1ZXGA

Solution structure of a219
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/protein binding
molecule keywords Immunoglobulin G binding protein A
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1zxgA00
1X0TA 4KJMA 1U7JA 5C39A 1H0TA 2M0BA 1JM0A 1ZW0A 1OVRA 2RKLA 1EDLA 1U7MA 1ZXGA 3MZWB 2K3RA 4ZMDA 2QVAA 2B87B 2KZIA 1OVVA 1EDJA 1MFTA 2LXCB 3MHVA 4BXLA 5K5GB 2KI7B 1EDKA 3QWOC 4K3AA 3FXEA 2LR2A 1NVOA 4WWIA 2SPZA 5DJTB 1OVUA 2B87A 4ASVA 2B88A 2KUBA 2ZAEB 2R44A 3S1KA 2KS1B 4HB1A 1Y47A 4MN4C 2JWDA 2B89A 1LT1A 1BDCA 1Q2NA 3PH0A 4IOIH 5CBOA 4K35A 2OTKE 3RGUA 4ASWA 2P58A 2Q1KA 2I8DA 5DJUB 1JMBA 4EYYQ 1DEEG 4GOFA 2UWJE 1BDDA 1LP1B 1EC5A 1EDIA 4JBZA 2LXBA 2M5AB 4GOEA 5CBNA 4HKZH 3ZDMA 2KZJA 2QRXA 5EFWB 4ZNCA 1H0TB 2WMMA 1LP1A 4HJGH 4NPDA 1SS1A 4CPGA 3FXDA 4NPFX 2M5AA 1FC2C 2KIKA 4NPEA 4GODA 2HR3A 1S3JA
chains in the Genus database with same CATH superfamily
2ZVNB 2KSEA 3NMDA 3B71A 2M0BA 1OW7A 3TK1A 3AEBC 4ZKPA 1H8AA 2DW3A 5KKZB 3RBXA 3OA7A 2WPQA 1EZVG 3CWBD 3CI9A 2OYIC 2NRGA 4AYCA 4BRYB 3H1KE 1M90Q 3I55P 2E74B 2RH0A 2ZXXA 1NU1G 1VF5B 4XA4A 2Z4EA 1QL1A 5APYA 3WUUA 2W8ZA 3C9IA 2KUBA 3LIEA 5E79H 4EIJA 3CLQA 2M8RA 4N78D 5AVZB 3WU2H 1FOSF 1S5LH 3VMAA 1GDTA 4EYYQ 2I1JA 1RY3A 4JYCA 3Q3DA 3P7KA 1G1IA 1EZVD 4IFFA 4W80A 1T3UA 1URQA 4GOEA 5CBNA 3B4SA 4BWNA 5APVA 4Y99C 2IBZI 1IFDA 2AEJA 2E76C 5H2FH 4OGQD 2O1KA 3HD7C 1LTIC 3RL0D 3L72E 3LW5J 4EOTA 5CCGD 2RKLA 1RF1B 1FZGA 1EDLA 2R3SA 3V2RA 1ZXGA 2D2CC 4UB8E 3M06A 4PJ0H 3RK3B 3CXHE 3II6A 3QWOC 1NTMJ 1NTZJ 2AEFA 4WWIA 3AE9C 2O01H 1JMMA 3CX5E 4PD4D 2YKOA 1QGKB 2IDBA 3MGNA 5TISH 3V5BA 1JTHA 4I6MC 1OZHA 2K9JB 1JCDA 2ZVOB 3RK2B 2I8DA 1PPJE 1VQ9P 1BCCG 1X22A 2GM4A 2W83C 4Y28J 1ZLLA 3SWFA 3A3YB 1IFIA 3BRVB 2QJYB 1A02J 5CHXA 4H0LD 3IR9A 3N4XA 1OIPA 2JEEA 1WT6A 1M1JB 1GL2D 1FAVA 5E79E 4D6TG 3Q5SA 2GA1A 1KZUB 1SS1A 3H1JG 2K9YA 3MIWA 5L8RJ 2M5AA 4YTPC 4TT3H 3WU2E 1NTMG 4WY4B 2OQQA 1OFCX 1NTZG 1S5LE 2WSEJ 3B5NB 1KORA 3AE8C 2E42A 4ZKUA 1LWUA 1NTKE 2FFDA 1ZW0A 2H7HA 1P84H 2B87B 2KZIA 1EXIA 1EDJA 1KD1Q 3VMXA 3MHVA 3Q2YA 3A0BH 3C1LA 2OYOA 5B5EH 1IK7A 1L0LK 5H2FE 2I1KA 3RBZA 3AEDC 1IJDB 1N86A 3L74D 2E75D 5APXA 1RF0C 2G3AA 3I56P 2A06G 2IPPA 3HUSC 5AVUB 1OW8A 1FDOA 2WPSA 4RJTA 1L0LD 2JWDA 2XDJA 2BCCE 2K1AA 1NTZD 2Q9IA 3L70E 1SQXE 1KILE 2K88A 3OAKA 4JYBA 1QVGO 2FXMA 4OGQC 4PJ0E 4JPZB 1JEKA 2POHA 2J58A 3RL0C 2OYHC 1J1DC 1JY3P 2B9BA 2NPSB 1JB0J 5CCGC 2CPSA 1M7LA 4UB6H 2ZYAA 5TISE 1X79B 3AE3C 3ITKA 1OMIA 3PLNA 3L75J 1KV4A 3EFGA 2WWWA 2KIKA 2E74D 1ZRTD 5AVTB 5AW8B 1VF5D 1SQBE 1USDA 3H1HE 1L0NK 1NHLA 3V2QA 3BASA 1PGOA 3F5HA 1VQ5P 3VP9A 1L0ND 1IO4A 3FXEA 4KHXA 5KJ7A 5CMZA 2IZ0A 1AA0A 2JKVA 3L36A 1K04A 5KLVG 5AW2B 1HF9A 1S4XA 4B86A 1T3JA 4H0LC 1SQQE 1NYHA 3A0HH 2C9LY 1URQB 2FYNC 3H1ID 3RGUA 1P84E 2FKWB 2HYNA 3I5CA 2KB7P 4H13B 2QIWA 2C9NY 1EQ7A 1YIJP 3L75G 3L37A 2UWJE 5AW4B 1ZOYC 1BDDA 2M3BA 3A0BE 3CD6P 2M3EA 5B5EE 4JQ0D 2N1TA 4U3FD 3PHLA 1EZVE 1L2PA 5EFWB 3JCUH 3WMM0 1JY3O 3KXDA 1G2CA 2QJPB 1YJNP 1NU1E 1N7LA 3RK3D 1OXZA 3LW5H 2E75C 3BCCJ 1FZEA 2FBWC 3CCSP 2HPCA 5C39A 4WB4A 3C8VA 2R5BA 1JO5A 1KQGB 1XTGB 3A5TA 3CCVP 3CWBJ 4I7ZB 1JTHB 1NKZB 1SQVK 1HBWA 4UB6E 2KP8A 3KYQA 3CCMP 3FGAD 3P8CD 3CMAP 2P1JA 3RK2D 3L73D 1Y8AA 4PV1B 4RESB 1AV1A 1OVUA 2K37A 4IL6X 2OGUA 5KLIC 5CJ4A 1N73A 2L5GB 3HD7A 2Y0EA 1KYOD 5KKZC 2E5TA 2NZ2A 2OTKE 3CPWO 3AE2C 2Q1KA 1KILA 3L35A 4OVNF 2Y0CA 1PP9D 2ZT9B 2WSCJ 2E74C 3SFEC 2QG4A 1X9VA 5AVXB 4WY4D 3FWNA 1VF5C 3B5ND 2LXBA 2M5AB 2YO3A 3BCCG 5AW6B 2PRRA 1LTSC 1LGHB 3BVHA 1LWUB 3CWBG 2FFDB 2WSEH 3A0HE 1YTZT 1LTAC 2OTLP 4OWFA 2XNXA 1CZQA 2JO1A 3FWLA 1S3JA 1SQPJ 4YPCA 2HLOA 5CCHA 4C7NA 3TGUD 3CC2P 1Q86Q 2Q3IA 2FXPA 4ZMDA 2QVAA 3A2AA 1XTCC 3WUTA 1BE3D 3KQGA 3JCUE 1FZCA 1BCCE 3L71D 2ITAA 1T8ZA 3VYIA 1FZFA 1SFCB 1KTMA 3GHGA 3AEAC 3CCJP 4O9BA 1S1CX 3CCQP 5KAIH 1Z56A 2NPSD 2P7JA 1L4AA 3NFQA 2C0XA 4D6TE 1UIIA 2KNCA 1YQ3C 3H1JE 2P58A 3M0DC 1JMBA 2R3CA 1NTME 1NTZE 2LKMA 4C46A 1KQFB 3VTPC 4I1LA 1HGVA 1DD4A 4YXDC 1NGMB 1J1EB 1PGPA 1Q81Q 1P84I 2QRXA 3SWKA 1RF0A 1ZV8A 1YBKA 5APWA 1QL2A 1BSHA 1WMKA 3EWKA 1FZBA 3MP7B 4L75A 1Q82Q 3RK2C 1HUCA 2WPVB 3U1CA 1EZVI 2A06E 2YMKA 1SQPK 2WITA 5AW5B 5AVRB 2IBZD 2QJYC 1NAFA 2E5YA 1E79H 1S9KD 4BXLA 1M8OB 5K5GB 1H88A 2QJKB 1SQPD 1URQD 2ZXEB 4N3YB 1N7SA 1NVOA 2JJLA 4DZOA 3F89A 3L74J 2CPBA 1X8YA 4WY4C 4HB1A 1SVFA 1L0LJ 1LTJA 4L73A 2N1TB 4OH8B 1VPCA 2RN0A 1CI6A 1M56D 4GKGA 3U1AA 2W90A 1IFMA 4N6JA 3AE7C 1G2CB 5AVSB 3G3ZA 4HH2A 2Q7CA 2FY8A 2HPCB 2QA4P 1FZAA 2WQYC 1DD3A 4CPGA 5KTBA 1KC8Q 2XV5A 1RE4A 3AEFC 5KAIE 3WUVA 1RQUA 1Q7YQ 1WRGA 4KJMA 3KDPB 5KLVE 3H1LD 1H0TA 3BATA 3L74G 4Y99B 4PV1D 2W6BA 3MD0A 1HJBA 1L0LG 3D6ZA 1AQ5A 1DX7A 2FYUK 2HFED 2N9BA 1N73B 1L0NJ 3HD7B 3L4FA 3L75E 1VQ8P 1K8AQ 3RL0g 2FYUD 1BSNA 1KILB 3L72J 1CW5A 5GTIH 1BGYD 2MJZA 1SP4A 3P8CE 2D2CB 1USEA 2WT7A 1DIPA 4DCKA 3H1IJ 1LT9A 2WSCH 2J5UA 1T6AA 5GTHH 2KS1A 3G4SP 3PTZA 3JSVC 1GMJA 3TNUA 2AXCA 4Z1MH 1N8RQ 5AW9B 1JOCA 1OWAA 3H1KD 4U3FJ 2L91A 2WMMA 1LP1A 4C7NB 1SFCA 3T97A 4L74A 3Q1MA 5AW1B 2H88C 1URQC 1YHQP 1EXJA 1L0NG 2O1JA 1FZCB 3USSA 2ZYDA 2K3RA 4XFJA 3MUDA 2HODA 2PP6A 3GHGB 4K3AA 3CL3D 4GDOA 1M1KQ 3H1IG 1PIXA 1S5LX 4PD4H 2XU6A 1L4AB 4I2LC 1MV8A 2QJPC 3L73J 4DOJA 1DH3A 4H44B 2KNCB 2B88A 3AE5C 1SQVJ 3S1KA 3BCCE 3PJSK 1LTTC 4U3FG 3SWYA 1NKNA 3AE1C 3CWBE 3Q5PA 4I7ZC 1MKMA 5APSA 2BEQD 3L72D 3CCUP 1PP9J 3TF5A 1R5SA 1VQ7P 4HKZH 1GL2C 3CXHD 3GF7A 5GTIE 2YMYA 5KJ7D 3HE4A 1FJKA 3G71P 1JY2O 2YKQA 2Y9YA 3S4RA 3CX5D 3IFMA 4N78E 1FC2C 2WTYA 2OYIA 1MUUA 4WVZA 2G8YA 2W27A 1X0TA 5GTHE 3L73G 1VQKP 1N7SB 3TGUJ 1SQVG 1QLED 3MZWB 1PPJD 5B66H 1FS0E 1GU4A 1BE3J 3B8EB 2LR2A 1R8EA 2N1TD 3E1RA 4LGDE 3KZIH 1LTJB 4DT0A 1LWUC 3TSIA 1PP9G 2Z5HA 5DJTB 1AVOA 3L71J 3V2NA 4IFMA 1CI6B 2ZJSE 3V6IA 1BDCA 1Q2NA 3N7NA 3MTUE 1NTKK 1FOSE 5CBOA 5AW7B 1KFMA 2A45H 2Z5IA 5CJ0A 1GK4A 1PV3A 1DEEG 1SQVD 3M9HA 1NTKD 1KQLA 5AVQB 3G6EP 3A7OA 4PD4E 1NOHA 3S9OA 3TGUG 1H0TB 3AE6C 4HJGH 2YIUB 2W6AA 2MKVA 3CMEP 1HWTC 1YJWP 1SQXK 3E7KA 1BE3G 1KB9D 3M0AA 4L76A 1PFIA 1AQTA 3HD7D 3W67A 3FX0A 2BCCD 3L71G 3L70D 1SQXD 3HE5B 1OVRA 3IN6A 1ZR2A 1KILD 1U7MA 1J1EC 4JF7A 2D2CD 3NTNA 3CC4P 1YYCA 1W5CE 2IFNA 2JDIH 2WT7B 1LNQA 1QEXA 3SFDC 1LT9B 1NO4A 2YXQB 2KS1B 1SQBK 1FDIA 1J2JB 3IAOA 3TNUB 4LLHA 2IYOA 2V7QJ 4IOIH 5KJ7C 1HTLC 1RE3C 4ASWA 1KQSO 5CCHD 5B66E 1SQBD 2PAJA 3H1HD 1LP1B 3PRJA 1EC5A 3T97B 2P67A 1JY3N 2N9YB 3L74E 2Q5UA 2YXRB 2PFXA 2KZJA 3NXSA 1RF1C 1MZ9A 1VQLP 3UIAA 2IBZG 1L0LE 1OX3A 4NPDA 2Q3EA 1SQQK 1GTWA 3RK3C 1VL2A 3H25A 3D70A 3O6QA 2N1TC 3G9RA 1SQPG 4W7ZA 2HODB 2QM7A 1SQQD 2H89C 3H1LJ 1L4AD 3GW6A 1S2EA 1JM0A 4H44D 2GUVA 1P84D 3P8MC 2AXTH 3HUSA 2KXPB 4R4MA 1VQ6P 2H8PD 4R4LA 2H43A 1NU1K 1JCCA 2P2UA 4ASVA 1HVVA 1AJYA 1ZRTE 2FYUJ 1HH0A 2V4HA 2O01N 5AVWB 1S72P 2B89A 1BGYJ 3VP8A 2OYHA 1KYOH 2AEMA 1K9MQ 1NU1D 3KPEA 1M1JC 5CCGA 1K73Q 2WZ7A 2WSFJ 4H13D 1BCCJ 4U7JA 3HE4B 5AVYB 3B5NC 1L0NE 1KB9H 1N73C 3GF3A 2RMZA 2OYIB 3H1LG 3H1KJ 3VMYA 1KILC 1N7SD 1GU5A 4ZNCA 4RO0A 2FYZA 4GT1A 3AEGC 4AQRD 4D6TJ 2Y9ZA 3H1JJ 3P32A 3CCEP 4PD4I 4GODA 2HR3A 3H1IE 2XKMA 3SSUA 1QX8A 2KOGA 2VRSA 1VQOP 4W7YA 2FYUG 1IFPA 4U3FE 1BGYG 1HGZA 2LXCB 4DJGA 4TLFA 2KI7B 1W2BO 1EDKA 1IFJA 1GW3A 2CK3H 5CCHC 4HYTB 1ZR4A 1GL2A 2R5DA 1E5WA 4EI2A 3EQ2A 3RK3E 2E76B 2NPSC 1Y9BA 1G1JA 3H1KG 4WBAA 1FZCC 3V4WA 1UIXA 1FBMA 1R5LA 2C0WA 3HE5A 2A45G 2FXOA 2AXTE 4IL6H 1VQNP 3U59A 2ZT9D 4GOFA 1NJIQ 4XE5B 3GHGC 1IFNA 4JBZA 3L73E 1L4AC 2KLVA 1DEBA 1HJ0A 2Q6QA 3R2PA 1SQVE 4H44C 3ZDMA 2W6JH 1BCCD 3LIDA 4LC1A 5APQA 4NPFX 3H6PA 1KYOE 1YITP 2YNYA 4NPEA 5APTA 3HTKA 1JY2P 3H32A 1PP9E 1NTMK 1NTZK 3VN0A 1MFZA 3M9BA 3V4QA 3V2PA 1A02F 1KB9E 3E1IA 4D6TD 4GIFA 3H1JD 3JC22 4C7RA 1RQVA 1OVVA 2JR8A 1MFTA 2R32A 2WPRA 5KAFH 1NTMD 2A45I 1GD2E 5AVVB 4EDFA 1VQMP 1JUNA 4H13C 2SPZA 2PGDA 3L72G 5KLVJ 4BRYA 2ZAEB 3EFFK 1Q90D 1SFCD 5BU8B 1VQ4P 4KT0J 2V7QH 2BEZF 1PGJA 3VMZA 1NAYA 3TGUE 1N7SC 3PH0A 5BVZA 3AEEC 2BASA 1D7MA 5DJUB 2WVRA 2E43A 1BE3E 2A06D 1KFNA 3GLMA 1T2KD 2Y0DA 3D6YA 3GMAA 1NTKJ 3R4YA 3W68A 1ZP0C 1LTJC 2JWAA 2YO2A 3O6QB 3L71E 1GW4A 5AW0B 5AW3B 1NH4A 1QVFO 2YKPA 3IF4A 2P10A 3FXDA 1PPJG 2O3JA 5APUA 1KMIZ 3O8ZA 3HUSB 3TDKA 3M9QA 3TYYA 4PV1C 2QSIA 1RE3A 4IL6E 4RKUJ 2BCCJ 1ZMEC 2QEXP 1N2DC 3L70J 3ABVC 1SQXJ 2KK7A 1RE4C 1TU3F 3CXHI 1FDMA 3M91A 4OGQB 1H89A 3CX5I 3RL0B 2YIUC 2OYHB 1AFOA 1J1DB 1YJ9P 2QM8A 4YXWH 3OW2O 1RF1A 2ZT9C 3M0DA 2O01J 1PL5A 1GK6A 3CC7P 1PZQA 2R44A 1NTKG 1Y47A 3AECC 1RH5B 2IYPA 5KLVK 2J59M 2KLUA 2KYVA 5M1BA 2WSFH 2IBZE 2KSJA 1LJ2A 2FFDC 5KLVD 1S9KE 5TJHA 1SQBJ 5KAFE 1YQ4C 2QE7H 1SQPE 3H1HJ 1EDIA 1IC2A 2ZFCA 2K9JA 2XZRA 2OARA 2BCCG 3VOPA 4AUWA 3D71A 1LT9C 2IFMA 3L70G 1SLQA 5BU5A 1SQXG 1M57D 1JNMA 3L75D 4QMAA 1LTGC 4M3LA 1IZNB 4H0LB 1KN7A 1PGQA 3K5BA 1U7JA 2IX7C 1LTBC 1M1JA 1YI2P 2GUSA 1SQQJ 1AVYA 1GL2B 2JP3A 1IK9A 2IZ1A 2FYNB 1SFCC 4WY4A 2E76D 3Q5RA 1KYOI 2ZYGA 3B5NA 3CCRP 2HG5D 3GG2A 1NWQA 1W2EA 1FE6A 3HRNA 1SQBG 1KB9I 1VDFA 1U57A 4IFDK 2B87A 1T2KC 3PP5A 1YTZI 3H1HG 2OTJP 4A7PA 1CSBA 2WSSH 3MUDC 3H1LE 4MN4C 2XNDH 3BRTB 1LT1A 1RHZB 1GZLA 3KHUA 4K35A 1NU1J 3OJAB 2E75B 1FU1A 1ZN5A 3AE4C 3QH9A 1K05A 1FJPA 1JY2N 4UB8H 3HTKB 1SQQG 3CXHH 2FYUE 3H32B 1OW6A 1BGYE 3CCLP 3CX5H 2QJKC 1VQPP 2NPSA 5KLIB 3BCCD 3KZIE
chains in the Genus database with same CATH topology
1X0TA 4KJMA 1U7JA 5C39A 1H0TA 2M0BA 1JM0A 1ZW0A 1OVRA 2RKLA 1EDLA 1U7MA 1ZXGA 3MZWB 2K3RA 4ZMDA 2QVAA 2B87B 2KZIA 1OVVA 1EDJA 1MFTA 2LXCB 3MHVA 4BXLA 5K5GB 2KI7B 1EDKA 3QWOC 4K3AA 3FXEA 2LR2A 1NVOA 4WWIA 2SPZA 5DJTB 1OVUA 2B87A 4ASVA 2B88A 2KUBA 2ZAEB 2R44A 3S1KA 2KS1B 4HB1A 1Y47A 4MN4C 2JWDA 2B89A 1LT1A 1BDCA 1Q2NA 3PH0A 4IOIH 5CBOA 4K35A 2OTKE 3RGUA 4ASWA 2P58A 2Q1KA 2I8DA 5DJUB 1JMBA 4EYYQ 1DEEG 4GOFA 2UWJE 1BDDA 1LP1B 1EC5A 1EDIA 4JBZA 2LXBA 2M5AB 4GOEA 5CBNA 4HKZH 3ZDMA 2KZJA 2QRXA 5EFWB 4ZNCA 1H0TB 2WMMA 1LP1A 4HJGH 4NPDA 1SS1A 4CPGA 3FXDA 4NPFX 2M5AA 1FC2C 2KIKA 4NPEA 4GODA 2HR3A 1S3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0T A;  4KJM A;  1U7J A;  5C39 A;  1H0T A;  2M0B A;  1JM0 A;  1ZW0 A;  1OVR A;  2RKL A;  1EDL A;  1U7M A;  1ZXG A;  3MZW B;  2K3R A;  4ZMD A;  2QVA A;  2B87 B;  2KZI A;  1OVV A;  1EDJ A;  1MFT A;  2LXC B;  3MHV A;  4BXL A;  5K5G B;  2KI7 B;  1EDK A;  3QWO C;  4K3A A;  3FXE A;  2LR2 A;  1NVO A;  4WWI A;  2SPZ A;  5DJT B;  1OVU A;  2B87 A;  4ASV A;  2B88 A;  2KUB A;  2ZAE B;  2R44 A;  3S1K A;  2KS1 B;  4HB1 A;  1Y47 A;  4MN4 C;  2JWD A;  2B89 A;  1LT1 A;  1BDC A;  1Q2N A;  3PH0 A;  4IOI H;  5CBO A;  4K35 A;  2OTK E;  3RGU A;  4ASW A;  2P58 A;  2Q1K A;  2I8D A;  5DJU B;  1JMB A;  4EYY Q;  1DEE G;  4GOF A;  2UWJ E;  1BDD A;  1LP1 B;  1EC5 A;  1EDI A;  4JBZ A;  2LXB A;  2M5A B;  4GOE A;  5CBN A;  4HKZ H;  3ZDM A;  2KZJ A;  2QRX A;  5EFW B;  4ZNC A;  1H0T B;  2WMM A;  1LP1 A;  4HJG H;  4NPD A;  1SS1 A;  4CPG A;  3FXD A;  4NPF X;  2M5A A;  1FC2 C;  2KIK A;  4NPE A;  4GOD A;  2HR3 A;  1S3J A; 
#chains in the Genus database with same CATH topology
 2ZVN B;  2KSE A;  3NMD A;  3B71 A;  2M0B A;  1OW7 A;  3TK1 A;  3AEB C;  4ZKP A;  1H8A A;  2DW3 A;  5KKZ B;  3RBX A;  3OA7 A;  2WPQ A;  1EZV G;  3CWB D;  3CI9 A;  2OYI C;  2NRG A;  4AYC A;  4BRY B;  3H1K E;  1M90 Q;  3I55 P;  2E74 B;  2RH0 A;  2ZXX A;  1NU1 G;  1VF5 B;  4XA4 A;  2Z4E A;  1QL1 A;  5APY A;  3WUU A;  2W8Z A;  3C9I A;  2KUB A;  3LIE A;  5E79 H;  4EIJ A;  3CLQ A;  2M8R A;  4N78 D;  5AVZ B;  3WU2 H;  1FOS F;  1S5L H;  3VMA A;  1GDT A;  4EYY Q;  2I1J A;  1RY3 A;  4JYC A;  3Q3D A;  3P7K A;  1G1I A;  1EZV D;  4IFF A;  4W80 A;  1T3U A;  1URQ A;  4GOE A;  5CBN A;  3B4S A;  4BWN A;  5APV A;  4Y99 C;  2IBZ I;  1IFD A;  2AEJ A;  2E76 C;  5H2F H;  4OGQ D;  2O1K A;  3HD7 C;  1LTI C;  3RL0 D;  3L72 E;  3LW5 J;  4EOT A;  5CCG D;  2RKL A;  1RF1 B;  1FZG A;  1EDL A;  2R3S A;  3V2R A;  1ZXG A;  2D2C C;  4UB8 E;  3M06 A;  4PJ0 H;  3RK3 B;  3CXH E;  3II6 A;  3QWO C;  1NTM J;  1NTZ J;  2AEF A;  4WWI A;  3AE9 C;  2O01 H;  1JMM A;  3CX5 E;  4PD4 D;  2YKO A;  1QGK B;  2IDB A;  3MGN A;  5TIS H;  3V5B A;  1JTH A;  4I6M C;  1OZH A;  2K9J B;  1JCD A;  2ZVO B;  3RK2 B;  2I8D A;  1PPJ E;  1VQ9 P;  1BCC G;  1X22 A;  2GM4 A;  2W83 C;  4Y28 J;  1ZLL A;  3SWF A;  3A3Y B;  1IFI A;  3BRV B;  2QJY B;  1A02 J;  5CHX A;  4H0L D;  3IR9 A;  3N4X A;  1OIP A;  2JEE A;  1WT6 A;  1M1J B;  1GL2 D;  1FAV A;  5E79 E;  4D6T G;  3Q5S A;  2GA1 A;  1KZU B;  1SS1 A;  3H1J G;  2K9Y A;  3MIW A;  5L8R J;  2M5A A;  4YTP C;  4TT3 H;  3WU2 E;  1NTM G;  4WY4 B;  2OQQ A;  1OFC X;  1NTZ G;  1S5L E;  2WSE J;  3B5N B;  1KOR A;  3AE8 C;  2E42 A;  4ZKU A;  1LWU A;  1NTK E;  2FFD A;  1ZW0 A;  2H7H A;  1P84 H;  2B87 B;  2KZI A;  1EXI A;  1EDJ A;  1KD1 Q;  3VMX A;  3MHV A;  3Q2Y A;  3A0B H;  3C1L A;  2OYO A;  5B5E H;  1IK7 A;  1L0L K;  5H2F E;  2I1K A;  3RBZ A;  3AED C;  1IJD B;  1N86 A;  3L74 D;  2E75 D;  5APX A;  1RF0 C;  2G3A A;  3I56 P;  2A06 G;  2IPP A;  3HUS C;  5AVU B;  1OW8 A;  1FDO A;  2WPS A;  4RJT A;  1L0L D;  2JWD A;  2XDJ A;  2BCC E;  2K1A A;  1NTZ D;  2Q9I A;  3L70 E;  1SQX E;  1KIL E;  2K88 A;  3OAK A;  4JYB A;  1QVG O;  2FXM A;  4OGQ C;  4PJ0 E;  4JPZ B;  1JEK A;  2POH A;  2J58 A;  3RL0 C;  2OYH C;  1J1D C;  1JY3 P;  2B9B A;  2NPS B;  1JB0 J;  5CCG C;  2CPS A;  1M7L A;  4UB6 H;  2ZYA A;  5TIS E;  1X79 B;  3AE3 C;  3ITK A;  1OMI A;  3PLN A;  3L75 J;  1KV4 A;  3EFG A;  2WWW A;  2KIK A;  2E74 D;  1ZRT D;  5AVT B;  5AW8 B;  1VF5 D;  1SQB E;  1USD A;  3H1H E;  1L0N K;  1NHL A;  3V2Q A;  3BAS A;  1PGO A;  3F5H A;  1VQ5 P;  3VP9 A;  1L0N D;  1IO4 A;  3FXE A;  4KHX A;  5KJ7 A;  5CMZ A;  2IZ0 A;  1AA0 A;  2JKV A;  3L36 A;  1K04 A;  5KLV G;  5AW2 B;  1HF9 A;  1S4X A;  4B86 A;  1T3J A;  4H0L C;  1SQQ E;  1NYH A;  3A0H H;  2C9L Y;  1URQ B;  2FYN C;  3H1I D;  3RGU A;  1P84 E;  2FKW B;  2HYN A;  3I5C A;  2KB7 P;  4H13 B;  2QIW A;  2C9N Y;  1EQ7 A;  1YIJ P;  3L75 G;  3L37 A;  2UWJ E;  5AW4 B;  1ZOY C;  1BDD A;  2M3B A;  3A0B E;  3CD6 P;  2M3E A;  5B5E E;  4JQ0 D;  2N1T A;  4U3F D;  3PHL A;  1EZV E;  1L2P A;  5EFW B;  3JCU H;  3WMM 0;  1JY3 O;  3KXD A;  1G2C A;  2QJP B;  1YJN P;  1NU1 E;  1N7L A;  3RK3 D;  1OXZ A;  3LW5 H;  2E75 C;  3BCC J;  1FZE A;  2FBW C;  3CCS P;  2HPC A;  5C39 A;  4WB4 A;  3C8V A;  2R5B A;  1JO5 A;  1KQG B;  1XTG B;  3A5T A;  3CCV P;  3CWB J;  4I7Z B;  1JTH B;  1NKZ B;  1SQV K;  1HBW A;  4UB6 E;  2KP8 A;  3KYQ A;  3CCM P;  3FGA D;  3P8C D;  3CMA P;  2P1J A;  3RK2 D;  3L73 D;  1Y8A A;  4PV1 B;  4RES B;  1AV1 A;  1OVU A;  2K37 A;  4IL6 X;  2OGU A;  5KLI C;  5CJ4 A;  1N73 A;  2L5G B;  3HD7 A;  2Y0E A;  1KYO D;  5KKZ C;  2E5T A;  2NZ2 A;  2OTK E;  3CPW O;  3AE2 C;  2Q1K A;  1KIL A;  3L35 A;  4OVN F;  2Y0C A;  1PP9 D;  2ZT9 B;  2WSC J;  2E74 C;  3SFE C;  2QG4 A;  1X9V A;  5AVX B;  4WY4 D;  3FWN A;  1VF5 C;  3B5N D;  2LXB A;  2M5A B;  2YO3 A;  3BCC G;  5AW6 B;  2PRR A;  1LTS C;  1LGH B;  3BVH A;  1LWU B;  3CWB G;  2FFD B;  2WSE H;  3A0H E;  1YTZ T;  1LTA C;  2OTL P;  4OWF A;  2XNX A;  1CZQ A;  2JO1 A;  3FWL A;  1S3J A;  1SQP J;  4YPC A;  2HLO A;  5CCH A;  4C7N A;  3TGU D;  3CC2 P;  1Q86 Q;  2Q3I A;  2FXP A;  4ZMD A;  2QVA A;  3A2A A;  1XTC C;  3WUT A;  1BE3 D;  3KQG A;  3JCU E;  1FZC A;  1BCC E;  3L71 D;  2ITA A;  1T8Z A;  3VYI A;  1FZF A;  1SFC B;  1KTM A;  3GHG A;  3AEA C;  3CCJ P;  4O9B A;  1S1C X;  3CCQ P;  5KAI H;  1Z56 A;  2NPS D;  2P7J A;  1L4A A;  3NFQ A;  2C0X A;  4D6T E;  1UII A;  2KNC A;  1YQ3 C;  3H1J E;  2P58 A;  3M0D C;  1JMB A;  2R3C A;  1NTM E;  1NTZ E;  2LKM A;  4C46 A;  1KQF B;  3VTP C;  4I1L A;  1HGV A;  1DD4 A;  4YXD C;  1NGM B;  1J1E B;  1PGP A;  1Q81 Q;  1P84 I;  2QRX A;  3SWK A;  1RF0 A;  1ZV8 A;  1YBK A;  5APW A;  1QL2 A;  1BSH A;  1WMK A;  3EWK A;  1FZB A;  3MP7 B;  4L75 A;  1Q82 Q;  3RK2 C;  1HUC A;  2WPV B;  3U1C A;  1EZV I;  2A06 E;  2YMK A;  1SQP K;  2WIT A;  5AW5 B;  5AVR B;  2IBZ D;  2QJY C;  1NAF A;  2E5Y A;  1E79 H;  1S9K D;  4BXL A;  1M8O B;  5K5G B;  1H88 A;  2QJK B;  1SQP D;  1URQ D;  2ZXE B;  4N3Y B;  1N7S A;  1NVO A;  2JJL A;  4DZO A;  3F89 A;  3L74 J;  2CPB A;  1X8Y A;  4WY4 C;  4HB1 A;  1SVF A;  1L0L J;  1LTJ A;  4L73 A;  2N1T B;  4OH8 B;  1VPC A;  2RN0 A;  1CI6 A;  1M56 D;  4GKG A;  3U1A A;  2W90 A;  1IFM A;  4N6J A;  3AE7 C;  1G2C B;  5AVS B;  3G3Z A;  4HH2 A;  2Q7C A;  2FY8 A;  2HPC B;  2QA4 P;  1FZA A;  2WQY C;  1DD3 A;  4CPG A;  5KTB A;  1KC8 Q;  2XV5 A;  1RE4 A;  3AEF C;  5KAI E;  3WUV A;  1RQU A;  1Q7Y Q;  1WRG A;  4KJM A;  3KDP B;  5KLV E;  3H1L D;  1H0T A;  3BAT A;  3L74 G;  4Y99 B;  4PV1 D;  2W6B A;  3MD0 A;  1HJB A;  1L0L G;  3D6Z A;  1AQ5 A;  1DX7 A;  2FYU K;  2HFE D;  2N9B A;  1N73 B;  1L0N J;  3HD7 B;  3L4F A;  3L75 E;  1VQ8 P;  1K8A Q;  3RL0 g;  2FYU D;  1BSN A;  1KIL B;  3L72 J;  1CW5 A;  5GTI H;  1BGY D;  2MJZ A;  1SP4 A;  3P8C E;  2D2C B;  1USE A;  2WT7 A;  1DIP A;  4DCK A;  3H1I J;  1LT9 A;  2WSC H;  2J5U A;  1T6A A;  5GTH H;  2KS1 A;  3G4S P;  3PTZ A;  3JSV C;  1GMJ A;  3TNU A;  2AXC A;  4Z1M H;  1N8R Q;  5AW9 B;  1JOC A;  1OWA A;  3H1K D;  4U3F J;  2L91 A;  2WMM A;  1LP1 A;  4C7N B;  1SFC A;  3T97 A;  4L74 A;  3Q1M A;  5AW1 B;  2H88 C;  1URQ C;  1YHQ P;  1EXJ A;  1L0N G;  2O1J A;  1FZC B;  3USS A;  2ZYD A;  2K3R A;  4XFJ A;  3MUD A;  2HOD A;  2PP6 A;  3GHG B;  4K3A A;  3CL3 D;  4GDO A;  1M1K Q;  3H1I G;  1PIX A;  1S5L X;  4PD4 H;  2XU6 A;  1L4A B;  4I2L C;  1MV8 A;  2QJP C;  3L73 J;  4DOJ A;  1DH3 A;  4H44 B;  2KNC B;  2B88 A;  3AE5 C;  1SQV J;  3S1K A;  3BCC E;  3PJS K;  1LTT C;  4U3F G;  3SWY A;  1NKN A;  3AE1 C;  3CWB E;  3Q5P A;  4I7Z C;  1MKM A;  5APS A;  2BEQ D;  3L72 D;  3CCU P;  1PP9 J;  3TF5 A;  1R5S A;  1VQ7 P;  4HKZ H;  1GL2 C;  3CXH D;  3GF7 A;  5GTI E;  2YMY A;  5KJ7 D;  3HE4 A;  1FJK A;  3G71 P;  1JY2 O;  2YKQ A;  2Y9Y A;  3S4R A;  3CX5 D;  3IFM A;  4N78 E;  1FC2 C;  2WTY A;  2OYI A;  1MUU A;  4WVZ A;  2G8Y A;  2W27 A;  1X0T A;  5GTH E;  3L73 G;  1VQK P;  1N7S B;  3TGU J;  1SQV G;  1QLE D;  3MZW B;  1PPJ D;  5B66 H;  1FS0 E;  1GU4 A;  1BE3 J;  3B8E B;  2LR2 A;  1R8E A;  2N1T D;  3E1R A;  4LGD E;  3KZI H;  1LTJ B;  4DT0 A;  1LWU C;  3TSI A;  1PP9 G;  2Z5H A;  5DJT B;  1AVO A;  3L71 J;  3V2N A;  4IFM A;  1CI6 B;  2ZJS E;  3V6I A;  1BDC A;  1Q2N A;  3N7N A;  3MTU E;  1NTK K;  1FOS E;  5CBO A;  5AW7 B;  1KFM A;  2A45 H;  2Z5I A;  5CJ0 A;  1GK4 A;  1PV3 A;  1DEE G;  1SQV D;  3M9H A;  1NTK D;  1KQL A;  5AVQ B;  3G6E P;  3A7O A;  4PD4 E;  1NOH A;  3S9O A;  3TGU G;  1H0T B;  3AE6 C;  4HJG H;  2YIU B;  2W6A A;  2MKV A;  3CME P;  1HWT C;  1YJW P;  1SQX K;  3E7K A;  1BE3 G;  1KB9 D;  3M0A A;  4L76 A;  1PFI A;  1AQT A;  3HD7 D;  3W67 A;  3FX0 A;  2BCC D;  3L71 G;  3L70 D;  1SQX D;  3HE5 B;  1OVR A;  3IN6 A;  1ZR2 A;  1KIL D;  1U7M A;  1J1E C;  4JF7 A;  2D2C D;  3NTN A;  3CC4 P;  1YYC A;  1W5C E;  2IFN A;  2JDI H;  2WT7 B;  1LNQ A;  1QEX A;  3SFD C;  1LT9 B;  1NO4 A;  2YXQ B;  2KS1 B;  1SQB K;  1FDI A;  1J2J B;  3IAO A;  3TNU B;  4LLH A;  2IYO A;  2V7Q J;  4IOI H;  5KJ7 C;  1HTL C;  1RE3 C;  4ASW A;  1KQS O;  5CCH D;  5B66 E;  1SQB D;  2PAJ A;  3H1H D;  1LP1 B;  3PRJ A;  1EC5 A;  3T97 B;  2P67 A;  1JY3 N;  2N9Y B;  3L74 E;  2Q5U A;  2YXR B;  2PFX A;  2KZJ A;  3NXS A;  1RF1 C;  1MZ9 A;  1VQL P;  3UIA A;  2IBZ G;  1L0L E;  1OX3 A;  4NPD A;  2Q3E A;  1SQQ K;  1GTW A;  3RK3 C;  1VL2 A;  3H25 A;  3D70 A;  3O6Q A;  2N1T C;  3G9R A;  1SQP G;  4W7Z A;  2HOD B;  2QM7 A;  1SQQ D;  2H89 C;  3H1L J;  1L4A D;  3GW6 A;  1S2E A;  1JM0 A;  4H44 D;  2GUV A;  1P84 D;  3P8M C;  2AXT H;  3HUS A;  2KXP B;  4R4M A;  1VQ6 P;  2H8P D;  4R4L A;  2H43 A;  1NU1 K;  1JCC A;  2P2U A;  4ASV A;  1HVV A;  1AJY A;  1ZRT E;  2FYU J;  1HH0 A;  2V4H A;  2O01 N;  5AVW B;  1S72 P;  2B89 A;  1BGY J;  3VP8 A;  2OYH A;  1KYO H;  2AEM A;  1K9M Q;  1NU1 D;  3KPE A;  1M1J C;  5CCG A;  1K73 Q;  2WZ7 A;  2WSF J;  4H13 D;  1BCC J;  4U7J A;  3HE4 B;  5AVY B;  3B5N C;  1L0N E;  1KB9 H;  1N73 C;  3GF3 A;  2RMZ A;  2OYI B;  3H1L G;  3H1K J;  3VMY A;  1KIL C;  1N7S D;  1GU5 A;  4ZNC A;  4RO0 A;  2FYZ A;  4GT1 A;  3AEG C;  4AQR D;  4D6T J;  2Y9Z A;  3H1J J;  3P32 A;  3CCE P;  4PD4 I;  4GOD A;  2HR3 A;  3H1I E;  2XKM A;  3SSU A;  1QX8 A;  2KOG A;  2VRS A;  1VQO P;  4W7Y A;  2FYU G;  1IFP A;  4U3F E;  1BGY G;  1HGZ A;  2LXC B;  4DJG A;  4TLF A;  2KI7 B;  1W2B O;  1EDK A;  1IFJ A;  1GW3 A;  2CK3 H;  5CCH C;  4HYT B;  1ZR4 A;  1GL2 A;  2R5D A;  1E5W A;  4EI2 A;  3EQ2 A;  3RK3 E;  2E76 B;  2NPS C;  1Y9B A;  1G1J A;  3H1K G;  4WBA A;  1FZC C;  3V4W A;  1UIX A;  1FBM A;  1R5L A;  2C0W A;  3HE5 A;  2A45 G;  2FXO A;  2AXT E;  4IL6 H;  1VQN P;  3U59 A;  2ZT9 D;  4GOF A;  1NJI Q;  4XE5 B;  3GHG C;  1IFN A;  4JBZ A;  3L73 E;  1L4A C;  2KLV A;  1DEB A;  1HJ0 A;  2Q6Q A;  3R2P A;  1SQV E;  4H44 C;  3ZDM A;  2W6J H;  1BCC D;  3LID A;  4LC1 A;  5APQ A;  4NPF X;  3H6P A;  1KYO E;  1YIT P;  2YNY A;  4NPE A;  5APT A;  3HTK A;  1JY2 P;  3H32 A;  1PP9 E;  1NTM K;  1NTZ K;  3VN0 A;  1MFZ A;  3M9B A;  3V4Q A;  3V2P A;  1A02 F;  1KB9 E;  3E1I A;  4D6T D;  4GIF A;  3H1J D;  3JC2 2;  4C7R A;  1RQV A;  1OVV A;  2JR8 A;  1MFT A;  2R32 A;  2WPR A;  5KAF H;  1NTM D;  2A45 I;  1GD2 E;  5AVV B;  4EDF A;  1VQM P;  1JUN A;  4H13 C;  2SPZ A;  2PGD A;  3L72 G;  5KLV J;  4BRY A;  2ZAE B;  3EFF K;  1Q90 D;  1SFC D;  5BU8 B;  1VQ4 P;  4KT0 J;  2V7Q H;  2BEZ F;  1PGJ A;  3VMZ A;  1NAY A;  3TGU E;  1N7S C;  3PH0 A;  5BVZ A;  3AEE C;  2BAS A;  1D7M A;  5DJU B;  2WVR A;  2E43 A;  1BE3 E;  2A06 D;  1KFN A;  3GLM A;  1T2K D;  2Y0D A;  3D6Y A;  3GMA A;  1NTK J;  3R4Y A;  3W68 A;  1ZP0 C;  1LTJ C;  2JWA A;  2YO2 A;  3O6Q B;  3L71 E;  1GW4 A;  5AW0 B;  5AW3 B;  1NH4 A;  1QVF O;  2YKP A;  3IF4 A;  2P10 A;  3FXD A;  1PPJ G;  2O3J A;  5APU A;  1KMI Z;  3O8Z A;  3HUS B;  3TDK A;  3M9Q A;  3TYY A;  4PV1 C;  2QSI A;  1RE3 A;  4IL6 E;  4RKU J;  2BCC J;  1ZME C;  2QEX P;  1N2D C;  3L70 J;  3ABV C;  1SQX J;  2KK7 A;  1RE4 C;  1TU3 F;  3CXH I;  1FDM A;  3M91 A;  4OGQ B;  1H89 A;  3CX5 I;  3RL0 B;  2YIU C;  2OYH B;  1AFO A;  1J1D B;  1YJ9 P;  2QM8 A;  4YXW H;  3OW2 O;  1RF1 A;  2ZT9 C;  3M0D A;  2O01 J;  1PL5 A;  1GK6 A;  3CC7 P;  1PZQ A;  2R44 A;  1NTK G;  1Y47 A;  3AEC C;  1RH5 B;  2IYP A;  5KLV K;  2J59 M;  2KLU A;  2KYV A;  5M1B A;  2WSF H;  2IBZ E;  2KSJ A;  1LJ2 A;  2FFD C;  5KLV D;  1S9K E;  5TJH A;  1SQB J;  5KAF E;  1YQ4 C;  2QE7 H;  1SQP E;  3H1H J;  1EDI A;  1IC2 A;  2ZFC A;  2K9J A;  2XZR A;  2OAR A;  2BCC G;  3VOP A;  4AUW A;  3D71 A;  1LT9 C;  2IFM A;  3L70 G;  1SLQ A;  5BU5 A;  1SQX G;  1M57 D;  1JNM A;  3L75 D;  4QMA A;  1LTG C;  4M3L A;  1IZN B;  4H0L B;  1KN7 A;  1PGQ A;  3K5B A;  1U7J A;  2IX7 C;  1LTB C;  1M1J A;  1YI2 P;  2GUS A;  1SQQ J;  1AVY A;  1GL2 B;  2JP3 A;  1IK9 A;  2IZ1 A;  2FYN B;  1SFC C;  4WY4 A;  2E76 D;  3Q5R A;  1KYO I;  2ZYG A;  3B5N A;  3CCR P;  2HG5 D;  3GG2 A;  1NWQ A;  1W2E A;  1FE6 A;  3HRN A;  1SQB G;  1KB9 I;  1VDF A;  1U57 A;  4IFD K;  2B87 A;  1T2K C;  3PP5 A;  1YTZ I;  3H1H G;  2OTJ P;  4A7P A;  1CSB A;  2WSS H;  3MUD C;  3H1L E;  4MN4 C;  2XND H;  3BRT B;  1LT1 A;  1RHZ B;  1GZL A;  3KHU A;  4K35 A;  1NU1 J;  3OJA B;  2E75 B;  1FU1 A;  1ZN5 A;  3AE4 C;  3QH9 A;  1K05 A;  1FJP A;  1JY2 N;  4UB8 H;  3HTK B;  1SQQ G;  3CXH H;  2FYU E;  3H32 B;  1OW6 A;  1BGY E;  3CCL P;  3CX5 H;  2QJK C;  1VQP P;  2NPS A;  5KLI B;  3BCC D;  3KZI E; 
#chains in the Genus database with same CATH homology
 1X0T A;  4KJM A;  1U7J A;  5C39 A;  1H0T A;  2M0B A;  1JM0 A;  1ZW0 A;  1OVR A;  2RKL A;  1EDL A;  1U7M A;  1ZXG A;  3MZW B;  2K3R A;  4ZMD A;  2QVA A;  2B87 B;  2KZI A;  1OVV A;  1EDJ A;  1MFT A;  2LXC B;  3MHV A;  4BXL A;  5K5G B;  2KI7 B;  1EDK A;  3QWO C;  4K3A A;  3FXE A;  2LR2 A;  1NVO A;  4WWI A;  2SPZ A;  5DJT B;  1OVU A;  2B87 A;  4ASV A;  2B88 A;  2KUB A;  2ZAE B;  2R44 A;  3S1K A;  2KS1 B;  4HB1 A;  1Y47 A;  4MN4 C;  2JWD A;  2B89 A;  1LT1 A;  1BDC A;  1Q2N A;  3PH0 A;  4IOI H;  5CBO A;  4K35 A;  2OTK E;  3RGU A;  4ASW A;  2P58 A;  2Q1K A;  2I8D A;  5DJU B;  1JMB A;  4EYY Q;  1DEE G;  4GOF A;  2UWJ E;  1BDD A;  1LP1 B;  1EC5 A;  1EDI A;  4JBZ A;  2LXB A;  2M5A B;  4GOE A;  5CBN A;  4HKZ H;  3ZDM A;  2KZJ A;  2QRX A;  5EFW B;  4ZNC A;  1H0T B;  2WMM A;  1LP1 A;  4HJG H;  4NPD A;  1SS1 A;  4CPG A;  3FXD A;  4NPF X;  2M5A A;  1FC2 C;  2KIK A;  4NPE A;  4GOD A;  2HR3 A;  1S3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...