2I8DA

Crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
GSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized conserved protein of COG5646 (ZP_00384875.1) from Lactobacillus casei ATCC 334 at 1.69 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Structural genomics/unknown function
molecule keywords Uncharacterized conserved protein of COG5646
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2i8dA01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2i8dA02
3MZWB 3ZDMA 1OVUA 4NPDA 3MHVA 2OTKE 1JM0A 2KUBA 2OC6A 1JMBA 2KZIA 2LXBA 1EDKA 1MFTA 4GOFA 5EFWB 1BDDA 4GODA 2Q1KA 4ZMDA 5DJTB 1U7MA 5CBNA 1ZXGA 2HR3A 1BDCA 3PH0A 2KS1B 2B87A 2R44A 3FXEA 4MN4C 3QWOC 2P58A 1NVOA 1DEEG 2SPZA 4ASWA 3RGUA 2LXCB 2B89A 1OVVA 2UWJE 4CPGA 2B87B 5K5GB 3FXDA 1LP1A 2KIKA 2M5AA 2WMMA 4ZNCA 1H0TB 1EDIA 4NPFX 4HB1A 4WWIA 4IOIH 5CBOA 1SS1A 4K35A 1H0TA 2LR2A 4HKZH 2QRXA 4HJGH 1LT1A 1ZW0A 2M0BA 5DJUB 1OVRA 2JWDA 2RKLA 3S1KA 1Y47A 4ASVA 1FC2C 2ZAEB 2KL4A 1EDLA 1S3JA 1EC5A 2B88A 2KZJA 4EYYQ 4K3AA 2K3RA 4BXLA 1U7JA 4NPEA 2KI7B 4KJMA 5C39A 1EDJA 1Q2NA 2QVAA 2M5AB 4JBZA 2I8DA 1LP1B 1X0TA 4GOEA
chains in the Genus database with same CATH superfamily
4HF0A 2WPQA 3BR6A 3RKQA 3QWLA 4NC7A 2LF8A 4BH9A 3HUGA 2ACJA 2HTJA 4BE1A 4W97A 4WY4D 2FFDA 1SFXA 2XGEA 2XAFA 2ELJA 4E70A 1QGKB 3VODA 3ECHA 2IDBA 3O3KA 1B9MA 4B48A 3IKTA 1L0NJ 2H8RA 3J7ZI 2J5PA 2RNGA 4L5JA 3D5SC 3J7YJ 4M71A 2Y9ZA 1PVEA 1SD6A 1JTHB 1G59A 3H1KD 3L70E 4M3LA 4WY4B 1QL2A 3AE1C 4HLXA 3AEBC 4I7ZC 1VQKI 2WQYC 4L9TA 4IFDK 1QVTA 1TZLA 2LDUA 4M73A 4BRYA 4IF4A 2DA2A 4MTEA 3U2RA 3V8KA 2Z1DA 2BW3B 4C3JJ 5IYDJ 2ZJSE 2FNPA 5KLVK 4U7DA 4BEHB 1IFMA 2D2WA 3BCAA 3L73E 1X4PA 3PSIA 3CXHD 3LIDA 3M06A 3AE7C 3CCMI 4P55A 4L9VA 2B87A 2JUGA 2PP6A 4MEXF 2HQNA 5GAHJ 3RCOA 3CCQI 1IO4A 2FKWB 3H1IJ 4BRYB 5KLVJ 4HNVA 3FX0A 5HOOA 1NYHA 3IC7A 1BJAA 1JKQC 2BASA 2GZWA 2EFOA 5H6QA 4I7HA 2DTRA 2X6WA 4PFPA 3CCSP 2XNXA 4I6ZA 3HPGA 4YFNF 3MIWA 2GQQA 2LSOA 4ZYHA 1VQ4I 3CC7I 5C4JJ 3N7NA 3L35A 3BZ6A 4UVBA 1S72P 3MEXA 2WB1N 2RREA 2CGPA 1HSTA 2QF7A 3O8HA 4HZFA 4XR6A 2KDZA 1SS1A 3LSKA 5LHGA 5D8KB 2KSJA 2WAEA 4HW0A 2OQRA 4AIHA 3FZVA 1W36D 2QJYB 3WU2E 1VPCA 1XN7A 1YYCA 2HYNA 2V1NA 1KD1Q 2E19A 2IRFG 1URQA 5EEGA 4AWXB 5FD6A 1FDMA 1T8IA 2Y0CA 1Y47A 1LTGC 1K83J 2M3AA 5FGMA 3FK6A 4PGHA 3REOA 2ZAEB 3L70J 5AW0B 1AKHA 3H1IG 3L71G 3QPSA 3SWFA 2VKVA 1BI2A 3OR2C 4XRFA 1RKTA 1MNMC 5CVVA 2DXIA 2QUFA 1BI1A 4UV9A 4L0YB 3ASNH 4DZPA 2KZJA 4GKGA 4EYYQ 2XGXA 1G3YA 2XF5A 3IH2A 4BYYA 2D45A 3BT9A 1N8RQ 2PN6A 2XUBA 4R8HA 5JR3A 4UB6C 1LTIC 3H92A 2ZXHA 1PP9D 2ESNA 2J58A 1MNEA 4S05A 2O01N 4GIFA 4D7MA 1AKHB 1PV3A 5AVSB 3QPHA 4C3IJ 2GUVA 2F5CA 2IBZD 2NOGA 2O01J 1SQVE 1JOCA 2CH0A 2XRLA 2J5OA 2A5WA 3H1IE 3TP3A 2DK5A 1I6HJ 3RTRA 1EA3A 1WJEA 2IPQX 1LP1B 1FZEA 1S5LE 2WSEH 2KT0A 3A3YB 3Q2YA 2VE9A 4V2GA 5D5WB 5AW5B 2MG4A 1BCCD 2VI6A 2DT5A 3E7KA 2DT6A 4N78E 5DCFA 1E3PA 2FA5A 2L5QA 2NOJB 3HHHA 5LEJA 3EQLF 1FZAA 2P5VA 2TDXA 5D8LB 2ZSIB 4GGGA 1LQ1A 1AQTA 3FMQA 1J59A 1SQBK 2K85A 4X0GA 5B66E 3M0DC 2P10A 3LSGA 1Z6RA 2VE8A 1K04A 3I59B 2CQNA 1W5CE 1PP7U 4ESJA 3GYHX 1YJ9I 3BG9A 1VNDA 2DTZA 3HXLA 4M9SA 2CRGA 4IPAA 1TWCJ 3HRMA 1SEUA 3H3ZA 5LHHA 3L75E 5J1RA 1T98A 3BWGA 4ZDLA 3B71A 5AVRB 1T2KA 1NTZG 3SJMA 1ORKA 2M0MA 1X1DA 2VJ4A 1HH0A 4JYKA 1IC8A 1KZUB 5GPAA 2Z3YA 4N78D 4PD4D 5J1YA 1KYOD 2E35A 2WY8Q 3IRQA 2V1DA 4G6QA 3KZIC 4H0LB 5EF6A 4IXAA 2ZYDA 4H44C 4JF7A 1EXIA 2V1XA 2B89A 1X22A 2EINH 2UWJE 1U8RA 3MD0A 2ZYAA 3FXDA 3CZ6A 1J1EC 3HSRA 5CYVA 3BC8A 1M1JA 2DA4A 2M5AA 4XKVA 3HIFA 5FRMA 4PGGA 4WY4A 1MBHA 2CU7A 2M5WA 4L5IA 1NTZE 1ZLLA 2K9JB 3PJSK 1ZMEC 4Q5SF 2G7HA 1H88A 3L75D 1SQVJ 4A7PA 1DGWY 4CYDA 4HDUA 3Q0WA 1AOYA 2QRXA 2NNNA 1Y1VJ 1GVJA 5L3BA 4B86A 1H88C 4CZCA 2IS4A 3LSMA 2IPPA 3HRTA 3WGIA 1TLHB 4R79A 2M0BA 2EWNA 5EZHA 4JOMA 1X1BA 5TGTA 4O5VA 2CUJA 2IT0A 4WXHA 1NHAA 1RNLA 1ZTRA 3TW6A 1ZR2A 3OSFA 1O3RA 3LSJA 1G2HA 2JO1A 3QPTA 3HD7A 1OJLA 3BR3A 5C3EJ 2W6JH 2VJ5A 3KHUA 1JE8A 3F8CA 1HJBA 2XHKA 2EZIA 1UMQA 1D1BA 1WI3A 5FLMJ 2NVQJ 1Q86Q 3HG9A 4XSZF 2LP0A 3M1EA 2EZLA 1N73C 5CPRB 1JT0A 3E6MA 3IL2A 3GHGA 3PUBA 3RYPA 4PSXA 3PO3J 3U21A 3T97B 1UB9A 2DYRH 2KXPB 1ZQ3P 2BGCA 3HOTA 1H89A 3C2HA 2BW3A 2EBIA 3RYRA 5F1JA 2C9NY 1BR1A 2V9PA 1CGPA 1MD0A 1VL2A 4PD4E 3T0YA 3HGGA 4OWFA 3L00A 1HBXG 1HOMA 5A2QZ 1OCTC 4JBZA 4LLHA 3GWZA 2RVCA 2XAHA 3SWYA 1BIBA 1W5SA 2D5VA 3A0HC 1NTKG 2WTEA 4V2FA 4P96A 4ZDPA 2HU9A 2KDOA 2KLUA 4M74A 2QJKC 3W2AA 1MDMA 3H1KE 4NBQA 3VOEA 2F5DA 5BS6A 3KYLA 4HH2A 3P8MC 3BR5A 3MCZA 2HZTA 4M9XA 3JAMK 2VQLA 4HQEA 4A3FJ 4BJ6C 1ZV8A 4HYTB 2N9YB 2KPMA 3DEEA 1BSNA 3DFGA 2X0LA 4JPZB 1B6AA 4GOFA 5FLXZ 1F5TA 4BKXA 3PQJA 1RE4C 2ZXEB 1MV8A 1GUUA 3E1IA 2D1VA 1NTKE 4PV1B 1Y8QB 2QQBA 2ISZA 2PMUA 3HHGA 2AXTE 2VQGA 2JA5J 1IFDA 2VONA 2WPRA 4RS8A 3RQIA 4NQWB 2K9NA 1GL2B 1T95A 3RL0B 1P7JA 4OAZA 2ZT9D 5F0CA 3VTPC 1J1EB 3CC4P 1BN5A 1NVOA 1ZARA 1AWCA 2HODB 1RY3A 3TO7A 3OIPA 1JCCA 2E76C 2P67A 2OQQA 4OMZA 3BG7A 1S2EA 1OR7A 5GP9A 4QPQA 3TO6A 2ZJ2A 2EFWA 1S4XA 2E75D 3GMEA 5DV5A 4LFUA 2M30A 5J40A 2PRRA 2L9RA 4RB2C 2ELHA 3VMAA 2HEOA 1NAFA 3RBXA 4U88A 1SQVD 5BVZA 5AW6B 2IA0A 3S8PA 2AXTH 1ZN2A 1RR7A 1YIJP 3LAJA 5FRNA 1H8AA 1H9GA 2OTLP 2CUEA 4BE0A 4AIDA 4BNCA 1SD4A 3ZQ7A 4U87A 4OAYA 4YG2F 2NXNB 4EIJA 3E6DA 2Y69H 2FYZA 3HB9A 2ZKZA 1PYVA 2FBHA 3MAJA 1F36A 1FBUA 4PSWA 1ZKGA 4KIFA 4H13D 2PGDA 4M6VA 4IZZA 3M91A 2DBBA 2IGMA 2E76D 4I02A 2KB7P 2NRGA 1K6YA 2UXXA 2JWDA 3HOZJ 5FKKA 2C0XA 2RKLA 1YBKA 1ZG5A 3EUKL 3ELKA 3F8FA 3L74E 4EATA 1FZFA 3RSNA 1IFIA 5IT3A 2V79A 5LHIA 3HOXJ 4A0XA 5AVTB 1FZCA 2E5TA 2NZ2A 1FAVA 3KQGA 3UKGA 1IXRC 4G12A 1XG1A 2JPBA 2OD5A 3QAHA 2L4AA 3LNQA 1VQ7P 3K4BA 4XE5B 2OYOA 4AYBN 4BJ5C 2P8TA 2MKVA 1VQ9P 5E20A 4WBAA 1V55H 3MVPA 3OYGA 3H1JD 3ZMVA 3O6QB 4HQMA 1JY3N 3VSLA 1OX3A 5H2FC 3L72E 2WTYA 3KP5A 2HG5D 1S5LH 2XV4S 3OAKA 1K05A 4D7NA 3NARA 2WSCJ 4EVIA 2F48A 2QJYC 2ZCWA 4UB8E 2NPSD 4GOEA 1X2NA 3SHFA 1SQXK 4I99C 4RAGA 4B8XA 1N7LA 3OS2A 3LQQA 4FT8A 4GCVA 2GAUA 2VODA 1N7SD 4D6TD 1IN6A 1SQXE 3P7KA 4QMAA 3S3NA 3G71P 3FXJA 2K9MA 3H3VK 2PFBA 4S04A 1BI0A 3F22A 1M1JB 2EA2A 2JA8J 4A3GJ 1JMBA 2H7HA 2M7AA 3LL7A 1VQLI 5CHXA 4DW6A 4FASD 1KZHA 1T0FA 2P0WA 3MUDC 2VRSA 1S1CX 1R4NB 2O01H 4PJMA 1BR2A 2KJBA 1A35A 4BBRJ 4OIPF 4Q47A 2P7VB 5CCGC 2A6TA 1NU1J 2X85A 4FISA 2W57A 3CCYA 4PJLA 4EJVA 3CC4I 1YI2P 2YPRA 2EB7A 2ZMEA 1SQXG 2A06D 2ME0A 4A5NA 3S14J 3VWBA 1RI7A 5AVUB 1ZLJA 2EPFA 4FQGA 4FCYA 1PPJE 1K9MQ 4AQRD 3PNVA 2R7UA 1Z3YA 3WTTC 2FYUG 1L3LA 1XSVA 5FKMA 3Q9SA 1NU1K 2AEFA 1HW1A 3FHZA 4HF2A 3HOVJ 5CMZA 3WU2H 3AG4H 3GTMJ 2ZVNB 1SAXA 1QLED 2QWWA 2EIJH 1KB9H 2FY8A 5TISH 2FYUD 3A0BE 5KJ7A 3BR2A 1S9KD 4YELA 1HDDC 5TJJA 2PI0A 1MIJA 4PD4I 1WKMA 3AEEC 1XGOA 2XGDA 2BZTA 1JJ6C 1EDIA 3TGUJ 3MTUE 2IP2A 1DEBA 2OYHA 4XLPF 4BDZA 4IRHA 2EZHA 5BQTA 3OYNA 2JR8A 4Y17A 1RE3C 1QRYA 2LR2A 3L72J 2O7OA 4RAYA 4MFEA 1I3QJ 5AIQA 1IC2A 3RK2C 1RF0A 1L0LJ 3S1NJ 1QNTA 3OYFA 4LMYA 4BHBA 2YMKA 1IDYA 1V5GA 1P7IA 3G2BA 2IS1A 2X6YA 4A6EA 5B1BH 2XF6A 2HQAA 3VP8A 1SQVK 4MFDA 5E1WA 2QENA 2B9SA 1IRZA 4Z6YA 1OWAA 1SQXJ 5H2FH 2K1AA 3F3XA 2BCCG 4EDFA 3BRTB 3AFHA 3GHGC 1YX5A 2W4SA 2R4GA 1QHHD 3K4MA 3KXDA 2VBWA 3IH3A 4A3IJ 1PPJG 1W5TA 3GTLJ 4AC0A 2CPSA 1APLC 2HDDA 1XMXA 2HLOA 4N4NB 3RL0g 3JRFA 1X79B 3K70D 3CMAI 2WWYA 3T97A 3TF5A 3I56P 1S29A 1NJIQ 2E36A 2LBFA 5IY5H 2YO3A 4RKUJ 1MBJA 3IR9A 1VQMI 4CGZA 4BQAA 3W6KB 2YU3A 3ZOBA 1LTTC 1T56A 5APSA 1S7OA 1VDFA 2CFXA 1YG2A 4L75A 1MW7A 2VBYA 4UB6H 1G3TA 2HOEA 5HNHA 3EPZA 1KA8A 1SFCD 2OBPA 2ECCA 3G71I 1L0LG 4ENMA 1LT9B 3KZYA 2IGOA 5KNLA 4XSXF 2LK2A 4RAFA 2DPUA 4KNYA 1MUUA 3FM5A 1MBEA 2WITA 2CW0F 1PUFA 2FUG2 3D70A 1P84I 3PSFA 4BHPA 3I54A 1JXSA 1M7LA 2DW3A 2N1TC 5CCHC 3FBIB 1FBMA 2QZ8A 3DEWA 5B1AH 1CI6A 4DBRA 2O03A 3KX2A 1E3OC 4HOBA 3WG9A 3ISPA 4IFMA 4IQJA 1D0YA 2R7DA 3N4XA 2BBYA 3JREA 4HNUA 3SZPA 3E6CC 3RKXA 3H1JE 3S1QJ 2W83C 4W80A 4YRVA 3M4OJ 2H43A 1MFZA 1NGMB 2CYYA 3CX5E 1G2CA 3MQ0A 3WMM0 4BUPA 4DYQA 4WWCA 2P7CB 1URQC 3H1HJ 4O9BA 4B1RA 5AVWB 3FBNB 3KP3A 3TO9A 3GTJJ 2EZKA 3JCUH 3M9HA 5HS9A 3DKXA 2LKXA 1H89C 3L37A 2ME6A 2DFIA 4IHWA 1VQ5P 3TOAA 2I1JA 3A2AA 1FC3A 2YR2A 1W4MA 2AS5F 2BHYA 2E2IJ 3BG5A 1B59A 2Q0OA 3FDYA 1BC8C 3KZIE 4P5OA 2X1DA 3BZCA 3C18A 4MEYF 2JPCA 2PQ8A 3KP2A 4ZH4F 5FJ8J 2M3BA 2BE5F 1DX7A 4ASNA 4L5EA 1R00A 1HW5A 1HF0A 4ZTFA 2E1NA 4LLGF 2XNDH 1ZGAA 2KYVA 3WODF 4B47A 5HLHA 3EWKA 1HVVA 1IRFA 1GU5A 3RL0C 3ZMSA 1SQQK 5KCMA 4RM2A 2P7JA 3HDDA 1ACIA 1VQMP 5EGOA 4ITVA 3GW6A 3IAOA 4PCQA 1RF1A 3K9TA 1ZRDA 1LP1A 1J5YA 5J4VA 1FDOA 4PJ0E 3GW2A 4Y33A 5DEQA 5L3GA 4U0YA 2R32A 3KEOA 1O3TA 3T8TA 2R3SA 5DUKA 3LSRA 4IX7A 5CJ4A 1POGA 1FOSE 1G1IA 1TWAJ 3USSA 4K35A 4YTPC 1H0TA 5M5XJ 1IZNB 1L4AB 4ZYAA 1BI3A 2Q1ZB 4HKZH 2JP3A 2W85A 1HW2A 3H1LJ 4R1HA 1P84D 4WF2A 4TV7A 1X1AA 3DBHB 3V8LA 3DV8A 1FWZA 5EEAA 1UJ8A 5L3CA 1BA5A 3DBLB 3HGYA 1E0EA 3T1BA 1V3FA 1NTME 1BE3J 1R5ID 4A3JJ 2MFZA 4I76A 5D6FA 3E0JB 3K4LA 3D5LA 3A02A 1GT0C 3E6BA 2BHZA 3I4NJ 1SQQD 1TU3F 4II3A 5FKOA 3AE5C 5LRRA 5GTHH 1HKSA 1EKEA 3Q0VA 3PO2J 2N9BA 1FTTA 2FD5A 3SFIA 5KAFE 1XSXA 2Y2ZA 5ED4A 2ELKA 2B88A 1Q82Q 2OF7A 3FX3A 3H1HE 1IFPA 2E76B 3PFIA 1QU3A 4UB6E 5B5EE 3CD6P 2M4KA 1L4AC 3FKJA 4C46A 1XPXA 2VUMJ 1N7SA 4XLNF 5KK1A 1W7PD 2VPRA 1FYLA 3GLXA 4FHTA 2Y75A 1H8AC 3DTEA 1KQLA 1NKNA 4JX5A 4ENJA 3U1AA 5AVZB 2ZFWA 4HBLA 1NWQA 3R0AA 2OPTA 4LK0F 2M5AB 2JA6J 1IGNA 2LH9A 3GLLA 1IW7F 3DKWA 4HX7A 4BAYA 2A69F 4ESBA 1X9VA 3JRDA 3VMXA 3TKYA 4FX0A 2A5YB 2CQQA 2WBMA 4KUMA 1P4AA 4FETA 3K4JA 5ERIA 3OJAB 3PRJA 3RZOJ 1M8OB 1NTMG 2K9SA 4ZTJA 3OW2O 2IAIA 1G8XA 1WWXA 3KP4A 4C9YA 1NG6A 1WCMJ 3C7JA 3NXSA 3ZMUA 4RGSA 2FBKA 2MW8A 3CP8A 2K9LA 3ZR8X 1ON2A 1DP3A 2DJIA 2W27A 2YX7A 1URQD 3L2UA 3K70C 4GODA 1ON1A 3BLYA 2UWMA 3X2QH 1PP9E 5DJTB 2OYHB 4ENNA 1BGYE 2L7ZA 3RK3D 1QVUA 2YIUC 5FB2A 5APVA 2M2EA 2FMLA 3CCQP 3M3YJ 4PV1D 2OV7A 1TWFJ 3H1KG 2P4WA 2XROA 1BC7C 4H13C 5FROA 3K5BA 3ZPLA 3PJRA 1BE3E 1FZBA 1GLNA 3Q9VA 3LAPA 1IN4A 1VQOI 2HPCA 1AA0A 2WZ7A 5F0HA 1JNMA 1BM9A 3IH4A 1KC8Q 2EFPA 4DT0A 2VBZA 3TP0A 5KJ7D 3CUQC 2EQRA 1DU0A 4CCMA 1S7AA 2NAZA 5AVVB 2HPMA 3M9BA 1E2XA 4ASWA 3EFGA 3G1OA 3V2RA 3WHBA 3VYIA 2JJ7A 4RJTA 3QYBA 4E7SA 1VQ8I 2VQHA 4CSWA 4RAZA 4A69C 1DP7P 4I1LA 5K5GB 2HPCB 3CCUI 1C0WA 4W7YA 2BVMA 4NNJA 4IRIA 5HDKA 1T38A 3F23A 2VC1A 3VYTB 1O57A 1V4RA 5K5RA 1ODDA 3KLNA 1M1EB 3MP7B 3FXRA 3CF5F 3O2PE 4L76A 2HNHA 5J6XA 1VQ6I 3F5HA 2HYFA 3GX4X 3MMYB 3CWBJ 1LTJC 2YKPA 3WTWC 3IN6A 3BQYA 3GBGA 4GRIA 4HAMA 3K69A 2STTA 2V4HA 3CWBD 3LW5H 5CJ0A 1O7LA 4U0WA 2KHMA 1FE6A 2K9YA 3OYHA 5HVQC 1BE3G 2D2CB 3L4FA 4WK8F 4QPOA 4G8XA 3S1KA 3I56I 3I59A 3CJNA 1EF4A 4HYEA 1VQPP 2ID3A 1YLFA 3CLOA 2KP6A 4UB8H 1OPCA 5JHUA 3RZDJ 1NU1D 2WWWA 3L71J 4WXCA 1IO2A 3T8RA 1SMYF 3QH9A 3HBLA 3WUVA 2JTVA 3RJPA 4BACA 1BGYJ 4YFXF 5M5WJ 5FLXK 2OA4A 1HCRA 2N1TB 1NK2P 2Q3IA 1SQBE 4GFBA 2R7ZJ 3GFJA 3ZQLA 5ICEA 1G3WA 4F55A 2Z16A 3KP6A 3I5UA 2UV1A 5C39A 5KLVD 2L9VA 4HNTA 1T39A 3MZYA 5GTIH 1LKXA 3W2VA 4ENKA 2ZT9B 4Y52J 1ITYA 1J1DB 2YO2A 1NOHA 1YHQI 3H1LG 2L4MA 4BS9A 3K7AJ 4E7IA 1SQPG 5E1ZB 3O8GA 1YS6A 3M8FA 2E74C 1X0TA 4YXDC 1N73A 2MD5A 4A3MJ 1WZ2A 2R7XA 3AE3C 3A1YA 3J81K 1UG2A 1FJKA 1JY2P 3MZWB 2DMTA 4PD4H 3QOPA 1JB0J 5CCGA 4EJWA 5TRDA 3CTAA 3GTOJ 4UY8I 2W8ZA 2FFDC 5ICFA 2K02A 2PAJA 2HVRA 3GTQJ 1KB9I 1EH8A 1RQUA 4XRSG 2R7FA 1SQXD 1YTZI 3CCVI 3D0SA 1VI0A 1R5LA 2Y31A 4RMNA 4UUVA 1P2FA 4LOCA 1YS7A 3WTZA 3OYCA 1CZQA 2Y0DA 2BCCD 4C7RA 3H6PA 1ZRCA 1N7SB 1GXQA 3NFQA 1X3UA 4H4KC 1QX8A 3C9IA 1SFUA 2A05A 3QP6A 1SQPK 3BG3A 1E5WA 2QEXP 1AA7A 3FK7A 4BJTA 2HR3A 3DCFA 1FPQA 1WPKA 1FZPB 1WJ5A 4AUXA 1YO5C 4PJ0H 1Q7YQ 1ZN5A 2R44A 4CXFA 3H32A 1FJPA 2FX0A 2BYVE 1YHQP 2CMPA 3VEPA 4A5MA 1LFUP 1U8BA 3S9OA 4HSRA 1RF1C 3LWFA 1HLVA 1DD4A 3R4YA 2XKPA 1SQPE 1FYMA 2R3CA 4BXXJ 3DPLC 3ZMTA 2F4MB 2LXCB 3R2PA 3KZIH 5EGOB 4CPGA 4OU0A 1VQ5I 2JKVA 4QTRA 3WTVC 4BY1J 1K6OA 3RK3E 4GYIA 5J4YA 3GZ6A 5L8RJ 1LTJB 4Y7NJ 3BASA 1CF7B 5EEHA 3L75J 2LKSA 3JTHA 1ZH5A 3LW5J 2AXCA 2X4HA 3AE4C 2JRTA 4A2UA 3C8VA 1H0TB 2CUZA 2XAGA 1OKRA 1NTMD 5HLIA 3KPEA 2OJED 2D2CD 4IOIH 3RQ4A 2H1LA 2DDAA 4HV5A 4J19A 1FBSA 4Y28J 2YXRB 2LF7A 3CCEI 2WAQN 3S1MJ 2RC4A 5KAIC 1G6NA 1D7MA 1WGXA 3H35A 4GDFA 2CSOA 4RLFA 3OA7A 2RH0A 2DOFA 3WTYC 3H1KJ 3F8NA 5HDGA 1IZ1A 2FQ4A 5DJUB 3NTNA 3G3ZA 2Q2EB 4JP0A 4RB0A 5K7FA 1EJ9A 3CMYA 5KLIB 4WVZA 3MZ8A 3HD7D 1LFBA 3EYIA 1JUPA 4ASVA 4EV0A 5LGNA 3QYEA 4G7OF 1FC2C 2O1KA 5BOXA 4Y99B 1U2WA 4G94A 3SZTA 3S2DJ 1LVKA 1RZ4A 2DMQA 3M9AA 3ERMA 1LVAA 1WHUA 1HF9A 3K4NA 1S3JA 5HODA 3DTIA 1R71A 3OL3A 3E5XA 1PUEE 3C1DA 5GTIE 3JAMZ 4NPEA 2O0YA 1X4OA 4KITB 4EM1A 4KJZA 1ZK8A 2GA1A 2WT7B 1JJ8C 4JYCA 1K8AQ 2HODA 1K4TA 1AFOA 1GK6A 4RBOA 2V1UA 2ETHA 2P1JA 3U1DA 1GMJA 2DO7A 4II2A 4RESB 3R4KA 2L2OA 2A6EF 1IG7A 4HG2A 3V2NA 1I3AA 3KEQA 4LK1F 1JEKA 3V6IA 1SFCA 2DAOA 2A06E 1A02F 3IKVA 4OGQD 4DZJA 1GL2D 4P1WA 3HOUJ 2O1JA 5IP9J 4OGQB 4BL0B 4I2OA 4C30A 2H8WA 2XSJC 1LFPA 1AV1A 1Y6IA 1OVUA 4DJGA 2R5ZA 2G8YA 1PGOA 3ZCOA 1NKZB 2JDIH 1Z05A 2QCOA 3MHVA 2EH3A 5HLTA 1YQ3C 1QEXA 1MH3A 1LB2A 3P8CE 4E7ZA 2H27A 2BCCE 2GIVA 2MJZA 2OTKE 1X1PA 3K4CA 3R6SA 5GPCA 1IRGA 2KS1A 4KYWA 2XASA 5K1YA 1B1BA 5HS8A 3I55I 1Z6TA 3OOPA 2ISYA 2MD0A 2DA1A 4D9JA 2ZNYA 1HSJA 4B43A 2QGUA 3ECOA 3TEDA 1LEBA 2E42A 4M3FA 5L3FA 2XB0X 3BCBA 4ZZLA 3I55P 2M87A 3PTZA 2DFEA 2EJRA 1UIXA 3O6BB 1R7JA 4DOZA 2FXMA 2O3JA 3GG2A 2KS1B 1GU4A 1EZVG 4AVZA 3NAUA 1FZCC 1BR4A 3JCUC 5H20A 1XB4A 1K79A 5E3NA 1GK4A 3L74J 2Q6QA 2LBFB 1EZVD 4EJOA 4IHVA 2K37A 2KOGA 4TLFA 1ETKA 2EV0A 1KTMA 1P6RA 1RH5B 3LA3A 3LA2A 1OCOH 1DGRM 4CDGA 1MSFC 2XB5A 1R49A 3BTCA 1HTLC 5JI6A 4H13B 3FXOA 4KHXA 2X6OA 2JA7J 3VOPA 1O3SA 1W0TA 2NVUB 1WJDA 3ZQGA 5E79E 3E5UA 3HE4B 2Q5UA 4A3DJ 4ZZDA 2Y9YA 2OQGA 3I0TA 2N1TA 3B5ND 3J81Z 3CUQB 1F43A 5CCHA 1ZYRF 2Z9OA 4PJJA 3DLAA 3HC7A 3L9FA 3AECC 4XQFA 4MO7A 4XKCA 1OCZH 2R5ZB 4I0BA 5JVGF 3CC7P 3OIOA 3ABLH 1IN7A 2R7WA 2IYOA 1ULYA 3GXOA 1FZGA 2YXQB 3HE5B 3F8MA 1FT9A 1VZ0A 3HSEA 3HUGB 3FWLA 4RM3A 2ZJRF 2OTJI 1JGGA 4G6DA 2W84A 2K3PA 3W3CA 4EM0B 2QLZA 3OV8A 1SFOJ 2CO5A 4DZOA 2TRTA 4NHJA 1JTHA 3SSUA 1YITP 3TSIA 2OZ6A 1EZVE 4A6DA 2XAQA 4IQ4A 3L2RA 1PL5A 2K27A 2BCCJ 1R58A 2YS9A 2EFNA 3BVHA 2LRDA 3I9V2 3GTGJ 3CQZJ 4DYRA 4ZYGA 3ESWB 2F6CA 3W68A 2R0QC 5LBQA 2DCEA 5EG0A 3WTUC 4AYBA 2DQRA 4P9UA 2I10A 3JRGA 5H6RA 3GVAA 1I50J 2FXAA 3AG3H 4RGUA 2WB1A 2XDJA 4DJAA 2XV5A 2YKQA 1VQKP 3CCEP 2R7RA 3DP7A 3CF2A 2WADA 3JSOA 3L75G 5AONA 3K1NA 2ZB9A 2ZBKA 2H89C 3L2VA 3RBZA 3BJOA 3G4SI 3WU0A 1I1SA 1IJDB 2JVGA 3GEZA 2AO9A 3PM1A 2O8KA 2XAUA 5K7HA 3FIWA 3CXHE 1BSHA 4Y3OA 1EDJA 1T3UA 1LT9C 1STZA 3K1PA 3G4SP 1S9HA 1LGHB 2OTJP 3VDXA 3CUQA 3KLOA 2DK8A 2LY2A 1BOBA 2GXGA 3ZRGA 1U5TA 3B5NC 1SFEA 1OYYA 3HM5A 3JW4A 1FOYA 2NVYJ 2GOXB 3CP2A 2PJPA 3OL4A 1TT0A 3AEFC 1R1VA 1A36A 3CCVP 3CDIA 2WAQA 2QA4I 2BEQD 3CCJP 3R0JA 1Q1HA 1T08B 2LY9A 3H9QA 1OYWA 2GOMA 1XTAA 2DLLA 2KUBA 3NRVA 3V8JA 1XD7A 2STWA 1KFNA 3RKYA 2LYCA 1TP4A 3MWMA 3T5XA 2GBYA 1W0UA 1LEAA 1I5ZA 5DDGA 2O9LA 3H25A 2UZKA 2M7BA 3H1HG 1DU6A 1RE4A 1AVYA 1AQ5A 3IRRA 2KJCA 2HQRA 4KMUX 4IHTA 1BGYD 4KT5C 3QRFF 1ZP0C 3RDIA 3PH0A 1BDCA 2Z5HA 3D71A 1MMSA 3I4PA 2QKLB 1IUFA 2IXSA 4PJNA 1WJFA 4WX9A 1B4AA 4J00A 2RKHA 4EGYA 1LWUB 3H5NA 1NTZJ 1KQFB 3A03A 3H5RA 1PPJD 2KRFA 3MKZA 3F9KA 2R7SA 3WGHA 3OYLA 3P8CD 2POHA 2R7TA 2WSEJ 3OYDA 4F93B 4V19K 3MKYB 2VOOA 1BCCG 3CXHI 5GAGJ 2PG4A 5FD5A 1UELB 1IAWA 1JMMA 1Z56A 1ZGJA 4C3HJ 3LOCA 2FYUJ 2VC0A 2P2UA 1X58A 3E1SA 3UIAA 4HLYA 1OW8A 4OIRF 1GVDA 3L09A 4KIBA 4E4HA 3L2CA 1N75A 5FKNA 1BGYG 2HVSA 1LTJA 4LGWA 1FOXA 1N25A 2B87B 3VP9A 2KZVA 3RI4A 1OYIA 4F7ZA 4KN4X 3ZQHA 3JCUE 3GF2A 2KIQA 2QM3A 1N78A 2K88A 2P6SA 1Z91A 1YRNB 2DA3A 1PGJA 4WWIA 5HNFA 3S2HJ 2FFDB 2E5YA 1TNTA 3SXYA 4E7JA 3WG7H 1KILE 5E3MA 3J7AO 3SDGA 3V4GA 2HFHA 4D6TJ 3CJRB 1SVOA 4AIKA 4I01A 1LT1A 1JY3O 4LGDE 1PFIA 4EJUA 1SQBG 1YJ9P 2ZXWH 4MHGA 1W2BO 1WSUA 4CH7A 3JTGA 2V7QH 2G7UA 2K5CA 5D5VB 2DDBA 1VFCA 3DWLE 1XTGB 3BOQA 3SEZA 2DW4A 5C44J 1Z3XA 3HZJA 5CQGA 1ZGWA 3QU3A 1ZOYC 2RMZA 1Y0UA 2VBXA 4XM3A 3JSPA 2BXZA 1BCCE 1LWUA 5F0FA 1PIXA 1EDLA 3OYIA 1TC3C 4KN7X 1BBYA 1NTMK 3K6GA 1XDUA 4C7NA 1IN5A 4BY7J 1UHMA 2VXDA 1XCBA 3EUAA 4XMYA 5E8IA 2YNYA 2MBFA 2KFDA 5E3LA 4YIRX 1VQ8P 5M3FJ 1NU1G 4XIDA 3V4WA 1B9NA 2CS3A 2W48A 1VF5B 1FJLA 1KYWA 5F64A 2IBZI 2HTSA 3CMEP 4BQQA 1VTNC 2BEZF 2DMPA 4BXUA 2IBZG 1VQNP 3TBIA 2FYNB 1JY2O 3CX5I 2KKOA 2OARA 3CWBG 3I4MJ 3RPUD 2GM4A 2QA4P 1MNDA 2KLOA 1J9IA 1NAYA 4LB5A 2M45A 1IN8A 4A3KJ 2IZ0A 4RO0A 1MMNA 1ZAOA 2DYSH 2VT2A 1XX5A 5J3LA 4LITA 4DQ2A 5KHDA 1GXPA 3AG2H 2B9BA 3CI9A 1KQ8A 4AUWA 3K2AA 4MIMA 4YFKF 3L72D 1TL8A 2ZNZA 1UCRA 2ZSHB 1I39A 2VJIA 4ON0A 2WSCH 4DNCA 2L02A 3FKIJ 4UUSB 1FMVA 5E8GA 3TYYA 4YEJA 3TMOA 1RETA 1PZQA 3PFYA 1HBWA 2XSDC 4AIJA 1O7FA 2PJRB 3H1LE 3FGAD 2YSRA 2HQ5A 2BOLA 5KAIE 3ZP5A 2JRMA 2HOSA 1U7MA 3P7NA 1D5YA 3QP5A 2CK3H 2IFMA 1A04A 5IPAA 3DF8A 5CJ9A 2DODA 2QBYB 5DTDA 2BY3A 3DQVC 5TISE 2AXLA 2PBIA 5J47A 2VOPA 4J01A 1IDZA 1K61A 4MN4C 1HA8A 1XGMA 4M9ZA 4O3MA 1J2JB 2A45I 2K86A 1FU1A 3TNUB 3RK3C 4IL6X 1L0OC 1U5TB 3R61A 5F1RA 3VB2A 3H1JJ 1SFCC 1VQ4P 4DYCA 4XOPA 5CLSA 4EGZA 4NC8A 3CCSI 1R36A 1TW2A 3CC2I 1KILA 1J2XA 3CLQA 4HX8A 3SQNA 2DA7A 1JCDA 2VB6A 2M0CA 1NHLA 5KJ7C 1L4AD 3R60A 1EH7A 4PK4A 4LLLA 1PDNC 3B73A 5CVUA 4EEFG 2PX9A 1Z21A 3E1RA 1ZHFA 3GCMA 3CUOA 4NPFX 5GAEJ 4U3FE 2NS7A 1MJBA 4W1UA 2Y0SA 2L9NA 3SEQA 1GTWA 3NQOA 3HPHA 4JX4A 3L72G 3LFUA 4HRIA 5APYA 4WY4C 2EV6A 2DFHA 1VF5C 4EM2A 5TJHA 3W6JB 1LNQA 3S2WA 1IK7A 4D6TG 3BDDA 1MGTA 1ETWA 4XK4A 2Q9IA 1DPUA 5DUIA 2FYNC 3CMAP 1U5TC 5DCMA 4JYBA 3BJAA 2RGVA 4XNFA 3L70D 1KYOH 4NUBA 1L0ND 2KP8A 1R23A 3SFZA 1SQQE 1P9QC 1YJWP 4MQVA 2VQCA 3IV5A 2DT7B 5HDNA 3BROA 4I98B 4U3FG 5CVRA 3COAC 5APQA 4D5CA 1QHGA 3TQNA 2QYOA 1TNSA 1KFMA 1OXZA 2PMHA 5E1XA 1QQIA 4IL6C 1USDA 3BQZA 3BTIA 4DCKA 2E75B 2K3RA 3V5BA 3D6YA 1TWHJ 2JMWA 2MSYA 3MFKA 4KT0J 5EJCA 3CL3D 1X1CA 3ASOH 3SWKA 4LG0A 2G0EA 2WSFJ 3LSHA 3E7LA 1HJ0A 1UG0A 1WVRA 2HXIA 1HC8A 3S17J 1SQQG 2V7QJ 2J5UA 3PL8A 2BY1A 1FEXA 4M3DA 2XAJA 3A01A 5DM6F 3H36A 3HSFA 1FBQA 5BPIA 5IYCJ 2X48A 2I8DA 3ONQA 4CA0A 3P9CA 3Q3SA 2W6BA 1KQSO 1I1GA 1U57A 2OCEA 4IL6E 2QQ8A 5D4SA 2MC4A 3LFKA 3DPTA 3D5RC 4PZJA 4OOIA 3PIOF 2DOAA 3B02A 2JZYA 1NH3A 4XRMA 3FXMA 4LB6B 4PUSA 3S32A 3KIOA 3S3MA 4XLAA 3J80Z 1YQ4C 5ILVA 3EDPA 1KU9A 1P92A 2K9QA 2XPWA 4PDKA 1MH4A 5AW1B 1JT6A 3H1LD 3CO6C 2AQEA 4BDYA 1ZRTD 2E74D 3AEGC 3V7CA 4AVPA 1XS9A 1E17A 2LXBA 2XKMA 2ZVOB 3GF7A 3OMYA 1DPRA 2EIKH 3EUHC 3RK2B 4Q48A 2W82A 4BXFA 1ONVA 4LC1A 2DPDA 1Z0XA 3A5TA 3S16J 1MZBA 4XN0A 2LFBA 1ZXGA 1VQ9I 3VYUB 3IUOA 2X9DA 1VQOP 1S72I 5KKZC 3M9QA 2M8RA 3F89A 2R93J 4G6TB 3H0GJ 2A68F 1V5EA 3DBRB 4F92B 2P81A 3CJTB 5A2QK 1HGZA 3U1CA 4KT6A 1IFJA 3BCCE 2FXOA 2WA0A 2K4JA 3KFWX 4NB5A 5LFAA 2A45G 1GL2C 2FXPA 4S0HB 3L71E 4ZKUA 2NYXA 3FWEA 2QSHX 1L0LE 1JO5A 4XLEA 4KFCA 3L2QA 4MNUA 2OUMA 2WAFA 2DOEA 3RIRA 4H44D 3WUUA 4GO1A 1R5SA 3WE2A 1LTSC 2LY1A 2FOKA 1X8YA 2E5NA 2KIKA 2Z2SB 1WH5A 2ZXXA 2OGUA 4CICA 5APTA 4MTDA 3MGNA 3HE4A 4C7NB 1EH6A 2ZJPF 1EZVI 3TDKA 2M34A 1KB9E 2AXTC 2K4BA 4HPQA 4L9JA 4OWRB 4AU7A 5M5YJ 1Q90D 1VF5D 1KU2A 3HOYJ 2XVCA 4BGDA 5KKZB 2YU9J 1A31A 2QSIA 4OMYA 5F6FA 1BW6A 1FZCB 2IA1A 4E7LA 2F4IA 2A45H 4ANJA 2QM8A 3CESA 3H1HD 3CX5D 2OZUA 2CW7A 1L0LD 3TNUA 2HZDA 3MD2A 2DMUA 1FOKA 1LTAC 1JTYA 2YIUB 1UAAA 2XGCA 2MH2A 5BMZA 2PLYA 3AE8C 2H6BA 2L7FP 1K73Q 4CYCB 2CQKA 3JSVC 1SP4A 1ETQA 2MABA 5DD8A 3CDLA 5BU8B 1R8EA 2VLAA 1Z9CA 5LRSA 5KLVG 3CCRP 5D5UB 1FTZA 2M4GA 1YOVB 2V9VA 1U9NA 2B0LA 3BJ6A 3S93A 2X1EA 4K3AA 3CCRI 3S15J 1LJ9A 2ZMEB 1TQMA 2E34A 5E3OA 1KN7A 1Z67A 3H1ID 5KAFH 2Y0SN 1N73B 4Q4ZF 4Z1MH 1Z77A 1K78A 2I5UA 1GW3A 1YX3A 1T3JA 3WTSC 1JTXA 3PQKA 3WE3A 2E2HJ 1YJNP 4ZYDA 1ZR4A 1KORA 2COBA 2ZO4A 5E18F 1Q2NA 3BCCJ 4JQFA 1VF9A 1P4XA 1WJAA 1OISA 3ZMDA 5B5EC 3C3WA 1QVFO 1X3WB 1P4WA 1SQPJ 2QE7H 3H9GA 2JK3A 2KISA 4IRGA 3LSTA 1QL1A 2E7WA 4A93J 1CF7A 1XC5A 3I3LA 3DPUA 4F91B 3N05A 1FSEA 3IWFA 1SLQA 1OZHA 5APUA 3L73J 1EXJA 3A0HH 3IP4B 1F1ZA 2JQ7A 1TWGJ 1SVFA 4EJTA 2NVTJ 3ULQB 2M1BA 2KIMA 2VASA 1IUYA 2ZMEC 2D2CC 1IRXA 3BP8A 1JKPC 4XICA 2WVRA 3U59A 1EDKA 2HPIA 1MFTA 2CQ7A 3TDUC 3TGNA 5EFWB 5KLVE 2JWTA 4XKBA 1VQLP 4IO9F 3AE6C 2HOTA 1KQ9A 1D0XA 1OQYA 1SVMA 2LREA 5APWA 1Y8AA 4MLOA 2O6GE 4LIUA 2O5RA 4YXWH 1QPMA 1KU7A 4JBAA 1BIAA 5BPDA 4Y15A 3G6EP 2FU4A 1L2PA 2GWRA 2E1OA 3II6A 4TT3H 3ZQIA 4AM3A 2W00A 2E1CA 3HTKB 5ILSA 2P58A 3LQRA 1LPQA 2XDVA 3OS0A 3WU1B 2NNYA 9ANTA 4BBSJ 4N3YB 3I71A 1V54H 4UVCA 2HI3A 2MLKA 1H0MA 1FOSF 5F27A 2SPZA 1WRGA 2JEEA 2WT7A 2X51A 1SFKA 3V2PA 4XLHA 2YUSA 5TISC 4BEHA 3FMSA 2HDWA 3ABKH 3M7GA 3OR1C 5JLXA 3VYRB 2LR8A 3BPVA 3I58A 2E1MC 3D1NI 5D4RA 5JLWA 3HTKA 4N4OB 1B8IA 1L0LK 2O3FA 1KYOI 1LDJA 4M6XA 4XLFA 3JRBA 5EYRA 2AEMA 4DGWB 4HB1A 4BU2A 1H9TA 3IHUA 1GHCA 2NPSA 1F9NA 5KVRA 2XKOA 3LMMA 2WY7Q 2DJNA 2KNCB 1R5GA 1B72A 2D1HA 3CXHH 1OMIA 1QZYA 4MQ9F 2IX7C 4HJGH 1CI6B 3Q5SA 4EQQA 5DM7F 2XF7A 1QO0D 1W5CC 3KYDB 3Q3DA 3JRAA 2M8EA 1M56D 3AEAC 2LC2A 3PNTA 2VN2A 2W6AA 1RESA 1FS0E 2KRCA 3ZN1A 1OVRA 3VFZA 1LJ2A 1E79H 3K2ZA 2L54A 4G7ZF 1QA6A 1UHSA 2PMZN 5IT9Z 2Y30A 4CCLA 5JVTA 4I2LC 4HEA2 4L9NA 2IBZE 3P9KA 2MC3A 3M07A 3OS1A 1KB9D 3GF3A 1MMGA 2H8PD 5AVXB 2LMDA 2E5ZA 5AW4B 3OOUA 1PP9G 2JUCA 1YTZT 1EC5A 2QEXI 2MA3A 2FJ1A 3GHGB 4P9FA 3EYYA 4Y13A 1RC9A 1S9KE 1QZZA 4HV6A 4JQ0D 3RK2D 3F0CA 3DEUA 1D1AA 1AU7A 3BCCD 1U78A 1W1WE 3QYFA 2FYUK 2B7EA 3BG6A 1G3SA 2IJLA 3G6EI 3PNYA 3PHLA 3M0AA 3KPHA 4HA8A 2L5GB 4I6MC 1OLTA 2XPUA 3RPQA 1NO4A 3B5NB 4U0VA 2Q3EA 3ZQCA 1U6GA 3OYJA 5ILUA 1GW4A 3JRHA 2QKMB 2IYPA 1ZG3A 2OU2A 4N9HA 3OSGA 1REPC 5CKTA 3QU6A 4RLQA 5ICGA 1OR7C 2M8GX 3GFMA 1YW7A 5CQEA 2GIZA 1PGPA 4EOTA 5IP6A 3AL0B 3ABTA 2F4OB 2HYGD 4A12A 2L0KA 1URQB 3HD7C 4B3AA 3CO7C 1LT9A 2E43A 1IXCA 2VPLA 1S5LX 2KZIA 1XSDA 1KILC 3KZZA 3ZQQA 2P6TA 1ETXA 3LA7A 2CV0A 5AW3B 3CC2P 3BTLA 1J09A 4WCGA 2GLOA 4BE2A 3N4MA 2ZC2A 2FBWC 2QG4A 2V6CA 1SD7A 1Y56A 5CBNA 1W2EA 3J80K 3HKZN 4RB1A 2A6HF 1WJCA 2DMNA 2R5YA 1N86A 1NH4A 3H1CA 4FE7A 4GDOA 3ZN0A 5HLGA 4M3EA 1JI8A 4A3BJ 1KQ0A 2TCTA 1P84H 5J8CA 4IHYA 2E1MB 1HXDA 4DIQA 2NS0A 5EG0B 3GTKJ 2C0WA 3MZHA 2ZFUA 2PJRA 2F2EA 3M8EA 4CZZA 5M1BA 5CVJA 1K7AA 2RQPA 1ENHA 3W6VA 1DEEG 1MKMA 1RR8C 3GZNB 2ZJQF 1R6RA 4EMSA 3CPWO 2IA2A 3CWBE 2DU9A 3WUTA 3F72A 3ERED 2FEZA 1CQTA 5LEKA 1HKQA 1X19A 3Q5FA 3QOEA 5AVQB 5L3EA 4RGRA 3I64A 2YX4A 5FLVA 4DBQA 4BHCA 1F4KA 4OH8B 1BW5A 2LOOA 3VYSB 2QM7A 1R22A 1Y8RB 1UFMA 2QQ9A 5E79H 4IOAF 1FSHA 2NPSC 2HYJA 2M9HA 1SAUA 1J1DC 2LKPA 3HE5A 1HWTC 3KP7A 1ETVA 2MLGA 4A3CJ 2R5BA 2HS5A 3IAS2 1A02J 3PIPF 4G7HF 3O6QA 4IFFA 4FE4A 2W1OA 1USTA 3TDZC 2PMZA 1ZW0A 3C1LA 3CCJI 1T6AA 2L3DA 2KLVA 3SDBA 4K2EA 1SQBJ 4C2UA 2IVMA 3I5CA 3S1RJ 3BY6A 3IWZA 4XKWA 2HDCA 1W7PA 2JT1A 3CJQB 4X1EA 3J7AY 2JWAA 1VQ6P 1GZLA 4HF1A 3C2BA 2X6XA 4JK1X 2DA5A 2FBIA 2IGKA 2HGCA 3N97A 1D3YA 2FQ3A 2CQXA 1IF1A 4A3LJ 2VXZA 2A06G 1JGSA 4ZYEA 5AW8B 2FOWA 2EILH 2HWVA 3LSPA 4KA4A 2A3SA 1N7SC 4OIOF 4BWNA 5DCMB 1IJWC 4KDPA 4FTHA 2Q7CA 3CCUP 5EZGA 4E7KA 2KZGA 1WQ2A 2GXBA 2V9KA 1MZ9A 2KI7B 2G3AA 2QJPB 3KYCB 2HXOA 5FKLA 3KEYA 1GDTA 2ZT9C 4LD5A 1T2KD 1OCRH 2LLKA 5KAFC 4FX4A 5JFRA 1LE8B 3AL0C 3G1LA 4IJAA 2RN0A 2OYIB 3BTJA 3GO5A 1VQNI 2QVAA 1ERDA 5GADJ 1SC7A 1HUCA 3B4SA 2V26A 1FIPA 3DU6A 4IHXA 3QODA 1ETOA 3CMEI 3L7WA 2L01A 2FYUE 3HOWJ 2Q8KA 4QLCU 2H94A 4R4MA 2YKOA 3B6AA 1KGSA 1D0ZA 1FLIA 3MKWB 3L73G 3FXQA 3NWTA 1KYOE 3UNGC 3QQAA 2OYIA 2CV1A 4XL9A 3V2QA 3PUFA 2Y0EA 2Z4EA 5KLIC 3ZQFA 1X3ZB 2XRNA 5F08A 3MN2A 2Y0MA 2BXYA 1B8IB 1W7PB 2UXNA 2JVHA 1T0FC 2VT3A 3CCMP 1FDIA 3ABUA 2NPSB 1MDMB 3OYAA 2QQAA 1Y9BA 1EV7A 2YMYA 4I09A 4PJ0C 2OAZA 5F04A 3U9GA 2ICWG 1JHFA 1WFXA 2ESHA 1OFCX 5E79C 4ZDOA 3FXLA 3S4RA 4F3QA 2A61A 2G9WA 3K10A 1T33A 2ZYGA 3CCLI 2KIUA 4BQNA 1KU3A 2DI3A 4XN3A 1QBJA 4M72A 2OYHC 3FXEA 1ZREA 5AW2B 1HGVA 1S6LA 1SFCB 3A0BC 2UUZA 4CO8A 5DS9A 2DN0A 2LVSA 4D1QA 4Y99C 1RRJA 4QWQA 2MYSA 5AVYB 3HL2A 1RUOA 2V6EA 4CHUA 2RNJA 1QZEA 1MJ9A 4XRSA 1V5FA 3V7RA 4XOTA 1MSEC 1R1UA 3RGUA 3FWNA 5JHFA 4CCJA 5IP7J 1M57D 3EFFK 3W67A 3Q5RA 1KQGB 1JUMA 2WC2A 1XDSA 1RF0C 1Y1WJ 1HDPA 3I53A 4ABZA 1PP8F 1DH3A 5HS7A 1YI2I 2ZFCA 4IKFA 2IGNA 1J0RA 1RUNA 5E17F 3WGGA 1KILD 1SMTA 1OW7A 1FY7A 2ID6A 3JRIA 1Q1VA 3L1PA 3V7SA 3BRVB 5KAIH 3BCCG 3HUSA 5GTHC 1NTZK 2IBDA 5ICCA 5M3MJ 4CCKA 2BV6A 3WTXC 2E2JJ 2XZRA 1NTKD 1FYKA 3Q0UA 4D0PA 1AJYA 1NTKJ 2PFXA 3A7OA 1OCCH 3H5AA 2CJJA 4Z2YA 1USSA 4N6JA 3UR3C 2P5LC 1M1JC 4XLCA 1G4DA 3E3VA 3VMZA 1Z1DA 1HKTA 1QPIA 4I7ZB 1E3HA 4PFOA 3H1JG 2B63J 1XGNA 1XGSA 1KMIZ 1J7KA 1RIOH 2IEKA 2E75C 3HTUA 1TQIA 4UB8C 4A0ZA 3IFMA 2F5VA 4XA4A 4EI2A 1WI9A 2QBYA 3QPLA 1IK9A 2W7NA 3LIEA 2JSPA 4IEJA 4M3GA 5K5OA 4M6YA 2R92J 3PLNA 4BXLA 1U7JA 1Q81Q 3H32B 3P5JA 5H2FE 1ZG1A 2EK5A 2LKMA 5CCGD 1I27A 4RGXA 3A2KA 1BOAA 5KTBA 5GTIC 1IV6A 4CYCA 1DDNA 1NK3P 3ITKA 3CCLP 4QSHA 3KETA 1QVGO 1Y39A 3LSIA 1LUJB 2RN7A 4G9YA 4HSTA 4UHTA 4C2MJ 3F6VA 1KILB 3OYMA 1N2DC 3AE2C 2JA2A 2L9SA 2O8XA 2W25A 1UIIA 5DD4A 5LD2C 3EUHA 4I0AA 1S8NA 1BCCJ 1BJZA 3GLMA 1ZLKA 1WMKA 4IL6H 4OGQC 1IV8A 1D8JA 2ECBA 2VJJA 2E7XA 3MKLA 4KMFA 1SVLA 2BY0A 2R7OA 4JX6A 2C9LY 4DOJA 2QJKB 5BU5A 1ZELA 2GA2A 4XONA 2HOAA 2CFOA 3FMRA 4RA2A 1RQVA 1I6XA 2VKEA 2E74B 4ESFA 4BQOA 1WT6A 3F6OA 3TW7A 3ZXSA 5K5QA 4GT1A 3HRNA 1JM0A 4LLNA 3W2WA 5LLQA 3BATA 5FO5A 4UUTA 4ZJZA 5IOZA 4AYCA 2W90A 1T6SA 2KQRA 3SZGA 1TBXA 2Z5UA 1SQVG 5L3DA 3C2GA 2HFED 2L7KA 2Q1KA 1MBFA 4UXNA 2LG4A 5AIPA 1AVOA 1M1KQ 1SQBD 2RV8A 2CG4A 1MBGA 2LD5A 2WSFH 1D8KA 4N9IA 1O3QA 2RAEA 3RK3B 2RQQA 3BPXA 1TT5B 4MGRA 1YIJI 4ZC3A 2Z5IA 4PV1C 4E6KG 2DQLA 4D5FA 1SQQJ 1YIOA 1OCPA 2IW5A 4L73A 2JN6A 5BNGA 1A6QA 1R5HA 3M1CA 3HEFA 4HDVA 3F8BA 1O4XA 1YYVA 1EQ7A 4WXDA 3HUSC 3DKYA 4U7JA 3AEDC 2ZXIA 1PP9J 4OINF 3M0DA 1DD3A 1KYZA 3HRSA 1YFHA 1S7EA 3IAM2 3OYEA 1WH7A 4KISA 3DTKA 2WPSA 1UHWA 4QIWN 5K7ZA 1P84E 1X2MA 3KCCA 4NC6A 3A01B 2K9JA 5DYMA 3HJEA 1JY3P 4N0BA 3P32A 3CDHA 4UV8A 2WSSH 3K0LA 2FE3A 3A0BH 2IFNA 2VKDA 1ETYA 2EFQA 1NTCA 2H88C 2HVQA 2XPVA 3HD7B 3H9JA 1PJRA 2FMYA 1LE8A 2FNAA 1G1JA 3KE2A 2C6YA 2OCCH 3FXUA 5EDNA 2R7QA 2WV1A 3CD6I 2J59M 4ZKPA 1YW9A 3G9RA 3TL4X 1UZCA 2NRAC 4L18B 2E71A 2HKOA 2MGQA 3F21A 1NU1E 5B5EH 1DIPA 2K7LA 5LGUA 3VMYA 3K1MA 2DA6A 1JUSA 1OW6A 3ABVC 1JUNA 3ML6A 4A3EJ 3A4CA 2KNCA 2FRHA 4LG0B 4U3FJ 1NTKK 2K3FA 4UVAA 1Z7UA 4F52A 4OIQF 1CSBA 3B8EB 4OVNF 4YIIA 1S5LC 5APXA 1NTZD 3OYBA 1DUXC 1D1CA 4IHSA 1SANA 1Y0NA 4NQWA 1GL2A 2ZXJA 1D5VA 3B6CA 3Q5PA 2Q2EA 4H0EA 2HKXA 1M90Q 2GUSA 1YRNA 5FFZA 2VL8A 2XC7A 4WB4A 3HYIA 1JKOC 4KIGA 1LWUC 3HTSB 2QIWA 4HX4A 1RKWA 2NVXJ 2KK7A 2AEJA 3NEUA 3M8JA 5C4XJ 5CBOA 2ITAA 1FMWA 1TTYA 3TGUE 4H0LC 3RPUA 1A6IA 3AE9C 1GV2A 2P5KA 2VKHA 2LNBA 3OY9A 1GD2E 1Z7LA 2H1KA 1TW3A 2BEOA 1MJAA 3ABMH 4L0ZB 1KV4A 1PGQA 3E97A 3RL0D 1LDKB 4CCOA 1LTBC 3L73D 3VSKA 3V4QA 1B72B 1JHHA 3AG1H 1HQCA 2M3EA 3ROUA 3ZDMA 3FM3A 5FFXA 1YE9A 4UNOA 4NDLA 1A5JA 3IF4A 4NPDA 3CMMA 3BZKA 3BR0A 2LTPA 2W24A 2E60A 3E5QA 3SYTA 1XTCC 2PEXA 2EIMH 2OC6A 3TGUG 2EA4A 4E7HA 1BE3D 3TOBA 2MH9A 1QGPA 2Z33A 1RHZB 2L7MP 1BL0A 3OWTA 1BDDA 4ZMDA 3GZ5A 1YW8A 3FHNA 3FF5A 1FIAA 5J1UA 3ZGKA 3OYKA 2GXAA 3GMAA 3WU2C 4CUGA 1N77A 1YQAA 2QJPC 3HUSB 4XFJA 2WV0A 1DQUA 1XMAA 5GTHE 2JJLA 2KIFA 3DXJF 5D5XB 4B3XA 3S3OA 3GFLA 4LG3A 4LJZF 1JKRC 2N8GA 4C2TA 1RPWA 4B44A 1MMDA 1TQPA 3L74G 3PP5A 2Y48A 3H0DA 3QWOC 2IS2A 2IS6A 3L71D 1NG7A 2CW8A 1FP1D 3DLLF 2AHQA 3CX5H 3L74D 2RDPA 1J75A 2BY2A 2CUFA 2COMA 1WRJA 2FSWA 2NS8A 2O61A 2V4JC 1ZRFA 3BR1A 5IT9K 4D6TE 2K40A 3MUDA 4YPCA 2XU6A 3V42A 2H6CA 2EV5A 1K78B 1T8ZA 3G1MA 1VQ7I 1OVVA 3SFDC 2N1TD 2KRHA 3B5NA 5CCHD 1R4MB 2QSFX 3FISA 4IVNA 5IOYA 5J8FA 5B3SH 1NTMJ 3WHCA 5AW7B 2KMUA 1L0NK 3L36A 2FF4A 4CCNA 4UUSA 1U9OA 1PUFB 4W7ZA 3TGUD 2OTLI 4X6AJ 4IOCF 2WMMA 1FP2A 1L0NE 6PAXA 1U3EM 4ZNCA 2R7VA 1K4SA 1FOWA 2Z99A 2A07F 1T2KC 3TK1A 3P9IA 2X1CA 1CW5A 4B09A 1JY2N 1L4AA 2KSEA 5B66H 3GFIA 1W36C 4H44B 4RB3C 2H09A 1U0JA 1MMAA 1LDDA 3U1KA 1FX7A 4GYGA 3EETA 5B66C 3ZMZA 1G2CB 3DU5A 4ETSA 1KONA 2CPBA 1OIPA 4U3FD 4KICA 2L91A 1SD5A 3A0HE 3O8ZA 3AAFA 5CVIA 2F5EA 1IFNA 1MBKA 4XBFA 2R5YB 3Q1MA 1L0NG 2I1KA 3G73A 4AD9A 3L70G 2VIXA 3RKWA 2KL4A 4Y4RA 4A0YA 2CWEA 3SFEC 3KDPB 3L2WA 2XIGA 3H3UA 1RE3A 3EQ2A 4YIFA 3NWSA 3JRCA 1YJNI 1USEA 5D6EA 3JC22 2AQFA 1LNWA 4XORA 1GV5A 4B4CA 1YJWI 5LGTA 1FNNA 3VPRA 2QSGX 1IXSB 4R4LA 3VN0A 3D6ZA 4L74A 2OYIC 2ADUA 3AKZA 2R5DA 2QVOA 5AW9B 1YTYA 4H0LD 1WJBA 3K4KA 2DFFA 4KJMA 4LIVA 1SQPD 1XMKA 3NMDA 2IZ1A 2V7FA 3OIQA 2WPVB 1VQPI 3HKZA 2CV2A 1ZRTE 1RF1B 3GUDA 3HRUA 4GXOA 1AHDP 1R1TA 2F5FA 4M3BA 3FXKA 4O6JA 4RDUA 3JR9A 5IYBJ 4U7BA 3KYQA 1XCVA 3HOSA 1YITI 3GTPJ 2JSCA 2BVLA 1R9TJ
chains in the Genus database with same CATH topology
2GOXB 3CP2A 3OL4A 3PSFA 1TT0A 4NC7A 3FBIB 5CQEA 2WAQA 4BE1A 4DBRA 3AL0B 3KX2A 2ELJA 3H9QA 4B48A 1D0YA 2GOMA 4HNUA 2KUBA 2VPLA 2RNGA 2KZIA 3D5SC 3ZQQA 2LYCA 4YRVA 1G59A 2CV0A 1J09A 4BE2A 4BUPA 2M7BA 1TZLA 3FBNB 1Y56A 2Z1DA 2BW3B 5CBNA 1WJCA 4BEHB 3PH0A 3BCAA 3DKXA 1BDCA 1X4PA 3PSIA 1JI8A 2QKLB 2IXSA 4PJNA 1WJFA 4J00A 2B87A 2JUGA 2E1MB 3H5NA 3H5RA 4DIQA 3FDYA 3MKZA 2ZFUA 3F9KA 2X1DA 4P5OA 3OYLA 2PJRA 2R7SA 2R7TA 3OYDA 3RCOA 4F93B 3MKYB 1DEEG 1UELB 4ZTFA 1R6RA 5HOOA 3E1SA 4B47A 4E4HA 1N75A 1X19A 2X6WA 3QOEA 4PFPA 4RM2A 5KCMA 2HVSA 2B87B 3HPGA 2KZVA 4ITVA 4DBQA 1LP1A 1N78A 4Y33A 2LOOA 3VYSB 2RREA 4IX7A 4WWIA 4XR6A 1SS1A 5HNFA 1SAUA 4K35A 4E7JA 1H0TA 3LSKA 4ZYAA 2WAEA 2Q1ZB 1W36D 4HKZH 3IAS2 3CJRB 2W1OA 1X1AA 1LT1A 2V1NA 2PMZA 1ZW0A 3SDBA 4C2UA 1E0EA 4CH7A 4XKWA 3J7AY 2K5CA 3CJQB 3DWLE 1Y47A 2X6XA 2MFZA 3SEZA 3E0JB 1Z3XA 2IGKA 2M3AA 3D5LA 3K4LA 5CQGA 4II3A 2ZAEB 4XM3A 2VXZA 3OR2C 1EDLA 3OYIA 2DXIA 2B88A 2KZJA 4EYYQ 1QU3A 2XF5A 4E7KA 3K6GA 2M4KA 3FKJA 2V9KA 2VXDA 3EUAA 4XMYA 2KI7B 2ZXHA 3KEYA 1MNEA 2CS3A 3DTEA 3AL0C 4BQQA 2QVAA 1ERDA 2M5AB 2V26A 3DU6A 2CH0A 2A5WA 3QODA 2LH9A 3TBIA 3RTRA 1EA3A 1WJEA 3RPUD 1MNDA 2KLOA 1LP1B 1D0ZA 2WBMA 4FETA 1MMNA 3K4JA 5KHDA 3MKWB 3NWTA 4LITA 3UNGC 2DT6A 2CV1A 4XL9A 4ZTJA 1G8XA 2L5QA 2NOJB 2ZSHB 4C9YA 1NG6A 2VJIA 2ZSIB 4X0GA 1FMVA 3CP8A 2K9LA 2JVHA 3ZR8X 3LSGA 1T0FC 2DJIA 4YEJA 3TMOA 1DP3A 3PFYA 3L2UA 3K70C 4GODA 3BLYA 2PJRB 2UWMA 3OYAA 5DJTB 2BOLA 1U7MA 3HXLA 1WFXA 4ZDOA 4F3QA 2OV7A 3K10A 5FROA 4BQNA 3PJRA 4ZDLA 3DQVC 4XN3A 1GLNA 4J01A 3FXEA 4MN4C 1HA8A 2M0MA 1X1DA 2VJ4A 2UUZA 4D1QA 2MYSA 3HL2A 4CCMA 2V6EA 2WY8Q 4XOPA 1V5FA 2HPMA 4XOTA 4ASWA 4NC8A 3RGUA 2B89A 5JHFA 2UWJE 4CCJA 3QYBA 4E7SA 2VQHA 4CSWA 5K5GB 3FXDA 2VB6A 3CZ6A 4PK4A 3BC8A 2M5AA 4XKVA 2BVMA 5FRMA 1Z21A 4NNJA 4IKFA 2IGNA 4NPFX 5CBOA 3SEQA 2Y0SA 2L9NA 3VYTB 3HPHA 3LFUA 4HRIA 1DGWY 4CCKA 2QRXA 2HNHA 4CZCA 3MMYB 2IS4A 3LSMA 3GBGA 4GRIA 3H5AA 4R79A 2M0BA 2KHMA 4XNFA 3UR3C 4JOMA 4NUBA 1X1BA 4XLCA 5TGTA 5HVQC 2CUJA 4QPOA 3OYHA 3S1KA 1P9QC 2VQCA 2DT7B 4PFOA 2KP6A 2VJ5A 1QHGA 1D1BA 2F5VA 4BACA 3HG9A 2W7NA 2JSPA 2K3RA 4BXLA 5CPRB 1U7JA 3PUBA 4PSXA 3U21A 3A2KA 1X1CA 4F55A 3HOTA 2Z16A 3LSHA 3C2HA 2BW3A 1UG0A 2UV1A 5C39A 4HNTA 1BR1A 3LSIA 1LKXA 3PL8A 3W2VA 4HSTA 3OYMA 2JA2A 2L9SA 4JBZA 4BS9A 5LD2C 2I8DA 3ONQA 4CA0A 4E7IA 2MC4A 4ZDPA 2VJJA 2HU9A 2KDOA 2BVLA 3DPTA 3D5RC 1X0TA 3W2AA 2R7XA 3A1YA 3MZWB 3KYLA 2DOAA 2R7OA 4PUSA 1ZELA 3S32A 4XONA 3S3MA 4XLAA 2CFOA 4BQOA 2HVRA 3ZXSA 2VQLA 2AQEA 4BDYA 4BJ6C 1JM0A 2KPMA 3DEEA 4RMNA 3W2WA 2LXBA 4ZJZA 3OMYA 3OYCA 2KQRA 3SZGA 4GOFA 3EUHC 3C2GA 2L7KA 2Q1KA 2LG4A 2W82A 4BXFA 4H4KC 1AA7A 4XN0A 2RQQA 2VQGA 4BJTA 1ZXGA 2HR3A 3VYUB 3IUOA 4NQWB 1WJ5A 1T95A 4ZC3A 4E6KG 4OAZA 2R44A 4G6TB 1V5EA 4F92B 1NVOA 2CMPA 3M1CA 4KT6A 2WA0A 5LFAA 4HSRA 3OIPA 3DKYA 3BG7A 4XLEA 4QPQA 2ZXIA 3L2QA 3DPLC 2OUMA 2WAFA 2LXCB 4CPGA 3IAM2 3OYEA 4KISA 3DTKA 2LY1A 2E5NA 2KIKA 2Z2SB 3S8PA 1H0TB 2CUZA 5FRNA 4IOIH 2VKDA 4BE0A 4OWRB 4HPQA 4AU7A 2HVQA 3RQ4A 4U87A 4OAYA 3H9JA 1PJRA 4BGDA 1PYVA 4PSWA 2R7QA 4E7LA 3H35A 2F4IA 4RLFA 4ANJA 4IZZA 3CESA 3TL4X 2IGMA 2CW7A 1K6YA 5DJUB 2HZDA 3MD2A 2Q2EB 2JWDA 2RKLA 1UAAA 3EUKL 3A4CA 4EATA 4ASVA 3QYEA 2MABA 3RSNA 1FC2C 4F52A 2VLAA 1LVKA 3K4NA 2M4GA 3OYBA 1D1CA 1S3JA 3S93A 3DTIA 3OL3A 2X1EA 4K3AA 4NPEA 1X4OA 4KITB 4KJZA 2VL8A 2XC7A 3K4BA 4BJ5C 1YX3A 3M8JA 4II2A 1FMWA 2L2OA 4HG2A 3OYGA 1Q2NA 4JQFA 2VKHA 1WJAA 3VSLA 3OY9A 1Z7LA 3H9GA 4P1WA 3I3LA 1LDKB 3DPUA 4CCOA 3N05A 4F91B 4BL0B 4GOEA 4C30A 3VSKA 2XSJC 1LFPA 3ZDMA 3IP4B 1Y6IA 1YE9A 3OS2A 1OVUA 4NPDA 3ZCOA 3CMMA 3MHVA 5HLTA 3S3NA 2E60A 4E7ZA 2VASA 2K9MA 2OTKE 3SYTA 3K4CA 1IRXA 2OC6A 1JMBA 2M7AA 3LL7A 4E7HA 1EDKA 2HPIA 1MFTA 4FASD 5EFWB 2P0WA 3OWTA 4XKBA 1BDDA 4ZMDA 3ZGKA 2MD0A 1D0XA 2LREA 3FHNA 4D9JA 4B43A 3OYKA 4PJMA 1BR2A 4MLOA 4CUGA 1N77A 4LIUA 2O5RA 3BCBA 1DQUA 4DOZA 4IQJA 4B3XA 3S3OA 2A6TA 4LG3A 2X85A 4PJLA 4C2TA 4B44A 2KS1B 1MMDA 4AVZA 2W00A 1BR4A 3H0DA 2P58A 3QWOC 2IS2A 2IS6A 1NG7A 2CW8A 3VWBA 2XDVA 2LBFB 3OS0A 2V4JC 3PNVA 2SPZA 2R7UA 1Z3YA 3V42A 1DGRM 2X51A 1SFKA 4XLHA 4BEHA 1OVVA 2HDWA 2KRHA 3OR1C 3VYRB 1WJDA 2E1MC 2KMUA 4YELA 4N4OB 4CCNA 4XLFA 2WMMA 4ZNCA 4DGWB 1EDIA 4PJJA 4BU2A 3DLAA 3HC7A 2R7VA 4HB1A 4XQFA 4XKCA 4BDZA 3LMMA 3OYNA 2WY7Q 2R7WA 2X1CA 2LR2A 1VZ0A 3HUGB 1W36C 4HJGH 3OYFA 4RM3A 2XF7A 1V5GA 3G2BA 2IS1A 1U0JA 1MMAA 2X6YA 2K3PA 3W3CA 2XF6A 2HQAA 2LC2A 3PNTA 3DU5A 1KONA 1OVRA 2KRCA 4IQ4A 3AFHA 3L2RA 1YX5A 4CCLA 2W4SA 4HEA2 2LRDA 1QHHD 2KL4A 2R4GA 2VIXA 3I9V2 3K4MA 4Y4RA 3OS1A 1MMGA 2F6CA 3L2WA 2E5ZA 3NWSA 3OOUA 2DCEA 4N4NB 1EC5A 4AYBA 2AQFA 3K70D 4XORA 2WB1A 4DJAA 2R7RA 1D1AA 3CF2A 2WADA 2LBFA 3QYFA 3AKZA 3L2VA 3BG6A 2JVGA 1WJBA 3K4KA 4KJMA 3PNYA 2XAUA 4LIVA 1EDJA 4Y3OA 1MW7A 2V7FA 3OIQA 1OLTA 3HKZA 1S9HA 2CV2A 5HNHA 3EPZA 3VDXA 3OYJA 5KNLA 2IGOA 4U7BA 2LY2A 1BOBA 2QKMB 3ZRGA 3HOSA 5CKTA 4RLQA 2FUG2 1OR7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZW B;  3ZDM A;  1OVU A;  4NPD A;  3MHV A;  2OTK E;  1JM0 A;  2KUB A;  2OC6 A;  1JMB A;  2KZI A;  2LXB A;  1EDK A;  1MFT A;  4GOF A;  5EFW B;  1BDD A;  4GOD A;  2Q1K A;  4ZMD A;  5DJT B;  1U7M A;  5CBN A;  1ZXG A;  2HR3 A;  1BDC A;  3PH0 A;  2KS1 B;  2B87 A;  2R44 A;  3FXE A;  4MN4 C;  3QWO C;  2P58 A;  1NVO A;  1DEE G;  2SPZ A;  4ASW A;  3RGU A;  2LXC B;  2B89 A;  1OVV A;  2UWJ E;  4CPG A;  2B87 B;  5K5G B;  3FXD A;  1LP1 A;  2KIK A;  2M5A A;  2WMM A;  4ZNC A;  1H0T B;  1EDI A;  4NPF X;  4HB1 A;  4WWI A;  4IOI H;  5CBO A;  1SS1 A;  4K35 A;  1H0T A;  2LR2 A;  4HKZ H;  2QRX A;  4HJG H;  1LT1 A;  1ZW0 A;  2M0B A;  5DJU B;  1OVR A;  2JWD A;  2RKL A;  3S1K A;  1Y47 A;  4ASV A;  1FC2 C;  2ZAE B;  2KL4 A;  1EDL A;  1S3J A;  1EC5 A;  2B88 A;  2KZJ A;  4EYY Q;  4K3A A;  2K3R A;  4BXL A;  1U7J A;  4NPE A;  2KI7 B;  4KJM A;  5C39 A;  1EDJ A;  1Q2N A;  2QVA A;  2M5A B;  4JBZ A;  2I8D A;  1LP1 B;  1X0T A;  4GOE A; 
#chains in the Genus database with same CATH topology
 4HF0 A;  2WPQ A;  3BR6 A;  3RKQ A;  3QWL A;  4NC7 A;  2LF8 A;  4BH9 A;  3HUG A;  2ACJ A;  2HTJ A;  4BE1 A;  4W97 A;  4WY4 D;  2FFD A;  1SFX A;  2XGE A;  2XAF A;  2ELJ A;  4E70 A;  1QGK B;  3VOD A;  3ECH A;  2IDB A;  3O3K A;  1B9M A;  4B48 A;  3IKT A;  1L0N J;  2H8R A;  3J7Z I;  2J5P A;  2RNG A;  4L5J A;  3D5S C;  3J7Y J;  4M71 A;  2Y9Z A;  1PVE A;  1SD6 A;  1JTH B;  1G59 A;  3H1K D;  3L70 E;  4M3L A;  4WY4 B;  1QL2 A;  3AE1 C;  4HLX A;  3AEB C;  4I7Z C;  1VQK I;  2WQY C;  4L9T A;  4IFD K;  1QVT A;  1TZL A;  2LDU A;  4M73 A;  4BRY A;  4IF4 A;  2DA2 A;  4MTE A;  3U2R A;  3V8K A;  2Z1D A;  2BW3 B;  4C3J J;  5IYD J;  2ZJS E;  2FNP A;  5KLV K;  4U7D A;  4BEH B;  1IFM A;  2D2W A;  3BCA A;  3L73 E;  1X4P A;  3PSI A;  3CXH D;  3LID A;  3M06 A;  3AE7 C;  3CCM I;  4P55 A;  4L9V A;  2B87 A;  2JUG A;  2PP6 A;  4MEX F;  2HQN A;  5GAH J;  3RCO A;  3CCQ I;  1IO4 A;  2FKW B;  3H1I J;  4BRY B;  5KLV J;  4HNV A;  3FX0 A;  5HOO A;  1NYH A;  3IC7 A;  1BJA A;  1JKQ C;  2BAS A;  2GZW A;  2EFO A;  5H6Q A;  4I7H A;  2DTR A;  2X6W A;  4PFP A;  3CCS P;  2XNX A;  4I6Z A;  3HPG A;  4YFN F;  3MIW A;  2GQQ A;  2LSO A;  4ZYH A;  1VQ4 I;  3CC7 I;  5C4J J;  3N7N A;  3L35 A;  3BZ6 A;  4UVB A;  1S72 P;  3MEX A;  2WB1 N;  2RRE A;  2CGP A;  1HST A;  2QF7 A;  3O8H A;  4HZF A;  4XR6 A;  2KDZ A;  1SS1 A;  3LSK A;  5LHG A;  5D8K B;  2KSJ A;  2WAE A;  4HW0 A;  2OQR A;  4AIH A;  3FZV A;  1W36 D;  2QJY B;  3WU2 E;  1VPC A;  1XN7 A;  1YYC A;  2HYN A;  2V1N A;  1KD1 Q;  2E19 A;  2IRF G;  1URQ A;  5EEG A;  4AWX B;  5FD6 A;  1FDM A;  1T8I A;  2Y0C A;  1Y47 A;  1LTG C;  1K83 J;  2M3A A;  5FGM A;  3FK6 A;  4PGH A;  3REO A;  2ZAE B;  3L70 J;  5AW0 B;  1AKH A;  3H1I G;  3L71 G;  3QPS A;  3SWF A;  2VKV A;  1BI2 A;  3OR2 C;  4XRF A;  1RKT A;  1MNM C;  5CVV A;  2DXI A;  2QUF A;  1BI1 A;  4UV9 A;  4L0Y B;  3ASN H;  4DZP A;  2KZJ A;  4GKG A;  4EYY Q;  2XGX A;  1G3Y A;  2XF5 A;  3IH2 A;  4BYY A;  2D45 A;  3BT9 A;  1N8R Q;  2PN6 A;  2XUB A;  4R8H A;  5JR3 A;  4UB6 C;  1LTI C;  3H92 A;  2ZXH A;  1PP9 D;  2ESN A;  2J58 A;  1MNE A;  4S05 A;  2O01 N;  4GIF A;  4D7M A;  1AKH B;  1PV3 A;  5AVS B;  3QPH A;  4C3I J;  2GUV A;  2F5C A;  2IBZ D;  2NOG A;  2O01 J;  1SQV E;  1JOC A;  2CH0 A;  2XRL A;  2J5O A;  2A5W A;  3H1I E;  3TP3 A;  2DK5 A;  1I6H J;  3RTR A;  1EA3 A;  1WJE A;  2IPQ X;  1LP1 B;  1FZE A;  1S5L E;  2WSE H;  2KT0 A;  3A3Y B;  3Q2Y A;  2VE9 A;  4V2G A;  5D5W B;  5AW5 B;  2MG4 A;  1BCC D;  2VI6 A;  2DT5 A;  3E7K A;  2DT6 A;  4N78 E;  5DCF A;  1E3P A;  2FA5 A;  2L5Q A;  2NOJ B;  3HHH A;  5LEJ A;  3EQL F;  1FZA A;  2P5V A;  2TDX A;  5D8L B;  2ZSI B;  4GGG A;  1LQ1 A;  1AQT A;  3FMQ A;  1J59 A;  1SQB K;  2K85 A;  4X0G A;  5B66 E;  3M0D C;  2P10 A;  3LSG A;  1Z6R A;  2VE8 A;  1K04 A;  3I59 B;  2CQN A;  1W5C E;  1PP7 U;  4ESJ A;  3GYH X;  1YJ9 I;  3BG9 A;  1VND A;  2DTZ A;  3HXL A;  4M9S A;  2CRG A;  4IPA A;  1TWC J;  3HRM A;  1SEU A;  3H3Z A;  5LHH A;  3L75 E;  5J1R A;  1T98 A;  3BWG A;  4ZDL A;  3B71 A;  5AVR B;  1T2K A;  1NTZ G;  3SJM A;  1ORK A;  2M0M A;  1X1D A;  2VJ4 A;  1HH0 A;  4JYK A;  1IC8 A;  1KZU B;  5GPA A;  2Z3Y A;  4N78 D;  4PD4 D;  5J1Y A;  1KYO D;  2E35 A;  2WY8 Q;  3IRQ A;  2V1D A;  4G6Q A;  3KZI C;  4H0L B;  5EF6 A;  4IXA A;  2ZYD A;  4H44 C;  4JF7 A;  1EXI A;  2V1X A;  2B89 A;  1X22 A;  2EIN H;  2UWJ E;  1U8R A;  3MD0 A;  2ZYA A;  3FXD A;  3CZ6 A;  1J1E C;  3HSR A;  5CYV A;  3BC8 A;  1M1J A;  2DA4 A;  2M5A A;  4XKV A;  3HIF A;  5FRM A;  4PGG A;  4WY4 A;  1MBH A;  2CU7 A;  2M5W A;  4L5I A;  1NTZ E;  1ZLL A;  2K9J B;  3PJS K;  1ZME C;  4Q5S F;  2G7H A;  1H88 A;  3L75 D;  1SQV J;  4A7P A;  1DGW Y;  4CYD A;  4HDU A;  3Q0W A;  1AOY A;  2QRX A;  2NNN A;  1Y1V J;  1GVJ A;  5L3B A;  4B86 A;  1H88 C;  4CZC A;  2IS4 A;  3LSM A;  2IPP A;  3HRT A;  3WGI A;  1TLH B;  4R79 A;  2M0B A;  2EWN A;  5EZH A;  4JOM A;  1X1B A;  5TGT A;  4O5V A;  2CUJ A;  2IT0 A;  4WXH A;  1NHA A;  1RNL A;  1ZTR A;  3TW6 A;  1ZR2 A;  3OSF A;  1O3R A;  3LSJ A;  1G2H A;  2JO1 A;  3QPT A;  3HD7 A;  1OJL A;  3BR3 A;  5C3E J;  2W6J H;  2VJ5 A;  3KHU A;  1JE8 A;  3F8C A;  1HJB A;  2XHK A;  2EZI A;  1UMQ A;  1D1B A;  1WI3 A;  5FLM J;  2NVQ J;  1Q86 Q;  3HG9 A;  4XSZ F;  2LP0 A;  3M1E A;  2EZL A;  1N73 C;  5CPR B;  1JT0 A;  3E6M A;  3IL2 A;  3GHG A;  3PUB A;  3RYP A;  4PSX A;  3PO3 J;  3U21 A;  3T97 B;  1UB9 A;  2DYR H;  2KXP B;  1ZQ3 P;  2BGC A;  3HOT A;  1H89 A;  3C2H A;  2BW3 A;  2EBI A;  3RYR A;  5F1J A;  2C9N Y;  1BR1 A;  2V9P A;  1CGP A;  1MD0 A;  1VL2 A;  4PD4 E;  3T0Y A;  3HGG A;  4OWF A;  3L00 A;  1HBX G;  1HOM A;  5A2Q Z;  1OCT C;  4JBZ A;  4LLH A;  3GWZ A;  2RVC A;  2XAH A;  3SWY A;  1BIB A;  1W5S A;  2D5V A;  3A0H C;  1NTK G;  2WTE A;  4V2F A;  4P96 A;  4ZDP A;  2HU9 A;  2KDO A;  2KLU A;  4M74 A;  2QJK C;  3W2A A;  1MDM A;  3H1K E;  4NBQ A;  3VOE A;  2F5D A;  5BS6 A;  3KYL A;  4HH2 A;  3P8M C;  3BR5 A;  3MCZ A;  2HZT A;  4M9X A;  3JAM K;  2VQL A;  4HQE A;  4A3F J;  4BJ6 C;  1ZV8 A;  4HYT B;  2N9Y B;  2KPM A;  3DEE A;  1BSN A;  3DFG A;  2X0L A;  4JPZ B;  1B6A A;  4GOF A;  5FLX Z;  1F5T A;  4BKX A;  3PQJ A;  1RE4 C;  2ZXE B;  1MV8 A;  1GUU A;  3E1I A;  2D1V A;  1NTK E;  4PV1 B;  1Y8Q B;  2QQB A;  2ISZ A;  2PMU A;  3HHG A;  2AXT E;  2VQG A;  2JA5 J;  1IFD A;  2VON A;  2WPR A;  4RS8 A;  3RQI A;  4NQW B;  2K9N A;  1GL2 B;  1T95 A;  3RL0 B;  1P7J A;  4OAZ A;  2ZT9 D;  5F0C A;  3VTP C;  1J1E B;  3CC4 P;  1BN5 A;  1NVO A;  1ZAR A;  1AWC A;  2HOD B;  1RY3 A;  3TO7 A;  3OIP A;  1JCC A;  2E76 C;  2P67 A;  2OQQ A;  4OMZ A;  3BG7 A;  1S2E A;  1OR7 A;  5GP9 A;  4QPQ A;  3TO6 A;  2ZJ2 A;  2EFW A;  1S4X A;  2E75 D;  3GME A;  5DV5 A;  4LFU A;  2M30 A;  5J40 A;  2PRR A;  2L9R A;  4RB2 C;  2ELH A;  3VMA A;  2HEO A;  1NAF A;  3RBX A;  4U88 A;  1SQV D;  5BVZ A;  5AW6 B;  2IA0 A;  3S8P A;  2AXT H;  1ZN2 A;  1RR7 A;  1YIJ P;  3LAJ A;  5FRN A;  1H8A A;  1H9G A;  2OTL P;  2CUE A;  4BE0 A;  4AID A;  4BNC A;  1SD4 A;  3ZQ7 A;  4U87 A;  4OAY A;  4YG2 F;  2NXN B;  4EIJ A;  3E6D A;  2Y69 H;  2FYZ A;  3HB9 A;  2ZKZ A;  1PYV A;  2FBH A;  3MAJ A;  1F36 A;  1FBU A;  4PSW A;  1ZKG A;  4KIF A;  4H13 D;  2PGD A;  4M6V A;  4IZZ A;  3M91 A;  2DBB A;  2IGM A;  2E76 D;  4I02 A;  2KB7 P;  2NRG A;  1K6Y A;  2UXX A;  2JWD A;  3HOZ J;  5FKK A;  2C0X A;  2RKL A;  1YBK A;  1ZG5 A;  3EUK L;  3ELK A;  3F8F A;  3L74 E;  4EAT A;  1FZF A;  3RSN A;  1IFI A;  5IT3 A;  2V79 A;  5LHI A;  3HOX J;  4A0X A;  5AVT B;  1FZC A;  2E5T A;  2NZ2 A;  1FAV A;  3KQG A;  3UKG A;  1IXR C;  4G12 A;  1XG1 A;  2JPB A;  2OD5 A;  3QAH A;  2L4A A;  3LNQ A;  1VQ7 P;  3K4B A;  4XE5 B;  2OYO A;  4AYB N;  4BJ5 C;  2P8T A;  2MKV A;  1VQ9 P;  5E20 A;  4WBA A;  1V55 H;  3MVP A;  3OYG A;  3H1J D;  3ZMV A;  3O6Q B;  4HQM A;  1JY3 N;  3VSL A;  1OX3 A;  5H2F C;  3L72 E;  2WTY A;  3KP5 A;  2HG5 D;  1S5L H;  2XV4 S;  3OAK A;  1K05 A;  4D7N A;  3NAR A;  2WSC J;  4EVI A;  2F48 A;  2QJY C;  2ZCW A;  4UB8 E;  2NPS D;  4GOE A;  1X2N A;  3SHF A;  1SQX K;  4I99 C;  4RAG A;  4B8X A;  1N7L A;  3OS2 A;  3LQQ A;  4FT8 A;  4GCV A;  2GAU A;  2VOD A;  1N7S D;  4D6T D;  1IN6 A;  1SQX E;  3P7K A;  4QMA A;  3S3N A;  3G71 P;  3FXJ A;  2K9M A;  3H3V K;  2PFB A;  4S04 A;  1BI0 A;  3F22 A;  1M1J B;  2EA2 A;  2JA8 J;  4A3G J;  1JMB A;  2H7H A;  2M7A A;  3LL7 A;  1VQL I;  5CHX A;  4DW6 A;  4FAS D;  1KZH A;  1T0F A;  2P0W A;  3MUD C;  2VRS A;  1S1C X;  1R4N B;  2O01 H;  4PJM A;  1BR2 A;  2KJB A;  1A35 A;  4BBR J;  4OIP F;  4Q47 A;  2P7V B;  5CCG C;  2A6T A;  1NU1 J;  2X85 A;  4FIS A;  2W57 A;  3CCY A;  4PJL A;  4EJV A;  3CC4 I;  1YI2 P;  2YPR A;  2EB7 A;  2ZME A;  1SQX G;  2A06 D;  2ME0 A;  4A5N A;  3S14 J;  3VWB A;  1RI7 A;  5AVU B;  1ZLJ A;  2EPF A;  4FQG A;  4FCY A;  1PPJ E;  1K9M Q;  4AQR D;  3PNV A;  2R7U A;  1Z3Y A;  3WTT C;  2FYU G;  1L3L A;  1XSV A;  5FKM A;  3Q9S A;  1NU1 K;  2AEF A;  1HW1 A;  3FHZ A;  4HF2 A;  3HOV J;  5CMZ A;  3WU2 H;  3AG4 H;  3GTM J;  2ZVN B;  1SAX A;  1QLE D;  2QWW A;  2EIJ H;  1KB9 H;  2FY8 A;  5TIS H;  2FYU D;  3A0B E;  5KJ7 A;  3BR2 A;  1S9K D;  4YEL A;  1HDD C;  5TJJ A;  2PI0 A;  1MIJ A;  4PD4 I;  1WKM A;  3AEE C;  1XGO A;  2XGD A;  2BZT A;  1JJ6 C;  1EDI A;  3TGU J;  3MTU E;  2IP2 A;  1DEB A;  2OYH A;  4XLP F;  4BDZ A;  4IRH A;  2EZH A;  5BQT A;  3OYN A;  2JR8 A;  4Y17 A;  1RE3 C;  1QRY A;  2LR2 A;  3L72 J;  2O7O A;  4RAY A;  4MFE A;  1I3Q J;  5AIQ A;  1IC2 A;  3RK2 C;  1RF0 A;  1L0L J;  3S1N J;  1QNT A;  3OYF A;  4LMY A;  4BHB A;  2YMK A;  1IDY A;  1V5G A;  1P7I A;  3G2B A;  2IS1 A;  2X6Y A;  4A6E A;  5B1B H;  2XF6 A;  2HQA A;  3VP8 A;  1SQV K;  4MFD A;  5E1W A;  2QEN A;  2B9S A;  1IRZ A;  4Z6Y A;  1OWA A;  1SQX J;  5H2F H;  2K1A A;  3F3X A;  2BCC G;  4EDF A;  3BRT B;  3AFH A;  3GHG C;  1YX5 A;  2W4S A;  2R4G A;  1QHH D;  3K4M A;  3KXD A;  2VBW A;  3IH3 A;  4A3I J;  1PPJ G;  1W5T A;  3GTL J;  4AC0 A;  2CPS A;  1APL C;  2HDD A;  1XMX A;  2HLO A;  4N4N B;  3RL0 g;  3JRF A;  1X79 B;  3K70 D;  3CMA I;  2WWY A;  3T97 A;  3TF5 A;  3I56 P;  1S29 A;  1NJI Q;  2E36 A;  2LBF A;  5IY5 H;  2YO3 A;  4RKU J;  1MBJ A;  3IR9 A;  1VQM I;  4CGZ A;  4BQA A;  3W6K B;  2YU3 A;  3ZOB A;  1LTT C;  1T56 A;  5APS A;  1S7O A;  1VDF A;  2CFX A;  1YG2 A;  4L75 A;  1MW7 A;  2VBY A;  4UB6 H;  1G3T A;  2HOE A;  5HNH A;  3EPZ A;  1KA8 A;  1SFC D;  2OBP A;  2ECC A;  3G71 I;  1L0L G;  4ENM A;  1LT9 B;  3KZY A;  2IGO A;  5KNL A;  4XSX F;  2LK2 A;  4RAF A;  2DPU A;  4KNY A;  1MUU A;  3FM5 A;  1MBE A;  2WIT A;  2CW0 F;  1PUF A;  2FUG 2;  3D70 A;  1P84 I;  3PSF A;  4BHP A;  3I54 A;  1JXS A;  1M7L A;  2DW3 A;  2N1T C;  5CCH C;  3FBI B;  1FBM A;  2QZ8 A;  3DEW A;  5B1A H;  1CI6 A;  4DBR A;  2O03 A;  3KX2 A;  1E3O C;  4HOB A;  3WG9 A;  3ISP A;  4IFM A;  4IQJ A;  1D0Y A;  2R7D A;  3N4X A;  2BBY A;  3JRE A;  4HNU A;  3SZP A;  3E6C C;  3RKX A;  3H1J E;  3S1Q J;  2W83 C;  4W80 A;  4YRV A;  3M4O J;  2H43 A;  1MFZ A;  1NGM B;  2CYY A;  3CX5 E;  1G2C A;  3MQ0 A;  3WMM 0;  4BUP A;  4DYQ A;  4WWC A;  2P7C B;  1URQ C;  3H1H J;  4O9B A;  4B1R A;  5AVW B;  3FBN B;  3KP3 A;  3TO9 A;  3GTJ J;  2EZK A;  3JCU H;  3M9H A;  5HS9 A;  3DKX A;  2LKX A;  1H89 C;  3L37 A;  2ME6 A;  2DFI A;  4IHW A;  1VQ5 P;  3TOA A;  2I1J A;  3A2A A;  1FC3 A;  2YR2 A;  1W4M A;  2AS5 F;  2BHY A;  2E2I J;  3BG5 A;  1B59 A;  2Q0O A;  3FDY A;  1BC8 C;  3KZI E;  4P5O A;  2X1D A;  3BZC A;  3C18 A;  4MEY F;  2JPC A;  2PQ8 A;  3KP2 A;  4ZH4 F;  5FJ8 J;  2M3B A;  2BE5 F;  1DX7 A;  4ASN A;  4L5E A;  1R00 A;  1HW5 A;  1HF0 A;  4ZTF A;  2E1N A;  4LLG F;  2XND H;  1ZGA A;  2KYV A;  3WOD F;  4B47 A;  5HLH A;  3EWK A;  1HVV A;  1IRF A;  1GU5 A;  3RL0 C;  3ZMS A;  1SQQ K;  5KCM A;  4RM2 A;  2P7J A;  3HDD A;  1ACI A;  1VQM P;  5EGO A;  4ITV A;  3GW6 A;  3IAO A;  4PCQ A;  1RF1 A;  3K9T A;  1ZRD A;  1LP1 A;  1J5Y A;  5J4V A;  1FDO A;  4PJ0 E;  3GW2 A;  4Y33 A;  5DEQ A;  5L3G A;  4U0Y A;  2R32 A;  3KEO A;  1O3T A;  3T8T A;  2R3S A;  5DUK A;  3LSR A;  4IX7 A;  5CJ4 A;  1POG A;  1FOS E;  1G1I A;  1TWA J;  3USS A;  4K35 A;  4YTP C;  1H0T A;  5M5X J;  1IZN B;  1L4A B;  4ZYA A;  1BI3 A;  2Q1Z B;  4HKZ H;  2JP3 A;  2W85 A;  1HW2 A;  3H1L J;  4R1H A;  1P84 D;  4WF2 A;  4TV7 A;  1X1A A;  3DBH B;  3V8L A;  3DV8 A;  1FWZ A;  5EEA A;  1UJ8 A;  5L3C A;  1BA5 A;  3DBL B;  3HGY A;  1E0E A;  3T1B A;  1V3F A;  1NTM E;  1BE3 J;  1R5I D;  4A3J J;  2MFZ A;  4I76 A;  5D6F A;  3E0J B;  3K4L A;  3D5L A;  3A02 A;  1GT0 C;  3E6B A;  2BHZ A;  3I4N J;  1SQQ D;  1TU3 F;  4II3 A;  5FKO A;  3AE5 C;  5LRR A;  5GTH H;  1HKS A;  1EKE A;  3Q0V A;  3PO2 J;  2N9B A;  1FTT A;  2FD5 A;  3SFI A;  5KAF E;  1XSX A;  2Y2Z A;  5ED4 A;  2ELK A;  2B88 A;  1Q82 Q;  2OF7 A;  3FX3 A;  3H1H E;  1IFP A;  2E76 B;  3PFI A;  1QU3 A;  4UB6 E;  5B5E E;  3CD6 P;  2M4K A;  1L4A C;  3FKJ A;  4C46 A;  1XPX A;  2VUM J;  1N7S A;  4XLN F;  5KK1 A;  1W7P D;  2VPR A;  1FYL A;  3GLX A;  4FHT A;  2Y75 A;  1H8A C;  3DTE A;  1KQL A;  1NKN A;  4JX5 A;  4ENJ A;  3U1A A;  5AVZ B;  2ZFW A;  4HBL A;  1NWQ A;  3R0A A;  2OPT A;  4LK0 F;  2M5A B;  2JA6 J;  1IGN A;  2LH9 A;  3GLL A;  1IW7 F;  3DKW A;  4HX7 A;  4BAY A;  2A69 F;  4ESB A;  1X9V A;  3JRD A;  3VMX A;  3TKY A;  4FX0 A;  2A5Y B;  2CQQ A;  2WBM A;  4KUM A;  1P4A A;  4FET A;  3K4J A;  5ERI A;  3OJA B;  3PRJ A;  3RZO J;  1M8O B;  1NTM G;  2K9S A;  4ZTJ A;  3OW2 O;  2IAI A;  1G8X A;  1WWX A;  3KP4 A;  4C9Y A;  1NG6 A;  1WCM J;  3C7J A;  3NXS A;  3ZMU A;  4RGS A;  2FBK A;  2MW8 A;  3CP8 A;  2K9L A;  3ZR8 X;  1ON2 A;  1DP3 A;  2DJI A;  2W27 A;  2YX7 A;  1URQ D;  3L2U A;  3K70 C;  4GOD A;  1ON1 A;  3BLY A;  2UWM A;  3X2Q H;  1PP9 E;  5DJT B;  2OYH B;  4ENN A;  1BGY E;  2L7Z A;  3RK3 D;  1QVU A;  2YIU C;  5FB2 A;  5APV A;  2M2E A;  2FML A;  3CCQ P;  3M3Y J;  4PV1 D;  2OV7 A;  1TWF J;  3H1K G;  2P4W A;  2XRO A;  1BC7 C;  4H13 C;  5FRO A;  3K5B A;  3ZPL A;  3PJR A;  1BE3 E;  1FZB A;  1GLN A;  3Q9V A;  3LAP A;  1IN4 A;  1VQO I;  2HPC A;  1AA0 A;  2WZ7 A;  5F0H A;  1JNM A;  1BM9 A;  3IH4 A;  1KC8 Q;  2EFP A;  4DT0 A;  2VBZ A;  3TP0 A;  5KJ7 D;  3CUQ C;  2EQR A;  1DU0 A;  4CCM A;  1S7A A;  2NAZ A;  5AVV B;  2HPM A;  3M9B A;  1E2X A;  4ASW A;  3EFG A;  3G1O A;  3V2R A;  3WHB A;  3VYI A;  2JJ7 A;  4RJT A;  3QYB A;  4E7S A;  1VQ8 I;  2VQH A;  4CSW A;  4RAZ A;  4A69 C;  1DP7 P;  4I1L A;  5K5G B;  2HPC B;  3CCU I;  1C0W A;  4W7Y A;  2BVM A;  4NNJ A;  4IRI A;  5HDK A;  1T38 A;  3F23 A;  2VC1 A;  3VYT B;  1O57 A;  1V4R A;  5K5R A;  1ODD A;  3KLN A;  1M1E B;  3MP7 B;  3FXR A;  3CF5 F;  3O2P E;  4L76 A;  2HNH A;  5J6X A;  1VQ6 I;  3F5H A;  2HYF A;  3GX4 X;  3MMY B;  3CWB J;  1LTJ C;  2YKP A;  3WTW C;  3IN6 A;  3BQY A;  3GBG A;  4GRI A;  4HAM A;  3K69 A;  2STT A;  2V4H A;  3CWB D;  3LW5 H;  5CJ0 A;  1O7L A;  4U0W A;  2KHM A;  1FE6 A;  2K9Y A;  3OYH A;  5HVQ C;  1BE3 G;  2D2C B;  3L4F A;  4WK8 F;  4QPO A;  4G8X A;  3S1K A;  3I56 I;  3I59 A;  3CJN A;  1EF4 A;  4HYE A;  1VQP P;  2ID3 A;  1YLF A;  3CLO A;  2KP6 A;  4UB8 H;  1OPC A;  5JHU A;  3RZD J;  1NU1 D;  2WWW A;  3L71 J;  4WXC A;  1IO2 A;  3T8R A;  1SMY F;  3QH9 A;  3HBL A;  3WUV A;  2JTV A;  3RJP A;  4BAC A;  1BGY J;  4YFX F;  5M5W J;  5FLX K;  2OA4 A;  1HCR A;  2N1T B;  1NK2 P;  2Q3I A;  1SQB E;  4GFB A;  2R7Z J;  3GFJ A;  3ZQL A;  5ICE A;  1G3W A;  4F55 A;  2Z16 A;  3KP6 A;  3I5U A;  2UV1 A;  5C39 A;  5KLV D;  2L9V A;  4HNT A;  1T39 A;  3MZY A;  5GTI H;  1LKX A;  3W2V A;  4ENK A;  2ZT9 B;  4Y52 J;  1ITY A;  1J1D B;  2YO2 A;  1NOH A;  1YHQ I;  3H1L G;  2L4M A;  4BS9 A;  3K7A J;  4E7I A;  1SQP G;  5E1Z B;  3O8G A;  1YS6 A;  3M8F A;  2E74 C;  1X0T A;  4YXD C;  1N73 A;  2MD5 A;  4A3M J;  1WZ2 A;  2R7X A;  3AE3 C;  3A1Y A;  3J81 K;  1UG2 A;  1FJK A;  1JY2 P;  3MZW B;  2DMT A;  4PD4 H;  3QOP A;  1JB0 J;  5CCG A;  4EJW A;  5TRD A;  3CTA A;  3GTO J;  4UY8 I;  2W8Z A;  2FFD C;  5ICF A;  2K02 A;  2PAJ A;  2HVR A;  3GTQ J;  1KB9 I;  1EH8 A;  1RQU A;  4XRS G;  2R7F A;  1SQX D;  1YTZ I;  3CCV I;  3D0S A;  1VI0 A;  1R5L A;  2Y31 A;  4RMN A;  4UUV A;  1P2F A;  4LOC A;  1YS7 A;  3WTZ A;  3OYC A;  1CZQ A;  2Y0D A;  2BCC D;  4C7R A;  3H6P A;  1ZRC A;  1N7S B;  1GXQ A;  3NFQ A;  1X3U A;  4H4K C;  1QX8 A;  3C9I A;  1SFU A;  2A05 A;  3QP6 A;  1SQP K;  3BG3 A;  1E5W A;  2QEX P;  1AA7 A;  3FK7 A;  4BJT A;  2HR3 A;  3DCF A;  1FPQ A;  1WPK A;  1FZP B;  1WJ5 A;  4AUX A;  1YO5 C;  4PJ0 H;  1Q7Y Q;  1ZN5 A;  2R44 A;  4CXF A;  3H32 A;  1FJP A;  2FX0 A;  2BYV E;  1YHQ P;  2CMP A;  3VEP A;  4A5M A;  1LFU P;  1U8B A;  3S9O A;  4HSR A;  1RF1 C;  3LWF A;  1HLV A;  1DD4 A;  3R4Y A;  2XKP A;  1SQP E;  1FYM A;  2R3C A;  4BXX J;  3DPL C;  3ZMT A;  2F4M B;  2LXC B;  3R2P A;  3KZI H;  5EGO B;  4CPG A;  4OU0 A;  1VQ5 I;  2JKV A;  4QTR A;  3WTV C;  4BY1 J;  1K6O A;  3RK3 E;  4GYI A;  5J4Y A;  3GZ6 A;  5L8R J;  1LTJ B;  4Y7N J;  3BAS A;  1CF7 B;  5EEH A;  3L75 J;  2LKS A;  3JTH A;  1ZH5 A;  3LW5 J;  2AXC A;  2X4H A;  3AE4 C;  2JRT A;  4A2U A;  3C8V A;  1H0T B;  2CUZ A;  2XAG A;  1OKR A;  1NTM D;  5HLI A;  3KPE A;  2OJE D;  2D2C D;  4IOI H;  3RQ4 A;  2H1L A;  2DDA A;  4HV5 A;  4J19 A;  1FBS A;  4Y28 J;  2YXR B;  2LF7 A;  3CCE I;  2WAQ N;  3S1M J;  2RC4 A;  5KAI C;  1G6N A;  1D7M A;  1WGX A;  3H35 A;  4GDF A;  2CSO A;  4RLF A;  3OA7 A;  2RH0 A;  2DOF A;  3WTY C;  3H1K J;  3F8N A;  5HDG A;  1IZ1 A;  2FQ4 A;  5DJU B;  3NTN A;  3G3Z A;  2Q2E B;  4JP0 A;  4RB0 A;  5K7F A;  1EJ9 A;  3CMY A;  5KLI B;  4WVZ A;  3MZ8 A;  3HD7 D;  1LFB A;  3EYI A;  1JUP A;  4ASV A;  4EV0 A;  5LGN A;  3QYE A;  4G7O F;  1FC2 C;  2O1K A;  5BOX A;  4Y99 B;  1U2W A;  4G94 A;  3SZT A;  3S2D J;  1LVK A;  1RZ4 A;  2DMQ A;  3M9A A;  3ERM A;  1LVA A;  1WHU A;  1HF9 A;  3K4N A;  1S3J A;  5HOD A;  3DTI A;  1R71 A;  3OL3 A;  3E5X A;  1PUE E;  3C1D A;  5GTI E;  3JAM Z;  4NPE A;  2O0Y A;  1X4O A;  4KIT B;  4EM1 A;  4KJZ A;  1ZK8 A;  2GA1 A;  2WT7 B;  1JJ8 C;  4JYC A;  1K8A Q;  2HOD A;  1K4T A;  1AFO A;  1GK6 A;  4RBO A;  2V1U A;  2ETH A;  2P1J A;  3U1D A;  1GMJ A;  2DO7 A;  4II2 A;  4RES B;  3R4K A;  2L2O A;  2A6E F;  1IG7 A;  4HG2 A;  3V2N A;  1I3A A;  3KEQ A;  4LK1 F;  1JEK A;  3V6I A;  1SFC A;  2DAO A;  2A06 E;  1A02 F;  3IKV A;  4OGQ D;  4DZJ A;  1GL2 D;  4P1W A;  3HOU J;  2O1J A;  5IP9 J;  4OGQ B;  4BL0 B;  4I2O A;  4C30 A;  2H8W A;  2XSJ C;  1LFP A;  1AV1 A;  1Y6I A;  1OVU A;  4DJG A;  2R5Z A;  2G8Y A;  1PGO A;  3ZCO A;  1NKZ B;  2JDI H;  1Z05 A;  2QCO A;  3MHV A;  2EH3 A;  5HLT A;  1YQ3 C;  1QEX A;  1MH3 A;  1LB2 A;  3P8C E;  4E7Z A;  2H27 A;  2BCC E;  2GIV A;  2MJZ A;  2OTK E;  1X1P A;  3K4C A;  3R6S A;  5GPC A;  1IRG A;  2KS1 A;  4KYW A;  2XAS A;  5K1Y A;  1B1B A;  5HS8 A;  3I55 I;  1Z6T A;  3OOP A;  2ISY A;  2MD0 A;  2DA1 A;  4D9J A;  2ZNY A;  1HSJ A;  4B43 A;  2QGU A;  3ECO A;  3TED A;  1LEB A;  2E42 A;  4M3F A;  5L3F A;  2XB0 X;  3BCB A;  4ZZL A;  3I55 P;  2M87 A;  3PTZ A;  2DFE A;  2EJR A;  1UIX A;  3O6B B;  1R7J A;  4DOZ A;  2FXM A;  2O3J A;  3GG2 A;  2KS1 B;  1GU4 A;  1EZV G;  4AVZ A;  3NAU A;  1FZC C;  1BR4 A;  3JCU C;  5H20 A;  1XB4 A;  1K79 A;  5E3N A;  1GK4 A;  3L74 J;  2Q6Q A;  2LBF B;  1EZV D;  4EJO A;  4IHV A;  2K37 A;  2KOG A;  4TLF A;  1ETK A;  2EV0 A;  1KTM A;  1P6R A;  1RH5 B;  3LA3 A;  3LA2 A;  1OCO H;  1DGR M;  4CDG A;  1MSF C;  2XB5 A;  1R49 A;  3BTC A;  1HTL C;  5JI6 A;  4H13 B;  3FXO A;  4KHX A;  2X6O A;  2JA7 J;  3VOP A;  1O3S A;  1W0T A;  2NVU B;  1WJD A;  3ZQG A;  5E79 E;  3E5U A;  3HE4 B;  2Q5U A;  4A3D J;  4ZZD A;  2Y9Y A;  2OQG A;  3I0T A;  2N1T A;  3B5N D;  3J81 Z;  3CUQ B;  1F43 A;  5CCH A;  1ZYR F;  2Z9O A;  4PJJ A;  3DLA A;  3HC7 A;  3L9F A;  3AEC C;  4XQF A;  4MO7 A;  4XKC A;  1OCZ H;  2R5Z B;  4I0B A;  5JVG F;  3CC7 P;  3OIO A;  3ABL H;  1IN7 A;  2R7W A;  2IYO A;  1ULY A;  3GXO A;  1FZG A;  2YXQ B;  3HE5 B;  3F8M A;  1FT9 A;  1VZ0 A;  3HSE A;  3HUG B;  3FWL A;  4RM3 A;  2ZJR F;  2OTJ I;  1JGG A;  4G6D A;  2W84 A;  2K3P A;  3W3C A;  4EM0 B;  2QLZ A;  3OV8 A;  1SFO J;  2CO5 A;  4DZO A;  2TRT A;  4NHJ A;  1JTH A;  3SSU A;  1YIT P;  3TSI A;  2OZ6 A;  1EZV E;  4A6D A;  2XAQ A;  4IQ4 A;  3L2R A;  1PL5 A;  2K27 A;  2BCC J;  1R58 A;  2YS9 A;  2EFN A;  3BVH A;  2LRD A;  3I9V 2;  3GTG J;  3CQZ J;  4DYR A;  4ZYG A;  3ESW B;  2F6C A;  3W68 A;  2R0Q C;  5LBQ A;  2DCE A;  5EG0 A;  3WTU C;  4AYB A;  2DQR A;  4P9U A;  2I10 A;  3JRG A;  5H6R A;  3GVA A;  1I50 J;  2FXA A;  3AG3 H;  4RGU A;  2WB1 A;  2XDJ A;  4DJA A;  2XV5 A;  2YKQ A;  1VQK P;  3CCE P;  2R7R A;  3DP7 A;  3CF2 A;  2WAD A;  3JSO A;  3L75 G;  5AON A;  3K1N A;  2ZB9 A;  2ZBK A;  2H89 C;  3L2V A;  3RBZ A;  3BJO A;  3G4S I;  3WU0 A;  1I1S A;  1IJD B;  2JVG A;  3GEZ A;  2AO9 A;  3PM1 A;  2O8K A;  2XAU A;  5K7H A;  3FIW A;  3CXH E;  1BSH A;  4Y3O A;  1EDJ A;  1T3U A;  1LT9 C;  1STZ A;  3K1P A;  3G4S P;  1S9H A;  1LGH B;  2OTJ P;  3VDX A;  3CUQ A;  3KLO A;  2DK8 A;  2LY2 A;  1BOB A;  2GXG A;  3ZRG A;  1U5T A;  3B5N C;  1SFE A;  1OYY A;  3HM5 A;  3JW4 A;  1FOY A;  2NVY J;  2GOX B;  3CP2 A;  2PJP A;  3OL4 A;  1TT0 A;  3AEF C;  1R1V A;  1A36 A;  3CCV P;  3CDI A;  2WAQ A;  2QA4 I;  2BEQ D;  3CCJ P;  3R0J A;  1Q1H A;  1T08 B;  2LY9 A;  3H9Q A;  1OYW A;  2GOM A;  1XTA A;  2DLL A;  2KUB A;  3NRV A;  3V8J A;  1XD7 A;  2STW A;  1KFN A;  3RKY A;  2LYC A;  1TP4 A;  3MWM A;  3T5X A;  2GBY A;  1W0U A;  1LEA A;  1I5Z A;  5DDG A;  2O9L A;  3H25 A;  2UZK A;  2M7B A;  3H1H G;  1DU6 A;  1RE4 A;  1AVY A;  1AQ5 A;  3IRR A;  2KJC A;  2HQR A;  4KMU X;  4IHT A;  1BGY D;  4KT5 C;  3QRF F;  1ZP0 C;  3RDI A;  3PH0 A;  1BDC A;  2Z5H A;  3D71 A;  1MMS A;  3I4P A;  2QKL B;  1IUF A;  2IXS A;  4PJN A;  1WJF A;  4WX9 A;  1B4A A;  4J00 A;  2RKH A;  4EGY A;  1LWU B;  3H5N A;  1NTZ J;  1KQF B;  3A03 A;  3H5R A;  1PPJ D;  2KRF A;  3MKZ A;  3F9K A;  2R7S A;  3WGH A;  3OYL A;  3P8C D;  2POH A;  2R7T A;  2WSE J;  3OYD A;  4F93 B;  4V19 K;  3MKY B;  2VOO A;  1BCC G;  3CXH I;  5GAG J;  2PG4 A;  5FD5 A;  1UEL B;  1IAW A;  1JMM A;  1Z56 A;  1ZGJ A;  4C3H J;  3LOC A;  2FYU J;  2VC0 A;  2P2U A;  1X58 A;  3E1S A;  3UIA A;  4HLY A;  1OW8 A;  4OIR F;  1GVD A;  3L09 A;  4KIB A;  4E4H A;  3L2C A;  1N75 A;  5FKN A;  1BGY G;  2HVS A;  1LTJ A;  4LGW A;  1FOX A;  1N25 A;  2B87 B;  3VP9 A;  2KZV A;  3RI4 A;  1OYI A;  4F7Z A;  4KN4 X;  3ZQH A;  3JCU E;  3GF2 A;  2KIQ A;  2QM3 A;  1N78 A;  2K88 A;  2P6S A;  1Z91 A;  1YRN B;  2DA3 A;  1PGJ A;  4WWI A;  5HNF A;  3S2H J;  2FFD B;  2E5Y A;  1TNT A;  3SXY A;  4E7J A;  3WG7 H;  1KIL E;  5E3M A;  3J7A O;  3SDG A;  3V4G A;  2HFH A;  4D6T J;  3CJR B;  1SVO A;  4AIK A;  4I01 A;  1LT1 A;  1JY3 O;  4LGD E;  1PFI A;  4EJU A;  1SQB G;  1YJ9 P;  2ZXW H;  4MHG A;  1W2B O;  1WSU A;  4CH7 A;  3JTG A;  2V7Q H;  2G7U A;  2K5C A;  5D5V B;  2DDB A;  1VFC A;  3DWL E;  1XTG B;  3BOQ A;  3SEZ A;  2DW4 A;  5C44 J;  1Z3X A;  3HZJ A;  5CQG A;  1ZGW A;  3QU3 A;  1ZOY C;  2RMZ A;  1Y0U A;  2VBX A;  4XM3 A;  3JSP A;  2BXZ A;  1BCC E;  1LWU A;  5F0F A;  1PIX A;  1EDL A;  3OYI A;  1TC3 C;  4KN7 X;  1BBY A;  1NTM K;  3K6G A;  1XDU A;  4C7N A;  1IN5 A;  4BY7 J;  1UHM A;  2VXD A;  1XCB A;  3EUA A;  4XMY A;  5E8I A;  2YNY A;  2MBF A;  2KFD A;  5E3L A;  4YIR X;  1VQ8 P;  5M3F J;  1NU1 G;  4XID A;  3V4W A;  1B9N A;  2CS3 A;  2W48 A;  1VF5 B;  1FJL A;  1KYW A;  5F64 A;  2IBZ I;  2HTS A;  3CME P;  4BQQ A;  1VTN C;  2BEZ F;  2DMP A;  4BXU A;  2IBZ G;  1VQN P;  3TBI A;  2FYN B;  1JY2 O;  3CX5 I;  2KKO A;  2OAR A;  3CWB G;  3I4M J;  3RPU D;  2GM4 A;  2QA4 P;  1MND A;  2KLO A;  1J9I A;  1NAY A;  4LB5 A;  2M45 A;  1IN8 A;  4A3K J;  2IZ0 A;  4RO0 A;  1MMN A;  1ZAO A;  2DYS H;  2VT2 A;  1XX5 A;  5J3L A;  4LIT A;  4DQ2 A;  5KHD A;  1GXP A;  3AG2 H;  2B9B A;  3CI9 A;  1KQ8 A;  4AUW A;  3K2A A;  4MIM A;  4YFK F;  3L72 D;  1TL8 A;  2ZNZ A;  1UCR A;  2ZSH B;  1I39 A;  2VJI A;  4ON0 A;  2WSC H;  4DNC A;  2L02 A;  3FKI J;  4UUS B;  1FMV A;  5E8G A;  3TYY A;  4YEJ A;  3TMO A;  1RET A;  1PZQ A;  3PFY A;  1HBW A;  2XSD C;  4AIJ A;  1O7F A;  2PJR B;  3H1L E;  3FGA D;  2YSR A;  2HQ5 A;  2BOL A;  5KAI E;  3ZP5 A;  2JRM A;  2HOS A;  1U7M A;  3P7N A;  1D5Y A;  3QP5 A;  2CK3 H;  2IFM A;  1A04 A;  5IPA A;  3DF8 A;  5CJ9 A;  2DOD A;  2QBY B;  5DTD A;  2BY3 A;  3DQV C;  5TIS E;  2AXL A;  2PBI A;  5J47 A;  2VOP A;  4J01 A;  1IDZ A;  1K61 A;  4MN4 C;  1HA8 A;  1XGM A;  4M9Z A;  4O3M A;  1J2J B;  2A45 I;  2K86 A;  1FU1 A;  3TNU B;  3RK3 C;  4IL6 X;  1L0O C;  1U5T B;  3R61 A;  5F1R A;  3VB2 A;  3H1J J;  1SFC C;  1VQ4 P;  4DYC A;  4XOP A;  5CLS A;  4EGZ A;  4NC8 A;  3CCS I;  1R36 A;  1TW2 A;  3CC2 I;  1KIL A;  1J2X A;  3CLQ A;  4HX8 A;  3SQN A;  2DA7 A;  1JCD A;  2VB6 A;  2M0C A;  1NHL A;  5KJ7 C;  1L4A D;  3R60 A;  1EH7 A;  4PK4 A;  4LLL A;  1PDN C;  3B73 A;  5CVU A;  4EEF G;  2PX9 A;  1Z21 A;  3E1R A;  1ZHF A;  3GCM A;  3CUO A;  4NPF X;  5GAE J;  4U3F E;  2NS7 A;  1MJB A;  4W1U A;  2Y0S A;  2L9N A;  3SEQ A;  1GTW A;  3NQO A;  3HPH A;  4JX4 A;  3L72 G;  3LFU A;  4HRI A;  5APY A;  4WY4 C;  2EV6 A;  2DFH A;  1VF5 C;  4EM2 A;  5TJH A;  3W6J B;  1LNQ A;  3S2W A;  1IK7 A;  4D6T G;  3BDD A;  1MGT A;  1ETW A;  4XK4 A;  2Q9I A;  1DPU A;  5DUI A;  2FYN C;  3CMA P;  1U5T C;  5DCM A;  4JYB A;  3BJA A;  2RGV A;  4XNF A;  3L70 D;  1KYO H;  4NUB A;  1L0N D;  2KP8 A;  1R23 A;  3SFZ A;  1SQQ E;  1P9Q C;  1YJW P;  4MQV A;  2VQC A;  3IV5 A;  2DT7 B;  5HDN A;  3BRO A;  4I98 B;  4U3F G;  5CVR A;  3COA C;  5APQ A;  4D5C A;  1QHG A;  3TQN A;  2QYO A;  1TNS A;  1KFM A;  1OXZ A;  2PMH A;  5E1X A;  1QQI A;  4IL6 C;  1USD A;  3BQZ A;  3BTI A;  4DCK A;  2E75 B;  2K3R A;  3V5B A;  3D6Y A;  1TWH J;  2JMW A;  2MSY A;  3MFK A;  4KT0 J;  5EJC A;  3CL3 D;  1X1C A;  3ASO H;  3SWK A;  4LG0 A;  2G0E A;  2WSF J;  3LSH A;  3E7L A;  1HJ0 A;  1UG0 A;  1WVR A;  2HXI A;  1HC8 A;  3S17 J;  1SQQ G;  2V7Q J;  2J5U A;  3PL8 A;  2BY1 A;  1FEX A;  4M3D A;  2XAJ A;  3A01 A;  5DM6 F;  3H36 A;  3HSF A;  1FBQ A;  5BPI A;  5IYC J;  2X48 A;  2I8D A;  3ONQ A;  4CA0 A;  3P9C A;  3Q3S A;  2W6B A;  1KQS O;  1I1G A;  1U57 A;  2OCE A;  4IL6 E;  2QQ8 A;  5D4S A;  2MC4 A;  3LFK A;  3DPT A;  3D5R C;  4PZJ A;  4OOI A;  3PIO F;  2DOA A;  3B02 A;  2JZY A;  1NH3 A;  4XRM A;  3FXM A;  4LB6 B;  4PUS A;  3S32 A;  3KIO A;  3S3M A;  4XLA A;  3J80 Z;  1YQ4 C;  5ILV A;  3EDP A;  1KU9 A;  1P92 A;  2K9Q A;  2XPW A;  4PDK A;  1MH4 A;  5AW1 B;  1JT6 A;  3H1L D;  3CO6 C;  2AQE A;  4BDY A;  1ZRT D;  2E74 D;  3AEG C;  3V7C A;  4AVP A;  1XS9 A;  1E17 A;  2LXB A;  2XKM A;  2ZVO B;  3GF7 A;  3OMY A;  1DPR A;  2EIK H;  3EUH C;  3RK2 B;  4Q48 A;  2W82 A;  4BXF A;  1ONV A;  4LC1 A;  2DPD A;  1Z0X A;  3A5T A;  3S16 J;  1MZB A;  4XN0 A;  2LFB A;  1ZXG A;  1VQ9 I;  3VYU B;  3IUO A;  2X9D A;  1VQO P;  1S72 I;  5KKZ C;  3M9Q A;  2M8R A;  3F89 A;  2R93 J;  4G6T B;  3H0G J;  2A68 F;  1V5E A;  3DBR B;  4F92 B;  2P81 A;  3CJT B;  5A2Q K;  1HGZ A;  3U1C A;  4KT6 A;  1IFJ A;  3BCC E;  2FXO A;  2WA0 A;  2K4J A;  3KFW X;  4NB5 A;  5LFA A;  2A45 G;  1GL2 C;  2FXP A;  4S0H B;  3L71 E;  4ZKU A;  2NYX A;  3FWE A;  2QSH X;  1L0L E;  1JO5 A;  4XLE A;  4KFC A;  3L2Q A;  4MNU A;  2OUM A;  2WAF A;  2DOE A;  3RIR A;  4H44 D;  3WUU A;  4GO1 A;  1R5S A;  3WE2 A;  1LTS C;  2LY1 A;  2FOK A;  1X8Y A;  2E5N A;  2KIK A;  2Z2S B;  1WH5 A;  2ZXX A;  2OGU A;  4CIC A;  5APT A;  4MTD A;  3MGN A;  3HE4 A;  4C7N B;  1EH6 A;  2ZJP F;  1EZV I;  3TDK A;  2M34 A;  1KB9 E;  2AXT C;  2K4B A;  4HPQ A;  4L9J A;  4OWR B;  4AU7 A;  5M5Y J;  1Q90 D;  1VF5 D;  1KU2 A;  3HOY J;  2XVC A;  4BGD A;  5KKZ B;  2YU9 J;  1A31 A;  2QSI A;  4OMY A;  5F6F A;  1BW6 A;  1FZC B;  2IA1 A;  4E7L A;  2F4I A;  2A45 H;  4ANJ A;  2QM8 A;  3CES A;  3H1H D;  3CX5 D;  2OZU A;  2CW7 A;  1L0L D;  3TNU A;  2HZD A;  3MD2 A;  2DMU A;  1FOK A;  1LTA C;  1JTY A;  2YIU B;  1UAA A;  2XGC A;  2MH2 A;  5BMZ A;  2PLY A;  3AE8 C;  2H6B A;  2L7F P;  1K73 Q;  4CYC B;  2CQK A;  3JSV C;  1SP4 A;  1ETQ A;  2MAB A;  5DD8 A;  3CDL A;  5BU8 B;  1R8E A;  2VLA A;  1Z9C A;  5LRS A;  5KLV G;  3CCR P;  5D5U B;  1FTZ A;  2M4G A;  1YOV B;  2V9V A;  1U9N A;  2B0L A;  3BJ6 A;  3S93 A;  2X1E A;  4K3A A;  3CCR I;  3S15 J;  1LJ9 A;  2ZME B;  1TQM A;  2E34 A;  5E3O A;  1KN7 A;  1Z67 A;  3H1I D;  5KAF H;  2Y0S N;  1N73 B;  4Q4Z F;  4Z1M H;  1Z77 A;  1K78 A;  2I5U A;  1GW3 A;  1YX3 A;  1T3J A;  3WTS C;  1JTX A;  3PQK A;  3WE3 A;  2E2H J;  1YJN P;  4ZYD A;  1ZR4 A;  1KOR A;  2COB A;  2ZO4 A;  5E18 F;  1Q2N A;  3BCC J;  4JQF A;  1VF9 A;  1P4X A;  1WJA A;  1OIS A;  3ZMD A;  5B5E C;  3C3W A;  1QVF O;  1X3W B;  1P4W A;  1SQP J;  2QE7 H;  3H9G A;  2JK3 A;  2KIS A;  4IRG A;  3LST A;  1QL1 A;  2E7W A;  4A93 J;  1CF7 A;  1XC5 A;  3I3L A;  3DPU A;  4F91 B;  3N05 A;  1FSE A;  3IWF A;  1SLQ A;  1OZH A;  5APU A;  3L73 J;  1EXJ A;  3A0H H;  3IP4 B;  1F1Z A;  2JQ7 A;  1TWG J;  1SVF A;  4EJT A;  2NVT J;  3ULQ B;  2M1B A;  2KIM A;  2VAS A;  1IUY A;  2ZME C;  2D2C C;  1IRX A;  3BP8 A;  1JKP C;  4XIC A;  2WVR A;  3U59 A;  1EDK A;  2HPI A;  1MFT A;  2CQ7 A;  3TDU C;  3TGN A;  5EFW B;  5KLV E;  2JWT A;  4XKB A;  1VQL P;  4IO9 F;  3AE6 C;  2HOT A;  1KQ9 A;  1D0X A;  1OQY A;  1SVM A;  2LRE A;  5APW A;  1Y8A A;  4MLO A;  2O6G E;  4LIU A;  2O5R A;  4YXW H;  1QPM A;  1KU7 A;  4JBA A;  1BIA A;  5BPD A;  4Y15 A;  3G6E P;  2FU4 A;  1L2P A;  2GWR A;  2E1O A;  3II6 A;  4TT3 H;  3ZQI A;  4AM3 A;  2W00 A;  2E1C A;  3HTK B;  5ILS A;  2P58 A;  3LQR A;  1LPQ A;  2XDV A;  3OS0 A;  3WU1 B;  2NNY A;  9ANT A;  4BBS J;  4N3Y B;  3I71 A;  1V54 H;  4UVC A;  2HI3 A;  2MLK A;  1H0M A;  1FOS F;  5F27 A;  2SPZ A;  1WRG A;  2JEE A;  2WT7 A;  2X51 A;  1SFK A;  3V2P A;  4XLH A;  2YUS A;  5TIS C;  4BEH A;  3FMS A;  2HDW A;  3ABK H;  3M7G A;  3OR1 C;  5JLX A;  3VYR B;  2LR8 A;  3BPV A;  3I58 A;  2E1M C;  3D1N I;  5D4R A;  5JLW A;  3HTK A;  4N4O B;  1B8I A;  1L0L K;  2O3F A;  1KYO I;  1LDJ A;  4M6X A;  4XLF A;  3JRB A;  5EYR A;  2AEM A;  4DGW B;  4HB1 A;  4BU2 A;  1H9T A;  3IHU A;  1GHC A;  2NPS A;  1F9N A;  5KVR A;  2XKO A;  3LMM A;  2WY7 Q;  2DJN A;  2KNC B;  1R5G A;  1B72 A;  2D1H A;  3CXH H;  1OMI A;  1QZY A;  4MQ9 F;  2IX7 C;  4HJG H;  1CI6 B;  3Q5S A;  4EQQ A;  5DM7 F;  2XF7 A;  1QO0 D;  1W5C C;  3KYD B;  3Q3D A;  3JRA A;  2M8E A;  1M56 D;  3AEA C;  2LC2 A;  3PNT A;  2VN2 A;  2W6A A;  1RES A;  1FS0 E;  2KRC A;  3ZN1 A;  1OVR A;  3VFZ A;  1LJ2 A;  1E79 H;  3K2Z A;  2L54 A;  4G7Z F;  1QA6 A;  1UHS A;  2PMZ N;  5IT9 Z;  2Y30 A;  4CCL A;  5JVT A;  4I2L C;  4HEA 2;  4L9N A;  2IBZ E;  3P9K A;  2MC3 A;  3M07 A;  3OS1 A;  1KB9 D;  3GF3 A;  1MMG A;  2H8P D;  5AVX B;  2LMD A;  2E5Z A;  5AW4 B;  3OOU A;  1PP9 G;  2JUC A;  1YTZ T;  1EC5 A;  2QEX I;  2MA3 A;  2FJ1 A;  3GHG B;  4P9F A;  3EYY A;  4Y13 A;  1RC9 A;  1S9K E;  1QZZ A;  4HV6 A;  4JQ0 D;  3RK2 D;  3F0C A;  3DEU A;  1D1A A;  1AU7 A;  3BCC D;  1U78 A;  1W1W E;  3QYF A;  2FYU K;  2B7E A;  3BG6 A;  1G3S A;  2IJL A;  3G6E I;  3PNY A;  3PHL A;  3M0A A;  3KPH A;  4HA8 A;  2L5G B;  4I6M C;  1OLT A;  2XPU A;  3RPQ A;  1NO4 A;  3B5N B;  4U0V A;  2Q3E A;  3ZQC A;  1U6G A;  3OYJ A;  5ILU A;  1GW4 A;  3JRH A;  2QKM B;  2IYP A;  1ZG3 A;  2OU2 A;  4N9H A;  3OSG A;  1REP C;  5CKT A;  3QU6 A;  4RLQ A;  5ICG A;  1OR7 C;  2M8G X;  3GFM A;  1YW7 A;  5CQE A;  2GIZ A;  1PGP A;  4EOT A;  5IP6 A;  3AL0 B;  3ABT A;  2F4O B;  2HYG D;  4A12 A;  2L0K A;  1URQ B;  3HD7 C;  4B3A A;  3CO7 C;  1LT9 A;  2E43 A;  1IXC A;  2VPL A;  1S5L X;  2KZI A;  1XSD A;  1KIL C;  3KZZ A;  3ZQQ A;  2P6T A;  1ETX A;  3LA7 A;  2CV0 A;  5AW3 B;  3CC2 P;  3BTL A;  1J09 A;  4WCG A;  2GLO A;  4BE2 A;  3N4M A;  2ZC2 A;  2FBW C;  2QG4 A;  2V6C A;  1SD7 A;  1Y56 A;  5CBN A;  1W2E A;  3J80 K;  3HKZ N;  4RB1 A;  2A6H F;  1WJC A;  2DMN A;  2R5Y A;  1N86 A;  1NH4 A;  3H1C A;  4FE7 A;  4GDO A;  3ZN0 A;  5HLG A;  4M3E A;  1JI8 A;  4A3B J;  1KQ0 A;  2TCT A;  1P84 H;  5J8C A;  4IHY A;  2E1M B;  1HXD A;  4DIQ A;  2NS0 A;  5EG0 B;  3GTK J;  2C0W A;  3MZH A;  2ZFU A;  2PJR A;  2F2E A;  3M8E A;  4CZZ A;  5M1B A;  5CVJ A;  1K7A A;  2RQP A;  1ENH A;  3W6V A;  1DEE G;  1MKM A;  1RR8 C;  3GZN B;  2ZJQ F;  1R6R A;  4EMS A;  3CPW O;  2IA2 A;  3CWB E;  2DU9 A;  3WUT A;  3F72 A;  3ERE D;  2FEZ A;  1CQT A;  5LEK A;  1HKQ A;  1X19 A;  3Q5F A;  3QOE A;  5AVQ B;  5L3E A;  4RGR A;  3I64 A;  2YX4 A;  5FLV A;  4DBQ A;  4BHC A;  1F4K A;  4OH8 B;  1BW5 A;  2LOO A;  3VYS B;  2QM7 A;  1R22 A;  1Y8R B;  1UFM A;  2QQ9 A;  5E79 H;  4IOA F;  1FSH A;  2NPS C;  2HYJ A;  2M9H A;  1SAU A;  1J1D C;  2LKP A;  3HE5 A;  1HWT C;  3KP7 A;  1ETV A;  2MLG A;  4A3C J;  2R5B A;  2HS5 A;  3IAS 2;  1A02 J;  3PIP F;  4G7H F;  3O6Q A;  4IFF A;  4FE4 A;  2W1O A;  1UST A;  3TDZ C;  2PMZ A;  1ZW0 A;  3C1L A;  3CCJ I;  1T6A A;  2L3D A;  2KLV A;  3SDB A;  4K2E A;  1SQB J;  4C2U A;  2IVM A;  3I5C A;  3S1R J;  3BY6 A;  3IWZ A;  4XKW A;  2HDC A;  1W7P A;  2JT1 A;  3CJQ B;  4X1E A;  3J7A Y;  2JWA A;  1VQ6 P;  1GZL A;  4HF1 A;  3C2B A;  2X6X A;  4JK1 X;  2DA5 A;  2FBI A;  2IGK A;  2HGC A;  3N97 A;  1D3Y A;  2FQ3 A;  2CQX A;  1IF1 A;  4A3L J;  2VXZ A;  2A06 G;  1JGS A;  4ZYE A;  5AW8 B;  2FOW A;  2EIL H;  2HWV A;  3LSP A;  4KA4 A;  2A3S A;  1N7S C;  4OIO F;  4BWN A;  5DCM B;  1IJW C;  4KDP A;  4FTH A;  2Q7C A;  3CCU P;  5EZG A;  4E7K A;  2KZG A;  1WQ2 A;  2GXB A;  2V9K A;  1MZ9 A;  2KI7 B;  2G3A A;  2QJP B;  3KYC B;  2HXO A;  5FKL A;  3KEY A;  1GDT A;  2ZT9 C;  4LD5 A;  1T2K D;  1OCR H;  2LLK A;  5KAF C;  4FX4 A;  5JFR A;  1LE8 B;  3AL0 C;  3G1L A;  4IJA A;  2RN0 A;  2OYI B;  3BTJ A;  3GO5 A;  1VQN I;  2QVA A;  1ERD A;  5GAD J;  1SC7 A;  1HUC A;  3B4S A;  2V26 A;  1FIP A;  3DU6 A;  4IHX A;  3QOD A;  1ETO A;  3CME I;  3L7W A;  2L01 A;  2FYU E;  3HOW J;  2Q8K A;  4QLC U;  2H94 A;  4R4M A;  2YKO A;  3B6A A;  1KGS A;  1D0Z A;  1FLI A;  3MKW B;  3L73 G;  3FXQ A;  3NWT A;  1KYO E;  3UNG C;  3QQA A;  2OYI A;  2CV1 A;  4XL9 A;  3V2Q A;  3PUF A;  2Y0E A;  2Z4E A;  5KLI C;  3ZQF A;  1X3Z B;  2XRN A;  5F08 A;  3MN2 A;  2Y0M A;  2BXY A;  1B8I B;  1W7P B;  2UXN A;  2JVH A;  1T0F C;  2VT3 A;  3CCM P;  1FDI A;  3ABU A;  2NPS B;  1MDM B;  3OYA A;  2QQA A;  1Y9B A;  1EV7 A;  2YMY A;  4I09 A;  4PJ0 C;  2OAZ A;  5F04 A;  3U9G A;  2ICW G;  1JHF A;  1WFX A;  2ESH A;  1OFC X;  5E79 C;  4ZDO A;  3FXL A;  3S4R A;  4F3Q A;  2A61 A;  2G9W A;  3K10 A;  1T33 A;  2ZYG A;  3CCL I;  2KIU A;  4BQN A;  1KU3 A;  2DI3 A;  4XN3 A;  1QBJ A;  4M72 A;  2OYH C;  3FXE A;  1ZRE A;  5AW2 B;  1HGV A;  1S6L A;  1SFC B;  3A0B C;  2UUZ A;  4CO8 A;  5DS9 A;  2DN0 A;  2LVS A;  4D1Q A;  4Y99 C;  1RRJ A;  4QWQ A;  2MYS A;  5AVY B;  3HL2 A;  1RUO A;  2V6E A;  4CHU A;  2RNJ A;  1QZE A;  1MJ9 A;  4XRS A;  1V5F A;  3V7R A;  4XOT A;  1MSE C;  1R1U A;  3RGU A;  3FWN A;  5JHF A;  4CCJ A;  5IP7 J;  1M57 D;  3EFF K;  3W67 A;  3Q5R A;  1KQG B;  1JUM A;  2WC2 A;  1XDS A;  1RF0 C;  1Y1W J;  1HDP A;  3I53 A;  4ABZ A;  1PP8 F;  1DH3 A;  5HS7 A;  1YI2 I;  2ZFC A;  4IKF A;  2IGN A;  1J0R A;  1RUN A;  5E17 F;  3WGG A;  1KIL D;  1SMT A;  1OW7 A;  1FY7 A;  2ID6 A;  3JRI A;  1Q1V A;  3L1P A;  3V7S A;  3BRV B;  5KAI H;  3BCC G;  3HUS A;  5GTH C;  1NTZ K;  2IBD A;  5ICC A;  5M3M J;  4CCK A;  2BV6 A;  3WTX C;  2E2J J;  2XZR A;  1NTK D;  1FYK A;  3Q0U A;  4D0P A;  1AJY A;  1NTK J;  2PFX A;  3A7O A;  1OCC H;  3H5A A;  2CJJ A;  4Z2Y A;  1USS A;  4N6J A;  3UR3 C;  2P5L C;  1M1J C;  4XLC A;  1G4D A;  3E3V A;  3VMZ A;  1Z1D A;  1HKT A;  1QPI A;  4I7Z B;  1E3H A;  4PFO A;  3H1J G;  2B63 J;  1XGN A;  1XGS A;  1KMI Z;  1J7K A;  1RIO H;  2IEK A;  2E75 C;  3HTU A;  1TQI A;  4UB8 C;  4A0Z A;  3IFM A;  2F5V A;  4XA4 A;  4EI2 A;  1WI9 A;  2QBY A;  3QPL A;  1IK9 A;  2W7N A;  3LIE A;  2JSP A;  4IEJ A;  4M3G A;  5K5O A;  4M6Y A;  2R92 J;  3PLN A;  4BXL A;  1U7J A;  1Q81 Q;  3H32 B;  3P5J A;  5H2F E;  1ZG1 A;  2EK5 A;  2LKM A;  5CCG D;  1I27 A;  4RGX A;  3A2K A;  1BOA A;  5KTB A;  5GTI C;  1IV6 A;  4CYC A;  1DDN A;  1NK3 P;  3ITK A;  3CCL P;  4QSH A;  3KET A;  1QVG O;  1Y39 A;  3LSI A;  1LUJ B;  2RN7 A;  4G9Y A;  4HST A;  4UHT A;  4C2M J;  3F6V A;  1KIL B;  3OYM A;  1N2D C;  3AE2 C;  2JA2 A;  2L9S A;  2O8X A;  2W25 A;  1UII A;  5DD4 A;  5LD2 C;  3EUH A;  4I0A A;  1S8N A;  1BCC J;  1BJZ A;  3GLM A;  1ZLK A;  1WMK A;  4IL6 H;  4OGQ C;  1IV8 A;  1D8J A;  2ECB A;  2VJJ A;  2E7X A;  3MKL A;  4KMF A;  1SVL A;  2BY0 A;  2R7O A;  4JX6 A;  2C9L Y;  4DOJ A;  2QJK B;  5BU5 A;  1ZEL A;  2GA2 A;  4XON A;  2HOA A;  2CFO A;  3FMR A;  4RA2 A;  1RQV A;  1I6X A;  2VKE A;  2E74 B;  4ESF A;  4BQO A;  1WT6 A;  3F6O A;  3TW7 A;  3ZXS A;  5K5Q A;  4GT1 A;  3HRN A;  1JM0 A;  4LLN A;  3W2W A;  5LLQ A;  3BAT A;  5FO5 A;  4UUT A;  4ZJZ A;  5IOZ A;  4AYC A;  2W90 A;  1T6S A;  2KQR A;  3SZG A;  1TBX A;  2Z5U A;  1SQV G;  5L3D A;  3C2G A;  2HFE D;  2L7K A;  2Q1K A;  1MBF A;  4UXN A;  2LG4 A;  5AIP A;  1AVO A;  1M1K Q;  1SQB D;  2RV8 A;  2CG4 A;  1MBG A;  2LD5 A;  2WSF H;  1D8K A;  4N9I A;  1O3Q A;  2RAE A;  3RK3 B;  2RQQ A;  3BPX A;  1TT5 B;  4MGR A;  1YIJ I;  4ZC3 A;  2Z5I A;  4PV1 C;  4E6K G;  2DQL A;  4D5F A;  1SQQ J;  1YIO A;  1OCP A;  2IW5 A;  4L73 A;  2JN6 A;  5BNG A;  1A6Q A;  1R5H A;  3M1C A;  3HEF A;  4HDV A;  3F8B A;  1O4X A;  1YYV A;  1EQ7 A;  4WXD A;  3HUS C;  3DKY A;  4U7J A;  3AED C;  2ZXI A;  1PP9 J;  4OIN F;  3M0D A;  1DD3 A;  1KYZ A;  3HRS A;  1YFH A;  1S7E A;  3IAM 2;  3OYE A;  1WH7 A;  4KIS A;  3DTK A;  2WPS A;  1UHW A;  4QIW N;  5K7Z A;  1P84 E;  1X2M A;  3KCC A;  4NC6 A;  3A01 B;  2K9J A;  5DYM A;  3HJE A;  1JY3 P;  4N0B A;  3P32 A;  3CDH A;  4UV8 A;  2WSS H;  3K0L A;  2FE3 A;  3A0B H;  2IFN A;  2VKD A;  1ETY A;  2EFQ A;  1NTC A;  2H88 C;  2HVQ A;  2XPV A;  3HD7 B;  3H9J A;  1PJR A;  2FMY A;  1LE8 A;  2FNA A;  1G1J A;  3KE2 A;  2C6Y A;  2OCC H;  3FXU A;  5EDN A;  2R7Q A;  2WV1 A;  3CD6 I;  2J59 M;  4ZKP A;  1YW9 A;  3G9R A;  3TL4 X;  1UZC A;  2NRA C;  4L18 B;  2E71 A;  2HKO A;  2MGQ A;  3F21 A;  1NU1 E;  5B5E H;  1DIP A;  2K7L A;  5LGU A;  3VMY A;  3K1M A;  2DA6 A;  1JUS A;  1OW6 A;  3ABV C;  1JUN A;  3ML6 A;  4A3E J;  3A4C A;  2KNC A;  2FRH A;  4LG0 B;  4U3F J;  1NTK K;  2K3F A;  4UVA A;  1Z7U A;  4F52 A;  4OIQ F;  1CSB A;  3B8E B;  4OVN F;  4YII A;  1S5L C;  5APX A;  1NTZ D;  3OYB A;  1DUX C;  1D1C A;  4IHS A;  1SAN A;  1Y0N A;  4NQW A;  1GL2 A;  2ZXJ A;  1D5V A;  3B6C A;  3Q5P A;  2Q2E A;  4H0E A;  2HKX A;  1M90 Q;  2GUS A;  1YRN A;  5FFZ A;  2VL8 A;  2XC7 A;  4WB4 A;  3HYI A;  1JKO C;  4KIG A;  1LWU C;  3HTS B;  2QIW A;  4HX4 A;  1RKW A;  2NVX J;  2KK7 A;  2AEJ A;  3NEU A;  3M8J A;  5C4X J;  5CBO A;  2ITA A;  1FMW A;  1TTY A;  3TGU E;  4H0L C;  3RPU A;  1A6I A;  3AE9 C;  1GV2 A;  2P5K A;  2VKH A;  2LNB A;  3OY9 A;  1GD2 E;  1Z7L A;  2H1K A;  1TW3 A;  2BEO A;  1MJA A;  3ABM H;  4L0Z B;  1KV4 A;  1PGQ A;  3E97 A;  3RL0 D;  1LDK B;  4CCO A;  1LTB C;  3L73 D;  3VSK A;  3V4Q A;  1B72 B;  1JHH A;  3AG1 H;  1HQC A;  2M3E A;  3ROU A;  3ZDM A;  3FM3 A;  5FFX A;  1YE9 A;  4UNO A;  4NDL A;  1A5J A;  3IF4 A;  4NPD A;  3CMM A;  3BZK A;  3BR0 A;  2LTP A;  2W24 A;  2E60 A;  3E5Q A;  3SYT A;  1XTC C;  2PEX A;  2EIM H;  2OC6 A;  3TGU G;  2EA4 A;  4E7H A;  1BE3 D;  3TOB A;  2MH9 A;  1QGP A;  2Z33 A;  1RHZ B;  2L7M P;  1BL0 A;  3OWT A;  1BDD A;  4ZMD A;  3GZ5 A;  1YW8 A;  3FHN A;  3FF5 A;  1FIA A;  5J1U A;  3ZGK A;  3OYK A;  2GXA A;  3GMA A;  3WU2 C;  4CUG A;  1N77 A;  1YQA A;  2QJP C;  3HUS B;  4XFJ A;  2WV0 A;  1DQU A;  1XMA A;  5GTH E;  2JJL A;  2KIF A;  3DXJ F;  5D5X B;  4B3X A;  3S3O A;  3GFL A;  4LG3 A;  4LJZ F;  1JKR C;  2N8G A;  4C2T A;  1RPW A;  4B44 A;  1MMD A;  1TQP A;  3L74 G;  3PP5 A;  2Y48 A;  3H0D A;  3QWO C;  2IS2 A;  2IS6 A;  3L71 D;  1NG7 A;  2CW8 A;  1FP1 D;  3DLL F;  2AHQ A;  3CX5 H;  3L74 D;  2RDP A;  1J75 A;  2BY2 A;  2CUF A;  2COM A;  1WRJ A;  2FSW A;  2NS8 A;  2O61 A;  2V4J C;  1ZRF A;  3BR1 A;  5IT9 K;  4D6T E;  2K40 A;  3MUD A;  4YPC A;  2XU6 A;  3V42 A;  2H6C A;  2EV5 A;  1K78 B;  1T8Z A;  3G1M A;  1VQ7 I;  1OVV A;  3SFD C;  2N1T D;  2KRH A;  3B5N A;  5CCH D;  1R4M B;  2QSF X;  3FIS A;  4IVN A;  5IOY A;  5J8F A;  5B3S H;  1NTM J;  3WHC A;  5AW7 B;  2KMU A;  1L0N K;  3L36 A;  2FF4 A;  4CCN A;  4UUS A;  1U9O A;  1PUF B;  4W7Z A;  3TGU D;  2OTL I;  4X6A J;  4IOC F;  2WMM A;  1FP2 A;  1L0N E;  6PAX A;  1U3E M;  4ZNC A;  2R7V A;  1K4S A;  1FOW A;  2Z99 A;  2A07 F;  1T2K C;  3TK1 A;  3P9I A;  2X1C A;  1CW5 A;  4B09 A;  1JY2 N;  1L4A A;  2KSE A;  5B66 H;  3GFI A;  1W36 C;  4H44 B;  4RB3 C;  2H09 A;  1U0J A;  1MMA A;  1LDD A;  3U1K A;  1FX7 A;  4GYG A;  3EET A;  5B66 C;  3ZMZ A;  1G2C B;  3DU5 A;  4ETS A;  1KON A;  2CPB A;  1OIP A;  4U3F D;  4KIC A;  2L91 A;  1SD5 A;  3A0H E;  3O8Z A;  3AAF A;  5CVI A;  2F5E A;  1IFN A;  1MBK A;  4XBF A;  2R5Y B;  3Q1M A;  1L0N G;  2I1K A;  3G73 A;  4AD9 A;  3L70 G;  2VIX A;  3RKW A;  2KL4 A;  4Y4R A;  4A0Y A;  2CWE A;  3SFE C;  3KDP B;  3L2W A;  2XIG A;  3H3U A;  1RE3 A;  3EQ2 A;  4YIF A;  3NWS A;  3JRC A;  1YJN I;  1USE A;  5D6E A;  3JC2 2;  2AQF A;  1LNW A;  4XOR A;  1GV5 A;  4B4C A;  1YJW I;  5LGT A;  1FNN A;  3VPR A;  2QSG X;  1IXS B;  4R4L A;  3VN0 A;  3D6Z A;  4L74 A;  2OYI C;  2ADU A;  3AKZ A;  2R5D A;  2QVO A;  5AW9 B;  1YTY A;  4H0L D;  1WJB A;  3K4K A;  2DFF A;  4KJM A;  4LIV A;  1SQP D;  1XMK A;  3NMD A;  2IZ1 A;  2V7F A;  3OIQ A;  2WPV B;  1VQP I;  3HKZ A;  2CV2 A;  1ZRT E;  1RF1 B;  3GUD A;  3HRU A;  4GXO A;  1AHD P;  1R1T A;  2F5F A;  4M3B A;  3FXK A;  4O6J A;  4RDU A;  3JR9 A;  5IYB J;  4U7B A;  3KYQ A;  1XCV A;  3HOS A;  1YIT I;  3GTP J;  2JSC A;  2BVL A;  1R9T J; 
#chains in the Genus database with same CATH homology
 2GOX B;  3CP2 A;  3OL4 A;  3PSF A;  1TT0 A;  4NC7 A;  3FBI B;  5CQE A;  2WAQ A;  4BE1 A;  4DBR A;  3AL0 B;  3KX2 A;  2ELJ A;  3H9Q A;  4B48 A;  1D0Y A;  2GOM A;  4HNU A;  2KUB A;  2VPL A;  2RNG A;  2KZI A;  3D5S C;  3ZQQ A;  2LYC A;  4YRV A;  1G59 A;  2CV0 A;  1J09 A;  4BE2 A;  4BUP A;  2M7B A;  1TZL A;  3FBN B;  1Y56 A;  2Z1D A;  2BW3 B;  5CBN A;  1WJC A;  4BEH B;  3PH0 A;  3BCA A;  3DKX A;  1BDC A;  1X4P A;  3PSI A;  1JI8 A;  2QKL B;  2IXS A;  4PJN A;  1WJF A;  4J00 A;  2B87 A;  2JUG A;  2E1M B;  3H5N A;  3H5R A;  4DIQ A;  3FDY A;  3MKZ A;  2ZFU A;  3F9K A;  2X1D A;  4P5O A;  3OYL A;  2PJR A;  2R7S A;  2R7T A;  3OYD A;  3RCO A;  4F93 B;  3MKY B;  1DEE G;  1UEL B;  4ZTF A;  1R6R A;  5HOO A;  3E1S A;  4B47 A;  4E4H A;  1N75 A;  1X19 A;  2X6W A;  3QOE A;  4PFP A;  4RM2 A;  5KCM A;  2HVS A;  2B87 B;  3HPG A;  2KZV A;  4ITV A;  4DBQ A;  1LP1 A;  1N78 A;  4Y33 A;  2LOO A;  3VYS B;  2RRE A;  4IX7 A;  4WWI A;  4XR6 A;  1SS1 A;  5HNF A;  1SAU A;  4K35 A;  4E7J A;  1H0T A;  3LSK A;  4ZYA A;  2WAE A;  2Q1Z B;  1W36 D;  4HKZ H;  3IAS 2;  3CJR B;  2W1O A;  1X1A A;  1LT1 A;  2V1N A;  2PMZ A;  1ZW0 A;  3SDB A;  4C2U A;  1E0E A;  4CH7 A;  4XKW A;  3J7A Y;  2K5C A;  3CJQ B;  3DWL E;  1Y47 A;  2X6X A;  2MFZ A;  3SEZ A;  3E0J B;  1Z3X A;  2IGK A;  2M3A A;  3D5L A;  3K4L A;  5CQG A;  4II3 A;  2ZAE B;  4XM3 A;  2VXZ A;  3OR2 C;  1EDL A;  3OYI A;  2DXI A;  2B88 A;  2KZJ A;  4EYY Q;  1QU3 A;  2XF5 A;  4E7K A;  3K6G A;  2M4K A;  3FKJ A;  2V9K A;  2VXD A;  3EUA A;  4XMY A;  2KI7 B;  2ZXH A;  3KEY A;  1MNE A;  2CS3 A;  3DTE A;  3AL0 C;  4BQQ A;  2QVA A;  1ERD A;  2M5A B;  2V26 A;  3DU6 A;  2CH0 A;  2A5W A;  3QOD A;  2LH9 A;  3TBI A;  3RTR A;  1EA3 A;  1WJE A;  3RPU D;  1MND A;  2KLO A;  1LP1 B;  1D0Z A;  2WBM A;  4FET A;  1MMN A;  3K4J A;  5KHD A;  3MKW B;  3NWT A;  4LIT A;  3UNG C;  2DT6 A;  2CV1 A;  4XL9 A;  4ZTJ A;  1G8X A;  2L5Q A;  2NOJ B;  2ZSH B;  4C9Y A;  1NG6 A;  2VJI A;  2ZSI B;  4X0G A;  1FMV A;  3CP8 A;  2K9L A;  2JVH A;  3ZR8 X;  3LSG A;  1T0F C;  2DJI A;  4YEJ A;  3TMO A;  1DP3 A;  3PFY A;  3L2U A;  3K70 C;  4GOD A;  3BLY A;  2PJR B;  2UWM A;  3OYA A;  5DJT B;  2BOL A;  1U7M A;  3HXL A;  1WFX A;  4ZDO A;  4F3Q A;  2OV7 A;  3K10 A;  5FRO A;  4BQN A;  3PJR A;  4ZDL A;  3DQV C;  4XN3 A;  1GLN A;  4J01 A;  3FXE A;  4MN4 C;  1HA8 A;  2M0M A;  1X1D A;  2VJ4 A;  2UUZ A;  4D1Q A;  2MYS A;  3HL2 A;  4CCM A;  2V6E A;  2WY8 Q;  4XOP A;  1V5F A;  2HPM A;  4XOT A;  4ASW A;  4NC8 A;  3RGU A;  2B89 A;  5JHF A;  2UWJ E;  4CCJ A;  3QYB A;  4E7S A;  2VQH A;  4CSW A;  5K5G B;  3FXD A;  2VB6 A;  3CZ6 A;  4PK4 A;  3BC8 A;  2M5A A;  4XKV A;  2BVM A;  5FRM A;  1Z21 A;  4NNJ A;  4IKF A;  2IGN A;  4NPF X;  5CBO A;  3SEQ A;  2Y0S A;  2L9N A;  3VYT B;  3HPH A;  3LFU A;  4HRI A;  1DGW Y;  4CCK A;  2QRX A;  2HNH A;  4CZC A;  3MMY B;  2IS4 A;  3LSM A;  3GBG A;  4GRI A;  3H5A A;  4R79 A;  2M0B A;  2KHM A;  4XNF A;  3UR3 C;  4JOM A;  4NUB A;  1X1B A;  4XLC A;  5TGT A;  5HVQ C;  2CUJ A;  4QPO A;  3OYH A;  3S1K A;  1P9Q C;  2VQC A;  2DT7 B;  4PFO A;  2KP6 A;  2VJ5 A;  1QHG A;  1D1B A;  2F5V A;  4BAC A;  3HG9 A;  2W7N A;  2JSP A;  2K3R A;  4BXL A;  5CPR B;  1U7J A;  3PUB A;  4PSX A;  3U21 A;  3A2K A;  1X1C A;  4F55 A;  3HOT A;  2Z16 A;  3LSH A;  3C2H A;  2BW3 A;  1UG0 A;  2UV1 A;  5C39 A;  4HNT A;  1BR1 A;  3LSI A;  1LKX A;  3PL8 A;  3W2V A;  4HST A;  3OYM A;  2JA2 A;  2L9S A;  4JBZ A;  4BS9 A;  5LD2 C;  2I8D A;  3ONQ A;  4CA0 A;  4E7I A;  2MC4 A;  4ZDP A;  2VJJ A;  2HU9 A;  2KDO A;  2BVL A;  3DPT A;  3D5R C;  1X0T A;  3W2A A;  2R7X A;  3A1Y A;  3MZW B;  3KYL A;  2DOA A;  2R7O A;  4PUS A;  1ZEL A;  3S32 A;  4XON A;  3S3M A;  4XLA A;  2CFO A;  4BQO A;  2HVR A;  3ZXS A;  2VQL A;  2AQE A;  4BDY A;  4BJ6 C;  1JM0 A;  2KPM A;  3DEE A;  4RMN A;  3W2W A;  2LXB A;  4ZJZ A;  3OMY A;  3OYC A;  2KQR A;  3SZG A;  4GOF A;  3EUH C;  3C2G A;  2L7K A;  2Q1K A;  2LG4 A;  2W82 A;  4BXF A;  4H4K C;  1AA7 A;  4XN0 A;  2RQQ A;  2VQG A;  4BJT A;  1ZXG A;  2HR3 A;  3VYU B;  3IUO A;  4NQW B;  1WJ5 A;  1T95 A;  4ZC3 A;  4E6K G;  4OAZ A;  2R44 A;  4G6T B;  1V5E A;  4F92 B;  1NVO A;  2CMP A;  3M1C A;  4KT6 A;  2WA0 A;  5LFA A;  4HSR A;  3OIP A;  3DKY A;  3BG7 A;  4XLE A;  4QPQ A;  2ZXI A;  3L2Q A;  3DPL C;  2OUM A;  2WAF A;  2LXC B;  4CPG A;  3IAM 2;  3OYE A;  4KIS A;  3DTK A;  2LY1 A;  2E5N A;  2KIK A;  2Z2S B;  3S8P A;  1H0T B;  2CUZ A;  5FRN A;  4IOI H;  2VKD A;  4BE0 A;  4OWR B;  4HPQ A;  4AU7 A;  2HVQ A;  3RQ4 A;  4U87 A;  4OAY A;  3H9J A;  1PJR A;  4BGD A;  1PYV A;  4PSW A;  2R7Q A;  4E7L A;  3H35 A;  2F4I A;  4RLF A;  4ANJ A;  4IZZ A;  3CES A;  3TL4 X;  2IGM A;  2CW7 A;  1K6Y A;  5DJU B;  2HZD A;  3MD2 A;  2Q2E B;  2JWD A;  2RKL A;  1UAA A;  3EUK L;  3A4C A;  4EAT A;  4ASV A;  3QYE A;  2MAB A;  3RSN A;  1FC2 C;  4F52 A;  2VLA A;  1LVK A;  3K4N A;  2M4G A;  3OYB A;  1D1C A;  1S3J A;  3S93 A;  3DTI A;  3OL3 A;  2X1E A;  4K3A A;  4NPE A;  1X4O A;  4KIT B;  4KJZ A;  2VL8 A;  2XC7 A;  3K4B A;  4BJ5 C;  1YX3 A;  3M8J A;  4II2 A;  1FMW A;  2L2O A;  4HG2 A;  3OYG A;  1Q2N A;  4JQF A;  2VKH A;  1WJA A;  3VSL A;  3OY9 A;  1Z7L A;  3H9G A;  4P1W A;  3I3L A;  1LDK B;  3DPU A;  4CCO A;  3N05 A;  4F91 B;  4BL0 B;  4GOE A;  4C30 A;  3VSK A;  2XSJ C;  1LFP A;  3ZDM A;  3IP4 B;  1Y6I A;  1YE9 A;  3OS2 A;  1OVU A;  4NPD A;  3ZCO A;  3CMM A;  3MHV A;  5HLT A;  3S3N A;  2E60 A;  4E7Z A;  2VAS A;  2K9M A;  2OTK E;  3SYT A;  3K4C A;  1IRX A;  2OC6 A;  1JMB A;  2M7A A;  3LL7 A;  4E7H A;  1EDK A;  2HPI A;  1MFT A;  4FAS D;  5EFW B;  2P0W A;  3OWT A;  4XKB A;  1BDD A;  4ZMD A;  3ZGK A;  2MD0 A;  1D0X A;  2LRE A;  3FHN A;  4D9J A;  4B43 A;  3OYK A;  4PJM A;  1BR2 A;  4MLO A;  4CUG A;  1N77 A;  4LIU A;  2O5R A;  3BCB A;  1DQU A;  4DOZ A;  4IQJ A;  4B3X A;  3S3O A;  2A6T A;  4LG3 A;  2X85 A;  4PJL A;  4C2T A;  4B44 A;  2KS1 B;  1MMD A;  4AVZ A;  2W00 A;  1BR4 A;  3H0D A;  2P58 A;  3QWO C;  2IS2 A;  2IS6 A;  1NG7 A;  2CW8 A;  3VWB A;  2XDV A;  2LBF B;  3OS0 A;  2V4J C;  3PNV A;  2SPZ A;  2R7U A;  1Z3Y A;  3V42 A;  1DGR M;  2X51 A;  1SFK A;  4XLH A;  4BEH A;  1OVV A;  2HDW A;  2KRH A;  3OR1 C;  3VYR B;  1WJD A;  2E1M C;  2KMU A;  4YEL A;  4N4O B;  4CCN A;  4XLF A;  2WMM A;  4ZNC A;  4DGW B;  1EDI A;  4PJJ A;  4BU2 A;  3DLA A;  3HC7 A;  2R7V A;  4HB1 A;  4XQF A;  4XKC A;  4BDZ A;  3LMM A;  3OYN A;  2WY7 Q;  2R7W A;  2X1C A;  2LR2 A;  1VZ0 A;  3HUG B;  1W36 C;  4HJG H;  3OYF A;  4RM3 A;  2XF7 A;  1V5G A;  3G2B A;  2IS1 A;  1U0J A;  1MMA A;  2X6Y A;  2K3P A;  3W3C A;  2XF6 A;  2HQA A;  2LC2 A;  3PNT A;  3DU5 A;  1KON A;  1OVR A;  2KRC A;  4IQ4 A;  3AFH A;  3L2R A;  1YX5 A;  4CCL A;  2W4S A;  4HEA 2;  2LRD A;  1QHH D;  2KL4 A;  2R4G A;  2VIX A;  3I9V 2;  3K4M A;  4Y4R A;  3OS1 A;  1MMG A;  2F6C A;  3L2W A;  2E5Z A;  3NWS A;  3OOU A;  2DCE A;  4N4N B;  1EC5 A;  4AYB A;  2AQF A;  3K70 D;  4XOR A;  2WB1 A;  4DJA A;  2R7R A;  1D1A A;  3CF2 A;  2WAD A;  2LBF A;  3QYF A;  3AKZ A;  3L2V A;  3BG6 A;  2JVG A;  1WJB A;  3K4K A;  4KJM A;  3PNY A;  2XAU A;  4LIV A;  1EDJ A;  4Y3O A;  1MW7 A;  2V7F A;  3OIQ A;  1OLT A;  3HKZ A;  1S9H A;  2CV2 A;  5HNH A;  3EPZ A;  3VDX A;  3OYJ A;  5KNL A;  2IGO A;  4U7B A;  2LY2 A;  1BOB A;  2QKM B;  3ZRG A;  3HOS A;  5CKT A;  4RLQ A;  2FUG 2;  1OR7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...