4NPEA

High-resolution structure of c domain of staphylococcal protein a at room temperature
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 24
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npeA00
3QWOC 2M5AB 4NPFX 1Q2NA 4GOFA 2KS1B 1X0TA 4NPDA 4K35A 5DJTB 1DEEG 1NVOA 1H0TB 4JBZA 1FC2C 1SS1A 4HJGH 5C39A 1OVVA 4EYYQ 2LXCB 2KZJA 1LP1B 2HR3A 4MN4C 1BDCA 2B88A 4KJMA 1EDLA 5CBOA 1OVUA 2LR2A 3MZWB 2SPZA 4HKZH 3MHVA 1H0TA 4ASWA 2Q1KA 1S3JA 2B87A 2RKLA 5K5GB 2B87B 4WWIA 2KIKA 4BXLA 2B89A 5CBNA 2KUBA 2UWJE 1ZW0A 2KI7B 5DJUB 2R44A 2ZAEB 3FXDA 1ZXGA 2KZIA 2K3RA 5EFWB 3RGUA 4HB1A 1JM0A 4GOEA 1MFTA 1OVRA 3FXEA 1JMBA 4ZMDA 2OTKE 4ASVA 2P58A 1EDJA 1LP1A 1BDDA 2M5AA 2LXBA 2QVAA 2JWDA 2WMMA 2I8DA 1U7MA 4CPGA 4K3AA 4NPEA 1EDIA 1EDKA 3PH0A 3S1KA 4IOIH 4ZNCA 2QRXA 1EC5A 1U7JA 1Y47A 1LT1A 2M0BA 4GODA 3ZDMA
chains in the Genus database with same CATH superfamily
2Q5UA 3L72G 1Q2NA 5M1BA 1H8AA 2KS1B 3MUDA 1QL2A 3O6QB 3AECC 2OYHB 1PL5A 4HYTB 5APVA 3TGUJ 1X0TA 2WSEJ 1RF0C 1NTKK 3L71J 2NPSA 2CPBA 1BE3G 3AE6C 3L74D 1NKZB 3SFEC 2W27A 4JQ0D 2OTJP 1DEEG 1GTWA 5KAIH 1AVOA 1RE3C 2JWAA 1H0TB 4H0LC 5C39A 3HUSC 1KQSO 3CXHH 3JSVC 1KYOE 2K9JA 1OXZA 1MV8A 1URQC 3KXDA 1R5LA 3M0DA 4MN4C 1ZN5A 2E75C 3RK3E 2NZ2A 3RK2B 4ZKPA 1KB9E 3Q1MA 1N73A 1LTJB 1T3JA 1JY3P 2H7HA 1BSHA 5CHXA 1FDOA 2C9NY 1KMIZ 4KT0J 4BRYA 1IK7A 1NTKE 1M1JB 1BCCE 3B4SA 3MZWB 3RL0g 1NU1K 2E74B 2PGDA 2RN0A 4AQRD 2PP6A 1A02F 1J1EB 4HKZH 4EI2A 3GLMA 3D71A 1H0TA 1PPJD 1FS0E 3H1KG 5AVWB 1NGMB 1S3JA 2JJLA 1M1KQ 1LT9C 3H1IE 1RF1C 1G2CB 1HGZA 4PV1B 4WB4A 3IAOA 1SQBJ 5AW3B 5KTBA 4WWIA 1SQVD 1NTKG 2N1TD 3M9BA 4AYCA 2K9YA 1DX7A 3MGNA 2KSJA 2GUSA 3KZIH 4I2LC 2J59M 1EXIA 1USDA 2PFXA 1S9KD 2Z4EA 1NOHA 2KUBA 3CX5I 2KNCA 1CI6A 3EWKA 1RE4A 1L0LJ 1VF5D 3AEGC 1K9MQ 1QVGO 1GK6A 2W6JH 5DJUB 4WY4B 1DIPA 3CXHD 3FXDA 3PRJA 3TNUB 2V7QJ 1NO4A 3GHGB 5AVUB 1ZXGA 3HD7C 4JYCA 5L8RJ 1IFIA 1NAYA 4D6TG 2WITA 1SLQA 3HE5A 4GIFA 2H43A 1DH3A 2HFED 3BRVB 3CX5D 1NH4A 4Y99C 1ZP0C 1L0ND 2BEZF 3E1RA 3GW6A 5EFWB 5AVTB 3RGUA 4W80A 3P8CD 5KLVG 3GHGA 3OW2O 1GZLA 2WPQA 2GM4A 1KILC 5KJ7A 1NTMK 3WMM0 2E74D 1OW8A 2R3SA 2V7QH 1QEXA 4PD4D 2Q7CA 1S1CX 1ZR4A 2YO2A 1JY2P 3RK3C 3L74G 3ZDMA 5KLVJ 1M1JC 2WPVB 1IFDA 2OGUA 3AEAC 2FXOA 3BASA 3CD6P 1G1IA 1KILA 1X8YA 2ZYDA 3L71E 1SFCD 4LGDE 2W83C 3P8CE 3A0BH 4ASVA 2P58A 1EDLA 2AEFA 2E76C 2RH0A 3CWBE 3LW5H 2FKWB 5AVVB 1M8OB 3RK2C 3H25A 2OTLP 3CX5E 2ZT9D 1KQLA 2O01N 3AE3C 1G1JA 1EXJA 2E76B 1YIJP 2M5AA 1K8AQ 2LXBA 3HD7A 2QVAA 5AVRB 3IN6A 1NTMD 1U57A 2YXQB 2JDIH 1P84H 1JTHA 1LTJC 3L75J 5AW6B 4H44B 4UB8E 4IFDK 1FJPA 2JWDA 1SQVJ 2I8DA 1U7MA 3QH9A 2KYVA 2RMZA 1FZCB 1ZV8A 2ZVOB 1L0NK 3C8VA 3L72E 1L4AA 3T97A 1IZNB 1LTJA 1YYCA 3A0HE 1T6AA 3U1AA 3H1KD 1HUCA 5AVSB 4NPEA 1Q81Q 1L0LD 4PV1D 2WTYA 1NTKJ 3G9RA 2HODB 3H32B 4BWNA 1MFZA 2ZYAA 2N1TB 1EC5A 1U7JA 2O01H 1GL2B 3RL0B 3U1CA 2PRRA 3D70A 3LIEA 1FZAA 2QM7A 1LT9A 1ZR2A 1RF1A 4PD4H 3V4WA 1VQPP 1SQXJ 2P7JA 2M0BA 2QJKC 2H8PD 3OAKA 3L72D 4OGQD 2A45H 3U59A 2QE7H 1SQPD 3MP7B 3D6ZA 2L5GB 2IYOA 2OYOA 3TK1A 2Y9ZA 1AFOA 2NPSD 1HF9A 3TF5A 2FY8A 2WSEH 3KDPB 3QWOC 3V2QA 5CJ4A 2XDJA 1USEA 4IFMA 3VN0A 3A5TA 5KKZB 3VMXA 2HPCA 4GT1A 1ZMEC 1AQ5A 1YTZI 1M57D 1IFNA 1URQA 1GW4A 2FYUJ 2IDBA 3M0DC 3E7KA 4NPDA 3WUTA 2YMYA 5KLIB 2IBZI 3CXHE 4XE5B 2ZYGA 3Q3DA 3H1HD 4JBZA 2P1JA 2Y0CA 1FC2C 4HJGH 5KLVD 3SWKA 3VOPA 1GMJA 1OVVA 2ZT9B 1AQTA 2QSIA 4EYYQ 2ITAA 4KHXA 3PTZA 1N7SC 5AW9B 3HE5B 3D6YA 3L74E 1A02J 3CLQA 1BCCD 1NTZE 1RF0A 3EQ2A 3FWLA 2FFDA 1S5LE 5AW5B 4KJMA 4OWFA 3CMAP 2FFDC 1NWQA 1ZRTE 2W8ZA 1JCCA 3NMDA 1KFNA 4H44C 2YO3A 4WY4A 5CBOA 2OYHA 1J2JB 2BCCE 1PPJG 1OVUA 1JO5A 2BEQD 1SQVK 2XNDH 4WVZA 1VDFA 2JO1A 5AVXB 5KJ7D 2ZFCA 2E74C 3VTPC 1OW7A 1JMMA 1VF5B 3GG2A 5AW1B 2Q1KA 2Y0DA 1X22A 3H6PA 2E43A 1P84I 2WQYC 2YKPA 1PGPA 3K5BA 1NTZJ 5K5GB 2AEJA 1BCCJ 3CCRP 2E75B 2LKMA 3V5BA 1GL2A 2AXTE 4UB6H 2BCCJ 1IFMA 1JY2O 1WT6A 2JR8A 2W6AA 2CK3H 2E5YA 1SQXK 1KZUB 2Z5HA 5CBNA 2POHA 3TGUG 1FZGA 2ZT9C 2O01J 4H0LD 5APUA 2ZXXA 3JC22 1VQNP 1NHLA 3L72J 1N73C 3GF3A 3BRTB 3T97B 1SQVE 1HH0A 1FBMA 1BGYG 3L4FA 1Y9BA 4U3FD 5KLVK 4Y99B 1MZ9A 4RO0A 1N73B 1FDMA 4C7NB 5CCGD 3NXSA 1JTHB 1L2PA 3F5HA 2P2UA 2KXPB 1SQPG 1OMIA 3H1IG 1T3UA 1QLED 3H1HJ 4HB1A 1VQ4P 3G4SP 1S9KE 1SFCB 1JM0A 4AUWA 4WBAA 3PP5A 5CJ0A 2K1AA 3CC7P 1E5WA 1DEBA 1PP9E 1PGJA 1SQXE 4EOTA 3VMAA 2FYZA 1DD3A 2E76D 1RQVA 2WZ7A 5GTIH 1FZFA 1L0NJ 5KAIE 2KK7A 2G3AA 2N1TA 2OTKE 2YIUC 4OVNF 5APWA 3CCMP 2P67A 1KTMA 3H1IJ 2KP8A 3VP9A 1UIIA 4IFFA 1JUNA 3H1HG 1YQ4C 3M9QA 2L91A 2OYIC 1VQ5P 3A0HH 1LTGC 1VF5C 2FFDB 4A7PA 3TSIA 1FZCA 1S4XA 2Y0EA 1FE6A 1JB0J 1KV4A 4IL6X 4GDOA 1RH5B 1L0LE 3BCCD 1K05A 3G71P 1T2KC 1SQQG 5APSA 1JY2N 2WMMA 3L74J 5KLIC 1URQB 1JOCA 1L0LG 3WUUA 2C9LY 2Y9YA 3F89A 2KOGA 4K3AA 5H2FH 1JEKA 2R3CA 1CI6B 1QVFO 1KILB 4M3LA 2A45I 2HLOA 3KQGA 1SQPK 3PJSK 5H2FE 4PJ0H 4TT3H 4PD4I 2IX7C 2I1JA 2MJZA 3TGUE 1GU5A 3SFDC 5AW4B 4EIJA 1HWTC 1FDIA 3CMEP 2B9BA 3C1LA 3H1KJ 3R2PA 1VQKP 3CI9A 2IZ1A 4GODA 5CCGA 1NU1E 1VQMP 1L0LK 1SFCC 1YQ3C 3CL3D 5TJHA 5GTIE 1J1DB 3I5CA 2Q9IA 2QM8A 4B86A 1KORA 3CCSP 2E5TA 3LIDA 1Y8AA 1BGYD 4U3FG 1LJ2A 1SQXG 1GW3A 4GOFA 1VQOP 1IC2A 1SQPE 1D7MA 2G8YA 1QX8A 2HG5D 2JKVA 1RQUA 1GL2C 3RL0C 1FZCC 1X9VA 2E42A 2KLVA 3BCCE 1JCDA 4L73A 4YXDC 3H1ID 4TLFA 1BCCG 4ZKUA 5APXA 4HH2A 1SS1A 5TISE 5CCHC 2HPCB 1NTZG 1NAFA 2DW3A 1BE3J 2WSFH 3MTUE 2FYUG 2LXCB 3L73E 4LC1A 2KZJA 1JY3O 3AE8C 3AE7C 2O1JA 1YHQP 3CX5H 1HVVA 2WSFJ 3L75G 5E79H 3B5NB 1SFCA 2IFMA 1KB9D 3Q2YA 1LT9B 1RF1B 1YBKA 5E79E 4RJTA 1HGVA 2LR2A 1PP9J 3HUSA 2SPZA 3WU2E 3R4YA 2XNXA 2FYUK 3FWNA 3MHVA 1OIPA 3H32A 3H1LD 5AW2B 5B5EE 1E79H 1FZEA 3H1JG 4JYBA 5AW7B 1KB9I 2NPSC 5CMZA 4DZOA 2ZXEB 3AEEC 1SQBD 2OARA 4BRYB 4UB6E 1W2BO 2B87B 3NTNA 3TGUD 3H1JE 1R8EA 1SQQD 3N7NA 1EZVG 4JF7A 2XU6A 3AEBC 1URQD 2BASA 1T8ZA 2ZJSE 3GF7A 1N7SB 3HD7B 4PD4E 3BATA 2V4HA 1H88A 2H89C 1PP9D 2XZRA 1GDTA 1NKNA 5CCHD 1KC8Q 3KYQA 4GKGA 3I55P 2R5BA 1YJWP 2R44A 3CC4P 3CXHI 1EQ7A 1LWUC 1X79B 3RK3D 2FYUE 3L73G 2FYNB 4I7ZC 2IPPA 2QJKB 1EZVE 2KZIA 3GHGC 3O6QA 2OYIA 1OW6A 1XTGB 2H88C 3AE4C 1MKMA 3SSUA 1AVYA 2N1TC 3A0BE 2A06D 4H13B 1WMKA 4PJ0E 4DCKA 1XTCC 2O1KA 3PHLA 4GOEA 2JEEA 3AE5C 4N78E 3ITKA 5AVYB 1OVRA 2GUVA 2IBZE 2M8RA 1NU1D 3CWBG 1JY3N 3H1LE 3OA7A 3WU2H 3CCJP 3L35A 1KYOD 1JMBA 1AV1A 1J1EC 1RY3A 4L76A 5B5EH 3AEFC 2I1KA 3IF4A 1LTAC 3Q5RA 3CC2P 1N7SA 1KFMA 2D2CB 2C0WA 1L4AD 1FOSE 2KB7P 2K88A 3L70E 1SQPJ 1NTZD 1EDJA 5APYA 2J5UA 2HYNA 3BCCG 1IFJA 2K9JB 3EFFK 4YPCA 3C9IA 2QIWA 2WWWA 1N7SD 5BU8B 3CCQP 1FU1A 4OGQB 1BDDA 1YI2P 1HJBA 1KILD 2KNCB 3L75D 1IJDB 1SQBK 3Q5SA 2D2CC 2IZ0A 1KQFB 3W67A 5TISH 2YXRB 3B5NC 1FJKA 4YXWH 4WY4C 1BSNA 3II6A 2QEXP 3FGAD 3L36A 3AE1C 4H13C 1SQQE 2C0XA 4I6MC 3B5NA 1G2CA 3HRNA 1BGYE 3M06A 3V2RA 4DT0A 2KS1A 3VMZA 5KJ7C 1EDKA 2A06E 3PH0A 1SQBG 2HODA 1NTZK 2YIUB 3RK2D 1W5CE 1GU4A 2N9YB 4N3YB 2QJYB 4ZNCA 1H89A 3H1HE 4IL6H 1VQ9P 1YTZT 2WPSA 1EZVD 1Y47A 1LTSC 1SQBE 2IFNA 1KN7A 3KPEA 3P7KA 4EDFA 3CCVP 3VP8A 1RE3A 1SQXD 3L71D 1K73Q 3CCEP 1RHZB 3CCUP 1LWUB 1L4AC 1PP9G 1CZQA 1LNQA 3NFQA 1ZRTD 2XKMA 3M9HA 3HE4A 1SQQK 2AEMA 1HJ0A 2QJYC 3AEDC 2YKQA 2FBWC 2YKOA 1QL1A 3OJAB 3M91A 4NPFX 2M5AB 3MUDC 4L74A 5KKZC 3L73D 3P32A 1KILE 3CCLP 3N4XA 2FYNC 4I7ZB 1SVFA 3JCUE 2QJPB 1NU1J 1PGQA 4L75A 5GTHH 2D2CD 4DOJA 2FXMA 1WRGA 4K35A 2BCCG 2FYUD 3A3YB 5DJTB 2KLUA 1NVOA 1SP4A 2KSEA 2OQQA 4I1LA 3HTKA 1GK4A 3UIAA 1M7LA 1HTLC 1TU3F 1NYHA 3KHUA 1HBWA 4N6JA 3PLNA 1OWAA 1IK9A 1CSBA 1ZOYC 3V2PA 4OGQC 4LLHA 5BVZA 4Y28J 1NU1G 2JP3A 3CWBD 3EFGA 3L70G 3TDKA 1LP1B 2HR3A 4U3FJ 4R4MA 5AVZB 1LTIC 2B88A 1Q86Q 1BDCA 5APQA 1P84D 1KYOH 3SWFA 2AXTH 3H1LG 4N78D 1GD2E 1N2DC 2YNYA 3H1JD 3MIWA 1IO4A 1NTME 4RESB 5KAFH 3AE2C 2IBZG 3IFMA 3HD7D 1GL2D 3RL0D 3L70J 5CCGC 4ASWA 1FOSF 1UIXA 3O8ZA 3ABVC 4JPZB 2PAJA 4DJGA 4QMAA 2J58A 4W7ZA 2B87A 4UB8H 2RKLA 4H13D 3H1KE 1S5LH 2KIKA 3S9OA 3W68A 4BXLA 3RK3B 1PPJE 2B89A 2K37A 3AE9C 4RKUJ 2W90A 2WVRA 1OX3A 3USSA 1KYOI 1CW5A 1NTMJ 3A2AA 1FAVA 1N86A 1RE4C 1SQVG 1ZW0A 2UWJE 3HUSB 3IR9A 3KZIE 4U7JA 5APTA 1YJNP 3RBXA 1IFPA 1SQQJ 4OH8B 3SWYA 2KI7B 5AVQB 3E1IA 3FX0A 2ZAEB 3BVHA 1VQ8P 5B66E 4D6TJ 1OFCX 3B8EB 2W6BA 2A06G 1W2EA 1L0NE 4XA4A 3A7OA 3BCCJ 1VQ6P 1BE3E 2WSCJ 5CCHA 2K3RA 3L73J 1Q90D 2Z5IA 5BU5A 1BE3D 1PIXA 4W7YA 5AW8B 1M1JA 2R32A 1MUUA 2M3EA 1KB9H 3HE4B 1L4AB 2MKVA 4IL6E 2VRSA 2R5DA 3GMAA 4C7NA 1JNMA 1K04A 2A45G 1MFTA 3VYIA 3G3ZA 1T2KD 2FXPA 1VQLP 1L0NG 2CPSA 2XV5A 3CWBJ 5KAFE 3FXEA 1S72P 4Z1MH 1AA0A 1M56D 4ZMDA 2O3JA 1Q82Q 5AW0B 2BCCD 3CPWO 1VL2A 4O9BA 2P10A 2WPRA 1KD1Q 4YTPC 4PV1C 1LTTC 3V4QA 4D6TE 3TYYA 3H1JJ 2NPSB 2M3BA 1ZLLA 1LP1A 2AXCA 2IYPA 3Q5PA 1YITP 3G6EP 3L37A 3L70D 1Z56A 3B71A 1PV3A 1BGYJ 1YJ9P 1Q7YQ 2N9BA 2GA1A 3RBZA 3S4RA 5KLVE 1VQ7P 1AJYA 1VPCA 2OYIB 3HTKB 3VMYA 1KQGB 1LGHB 1NTKD 1R5SA 2QG4A 4H0LB 4U3FE 2Q3EA 3WUVA 2ZVNB 2WSSH 1PZQA 1S2EA 1P84E 5B66H 2IBZD 2Q3IA 1LTBC 3P8MC 1NTMG 3MD0A 3V2NA 4C7RA 1M90Q 4CPGA 2WT7B 2Q6QA 3I56P 1NJIQ 1EDIA 1QGKB 4XFJA 3S1KA 4C46A 3L75E 4IOIH 1DD4A 2E75D 4WY4D 2QRXA 3L71G 1LWUA 3JCUH 2NRGA 4H44D 3TNUA 5GTHE 2QA4P 1N8RQ 1N7LA 2QJPC 2WT7A 3M0AA 1S5LX 4D6TD 2OYHC 1LT1A 4R4LA 2YMKA 1PFIA 3B5ND 3H1LJ 2WSCH 1EZVI 3V6IA 1J1DC 1OZHA 1PGOA 1FZBA 3LW5J
chains in the Genus database with same CATH topology
3QWOC 2M5AB 4NPFX 1Q2NA 4GOFA 2KS1B 1X0TA 4NPDA 4K35A 5DJTB 1DEEG 1NVOA 1H0TB 4JBZA 1FC2C 1SS1A 4HJGH 5C39A 1OVVA 4EYYQ 2LXCB 2KZJA 1LP1B 2HR3A 4MN4C 1BDCA 2B88A 4KJMA 1EDLA 5CBOA 1OVUA 2LR2A 3MZWB 2SPZA 4HKZH 3MHVA 1H0TA 4ASWA 2Q1KA 1S3JA 2B87A 2RKLA 5K5GB 2B87B 4WWIA 2KIKA 4BXLA 2B89A 5CBNA 2KUBA 2UWJE 1ZW0A 2KI7B 5DJUB 2R44A 2ZAEB 3FXDA 1ZXGA 2KZIA 2K3RA 5EFWB 3RGUA 4HB1A 1JM0A 4GOEA 1MFTA 1OVRA 3FXEA 1JMBA 4ZMDA 2OTKE 4ASVA 2P58A 1EDJA 1LP1A 1BDDA 2M5AA 2LXBA 2QVAA 2JWDA 2WMMA 2I8DA 1U7MA 4CPGA 4K3AA 4NPEA 1EDIA 1EDKA 3PH0A 3S1KA 4IOIH 4ZNCA 2QRXA 1EC5A 1U7JA 1Y47A 1LT1A 2M0BA 4GODA 3ZDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWO C;  2M5A B;  4NPF X;  1Q2N A;  4GOF A;  2KS1 B;  1X0T A;  4NPD A;  4K35 A;  5DJT B;  1DEE G;  1NVO A;  1H0T B;  4JBZ A;  1FC2 C;  1SS1 A;  4HJG H;  5C39 A;  1OVV A;  4EYY Q;  2LXC B;  2KZJ A;  1LP1 B;  2HR3 A;  4MN4 C;  1BDC A;  2B88 A;  4KJM A;  1EDL A;  5CBO A;  1OVU A;  2LR2 A;  3MZW B;  2SPZ A;  4HKZ H;  3MHV A;  1H0T A;  4ASW A;  2Q1K A;  1S3J A;  2B87 A;  2RKL A;  5K5G B;  2B87 B;  4WWI A;  2KIK A;  4BXL A;  2B89 A;  5CBN A;  2KUB A;  2UWJ E;  1ZW0 A;  2KI7 B;  5DJU B;  2R44 A;  2ZAE B;  3FXD A;  1ZXG A;  2KZI A;  2K3R A;  5EFW B;  3RGU A;  4HB1 A;  1JM0 A;  4GOE A;  1MFT A;  1OVR A;  3FXE A;  1JMB A;  4ZMD A;  2OTK E;  4ASV A;  2P58 A;  1EDJ A;  1LP1 A;  1BDD A;  2M5A A;  2LXB A;  2QVA A;  2JWD A;  2WMM A;  2I8D A;  1U7M A;  4CPG A;  4K3A A;  4NPE A;  1EDI A;  1EDK A;  3PH0 A;  3S1K A;  4IOI H;  4ZNC A;  2QRX A;  1EC5 A;  1U7J A;  1Y47 A;  1LT1 A;  2M0B A;  4GOD A;  3ZDM A; 
#chains in the Genus database with same CATH topology
 2Q5U A;  3L72 G;  1Q2N A;  5M1B A;  1H8A A;  2KS1 B;  3MUD A;  1QL2 A;  3O6Q B;  3AEC C;  2OYH B;  1PL5 A;  4HYT B;  5APV A;  3TGU J;  1X0T A;  2WSE J;  1RF0 C;  1NTK K;  3L71 J;  2NPS A;  2CPB A;  1BE3 G;  3AE6 C;  3L74 D;  1NKZ B;  3SFE C;  2W27 A;  4JQ0 D;  2OTJ P;  1DEE G;  1GTW A;  5KAI H;  1AVO A;  1RE3 C;  2JWA A;  1H0T B;  4H0L C;  5C39 A;  3HUS C;  1KQS O;  3CXH H;  3JSV C;  1KYO E;  2K9J A;  1OXZ A;  1MV8 A;  1URQ C;  3KXD A;  1R5L A;  3M0D A;  4MN4 C;  1ZN5 A;  2E75 C;  3RK3 E;  2NZ2 A;  3RK2 B;  4ZKP A;  1KB9 E;  3Q1M A;  1N73 A;  1LTJ B;  1T3J A;  1JY3 P;  2H7H A;  1BSH A;  5CHX A;  1FDO A;  2C9N Y;  1KMI Z;  4KT0 J;  4BRY A;  1IK7 A;  1NTK E;  1M1J B;  1BCC E;  3B4S A;  3MZW B;  3RL0 g;  1NU1 K;  2E74 B;  2PGD A;  2RN0 A;  4AQR D;  2PP6 A;  1A02 F;  1J1E B;  4HKZ H;  4EI2 A;  3GLM A;  3D71 A;  1H0T A;  1PPJ D;  1FS0 E;  3H1K G;  5AVW B;  1NGM B;  1S3J A;  2JJL A;  1M1K Q;  1LT9 C;  3H1I E;  1RF1 C;  1G2C B;  1HGZ A;  4PV1 B;  4WB4 A;  3IAO A;  1SQB J;  5AW3 B;  5KTB A;  4WWI A;  1SQV D;  1NTK G;  2N1T D;  3M9B A;  4AYC A;  2K9Y A;  1DX7 A;  3MGN A;  2KSJ A;  2GUS A;  3KZI H;  4I2L C;  2J59 M;  1EXI A;  1USD A;  2PFX A;  1S9K D;  2Z4E A;  1NOH A;  2KUB A;  3CX5 I;  2KNC A;  1CI6 A;  3EWK A;  1RE4 A;  1L0L J;  1VF5 D;  3AEG C;  1K9M Q;  1QVG O;  1GK6 A;  2W6J H;  5DJU B;  4WY4 B;  1DIP A;  3CXH D;  3FXD A;  3PRJ A;  3TNU B;  2V7Q J;  1NO4 A;  3GHG B;  5AVU B;  1ZXG A;  3HD7 C;  4JYC A;  5L8R J;  1IFI A;  1NAY A;  4D6T G;  2WIT A;  1SLQ A;  3HE5 A;  4GIF A;  2H43 A;  1DH3 A;  2HFE D;  3BRV B;  3CX5 D;  1NH4 A;  4Y99 C;  1ZP0 C;  1L0N D;  2BEZ F;  3E1R A;  3GW6 A;  5EFW B;  5AVT B;  3RGU A;  4W80 A;  3P8C D;  5KLV G;  3GHG A;  3OW2 O;  1GZL A;  2WPQ A;  2GM4 A;  1KIL C;  5KJ7 A;  1NTM K;  3WMM 0;  2E74 D;  1OW8 A;  2R3S A;  2V7Q H;  1QEX A;  4PD4 D;  2Q7C A;  1S1C X;  1ZR4 A;  2YO2 A;  1JY2 P;  3RK3 C;  3L74 G;  3ZDM A;  5KLV J;  1M1J C;  2WPV B;  1IFD A;  2OGU A;  3AEA C;  2FXO A;  3BAS A;  3CD6 P;  1G1I A;  1KIL A;  1X8Y A;  2ZYD A;  3L71 E;  1SFC D;  4LGD E;  2W83 C;  3P8C E;  3A0B H;  4ASV A;  2P58 A;  1EDL A;  2AEF A;  2E76 C;  2RH0 A;  3CWB E;  3LW5 H;  2FKW B;  5AVV B;  1M8O B;  3RK2 C;  3H25 A;  2OTL P;  3CX5 E;  2ZT9 D;  1KQL A;  2O01 N;  3AE3 C;  1G1J A;  1EXJ A;  2E76 B;  1YIJ P;  2M5A A;  1K8A Q;  2LXB A;  3HD7 A;  2QVA A;  5AVR B;  3IN6 A;  1NTM D;  1U57 A;  2YXQ B;  2JDI H;  1P84 H;  1JTH A;  1LTJ C;  3L75 J;  5AW6 B;  4H44 B;  4UB8 E;  4IFD K;  1FJP A;  2JWD A;  1SQV J;  2I8D A;  1U7M A;  3QH9 A;  2KYV A;  2RMZ A;  1FZC B;  1ZV8 A;  2ZVO B;  1L0N K;  3C8V A;  3L72 E;  1L4A A;  3T97 A;  1IZN B;  1LTJ A;  1YYC A;  3A0H E;  1T6A A;  3U1A A;  3H1K D;  1HUC A;  5AVS B;  4NPE A;  1Q81 Q;  1L0L D;  4PV1 D;  2WTY A;  1NTK J;  3G9R A;  2HOD B;  3H32 B;  4BWN A;  1MFZ A;  2ZYA A;  2N1T B;  1EC5 A;  1U7J A;  2O01 H;  1GL2 B;  3RL0 B;  3U1C A;  2PRR A;  3D70 A;  3LIE A;  1FZA A;  2QM7 A;  1LT9 A;  1ZR2 A;  1RF1 A;  4PD4 H;  3V4W A;  1VQP P;  1SQX J;  2P7J A;  2M0B A;  2QJK C;  2H8P D;  3OAK A;  3L72 D;  4OGQ D;  2A45 H;  3U59 A;  2QE7 H;  1SQP D;  3MP7 B;  3D6Z A;  2L5G B;  2IYO A;  2OYO A;  3TK1 A;  2Y9Z A;  1AFO A;  2NPS D;  1HF9 A;  3TF5 A;  2FY8 A;  2WSE H;  3KDP B;  3QWO C;  3V2Q A;  5CJ4 A;  2XDJ A;  1USE A;  4IFM A;  3VN0 A;  3A5T A;  5KKZ B;  3VMX A;  2HPC A;  4GT1 A;  1ZME C;  1AQ5 A;  1YTZ I;  1M57 D;  1IFN A;  1URQ A;  1GW4 A;  2FYU J;  2IDB A;  3M0D C;  3E7K A;  4NPD A;  3WUT A;  2YMY A;  5KLI B;  2IBZ I;  3CXH E;  4XE5 B;  2ZYG A;  3Q3D A;  3H1H D;  4JBZ A;  2P1J A;  2Y0C A;  1FC2 C;  4HJG H;  5KLV D;  3SWK A;  3VOP A;  1GMJ A;  1OVV A;  2ZT9 B;  1AQT A;  2QSI A;  4EYY Q;  2ITA A;  4KHX A;  3PTZ A;  1N7S C;  5AW9 B;  3HE5 B;  3D6Y A;  3L74 E;  1A02 J;  3CLQ A;  1BCC D;  1NTZ E;  1RF0 A;  3EQ2 A;  3FWL A;  2FFD A;  1S5L E;  5AW5 B;  4KJM A;  4OWF A;  3CMA P;  2FFD C;  1NWQ A;  1ZRT E;  2W8Z A;  1JCC A;  3NMD A;  1KFN A;  4H44 C;  2YO3 A;  4WY4 A;  5CBO A;  2OYH A;  1J2J B;  2BCC E;  1PPJ G;  1OVU A;  1JO5 A;  2BEQ D;  1SQV K;  2XND H;  4WVZ A;  1VDF A;  2JO1 A;  5AVX B;  5KJ7 D;  2ZFC A;  2E74 C;  3VTP C;  1OW7 A;  1JMM A;  1VF5 B;  3GG2 A;  5AW1 B;  2Q1K A;  2Y0D A;  1X22 A;  3H6P A;  2E43 A;  1P84 I;  2WQY C;  2YKP A;  1PGP A;  3K5B A;  1NTZ J;  5K5G B;  2AEJ A;  1BCC J;  3CCR P;  2E75 B;  2LKM A;  3V5B A;  1GL2 A;  2AXT E;  4UB6 H;  2BCC J;  1IFM A;  1JY2 O;  1WT6 A;  2JR8 A;  2W6A A;  2CK3 H;  2E5Y A;  1SQX K;  1KZU B;  2Z5H A;  5CBN A;  2POH A;  3TGU G;  1FZG A;  2ZT9 C;  2O01 J;  4H0L D;  5APU A;  2ZXX A;  3JC2 2;  1VQN P;  1NHL A;  3L72 J;  1N73 C;  3GF3 A;  3BRT B;  3T97 B;  1SQV E;  1HH0 A;  1FBM A;  1BGY G;  3L4F A;  1Y9B A;  4U3F D;  5KLV K;  4Y99 B;  1MZ9 A;  4RO0 A;  1N73 B;  1FDM A;  4C7N B;  5CCG D;  3NXS A;  1JTH B;  1L2P A;  3F5H A;  2P2U A;  2KXP B;  1SQP G;  1OMI A;  3H1I G;  1T3U A;  1QLE D;  3H1H J;  4HB1 A;  1VQ4 P;  3G4S P;  1S9K E;  1SFC B;  1JM0 A;  4AUW A;  4WBA A;  3PP5 A;  5CJ0 A;  2K1A A;  3CC7 P;  1E5W A;  1DEB A;  1PP9 E;  1PGJ A;  1SQX E;  4EOT A;  3VMA A;  2FYZ A;  1DD3 A;  2E76 D;  1RQV A;  2WZ7 A;  5GTI H;  1FZF A;  1L0N J;  5KAI E;  2KK7 A;  2G3A A;  2N1T A;  2OTK E;  2YIU C;  4OVN F;  5APW A;  3CCM P;  2P67 A;  1KTM A;  3H1I J;  2KP8 A;  3VP9 A;  1UII A;  4IFF A;  1JUN A;  3H1H G;  1YQ4 C;  3M9Q A;  2L91 A;  2OYI C;  1VQ5 P;  3A0H H;  1LTG C;  1VF5 C;  2FFD B;  4A7P A;  3TSI A;  1FZC A;  1S4X A;  2Y0E A;  1FE6 A;  1JB0 J;  1KV4 A;  4IL6 X;  4GDO A;  1RH5 B;  1L0L E;  3BCC D;  1K05 A;  3G71 P;  1T2K C;  1SQQ G;  5APS A;  1JY2 N;  2WMM A;  3L74 J;  5KLI C;  1URQ B;  1JOC A;  1L0L G;  3WUU A;  2C9L Y;  2Y9Y A;  3F89 A;  2KOG A;  4K3A A;  5H2F H;  1JEK A;  2R3C A;  1CI6 B;  1QVF O;  1KIL B;  4M3L A;  2A45 I;  2HLO A;  3KQG A;  1SQP K;  3PJS K;  5H2F E;  4PJ0 H;  4TT3 H;  4PD4 I;  2IX7 C;  2I1J A;  2MJZ A;  3TGU E;  1GU5 A;  3SFD C;  5AW4 B;  4EIJ A;  1HWT C;  1FDI A;  3CME P;  2B9B A;  3C1L A;  3H1K J;  3R2P A;  1VQK P;  3CI9 A;  2IZ1 A;  4GOD A;  5CCG A;  1NU1 E;  1VQM P;  1L0L K;  1SFC C;  1YQ3 C;  3CL3 D;  5TJH A;  5GTI E;  1J1D B;  3I5C A;  2Q9I A;  2QM8 A;  4B86 A;  1KOR A;  3CCS P;  2E5T A;  3LID A;  1Y8A A;  1BGY D;  4U3F G;  1LJ2 A;  1SQX G;  1GW3 A;  4GOF A;  1VQO P;  1IC2 A;  1SQP E;  1D7M A;  2G8Y A;  1QX8 A;  2HG5 D;  2JKV A;  1RQU A;  1GL2 C;  3RL0 C;  1FZC C;  1X9V A;  2E42 A;  2KLV A;  3BCC E;  1JCD A;  4L73 A;  4YXD C;  3H1I D;  4TLF A;  1BCC G;  4ZKU A;  5APX A;  4HH2 A;  1SS1 A;  5TIS E;  5CCH C;  2HPC B;  1NTZ G;  1NAF A;  2DW3 A;  1BE3 J;  2WSF H;  3MTU E;  2FYU G;  2LXC B;  3L73 E;  4LC1 A;  2KZJ A;  1JY3 O;  3AE8 C;  3AE7 C;  2O1J A;  1YHQ P;  3CX5 H;  1HVV A;  2WSF J;  3L75 G;  5E79 H;  3B5N B;  1SFC A;  2IFM A;  1KB9 D;  3Q2Y A;  1LT9 B;  1RF1 B;  1YBK A;  5E79 E;  4RJT A;  1HGV A;  2LR2 A;  1PP9 J;  3HUS A;  2SPZ A;  3WU2 E;  3R4Y A;  2XNX A;  2FYU K;  3FWN A;  3MHV A;  1OIP A;  3H32 A;  3H1L D;  5AW2 B;  5B5E E;  1E79 H;  1FZE A;  3H1J G;  4JYB A;  5AW7 B;  1KB9 I;  2NPS C;  5CMZ A;  4DZO A;  2ZXE B;  3AEE C;  1SQB D;  2OAR A;  4BRY B;  4UB6 E;  1W2B O;  2B87 B;  3NTN A;  3TGU D;  3H1J E;  1R8E A;  1SQQ D;  3N7N A;  1EZV G;  4JF7 A;  2XU6 A;  3AEB C;  1URQ D;  2BAS A;  1T8Z A;  2ZJS E;  3GF7 A;  1N7S B;  3HD7 B;  4PD4 E;  3BAT A;  2V4H A;  1H88 A;  2H89 C;  1PP9 D;  2XZR A;  1GDT A;  1NKN A;  5CCH D;  1KC8 Q;  3KYQ A;  4GKG A;  3I55 P;  2R5B A;  1YJW P;  2R44 A;  3CC4 P;  3CXH I;  1EQ7 A;  1LWU C;  1X79 B;  3RK3 D;  2FYU E;  3L73 G;  2FYN B;  4I7Z C;  2IPP A;  2QJK B;  1EZV E;  2KZI A;  3GHG C;  3O6Q A;  2OYI A;  1OW6 A;  1XTG B;  2H88 C;  3AE4 C;  1MKM A;  3SSU A;  1AVY A;  2N1T C;  3A0B E;  2A06 D;  4H13 B;  1WMK A;  4PJ0 E;  4DCK A;  1XTC C;  2O1K A;  3PHL A;  4GOE A;  2JEE A;  3AE5 C;  4N78 E;  3ITK A;  5AVY B;  1OVR A;  2GUV A;  2IBZ E;  2M8R A;  1NU1 D;  3CWB G;  1JY3 N;  3H1L E;  3OA7 A;  3WU2 H;  3CCJ P;  3L35 A;  1KYO D;  1JMB A;  1AV1 A;  1J1E C;  1RY3 A;  4L76 A;  5B5E H;  3AEF C;  2I1K A;  3IF4 A;  1LTA C;  3Q5R A;  3CC2 P;  1N7S A;  1KFM A;  2D2C B;  2C0W A;  1L4A D;  1FOS E;  2KB7 P;  2K88 A;  3L70 E;  1SQP J;  1NTZ D;  1EDJ A;  5APY A;  2J5U A;  2HYN A;  3BCC G;  1IFJ A;  2K9J B;  3EFF K;  4YPC A;  3C9I A;  2QIW A;  2WWW A;  1N7S D;  5BU8 B;  3CCQ P;  1FU1 A;  4OGQ B;  1BDD A;  1YI2 P;  1HJB A;  1KIL D;  2KNC B;  3L75 D;  1IJD B;  1SQB K;  3Q5S A;  2D2C C;  2IZ0 A;  1KQF B;  3W67 A;  5TIS H;  2YXR B;  3B5N C;  1FJK A;  4YXW H;  4WY4 C;  1BSN A;  3II6 A;  2QEX P;  3FGA D;  3L36 A;  3AE1 C;  4H13 C;  1SQQ E;  2C0X A;  4I6M C;  3B5N A;  1G2C A;  3HRN A;  1BGY E;  3M06 A;  3V2R A;  4DT0 A;  2KS1 A;  3VMZ A;  5KJ7 C;  1EDK A;  2A06 E;  3PH0 A;  1SQB G;  2HOD A;  1NTZ K;  2YIU B;  3RK2 D;  1W5C E;  1GU4 A;  2N9Y B;  4N3Y B;  2QJY B;  4ZNC A;  1H89 A;  3H1H E;  4IL6 H;  1VQ9 P;  1YTZ T;  2WPS A;  1EZV D;  1Y47 A;  1LTS C;  1SQB E;  2IFN A;  1KN7 A;  3KPE A;  3P7K A;  4EDF A;  3CCV P;  3VP8 A;  1RE3 A;  1SQX D;  3L71 D;  1K73 Q;  3CCE P;  1RHZ B;  3CCU P;  1LWU B;  1L4A C;  1PP9 G;  1CZQ A;  1LNQ A;  3NFQ A;  1ZRT D;  2XKM A;  3M9H A;  3HE4 A;  1SQQ K;  2AEM A;  1HJ0 A;  2QJY C;  3AED C;  2YKQ A;  2FBW C;  2YKO A;  1QL1 A;  3OJA B;  3M91 A;  4NPF X;  2M5A B;  3MUD C;  4L74 A;  5KKZ C;  3L73 D;  3P32 A;  1KIL E;  3CCL P;  3N4X A;  2FYN C;  4I7Z B;  1SVF A;  3JCU E;  2QJP B;  1NU1 J;  1PGQ A;  4L75 A;  5GTH H;  2D2C D;  4DOJ A;  2FXM A;  1WRG A;  4K35 A;  2BCC G;  2FYU D;  3A3Y B;  5DJT B;  2KLU A;  1NVO A;  1SP4 A;  2KSE A;  2OQQ A;  4I1L A;  3HTK A;  1GK4 A;  3UIA A;  1M7L A;  1HTL C;  1TU3 F;  1NYH A;  3KHU A;  1HBW A;  4N6J A;  3PLN A;  1OWA A;  1IK9 A;  1CSB A;  1ZOY C;  3V2P A;  4OGQ C;  4LLH A;  5BVZ A;  4Y28 J;  1NU1 G;  2JP3 A;  3CWB D;  3EFG A;  3L70 G;  3TDK A;  1LP1 B;  2HR3 A;  4U3F J;  4R4M A;  5AVZ B;  1LTI C;  2B88 A;  1Q86 Q;  1BDC A;  5APQ A;  1P84 D;  1KYO H;  3SWF A;  2AXT H;  3H1L G;  4N78 D;  1GD2 E;  1N2D C;  2YNY A;  3H1J D;  3MIW A;  1IO4 A;  1NTM E;  4RES B;  5KAF H;  3AE2 C;  2IBZ G;  3IFM A;  3HD7 D;  1GL2 D;  3RL0 D;  3L70 J;  5CCG C;  4ASW A;  1FOS F;  1UIX A;  3O8Z A;  3ABV C;  4JPZ B;  2PAJ A;  4DJG A;  4QMA A;  2J58 A;  4W7Z A;  2B87 A;  4UB8 H;  2RKL A;  4H13 D;  3H1K E;  1S5L H;  2KIK A;  3S9O A;  3W68 A;  4BXL A;  3RK3 B;  1PPJ E;  2B89 A;  2K37 A;  3AE9 C;  4RKU J;  2W90 A;  2WVR A;  1OX3 A;  3USS A;  1KYO I;  1CW5 A;  1NTM J;  3A2A A;  1FAV A;  1N86 A;  1RE4 C;  1SQV G;  1ZW0 A;  2UWJ E;  3HUS B;  3IR9 A;  3KZI E;  4U7J A;  5APT A;  1YJN P;  3RBX A;  1IFP A;  1SQQ J;  4OH8 B;  3SWY A;  2KI7 B;  5AVQ B;  3E1I A;  3FX0 A;  2ZAE B;  3BVH A;  1VQ8 P;  5B66 E;  4D6T J;  1OFC X;  3B8E B;  2W6B A;  2A06 G;  1W2E A;  1L0N E;  4XA4 A;  3A7O A;  3BCC J;  1VQ6 P;  1BE3 E;  2WSC J;  5CCH A;  2K3R A;  3L73 J;  1Q90 D;  2Z5I A;  5BU5 A;  1BE3 D;  1PIX A;  4W7Y A;  5AW8 B;  1M1J A;  2R32 A;  1MUU A;  2M3E A;  1KB9 H;  3HE4 B;  1L4A B;  2MKV A;  4IL6 E;  2VRS A;  2R5D A;  3GMA A;  4C7N A;  1JNM A;  1K04 A;  2A45 G;  1MFT A;  3VYI A;  3G3Z A;  1T2K D;  2FXP A;  1VQL P;  1L0N G;  2CPS A;  2XV5 A;  3CWB J;  5KAF E;  3FXE A;  1S72 P;  4Z1M H;  1AA0 A;  1M56 D;  4ZMD A;  2O3J A;  1Q82 Q;  5AW0 B;  2BCC D;  3CPW O;  1VL2 A;  4O9B A;  2P10 A;  2WPR A;  1KD1 Q;  4YTP C;  4PV1 C;  1LTT C;  3V4Q A;  4D6T E;  3TYY A;  3H1J J;  2NPS B;  2M3B A;  1ZLL A;  1LP1 A;  2AXC A;  2IYP A;  3Q5P A;  1YIT P;  3G6E P;  3L37 A;  3L70 D;  1Z56 A;  3B71 A;  1PV3 A;  1BGY J;  1YJ9 P;  1Q7Y Q;  2N9B A;  2GA1 A;  3RBZ A;  3S4R A;  5KLV E;  1VQ7 P;  1AJY A;  1VPC A;  2OYI B;  3HTK B;  3VMY A;  1KQG B;  1LGH B;  1NTK D;  1R5S A;  2QG4 A;  4H0L B;  4U3F E;  2Q3E A;  3WUV A;  2ZVN B;  2WSS H;  1PZQ A;  1S2E A;  1P84 E;  5B66 H;  2IBZ D;  2Q3I A;  1LTB C;  3P8M C;  1NTM G;  3MD0 A;  3V2N A;  4C7R A;  1M90 Q;  4CPG A;  2WT7 B;  2Q6Q A;  3I56 P;  1NJI Q;  1EDI A;  1QGK B;  4XFJ A;  3S1K A;  4C46 A;  3L75 E;  4IOI H;  1DD4 A;  2E75 D;  4WY4 D;  2QRX A;  3L71 G;  1LWU A;  3JCU H;  2NRG A;  4H44 D;  3TNU A;  5GTH E;  2QA4 P;  1N8R Q;  1N7L A;  2QJP C;  2WT7 A;  3M0A A;  1S5L X;  4D6T D;  2OYH C;  1LT1 A;  4R4L A;  2YMK A;  1PFI A;  3B5N D;  3H1L J;  2WSC H;  1EZV I;  3V6I A;  1J1D C;  1OZH A;  1PGO A;  1FZB A;  3LW5 J; 
#chains in the Genus database with same CATH homology
 3QWO C;  2M5A B;  4NPF X;  1Q2N A;  4GOF A;  2KS1 B;  1X0T A;  4NPD A;  4K35 A;  5DJT B;  1DEE G;  1NVO A;  1H0T B;  4JBZ A;  1FC2 C;  1SS1 A;  4HJG H;  5C39 A;  1OVV A;  4EYY Q;  2LXC B;  2KZJ A;  1LP1 B;  2HR3 A;  4MN4 C;  1BDC A;  2B88 A;  4KJM A;  1EDL A;  5CBO A;  1OVU A;  2LR2 A;  3MZW B;  2SPZ A;  4HKZ H;  3MHV A;  1H0T A;  4ASW A;  2Q1K A;  1S3J A;  2B87 A;  2RKL A;  5K5G B;  2B87 B;  4WWI A;  2KIK A;  4BXL A;  2B89 A;  5CBN A;  2KUB A;  2UWJ E;  1ZW0 A;  2KI7 B;  5DJU B;  2R44 A;  2ZAE B;  3FXD A;  1ZXG A;  2KZI A;  2K3R A;  5EFW B;  3RGU A;  4HB1 A;  1JM0 A;  4GOE A;  1MFT A;  1OVR A;  3FXE A;  1JMB A;  4ZMD A;  2OTK E;  4ASV A;  2P58 A;  1EDJ A;  1LP1 A;  1BDD A;  2M5A A;  2LXB A;  2QVA A;  2JWD A;  2WMM A;  2I8D A;  1U7M A;  4CPG A;  4K3A A;  4NPE A;  1EDI A;  1EDK A;  3PH0 A;  3S1K A;  4IOI H;  4ZNC A;  2QRX A;  1EC5 A;  1U7J A;  1Y47 A;  1LT1 A;  2M0B A;  4GOD A;  3ZDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...