4NPEA

High-resolution structure of c domain of staphylococcal protein a at room temperature
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 24
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npeA00
2KUBA 2KS1B 1SS1A 4JBZA 3PH0A 3S1KA 4ZNCA 1H0TB 1EDIA 5K5GB 5CBOA 2M5AB 1Q2NA 1EDLA 4NPEA 3MZWB 4NPDA 2LXCB 1JMBA 1BDCA 4ASWA 4BXLA 2P58A 1H0TA 4HJGH 3ZDMA 1DEEG 2UWJE 5CBNA 4KJMA 4HKZH 3FXDA 1Y47A 1ZXGA 1S3JA 4ASVA 1OVVA 2B87B 2I8DA 1U7MA 5C39A 2K3RA 1LP1B 4K35A 1EDJA 2LR2A 4GOEA 4IOIH 2Q1KA 2M5AA 4NPFX 5DJTB 1LP1A 2LXBA 4GODA 3RGUA 1FC2C 2KZIA 1EC5A 3MHVA 2JWDA 4MN4C 1LT1A 2KI7B 4CPGA 1OVRA 1U7JA 2B88A 1JM0A 2B89A 2KIKA 2OTKE 2B87A 1NVOA 4GOFA 1OVUA 5DJUB 2KZJA 3FXEA 2WMMA 1ZW0A 4WWIA 2HR3A 2SPZA 2RKLA 2M0BA 1EDKA 4K3AA 4EYYQ 1BDDA 4ZMDA 3QWOC 5EFWB 2QRXA 2QVAA 1MFTA 1X0TA 2ZAEB 2R44A 4HB1A
chains in the Genus database with same CATH superfamily
4WB4A 4JBZA 3PH0A 2OQQA 3EQ2A 3HE5A 4YPCA 1VQOP 1QVGO 4C46A 2IDBA 3MZWB 5APVA 4PD4I 2KXPB 1JY2N 3CD6P 3HD7D 2OYIA 3ITKA 3VMXA 2RH0A 3HE4B 1U7MA 4XFJA 1VQMP 3L70J 4PJ0H 4GOEA 2N1TC 4W80A 1USEA 2WSEH 3KDPB 2OTJP 1SQBE 2O1KA 1AA0A 3HTKB 2ZYDA 3RK3E 2FYNB 5B66E 1SQQE 4H13C 2JEEA 5CCHC 2HODA 3NMDA 1L0LK 3V4QA 1JY2P 2OTKE 2B87A 5AW4B 4GDOA 1OVUA 2NPSA 4QMAA 2FYUK 2OYOA 2N9YB 1AQTA 2GUSA 3M06A 4PD4H 1QGKB 4Y99C 3Q1MA 2C0WA 3L71J 2FYZA 2GA1A 1NHLA 1YJNP 3EFGA 2FFDC 1DH3A 2H43A 2OYHC 5E79E 1OWAA 2XDJA 4C7RA 5KTBA 1K04A 1M7LA 1YIJP 1YYCA 5KLIC 1PFIA 3GW6A 1L0NK 2IFMA 3WUUA 2E76C 3AE8C 1R5SA 2XNXA 2E74C 3KXDA 1NTMD 3HD7A 1FBMA 1RHZB 2O3JA 3CWBJ 4EIJA 2Z5IA 2K3RA 1KILD 1GK4A 1LGHB 4A7PA 4ZKPA 2PGDA 3B4SA 1JY2O 2WSCJ 2MKVA 3L75G 3CX5H 2R3SA 1GW3A 2W8ZA 2V7QJ 1YHQP 2D2CD 1M1JC 2KI7B 3HRNA 1VF5C 3CWBD 1FZCA 2ZVNB 1N8RQ 5KLVJ 1BGYD 4DCKA 4ZMDA 4WY4B 2O01H 4PJ0E 1S4XA 1Z56A 2QM7A 3B5NB 4OWFA 3T97A 4JYCA 1JNMA 1KYOE 4RKUJ 1SQVK 3U59A 2O01N 3RL0B 1KD1Q 3M9BA 2BCCE 1H0TB 2M5AB 2H88C 2ZT9C 1BE3J 3O6QA 1CI6A 5KLVD 2WSEJ 4D6TG 2H7HA 2JP3A 3RK2C 1LWUA 1OZHA 2UWJE 3I56P 4DOJA 3WU2H 2C0XA 3H1IJ 1JMMA 2OYIC 1OVVA 4PD4E 1ZRTD 1KB9I 4I6MC 5H2FH 1URQB 5C39A 2W6JH 2G8YA 1A02F 2E75D 4EI2A 2AEJA 1VQ6P 1VQKP 3V4WA 3HUSC 1RF1A 3L72J 1LJ2A 1LP1A 1BSNA 1BE3D 1KILA 5APSA 1EZVE 3RGUA 1TU3F 1S2EA 4RO0A 5KKZC 5AVSB 2N1TD 1LTIC 3D6YA 1OVRA 3H1ID 2IYOA 5AW9B 3CPWO 1VPCA 3OW2O 4H13D 2Z4EA 1NVOA 5CCHD 3TNUA 1J1EB 3L73E 5B5EE 1SQXG 2NPSC 3CCSP 3L72D 3OA7A 1OMIA 3BCCJ 1HBWA 1OIPA 4PD4D 3L74G 1GD2E 5CJ4A 2YIUB 4UB8H 3H1KG 1BSHA 3H1JJ 1NTKJ 2Q3EA 2Y0CA 1H89A 2HFED 3CX5E 1GDTA 3E7KA 3N7NA 3R2PA 4L75A 2ZFCA 1H8AA 3H1LG 2FBWC 1BDCA 4L74A 3VYIA 3BCCD 1GK6A 3ZDMA 1JTHA 1VL2A 3W67A 2OARA 1SQPJ 3H1JD 1NTKD 2RMZA 2E74D 2WSFJ 1OFCX 1PP9E 3IAOA 4EDFA 4OGQB 1N7SC 4GKGA 3QH9A 3SWKA 3P8CD 1NU1E 1N7LA 5KJ7A 1QX8A 3OJAB 1W5CE 2GM4A 3H32B 5APYA 2JWDA 3WUTA 1OW7A 3H1HJ 4WBAA 1LTJB 3AEFC 4KHXA 1J1DC 1MFZA 2N1TA 1RQUA 5KAFH 2QG4A 1SQPD 2W27A 3CCJP 1N2DC 1YTZT 3AEDC 3LW5J 5M1BA 5H2FE 1VF5D 5AW6B 1HH0A 1RE4A 4ZKUA 1VQ9P 3U1AA 2PAJA 3H1HD 1L0NG 2YXRB 5TJHA 4U7JA 2KOGA 1SS1A 3S1KA 2H8PD 1GZLA 1G2CA 1X8YA 2FFDA 1HVVA 1SVFA 3GMAA 2OYHA 2WTYA 2LXCB 1ZN5A 1FDIA 4JF7A 1GL2C 2ZT9D 4TLFA 1X22A 3RK3C 3RK2D 5B66H 3CCRP 1CZQA 1WMKA 2WPQA 1E5WA 2FY8A 1EDJA 1LT9A 3L70G 1IK9A 1AQ5A 1AV1A 2QJYC 1KQFB 1EQ7A 5L8RJ 2E42A 1FOSE 1DD4A 4MN4C 1VQ5P 2B88A 1XTCC 1ZLLA 2KSJA 1L0LE 1X9VA 2PFXA 1KV4A 1PIXA 1NTZJ 2IX7C 3G3ZA 2FYUE 1VQ8P 1M1JA 5CJ0A 2DW3A 1USDA 1SFCB 5BU8B 4B86A 2NPSD 3L71G 2ZXXA 3AECC 4GIFA 1IC2A 1KB9D 1T3UA 2KS1B 5CBOA 1KYOI 1NTZD 3PHLA 4NPDA 1JB0J 2G3AA 2QEXP 5KAFE 1L0NE 4YXWH 4H0LC 1VQNP 3Q5SA 2WT7B 1SQXK 1PPJE 3C1LA 3H25A 1Y47A 4IL6X 1LTTC 2KLUA 3BRVB 3GF3A 5GTHH 1XTGB 3P8MC 3WMM0 3CWBG 5AVXB 3SFEC 3Q2YA 4HYTB 1BCCD 1N73B 2YKPA 1K73Q 5AVYB 2AEFA 2JO1A 1FU1A 1LTGC 3M91A 5AVWB 2E75C 2NZ2A 1FC2C 3GF7A 1N7SD 4I7ZC 1RH5B 1ZMEC 5KJ7C 2YNYA 1U7JA 1S5LX 3HUSA 1E79H 1EZVI 1T6AA 4H44B 2LKMA 4PV1B 3A0BE 3BVHA 1GU5A 3AE1C 1KYOH 2XZRA 2E43A 3AE9C 4K3AA 3GHGC 5KLVG 1KN7A 4U3FE 2PP6A 4N6JA 1KTMA 3H6PA 1RE4C 4WY4D 3D71A 1OW8A 2Q9IA 2L91A 4RJTA 3CC7P 1VDFA 1SQBJ 2O1JA 2KUBA 1SQVE 1GW4A 1M1KQ 1SQQJ 4XA4A 2XV5A 4NPEA 3B8EB 3L71E 3KQGA 1NTMJ 3CX5I 2Y0EA 1DEEG 1NAYA 2A45G 3TGUE 1IK7A 4KJMA 2BEZF 3CC4P 2A06E 3L4FA 3FXDA 2HODB 1ZXGA 1S3JA 2R5BA 3H1IG 2IBZE 2B87B 2YXQB 3CCQP 1PZQA 1GL2D 1URQD 1SQBD 1LTAC 4JYBA 3PLNA 1FE6A 3RK3D 1SQQD 2WPVB 3PRJA 3L72G 1LT9C 1MUUA 1W2BO 5B5EH 2KZIA 1EC5A 1T8ZA 1KFNA 2XNDH 1N7SA 2AXTH 4DJGA 3AEBC 3JSVC 1Q86Q 1M8OB 4GOFA 3FXEA 3PJSK 1BGYJ 3S4RA 1YJ9P 2SPZA 4IFMA 5GTHE 2IYPA 1YJWP 3V2QA 5APUA 3BCCG 2ZAEB 4LC1A 1NJIQ 3HD7B 1AFOA 4N78E 3RL0g 1WRGA 1KORA 4WY4A 2WPSA 3H1JG 1NTKG 3CCVP 3B5NA 3VMZA 3F89A 1R5LA 3K5BA 4ASWA 3G4SP 3EWKA 1H0TA 1Q81Q 2QE7H 1T3JA 3A0HH 2PRRA 4RESB 4H0LD 3U1CA 1FZCB 1SQPG 1NTMK 1LNQA 1GL2A 1URQA 3AE6C 2ZYGA 4GODA 1AVOA 2BCCJ 1FJPA 3T97B 4LGDE 1HGZA 1T2KC 1FDMA 3H1HG 5AW1B 4UB6H 5KJ7D 2IZ1A 3TF5A 2Q3IA 4C7NB 1ZW0A 2FYNC 3O6QB 1KYOD 2QJPB 4EYYQ 1NKNA 1LWUB 4OVNF 5EFWB 3SSUA 2QVAA 3IR9A 1UIXA 3SWYA 2BCCD 1EXIA 5TISH 4HB1A 2JKVA 1M90Q 1S1CX 3P32A 4DT0A 3L75E 2QA4P 4ZNCA 1RF1B 3E1IA 1R8EA 2M3EA 2POHA 2CPSA 4JPZB 1G1IA 1KILB 5GTIE 2AXTE 1PV3A 3CCLP 2K37A 2JWAA 2ZJSE 1L4AB 3CMEP 2AXCA 3L73J 2RN0A 3MD0A 1JO5A 4JQ0D 5KLVK 4ASVA 2KNCA 1P84H 5AVQB 3IFMA 2D2CB 3TNUB 1EZVD 1FOSF 1FS0E 1RE3A 5AW0B 2R32A 2YO3A 2FKWB 2WVRA 3W68A 1Q82Q 3CXHH 1YQ3C 3IN6A 3L73D 1HGVA 4R4LA 2HG5D 3H32A 3A7OA 4D6TE 3RBXA 2KP8A 1L2PA 2HPCA 1Y8AA 5DJUB 1OXZA 2KZJA 1LTJA 3A0HE 2IPPA 3E1RA 1PP9J 5CMZA 4BRYA 2O01J 2CPBA 2WQYC 1JTHB 4HH2A 2KYVA 3CX5D 2C9LY 1NU1J 1FZBA 1LTSC 1IFPA 3GHGA 2QJKB 4WY4C 3B5NC 1IO4A 4O9BA 4UB6E 1PL5A 3FX0A 3L36A 1RF0C 1FDOA 3RL0C 3CI9A 1PP9D 1X79B 5APQA 1MZ9A 2I1JA 3WUVA 2P67A 2YKOA 3KHUA 1SQXE 2N1TB 1A02J 1NU1D 2Z5HA 1S9KE 1IFMA 4K35A 3L74E 3VTPC 4H13B 2IBZI 4DZOA 3A0BH 3H1KE 5TISE 1NTKK 4IL6E 1VQ7P 1URQC 4XE5B 3L37A 3LIEA 3Q5PA 1DEBA 3CC2P 3JC22 1JY3N 4Y99B 3H1LE 2XU6A 1YQ4C 1G2CB 4GT1A 1GTWA 1T2KD 3CL3D 3GG2A 3CMAP 2OYHB 1YBKA 2P10A 5KAIH 1EDKA 1P84E 3G6EP 1UIIA 1BDDA 1SQPK 1SQXD 2W6BA 5KLIB 2K9JB 1J1EC 3EFFK 5AVUB 3L74D 5BU5A 2HLOA 2E76B 3CXHE 1NAFA 1SQBG 2BEQD 5AW5B 2E74B 1AVYA 1JY3P 1SQQG 3D70A 1KZUB 3M0DA 2YIUC 1L4AC 4N3YB 3TDKA 1YTZI 2KS1A 1L0LJ 1NTMG 5CBNA 1VQLP 1NOHA 2I1KA 2FYUJ 1BCCJ 5AVTB 1GMJA 1HUCA 1RE3C 1M1JB 1NWQA 2Q1KA 2WPRA 2AEMA 1L0LD 1VF5B 1ZOYC 1QVFO 2WSCH 3MIWA 4OGQC 1MKMA 2VRSA 4CPGA 2M8RA 2Y9YA 2FYUD 2V7QH 5CCGC 3HE4A 1IFJA 2CK3H 1VQPP 2YMKA 1BGYG 3C9IA 2Q5UA 1LTJC 3MTUE 3V2RA 1IFNA 1M56D 1QL1A 1CW5A 1JY3O 3HTKA 2ZT9B 3L70E 2QJKC 1FZGA 3HE5B 4YTPC 2ITAA 1Q90D 2K1AA 1VQ4P 1L0ND 1K05A 3RK2B 1PPJD 3FWNA 2OYIB 3AEEC 1EDLA 3M9HA 3JCUE 2FXOA 1IJDB 2H89C 2P2UA 2WITA 3B5ND 2A45H 1NTZK 3HUSB 5KAIE 5AW3B 1IZNB 4U3FJ 2KSEA 2ZXEB 3RL0D 1CSBA 5KKZB 1PGPA 1HJ0A 3G9RA 2YMYA 1FAVA 1PGJA 1BE3G 1NTME 2Q7CA 3V6IA 4NPFX 5DJTB 1SQVJ 3L70D 2R3CA 3MHVA 1KILE 2BCCG 1Q7YQ 2NPSB 2BASA 2E5YA 1FZFA 2XKMA 3I55P 2OTLP 2K9YA 4U3FD 4WVZA 3TGUJ 1LTBC 1KQGB 3L35A 1YI2P 2WWWA 4YXDC 1KQSO 1PGOA 2J59M 3CWBE 1SQVD 1DD3A 5GTIH 3PTZA 3AE4C 1FZAA 3NFQA 3NXSA 3L71D 1ZR4A 1BGYE 1EZVG 2N9BA 3CCUP 1SFCC 3TGUD 3NTNA 2QM8A 1EDIA 3FGAD 2A06D 1NH4A 2IBZD 1J2JB 1YITP 1JMBA 3BASA 3M0DC 2P58A 1HTLC 4HJGH 1L4AD 1N7SB 3L73G 2ZVOB 1SLQA 1KQLA 4EOTA 5KLVE 4LLHA 1PGQA 3AE7C 4IFFA 1RF0A 2WSFH 1JEKA 1ZRTE 1J1DB 1U57A 4IOIH 2M5AA 3AE3C 1SQBK 1SQQK 3CLQA 1LT1A 1N73C 2IZ0A 1JM0A 1BE3E 4I1LA 3TYYA 5AW8B 2QSIA 3PP5A 4OGQD 4AQRD 2V4HA 4Y28J 2WMMA 3G71P 1HJBA 2YO2A 5CCGD 2RKLA 2R5DA 3H1IE 4N78D 3LW5H 2K88A 4C7NA 2WSSH 3AE5C 4H44C 4PV1C 1PP9G 1D7MA 1MFTA 2Q6QA 1P84I 5AW2B 1AJYA 1NU1G 2R44A 3L72E 3CCEP 3C8VA 1CI6B 4R4MA 4KT0J 1GL2B 5K5GB 4I2LC 3SFDC 1K9MQ 1Q2NA 3RK3B 3CXHI 3VN0A 3GLMA 3N4XA 1JCDA 2GUVA 1QLED 3VP9A 4IL6H 3I5CA 3BRTB 2W83C 3KZIH 1IFDA 1Y9BA 2I8DA 2QJYB 1L4AA 2W90A 3BCCE 1LP1B 3P7KA 3VP8A 3AEGC 5APWA 2KLVA 1N86A 1W2EA 1H88A 3H1JE 1NTKE 3MUDA 3L75J 2J5UA 3FWLA 5CHXA 2M3BA 2WZ7A 3V5BA 3P8CE 1S5LH 4W7YA 2B89A 4AYCA 1KB9H 3KPEA 2E5TA 3Q3DA 3S9OA 3Q5RA 2FXMA 3IF4A 5CCGA 1SQPE 2KB7P 3L75D 1GU4A 2JJLA 2B9BA 2KNCB 3BATA 4IFDK 4BWNA 1RQVA 1MV8A 1NO4A 4H0LB 2E76D 1OW6A 1FZEA 1NTZG 1HWTC 3HD7C 1HF9A 3H1HE 2OGUA 3M9QA 2JDIH 5APTA 1QL2A 3RBZA 4D6TJ 1SFCD 3A5TA 1L0LG 1S72P 4L76A 1G1JA 2FYUG 2HPCB 3A3YB 2P1JA 3ABVC 2E75B 1BCCG 1ZP0C 4I7ZB 3VMYA 5BVZA 3AE2C 2IFNA 5AVRB 2LR2A 3R4YA 1KC8Q 3USSA 3V2NA 3SWFA 2FXPA 3WU2E 4BRYB 1EXJA 2YKQA 1SP4A 4D6TD 1FZCC 5CCHA 1K8AQ 5AVZB 3AEAC 3KYQA 5AVVB 3OAKA 3GHGB 1RY3A 3VOPA 3O8ZA 4WWIA 1SQXJ 1PPJG 1WT6A 1QEXA 2HR3A 1NKZB 3VMAA 3B71A 2JR8A 2M0BA 3KZIE 1OX3A 2MJZA 3L74J 1X0TA 4W7ZA 3JCUH 3H1KJ 4H44D 2FFDB 4PV1D 2QJPC 2K9JA 1LWUC 4OH8B 2W6AA 2ZYAA 3II6A 3TK1A 3D6ZA 1S5LE 3H1LJ 2QIWA 2KK7A 1KB9E 4BXLA 4UB8E 3A2AA 1IFIA 1S9KD 2HYNA 1RF1C 4HKZH 1SFCA 1NGMB 1NTZE 1DIPA 1KILC 2Y9ZA 1LT9B 3H1KD 4U3FG 3LIDA 2P7JA 4L73A 2Y0DA 1NU1K 3MP7B 3TSIA 3UIAA 5E79H 4M3LA 1FJKA 2LXBA 2D2CC 3H1LD 3M0AA 1KFMA 1SQVG 4AUWA 4TT3H 2WT7A 3MUDC 2C9NY 1BCCE 3MGNA 1ZV8A 2NRGA 3F5HA 1DX7A 1P84D 2KIKA 1ZR2A 3TGUG 5AW7B 3V2PA 1NYHA 2A06G 1JCCA 2IBZG 4Z1MH 1N73A 3CXHD 2A45I 3QWOC 2J58A 1JUNA 2QRXA 3CCMP 2L5GB 1JOCA 1M57D 1L0NJ 1KMIZ 5APXA
chains in the Genus database with same CATH topology
2KUBA 2KS1B 1SS1A 4JBZA 3PH0A 3S1KA 4ZNCA 1H0TB 1EDIA 5K5GB 5CBOA 2M5AB 1Q2NA 1EDLA 4NPEA 3MZWB 4NPDA 2LXCB 1JMBA 1BDCA 4ASWA 4BXLA 2P58A 1H0TA 4HJGH 3ZDMA 1DEEG 2UWJE 5CBNA 4KJMA 4HKZH 3FXDA 1Y47A 1ZXGA 1S3JA 4ASVA 1OVVA 2B87B 2I8DA 1U7MA 5C39A 2K3RA 1LP1B 4K35A 1EDJA 2LR2A 4GOEA 4IOIH 2Q1KA 2M5AA 4NPFX 5DJTB 1LP1A 2LXBA 4GODA 3RGUA 1FC2C 2KZIA 1EC5A 3MHVA 2JWDA 4MN4C 1LT1A 2KI7B 4CPGA 1OVRA 1U7JA 2B88A 1JM0A 2B89A 2KIKA 2OTKE 2B87A 1NVOA 4GOFA 1OVUA 5DJUB 2KZJA 3FXEA 2WMMA 1ZW0A 4WWIA 2HR3A 2SPZA 2RKLA 2M0BA 1EDKA 4K3AA 4EYYQ 1BDDA 4ZMDA 3QWOC 5EFWB 2QRXA 2QVAA 1MFTA 1X0TA 2ZAEB 2R44A 4HB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUB A;  2KS1 B;  1SS1 A;  4JBZ A;  3PH0 A;  3S1K A;  4ZNC A;  1H0T B;  1EDI A;  5K5G B;  5CBO A;  2M5A B;  1Q2N A;  1EDL A;  4NPE A;  3MZW B;  4NPD A;  2LXC B;  1JMB A;  1BDC A;  4ASW A;  4BXL A;  2P58 A;  1H0T A;  4HJG H;  3ZDM A;  1DEE G;  2UWJ E;  5CBN A;  4KJM A;  4HKZ H;  3FXD A;  1Y47 A;  1ZXG A;  1S3J A;  4ASV A;  1OVV A;  2B87 B;  2I8D A;  1U7M A;  5C39 A;  2K3R A;  1LP1 B;  4K35 A;  1EDJ A;  2LR2 A;  4GOE A;  4IOI H;  2Q1K A;  2M5A A;  4NPF X;  5DJT B;  1LP1 A;  2LXB A;  4GOD A;  3RGU A;  1FC2 C;  2KZI A;  1EC5 A;  3MHV A;  2JWD A;  4MN4 C;  1LT1 A;  2KI7 B;  4CPG A;  1OVR A;  1U7J A;  2B88 A;  1JM0 A;  2B89 A;  2KIK A;  2OTK E;  2B87 A;  1NVO A;  4GOF A;  1OVU A;  5DJU B;  2KZJ A;  3FXE A;  2WMM A;  1ZW0 A;  4WWI A;  2HR3 A;  2SPZ A;  2RKL A;  2M0B A;  1EDK A;  4K3A A;  4EYY Q;  1BDD A;  4ZMD A;  3QWO C;  5EFW B;  2QRX A;  2QVA A;  1MFT A;  1X0T A;  2ZAE B;  2R44 A;  4HB1 A; 
#chains in the Genus database with same CATH topology
 4WB4 A;  4JBZ A;  3PH0 A;  2OQQ A;  3EQ2 A;  3HE5 A;  4YPC A;  1VQO P;  1QVG O;  4C46 A;  2IDB A;  3MZW B;  5APV A;  4PD4 I;  2KXP B;  1JY2 N;  3CD6 P;  3HD7 D;  2OYI A;  3ITK A;  3VMX A;  2RH0 A;  3HE4 B;  1U7M A;  4XFJ A;  1VQM P;  3L70 J;  4PJ0 H;  4GOE A;  2N1T C;  4W80 A;  1USE A;  2WSE H;  3KDP B;  2OTJ P;  1SQB E;  2O1K A;  1AA0 A;  3HTK B;  2ZYD A;  3RK3 E;  2FYN B;  5B66 E;  1SQQ E;  4H13 C;  2JEE A;  5CCH C;  2HOD A;  3NMD A;  1L0L K;  3V4Q A;  1JY2 P;  2OTK E;  2B87 A;  5AW4 B;  4GDO A;  1OVU A;  2NPS A;  4QMA A;  2FYU K;  2OYO A;  2N9Y B;  1AQT A;  2GUS A;  3M06 A;  4PD4 H;  1QGK B;  4Y99 C;  3Q1M A;  2C0W A;  3L71 J;  2FYZ A;  2GA1 A;  1NHL A;  1YJN P;  3EFG A;  2FFD C;  1DH3 A;  2H43 A;  2OYH C;  5E79 E;  1OWA A;  2XDJ A;  4C7R A;  5KTB A;  1K04 A;  1M7L A;  1YIJ P;  1YYC A;  5KLI C;  1PFI A;  3GW6 A;  1L0N K;  2IFM A;  3WUU A;  2E76 C;  3AE8 C;  1R5S A;  2XNX A;  2E74 C;  3KXD A;  1NTM D;  3HD7 A;  1FBM A;  1RHZ B;  2O3J A;  3CWB J;  4EIJ A;  2Z5I A;  2K3R A;  1KIL D;  1GK4 A;  1LGH B;  4A7P A;  4ZKP A;  2PGD A;  3B4S A;  1JY2 O;  2WSC J;  2MKV A;  3L75 G;  3CX5 H;  2R3S A;  1GW3 A;  2W8Z A;  2V7Q J;  1YHQ P;  2D2C D;  1M1J C;  2KI7 B;  3HRN A;  1VF5 C;  3CWB D;  1FZC A;  2ZVN B;  1N8R Q;  5KLV J;  1BGY D;  4DCK A;  4ZMD A;  4WY4 B;  2O01 H;  4PJ0 E;  1S4X A;  1Z56 A;  2QM7 A;  3B5N B;  4OWF A;  3T97 A;  4JYC A;  1JNM A;  1KYO E;  4RKU J;  1SQV K;  3U59 A;  2O01 N;  3RL0 B;  1KD1 Q;  3M9B A;  2BCC E;  1H0T B;  2M5A B;  2H88 C;  2ZT9 C;  1BE3 J;  3O6Q A;  1CI6 A;  5KLV D;  2WSE J;  4D6T G;  2H7H A;  2JP3 A;  3RK2 C;  1LWU A;  1OZH A;  2UWJ E;  3I56 P;  4DOJ A;  3WU2 H;  2C0X A;  3H1I J;  1JMM A;  2OYI C;  1OVV A;  4PD4 E;  1ZRT D;  1KB9 I;  4I6M C;  5H2F H;  1URQ B;  5C39 A;  2W6J H;  2G8Y A;  1A02 F;  2E75 D;  4EI2 A;  2AEJ A;  1VQ6 P;  1VQK P;  3V4W A;  3HUS C;  1RF1 A;  3L72 J;  1LJ2 A;  1LP1 A;  1BSN A;  1BE3 D;  1KIL A;  5APS A;  1EZV E;  3RGU A;  1TU3 F;  1S2E A;  4RO0 A;  5KKZ C;  5AVS B;  2N1T D;  1LTI C;  3D6Y A;  1OVR A;  3H1I D;  2IYO A;  5AW9 B;  3CPW O;  1VPC A;  3OW2 O;  4H13 D;  2Z4E A;  1NVO A;  5CCH D;  3TNU A;  1J1E B;  3L73 E;  5B5E E;  1SQX G;  2NPS C;  3CCS P;  3L72 D;  3OA7 A;  1OMI A;  3BCC J;  1HBW A;  1OIP A;  4PD4 D;  3L74 G;  1GD2 E;  5CJ4 A;  2YIU B;  4UB8 H;  3H1K G;  1BSH A;  3H1J J;  1NTK J;  2Q3E A;  2Y0C A;  1H89 A;  2HFE D;  3CX5 E;  1GDT A;  3E7K A;  3N7N A;  3R2P A;  4L75 A;  2ZFC A;  1H8A A;  3H1L G;  2FBW C;  1BDC A;  4L74 A;  3VYI A;  3BCC D;  1GK6 A;  3ZDM A;  1JTH A;  1VL2 A;  3W67 A;  2OAR A;  1SQP J;  3H1J D;  1NTK D;  2RMZ A;  2E74 D;  2WSF J;  1OFC X;  1PP9 E;  3IAO A;  4EDF A;  4OGQ B;  1N7S C;  4GKG A;  3QH9 A;  3SWK A;  3P8C D;  1NU1 E;  1N7L A;  5KJ7 A;  1QX8 A;  3OJA B;  1W5C E;  2GM4 A;  3H32 B;  5APY A;  2JWD A;  3WUT A;  1OW7 A;  3H1H J;  4WBA A;  1LTJ B;  3AEF C;  4KHX A;  1J1D C;  1MFZ A;  2N1T A;  1RQU A;  5KAF H;  2QG4 A;  1SQP D;  2W27 A;  3CCJ P;  1N2D C;  1YTZ T;  3AED C;  3LW5 J;  5M1B A;  5H2F E;  1VF5 D;  5AW6 B;  1HH0 A;  1RE4 A;  4ZKU A;  1VQ9 P;  3U1A A;  2PAJ A;  3H1H D;  1L0N G;  2YXR B;  5TJH A;  4U7J A;  2KOG A;  1SS1 A;  3S1K A;  2H8P D;  1GZL A;  1G2C A;  1X8Y A;  2FFD A;  1HVV A;  1SVF A;  3GMA A;  2OYH A;  2WTY A;  2LXC B;  1ZN5 A;  1FDI A;  4JF7 A;  1GL2 C;  2ZT9 D;  4TLF A;  1X22 A;  3RK3 C;  3RK2 D;  5B66 H;  3CCR P;  1CZQ A;  1WMK A;  2WPQ A;  1E5W A;  2FY8 A;  1EDJ A;  1LT9 A;  3L70 G;  1IK9 A;  1AQ5 A;  1AV1 A;  2QJY C;  1KQF B;  1EQ7 A;  5L8R J;  2E42 A;  1FOS E;  1DD4 A;  4MN4 C;  1VQ5 P;  2B88 A;  1XTC C;  1ZLL A;  2KSJ A;  1L0L E;  1X9V A;  2PFX A;  1KV4 A;  1PIX A;  1NTZ J;  2IX7 C;  3G3Z A;  2FYU E;  1VQ8 P;  1M1J A;  5CJ0 A;  2DW3 A;  1USD A;  1SFC B;  5BU8 B;  4B86 A;  2NPS D;  3L71 G;  2ZXX A;  3AEC C;  4GIF A;  1IC2 A;  1KB9 D;  1T3U A;  2KS1 B;  5CBO A;  1KYO I;  1NTZ D;  3PHL A;  4NPD A;  1JB0 J;  2G3A A;  2QEX P;  5KAF E;  1L0N E;  4YXW H;  4H0L C;  1VQN P;  3Q5S A;  2WT7 B;  1SQX K;  1PPJ E;  3C1L A;  3H25 A;  1Y47 A;  4IL6 X;  1LTT C;  2KLU A;  3BRV B;  3GF3 A;  5GTH H;  1XTG B;  3P8M C;  3WMM 0;  3CWB G;  5AVX B;  3SFE C;  3Q2Y A;  4HYT B;  1BCC D;  1N73 B;  2YKP A;  1K73 Q;  5AVY B;  2AEF A;  2JO1 A;  1FU1 A;  1LTG C;  3M91 A;  5AVW B;  2E75 C;  2NZ2 A;  1FC2 C;  3GF7 A;  1N7S D;  4I7Z C;  1RH5 B;  1ZME C;  5KJ7 C;  2YNY A;  1U7J A;  1S5L X;  3HUS A;  1E79 H;  1EZV I;  1T6A A;  4H44 B;  2LKM A;  4PV1 B;  3A0B E;  3BVH A;  1GU5 A;  3AE1 C;  1KYO H;  2XZR A;  2E43 A;  3AE9 C;  4K3A A;  3GHG C;  5KLV G;  1KN7 A;  4U3F E;  2PP6 A;  4N6J A;  1KTM A;  3H6P A;  1RE4 C;  4WY4 D;  3D71 A;  1OW8 A;  2Q9I A;  2L91 A;  4RJT A;  3CC7 P;  1VDF A;  1SQB J;  2O1J A;  2KUB A;  1SQV E;  1GW4 A;  1M1K Q;  1SQQ J;  4XA4 A;  2XV5 A;  4NPE A;  3B8E B;  3L71 E;  3KQG A;  1NTM J;  3CX5 I;  2Y0E A;  1DEE G;  1NAY A;  2A45 G;  3TGU E;  1IK7 A;  4KJM A;  2BEZ F;  3CC4 P;  2A06 E;  3L4F A;  3FXD A;  2HOD B;  1ZXG A;  1S3J A;  2R5B A;  3H1I G;  2IBZ E;  2B87 B;  2YXQ B;  3CCQ P;  1PZQ A;  1GL2 D;  1URQ D;  1SQB D;  1LTA C;  4JYB A;  3PLN A;  1FE6 A;  3RK3 D;  1SQQ D;  2WPV B;  3PRJ A;  3L72 G;  1LT9 C;  1MUU A;  1W2B O;  5B5E H;  2KZI A;  1EC5 A;  1T8Z A;  1KFN A;  2XND H;  1N7S A;  2AXT H;  4DJG A;  3AEB C;  3JSV C;  1Q86 Q;  1M8O B;  4GOF A;  3FXE A;  3PJS K;  1BGY J;  3S4R A;  1YJ9 P;  2SPZ A;  4IFM A;  5GTH E;  2IYP A;  1YJW P;  3V2Q A;  5APU A;  3BCC G;  2ZAE B;  4LC1 A;  1NJI Q;  3HD7 B;  1AFO A;  4N78 E;  3RL0 g;  1WRG A;  1KOR A;  4WY4 A;  2WPS A;  3H1J G;  1NTK G;  3CCV P;  3B5N A;  3VMZ A;  3F89 A;  1R5L A;  3K5B A;  4ASW A;  3G4S P;  3EWK A;  1H0T A;  1Q81 Q;  2QE7 H;  1T3J A;  3A0H H;  2PRR A;  4RES B;  4H0L D;  3U1C A;  1FZC B;  1SQP G;  1NTM K;  1LNQ A;  1GL2 A;  1URQ A;  3AE6 C;  2ZYG A;  4GOD A;  1AVO A;  2BCC J;  1FJP A;  3T97 B;  4LGD E;  1HGZ A;  1T2K C;  1FDM A;  3H1H G;  5AW1 B;  4UB6 H;  5KJ7 D;  2IZ1 A;  3TF5 A;  2Q3I A;  4C7N B;  1ZW0 A;  2FYN C;  3O6Q B;  1KYO D;  2QJP B;  4EYY Q;  1NKN A;  1LWU B;  4OVN F;  5EFW B;  3SSU A;  2QVA A;  3IR9 A;  1UIX A;  3SWY A;  2BCC D;  1EXI A;  5TIS H;  4HB1 A;  2JKV A;  1M90 Q;  1S1C X;  3P32 A;  4DT0 A;  3L75 E;  2QA4 P;  4ZNC A;  1RF1 B;  3E1I A;  1R8E A;  2M3E A;  2POH A;  2CPS A;  4JPZ B;  1G1I A;  1KIL B;  5GTI E;  2AXT E;  1PV3 A;  3CCL P;  2K37 A;  2JWA A;  2ZJS E;  1L4A B;  3CME P;  2AXC A;  3L73 J;  2RN0 A;  3MD0 A;  1JO5 A;  4JQ0 D;  5KLV K;  4ASV A;  2KNC A;  1P84 H;  5AVQ B;  3IFM A;  2D2C B;  3TNU B;  1EZV D;  1FOS F;  1FS0 E;  1RE3 A;  5AW0 B;  2R32 A;  2YO3 A;  2FKW B;  2WVR A;  3W68 A;  1Q82 Q;  3CXH H;  1YQ3 C;  3IN6 A;  3L73 D;  1HGV A;  4R4L A;  2HG5 D;  3H32 A;  3A7O A;  4D6T E;  3RBX A;  2KP8 A;  1L2P A;  2HPC A;  1Y8A A;  5DJU B;  1OXZ A;  2KZJ A;  1LTJ A;  3A0H E;  2IPP A;  3E1R A;  1PP9 J;  5CMZ A;  4BRY A;  2O01 J;  2CPB A;  2WQY C;  1JTH B;  4HH2 A;  2KYV A;  3CX5 D;  2C9L Y;  1NU1 J;  1FZB A;  1LTS C;  1IFP A;  3GHG A;  2QJK B;  4WY4 C;  3B5N C;  1IO4 A;  4O9B A;  4UB6 E;  1PL5 A;  3FX0 A;  3L36 A;  1RF0 C;  1FDO A;  3RL0 C;  3CI9 A;  1PP9 D;  1X79 B;  5APQ A;  1MZ9 A;  2I1J A;  3WUV A;  2P67 A;  2YKO A;  3KHU A;  1SQX E;  2N1T B;  1A02 J;  1NU1 D;  2Z5H A;  1S9K E;  1IFM A;  4K35 A;  3L74 E;  3VTP C;  4H13 B;  2IBZ I;  4DZO A;  3A0B H;  3H1K E;  5TIS E;  1NTK K;  4IL6 E;  1VQ7 P;  1URQ C;  4XE5 B;  3L37 A;  3LIE A;  3Q5P A;  1DEB A;  3CC2 P;  3JC2 2;  1JY3 N;  4Y99 B;  3H1L E;  2XU6 A;  1YQ4 C;  1G2C B;  4GT1 A;  1GTW A;  1T2K D;  3CL3 D;  3GG2 A;  3CMA P;  2OYH B;  1YBK A;  2P10 A;  5KAI H;  1EDK A;  1P84 E;  3G6E P;  1UII A;  1BDD A;  1SQP K;  1SQX D;  2W6B A;  5KLI B;  2K9J B;  1J1E C;  3EFF K;  5AVU B;  3L74 D;  5BU5 A;  2HLO A;  2E76 B;  3CXH E;  1NAF A;  1SQB G;  2BEQ D;  5AW5 B;  2E74 B;  1AVY A;  1JY3 P;  1SQQ G;  3D70 A;  1KZU B;  3M0D A;  2YIU C;  1L4A C;  4N3Y B;  3TDK A;  1YTZ I;  2KS1 A;  1L0L J;  1NTM G;  5CBN A;  1VQL P;  1NOH A;  2I1K A;  2FYU J;  1BCC J;  5AVT B;  1GMJ A;  1HUC A;  1RE3 C;  1M1J B;  1NWQ A;  2Q1K A;  2WPR A;  2AEM A;  1L0L D;  1VF5 B;  1ZOY C;  1QVF O;  2WSC H;  3MIW A;  4OGQ C;  1MKM A;  2VRS A;  4CPG A;  2M8R A;  2Y9Y A;  2FYU D;  2V7Q H;  5CCG C;  3HE4 A;  1IFJ A;  2CK3 H;  1VQP P;  2YMK A;  1BGY G;  3C9I A;  2Q5U A;  1LTJ C;  3MTU E;  3V2R A;  1IFN A;  1M56 D;  1QL1 A;  1CW5 A;  1JY3 O;  3HTK A;  2ZT9 B;  3L70 E;  2QJK C;  1FZG A;  3HE5 B;  4YTP C;  2ITA A;  1Q90 D;  2K1A A;  1VQ4 P;  1L0N D;  1K05 A;  3RK2 B;  1PPJ D;  3FWN A;  2OYI B;  3AEE C;  1EDL A;  3M9H A;  3JCU E;  2FXO A;  1IJD B;  2H89 C;  2P2U A;  2WIT A;  3B5N D;  2A45 H;  1NTZ K;  3HUS B;  5KAI E;  5AW3 B;  1IZN B;  4U3F J;  2KSE A;  2ZXE B;  3RL0 D;  1CSB A;  5KKZ B;  1PGP A;  1HJ0 A;  3G9R A;  2YMY A;  1FAV A;  1PGJ A;  1BE3 G;  1NTM E;  2Q7C A;  3V6I A;  4NPF X;  5DJT B;  1SQV J;  3L70 D;  2R3C A;  3MHV A;  1KIL E;  2BCC G;  1Q7Y Q;  2NPS B;  2BAS A;  2E5Y A;  1FZF A;  2XKM A;  3I55 P;  2OTL P;  2K9Y A;  4U3F D;  4WVZ A;  3TGU J;  1LTB C;  1KQG B;  3L35 A;  1YI2 P;  2WWW A;  4YXD C;  1KQS O;  1PGO A;  2J59 M;  3CWB E;  1SQV D;  1DD3 A;  5GTI H;  3PTZ A;  3AE4 C;  1FZA A;  3NFQ A;  3NXS A;  3L71 D;  1ZR4 A;  1BGY E;  1EZV G;  2N9B A;  3CCU P;  1SFC C;  3TGU D;  3NTN A;  2QM8 A;  1EDI A;  3FGA D;  2A06 D;  1NH4 A;  2IBZ D;  1J2J B;  1YIT P;  1JMB A;  3BAS A;  3M0D C;  2P58 A;  1HTL C;  4HJG H;  1L4A D;  1N7S B;  3L73 G;  2ZVO B;  1SLQ A;  1KQL A;  4EOT A;  5KLV E;  4LLH A;  1PGQ A;  3AE7 C;  4IFF A;  1RF0 A;  2WSF H;  1JEK A;  1ZRT E;  1J1D B;  1U57 A;  4IOI H;  2M5A A;  3AE3 C;  1SQB K;  1SQQ K;  3CLQ A;  1LT1 A;  1N73 C;  2IZ0 A;  1JM0 A;  1BE3 E;  4I1L A;  3TYY A;  5AW8 B;  2QSI A;  3PP5 A;  4OGQ D;  4AQR D;  2V4H A;  4Y28 J;  2WMM A;  3G71 P;  1HJB A;  2YO2 A;  5CCG D;  2RKL A;  2R5D A;  3H1I E;  4N78 D;  3LW5 H;  2K88 A;  4C7N A;  2WSS H;  3AE5 C;  4H44 C;  4PV1 C;  1PP9 G;  1D7M A;  1MFT A;  2Q6Q A;  1P84 I;  5AW2 B;  1AJY A;  1NU1 G;  2R44 A;  3L72 E;  3CCE P;  3C8V A;  1CI6 B;  4R4M A;  4KT0 J;  1GL2 B;  5K5G B;  4I2L C;  3SFD C;  1K9M Q;  1Q2N A;  3RK3 B;  3CXH I;  3VN0 A;  3GLM A;  3N4X A;  1JCD A;  2GUV A;  1QLE D;  3VP9 A;  4IL6 H;  3I5C A;  3BRT B;  2W83 C;  3KZI H;  1IFD A;  1Y9B A;  2I8D A;  2QJY B;  1L4A A;  2W90 A;  3BCC E;  1LP1 B;  3P7K A;  3VP8 A;  3AEG C;  5APW A;  2KLV A;  1N86 A;  1W2E A;  1H88 A;  3H1J E;  1NTK E;  3MUD A;  3L75 J;  2J5U A;  3FWL A;  5CHX A;  2M3B A;  2WZ7 A;  3V5B A;  3P8C E;  1S5L H;  4W7Y A;  2B89 A;  4AYC A;  1KB9 H;  3KPE A;  2E5T A;  3Q3D A;  3S9O A;  3Q5R A;  2FXM A;  3IF4 A;  5CCG A;  1SQP E;  2KB7 P;  3L75 D;  1GU4 A;  2JJL A;  2B9B A;  2KNC B;  3BAT A;  4IFD K;  4BWN A;  1RQV A;  1MV8 A;  1NO4 A;  4H0L B;  2E76 D;  1OW6 A;  1FZE A;  1NTZ G;  1HWT C;  3HD7 C;  1HF9 A;  3H1H E;  2OGU A;  3M9Q A;  2JDI H;  5APT A;  1QL2 A;  3RBZ A;  4D6T J;  1SFC D;  3A5T A;  1L0L G;  1S72 P;  4L76 A;  1G1J A;  2FYU G;  2HPC B;  3A3Y B;  2P1J A;  3ABV C;  2E75 B;  1BCC G;  1ZP0 C;  4I7Z B;  3VMY A;  5BVZ A;  3AE2 C;  2IFN A;  5AVR B;  2LR2 A;  3R4Y A;  1KC8 Q;  3USS A;  3V2N A;  3SWF A;  2FXP A;  3WU2 E;  4BRY B;  1EXJ A;  2YKQ A;  1SP4 A;  4D6T D;  1FZC C;  5CCH A;  1K8A Q;  5AVZ B;  3AEA C;  3KYQ A;  5AVV B;  3OAK A;  3GHG B;  1RY3 A;  3VOP A;  3O8Z A;  4WWI A;  1SQX J;  1PPJ G;  1WT6 A;  1QEX A;  2HR3 A;  1NKZ B;  3VMA A;  3B71 A;  2JR8 A;  2M0B A;  3KZI E;  1OX3 A;  2MJZ A;  3L74 J;  1X0T A;  4W7Z A;  3JCU H;  3H1K J;  4H44 D;  2FFD B;  4PV1 D;  2QJP C;  2K9J A;  1LWU C;  4OH8 B;  2W6A A;  2ZYA A;  3II6 A;  3TK1 A;  3D6Z A;  1S5L E;  3H1L J;  2QIW A;  2KK7 A;  1KB9 E;  4BXL A;  4UB8 E;  3A2A A;  1IFI A;  1S9K D;  2HYN A;  1RF1 C;  4HKZ H;  1SFC A;  1NGM B;  1NTZ E;  1DIP A;  1KIL C;  2Y9Z A;  1LT9 B;  3H1K D;  4U3F G;  3LID A;  2P7J A;  4L73 A;  2Y0D A;  1NU1 K;  3MP7 B;  3TSI A;  3UIA A;  5E79 H;  4M3L A;  1FJK A;  2LXB A;  2D2C C;  3H1L D;  3M0A A;  1KFM A;  1SQV G;  4AUW A;  4TT3 H;  2WT7 A;  3MUD C;  2C9N Y;  1BCC E;  3MGN A;  1ZV8 A;  2NRG A;  3F5H A;  1DX7 A;  1P84 D;  2KIK A;  1ZR2 A;  3TGU G;  5AW7 B;  3V2P A;  1NYH A;  2A06 G;  1JCC A;  2IBZ G;  4Z1M H;  1N73 A;  3CXH D;  2A45 I;  3QWO C;  2J58 A;  1JUN A;  2QRX A;  3CCM P;  2L5G B;  1JOC A;  1M57 D;  1L0N J;  1KMI Z;  5APX A; 
#chains in the Genus database with same CATH homology
 2KUB A;  2KS1 B;  1SS1 A;  4JBZ A;  3PH0 A;  3S1K A;  4ZNC A;  1H0T B;  1EDI A;  5K5G B;  5CBO A;  2M5A B;  1Q2N A;  1EDL A;  4NPE A;  3MZW B;  4NPD A;  2LXC B;  1JMB A;  1BDC A;  4ASW A;  4BXL A;  2P58 A;  1H0T A;  4HJG H;  3ZDM A;  1DEE G;  2UWJ E;  5CBN A;  4KJM A;  4HKZ H;  3FXD A;  1Y47 A;  1ZXG A;  1S3J A;  4ASV A;  1OVV A;  2B87 B;  2I8D A;  1U7M A;  5C39 A;  2K3R A;  1LP1 B;  4K35 A;  1EDJ A;  2LR2 A;  4GOE A;  4IOI H;  2Q1K A;  2M5A A;  4NPF X;  5DJT B;  1LP1 A;  2LXB A;  4GOD A;  3RGU A;  1FC2 C;  2KZI A;  1EC5 A;  3MHV A;  2JWD A;  4MN4 C;  1LT1 A;  2KI7 B;  4CPG A;  1OVR A;  1U7J A;  2B88 A;  1JM0 A;  2B89 A;  2KIK A;  2OTK E;  2B87 A;  1NVO A;  4GOF A;  1OVU A;  5DJU B;  2KZJ A;  3FXE A;  2WMM A;  1ZW0 A;  4WWI A;  2HR3 A;  2SPZ A;  2RKL A;  2M0B A;  1EDK A;  4K3A A;  4EYY Q;  1BDD A;  4ZMD A;  3QWO C;  5EFW B;  2QRX A;  2QVA A;  1MFT A;  1X0T A;  2ZAE B;  2R44 A;  4HB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...