1ZXGA

Solution structure of a219
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
b'MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQAPKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein A
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system/protein binding
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1zxgA00
2Q1KA 2QVAA 5DJUB 2HR3A 1EDKA 4BXLA 4KJMA 1Q2NA 4GODA 1U7MA 1DEEG 3QWOC 1H0TA 2I8DA 2M0BA 1ZW0A 2KZIA 3ZDMA 1MFTA 1NVOA 1LP1B 2KUBA 3FXEA 4ASVA 4EYYQ 5CBOA 4WWIA 4NPDA 3S1KA 1BDCA 4JBZA 2R44A 4HJGH 4ZNCA 1LP1A 4CPGA 1EDJA 4HB1A 1LT1A 1JMBA 2LXCB 2B87B 1Y47A 5C39A 1X0TA 4IOIH 4NPEA 2KZJA 1S3JA 1OVRA 2RKLA 4HKZH 2SPZA 2B88A 2OTKE 2M5AB 2KIKA 1OVVA 2B87A 2P58A 2KS1B 1BDDA 5DJTB 1U7JA 1FC2C 2K3RA 5EFWB 3PH0A 4GOFA 1ZXGA 2M5AA 2UWJE 1SS1A 3FXDA 4NPFX 2KI7B 4K35A 5K5GB 1OVUA 4MN4C 4GOEA 1EC5A 2QRXA 2B89A 3RGUA 2JWDA 2LR2A 4ZMDA 2LXBA 2WMMA 2ZAEB 1JM0A 5CBNA 1H0TB 3MZWB 4ASWA 4K3AA 1EDLA 1EDIA 3MHVA
chains in the Genus database with same CATH superfamily
1L0NG 3GHGA 1LTJB 3H1HE 2Z5IA 5AVXB 2BCCG 2M3BA 1PGOA 3RK3C 1CI6B 1LTSC 3KDPB 3WUTA 3CWBJ 1VF5B 4NPDA 3S1KA 3HUSA 3PRJA 1EZVI 1HGZA 5TISE 4ZNCA 2HG5D 2WT7A 1T6AA 3OAKA 4TLFA 2XKMA 1H8AA 3T97A 1YIJP 5APSA 1TU3F 5E79E 3LW5J 1ZR2A 2IBZE 2FYUJ 3CWBD 2YIUB 2AXTH 1L0LK 3VMYA 3SFDC 2ZJSE 1GL2B 2ZXEB 1MUUA 4JYBA 5CJ4A 1BDDA 3E7KA 2Y9YA 2CK3H 5CJ0A 1LTJC 2IZ0A 3L35A 5AW8B 3TDKA 3F89A 3W67A 5CCHA 3FWNA 2OGUA 4NPFX 4GDOA 5K5GB 4OH8B 1JY2P 1FDMA 1IO4A 1FDOA 1X9VA 1VF5C 3GW6A 3M9BA 1GU5A 1UIXA 3M9HA 3OA7A 4PD4E 3B5NA 3CCJP 1NTME 3T97B 3H1LD 4BXLA 2BCCJ 5GTIH 1U7MA 1SLQA 3AEEC 4IL6X 4YPCA 4BRYB 1MFTA 2FXOA 4ASVA 2YIUC 3AE6C 5AW6B 4OWFA 5AVUB 3A3YB 3L74G 5B5EH 4C7NB 4WWIA 3V4QA 1CZQA 1GL2C 1PP9E 5AVSB 3M0DC 2LXCB 3P8CD 1X0TA 3FGAD 3HE5A 3NMDA 1KB9E 1URQB 2RKLA 3H1JG 1J1DB 1YITP 2OTKE 2W90A 3L72G 1VQ6P 5KLVK 2Z4EA 2ZYDA 2KIKA 3IN6A 2AEFA 4L74A 4WY4A 4TT3H 2P10A 2C0WA 1N2DC 2H89C 2ZT9B 3CX5E 1OW7A 1JB0J 1RE3C 3L73D 1LTTC 1K04A 3D6YA 3RL0D 3EWKA 2R5DA 2LR2A 2JEEA 2K37A 3P32A 5CBNA 4OGQB 2N1TD 2Y9ZA 1SQQK 1EDLA 2ZYGA 1HTLC 3RBZA 2PRRA 1D7MA 1NU1G 3H1KG 2G8YA 4GODA 4L76A 1RF1B 4PV1D 4QMAA 1VQMP 1EQ7A 2L91A 1NTZE 4AUWA 4EOTA 1URQC 5KJ7A 3N4XA 3WMM0 2W83C 3L70E 3L74J 2E75D 3H6PA 1PPJE 1J1DC 2QSIA 2WVRA 3F5HA 5BVZA 3FWLA 3CD6P 1S5LX 1KYOE 1LP1A 5L8RJ 1JMBA 1L4AD 1M1JB 2ZT9C 3V2NA 3AE3C 3OW2O 3CI9A 2A06E 3CXHH 3HTKA 3L72J 3A2AA 4GKGA 1GDTA 1T3JA 2FYUK 3EFFK 1SQXJ 2Y0CA 1AV1A 3JCUH 4OGQC 2YMKA 2KS1B 4PJ0E 3RL0g 1U57A 3A0HE 2P2UA 2E76B 2GA1A 1GK6A 4N78D 5AW2B 1RF1C 1YTZT 4DCKA 1RF0A 1SS1A 2PFXA 4A7PA 2M3EA 1FJKA 2GM4A 3VMZA 4K35A 4MN4C 1SQXD 4LGDE 1SQBE 1GK4A 1S9KD 3U1AA 3E1RA 3HD7A 3Q3DA 2N9YB 1AQTA 2HFED 2E74D 3H1IG 3H1KJ 1CW5A 1BCCJ 1LWUA 3Q2YA 1M1JC 1A02J 1DEEG 4W7YA 1VQLP 2WTYA 2AEJA 1X22A 2WWWA 1BGYJ 3AE9C 3CXHD 1BCCD 1OXZA 2E76C 2XV5A 1SQVD 1NJIQ 5KAFE 3CC4P 1LJ2A 1SFCA 1NAFA 1Q7YQ 3MUDC 4UB6E 2KZJA 3V2PA 1JY3N 2JO1A 1BGYD 1VF5D 3O6QB 1VL2A 2M5AB 4HH2A 4R4LA 1K8AQ 2FYNB 1VQ5P 2K9YA 5TISH 3KPEA 3AEBC 3IR9A 3GMAA 2E5YA 3MP7B 4KHXA 3D71A 3BATA 1T3UA 1VQPP 5E79H 1R5SA 1DIPA 4ZMDA 1GL2D 2W6BA 2ZAEB 3H1HJ 1RQVA 3KHUA 4I7ZB 2P1JA 3TNUB 1SFCB 2KLUA 2QM8A 4B86A 2KNCB 1RE4A 3SFEC 2Q7CA 2WPRA 5TJHA 5APWA 3G9RA 2M0BA 1MKMA 1NTKE 3BASA 3LIDA 2IYPA 3H1HD 2AXCA 2R32A 1FDIA 1M7LA 2FYNC 3CCEP 1VQ8P 3V4WA 4U7JA 2WSFH 4PD4H 1PFIA 5CCGC 4CPGA 3V6IA 2N9BA 1G1IA 5APTA 2FFDA 3TGUE 1Y47A 3GF7A 4NPEA 1QEXA 1S3JA 2Q3EA 1ZR4A 1KN7A 3JCUE 1IJDB 3CWBG 1T2KC 4I7ZC 1KFMA 2WITA 4L73A 1AVOA 1SFCC 2I1KA 3OJAB 2IBZD 3B8EB 4H13B 1N7LA 2YKPA 1KORA 2V4HA 1N7SD 4Z1MH 1Q90D 1ZXGA 4YXDC 1AJYA 1URQD 1FZCA 4U3FE 3FXDA 2O1JA 2WSFJ 3M9QA 5H2FE 1KB9H 3BCCE 3I56P 1NTMJ 4D6TE 3AEGC 3CXHI 3ITKA 2YKQA 1N73B 3R2PA 2ZT9D 2PGDA 3H1LG 3CX5H 4YXWH 4EDFA 3QWOC 1H0TA 4PD4D 1GW3A 1NTMD 2WPSA 1KD1Q 2WSCJ 2WSEJ 1PP9J 2KB7P 2OYIA 3CC7P 1EZVE 3CCSP 2NPSA 1YTZI 4R4MA 5AW1B 1VQ9P 4H13C 1ZP0C 3AE5C 1FZCB 1ZRTE 2B87B 3VP8A 2NZ2A 2PAJA 3CMAP 1L0LE 1PP9D 3FX0A 2A45H 1GMJA 3L71E 3TSIA 3H32B 5AVQB 4O9BA 2Z5HA 2HYNA 1N73C 1KB9D 1LTAC 2FXMA 1JY3P 1KYOH 5AVVB 1Y9BA 1LGHB 2WPVB 2JDIH 1SQPG 1HVVA 1KILA 2K9JB 2OYHB 3JC22 3I55P 3L73G 3L75E 3GHGB 2IPPA 1PIXA 2JWDA 1M8OB 3CMEP 4K3AA 1NTZJ 1YHQP 3H1LJ 4PJ0H 3TYYA 4W7ZA 2HR3A 3A0HH 3L70J 1N86A 1HBWA 1OW6A 1KQLA 1M90Q 1BSNA 3L4FA 2R3CA 1ZW0A 3HUSB 1MFZA 2WT7B 1S2EA 1BSHA 1NTZD 4JBZA 1N7SA 3L70D 1PPJD 1PGJA 4N3YB 2ZFCA 2OTLP 2ZXXA 3CLQA 3ABVC 2YO3A 2OYHC 1KYOD 5KLVE 2KSJA 3GHGC 1VPCA 1YJ9P 1P84I 5BU5A 2A06D 2P58A 1GD2E 1SQPJ 1AFOA 1VDFA 4RESB 2JWAA 5KAFH 1SQBJ 4PD4I 2Y0DA 3L73J 5APXA 1JMMA 4H0LD 4LLHA 4DOJA 3HUSC 3B5NB 4UB6H 2YKOA 1JCDA 1SQQE 4Y99B 2B89A 1SQXG 1K9MQ 5B66E 3GF3A 2B9BA 5CCGD 4ZKPA 1SQPD 2YXQB 3M91A 1SQBD 3CCMP 1WT6A 1HH0A 1T8ZA 1FZEA 3R4YA 1Q82Q 2GUVA 1OFCX 3SWKA 4WB4A 1T2KD 1WMKA 5CCHC 2H43A 4DZOA 1BCCG 3HE5B 2IDBA 2QEXP 1SQVG 2ZVNB 2FYUE 5M1BA 3HE4A 1VQ7P 3EFGA 1NOHA 1IFDA 4WY4B 3B5NC 2ITAA 1OX3A 4Y99C 5KAIE 3D6ZA 5CMZA 2QIWA 1BGYG 3IF4A 1W5CE 1R5LA 1EXJA 2D2CD 1JUNA 1FZGA 3VP9A 1M56D 1BE3E 3C1LA 1AVYA 1E5WA 3PHLA 5AW4B 4I2LC 1L0NE 2KSEA 1CSBA 1NH4A 2BEQD 2LXBA 2BCCE 2C0XA 3SSUA 2WMMA 4EI2A 3HRNA 1IK7A 1NTZK 4N6JA 1HWTC 1USEA 4IFMA 3RK3D 4KJMA 3WU2E 4UB8E 4EIJA 2IYOA 2MJZA 5APVA 4WY4C 2KXPB 3ZDMA 1LP1B 5H2FH 2XZRA 3H1HG 1NO4A 3TGUJ 3HTKB 1SQVJ 1NTKD 1GTWA 1LT1A 2WPQA 1JTHA 3B4SA 1YJNP 1L2PA 2O01N 3CPWO 1W2EA 1OWAA 3SWFA 4HKZH 2BEZF 3QH9A 3TGUD 4XA4A 3Q1MA 4U3FJ 1SQPK 5KJ7C 2E5TA 2XNDH 2Q3IA 2IBZG 1HF9A 1QX8A 3PTZA 3C8VA 5AVYB 2XDJA 3HD7B 1HJBA 2N1TA 2QRXA 1LWUB 1N8RQ 2JP3A 1JM0A 4U3FD 4ASWA 1S1CX 2I1JA 2WQYC 3BCCD 4D6TD 1Q2NA 1W2BO 3L74E 3GLMA 1OIPA 5KKZB 2E43A 1JY3O 4C46A 3AE2C 3CC2P 4Y28J 1NTMG 1DD3A 1PV3A 3IAOA 1L4AA 1LT9A 1RF0C 5CHXA 3MD0A 3H1JE 1FJPA 1GZLA 3TF5A 1KQSO 3L72E 4HB1A 2HPCA 4GT1A 3HD7C 1EZVD 1JY2N 3O8ZA 4JPZB 4IOIH 3WUUA 1NHLA 1PP9G 1ZRTD 2OTJP 4L75A 1LWUC 1QL1A 3WUVA 3E1IA 4H44B 3Q5RA 2P7JA 1HUCA 3G4SP 2XU6A 1L0LD 1FOSF 3H25A 1FZBA 5BU8B 2H7HA 3L71D 2J58A 3L75J 1J2JB 3USSA 5APQA 5KKZC 1DH3A 1SQXK 1NU1E 1L4AB 3H1KE 2IX7C 3EQ2A 2HLOA 1EC5A 2C9LY 3AE4C 5CCHD 2G3AA 1KFNA 3W68A 3MHVA 3L75D 2Q1KA 5DJUB 2P67A 3Q5PA 1YYCA 2W6AA 4RKUJ 1KC8Q 5AW3B 2KUBA 2CPBA 2J59M 1JCCA 1LTJA 2KP8A 4EYYQ 4H44C 1PL5A 1H89A 2QM7A 5CBOA 2FFDB 5B66H 1BDCA 1CI6A 5AW0B 3U59A 2R44A 1NTZG 1SQVK 3BRTB 2XNXA 2A45G 1NGMB 2BASA 3L70G 1PPJG 3I5CA 3G3ZA 1X79B 2E74B 5AW7B 1KMIZ 1OVRA 4OGQD 3S4RA 1ZV8A 4WBAA 1RE4C 2H88C 1FOSE 1OVVA 1USDA 5KLVD 1JOCA 4AQRD 2A06G 1LNQA 1FC2C 2YXRB 3A0BE 1ZLLA 3LW5H 1OW8A 4W80A 5APUA 4AYCA 1KILE 3PP5A 4WY4D 3H1IE 2UWJE 3S9OA 1GL2A 1RHZB 1YI2P 3U1CA 4C7RA 3GG2A 1FZFA 4GOEA 3M0DA 5KAIH 4XE5B 2FFDC 1H0TB 1NWQA 2JKVA 1IFMA 1EDIA 2ZYAA 2W6JH 2QVAA 1SQQD 2PP6A 4JYCA 1SQBG 3AEAC 2E74C 2OYIB 2DW3A 4IL6E 2IZ1A 3UIAA 2FXPA 1IFJA 2NPSB 3CX5D 4I6MC 2RMZA 2E76D 2K88A 1RE3A 1Q86Q 3KQGA 5KJ7D 1KTMA 1FZCC 4BRYA 1DD4A 1M57D 4RO0A 5AVWB 1EDJA 2KK7A 1YQ4C 3WU2H 2W27A 4C7NA 1GU4A 4UB8H 1XTCC 5C39A 1ZN5A 2QA4P 1FS0E 3KZIE 1P84E 3CCLP 1BE3J 2FYUD 2IBZI 1GW4A 1JEKA 1E79H 5AW5B 1KILB 3CCQP 1URQA 4XFJA 3NXSA 1L0NJ 2K1AA 1RQUA 3V2RA 3B71A 2O1KA 2OYIC 2V7QH 2NPSC 1S4XA 4DJGA 3VTPC 1BE3D 3M0AA 1J1EB 4ZKUA 1PZQA 3C9IA 2M8RA 3MZWB 1L0ND 2QJYB 2CPSA 2AEMA 3HD7D 1NKNA 2BCCD 3KXDA 1KV4A 1NTMK 1FBMA 3AEDC 1EXIA 1N7SB 2KZIA 3FXEA 2L5GB 1RF1A 2OQQA 2V7QJ 1S5LE 1KILC 4M3LA 5GTHE 1DX7A 1NTKG 2FBWC 3CWBE 2FYZA 2Q9IA 1IFNA 1G2CA 3LIEA 3VYIA 1AA0A 3VOPA 3JSVC 1QGKB 3AECC 1SFCD 2FY8A 1KB9I 1M1JA 2B88A 1J1EC 2IFMA 3TK1A 2O3JA 3A7OA 3TGUG 2QJYC 3RK2B 3BRVB 3MGNA 4I1LA 2WZ7A 4RJTA 3AE8C 4WVZA 1YBKA 2KS1A 3CX5I 1IFIA 2QG4A 1FZAA 1N7SC 3IFMA 4H44D 3H1LE 5AW9B 3RGUA 2KLVA 1G1JA 4LC1A 3MUDA 2OYOA 2QJKB 2Y0EA 4U3FG 3CL3D 1G2CB 2QJPB 5APYA 1OZHA 3L37A 3BCCG 4D6TG 4KT0J 2C9NY 2I8DA 1LTIC 3VN0A 1NVOA 3H1JJ 2A45I 1XTGB 3L74D 4H13D 2AXTE 1ZMEC 1KZUB 3HE4B 3II6A 3P8CE 1UIIA 1NTKJ 1JO5A 3AE7C 2R3SA 3RK2C 1K05A 1KYOI 1Z56A 1Y8AA 2OARA 1IZNB 1MZ9A 1MV8A 4JF7A 3NFQA 1EZVG 3H1JD 3D70A 1FE6A 3L72D 3RBXA 1SQPE 2YNYA 1QLED 2JJLA 2W8ZA 1AQ5A 1X8YA 2MKVA 2QJKC 3AE1C 3L73E 3P8MC 1KQFB 1L0LG 1L0NK 2QJPC 5GTIE 2K3RA 1NU1J 3O6QA 3L71G 3G6EP 1QVGO 2M5AA 1QL2A 1PGQA 3CCUP 2KI7B 5CCGA 1OVUA 3PLNA 4HYTB 1NKZB 5B5EE 1K73Q 1NAYA 1KQGB 2RH0A 1LTGC 1NU1D 1SQBK 3BCCJ 3H1KD 3PJSK 4D6TJ 3L75G 1ZOYC 3CCVP 3A0BH 3BVHA 1FAVA 1R8EA 3AEFC 2HODA 4DT0A 3TNUA 3VMXA 3L36A 5KLIB 2QE7H 2KNCA 1YQ3C 2YO2A 1IC2A 1JTHB 1A02F 4H0LB 2YMYA 3MTUE 1OMIA 3M06A 2WSSH 1LTBC 2E42A 2NPSD 1S72P 2FKWB 4IL6H 1Q81Q 2O01H 1H88A 5KTBA 2SPZA 4N78E 1RH5B 3RL0B 1VQNP 1HGVA 3RK3E 3MIWA 1L0LJ 1VQOP 3H1IJ 3L71J 3A5TA 5KLVG 5DJTB 1U7JA 2HODB 1M1KQ 2N1TB 1SQXE 4GOFA 1VQKP 1S9KE 1FU1A 2H8PD 1DEBA 2ZVOB 4PV1B 3V2QA 4JQ0D 5KLIC 3V5BA 2R5BA 2GUSA 3KZIH 1P84H 1KILD 2E75B 3Q5SA 3H1ID 4H0LC 1PGPA 3KYQA 3SWYA 2O01J 1IK9A 3G71P 1EDKA 2J5UA 1SQQG 1JY2O 4GIFA 3CXHE 2D2CB 1LT9B 1SP4A 1N73A 4OVNF 5AVZB 1BCCE 2LKMA 1WRGA 3K5BA 2Q6QA 1SQVE 2HPCB 3RL0C 3VMAA 1YJWP 5AVRB 1NTKK 1IFPA 4HJGH 3CCRP 5AVTB 2N1TC 2Q5UA 1BGYE 3B5ND 1VQ4P 2WSCH 2WSEH 1JNMA 4BWNA 4PV1C 3RK3B 2JR8A 3N7NA 3NTNA 2E75C 2POHA 5KLVJ 2B87A 2NRGA 2FYUG 2KYVA 1S5LH 1NU1K 5EFWB 3PH0A 1P84D 3P7KA 5GTHH 1SVFA 1NYHA 3H32A 4IFDK 2KOGA 1HJ0A 2VRSA 1L4AC 2D2CC 1LT9C 2IFNA 4YTPC 1BE3G 1RY3A 1QVFO 3RK2D 2K9JA 2OYHA 4IFFA 2RN0A 1SQQJ
chains in the Genus database with same CATH topology
2Q1KA 2QVAA 5DJUB 2HR3A 1EDKA 4BXLA 4KJMA 1Q2NA 4GODA 1U7MA 1DEEG 3QWOC 1H0TA 2I8DA 2M0BA 1ZW0A 2KZIA 3ZDMA 1MFTA 1NVOA 1LP1B 2KUBA 3FXEA 4ASVA 4EYYQ 5CBOA 4WWIA 4NPDA 3S1KA 1BDCA 4JBZA 2R44A 4HJGH 4ZNCA 1LP1A 4CPGA 1EDJA 4HB1A 1LT1A 1JMBA 2LXCB 2B87B 1Y47A 5C39A 1X0TA 4IOIH 4NPEA 2KZJA 1S3JA 1OVRA 2RKLA 4HKZH 2SPZA 2B88A 2OTKE 2M5AB 2KIKA 1OVVA 2B87A 2P58A 2KS1B 1BDDA 5DJTB 1U7JA 1FC2C 2K3RA 5EFWB 3PH0A 4GOFA 1ZXGA 2M5AA 2UWJE 1SS1A 3FXDA 4NPFX 2KI7B 4K35A 5K5GB 1OVUA 4MN4C 4GOEA 1EC5A 2QRXA 2B89A 3RGUA 2JWDA 2LR2A 4ZMDA 2LXBA 2WMMA 2ZAEB 1JM0A 5CBNA 1H0TB 3MZWB 4ASWA 4K3AA 1EDLA 1EDIA 3MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1K A;  2QVA A;  5DJU B;  2HR3 A;  1EDK A;  4BXL A;  4KJM A;  1Q2N A;  4GOD A;  1U7M A;  1DEE G;  3QWO C;  1H0T A;  2I8D A;  2M0B A;  1ZW0 A;  2KZI A;  3ZDM A;  1MFT A;  1NVO A;  1LP1 B;  2KUB A;  3FXE A;  4ASV A;  4EYY Q;  5CBO A;  4WWI A;  4NPD A;  3S1K A;  1BDC A;  4JBZ A;  2R44 A;  4HJG H;  4ZNC A;  1LP1 A;  4CPG A;  1EDJ A;  4HB1 A;  1LT1 A;  1JMB A;  2LXC B;  2B87 B;  1Y47 A;  5C39 A;  1X0T A;  4IOI H;  4NPE A;  2KZJ A;  1S3J A;  1OVR A;  2RKL A;  4HKZ H;  2SPZ A;  2B88 A;  2OTK E;  2M5A B;  2KIK A;  1OVV A;  2B87 A;  2P58 A;  2KS1 B;  1BDD A;  5DJT B;  1U7J A;  1FC2 C;  2K3R A;  5EFW B;  3PH0 A;  4GOF A;  1ZXG A;  2M5A A;  2UWJ E;  1SS1 A;  3FXD A;  4NPF X;  2KI7 B;  4K35 A;  5K5G B;  1OVU A;  4MN4 C;  4GOE A;  1EC5 A;  2QRX A;  2B89 A;  3RGU A;  2JWD A;  2LR2 A;  4ZMD A;  2LXB A;  2WMM A;  2ZAE B;  1JM0 A;  5CBN A;  1H0T B;  3MZW B;  4ASW A;  4K3A A;  1EDL A;  1EDI A;  3MHV A; 
#chains in the Genus database with same CATH topology
 1L0N G;  3GHG A;  1LTJ B;  3H1H E;  2Z5I A;  5AVX B;  2BCC G;  2M3B A;  1PGO A;  3RK3 C;  1CI6 B;  1LTS C;  3KDP B;  3WUT A;  3CWB J;  1VF5 B;  4NPD A;  3S1K A;  3HUS A;  3PRJ A;  1EZV I;  1HGZ A;  5TIS E;  4ZNC A;  2HG5 D;  2WT7 A;  1T6A A;  3OAK A;  4TLF A;  2XKM A;  1H8A A;  3T97 A;  1YIJ P;  5APS A;  1TU3 F;  5E79 E;  3LW5 J;  1ZR2 A;  2IBZ E;  2FYU J;  3CWB D;  2YIU B;  2AXT H;  1L0L K;  3VMY A;  3SFD C;  2ZJS E;  1GL2 B;  2ZXE B;  1MUU A;  4JYB A;  5CJ4 A;  1BDD A;  3E7K A;  2Y9Y A;  2CK3 H;  5CJ0 A;  1LTJ C;  2IZ0 A;  3L35 A;  5AW8 B;  3TDK A;  3F89 A;  3W67 A;  5CCH A;  3FWN A;  2OGU A;  4NPF X;  4GDO A;  5K5G B;  4OH8 B;  1JY2 P;  1FDM A;  1IO4 A;  1FDO A;  1X9V A;  1VF5 C;  3GW6 A;  3M9B A;  1GU5 A;  1UIX A;  3M9H A;  3OA7 A;  4PD4 E;  3B5N A;  3CCJ P;  1NTM E;  3T97 B;  3H1L D;  4BXL A;  2BCC J;  5GTI H;  1U7M A;  1SLQ A;  3AEE C;  4IL6 X;  4YPC A;  4BRY B;  1MFT A;  2FXO A;  4ASV A;  2YIU C;  3AE6 C;  5AW6 B;  4OWF A;  5AVU B;  3A3Y B;  3L74 G;  5B5E H;  4C7N B;  4WWI A;  3V4Q A;  1CZQ A;  1GL2 C;  1PP9 E;  5AVS B;  3M0D C;  2LXC B;  3P8C D;  1X0T A;  3FGA D;  3HE5 A;  3NMD A;  1KB9 E;  1URQ B;  2RKL A;  3H1J G;  1J1D B;  1YIT P;  2OTK E;  2W90 A;  3L72 G;  1VQ6 P;  5KLV K;  2Z4E A;  2ZYD A;  2KIK A;  3IN6 A;  2AEF A;  4L74 A;  4WY4 A;  4TT3 H;  2P10 A;  2C0W A;  1N2D C;  2H89 C;  2ZT9 B;  3CX5 E;  1OW7 A;  1JB0 J;  1RE3 C;  3L73 D;  1LTT C;  1K04 A;  3D6Y A;  3RL0 D;  3EWK A;  2R5D A;  2LR2 A;  2JEE A;  2K37 A;  3P32 A;  5CBN A;  4OGQ B;  2N1T D;  2Y9Z A;  1SQQ K;  1EDL A;  2ZYG A;  1HTL C;  3RBZ A;  2PRR A;  1D7M A;  1NU1 G;  3H1K G;  2G8Y A;  4GOD A;  4L76 A;  1RF1 B;  4PV1 D;  4QMA A;  1VQM P;  1EQ7 A;  2L91 A;  1NTZ E;  4AUW A;  4EOT A;  1URQ C;  5KJ7 A;  3N4X A;  3WMM 0;  2W83 C;  3L70 E;  3L74 J;  2E75 D;  3H6P A;  1PPJ E;  1J1D C;  2QSI A;  2WVR A;  3F5H A;  5BVZ A;  3FWL A;  3CD6 P;  1S5L X;  1KYO E;  1LP1 A;  5L8R J;  1JMB A;  1L4A D;  1M1J B;  2ZT9 C;  3V2N A;  3AE3 C;  3OW2 O;  3CI9 A;  2A06 E;  3CXH H;  3HTK A;  3L72 J;  3A2A A;  4GKG A;  1GDT A;  1T3J A;  2FYU K;  3EFF K;  1SQX J;  2Y0C A;  1AV1 A;  3JCU H;  4OGQ C;  2YMK A;  2KS1 B;  4PJ0 E;  3RL0 g;  1U57 A;  3A0H E;  2P2U A;  2E76 B;  2GA1 A;  1GK6 A;  4N78 D;  5AW2 B;  1RF1 C;  1YTZ T;  4DCK A;  1RF0 A;  1SS1 A;  2PFX A;  4A7P A;  2M3E A;  1FJK A;  2GM4 A;  3VMZ A;  4K35 A;  4MN4 C;  1SQX D;  4LGD E;  1SQB E;  1GK4 A;  1S9K D;  3U1A A;  3E1R A;  3HD7 A;  3Q3D A;  2N9Y B;  1AQT A;  2HFE D;  2E74 D;  3H1I G;  3H1K J;  1CW5 A;  1BCC J;  1LWU A;  3Q2Y A;  1M1J C;  1A02 J;  1DEE G;  4W7Y A;  1VQL P;  2WTY A;  2AEJ A;  1X22 A;  2WWW A;  1BGY J;  3AE9 C;  3CXH D;  1BCC D;  1OXZ A;  2E76 C;  2XV5 A;  1SQV D;  1NJI Q;  5KAF E;  3CC4 P;  1LJ2 A;  1SFC A;  1NAF A;  1Q7Y Q;  3MUD C;  4UB6 E;  2KZJ A;  3V2P A;  1JY3 N;  2JO1 A;  1BGY D;  1VF5 D;  3O6Q B;  1VL2 A;  2M5A B;  4HH2 A;  4R4L A;  1K8A Q;  2FYN B;  1VQ5 P;  2K9Y A;  5TIS H;  3KPE A;  3AEB C;  3IR9 A;  3GMA A;  2E5Y A;  3MP7 B;  4KHX A;  3D71 A;  3BAT A;  1T3U A;  1VQP P;  5E79 H;  1R5S A;  1DIP A;  4ZMD A;  1GL2 D;  2W6B A;  2ZAE B;  3H1H J;  1RQV A;  3KHU A;  4I7Z B;  2P1J A;  3TNU B;  1SFC B;  2KLU A;  2QM8 A;  4B86 A;  2KNC B;  1RE4 A;  3SFE C;  2Q7C A;  2WPR A;  5TJH A;  5APW A;  3G9R A;  2M0B A;  1MKM A;  1NTK E;  3BAS A;  3LID A;  2IYP A;  3H1H D;  2AXC A;  2R32 A;  1FDI A;  1M7L A;  2FYN C;  3CCE P;  1VQ8 P;  3V4W A;  4U7J A;  2WSF H;  4PD4 H;  1PFI A;  5CCG C;  4CPG A;  3V6I A;  2N9B A;  1G1I A;  5APT A;  2FFD A;  3TGU E;  1Y47 A;  3GF7 A;  4NPE A;  1QEX A;  1S3J A;  2Q3E A;  1ZR4 A;  1KN7 A;  3JCU E;  1IJD B;  3CWB G;  1T2K C;  4I7Z C;  1KFM A;  2WIT A;  4L73 A;  1AVO A;  1SFC C;  2I1K A;  3OJA B;  2IBZ D;  3B8E B;  4H13 B;  1N7L A;  2YKP A;  1KOR A;  2V4H A;  1N7S D;  4Z1M H;  1Q90 D;  1ZXG A;  4YXD C;  1AJY A;  1URQ D;  1FZC A;  4U3F E;  3FXD A;  2O1J A;  2WSF J;  3M9Q A;  5H2F E;  1KB9 H;  3BCC E;  3I56 P;  1NTM J;  4D6T E;  3AEG C;  3CXH I;  3ITK A;  2YKQ A;  1N73 B;  3R2P A;  2ZT9 D;  2PGD A;  3H1L G;  3CX5 H;  4YXW H;  4EDF A;  3QWO C;  1H0T A;  4PD4 D;  1GW3 A;  1NTM D;  2WPS A;  1KD1 Q;  2WSC J;  2WSE J;  1PP9 J;  2KB7 P;  2OYI A;  3CC7 P;  1EZV E;  3CCS P;  2NPS A;  1YTZ I;  4R4M A;  5AW1 B;  1VQ9 P;  4H13 C;  1ZP0 C;  3AE5 C;  1FZC B;  1ZRT E;  2B87 B;  3VP8 A;  2NZ2 A;  2PAJ A;  3CMA P;  1L0L E;  1PP9 D;  3FX0 A;  2A45 H;  1GMJ A;  3L71 E;  3TSI A;  3H32 B;  5AVQ B;  4O9B A;  2Z5H A;  2HYN A;  1N73 C;  1KB9 D;  1LTA C;  2FXM A;  1JY3 P;  1KYO H;  5AVV B;  1Y9B A;  1LGH B;  2WPV B;  2JDI H;  1SQP G;  1HVV A;  1KIL A;  2K9J B;  2OYH B;  3JC2 2;  3I55 P;  3L73 G;  3L75 E;  3GHG B;  2IPP A;  1PIX A;  2JWD A;  1M8O B;  3CME P;  4K3A A;  1NTZ J;  1YHQ P;  3H1L J;  4PJ0 H;  3TYY A;  4W7Z A;  2HR3 A;  3A0H H;  3L70 J;  1N86 A;  1HBW A;  1OW6 A;  1KQL A;  1M90 Q;  1BSN A;  3L4F A;  2R3C A;  1ZW0 A;  3HUS B;  1MFZ A;  2WT7 B;  1S2E A;  1BSH A;  1NTZ D;  4JBZ A;  1N7S A;  3L70 D;  1PPJ D;  1PGJ A;  4N3Y B;  2ZFC A;  2OTL P;  2ZXX A;  3CLQ A;  3ABV C;  2YO3 A;  2OYH C;  1KYO D;  5KLV E;  2KSJ A;  3GHG C;  1VPC A;  1YJ9 P;  1P84 I;  5BU5 A;  2A06 D;  2P58 A;  1GD2 E;  1SQP J;  1AFO A;  1VDF A;  4RES B;  2JWA A;  5KAF H;  1SQB J;  4PD4 I;  2Y0D A;  3L73 J;  5APX A;  1JMM A;  4H0L D;  4LLH A;  4DOJ A;  3HUS C;  3B5N B;  4UB6 H;  2YKO A;  1JCD A;  1SQQ E;  4Y99 B;  2B89 A;  1SQX G;  1K9M Q;  5B66 E;  3GF3 A;  2B9B A;  5CCG D;  4ZKP A;  1SQP D;  2YXQ B;  3M91 A;  1SQB D;  3CCM P;  1WT6 A;  1HH0 A;  1T8Z A;  1FZE A;  3R4Y A;  1Q82 Q;  2GUV A;  1OFC X;  3SWK A;  4WB4 A;  1T2K D;  1WMK A;  5CCH C;  2H43 A;  4DZO A;  1BCC G;  3HE5 B;  2IDB A;  2QEX P;  1SQV G;  2ZVN B;  2FYU E;  5M1B A;  3HE4 A;  1VQ7 P;  3EFG A;  1NOH A;  1IFD A;  4WY4 B;  3B5N C;  2ITA A;  1OX3 A;  4Y99 C;  5KAI E;  3D6Z A;  5CMZ A;  2QIW A;  1BGY G;  3IF4 A;  1W5C E;  1R5L A;  1EXJ A;  2D2C D;  1JUN A;  1FZG A;  3VP9 A;  1M56 D;  1BE3 E;  3C1L A;  1AVY A;  1E5W A;  3PHL A;  5AW4 B;  4I2L C;  1L0N E;  2KSE A;  1CSB A;  1NH4 A;  2BEQ D;  2LXB A;  2BCC E;  2C0X A;  3SSU A;  2WMM A;  4EI2 A;  3HRN A;  1IK7 A;  1NTZ K;  4N6J A;  1HWT C;  1USE A;  4IFM A;  3RK3 D;  4KJM A;  3WU2 E;  4UB8 E;  4EIJ A;  2IYO A;  2MJZ A;  5APV A;  4WY4 C;  2KXP B;  3ZDM A;  1LP1 B;  5H2F H;  2XZR A;  3H1H G;  1NO4 A;  3TGU J;  3HTK B;  1SQV J;  1NTK D;  1GTW A;  1LT1 A;  2WPQ A;  1JTH A;  3B4S A;  1YJN P;  1L2P A;  2O01 N;  3CPW O;  1W2E A;  1OWA A;  3SWF A;  4HKZ H;  2BEZ F;  3QH9 A;  3TGU D;  4XA4 A;  3Q1M A;  4U3F J;  1SQP K;  5KJ7 C;  2E5T A;  2XND H;  2Q3I A;  2IBZ G;  1HF9 A;  1QX8 A;  3PTZ A;  3C8V A;  5AVY B;  2XDJ A;  3HD7 B;  1HJB A;  2N1T A;  2QRX A;  1LWU B;  1N8R Q;  2JP3 A;  1JM0 A;  4U3F D;  4ASW A;  1S1C X;  2I1J A;  2WQY C;  3BCC D;  4D6T D;  1Q2N A;  1W2B O;  3L74 E;  3GLM A;  1OIP A;  5KKZ B;  2E43 A;  1JY3 O;  4C46 A;  3AE2 C;  3CC2 P;  4Y28 J;  1NTM G;  1DD3 A;  1PV3 A;  3IAO A;  1L4A A;  1LT9 A;  1RF0 C;  5CHX A;  3MD0 A;  3H1J E;  1FJP A;  1GZL A;  3TF5 A;  1KQS O;  3L72 E;  4HB1 A;  2HPC A;  4GT1 A;  3HD7 C;  1EZV D;  1JY2 N;  3O8Z A;  4JPZ B;  4IOI H;  3WUU A;  1NHL A;  1PP9 G;  1ZRT D;  2OTJ P;  4L75 A;  1LWU C;  1QL1 A;  3WUV A;  3E1I A;  4H44 B;  3Q5R A;  2P7J A;  1HUC A;  3G4S P;  2XU6 A;  1L0L D;  1FOS F;  3H25 A;  1FZB A;  5BU8 B;  2H7H A;  3L71 D;  2J58 A;  3L75 J;  1J2J B;  3USS A;  5APQ A;  5KKZ C;  1DH3 A;  1SQX K;  1NU1 E;  1L4A B;  3H1K E;  2IX7 C;  3EQ2 A;  2HLO A;  1EC5 A;  2C9L Y;  3AE4 C;  5CCH D;  2G3A A;  1KFN A;  3W68 A;  3MHV A;  3L75 D;  2Q1K A;  5DJU B;  2P67 A;  3Q5P A;  1YYC A;  2W6A A;  4RKU J;  1KC8 Q;  5AW3 B;  2KUB A;  2CPB A;  2J59 M;  1JCC A;  1LTJ A;  2KP8 A;  4EYY Q;  4H44 C;  1PL5 A;  1H89 A;  2QM7 A;  5CBO A;  2FFD B;  5B66 H;  1BDC A;  1CI6 A;  5AW0 B;  3U59 A;  2R44 A;  1NTZ G;  1SQV K;  3BRT B;  2XNX A;  2A45 G;  1NGM B;  2BAS A;  3L70 G;  1PPJ G;  3I5C A;  3G3Z A;  1X79 B;  2E74 B;  5AW7 B;  1KMI Z;  1OVR A;  4OGQ D;  3S4R A;  1ZV8 A;  4WBA A;  1RE4 C;  2H88 C;  1FOS E;  1OVV A;  1USD A;  5KLV D;  1JOC A;  4AQR D;  2A06 G;  1LNQ A;  1FC2 C;  2YXR B;  3A0B E;  1ZLL A;  3LW5 H;  1OW8 A;  4W80 A;  5APU A;  4AYC A;  1KIL E;  3PP5 A;  4WY4 D;  3H1I E;  2UWJ E;  3S9O A;  1GL2 A;  1RHZ B;  1YI2 P;  3U1C A;  4C7R A;  3GG2 A;  1FZF A;  4GOE A;  3M0D A;  5KAI H;  4XE5 B;  2FFD C;  1H0T B;  1NWQ A;  2JKV A;  1IFM A;  1EDI A;  2ZYA A;  2W6J H;  2QVA A;  1SQQ D;  2PP6 A;  4JYC A;  1SQB G;  3AEA C;  2E74 C;  2OYI B;  2DW3 A;  4IL6 E;  2IZ1 A;  3UIA A;  2FXP A;  1IFJ A;  2NPS B;  3CX5 D;  4I6M C;  2RMZ A;  2E76 D;  2K88 A;  1RE3 A;  1Q86 Q;  3KQG A;  5KJ7 D;  1KTM A;  1FZC C;  4BRY A;  1DD4 A;  1M57 D;  4RO0 A;  5AVW B;  1EDJ A;  2KK7 A;  1YQ4 C;  3WU2 H;  2W27 A;  4C7N A;  1GU4 A;  4UB8 H;  1XTC C;  5C39 A;  1ZN5 A;  2QA4 P;  1FS0 E;  3KZI E;  1P84 E;  3CCL P;  1BE3 J;  2FYU D;  2IBZ I;  1GW4 A;  1JEK A;  1E79 H;  5AW5 B;  1KIL B;  3CCQ P;  1URQ A;  4XFJ A;  3NXS A;  1L0N J;  2K1A A;  1RQU A;  3V2R A;  3B71 A;  2O1K A;  2OYI C;  2V7Q H;  2NPS C;  1S4X A;  4DJG A;  3VTP C;  1BE3 D;  3M0A A;  1J1E B;  4ZKU A;  1PZQ A;  3C9I A;  2M8R A;  3MZW B;  1L0N D;  2QJY B;  2CPS A;  2AEM A;  3HD7 D;  1NKN A;  2BCC D;  3KXD A;  1KV4 A;  1NTM K;  1FBM A;  3AED C;  1EXI A;  1N7S B;  2KZI A;  3FXE A;  2L5G B;  1RF1 A;  2OQQ A;  2V7Q J;  1S5L E;  1KIL C;  4M3L A;  5GTH E;  1DX7 A;  1NTK G;  2FBW C;  3CWB E;  2FYZ A;  2Q9I A;  1IFN A;  1G2C A;  3LIE A;  3VYI A;  1AA0 A;  3VOP A;  3JSV C;  1QGK B;  3AEC C;  1SFC D;  2FY8 A;  1KB9 I;  1M1J A;  2B88 A;  1J1E C;  2IFM A;  3TK1 A;  2O3J A;  3A7O A;  3TGU G;  2QJY C;  3RK2 B;  3BRV B;  3MGN A;  4I1L A;  2WZ7 A;  4RJT A;  3AE8 C;  4WVZ A;  1YBK A;  2KS1 A;  3CX5 I;  1IFI A;  2QG4 A;  1FZA A;  1N7S C;  3IFM A;  4H44 D;  3H1L E;  5AW9 B;  3RGU A;  2KLV A;  1G1J A;  4LC1 A;  3MUD A;  2OYO A;  2QJK B;  2Y0E A;  4U3F G;  3CL3 D;  1G2C B;  2QJP B;  5APY A;  1OZH A;  3L37 A;  3BCC G;  4D6T G;  4KT0 J;  2C9N Y;  2I8D A;  1LTI C;  3VN0 A;  1NVO A;  3H1J J;  2A45 I;  1XTG B;  3L74 D;  4H13 D;  2AXT E;  1ZME C;  1KZU B;  3HE4 B;  3II6 A;  3P8C E;  1UII A;  1NTK J;  1JO5 A;  3AE7 C;  2R3S A;  3RK2 C;  1K05 A;  1KYO I;  1Z56 A;  1Y8A A;  2OAR A;  1IZN B;  1MZ9 A;  1MV8 A;  4JF7 A;  3NFQ A;  1EZV G;  3H1J D;  3D70 A;  1FE6 A;  3L72 D;  3RBX A;  1SQP E;  2YNY A;  1QLE D;  2JJL A;  2W8Z A;  1AQ5 A;  1X8Y A;  2MKV A;  2QJK C;  3AE1 C;  3L73 E;  3P8M C;  1KQF B;  1L0L G;  1L0N K;  2QJP C;  5GTI E;  2K3R A;  1NU1 J;  3O6Q A;  3L71 G;  3G6E P;  1QVG O;  2M5A A;  1QL2 A;  1PGQ A;  3CCU P;  2KI7 B;  5CCG A;  1OVU A;  3PLN A;  4HYT B;  1NKZ B;  5B5E E;  1K73 Q;  1NAY A;  1KQG B;  2RH0 A;  1LTG C;  1NU1 D;  1SQB K;  3BCC J;  3H1K D;  3PJS K;  4D6T J;  3L75 G;  1ZOY C;  3CCV P;  3A0B H;  3BVH A;  1FAV A;  1R8E A;  3AEF C;  2HOD A;  4DT0 A;  3TNU A;  3VMX A;  3L36 A;  5KLI B;  2QE7 H;  2KNC A;  1YQ3 C;  2YO2 A;  1IC2 A;  1JTH B;  1A02 F;  4H0L B;  2YMY A;  3MTU E;  1OMI A;  3M06 A;  2WSS H;  1LTB C;  2E42 A;  2NPS D;  1S72 P;  2FKW B;  4IL6 H;  1Q81 Q;  2O01 H;  1H88 A;  5KTB A;  2SPZ A;  4N78 E;  1RH5 B;  3RL0 B;  1VQN P;  1HGV A;  3RK3 E;  3MIW A;  1L0L J;  1VQO P;  3H1I J;  3L71 J;  3A5T A;  5KLV G;  5DJT B;  1U7J A;  2HOD B;  1M1K Q;  2N1T B;  1SQX E;  4GOF A;  1VQK P;  1S9K E;  1FU1 A;  2H8P D;  1DEB A;  2ZVO B;  4PV1 B;  3V2Q A;  4JQ0 D;  5KLI C;  3V5B A;  2R5B A;  2GUS A;  3KZI H;  1P84 H;  1KIL D;  2E75 B;  3Q5S A;  3H1I D;  4H0L C;  1PGP A;  3KYQ A;  3SWY A;  2O01 J;  1IK9 A;  3G71 P;  1EDK A;  2J5U A;  1SQQ G;  1JY2 O;  4GIF A;  3CXH E;  2D2C B;  1LT9 B;  1SP4 A;  1N73 A;  4OVN F;  5AVZ B;  1BCC E;  2LKM A;  1WRG A;  3K5B A;  2Q6Q A;  1SQV E;  2HPC B;  3RL0 C;  3VMA A;  1YJW P;  5AVR B;  1NTK K;  1IFP A;  4HJG H;  3CCR P;  5AVT B;  2N1T C;  2Q5U A;  1BGY E;  3B5N D;  1VQ4 P;  2WSC H;  2WSE H;  1JNM A;  4BWN A;  4PV1 C;  3RK3 B;  2JR8 A;  3N7N A;  3NTN A;  2E75 C;  2POH A;  5KLV J;  2B87 A;  2NRG A;  2FYU G;  2KYV A;  1S5L H;  1NU1 K;  5EFW B;  3PH0 A;  1P84 D;  3P7K A;  5GTH H;  1SVF A;  1NYH A;  3H32 A;  4IFD K;  2KOG A;  1HJ0 A;  2VRS A;  1L4A C;  2D2C C;  1LT9 C;  2IFN A;  4YTP C;  1BE3 G;  1RY3 A;  1QVF O;  3RK2 D;  2K9J A;  2OYH A;  4IFF A;  2RN0 A;  1SQQ J; 
#chains in the Genus database with same CATH homology
 2Q1K A;  2QVA A;  5DJU B;  2HR3 A;  1EDK A;  4BXL A;  4KJM A;  1Q2N A;  4GOD A;  1U7M A;  1DEE G;  3QWO C;  1H0T A;  2I8D A;  2M0B A;  1ZW0 A;  2KZI A;  3ZDM A;  1MFT A;  1NVO A;  1LP1 B;  2KUB A;  3FXE A;  4ASV A;  4EYY Q;  5CBO A;  4WWI A;  4NPD A;  3S1K A;  1BDC A;  4JBZ A;  2R44 A;  4HJG H;  4ZNC A;  1LP1 A;  4CPG A;  1EDJ A;  4HB1 A;  1LT1 A;  1JMB A;  2LXC B;  2B87 B;  1Y47 A;  5C39 A;  1X0T A;  4IOI H;  4NPE A;  2KZJ A;  1S3J A;  1OVR A;  2RKL A;  4HKZ H;  2SPZ A;  2B88 A;  2OTK E;  2M5A B;  2KIK A;  1OVV A;  2B87 A;  2P58 A;  2KS1 B;  1BDD A;  5DJT B;  1U7J A;  1FC2 C;  2K3R A;  5EFW B;  3PH0 A;  4GOF A;  1ZXG A;  2M5A A;  2UWJ E;  1SS1 A;  3FXD A;  4NPF X;  2KI7 B;  4K35 A;  5K5G B;  1OVU A;  4MN4 C;  4GOE A;  1EC5 A;  2QRX A;  2B89 A;  3RGU A;  2JWD A;  2LR2 A;  4ZMD A;  2LXB A;  2WMM A;  2ZAE B;  1JM0 A;  5CBN A;  1H0T B;  3MZW B;  4ASW A;  4K3A A;  1EDL A;  1EDI A;  3MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...