4NPEA

High-resolution structure of c domain of staphylococcal protein a at room temperature
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 24
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npeA00
4IOIH 2Q1KA 2JWDA 1MFTA 4ASVA 1OVVA 5C39A 2LXBA 2OTKE 1X0TA 2LXCB 4MN4C 2QVAA 1BDCA 4ZMDA 1NVOA 5CBNA 1EC5A 2I8DA 1SS1A 4K35A 2R44A 2B87A 4GODA 4K3AA 5CBOA 1DEEG 1U7MA 2M0BA 4HKZH 3MZWB 3RGUA 5EFWB 1EDIA 1S3JA 2B88A 1U7JA 2B89A 3MHVA 1Y47A 2UWJE 1LT1A 1H0TB 2ZAEB 5K5GB 1JM0A 2WMMA 2LR2A 1LP1A 4ZNCA 4KJMA 5DJTB 1EDKA 2KUBA 2P58A 1JMBA 2RKLA 1LP1B 1OVUA 2KS1B 4NPDA 1OVRA 1BDDA 3S1KA 1H0TA 1EDJA 4NPFX 2SPZA 5DJUB 2KI7B 2K3RA 2B87B 4BXLA 4JBZA 2M5AB 1EDLA 2KIKA 4ASWA 4CPGA 2HR3A 1ZW0A 4HB1A 1ZXGA 1FC2C 4EYYQ 2KZJA 4WWIA 3ZDMA 4NPEA 2QRXA 4GOEA 2KZIA 3FXDA 3QWOC 4GOFA 4HJGH 1Q2NA 3PH0A 2M5AA 3FXEA
chains in the Genus database with same CATH superfamily
3BASA 1T3JA 2WSSH 3PP5A 3RK2D 3L70J 1YYCA 3KQGA 1QGKB 2H43A 2JWDA 3P8MC 1SQBD 2ZT9C 3N4XA 5APWA 2KXPB 3L70E 5CJ0A 4ASVA 1AQTA 2E75D 2OYOA 5KLVG 2M8RA 5AVUB 1AJYA 1X0TA 4C7NB 1KB9D 3SWFA 1SQXE 2O01H 1NWQA 1FZCB 4GDOA 1OXZA 3AE4C 1YI2P 4GT1A 1S9KD 2WSCJ 1NVOA 4Z1MH 5CMZA 3VMYA 4LGDE 3VN0A 1VQKP 3OJAB 1EC5A 3CWBE 3JCUE 2PAJA 5CJ4A 4AUWA 1SS1A 1G1IA 3F5HA 1NU1G 1Q86Q 2R44A 1NTME 3KZIE 1GTWA 2OGUA 2R5BA 3L75E 1DD3A 2FYUD 4PJ0H 1T2KC 4RO0A 1SP4A 3AEGC 3KHUA 2QJPB 3RL0B 2GM4A 1SQQG 2FYUK 3L75J 3PRJA 4GKGA 3TGUE 2IPPA 1HH0A 3RGUA 5GTHE 5KKZC 1NKNA 4OWFA 5EFWB 1L0NE 2FY8A 1FJKA 3G3ZA 1BE3D 2YO3A 1GK4A 1U7JA 5CCGC 2ZT9B 4LC1A 3L72G 3E1RA 2NRGA 3HTKB 2PFXA 3H1KG 5KKZB 2E74C 4JQ0D 1FE6A 2BCCD 1SQBG 3L71J 3NFQA 5KAIH 1URQB 1VQPP 4WY4B 5CCHD 2LR2A 2W8ZA 2C0WA 3QH9A 1FOSE 3L71E 4D6TD 1PV3A 4ZNCA 1EXJA 3AE8C 1PGJA 4KJMA 2M3BA 2FFDC 1EDKA 1S5LE 2R32A 2KUBA 3CXHI 1NHLA 5AW2B 2QJKB 2HPCB 3PHLA 2W27A 1BE3J 1W2EA 2FBWC 2Q6QA 3GHGA 3H6PA 4JYCA 1VF5B 3BCCG 4I7ZB 3G71P 2OYHA 5B66H 1GU4A 5TJHA 1EDJA 3MD0A 1M56D 1FZCC 2E76D 4PV1D 3VMXA 2P10A 4RKUJ 3CWBJ 3CC4P 1GL2D 1N7SB 3D70A 2IZ0A 1SQQK 2FYUG 4JPZB 3CCLP 1X8YA 1M57D 4H44D 3USSA 4BWNA 4YXWH 1GL2B 4I6MC 1P84I 4O9BA 1KTMA 2E43A 1LJ2A 3AE1C 3AE2C 3BATA 2K3RA 1J1EB 3L73D 1JY3N 4L76A 5KAIE 2CK3H 4BRYA 1FDMA 2QM8A 3I56P 1Q90D 5APQA 4BRYB 3P8CE 3NTNA 2D2CD 2M5AB 3CC2P 2IBZI 3G6EP 3S4RA 2OYIC 1IC2A 3HD7D 3V4WA 2AXTE 2OTLP 1M1JA 2WT7A 2A45H 1SFCB 2HR3A 2I1JA 5GTIH 1KN7A 3V5BA 5CHXA 2OTJP 1S2EA 1OFCX 2OYIB 3MGNA 3B5NC 2JP3A 3TDKA 1UIXA 1RE3A 3LW5H 1M7LA 1K9MQ 1VL2A 3IAOA 1AVOA 2KP8A 1P84D 1IJDB 1PP9J 2KZJA 2N1TA 3H25A 1SFCD 2IBZD 5E79H 1HVVA 2AEJA 3II6A 5AVRB 3CLQA 3U1AA 3MUDC 1NTMJ 3EFGA 3VP8A 1FDIA 1FDOA 3P7KA 1IFMA 4A7PA 3L74D 1LTIC 3GF3A 1CSBA 1N7SC 2HG5D 3CX5H 2E76C 3ABVC 1YJNP 1ZMEC 2DW3A 2E75C 1G1JA 3VMZA 1GL2C 1SQPG 3WUTA 3PJSK 3VYIA 1GK6A 1L0NJ 3EFFK 3H1KJ 4U3FG 4LLHA 3CMAP 5KLVD 3RL0g 1NU1K 3Q1MA 5AW5B 2Y9ZA 4IOIH 3HE5B 1PL5A 2GUSA 3WMM0 2CPSA 3H1JD 1NGMB 3V2RA 1RE3C 3CMEP 2BEZF 1KILA 3VTPC 3B8EB 1SQVE 1OVVA 1GDTA 3GG2A 3U59A 2PGDA 3W67A 1YJWP 2IYPA 1FJPA 1YTZI 1SQPJ 3L72E 2K37A 3B5NB 3SSUA 2QVAA 4H13D 1MUUA 1SQPE 3CD6P 1L0LE 3FWNA 2KNCA 1MFZA 2KLUA 2A45I 1IFIA 1K04A 1BE3E 1LTAC 3CL3D 5APYA 5CBNA 1DH3A 1SQVD 1CW5A 3L73G 2FYUJ 3TGUD 2B87A 1SQBK 1OMIA 2FYUE 1VPCA 2KK7A 2ZXXA 3D6ZA 1DEEG 1LWUC 1U7MA 2YO2A 1NTZG 1G2CB 1GL2A 2A45G 5H2FE 4B86A 5KLVE 1VQ6P 1OIPA 3V2QA 1R5LA 4KT0J 5AW0B 1MKMA 1ZV8A 3U1CA 3CCSP 1VQOP 2XKMA 1JNMA 3PTZA 2B88A 3CCVP 1N73A 1S9KE 1YHQP 3L73J 2UWJE 3HE4B 3C1LA 1J1DC 4H0LD 2QEXP 4OGQD 1USEA 1N2DC 2N1TC 2NPSD 2ZAEB 1JUNA 2AXTH 1RF0A 2IBZG 3R4YA 1DIPA 2L91A 3HD7A 1HBWA 3A3YB 3AE9C 3L70G 5K5GB 1VQNP 1Q82Q 2GUVA 1LP1A 1IFJA 1OW6A 1PP9G 2WPQA 3CCJP 1ZRTE 3AE5C 3L70D 1WRGA 1A02F 1LTJB 3LIDA 2XV5A 3ITKA 2H88C 4L75A 1BCCD 1HTLC 1M1JC 1NTMG 3F89A 4TT3H 1J1EC 4YTPC 1JMBA 1FU1A 2RKLA 3HUSB 1BGYJ 2KNCB 1IK9A 1OVUA 1EZVE 1GZLA 3C9IA 1QLED 1PGOA 2XZRA 1FS0E 3H1LD 2YNYA 3H1LE 1BCCJ 4PD4H 5AW4B 1FOSF 1BDDA 1CZQA 5H2FH 1RF1C 1H0TA 1RF1A 2WTYA 3HUSC 2QA4P 1BCCE 3G4SP 5AVTB 1NO4A 1EZVI 1DEBA 1X79B 3CI9A 4EOTA 2WSFH 5KAFH 5B5EH 1LTBC 2W6JH 2XU6A 1ZLLA 3MIWA 3AEBC 1QEXA 1KFNA 5TISE 4XA4A 1IK7A 2GA1A 3H1JG 2K88A 2N9YB 3ZDMA 3AEEC 1Q7YQ 2R5DA 2QJKC 5AVYB 3TGUG 2HODA 3CXHH 4OH8B 1NH4A 1KILE 1KQFB 3TGUJ 4L74A 3VP9A 3GHGC 2W6AA 1NTMK 2HODB 4JBZA 3TK1A 4JF7A 3VMAA 4IFDK 2YIUC 1VF5C 1WT6A 1WMKA 1PPJD 3I5CA 2J59M 1K05A 1NAYA 4CPGA 5APXA 2JJLA 5AW9B 5KLIC 3TYYA 1K73Q 2Q5UA 5AVVB 3RK3C 4HB1A 1CI6A 3MP7B 2N1TD 1RH5B 5AW6B 2NPSC 1ZXGA 1VQ9P 1PP9D 1IFDA 1AV1A 1UIIA 2IFMA 2WZ7A 4HH2A 1T3UA 3B71A 4EIJA 2AEFA 2WQYC 3C8VA 4U3FD 4Y99C 2C9LY 4PD4I 1FZBA 5CCHC 2YXRB 2PP6A 3V4QA 2QRXA 3KYQA 2Z5HA 4GOEA 2D2CB 2KZIA 3FXDA 4U7JA 4DJGA 4Y99B 1FZFA 1SQPD 1M1JB 3B4SA 4I1LA 1BE3G 5KLVJ 2FXOA 1QVFO 2W90A 3TF5A 1KQLA 1L0ND 3L72D 4WY4A 1GW3A 3WUUA 4U3FE 3L35A 2KOGA 2BASA 1L0LG 2M5AA 2XNXA 2PRRA 1Y9BA 1XTCC 2WSFJ 1YQ3C 2QJYC 1QL1A 1QX8A 1E79H 2O1JA 2RN0A 1PP9E 2YMKA 3H1KE 3HTKA 2O01N 3LIEA 1JY3P 2H7HA 4EDFA 2Q1KA 2YIUB 1DD4A 1IFNA 1NU1D 2WPRA 3H1JE 3JCUH 3CCEP 3D6YA 3IFMA 1SQVG 1JY3O 3AE7C 4PV1C 3SWKA 2Y0EA 1YTZT 3CWBD 3FGAD 2V7QH 1PPJE 1VF5D 3GMAA 1EZVG 3M0DA 2O1KA 1JTHA 5KJ7D 2OYHB 3TNUB 1SQQE 2LXCB 1NTZE 1SVFA 2R3SA 3A0BE 1JTHB 2J58A 1KILD 3SWYA 3V2PA 3L74J 1PGPA 2E76B 3M91A 1L0LK 1T8ZA 2HPCA 1NKZB 2HFED 1LNQA 1SQXD 1BDCA 3UIAA 3A0HH 1PIXA 2ZYGA 1BSNA 1E5WA 3L4FA 2ZVOB 3H1LG 1D7MA 4ZMDA 1LT9B 1KQGB 4IL6X 1LWUA 3A2AA 2I8DA 2IBZE 3RL0C 2ZJSE 3AEFC 4DT0A 5L8RJ 3VOPA 1SQBE 1P84E 4K35A 1AQ5A 1KFMA 1RQVA 4GODA 3CCMP 2K9JB 4K3AA 1S5LH 2IFNA 3L71G 1SQBJ 2ZT9D 3A7OA 4H0LC 4UB8H 5CBOA 1HF9A 3RK3E 3H1IE 1JMMA 3BRVB 2M0BA 3B5NA 1S4XA 3W68A 2AXCA 2WITA 2WSEJ 4XE5B 3NXSA 4AYCA 3MZWB 5TISH 1H89A 3H1LJ 5BU8B 4H13B 1SFCC 1Q81Q 1EDIA 1ZN5A 1S3JA 2A06D 2E5TA 2FXMA 2B89A 3H1HJ 3MHVA 4R4LA 3CXHD 1SQXJ 3Q5SA 2OYIA 1ZRTD 3P32A 3CX5D 3CCQP 1IO4A 2JR8A 1KYOI 1OX3A 4U3FJ 3RBZA 3L73E 1NJIQ 1N8RQ 1L4AB 4IL6E 4AQRD 3KDPB 4WVZA 3PLNA 5KTBA 3Q3DA 4IFFA 1YIJP 5AVXB 1USDA 4IL6H 2G3AA 2V7QJ 1LWUB 5DJTB 3KZIH 1HWTC 5AVQB 1YQ4C 2C0XA 4YPCA 3A0HE 3BRTB 2P58A 5M1BA 5KJ7C 4L73A 1EQ7A 1JEKA 1GW4A 1FZAA 1P84H 1SQXG 3L72J 1FZCA 2XDJA 4ZKUA 3CPWO 2E5YA 5KJ7A 3AECC 3KXDA 2YXQB 1N7SA 5GTHH 2JWAA 1JY2N 2JKVA 4ZKPA 3Q5PA 3GF7A 1JOCA 4W7YA 2Q3IA 4NPFX 1N86A 3H32B 4W80A 4DCKA 5KLIB 1X22A 2HLOA 2L5GB 4UB8E 3M0DC 4I7ZC 1HJBA 5GTIE 2H8PD 2BCCJ 3L71D 4D6TE 5APVA 2QM7A 2SPZA 1KD1Q 2RMZA 3GW6A 2FFDA 1L0LD 3CCUP 2WSEH 5DJUB 3SFDC 3OW2O 5AVWB 1SFCA 3WUVA 2B87B 1MZ9A 3JC22 4H0LB 3RK2B 2WPVB 1T6AA 4BXLA 1M8OB 1N7SD 1W2BO 5CCGD 2ZFCA 3L74G 4N78D 4N6JA 1GD2E 4WY4C 1EDLA 1KB9I 2P67A 3H1HE 3AE6C 3N7NA 5CCHA 3A0BH 3CWBG 3S9OA 2E74D 1OW8A 1ZW0A 5KAFE 3H1HD 1KYOH 5AW1B 3A5TA 4N78E 2QSIA 3OA7A 2C9NY 1FZGA 1NAFA 5KLVK 5AVSB 1KQSO 1JO5A 1HJ0A 3V6IA 1NU1J 2NZ2A 3TSIA 1VQ8P 1FC2C 1RQUA 4Y28J 2NPSA 1L0NK 2Q7CA 1YITP 1L4AD 2KLVA 4PV1B 4PD4D 2WWWA 1M1KQ 1SQQJ 2YMYA 3L36A 3L75G 4NPEA 2VRSA 2H89C 3GHGB 4WWIA 4M3LA 1VDFA 3L74E 1U57A 2IYOA 5APUA 1YJ9P 1FAVA 3RBXA 3AE3C 3CCRP 4GOFA 1FBMA 1TU3F 1Q2NA 3HD7B 3PH0A 1N73C 4QMAA 1VQ5P 1A02J 2W6BA 4H44C 2RH0A 1JY2O 3T97B 1AFOA 3G9RA 5CCGA 1L4AA 1GMJA 4JYBA 2LKMA 4DZOA 1URQD 1MFTA 1RE4C 3Q5RA 2KB7P 2YKOA 1RY3A 5C39A 1NYHA 3AEAC 2LXBA 1MV8A 1W5CE 2ZYDA 3IF4A 2D2CC 1KORA 2OTKE 5E79E 2W83C 2QE7H 3P8CD 1RHZB 4MN4C 4UB6H 1RF1B 2YKQA 1KYOD 1S5LX 1L0NG 2WT7B 1BSHA 3RK2C 3HRNA 3WU2H 5AVZB 2OARA 4UB6E 2K1AA 1J2JB 2J5UA 1SQXK 3CX5E 1HUCA 1LTJC 2KS1A 2K9JA 2A06E 4I2LC 2JDIH 3HE5A 1RE4A 5APTA 1YBKA 1VQ7P 3OAKA 4WBAA 1L4AC 3Q2YA 1SLQA 1K8AQ 2Z4EA 2BCCG 3D71A 2MKVA 1GU5A 3CC7P 2Z5IA 4R4MA 3RK3D 1X9VA 1S1CX 4HYTB 3AEDC 5APSA 1KMIZ 4D6TG 2B9BA 3M06A 2FFDB 4GIFA 1PPJG 1NTKD 3HD7C 3MTUE 1RF0C 4WY4D 4HKZH 3H1IJ 3HE4A 4KHXA 1OZHA 1AVYA 2IZ1A 1J1DB 1H8AA 1BGYD 1HGVA 2KSJA 1CI6B 1OW7A 3B5ND 1G2CA 3TNUA 4XFJA 3EWKA 2JO1A 1LT9C 2ZXEB 1BGYG 1Y47A 3O8ZA 1H88A 1L0LJ 2FYZA 3M0AA 2FYNB 2E75B 4PD4E 1LT1A 1BCCG 4RESB 5B66E 1VQMP 1M90Q 1H0TB 2BCCE 4D6TJ 1NTZD 1SQQD 2G8YA 1JM0A 1OWAA 2WMMA 3L37A 1R5SA 1N7LA 1PZQA 2CPBA 1KB9H 1LTSC 2WPSA 3HUSA 3M9HA 3H1IG 4RJTA 3EQ2A 3M9BA 1Z56A 3RK3B 5B5EE 1NU1E 2BEQD 2JEEA 4OGQB 1URQA 3IR9A 5AW8B 1PFIA 2ZVNB 3NMDA 2M3EA 2XNDH 2Y9YA 3R2PA 1LP1B 3H1KD 4H13C 1JB0J 1IZNB 2Q3EA 2KS1B 4NPDA 1QL2A 2IDBA 4OVNF 1ZP0C 1HGZA 3SFEC 1OVRA 3O6QB 3S1KA 1VQLP 2P7JA 2QIWA 1JCCA 3L75D 2E42A 1NTMD 1KILC 2IX7C 3KPEA 2Y0CA 1SQVK 1NTKG 3H32A 4YXDC 1URQC 3JSVC 3IN6A 1ZR4A 1VQ4P 1SQPK 3BVHA 1NTZK 3K5BA 1S72P 1KC8Q 1Y8AA 3E1IA 4IFMA 4C7RA 2Y0DA 3FWLA 3T97A 3E7KA 2KSEA 4WB4A 2KI7B 1L2PA 2OQQA 2P2UA 3LW5J 2FYNC 2MJZA 1KB9E 4DOJA 2QG4A 2O3JA 3CX5I 1LT9A 3H1HG 5BU5A 1NOHA 1EXIA 1BGYE 2POHA 1DX7A 1NTKJ 1AA0A 2KIKA 2ZYAA 2O01J 3FX0A 1NTKK 4W7ZA 4ASWA 2Q9IA 1FZEA 1QVGO 1R8EA 4C46A 2OYHC 1KV4A 1NTKE 2AEMA 3WU2E 1IFPA 1LTGC 2WSCH 1N73B 2FKWB 5AW7B 3MUDA 2FXPA 1LGHB 3H1JJ 1KZUB 4H44B 2N1TB 2R3CA 2YKPA 4C7NA 1LTTC 1JCDA 1ZOYC 2HYNA 2QJPC 4N3YB 4EYYQ 1ZR2A 2N9BA 1PGQA 2NPSB 1NTZJ 4TLFA 3M9QA 1KILB 3O6QA 2KYVA 2P1JA 2WVRA 1SQVJ 3BCCE 3BCCD 3CXHE 3GLMA 3QWOC 4OGQC 4PJ0E 1T2KD 2A06G 1LTJA 2I1KA 2QJYB 2K9YA 4HJGH 4EI2A 1KYOE 3BCCJ 5AW3B 2E74B 3V2NA 3I55P 1XTGB 2V4HA 2ITAA 5BVZA 1JY2P 3FXEA 3RL0D 3H1ID 1EZVD
chains in the Genus database with same CATH topology
4IOIH 2Q1KA 2JWDA 1MFTA 4ASVA 1OVVA 5C39A 2LXBA 2OTKE 1X0TA 2LXCB 4MN4C 2QVAA 1BDCA 4ZMDA 1NVOA 5CBNA 1EC5A 2I8DA 1SS1A 4K35A 2R44A 2B87A 4GODA 4K3AA 5CBOA 1DEEG 1U7MA 2M0BA 4HKZH 3MZWB 3RGUA 5EFWB 1EDIA 1S3JA 2B88A 1U7JA 2B89A 3MHVA 1Y47A 2UWJE 1LT1A 1H0TB 2ZAEB 5K5GB 1JM0A 2WMMA 2LR2A 1LP1A 4ZNCA 4KJMA 5DJTB 1EDKA 2KUBA 2P58A 1JMBA 2RKLA 1LP1B 1OVUA 2KS1B 4NPDA 1OVRA 1BDDA 3S1KA 1H0TA 1EDJA 4NPFX 2SPZA 5DJUB 2KI7B 2K3RA 2B87B 4BXLA 4JBZA 2M5AB 1EDLA 2KIKA 4ASWA 4CPGA 2HR3A 1ZW0A 4HB1A 1ZXGA 1FC2C 4EYYQ 2KZJA 4WWIA 3ZDMA 4NPEA 2QRXA 4GOEA 2KZIA 3FXDA 3QWOC 4GOFA 4HJGH 1Q2NA 3PH0A 2M5AA 3FXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOI H;  2Q1K A;  2JWD A;  1MFT A;  4ASV A;  1OVV A;  5C39 A;  2LXB A;  2OTK E;  1X0T A;  2LXC B;  4MN4 C;  2QVA A;  1BDC A;  4ZMD A;  1NVO A;  5CBN A;  1EC5 A;  2I8D A;  1SS1 A;  4K35 A;  2R44 A;  2B87 A;  4GOD A;  4K3A A;  5CBO A;  1DEE G;  1U7M A;  2M0B A;  4HKZ H;  3MZW B;  3RGU A;  5EFW B;  1EDI A;  1S3J A;  2B88 A;  1U7J A;  2B89 A;  3MHV A;  1Y47 A;  2UWJ E;  1LT1 A;  1H0T B;  2ZAE B;  5K5G B;  1JM0 A;  2WMM A;  2LR2 A;  1LP1 A;  4ZNC A;  4KJM A;  5DJT B;  1EDK A;  2KUB A;  2P58 A;  1JMB A;  2RKL A;  1LP1 B;  1OVU A;  2KS1 B;  4NPD A;  1OVR A;  1BDD A;  3S1K A;  1H0T A;  1EDJ A;  4NPF X;  2SPZ A;  5DJU B;  2KI7 B;  2K3R A;  2B87 B;  4BXL A;  4JBZ A;  2M5A B;  1EDL A;  2KIK A;  4ASW A;  4CPG A;  2HR3 A;  1ZW0 A;  4HB1 A;  1ZXG A;  1FC2 C;  4EYY Q;  2KZJ A;  4WWI A;  3ZDM A;  4NPE A;  2QRX A;  4GOE A;  2KZI A;  3FXD A;  3QWO C;  4GOF A;  4HJG H;  1Q2N A;  3PH0 A;  2M5A A;  3FXE A; 
#chains in the Genus database with same CATH topology
 3BAS A;  1T3J A;  2WSS H;  3PP5 A;  3RK2 D;  3L70 J;  1YYC A;  3KQG A;  1QGK B;  2H43 A;  2JWD A;  3P8M C;  1SQB D;  2ZT9 C;  3N4X A;  5APW A;  2KXP B;  3L70 E;  5CJ0 A;  4ASV A;  1AQT A;  2E75 D;  2OYO A;  5KLV G;  2M8R A;  5AVU B;  1AJY A;  1X0T A;  4C7N B;  1KB9 D;  3SWF A;  1SQX E;  2O01 H;  1NWQ A;  1FZC B;  4GDO A;  1OXZ A;  3AE4 C;  1YI2 P;  4GT1 A;  1S9K D;  2WSC J;  1NVO A;  4Z1M H;  5CMZ A;  3VMY A;  4LGD E;  3VN0 A;  1VQK P;  3OJA B;  1EC5 A;  3CWB E;  3JCU E;  2PAJ A;  5CJ4 A;  4AUW A;  1SS1 A;  1G1I A;  3F5H A;  1NU1 G;  1Q86 Q;  2R44 A;  1NTM E;  3KZI E;  1GTW A;  2OGU A;  2R5B A;  3L75 E;  1DD3 A;  2FYU D;  4PJ0 H;  1T2K C;  4RO0 A;  1SP4 A;  3AEG C;  3KHU A;  2QJP B;  3RL0 B;  2GM4 A;  1SQQ G;  2FYU K;  3L75 J;  3PRJ A;  4GKG A;  3TGU E;  2IPP A;  1HH0 A;  3RGU A;  5GTH E;  5KKZ C;  1NKN A;  4OWF A;  5EFW B;  1L0N E;  2FY8 A;  1FJK A;  3G3Z A;  1BE3 D;  2YO3 A;  1GK4 A;  1U7J A;  5CCG C;  2ZT9 B;  4LC1 A;  3L72 G;  3E1R A;  2NRG A;  3HTK B;  2PFX A;  3H1K G;  5KKZ B;  2E74 C;  4JQ0 D;  1FE6 A;  2BCC D;  1SQB G;  3L71 J;  3NFQ A;  5KAI H;  1URQ B;  1VQP P;  4WY4 B;  5CCH D;  2LR2 A;  2W8Z A;  2C0W A;  3QH9 A;  1FOS E;  3L71 E;  4D6T D;  1PV3 A;  4ZNC A;  1EXJ A;  3AE8 C;  1PGJ A;  4KJM A;  2M3B A;  2FFD C;  1EDK A;  1S5L E;  2R32 A;  2KUB A;  3CXH I;  1NHL A;  5AW2 B;  2QJK B;  2HPC B;  3PHL A;  2W27 A;  1BE3 J;  1W2E A;  2FBW C;  2Q6Q A;  3GHG A;  3H6P A;  4JYC A;  1VF5 B;  3BCC G;  4I7Z B;  3G71 P;  2OYH A;  5B66 H;  1GU4 A;  5TJH A;  1EDJ A;  3MD0 A;  1M56 D;  1FZC C;  2E76 D;  4PV1 D;  3VMX A;  2P10 A;  4RKU J;  3CWB J;  3CC4 P;  1GL2 D;  1N7S B;  3D70 A;  2IZ0 A;  1SQQ K;  2FYU G;  4JPZ B;  3CCL P;  1X8Y A;  1M57 D;  4H44 D;  3USS A;  4BWN A;  4YXW H;  1GL2 B;  4I6M C;  1P84 I;  4O9B A;  1KTM A;  2E43 A;  1LJ2 A;  3AE1 C;  3AE2 C;  3BAT A;  2K3R A;  1J1E B;  3L73 D;  1JY3 N;  4L76 A;  5KAI E;  2CK3 H;  4BRY A;  1FDM A;  2QM8 A;  3I56 P;  1Q90 D;  5APQ A;  4BRY B;  3P8C E;  3NTN A;  2D2C D;  2M5A B;  3CC2 P;  2IBZ I;  3G6E P;  3S4R A;  2OYI C;  1IC2 A;  3HD7 D;  3V4W A;  2AXT E;  2OTL P;  1M1J A;  2WT7 A;  2A45 H;  1SFC B;  2HR3 A;  2I1J A;  5GTI H;  1KN7 A;  3V5B A;  5CHX A;  2OTJ P;  1S2E A;  1OFC X;  2OYI B;  3MGN A;  3B5N C;  2JP3 A;  3TDK A;  1UIX A;  1RE3 A;  3LW5 H;  1M7L A;  1K9M Q;  1VL2 A;  3IAO A;  1AVO A;  2KP8 A;  1P84 D;  1IJD B;  1PP9 J;  2KZJ A;  2N1T A;  3H25 A;  1SFC D;  2IBZ D;  5E79 H;  1HVV A;  2AEJ A;  3II6 A;  5AVR B;  3CLQ A;  3U1A A;  3MUD C;  1NTM J;  3EFG A;  3VP8 A;  1FDI A;  1FDO A;  3P7K A;  1IFM A;  4A7P A;  3L74 D;  1LTI C;  3GF3 A;  1CSB A;  1N7S C;  2HG5 D;  3CX5 H;  2E76 C;  3ABV C;  1YJN P;  1ZME C;  2DW3 A;  2E75 C;  1G1J A;  3VMZ A;  1GL2 C;  1SQP G;  3WUT A;  3PJS K;  3VYI A;  1GK6 A;  1L0N J;  3EFF K;  3H1K J;  4U3F G;  4LLH A;  3CMA P;  5KLV D;  3RL0 g;  1NU1 K;  3Q1M A;  5AW5 B;  2Y9Z A;  4IOI H;  3HE5 B;  1PL5 A;  2GUS A;  3WMM 0;  2CPS A;  3H1J D;  1NGM B;  3V2R A;  1RE3 C;  3CME P;  2BEZ F;  1KIL A;  3VTP C;  3B8E B;  1SQV E;  1OVV A;  1GDT A;  3GG2 A;  3U59 A;  2PGD A;  3W67 A;  1YJW P;  2IYP A;  1FJP A;  1YTZ I;  1SQP J;  3L72 E;  2K37 A;  3B5N B;  3SSU A;  2QVA A;  4H13 D;  1MUU A;  1SQP E;  3CD6 P;  1L0L E;  3FWN A;  2KNC A;  1MFZ A;  2KLU A;  2A45 I;  1IFI A;  1K04 A;  1BE3 E;  1LTA C;  3CL3 D;  5APY A;  5CBN A;  1DH3 A;  1SQV D;  1CW5 A;  3L73 G;  2FYU J;  3TGU D;  2B87 A;  1SQB K;  1OMI A;  2FYU E;  1VPC A;  2KK7 A;  2ZXX A;  3D6Z A;  1DEE G;  1LWU C;  1U7M A;  2YO2 A;  1NTZ G;  1G2C B;  1GL2 A;  2A45 G;  5H2F E;  4B86 A;  5KLV E;  1VQ6 P;  1OIP A;  3V2Q A;  1R5L A;  4KT0 J;  5AW0 B;  1MKM A;  1ZV8 A;  3U1C A;  3CCS P;  1VQO P;  2XKM A;  1JNM A;  3PTZ A;  2B88 A;  3CCV P;  1N73 A;  1S9K E;  1YHQ P;  3L73 J;  2UWJ E;  3HE4 B;  3C1L A;  1J1D C;  4H0L D;  2QEX P;  4OGQ D;  1USE A;  1N2D C;  2N1T C;  2NPS D;  2ZAE B;  1JUN A;  2AXT H;  1RF0 A;  2IBZ G;  3R4Y A;  1DIP A;  2L91 A;  3HD7 A;  1HBW A;  3A3Y B;  3AE9 C;  3L70 G;  5K5G B;  1VQN P;  1Q82 Q;  2GUV A;  1LP1 A;  1IFJ A;  1OW6 A;  1PP9 G;  2WPQ A;  3CCJ P;  1ZRT E;  3AE5 C;  3L70 D;  1WRG A;  1A02 F;  1LTJ B;  3LID A;  2XV5 A;  3ITK A;  2H88 C;  4L75 A;  1BCC D;  1HTL C;  1M1J C;  1NTM G;  3F89 A;  4TT3 H;  1J1E C;  4YTP C;  1JMB A;  1FU1 A;  2RKL A;  3HUS B;  1BGY J;  2KNC B;  1IK9 A;  1OVU A;  1EZV E;  1GZL A;  3C9I A;  1QLE D;  1PGO A;  2XZR A;  1FS0 E;  3H1L D;  2YNY A;  3H1L E;  1BCC J;  4PD4 H;  5AW4 B;  1FOS F;  1BDD A;  1CZQ A;  5H2F H;  1RF1 C;  1H0T A;  1RF1 A;  2WTY A;  3HUS C;  2QA4 P;  1BCC E;  3G4S P;  5AVT B;  1NO4 A;  1EZV I;  1DEB A;  1X79 B;  3CI9 A;  4EOT A;  2WSF H;  5KAF H;  5B5E H;  1LTB C;  2W6J H;  2XU6 A;  1ZLL A;  3MIW A;  3AEB C;  1QEX A;  1KFN A;  5TIS E;  4XA4 A;  1IK7 A;  2GA1 A;  3H1J G;  2K88 A;  2N9Y B;  3ZDM A;  3AEE C;  1Q7Y Q;  2R5D A;  2QJK C;  5AVY B;  3TGU G;  2HOD A;  3CXH H;  4OH8 B;  1NH4 A;  1KIL E;  1KQF B;  3TGU J;  4L74 A;  3VP9 A;  3GHG C;  2W6A A;  1NTM K;  2HOD B;  4JBZ A;  3TK1 A;  4JF7 A;  3VMA A;  4IFD K;  2YIU C;  1VF5 C;  1WT6 A;  1WMK A;  1PPJ D;  3I5C A;  2J59 M;  1K05 A;  1NAY A;  4CPG A;  5APX A;  2JJL A;  5AW9 B;  5KLI C;  3TYY A;  1K73 Q;  2Q5U A;  5AVV B;  3RK3 C;  4HB1 A;  1CI6 A;  3MP7 B;  2N1T D;  1RH5 B;  5AW6 B;  2NPS C;  1ZXG A;  1VQ9 P;  1PP9 D;  1IFD A;  1AV1 A;  1UII A;  2IFM A;  2WZ7 A;  4HH2 A;  1T3U A;  3B71 A;  4EIJ A;  2AEF A;  2WQY C;  3C8V A;  4U3F D;  4Y99 C;  2C9L Y;  4PD4 I;  1FZB A;  5CCH C;  2YXR B;  2PP6 A;  3V4Q A;  2QRX A;  3KYQ A;  2Z5H A;  4GOE A;  2D2C B;  2KZI A;  3FXD A;  4U7J A;  4DJG A;  4Y99 B;  1FZF A;  1SQP D;  1M1J B;  3B4S A;  4I1L A;  1BE3 G;  5KLV J;  2FXO A;  1QVF O;  2W90 A;  3TF5 A;  1KQL A;  1L0N D;  3L72 D;  4WY4 A;  1GW3 A;  3WUU A;  4U3F E;  3L35 A;  2KOG A;  2BAS A;  1L0L G;  2M5A A;  2XNX A;  2PRR A;  1Y9B A;  1XTC C;  2WSF J;  1YQ3 C;  2QJY C;  1QL1 A;  1QX8 A;  1E79 H;  2O1J A;  2RN0 A;  1PP9 E;  2YMK A;  3H1K E;  3HTK A;  2O01 N;  3LIE A;  1JY3 P;  2H7H A;  4EDF A;  2Q1K A;  2YIU B;  1DD4 A;  1IFN A;  1NU1 D;  2WPR A;  3H1J E;  3JCU H;  3CCE P;  3D6Y A;  3IFM A;  1SQV G;  1JY3 O;  3AE7 C;  4PV1 C;  3SWK A;  2Y0E A;  1YTZ T;  3CWB D;  3FGA D;  2V7Q H;  1PPJ E;  1VF5 D;  3GMA A;  1EZV G;  3M0D A;  2O1K A;  1JTH A;  5KJ7 D;  2OYH B;  3TNU B;  1SQQ E;  2LXC B;  1NTZ E;  1SVF A;  2R3S A;  3A0B E;  1JTH B;  2J58 A;  1KIL D;  3SWY A;  3V2P A;  3L74 J;  1PGP A;  2E76 B;  3M91 A;  1L0L K;  1T8Z A;  2HPC A;  1NKZ B;  2HFE D;  1LNQ A;  1SQX D;  1BDC A;  3UIA A;  3A0H H;  1PIX A;  2ZYG A;  1BSN A;  1E5W A;  3L4F A;  2ZVO B;  3H1L G;  1D7M A;  4ZMD A;  1LT9 B;  1KQG B;  4IL6 X;  1LWU A;  3A2A A;  2I8D A;  2IBZ E;  3RL0 C;  2ZJS E;  3AEF C;  4DT0 A;  5L8R J;  3VOP A;  1SQB E;  1P84 E;  4K35 A;  1AQ5 A;  1KFM A;  1RQV A;  4GOD A;  3CCM P;  2K9J B;  4K3A A;  1S5L H;  2IFN A;  3L71 G;  1SQB J;  2ZT9 D;  3A7O A;  4H0L C;  4UB8 H;  5CBO A;  1HF9 A;  3RK3 E;  3H1I E;  1JMM A;  3BRV B;  2M0B A;  3B5N A;  1S4X A;  3W68 A;  2AXC A;  2WIT A;  2WSE J;  4XE5 B;  3NXS A;  4AYC A;  3MZW B;  5TIS H;  1H89 A;  3H1L J;  5BU8 B;  4H13 B;  1SFC C;  1Q81 Q;  1EDI A;  1ZN5 A;  1S3J A;  2A06 D;  2E5T A;  2FXM A;  2B89 A;  3H1H J;  3MHV A;  4R4L A;  3CXH D;  1SQX J;  3Q5S A;  2OYI A;  1ZRT D;  3P32 A;  3CX5 D;  3CCQ P;  1IO4 A;  2JR8 A;  1KYO I;  1OX3 A;  4U3F J;  3RBZ A;  3L73 E;  1NJI Q;  1N8R Q;  1L4A B;  4IL6 E;  4AQR D;  3KDP B;  4WVZ A;  3PLN A;  5KTB A;  3Q3D A;  4IFF A;  1YIJ P;  5AVX B;  1USD A;  4IL6 H;  2G3A A;  2V7Q J;  1LWU B;  5DJT B;  3KZI H;  1HWT C;  5AVQ B;  1YQ4 C;  2C0X A;  4YPC A;  3A0H E;  3BRT B;  2P58 A;  5M1B A;  5KJ7 C;  4L73 A;  1EQ7 A;  1JEK A;  1GW4 A;  1FZA A;  1P84 H;  1SQX G;  3L72 J;  1FZC A;  2XDJ A;  4ZKU A;  3CPW O;  2E5Y A;  5KJ7 A;  3AEC C;  3KXD A;  2YXQ B;  1N7S A;  5GTH H;  2JWA A;  1JY2 N;  2JKV A;  4ZKP A;  3Q5P A;  3GF7 A;  1JOC A;  4W7Y A;  2Q3I A;  4NPF X;  1N86 A;  3H32 B;  4W80 A;  4DCK A;  5KLI B;  1X22 A;  2HLO A;  2L5G B;  4UB8 E;  3M0D C;  4I7Z C;  1HJB A;  5GTI E;  2H8P D;  2BCC J;  3L71 D;  4D6T E;  5APV A;  2QM7 A;  2SPZ A;  1KD1 Q;  2RMZ A;  3GW6 A;  2FFD A;  1L0L D;  3CCU P;  2WSE H;  5DJU B;  3SFD C;  3OW2 O;  5AVW B;  1SFC A;  3WUV A;  2B87 B;  1MZ9 A;  3JC2 2;  4H0L B;  3RK2 B;  2WPV B;  1T6A A;  4BXL A;  1M8O B;  1N7S D;  1W2B O;  5CCG D;  2ZFC A;  3L74 G;  4N78 D;  4N6J A;  1GD2 E;  4WY4 C;  1EDL A;  1KB9 I;  2P67 A;  3H1H E;  3AE6 C;  3N7N A;  5CCH A;  3A0B H;  3CWB G;  3S9O A;  2E74 D;  1OW8 A;  1ZW0 A;  5KAF E;  3H1H D;  1KYO H;  5AW1 B;  3A5T A;  4N78 E;  2QSI A;  3OA7 A;  2C9N Y;  1FZG A;  1NAF A;  5KLV K;  5AVS B;  1KQS O;  1JO5 A;  1HJ0 A;  3V6I A;  1NU1 J;  2NZ2 A;  3TSI A;  1VQ8 P;  1FC2 C;  1RQU A;  4Y28 J;  2NPS A;  1L0N K;  2Q7C A;  1YIT P;  1L4A D;  2KLV A;  4PV1 B;  4PD4 D;  2WWW A;  1M1K Q;  1SQQ J;  2YMY A;  3L36 A;  3L75 G;  4NPE A;  2VRS A;  2H89 C;  3GHG B;  4WWI A;  4M3L A;  1VDF A;  3L74 E;  1U57 A;  2IYO A;  5APU A;  1YJ9 P;  1FAV A;  3RBX A;  3AE3 C;  3CCR P;  4GOF A;  1FBM A;  1TU3 F;  1Q2N A;  3HD7 B;  3PH0 A;  1N73 C;  4QMA A;  1VQ5 P;  1A02 J;  2W6B A;  4H44 C;  2RH0 A;  1JY2 O;  3T97 B;  1AFO A;  3G9R A;  5CCG A;  1L4A A;  1GMJ A;  4JYB A;  2LKM A;  4DZO A;  1URQ D;  1MFT A;  1RE4 C;  3Q5R A;  2KB7 P;  2YKO A;  1RY3 A;  5C39 A;  1NYH A;  3AEA C;  2LXB A;  1MV8 A;  1W5C E;  2ZYD A;  3IF4 A;  2D2C C;  1KOR A;  2OTK E;  5E79 E;  2W83 C;  2QE7 H;  3P8C D;  1RHZ B;  4MN4 C;  4UB6 H;  1RF1 B;  2YKQ A;  1KYO D;  1S5L X;  1L0N G;  2WT7 B;  1BSH A;  3RK2 C;  3HRN A;  3WU2 H;  5AVZ B;  2OAR A;  4UB6 E;  2K1A A;  1J2J B;  2J5U A;  1SQX K;  3CX5 E;  1HUC A;  1LTJ C;  2KS1 A;  2K9J A;  2A06 E;  4I2L C;  2JDI H;  3HE5 A;  1RE4 A;  5APT A;  1YBK A;  1VQ7 P;  3OAK A;  4WBA A;  1L4A C;  3Q2Y A;  1SLQ A;  1K8A Q;  2Z4E A;  2BCC G;  3D71 A;  2MKV A;  1GU5 A;  3CC7 P;  2Z5I A;  4R4M A;  3RK3 D;  1X9V A;  1S1C X;  4HYT B;  3AED C;  5APS A;  1KMI Z;  4D6T G;  2B9B A;  3M06 A;  2FFD B;  4GIF A;  1PPJ G;  1NTK D;  3HD7 C;  3MTU E;  1RF0 C;  4WY4 D;  4HKZ H;  3H1I J;  3HE4 A;  4KHX A;  1OZH A;  1AVY A;  2IZ1 A;  1J1D B;  1H8A A;  1BGY D;  1HGV A;  2KSJ A;  1CI6 B;  1OW7 A;  3B5N D;  1G2C A;  3TNU A;  4XFJ A;  3EWK A;  2JO1 A;  1LT9 C;  2ZXE B;  1BGY G;  1Y47 A;  3O8Z A;  1H88 A;  1L0L J;  2FYZ A;  3M0A A;  2FYN B;  2E75 B;  4PD4 E;  1LT1 A;  1BCC G;  4RES B;  5B66 E;  1VQM P;  1M90 Q;  1H0T B;  2BCC E;  4D6T J;  1NTZ D;  1SQQ D;  2G8Y A;  1JM0 A;  1OWA A;  2WMM A;  3L37 A;  1R5S A;  1N7L A;  1PZQ A;  2CPB A;  1KB9 H;  1LTS C;  2WPS A;  3HUS A;  3M9H A;  3H1I G;  4RJT A;  3EQ2 A;  3M9B A;  1Z56 A;  3RK3 B;  5B5E E;  1NU1 E;  2BEQ D;  2JEE A;  4OGQ B;  1URQ A;  3IR9 A;  5AW8 B;  1PFI A;  2ZVN B;  3NMD A;  2M3E A;  2XND H;  2Y9Y A;  3R2P A;  1LP1 B;  3H1K D;  4H13 C;  1JB0 J;  1IZN B;  2Q3E A;  2KS1 B;  4NPD A;  1QL2 A;  2IDB A;  4OVN F;  1ZP0 C;  1HGZ A;  3SFE C;  1OVR A;  3O6Q B;  3S1K A;  1VQL P;  2P7J A;  2QIW A;  1JCC A;  3L75 D;  2E42 A;  1NTM D;  1KIL C;  2IX7 C;  3KPE A;  2Y0C A;  1SQV K;  1NTK G;  3H32 A;  4YXD C;  1URQ C;  3JSV C;  3IN6 A;  1ZR4 A;  1VQ4 P;  1SQP K;  3BVH A;  1NTZ K;  3K5B A;  1S72 P;  1KC8 Q;  1Y8A A;  3E1I A;  4IFM A;  4C7R A;  2Y0D A;  3FWL A;  3T97 A;  3E7K A;  2KSE A;  4WB4 A;  2KI7 B;  1L2P A;  2OQQ A;  2P2U A;  3LW5 J;  2FYN C;  2MJZ A;  1KB9 E;  4DOJ A;  2QG4 A;  2O3J A;  3CX5 I;  1LT9 A;  3H1H G;  5BU5 A;  1NOH A;  1EXI A;  1BGY E;  2POH A;  1DX7 A;  1NTK J;  1AA0 A;  2KIK A;  2ZYA A;  2O01 J;  3FX0 A;  1NTK K;  4W7Z A;  4ASW A;  2Q9I A;  1FZE A;  1QVG O;  1R8E A;  4C46 A;  2OYH C;  1KV4 A;  1NTK E;  2AEM A;  3WU2 E;  1IFP A;  1LTG C;  2WSC H;  1N73 B;  2FKW B;  5AW7 B;  3MUD A;  2FXP A;  1LGH B;  3H1J J;  1KZU B;  4H44 B;  2N1T B;  2R3C A;  2YKP A;  4C7N A;  1LTT C;  1JCD A;  1ZOY C;  2HYN A;  2QJP C;  4N3Y B;  4EYY Q;  1ZR2 A;  2N9B A;  1PGQ A;  2NPS B;  1NTZ J;  4TLF A;  3M9Q A;  1KIL B;  3O6Q A;  2KYV A;  2P1J A;  2WVR A;  1SQV J;  3BCC E;  3BCC D;  3CXH E;  3GLM A;  3QWO C;  4OGQ C;  4PJ0 E;  1T2K D;  2A06 G;  1LTJ A;  2I1K A;  2QJY B;  2K9Y A;  4HJG H;  4EI2 A;  1KYO E;  3BCC J;  5AW3 B;  2E74 B;  3V2N A;  3I55 P;  1XTG B;  2V4H A;  2ITA A;  5BVZ A;  1JY2 P;  3FXE A;  3RL0 D;  3H1I D;  1EZV D; 
#chains in the Genus database with same CATH homology
 4IOI H;  2Q1K A;  2JWD A;  1MFT A;  4ASV A;  1OVV A;  5C39 A;  2LXB A;  2OTK E;  1X0T A;  2LXC B;  4MN4 C;  2QVA A;  1BDC A;  4ZMD A;  1NVO A;  5CBN A;  1EC5 A;  2I8D A;  1SS1 A;  4K35 A;  2R44 A;  2B87 A;  4GOD A;  4K3A A;  5CBO A;  1DEE G;  1U7M A;  2M0B A;  4HKZ H;  3MZW B;  3RGU A;  5EFW B;  1EDI A;  1S3J A;  2B88 A;  1U7J A;  2B89 A;  3MHV A;  1Y47 A;  2UWJ E;  1LT1 A;  1H0T B;  2ZAE B;  5K5G B;  1JM0 A;  2WMM A;  2LR2 A;  1LP1 A;  4ZNC A;  4KJM A;  5DJT B;  1EDK A;  2KUB A;  2P58 A;  1JMB A;  2RKL A;  1LP1 B;  1OVU A;  2KS1 B;  4NPD A;  1OVR A;  1BDD A;  3S1K A;  1H0T A;  1EDJ A;  4NPF X;  2SPZ A;  5DJU B;  2KI7 B;  2K3R A;  2B87 B;  4BXL A;  4JBZ A;  2M5A B;  1EDL A;  2KIK A;  4ASW A;  4CPG A;  2HR3 A;  1ZW0 A;  4HB1 A;  1ZXG A;  1FC2 C;  4EYY Q;  2KZJ A;  4WWI A;  3ZDM A;  4NPE A;  2QRX A;  4GOE A;  2KZI A;  3FXD A;  3QWO C;  4GOF A;  4HJG H;  1Q2N A;  3PH0 A;  2M5A A;  3FXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...