;  1JY3 P;  2R3S A;  4RKU J;  1S2E A;  2POH A;  1Q81 Q;  4WBA A;  3V5B A;  3H1J E;  2CPS A;  1S3J A;  2ZVO B;  1L0L E;  1ZXG A;  2N1T C;  3CWB G;  3CD6 P;  2WSF H;  2E75 B;  3K5B A;  4JYC A;  1JY3 O;  2PP6 A;  1BE3 J;  4PV1 B;  4WWI A;  2QSI A;  1EZV G;  1SQB E;  1L0N J;  3L75 E;  3KHU A;  3H32 A;  2KLV A;  5KAF H;  2JEE A;  2HYN A;  3MZW B;  2OYI A;  3W67 A;  2B89 A;  1KC8 Q;  4PV1 D;  1P84 I;  5TJH A;  1YTZ T;  2PAJ A;  4Z1M H;  2GM4 A;  2E76 B;  1GD2 E;  3RL0 B;  3AEC C;  5AW6 B;  1N7L A;  1LT9 B;  2C0X A;  4YTP C;  1U7J A;  1SP4 A;  5AVS B;  1EDL A;  4AQR D;  3CCV P;  2Q6Q A;  1M1J C;  3HD7 A;  2E76 D;  3OJA B;  3P8C E;  1PGQ A;  1VQL P;  1QVF O;  1YQ3 C;  3HTK B;  1S1C X;  1PPJ D;  2W6J H;  4O9B A;  1NOH A;  2M5A A;  3EFF K;  3P7K A;  2YNY A;  2IBZ E;  5GTI E;  1OVV A;  3D6Z A;  3C1L A;  1SQV K;  2JKV A;  2ZYA A;  1FU1 A;  1URQ B;  4BXL A;  3CCR P;  1AV1 A;  1NHL A;  3V4Q A;  1KB9 H;  1BGY G;  1ZRT E;  1RF1 C;  1SQV D;  2W6A A;  3AE9 C;  3AEF C;  1GDT A;  1RE4 C;  1Y8A A;  4H0L D;  1GK4 A;  4ZNC A;  2KNC A;  5GTH H;  5BVZ A;  3S9O A;  4NPD A;  5CHX A;  2V4H A;  1K73 Q;  3NXS A;  1PP9 D;  1HF9 A;  2P10 A;  1PL5 A;  1L4A B;  1N7S B;  2J5U A;  2O01 J;  1R8E A;  2WTY A;  5L8R J;  1JTH A;  3I56 P;  3G71 P;  1KYO H;  5AVY B;  4N78 E;  5GTH E;  1FJK A;  1JOC A;  2E76 C;  3HE5 B;  2ZJS E;  1NTM K;  3M0D C;  3V2Q A;  2FYU K;  5CCH A;  1JUN A;  3A3Y B;  1KB9 E;  5KLV J;  1SQB J;  5DJU B;  2I1J A;  2YIU B;  3V4W A;  3CPW O;  1QL2 A;  3BVH A;  1DX7 A;  3LW5 H;  1BGY J;  2IBZ I;  2RKL A;  2BCC D;  2ZT9 B;  1L0L J;  1EZV I;  3HRN A;  2OAR A;  1LTA C;  3AE6 C;  2KLU A;  4W80 A;  3V2R A;  5B66 E;  1RF0 A;  1N8R Q;  2E5T A;  1J1E B;  3FX0 A;  3GLM A;  5AW2 B;  3RL0 D;  4ASW A;  4ZMD A;  1P84 E;  1FOS F;  3GHG C;  1S5L X;  4C7N B;  1GK6 A;  3CCL P;  1IFM A;  3E1R A;  4EDF A;  1CW5 A;  4M3L A;  1KQG B;  4R4L A;  1M1J B;  2G8Y A;  4K3A A;  1N73 A;  2KB7 P;  1EC5 A;  3HUS C;  2O01 H;  1Q90 D;  4H44 D;  3QH9 A;  1AQ5 A;  3Q5S A;  5AVT B;  3V2P A;  1URQ A;  4WB4 A;  3L72 J;  5APT A; 
#chains in the Genus database with same CATH homology
 2WMM A;  2B87 B;  2ZAE B;  3PH0 A;  3S1K A;  2HR3 A;  1LP1 A;  3FXD A;  4IOI H;  1OVU A;  1LT1 A;  4HKZ H;  2QVA A;  4NPF X;  1FC2 C;  1U7M A;  2P58 A;  2KS1 B;  4K35 A;  2R44 A;  2KZI A;  1NVO A;  1LP1 B;  2B88 A;  1OVR A;  2M5A B;  5DJT B;  4KJM A;  1DEE G;  3ZDM A;  1S3J A;  1ZXG A;  1JMB A;  1SS1 A;  4WWI A;  2KI7 B;  4GOE A;  3MZW B;  1H0T B;  2B89 A;  2B87 A;  1Q2N A;  2Q1K A;  5CBN A;  3QWO C;  4JBZ A;  1U7J A;  1EDL A;  1ZW0 A;  5C39 A;  1Y47 A;  1BDC A;  2LR2 A;  2M5A A;  2UWJ E;  1OVV A;  1X0T A;  4BXL A;  4ASV A;  2OTK E;  2SPZ A;  4ZNC A;  4NPD A;  4MN4 C;  1EDK A;  2QRX A;  1MFT A;  2KIK A;  3FXE A;  2LXB A;  2K3R A;  2KUB A;  5EFW B;  2KZJ A;  5CBO A;  1H0T A;  5DJU B;  1JM0 A;  4GOD A;  2RKL A;  1EDI A;  2I8D A;  3MHV A;  4ASW A;  4NPE A;  1BDD A;  4ZMD A;  4GOF A;  3RGU A;  5K5G B;  2LXC B;  4K3A A;  4CPG A;  4HB1 A;  2JWD A;  1EC5 A;  1EDJ A;  4HJG H;  2M0B A;  4EYY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...