2I8DA

Crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
GSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein of COG5646
publication title Crystal structure of an uncharacterized conserved protein of COG5646 (ZP_00384875.1) from Lactobacillus casei ATCC 334 at 1.69 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Structural genomics/unknown function
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2i8dA01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2i8dA02
2KIKA 4BXLA 4ASWA 1BDDA 2QRXA 1U7MA 4JBZA 4HJGH 1H0TB 4WWIA 2OTKE 5EFWB 1NVOA 1BDCA 2B87B 2K3RA 4NPFX 3PH0A 2M5AA 5CBOA 4ASVA 4CPGA 1X0TA 2KL4A 2SPZA 4K3AA 1MFTA 2M0BA 3RGUA 1EDIA 2B88A 2ZAEB 1LT1A 1LP1A 1EDKA 4GODA 4HB1A 1Q2NA 2WMMA 4IOIH 2B89A 1JMBA 2KZJA 2UWJE 5CBNA 3S1KA 3QWOC 1EDLA 5K5GB 1ZXGA 4K35A 1FC2C 4NPDA 2I8DA 3FXDA 1OVRA 1EDJA 1S3JA 4NPEA 1JM0A 4MN4C 1Y47A 2KUBA 2M5AB 1OVVA 2RKLA 1H0TA 2KS1B 2LR2A 1DEEG 2KZIA 2LXBA 1SS1A 1OVUA 2OC6A 2B87A 2R44A 1LP1B 4GOEA 3MZWB 3FXEA 1U7JA 4EYYQ 4HKZH 5C39A 2KI7B 4ZNCA 2P58A 4GOFA 4KJMA 2JWDA 1ZW0A 2Q1KA 5DJTB 3MHVA 4ZMDA 1EC5A 2HR3A 2QVAA 5DJUB 3ZDMA 2LXCB
chains in the Genus database with same CATH superfamily
1LDKB 5GAHJ 4BXLA 5APWA 1ZAOA 2C0XA 3K4BA 4D7MA 1OJLA 4UY8I 3H1JJ 3C2GA 4ON0A 2DXIA 2OYHB 1LT9A 4IOAF 1T8ZA 3DKYA 4CUGA 3L70E 2AEFA 3D5SC 4BEHB 1G8XA 2VPLA 1I6HJ 2WBMA 3I55P 2CO5A 1HF0A 2FMLA 1RKWA 1NTZK 2LTPA 3B02A 4E7ZA 5DV5A 3DPUA 2JZYA 1ETQA 1AFOA 2B87B 1V5GA 3GCMA 3OYGA 1RR8C 1IAWA 1B72B 5F6FA 2VN2A 4Y33A 3A0HH 1ZRCA 3CX5D 1IN6A 1GUUA 1OCCH 1YQAA 3AEDC 5CBOA 3E0JB 2HKOA 3H1KE 4U3FD 3G3ZA 2NNNA 1ZG1A 2XGXA 3I4NJ 1R4MB 1XGSA 1TC3C 2VB6A 4MFDA 4OOIA 5J8CA 2ITAA 3LSMA 3TOAA 2HPCB 4UB8C 5FD6A 5JHFA 3IRRA 1OW8A 2LKXA 1SQPD 2VT2A 1VQ5I 4XOPA 1URQA 4HF2A 2H89C 3K6GA 4B47A 4E6KG 3EYYA 3S2HJ 4CHUA 1MBEA 2J58A 2FUG2 4M74A 5KAIC 2FBKA 5FFZA 3OMYA 3TOBA 4XLCA 2STWA 5E17F 1NH3A 2O61A 2X4HA 2WZ7A 4GDFA 4IVNA 4UB6C 1FP2A 5JR3A 3CCJP 3DF8A 1SP4A 3BR0A 3M91A 3U59A 4FE4A 1TWCJ 2FFDC 3S17J 3F72A 1VTNC 1T2KC 4BE1A 4M71A 1GLNA 3H92A 3OIQA 2YXQB 1MBGA 2R7QA 1S2EA 2O3FA 4N9HA 2BCCD 2XAJA 3OYLA 2WY7Q 4XMYA 2MD0A 1NU1D 1OCRH 1LEBA 2FYUK 3L35A 5IP6A 3A2AA 5DM7F 1P84D 4XLAA 1FZAA 1TZLA 3DKXA 2CV2A 4IHSA 2OYOA 2QIWA 4YTPC 2LH9A 3CMAI 3JSOA 3S1RJ 3FWEA 3VFZA 2VXZA 2WTYA 1VQ4P 4D6TD 4KMUX 3WHBA 3DEWA 3AEFC 1SQVD 3WUTA 4JF7A 1GVJA 4BJ6C 4BDZA 2CV0A 4E7JA 2CW7A 1P7IA 2O0YA 2D1VA 3LIEA 2FYNB 1NGMB 2EIKH 1GHCA 4C7RA 1SEUA 3F0CA 1BGYE 3F6OA 4OU0A 1LT9C 1ZN5A 4ENMA 2E7XA 3I56P 2JK3A 4A3BJ 1J1DB 4HKZH 1BE3J 3OW2O 3H3VK 3OYBA 3VODA 4PJ0C 1GK4A 1UIXA 2DK8A 1SFUA 5DUKA 4KJMA 3WGHA 1IK7A 5GTIC 3LSGA 2D2CC 3H5AA 1DU0A 1HGVA 2N9YB 3C3WA 1ZG3A 4YEJA 2Q1KA 2K85A 2XV4S 4A5MA 3RPQA 4QTRA 3F21A 3ABLH 2WPSA 1WJDA 2NZ2A 1HW1A 1CSBA 2H8PD 3RSNA 3N97A 3CUQA 2V6CA 3M8EA 4D0PA 2ISZA 1WWXA 3LA7A 4UVCA 5KNLA 1QX8A 5GTHC 1URQC 2E75D 4W97A 3HOTA 3A0BC 1B8IA 4CYCB 2DN0A 1YO5C 1OIPA 1BIBA 1W7PA 2EA4A 3OS2A 1XB4A 1G6NA 3QPTA 1RF1B 2FXAA 3L37A 1IN7A 2EZKA 2VQGA 3M8JA 4H13C 4MNUA 1QU3A 1R23A 2OTKE 3LIDA 2Y0CA 3AL0C 3OYAA 2KZGA 3PO3J 2A68F 3PFYA 1NAYA 2GUSA 3W3CA 2Y9ZA 3C9IA 3HTSB 1HF9A 5KLVE 1RQVA 1QPIA 4ZYHA 3GTQJ 2EZHA 2H8RA 3U1AA 5E20A 5CCGD 3L4FA 2RVCA 2K7LA 3M9QA 1F36A 1JY2O 3JC22 5FLXK 1JGSA 3SYTA 4XN3A 1EZVI 2M3EA 3BCAA 3FF5A 2LREA 1JKRC 2COMA 1MW7A 3OS0A 5B3SH 2HPMA 1DGWY 5C39A 2CFXA 3ASOH 2E36A 2EFWA 3VWBA 3BJAA 4OIPF 1SQXG 2L91A 4U0VA 2ME0A 2RQPA 3P5JA 4M3FA 5ERIA 5KAFH 2KHMA 1YI2P 1F9NA 2BW3A 2ZBKA 1VZ0A 5CLSA 1MGTA 4XBFA 4CZCA 4G94A 3E1IA 2V7QH 2E76D 3KZIE 3GTMJ 3I54A 5B5EC 3AECC 2OCCH 1YQ4C 1FTZA 2GM4A 3TGUJ 2CQ7A 3CC4P 2MC4A 1IN4A 2YO2A 4RKUJ 2XAGA 5K7HA 2VC1A 2UWMA 2FXPA 5CBNA 2XDJA 3L9FA 3LSHA 4HNVA 1EDLA 3IAM2 4WY4A 1ETXA 1A6IA 4A0YA 2HG5D 1WHUA 4JK1X 2JT1A 4CDGA 1TWHJ 1SQBE 1J2XA 3PNYA 2X48A 3BG3A 1XPXA 4S0HB 2BEQD 1P6RA 4LD5A 4BDYA 3BROA 2PQ8A 1AHDP 3JR9A 2YU9J 3FBIB 1J1EC 4Y99C 3CUQC 1KILA 3BCCE 1HA8A 1LTAC 1OVVA 2K27A 1J2JB 1ZRTD 1LDDA 4OH8B 2ZVNB 1KORA 3AG1H 1YJNP 2LXBA 1T3UA 2VRSA 3KXDA 5LGUA 1OVUA 1USEA 2O01J 3ML6A 2X6OA 1E2XA 4EJUA 2Y48A 5LGNA 2OZ6A 3QH9A 4L9JA 4ABZA 3CC7I 1NTZE 1E17A 3NMDA 1YX5A 2E75B 2A69F 4EYYQ 2V9KA 5FROA 1YFHA 2ZVOB 4KIBA 1D3YA 5HNHA 4H0LC 1AJYA 2CRGA 3ZMUA 2OJED 2DOFA 2DQLA 1X8YA 1VF9A 3G1MA 3EWKA 1R9TJ 3PJSK 2BVMA 2QA4I 4DCKA 1NG6A 2N1TB 1FOWA 3DPTA 3FMRA 2QENA 3OYEA 1KYOI 1B4AA 1JEKA 2IYPA 2MJZA 2W83C 4KHXA 3GFLA 3GMAA 4LITA 4HNTA 2CYYA 2VKDA 3L72E 4E7HA 2FA5A 4L5EA 1SFOJ 4ZC3A 3H1IJ 2FXOA 1FZFA 2HQ5A 3TNUA 2OZUA 3HXLA 2QSHX 5JLWA 2IFMA 3K5BA 1SQXD 1IG7A 2M4GA 1APLC 1KQ0A 2JVGA 1N77A 2A06E 2JR8A 2MFZA 1GTWA 1AKHB 3CJTB 1NTKE 4N3YB 3H1JG 3V42A 4UUSB 3J7YJ 4ZKPA 5KJ7C 3QWLA 3SDBA 3FXMA 5F04A 3VPRA 1NK3P 3S1NJ 3OSFA 3CCRI 2FYUE 3VMXA 1D7MA 2E76B 4UNOA 1W2BO 3RIRA 1T0FA 1BR2A 5E1WA 1BDCA 1T38A 4EMSA 4EGZA 4DZOA 4WY4C 3JCUE 1YOVB 1BW5A 1KC8Q 1EZVE 1MNDA 1BA5A 3Q5FA 4D7NA 3BASA 1PPJG 2IAIA 2LY2A 2R5ZB 2FY8A 2XKMA 3BR3A 2RMZA 4OGQC 1NO4A 1A04A 1TU3F 2ZMEC 3JRBA 5J6XA 3SZPA 1XDUA 3HSRA 3AG4H 1KILC 3S3OA 2B0LA 5CHXA 3HL2A 3ABKH 1FYKA 2YO3A 1LFBA 3K1PA 1W0UA 2AXLA 3H1HJ 1UELB 2X0LA 4HB1A 3O6BB 5BU8B 2HQAA 1QVTA 1TWGJ 3DPLC 1N73C 3A01B 4HW0A 5HS9A 4GCVA 3KYDB 2W7NA 1N2DC 4V2GA 5CVVA 3WODF 2WPQA 2L0KA 3Q0WA 4FTHA 3L09A 2QSGX 2V4JC 1BCCE 2V1UA 1XC5A 4J01A 2FXMA 1FT9A 1R5ID 2DMNA 5LEJA 3TW6A 2IS1A 3S1MJ 1JXSA 4B3AA 1Z77A 2P7CB 1TW3A 1P92A 4A6EA 1CW5A 3O8GA 4LK0F 3R60A 3B6AA 5EEGA 1OCZH 4HQMA 3WE2A 3JAMZ 4P9UA 2FX0A 5J3LA 2MSYA 1WVRA 3JRHA 3F22A 1ZHFA 1IFPA 2IBZG 2P2UA 4CCMA 3SSUA 3MQ0A 3WTYC 3EFFK 1BC8C 2NPSA 4EM0B 1HOMA 2K9YA 1X58A 3I55I 2GA2A 5JI6A 3KYLA 4ENKA 1IO4A 3GW6A 5AW0B 1WQ2A 3BDDA 2FQ4A 1G59A 4IQJA 2KZIA 3OOUA 2H43A 2IBDA 3Q3DA 1IW7F 5IY5H 2DAOA 4FX4A 2CUEA 1A6QA 2BY3A 5HDNA 4UB8E 3ULQB 1K4TA 1A02J 2WVRA 1S72I 1PV3A 3QYFA 4DYRA 1T0FC 2QEXI 4OIOF 1B6AA 3M0DC 3D0SA 1KYOE 3KLNA 1XTAA 2XB0X 4UB6E 1G2CB 2HZTA 3LMMA 2A3SA 4RB2C 2BE5F 2K1AA 1K7AA 3OYFA 3F8BA 3HOWJ 2XSJC 1FBQA 2GOMA 3WTZA 1PPJD 2Q7CA 3RK3C 3JRDA 3CCJI 2KT0A 3F8FA 3I71A 2EFQA 4UVBA 1JNMA 4EGYA 5JVGF 3Q0VA 3GLMA 3H1KJ 3IKVA 2A45H 2V4HA 4ASWA 2CH0A 2XF5A 3RKYA 3RI4A 1A36A 1IFMA 2GXGA 1OR7A 5DD4A 4RAZA 2DA1A 1HXDA 3FDYA 3V2PA 1OFCX 3IRQA 2Z5UA 2F6CA 1SFEA 5IYCJ 2IVMA 2O1JA 1OMIA 2CUZA 2MLKA 4MGRA 1QEXA 3WUUA 1STZA 1YIJP 3IV5A 1T3JA 2ZXXA 2WWYA 3VDXA 2QQBA 3AEGC 3C1LA 1E3HA 3BP8A 3COAC 4HV5A 1FJLA 2SPZA 3B5NA 3F6VA 2PJRA 5KK1A 2XROA 4CICA 2EA2A 1U8BA 2GIZA 1BE3E 2VBWA 1G3SA 1HDPA 2P10A 2VONA 2EV6A 1P2FA 5EGOB 4RESB 3V8LA 3I56I 5GTIE 2NPSC 1VQKP 2ELJA 3HOYJ 1LP1A 2IBZD 2ZO4A 2ZXWH 2X85A 1OLTA 1WI9A 5M5WJ 1PP9E 3R0AA 3P8CD 2VJIA 3CMAP 1S6LA 1Z91A 4EJTA 3HM5A 2QSFX 2HOTA 3OIPA 3HKZA 1JY3N 4L9VA 1FOSF 5CVJA 5DCFA 2EV5A 1RHZB 1Y8RB 3V8KA 3BR6A 5GTHE 2HODB 4IRHA 5H2FE 3H32B 5LHGA 2M9HA 5LBQA 4E7SA 2XPUA 1RNLA 2COBA 2M7AA 3GLXA 2JA7J 1HCRA 3A0BE 5AVZB 5FLVA 1YRNA 2QJPB 5CCHA 3CF5F 2G0EA 5K5GB 4I09A 3L71D 4PD4I 1BGYJ 3IH4A 1QL1A 2IGMA 2K3FA 2E19A 2ICWG 3SWFA 5D5UB 1QGKB 2M0CA 1NOHA 4XONA 5KTBA 1S9KD 1JM0A 4KT6A 4C2MJ 3BWGA 2VKHA 2E5TA 3L75G 4QPOA 1FZCA 3S32A 2CQQA 1T6AA 5HOOA 3BR5A 4FT8A 5BMZA 1JMMA 4RJTA 4II3A 3I5UA 4ZJZA 5A2QK 1USSA 5FFXA 5DEQA 4M6XA 1NKNA 1G3YA 4G8XA 3ZQLA 1BM9A 3ZQCA 3HJEA 4AVZA 3DBHB 3H1LJ 1FZBA 2E42A 4NBQA 1Q90D 1WFXA 4XRSG 3E5XA 4GOEA 3QODA 4PGGA 4PJLA 3IUOA 4KIFA 1W4MA 5GPAA 4BBSJ 1QNTA 2EK5A 2LK2A 1D8JA 1GW3A 3HYIA 2EIJH 4KN4X 4WX9A 1SD6A 2R7WA 1IRZA 1KB9I 4GOFA 3F9KA 1PGPA 4M6VA 1XCVA 5AVTB 1QQIA 4AUWA 2IS6A 3M07A 5B5EE 1HSJA 2LC2A 1MMAA 4HX8A 3M9AA 4RB0A 3CCLI 1SVOA 2QJKC 1U9NA 4IX7A 4LOCA 3GZ6A 3H5NA 5DYMA 1K78B 2WSFJ 5DJTB 3AG2H 2E1MB 3Q0UA 4E4HA 2QQAA 4S04A 1ZRFA 2UXNA 1N86A 3B5NC 3TGUE 4FISA 4Z1MH 5ICCA 1J9IA 2KXPB 3K2AA 3HE5B 4PGHA 3ERMA 4F7ZA 3IN6A 2F2EA 3GMEA 4E7KA 3AE4C 1IXSB 4XLPF 1S5LC 2E71A 3J7ZI 2JA6J 4MTDA 2JO1A 4L0ZB 1JY3P 3KX2A 4F3QA 4LJZF 5AVWB 4B1RA 1HVVA 2KIKA 2JA2A 4CGZA 4BAYA 1D5VA 4C46A 5F27A 5JVTA 2QRXA 3DU5A 4CO8A 4JPZB 2ZXHA 2DFHA 4WB4A 3P32A 1LTSC 4XL9A 1X1BA 3H1IG 3T8RA 4UVAA 2JN6A 3WTSC 3BR1A 3ZXSA 1X1DA 4NB5A 2KLUA 2TDXA 3HSEA 3QP6A 2YIUC 4HJGH 1RPWA 1LUJB 1X2NA 1G2HA 1XSVA 2IJLA 5LEKA 2DMUA 1NVOA 2EINH 1W5TA 3EQLF 3CCVI 1LTJA 5FJ8J 5C4JJ 3PO2J 1JKPC 3L2QA 2ZJQF 2AXTE 2EWNA 5CCHC 3I3LA 3KEYA 2Q9IA 1T95A 3KZIC 1SFCD 1R1UA 4XR6A 4U0YA 4CPGA 4AYCA 4FQGA 3BR2A 3F8CA 2WITA 4CCOA 4LC1A 4JYBA 2W24A 2LY1A 5LRRA 5HDKA 2ZT9D 1CF7B 1U0JA 3Q1MA 4RDUA 4LIUA 1WMKA 2PRRA 3A3YB 1MZBA 2A5WA 1SQBJ 1X4OA 1EDIA 1FZCC 4BHBA 1Z6TA 1JUPA 3L75D 3HE4B 1FC3A 3L00A 1WCMJ 2KP6A 3PNVA 1C0WA 1FOKA 1IFIA 2X6WA 3LSIA 5HODA 2A6EF 1WH7A 2WMMA 1NJIQ 2YU3A 1KU3A 4U0WA 3JTGA 4M9SA 3BCCJ 3WU0A 2QSIA 2E43A 5APYA 1Y1VJ 1RZ4A 4PD4E 2H94A 2XAQA 4A3GJ 5ED4A 2Q3IA 1L4AD 3CX5I 1PIXA 2E34A 5TRDA 2FKWB 4N6JA 3CC7P 2Y9YA 1JJ6C 1TT0A 5FKNA 4I2OA 3ZR8X 1L0LG 1ORKA 5F1RA 2HFED 4KDPA 1WJFA 3FIWA 2DFFA 1X1AA 2K9JB 3SEZA 2VBYA 2P6SA 4G6DA 4PJJA 2BY0A 2I8DA 2JWAA 3H6PA 2WC2A 1O3TA 2LP0A 1V5FA 5EGOA 3K2ZA 1JCDA 4I1LA 3VYTB 4EEFG 4XE5B 4ZKUA 1F5TA 3CTAA 3I59A 3P9KA 2KSEA 2Z16A 5AVYB 2R4GA 1ZP0C 3D71A 3B4SA 3HD7D 1YJ9P 3H0GJ 1LWUA 2LR2A 4H44C 4TV7A 1LDJA 2KLVA 3MMYB 1WJBA 1YLFA 3SHFA 2IYOA 5E1ZB 4RA2A 2O5RA 1RF0A 1UG0A 2HODA 2CFOA 3H36A 3K1NA 1KB9E 2XF7A 2JEEA 1X2MA 5DDGA 1KILE 2ME6A 3MZHA 1WZ2A 4M9XA 4C3IJ 1KGSA 2I1JA 1SVLA 3U9GA 5J47A 1YTZI 1IGNA 1P84I 2JP3A 2JUGA 3L73J 2YMKA 1D1BA 1BW6A 1W1WE 1LTJC 2DMPA 2JPCA 4IHVA 2HYFA 3H1HE 1XD7A 4J00A 3CP2A 1OPCA 2OQRA 3FX3A 2MBFA 3V4WA 4F55A 2HZDA 2X6XA 3L70G 2O8XA 5DM6F 4IXAA 4YXWH 1SQQD 1PP8F 2DFEA 2XNDH 1KV4A 1WT6A 3CC2P 1SFCB 2LLKA 1LFUP 2CU7A 3W2AA 3VYSB 1LNQA 1X9VA 2NAZA 1MJBA 2HWVA 3DWLE 1N7SA 3LFKA 4HV6A 5D4SA 3K69A 2ZT9B 1BDDA 2HDWA 1QGPA 5HS7A 3O6QA 4C3JJ 2VOPA 2XDVA 4A3JJ 1BOBA 1JB0J 2OYIB 3CCEI 1GL2D 3E7LA 3P8MC 4WXHA 1TQPA 1MZ9A 3B73A 2KP8A 1JKQC 2GLOA 1L0OC 3HOXJ 3K4JA 3M7GA 2Y69H 4LGWA 5M3MJ 3AFHA 2ELKA 4A0ZA 3GUDA 3J80Z 4XQFA 2OARA 3D6ZA 1P4WA 1SQBK 5AVRB 3VYRB 2E2JJ 2Z5IA 2B9BA 5CVRA 1OCOH 1V55H 5L3GA 1E3OC 3V7RA 3UKGA 3PJRA 3TF5A 2VODA 4A93J 1L0LD 1H0MA 1BCCJ 1L4AB 3OS1A 4P55A 5M5XJ 5JLXA 3JSPA 1YTZT 3T8TA 1HH0A 2QBYB 2K4BA 3K4MA 3K70D 3CLQA 5LFAA 1X19A 4ZYEA 1AU7A 3F5HA 1VQNP 2B88A 3K0LA 2PAJA 4B44A 1O7FA 3JCUH 1VQLI 2XNXA 3SFDC 4IFDK 5KHDA 1LWUC 2K4JA 1O57A 2R0QC 2WSCJ 2NS0A 1Q2NA 1BSNA 1J5YA 2BXZA 5B66E 2DTRA 1N75A 3CX5E 3NXSA 3LSPA 4X6AJ 1TW2A 3RK3E 3H25A 3ABMH 1YG2A 4YRVA 2EBIA 1RF0C 2O01N 2EH3A 1BSHA 2DA5A 1FTTA 3L1PA 3HD7B 2L3DA 5KKZB 2X1CA 4MEXF 1IC8A 1OYYA 3VOEA 1S7OA 1Y6IA 2K86A 2E60A 1L3LA 1EH7A 2KNCA 4RGXA 2PI0A 3ERED 3CWBJ 3L2UA 1ZXGA 3SWKA 4K35A 4PFOA 3I64A 3WG7H 3OV8A 5D5XB 2WV1A 2VC0A 3R4KA 3BZKA 3PUFA 1S72P 2QJYB 1CF7A 2QEXP 4FCYA 3CMMA 1BGYG 2WSEJ 3FXDA 3S9OA 1ZGWA 2RKHA 1TT5B 5IP7J 1FWZA 2CUFA 2RGVA 4P9FA 4IHWA 1Y47A 5L3BA 1R7JA 1GXPA 3TDZC 5APTA 1AQ5A 4CA0A 1TQIA 3MWMA 4G12A 3DEUA 2M5AB 3L70D 2POHA 1M1JB 2LOOA 2VJ4A 1T33A 2HTJA 1QHHD 2Y75A 1BBYA 6PAXA 1YIJI 2OTJP 1ZGAA 3E1RA 4PZJA 4HSRA 1WPKA 4EM2A 1N7SC 4QPQA 1YS6A 5EG0B 1YITP 2CJJA 3BC8A 1JO5A 4BNCA 2R5DA 2NS8A 5AW7B 3SWYA 2M8EA 4ZTFA 1NTKK 3Q5SA 1FMWA 4XK4A 4XN0A 1P84E 1EQ7A 5TGTA 3G4SI 3CCSI 3FXEA 3MZWB 3LSRA 1KQ8A 1U5TA 1RE3A 1XG1A 1POGA 4HDUA 2GXAA 5ICFA 1BOAA 1RUNA 2H27A 3I4MJ 2KMUA 2HVRA 1MDMB 4D6TE 3FM3A 2HS5A 1VQKI 1AWCA 3G71I 2KKOA 1GL2B 1ZV8A 5B1BH 5E1XA 3FKIJ 2NNYA 3DU6A 4LB6B 4UB8H 3LA3A 1KU9A 2DCEA 4LG3A 4ZMDA 2QM8A 1V4RA 2QVAA 4G6QA 4ZTJA 1ZELA 3MD2A 3PP5A 2OD5A 1LPQA 2VASA 1EH6A 2L7FP 2ZFCA 4HOBA 1Y0UA 2WTEA 3KIOA 4EV0A 5KAIH 1HKTA 1L0NJ 1J09A 3LOCA 4DBQA 1KYOH 5KLVG 4UB6H 4BQOA 1OQYA 1IDYA 4HLYA 3FM5A 4I7ZB 1VQOI 1DU6A 1GD2E 1U7MA 2F5EA 4NUBA 2F5FA 4AIDA 2YSRA 4BS9A 1DPUA 1XMAA 3B6CA 4IFMA 5ICGA 4GXOA 3P7NA 1IV8A 2O8KA 5CMZA 1MH3A 4DYCA 1UAAA 1PP9J 2W6JH 3W2VA 2EFNA 3H5RA 4L18B 1ETKA 1HWTC 1MBJA 1LTBC 4KFCA 1R1TA 2M45A 1T98A 3ZMZA 5L3CA 3KYQA 2RAEA 4YPCA 5FD5A 1CGPA 2CV1A 5HLHA 4BU2A 3H1LE 1LJ9A 1IZNB 1FS0E 4BBRJ 4MTEA 2EQRA 4AU7A 2KPMA 5H2FC 2P7VB 2PJPA 2XRLA 4YIRX 2M0BA 2P4WA 2CGPA 2FSWA 4ZZDA 3HOSA 3BLYA 3LWFA 1BGYD 2R32A 4IHTA 1R71A 1EJ9A 3BZCA 2L5QA 3KP2A 4AYBA 4U7BA 1SQBG 4RS8A 3GHGA 4WVZA 1D1CA 2Q8KA 4KMFA 1IK9A 1IFDA 1OW6A 1RE4A 1VQ7P 5JHUA 3QPSA 3S1QJ 1VF5C 4PJ0H 2O7OA 3DTKA 4TLFA 2E74C 3E6DA 5F0FA 4ZYGA 4BRYA 4PV1C 3CCMI 1S5LE 1JTHA 4L5JA 1JGGA 3LL7A 5GTIH 3CI9A 3BCCG 4PSXA 4RAGA 5DTDA 1U5TC 3VN0A 3E5UA 2LR8A 3OYIA 2WAQN 4JYKA 2LKSA 1WH5A 3ABVC 4JX6A 2HLOA 1BR1A 4FETA 2R5YA 3OA7A 3A1YA 2XUBA 2Q1ZB 3MUDA 1RQUA 1YHQP 4GGGA 2LBFA 1ZK8A 2XGDA 2ZCWA 3RK2C 1JE8A 3HUGA 4QMAA 3BTJA 3X2QH 1YW9A 1Z67A 5EF6A 4HLXA 1S3JA 5J4YA 1NTZG 5GTHH 1HW2A 3OIOA 3H3UA 3CCLP 4QIWN 3A0BH 1TLHB 2ZJRF 1Z6RA 4HZFA 1JY2N 2OYHA 3HRTA 3FMSA 2FNAA 3SDGA 2MA3A 4BEHA 5ICEA 1FEXA 1MMDA 3QYBA 1SD7A 4M9ZA 2L02A 4JQ0D 2LMDA 4AQRD 2J5PA 1ERDA 3H1LD 1RESA 1X3WB 2B87A 5D5VB 5KLVD 3GFMA 1B72A 3FX0A 3CESA 2ZFUA 1FU1A 5AW6B 1PUFB 1P7JA 4ZDOA 1O3SA 1DD3A 1NTMJ 1ON2A 2PBIA 2V1XA 4G9YA 5E8GA 3TP0A 2KI7B 1ONVA 1FSHA 3L72G 4I2LC 3RL0C 1N8RQ 1FOSE 2DT6A 4XOTA 3WU2E 2YKPA 2HPCA 2QM3A 1D1AA 4EM1A 1W2EA 1VQ6P 2A06G 4R4MA 3GG2A 3CCVP 4HG2A 4P1WA 2NYXA 3A02A 3R4YA 3N7NA 3FXJA 5TISC 1JHFA 3SXYA 1W36D 1NTKG 1LKXA 3H1CA 1Q7YQ 5CVIA 1XX5A 1I6XA 5CYVA 3EQ2A 1O7LA 4B4CA 4N78E 5AW8B 1IC2A 4D5CA 4V19K 2FYUG 1Q1HA 2UZKA 1FNNA 1YX3A 3M06A 3UIAA 3PIOF 2VT3A 3G2BA 5DJUB 5B5EH 2EILH 2AXTC 4KNYA 3HOZJ 1EZVG 2QE7H 3ISPA 2D1HA 2P67A 3NFQA 4Y28J 1KFMA 3U1KA 3GHGC 1X4PA 4ZYAA 1RE4C 4RM3A 2IGNA 5KLIC 1B9MA 1KQ9A 3HOUJ 1SQBD 3MD0A 3PTZA 3CPWO 3ZMDA 4X1EA 3A03A 4Q4ZF 3S3MA 3GW2A 3CDIA 4YELA 3EYIA 1MJAA 1S8NA 2IW5A 3OL3A 5J4VA 3F23A 1R8EA 1A02F 3VYIA 1KYWA 5FB2A 1IRGA 2YKOA 3QOPA 1YJ9I 1BR4A 2VQHA 4I98B 4V2FA 4YIIA 1JY2P 3MUDC 3H0DA 2B9SA 4NQWB 3CLOA 1PP7U 4HDVA 1OXZA 1SQXE 1WRGA 4K3AA 1AQTA 1KFNA 3K10A 2DT7B 1BCCG 1IUYA 5B66H 4DZPA 1NTZD 3FXRA 3L73E 2OYHC 4KT0J 2DA6A 2W85A 5E3NA 2O01H 3UNGC 4ESJA 2JQ7A 3E6MA 4E7LA 3GVAA 2LG4A 2ELHA 3DKWA 4GODA 4IFFA 3BY6A 3L7WA 2Q2EB 1Q81Q 1R58A 3DBRB 4UUVA 2KDOA 4AM3A 2WAQA 3LFUA 3ZQFA 3O6QB 3ZP5A 1JUNA 1JMBA 2F4MB 2PP6A 1WJEA 1Q86Q 3NAUA 4A3KJ 5IT9K 3ASNH 1FMVA 1I5ZA 3FBNB 2JUCA 1UB9A 2MGQA 3RQIA 1J59A 3T1BA 3J81Z 2V6EA 3CC2I 1U2WA 2HPIA 3DEEA 3OYMA 3CMEI 1ZQ3P 4G7OF 1XN7A 5J40A 3E5QA 4IPAA 3L72D 2MKVA 4DOZA 1YW8A 3WUVA 4RLQA 3BG6A 3JTHA 2JSCA 3DTIA 2LY9A 3FXOA 2IX7C 3HUSB 4PD4H 4CYCA 4YIFA 2H6CA 3C18A 5BU5A 1EXJA 3Q9VA 2KRCA 3LA2A 2P5LC 2W4SA 1FPQA 1FAVA 1RF1A 2FE3A 1ZRDA 4IL6C 1NTKD 2KK7A 1JCCA 2JA5J 3VP9A 3S14J 1NTMK 1SVMA 2CPBA 1VNDA 4ITVA 3I58A 2FYUD 5D8KB 2V9VA 1GV5A 2G7UA 2BHZA 2ACJA 3BRTB 3F89A 5IYBJ 2CW0F 3PQKA 4FX0A 1EZVD 3GYHX 3HKZN 1Z56A 4A3CJ 1V54H 1USDA 3TO9A 3RDIA 2BOLA 2LF7A 5DCMB 1RR7A 4F91B 4I02A 4LLGF 2I5UA 4MLOA 2DPUA 4AVPA 3WTUC 2OV7A 3FHZA 3CCEP 1NTCA 2R7UA 3BATA 1VQNI 3W68A 4CZZA 1KD1Q 1G4DA 4GT1A 5FRMA 1MIJA 1BL0A 2FBIA 1T39A 3W6VA 1KB9H 2VI6A 4XLNF 2I10A 4MQ9F 3RYRA 1ZREA 3E3VA 1Z7UA 3JRCA 2CW8A 2HR3A 3HHGA 3QP5A 3V8JA 3GBGA 3W6KB 2ZJ2A 1MSEC 1BI3A 4Q5SF 1CI6B 2Q6QA 5BVZA 2QZ8A 4ENJA 3AE3C 2QKLB 4CCLA 1VQ9I 2FYNC 1KQSO 4BQQA 4AUXA 3HTKB 2HQRA 1Y56A 1S9HA 1FIAA 3CWBE 3CXHH 1K9MQ 1J1DC 2VKVA 4UV8A 3KZYA 2L4MA 1VQMI 5APSA 2KRHA 2HXIA 4RAFA 4BJ5C 4GRIA 1VQLP 1JTXA 3DBLB 2K37A 4I0AA 1RY3A 4CCJA 4A3LJ 2DQRA 4YXDC 2EIMH 3PUBA 2DDAA 1BE3G 2ZNZA 3AE8C 3H1JD 2QF7A 1H0TB 1FSEA 2DMTA 2IDBA 4N4NB 2AXCA 2DFIA 3WTTC 2DW3A 1GU5A 1G1IA 3I4PA 4LG0B 3L74E 3S2DJ 4RO0A 2NOJB 1DH3A 2FQ3A 2BZTA 2XGEA 2BXYA 3H9JA 5B66C 4B8XA 2OTJI 4U3FJ 3WTWC 1UG2A 1KQLA 4FHTA 3EUKL 4AIKA 1Z1DA 1Z9CA 1YITI 1HKQA 2YPRA 2CPSA 1V3FA 3B71A 2IZ1A 2Z9OA 4Y7NJ 2DLLA 1LT1A 2ZKZA 2VLAA 1RF1C 4YFNF 4HEA2 5IOYA 3SJMA 3KETA 3LW5J 2E1CA 1GXQA 2M1BA 3AE1C 1B9NA 2L4AA 3LAPA 2IP2A 3GZNB 2PFXA 1AOYA 1NG7A 3C2BA 1SC7A 4JYCA 1G3WA 2A5YB 1KYOD 2OA4A 2M3AA 3M4OJ 4M6YA 3D70A 4XLFA 4A5NA 3GFJA 1LE8B 5BQTA 4XLEA 4WK8F 5CVUA 4RB1A 1IRFA 4L74A 1YJWI 2BCCJ 1T2KD 1J0RA 1QZYA 3BOQA 3CUOA 2NVYJ 2PMUA 4MQVA 3BQZA 2K9LA 1T6SA 4EATA 1L0NE 2N1TA 5L8RJ 1VQ8I 3G4SP 3MEXA 3CCSP 2IPPA 4NQWA 1RI7A 4L73A 1X1CA 5M5YJ 3Q2YA 2A05A 5CCGA 3G9RA 3LSTA 2DT5A 3DCFA 4JBAA 3RL0g 3G71P 2VXDA 2K9NA 4D6TJ 2OQQA 2ECBA 2PN6A 1SQVJ 3WTXC 2M4KA 1AKHA 4CXFA 2D2WA 3N4XA 4LLHA 1UHWA 4IRGA 2OCEA 4UUSA 2KS1B 2Q2EA 4DYQA 2BASA 2L2OA 3KP3A 3FZVA 3LNQA 3KP4A 1IXRC 3KYCB 3L71E 2YX4A 2R44A 1NHAA 4LIVA 3OYHA 3GTKJ 4H4KC 3TGUG 3HIFA 1VQOP 3QU3A 4IZZA 2P5KA 2R5ZA 1S7AA 3ZRGA 3SZGA 1FYLA 1JT0A 1H9GA 1XMKA 5DUIA 2IRFG 2R7ZJ 1M56D 2Y0EA 4QWQA 3CCUI 1NAFA 1BE3D 3R6SA 1U9OA 4MIMA 2B63J 4ZNCA 4L0YB 3K4KA 2IS2A 2JWDA 1MJ9A 3E97A 2D2CD 3Q5RA 1DEBA 1T8IA 4U88A 1IN8A 2EV0A 4I99C 2VQLA 1Q82Q 3GZ5A 3I9V2 5L3FA 4A3FJ 3HDDA 1VQ7I 3B8EB 2XPWA 5KAFE 2D45A 1E0EA 3ZMVA 5AW5B 3VOPA 3TMOA 4EIJA 1SFXA 3ZPLA 1ETVA 3A01A 1Z7LA 4HF1A 1MV8A 2FU4A 3BTLA 1AVYA 1URQD 3GTPJ 1OR7C 3ABTA 2E75C 1G1JA 4ZDLA 3BTIA 3V4QA 4LLNA 3H1LG 5FKMA 4A2UA 4LGDE 3S2WA 4JBZA 3VMAA 3TDKA 2KJCA 3PQJA 1YHQI 1DPRA 4UV9A 2G3AA 5CPRB 2ESNA 4XSZF 4H13D 1Z0XA 5BNGA 2CQNA 2NRAC 3S4RA 3W67A 2ESHA 5LGTA 1XGMA 1MUUA 1NYHA 4B43A 3CCMP 3SQNA 1VPCA 1IJDB 2KJBA 1FY7A 4WBAA 1DX7A 4A12A 5JFRA 4AIJA 3ECHA 2QM7A 1GW4A 3O8HA 2M5WA 5FKKA 2FFDB 5CCGC 2E2HJ 2KL4A 3MCZA 2VOOA 2DOAA 3Q3SA 3GTJJ 3HG9A 1ETOA 2CS3A 4QSHA 4HQEA 3DV8A 2IXSA 4I76A 3HTKA 1H89A 4PJNA 1OZHA 2K3PA 1NTME 3MTUE 1XGNA 4R1HA 4XKVA 1MSFC 4OWRB 3S15J 1KZUB 2LVSA 3ZMTA 3OYNA 4E7IA 4D9JA 4KN7X 3ZGKA 2BGCA 3Q5PA 4U7DA 1WRJA 2BY2A 3REOA 1O4XA 4E70A 5TISE 2NVXJ 2Q5UA 2E76C 4O9BA 4IOIH 1FJPA 3QAHA 1VQ6I 3CCYA 3Q9SA 2Z5HA 3T97B 3D5RC 3WTVC 2IGKA 1G2CA 4DW6A 4C7NB 3OR1C 2Y31A 3JSVC 3R2PA 3HEFA 2IGOA 3DTEA 2Y2ZA 1LQ1A 2DA2A 1OISA 1WJCA 3UR3C 3TGUD 2Z4EA 1SQVK 3KDPB 2MH2A 4ZZLA 3N05A 5D5WB 4G7HF 2HXOA 1DP7P 2R7FA 3KZZA 5A2QZ 2KZVA 2YS9A 1LT9B 2M3BA 2WSFH 2RC4A 1N25A 3L75E 2V79A 2GIVA 2YKQA 1UZCA 1S5LH 2AQEA 1EDJA 5KVRA 1S29A 3NTNA 4F52A 3K4NA 2W6AA 2FMYA 4B09A 1JTYA 2D2CB 3IH3A 3WU2C 1DDNA 4PK4A 2FOWA 3TKYA 2EZIA 1RKTA 3H1HG 2A45I 3W2WA 2UUZA 3NWSA 4PDKA 4BACA 2M87A 4CSWA 2XZRA 4N0BA 1Q1VA 2G9WA 2N1TD 4BXUA 3MN2A 4XLHA 4L76A 1URQB 2HOSA 2K9SA 2F5DA 3FHNA 4M3GA 1KU2A 2MC3A 3KZIH 1ZMEC 2LYCA 3V7SA 3NRVA 3F8NA 3VTPC 4H0LD 1JT6A 1V5EA 1BC7C 1FDIA 2ZYDA 1VI0A 1FYMA 4H13B 4BHCA 2KIQA 4NC7A 3RPUD 3AL0B 2H09A 2Y0SA 1N78A 1VL2A 1H89C 2HYNA 5E3LA 2OPTA 1U6GA 1W5CC 5TJHA 3JREA 2O6GE 3NARA 4UHTA 1UJ8A 4XKWA 4PD4D 3ZDMA 3TL4X 3M1EA 1SQXJ 1M57D 3BPVA 3H32A 1PFIA 1DIPA 2A6TA 1K83J 2ZXJA 2EB7A 2G8YA 2WPRA 2FBHA 3H1ID 3A7OA 3RQ4A 3MVPA 3IL2A 3NWTA 1QZZA 2DW4A 2L7MP 5E79C 1SD4A 5GPCA 1HGZA 3M0AA 1MFZA 1FBSA 4IL6E 5KJ7D 2WAEA 4CH7A 1ZG5A 1ZR4A 4DNCA 1M1KQ 1R5GA 2OBPA 4OAYA 2V9PA 1SQQE 4KUMA 5F64A 2AS5F 1IFNA 2JSPA 2QQ8A 1IO2A 2QVOA 4NPFX 3IC7A 4WY4D 5AW9B 5FRNA 2XV5A 2LF8A 4QLCU 1UMQA 1UCRA 3ZQ7A 3CMEP 4OGQD 1LJ2A 2VKEA 4A3IJ 1MFTA 1XMXA 1HDDC 4A6DA 1R00A 4A69C 1PVEA 1X3ZB 1EH8A 2F5CA 1KB9D 3BT9A 4GO1A 1E5WA 1KN7A 4DZJA 3H1KG 1K6YA 1KILD 3JRAA 1U8RA 4ZDPA 4ZH4F 1GU4A 2WV0A 1OWAA 1R1VA 4D5FA 1J1EB 4Y99B 1FIPA 3HSFA 3CUQB 3TEDA 1GK6A 1FOXA 2W90A 3H1HD 4R4LA 3CXHD 4XORA 4IHXA 2AO9A 2VE8A 1L0LE 1HC8A 1LVKA 4BQNA 3OYDA 2UWJE 3KFWX 1D8KA 1K78A 3FKJA 2YNYA 1BJAA 1LFPA 4RGUA 4XM3A 1B8IB 3S1KA 5APUA 1UIIA 1JHHA 4WF2A 3WMM0 3HE5A 2DPDA 4D1QA 2AHQA 1T2KA 2ZXIA 3PM1A 1ACIA 5K7FA 2TCTA 3KP5A 4XKBA 5AVXB 1Z05A 2V1NA 1R22A 3A0HC 3IHUA 3IWFA 4W7YA 1I3QJ 4H0LB 1D0ZA 4KICA 3MAJA 4D6TG 2PG4A 4AC0A 3CMYA 4U3FE 1VQ9P 3CD6P 4AYBN 3CDLA 3T97A 1KZHA 2WAFA 1EKEA 2RNGA 4OIQF 2Q3EA 5FO5A 2QJPC 4O6JA 1SQPE 1XTGB 1VQMP 1ODDA 2HVQA 3MKLA 1SVFA 1Y39A 1KONA 2BYVE 3RKWA 2WY8Q 1QZEA 2BW3B 1L2PA 1UFMA 3A2KA 2IS4A 3LSKA 3HRNA 2L9SA 4KYWA 1KYZA 1XTCC 2RH0A 2FOKA 1VDFA 3CP8A 1MNEA 3K4CA 4CCKA 4GDOA 2L9VA 2HU9A 1SD5A 1YE9A 2XKPA 4BGDA 1DQUA 1JKOC 1SQXK 2PLYA 3HZJA 2J59M 4I6MC 2FF4A 3HE4A 1QL2A 1EC5A 3HRUA 2OU2A 1VQPP 2IA2A 2HTSA 2XC7A 3FISA 3L74J 5EDNA 4WY4B 3RK3D 2BEOA 3CQZJ 2BCCE 2DK5A 2H7HA 1NU1E 2AEJA 1WSUA 4BHPA 4W80A 4Y17A 2DI3A 4A7PA 2DDBA 2NS7A 3CJNA 3VEPA 3L2CA 3RKQA 2WSCH 2V26A 2LXCB 5E18F 3OSGA 4OGQB 1F4KA 5C3EJ 3H1KD 4WCGA 4C2TA 4P5OA 4I0BA 4YFKF 2ZMEB 4RLFA 2WADA 4MHGA 5HS8A 4WWCA 3OYCA 3R61A 3G6EI 3AE7C 2EJRA 3P7KA 2TRTA 3OOPA 3W6JB 2R7RA 1KILB 3AG3H 1FDMA 3T0YA 2W84A 4KJZA 1Z3XA 2XF6A 2K9JA 2O03A 1SQVE 4AD9A 2E1MC 5J8FA 2CWEA 3U2RA 2FD5A 2OGUA 2Y0DA 5LRSA 4BY1J 3GFIA 2IT0A 4IKFA 1I1SA 1N73B 2KB7P 4PSWA 4OAZA 1K6OA 1YJWP 2H6BA 4NC8A 2WSEH 4ASVA 4U87A 2XSDC 5KLVK 1X0TA 1VQ8P 3BRVB 2DO7A 2MABA 3ZQQA 3G73A 1SAUA 3WHCA 4XICA 2V7FA 1IDZA 4HSTA 3KHUA 2NPSD 3FGAD 5L3DA 3M3YJ 2FJ1A 2KQRA 2P0WA 2LNBA 3GO5A 1XSXA 2C6YA 4B86A 1Z3YA 4XA4A 2A07F 1HQCA 3GXOA 4HA8A 4C2UA 3V2RA 1MH4A 4EQQA 2DJIA 1H9TA 1J75A 2XAHA 2JPBA 2GBYA 4HBLA 4Y15A 4LK1F 2GXBA 2HDCA 3FXUA 3ELKA 2E2IJ 3PNTA 3M9BA 1AV1A 2DA7A 1I27A 3TNUB 3WGGA 1ZLJA 1PJRA 3L71J 3MIWA 4NC6A 2BVLA 2WA0A 2KDZA 1SFCA 3OR2C 2WSSH 1ZGJA 1GT0C 2CG4A 3CCUP 1TBXA 2XAFA 4C30A 2R3CA 3PSFA 2VUMJ 3AEBC 5HNFA 1OYWA 1WGXA 2JKVA 1O3QA 1OW7A 3V7CA 3EFGA 5FKOA 1P4XA 4IQ4A 5EZHA 4EJOA 1SLQA 2L9RA 2OYIA 2EZLA 2H1LA 4I7HA 1E79H 3G1OA 3TO7A 1YYCA 4GKGA 3ONQA 1GMJA 3JRIA 5LHIA 4OWFA 3GF2A 3KP7A 4DOJA 3KEOA 4OMYA 3RK3B 2OC6A 4F92B 2HDDA 1RE3C 1RRJA 2Z33A 1FZGA 1AA0A 5KAFC 2V7QJ 2ZSHB 2ADUA 1A5JA 2FYZA 2HOAA 5FLMJ 1S5LX 2NXNB 2W57A 3D5LA 2RDPA 4I6ZA 1PUEE 3SFZA 2D5VA 1L4AA 3RL0B 1H88A 1H8AA 3QPHA 1ZN2A 1EV7A 1I39A 2M30A 3BPXA 4XRSA 1R49A 2STTA 1ULYA 2P58A 4BL0B 2M8RA 1X22A 2QBYA 1YW7A 5APVA 1DUXC 1SFKA 2W82A 5H2FH 2XB5A 4FASD 4BH9A 2K40A 2HGCA 3GWZA 3V2NA 3LSJA 3B5ND 1MMNA 3GTLJ 4TT3H 3WE3A 4O3MA 1N7LA 1D5YA 2MYSA 4EJWA 2QGUA 3AE2C 3RPUA 1QPMA 1QBJA 1T08B 3O8ZA 2GAUA 3HD7A 3PLNA 2JA8J 4GIFA 5IP9J 2ZNYA 1QVGO 1R6RA 4J19A 1KA8A 4HYEA 1IRXA 2GZWA 3S8PA 4Q48A 4DIQA 3AKZA 3GX4X 3GLLA 1I1GA 2ID6A 2NPSB 3VP8A 5EEHA 2VJ5A 1ZRTE 3RJPA 2LSOA 2VL8A 2DA4A 4LFUA 3MKWB 1XS9A 3EDPA 1L0NK 1LTGC 4Q47A 1BI2A 2G7HA 2O9LA 3L73G 5CKTA 1A31A 1EF4A 1YTYA 3L2RA 4OIRF 3M1CA 2ZJSE 5KJ7A 5LD2C 4JX4A 5CCHD 2M5AA 1SFCC 1M1JA 5FKLA 2KOGA 3TGNA 5L3EA 4BE0A 1HUCA 1Y8AA 3USSA 3FK6A 5EG0A 2ZT9C 9ANTA 3AEEC 2FEZA 3MFKA 1AA7A 3L75J 3RGUA 4M3LA 2A61A 2OYIC 1IUFA 2JVHA 5BS6A 4IJAA 5E8IA 2UXXA 3CO6C 4DQ2A 2UV1A 2ZMEA 1EDKA 2XASA 1M7LA 1PGOA 2K88A 5J1YA 3LQQA 2VIXA 5K7ZA 2BY1A 5IOZA 5K5RA 4S05A 3J81K 1JJ8C 1LTJB 5FLXZ 2GOXB 1MDMA 2X1DA 1GL2A 1W5CE 1K04A 2Z99A 1ZOYC 1W0TA 5C44J 3GTOJ 4M3BA 3BCCD 5AVUB 4BWNA 2W25A 4P96A 1N73A 1L4AC 1IV6A 3EUHA 1XSDA 1H88C 1H8AC 2IA0A 4N78D 2I1KA 2E5NA 1GVDA 1WI3A 4F93B 5TISH 4KIGA 4EOTA 3QOEA 5E79E 1FC2C 1JI8A 3NQOA 5FGMA 5AW2B 1JUSA 4Y4RA 5HLGA 2JRMA 2LD5A 2Z3YA 2AXTH 2WWWA 4MN4C 3I53A 1PGJA 1X1PA 3ZCOA 3WU1B 3C8VA 2HQNA 1IN5A 3ABUA 3KLOA 1FLIA 3ZQGA 2C9LY 1FBUA 3IKTA 2QJKB 2FRHA 2QCOA 2RKLA 3L2WA 3H9QA 4M72A 4W1UA 3GF3A 3HD7C 3IP4B 2HOEA 5KKZC 3B5NB 3TQNA 4H44D 1ETYA 3RTRA 4R79A 2PJRB 1TQMA 1TTYA 2HYJA 2ZB9A 3JAMK 2R92J 2IZ0A 4ANJA 2LDUA 4NHJA 5HVQC 2NVUB 4MFEA 3PHLA 2JTVA 2DA3A 4C9YA 3FXLA 2IEKA 1JOCA 3WGIA 2ZXEB 1LP1B 1FZPB 2BBYA 3CF2A 3ZN0A 3PL8A 2ZJPF 3VB2A 2QJYC 2IA1A 4HH2A 2Y0MA 3OY9A 1SMTA 2M8GX 3OAKA 3DXJF 4I01A 2DBBA 5J1RA 2CUJA 5HDGA 3AEAC 3CWBG 4PCQA 3MP7B 2GQQA 2E5ZA 2ZYAA 1ON1A 2IBZI 2DOEA 2E1OA 2YIUB 3L73D 2A06D 3O2PE 1M1JC 2H88C 3AE9C 4A3DJ 3P9CA 3M0DA 1SQQJ 1QO0D 1P4AA 1G3TA 3G1LA 2YXRB 3VYUB 2C9NY 2LRDA 3DP7A 3PIPF 3HC7A 1FBMA 1YRNB 2WB1N 2KISA 2P5VA 1M1EB 2DYSH 2ZC2A 3VSKA 3VSLA 3F3XA 4ESFA 3JW4A 1KQGB 3L74G 3BZ6A 2PMZN 2M7BA 1YS7A 3EPZA 2FBWC 4BJTA 3OWTA 2O3JA 3A0HE 5AW3B 1IF1A 1XGOA 1FZCB 4L75A 2OF7A 3TW7A 4IOCF 2RNJA 2EFPA 1GL2C 2PX9A 4JOMA 5B1AH 4XIDA 2VBZA 5EFWB 1USTA 3BTCA 5ILVA 3CCQI 4BY7J 2K9MA 3EUHC 1MD0A 3FXQA 1DP3A 3C1DA 4M3DA 2BV6A 2OTLP 1O3RA 3J7AY 4CCNA 1NWQA 1Y8QB 2MD5A 1L0LJ 2E1NA 1T56A 1Z21A 4L5IA 3CD6I 3RYPA 3U21A 4IL6H 4MEYF 4Y3OA 1GV2A 1Y9BA 1ZARA 3CL3D 4I7ZC 2M0MA 2V1DA 4PFPA 5EJCA 3U1DA 2OUMA 2J5OA 1BCCD 1D0XA 2ECCA 3H1JE 5CJ0A 3K70C 1L0NG 2KIFA 1DGRM 1IFJA 1PUFA 3G6EP 5IT9Z 2LFBA 2QWWA 2F4OB 3HGYA 1KMIZ 4XSXF 1I50J 1K79A 1PPJE 1HBXG 3DFGA 1OX3A 4XRFA 1PP9G 2JWTA 2XHKA 3C2HA 2KZJA 1JUMA 2XKOA 2KFDA 5K5OA 5H6RA 5C4XJ 2HFHA 4H44B 1VQPI 4DJGA 1Y1WJ 2NOGA 3BCBA 2ISYA 3ZQHA 2OQGA 4II2A 1K4SA 2KSJA 5GP9A 3E1SA 2ETHA 4BE2A 3AAFA 1SQPJ 3RZDJ 5AVVB 4HX4A 3L71G 4NPDA 1U57A 3CWBD 2M2EA 1I3AA 3TSIA 3OJAB 1FE6A 5KAIE 3D1NI 1CQTA 5DS9A 2R5BA 2WPVB 4ZYDA 1B59A 1HKSA 5F0CA 3PRJA 3OL4A 1VFCA 5BPIA 5CQEA 3MKYB 4H0EA 4IO9F 3K7AJ 5F08A 1A35A 3TDUC 3L70J 3IAS2 4ASNA 2W8ZA 1X3UA 5K5QA 1UHSA 1LTTC 2WQYC 2MG4A 3IFMA 3L36A 1MMSA 2J5UA 1K61A 3SFEC 1N7SD 2A6HF 3A4CA 3D6YA 4G7ZF 2VJJA 1SS1A 3L74D 2N9BA 4JP0A 1R36A 3V5BA 3RCOA 2L01A 3DQVC 1NU1J 3AE6C 2WT7B 4LLLA 2ZFWA 3TBIA 1IJWC 1TL8A 2GUVA 1VQ5P 2IBZE 1SQQK 1K73Q 2KRFA 4EJVA 3HB9A 5K1YA 1W5SA 2C0WA 4JQFA 4K2EA 4EVIA 4ENNA 4Y52J 3K9TA 3QU6A 2GWRA 3CX5H 3P8CE 2DMQA 2IPQX 1LB2A 2H1KA 2XU6A 1HJBA 2HNHA 1ZLLA 4XFJA 3H3ZA 1ZW0A 3SFIA 2R93J 1NH4A 2WB1A 4U7JA 1OCTC 3TYYA 2CMPA 4DJAA 4N4OB 1U3EM 1VQ4I 4AIHA 2R7TA 2PMZA 1R4NB 2DODA 5CJ9A 2QYOA 5EYRA 4BYYA 1TNSA 3RKXA 2K02A 2R7DA 2RN7A 2L5GB 2HYGD 2E35A 2F5VA 3LW5H 2X9DA 3CJQB 3ECOA 3TK1A 2P6TA 4ESBA 4PJ0E 4EI2A 2NVTJ 3AE5C 5M1BA 1JY3O 4RB3C 1L0ND 4RGSA 3GEZA 4O5VA 5DD8A 4HF0A 1S9KE 3ITKA 1MBFA 3I59B 3CJRB 4IEJA 1L0LK 3V6IA 3U1CA 3KP6A 1QHGA 2KIMA 2W6BA 3EUAA 1NTMG 1R5LA 4BXXJ 4A3MJ 3GTGJ 1LWUB 3OYJA 1PP9D 3HUSA 3HRMA 1P84H 2B7EA 1E3PA 5E3MA 4XRMA 4RBOA 3MZYA 5AW1B 3QRFF 3SZTA 3PH0A 4DT0A 1HTLC 3KPEA 1LVAA 2CQKA 5H6QA 5M3FJ 2HEOA 4OVNF 1AVOA 4HPQA 1WJAA 3OYKA 1F1ZA 4JX5A 2LKMA 3ZN1A 5AVQB 3IH2A 3P9IA 2L9NA 2P8TA 2Y0SN 4C3HJ 3IWZA 4GFBA 5GAEJ 3KE2A 5F0HA 2RREA 2XGCA 3LQRA 1HJ0A 1ZTRA 4LMYA 4CYDA 2ZAEB 3FXKA 2R7OA 3BJ6A 5DCMA 4XKCA 1FDOA 2FNPA 1ZKGA 5HLIA 1OKRA 4EDFA 4WXCA 1SQPK 1VF5D 1M8OB 2E74D 1TWFJ 2B89A 2N1TC 1FX7A 4PV1D 3ZMSA 2F4IA 2JMWA 3FMQA 3HHHA 2XRNA 2VBXA 1N7SB 4XNFA 1WKMA 2R7XA 2F48A 1CI6A 3M8FA 4A0XA 1QA6A 2H8WA 5IYDJ 4A3EJ 4RGRA 3C7JA 4FE7A 2KIUA 1RUOA 2IFNA 2JDIH 3FWLA 4R8HA 2K5CA 2YMYA 1J7KA 3RK2D 3RBZA 2NVQJ 5CQGA 5ILUA 2M34A 2KLOA 2AQFA 5D6EA 5IT3A 3F8MA 1YI2I 1NU1K 2E5YA 2KUBA 3A5TA 3NEUA 1RH5B 2VE9A 5EZGA 1TWAJ 2HKXA 3ROUA 2DYRH 4Z2YA 3T5XA 1FZEA 2OAZA 3L2VA 1H0TA 1HW5A 5GADJ 3CXHI 2XPVA 2X1EA 2X51A 3MZ8A 5KLVJ 4RAYA 2L7ZA 1ZLKA 3CC4I 3HRSA 4LG0A 2K9QA 3LAJA 2XIGA 3J7AO 1XDSA 4IHYA 5D6FA 1TNTA 2VQCA 1GZLA 2MH9A 1PYVA 4M73A 2BHYA 1ZR2A 4DGWB 3RL0D 3BVHA 1S7EA 3EETA 5AONA 2Z2SB 1NHLA 2W1OA 1NTMD 3O3KA 3HUSC 3KPHA 3FWNA 5KCMA 3GF7A 1GDTA 2CK3H 5AIQA 5GAGJ 1X79B 3SEQA 3CDHA 5CJ4A 2YR2A 5HLTA 3MGNA 4RM2A 3S93A 3MHVA 5AW4B 1REPC 2KNCB 1W36C 3VMYA 5APQA 3R0JA 1YYVA 3BG7A 3WG9A 1SQQG 1YJNI 3CO7C 3K4LA 2R3SA 1MKMA 3BG5A 4G6TB 5LHHA 1HSTA 1LE8A 1HLVA 2XVCA 3HTUA 1W7PD 4KITB 1EXIA 4N9IA 1MMGA 4AWXB 2WT7A 1BJZA 1D0YA 1PGQA 3QQAA 2HI3A 5LLQA 5APXA 2MW8A 4NDLA 2DU9A 2L7KA 1OCPA 1SANA 5H20A 1ZYRF 3IR9A 3TP3A 4NNJA 4WWIA 1XCBA 1SMYF 2PMHA 1FOYA 1LEAA 1LNWA 4LB5A 1VF5B 4IRIA 2K3RA 4KT5C 2YX7A 4BKXA 2E74B 2P1JA 4PV1B 4GYGA 1F43A 4PUSA 1OYIA 2BEZF 4Y13A 3HGGA 1U5TB 2KS1A 2QG4A 3WU2H 2ZSIB 1MNMC 3H1IE 2PEXA 3KCCA 3ESWB 3HBLA 4BUPA 1NTZJ 1KU7A 1QLED 1R5HA 3JRGA 3J80K 3E6CC 1BN5A 1NKZB 1TP4A 4YFXF 3RK2B 1QRYA 2N8GA 2Z1DA 3H9GA 1SAXA 4B3XA 5AIPA 5BPDA 1YBKA 2DTZA 4ETSA 2W00A 4HRIA 4DBRA 3PSIA 2QA4P 2X6YA 2AEMA 4M3EA 3E7KA 2MLGA 1R5SA 3KEQA 1EA3A 1ITYA 1S4XA 3V2QA 3BQYA 1P9QC 2P7JA 3ZQIA 4IF4A 3CZ6A 2R7VA 2A45G 1RC9A 3N4MA 4KISA 1DD4A 1IXCA 1Y0NA 3DLAA 2E7WA 4HNUA 1PDNC 2JJLA 4IL6X 1K8AQ 5EEAA 5AVSB 3QWOC 3L72J 2XAUA 1QVUA 2EPFA 3QYEA 1WJ5A 1B1BA 4L9TA 2JJ7A 4U3FG 2Y30A 1LGHB 4L9NA 4OMZA 3VMZA 1RETA 3M9HA 1SQPG 1BIAA 1MBHA 2ID3A 1FJKA 3RZOJ 4MO7A 5D8LB 1ZH5A 1OVRA 3BG9A 4NPEA 3HPGA 3HPHA 1NTKJ 4PJMA 3CXHE 3CCRP 4HX7A 5ILSA 3FK7A 2CQXA 1KQFB 3MKZA 4W7ZA 5D4RA 2FYUJ 2O1KA 2YUSA 3IAOA 1QVFO 2EFOA 1ENHA 2PFBA 2RV8A 4RMNA 4GYIA 3I0TA 5E79H 4Z6YA 2L54A 1DEEG 5F1JA 4HYTB 5J1UA 4HAMA 3PFIA 2HVSA 3I5CA 2OTLI 4WXDA 3RBXA 1CZQA 1HBWA 4UUTA 3QPLA 3JCUC 1S1CX 3V4GA 2PGDA 2W27A 1YIOA 3ZOBA 2QKMB 2VPRA 4UXNA 3DLLF 4X0GA 2FFDA 1W7PB 2R7SA 1U7JA 2BCCG 1NU1G 1PL5A 2QLZA 5E3OA 1MBKA 1PZQA 1YQ3C 3GHGB 1BI1A 2KYVA 3KQGA 1U78A 2LKPA 5KLIB 4YG2F 5TJJA 1LTIC 1K05A 1M90Q 1KTMA 4KA4A 2NRGA 4BRYB 3CCQP 3K1MA 2GA1A 1JTHB 2W48A 2P81A 3BJOA 3TO6A 3II6A 2QUFA 5BOXA 3IF4A 4BXFA 3S3NA 3HOVJ 5IPAA 3E6BA 3JRFA 1FP1D 2ZYGA 3H35A 1BI0A 1SQVG 2RN0A 2CSOA 2R5YB 2Q0OA 1NK2P 2RQQA 4BQAA 4B48A 3S16J 1ETWA 1IZ1A 1UHMA 4OINF 4C7NA 2DJNA 2QQ9A 1RIOH 2LBFB 2JRTA 3HUGB
chains in the Genus database with same CATH topology
1LDKB 2KIKA 2JA2A 4BXLA 2QRXA 1IRXA 3DU5A 3K4BA 2KRHA 2ZXHA 3S8PA 4BJ5C 4DIQA 4GRIA 3AKZA 4XL9A 1X1BA 3C2GA 4CCJA 2DXIA 3ZXSA 3PUBA 1X1DA 3DKYA 2VJ5A 4CUGA 3D5SC 4BEHB 1G8XA 2VL8A 2VPLA 4HJGH 2WBMA 3MKWB 1H0TB 4N4NB 1NVOA 5CKTA 4E7ZA 3L2RA 3DPUA 3M1CA 2B87B 1V5GA 3OYGA 5LD2C 2NOJB 3L2QA 3H9JA 2M5AA 4Y33A 3I3LA 3KEYA 1T95A 5CBOA 4XR6A 3E0JB 4CPGA 3EUKL 4BE0A 4CCOA 2LY1A 2VB6A 1U0JA 3LSMA 1AA7A 4LIUA 5JHFA 2A5WA 3RGUA 1X4OA 1EDIA 4XOPA 1LT1A 2VLAA 3K6GA 2JVHA 4B47A 4HEA2 4E6KG 1EDKA 2UV1A 2KP6A 3PNVA 2VIXA 2FUG2 2X6WA 3LSIA 1NG7A 3OMYA 2GOXB 2WMMA 4XLCA 2X1DA 2M3AA 4XLFA 4XLEA 4BE1A 1GLNA 2K9LA 3OIQA 4EATA 2E5NA 2R7QA 4F93B 3OYLA 2WY7Q 1TT0A 2MD0A 4XMYA 3ZR8X 3QOEA 1FC2C 1X1CA 1JI8A 1WJFA 1X1AA 3SEZA 4PJJA 2I8DA 4XLAA 4Y4RA 1V5FA 1TZLA 2VXDA 3DKXA 2CV2A 4MN4C 3VYTB 3ZCOA 2LH9A 2VXZA 2Z16A 2M4KA 2R4GA 2RKLA 3L2WA 3H9QA 3IP4B 2KS1B 2LR2A 4BJ6C 3RTRA 4R79A 4BDZA 2PJRB 2CV0A 2L2OA 4E7JA 2CW7A 3MMYB 1WJBA 4ANJA 2R44A 2O5RA 4LIVA 5HVQC 3OYHA 1UG0A 4H4KC 2CFOA 4C9YA 2XF7A 1LP1B 4IZZA 3CF2A 3PL8A 4HKZH 3ZRGA 3SZGA 3OYBA 3OY9A 2CUJA 4ZNCA 4KJMA 2JUGA 1D1BA 2E5ZA 3K4KA 2IS2A 2JWDA 3LSGA 3H5AA 4J00A 3CP2A 4YEJA 4F55A 2Q1KA 2HZDA 2VQLA 3I9V2 1WJDA 2X6XA 3VYUB 2LRDA 3RSNA 3HC7A 1E0EA 3TMOA 3VSKA 3VSLA 3W2AA 1Z7LA 3VYSB 5KNLA 2M7BA 3EPZA 1OR7C 3DWLE 4BJTA 4ZDLA 3OWTA 3HOTA 1BDDA 2HDWA 4JBZA 2XDVA 3OS2A 1BOBA 5CPRB 2VQGA 3M8JA 4JOMA 1QU3A 2OTKE 3K4JA 5EFWB 3AFHA 3AL0C 2K9MA 3EUHC 4B43A 4XQFA 3PFYA 3OYAA 1DP3A 3W3CA 3J7AY 4CCNA 3VYRB 1Z21A 3PJRA 2KL4A 3U21A 2DOAA 3HG9A 2CS3A 4Y3OA 3OS1A 2M0MA 2IXSA 4PFPA 3SYTA 4XN3A 2OUMA 3BCAA 4PJNA 2LREA 1D0XA 2K3PA 3OS0A 1MW7A 3K4MA 4XKVA 5LFAA 1DGWY 1X19A 4OWRB 1DGRM 3K70D 3K70C 2B88A 3VWBA 4B44A 3OYNA 4E7IA 4D9JA 3ZGKA 2KHMA 2BW3A 5KHDA 1VZ0A 1Q2NA 1N75A 4IOIH 4YRVA 3D5RC 2HPMA 2IGKA 3C2HA 2KZJA 2MC4A 2X1CA 3OR1C 2UWMA 5CBNA 1Y6IA 2IGOA 2E60A 3DTEA 3BCBA 1WJCA 3UR3C 3LSHA 4II2A 1EDLA 3E1SA 3IAM2 4BE2A 3L2UA 1ZXGA 4K35A 3N05A 4PFOA 2KZVA 4NPDA 3PNYA 3CMMA 3FXDA 2AQEA 1EDJA 3OL4A 4F52A 3K4NA 5CQEA 3MKYB 4BDYA 1Y47A 3IAS2 3FBIB 4CA0A 2M5AB 1HA8A 1OVVA 4PK4A 2LOOA 2VJ4A 1QHHD 4HSRA 3A4CA 3W2WA 2LXBA 2UUZA 2VJJA 3NWSA 4QPQA 4BACA 4CSWA 3BC8A 1OVUA 1SS1A 3RCOA 3DQVC 4ZTFA 1FMWA 4XN0A 4XLHA 5TGTA 3TBIA 3MZWB 1YX5A 3FHNA 3FXEA 4EYYQ 2V9KA 5FROA 5C39A 4JQFA 2LYCA 2KMUA 2HVRA 2HNHA 5HNHA 1ZW0A 1V5EA 2WB1A 3DU6A 2CMPA 4DJAA 4N4OB 2BVMA 2DCEA 4LG3A 4NC7A 3RPUD 1NG6A 2R7TA 2PMZA 3AL0B 4ZMDA 3OYEA 3DPTA 2QVAA 2Y0SA 4ZTJA 1N78A 1ZELA 3MD2A 2VASA 2F5VA 4LITA 4HNTA 2VKDA 3CJQB 4XKWA 1J09A 4DBQA 3ZDMA 3TL4X 4BQOA 4E7HA 4ZC3A 2A6TA 3HXLA 1U7MA 4NUBA 2M4GA 4BS9A 2JVGA 1N77A 3RQ4A 2MFZA 3NWTA 3CJRB 1QHGA 3EUAA 1UAAA 2WAEA 3V42A 4CH7A 3W2VA 3SDBA 4OAYA 3H5RA 3OYJA 2JSPA 1BR2A 1BDCA 4NPFX 3PH0A 5FRNA 1MNDA 2CV1A 2LY2A 4HPQA 4BU2A 1WJAA 1MFTA 3OYKA 4AU7A 2KPMA 2L9NA 2M0BA 2RREA 3HOSA 3BLYA 1K6YA 2ZAEB 2R7OA 3S3OA 4ZDPA 2L5QA 4XKCA 3HL2A 4AYBA 4U7BA 1D1CA 1UELB 4HB1A 2HQAA 3DTKA 3DPLC 2B89A 4XORA 1LVKA 4BQNA 3OYDA 2W7NA 3LL7A 2UWJE 2F4IA 3FKJA 4PSXA 1LFPA 2V4JC 4XM3A 4XNFA 2R7XA 3OYIA 4J01A 3S1KA 2IS1A 1BR1A 4FETA 4D1QA 3A1YA 2ZXIA 2Q1ZB 2K5CA 2LBFA 4CZCA 4XKBA 5CQGA 1S3JA 2V1NA 2KLOA 4CCMA 2AQFA 2KUBA 1D0ZA 4BEHA 3KYLA 3L2VA 1MMDA 3QYBA 1H0TA 2X1EA 2X51A 1G59A 4IQJA 2KZIA 1ERDA 3OOUA 2WAFA 2RNGA 2B87A 3CESA 2ZFUA 2HVQA 4ZDOA 2VQCA 1KONA 1PYVA 2WY8Q 2BW3B 2IS4A 3A2KA 2KI7B 3LSKA 4DGWB 2L9SA 3QYFA 2Z2SB 2DT6A 2W1OA 4XOTA 1T0FC 1D1AA 1MNEA 3CP8A 3K4CA 5KCMA 4CCKA 2HU9A 1YE9A 4BGDA 1DQUA 3LMMA 3SEQA 4HG2A 5HLTA 4P1WA 4RM2A 3S93A 3MHVA 1EC5A 3OYFA 1W36D 1W36C 1LKXA 2XC7A 2XSJC 2GOMA 3BG7A 1YX3A 3K4LA 4G6TB 3G2BA 5DJUB 2V26A 3HUGB 2LXCB 4KITB 1MMGA 4ASWA 1D0YA 1X4PA 2CH0A 2XF5A 4P5OA 4ZYAA 4C2TA 4RLFA 3OYCA 2WADA 4RM3A 2IGNA 2R7RA 3FDYA 2L7KA 4KJZA 1Z3XA 2XF6A 2F6CA 4NNJA 4WWIA 2CUZA 3S3MA 2E1MC 4YELA 3OL3A 3VDXA 4IKFA 2K3RA 4PSWA 4OAZA 4PUSA 4NC8A 1BR4A 2VQHA 4U87A 4ASVA 1X0TA 3H0DA 2MABA 4NQWB 2ZSIB 2SPZA 4K3AA 3ZQQA 2PJRA 1SAUA 4BUPA 2V7FA 2DT7B 3K10A 4HSTA 2ELJA 1LP1A 2Z1DA 3H9GA 1OLTA 2KQRA 2P0WA 2X85A 4B3XA 2VJIA 1Z3YA 2W00A 3UNGC 4HRIA 4DBRA 4E7LA 4C2UA 3PSIA 2LG4A 2X6YA 4GODA 2DJIA 2Q2EB 1EA3A 3OIPA 3HKZA 2KDOA 1P9QC 2WAQA 3LFUA 2R7VA 3CZ6A 1JMBA 3PNTA 1WJEA 4KISA 3DLAA 4HNUA 1FMVA 4E7SA 3FBNB 2M7AA 1PJRA 3QWOC 2XAUA 2V6EA 3QYEA 1WJ5A 2BVLA 2HPIA 2WA0A 3DEEA 3OYMA 5K5GB 2IGMA 3OR2C 4DOZA 4RLQA 3BG6A 4C30A 3DTIA 1OVRA 3PSFA 4XONA 4NPEA 5HNFA 4KT6A 1JM0A 3HPGA 3HPHA 2VKHA 4PJMA 4QPOA 2KRCA 4IQ4A 3S32A 2W4SA 5HOOA 3MKZA 4II3A 4ZJZA 4RMNA 3ONQA 4ITVA 1DEEG 2HVSA 2OC6A 4F92B 4AVZA 2ZSHB 2QKMB 1WFXA 4GOEA 4X0GA 2BOLA 4F91B 3QODA 4PJLA 2R7SA 3IUOA 1U7JA 3D5LA 4MLOA 2OV7A 2R7WA 2P58A 4GOFA 2R7UA 4BL0B 3F9KA 2IS6A 1SFKA 2W82A 2LC2A 1MMAA 5FRMA 4FASD 4IX7A 3H5NA 5DJTB 2E1MB 4E4HA 4BXFA 3S3NA 2CW8A 1MMNA 2HR3A 3GBGA 3H35A 2MYSA 2QKLB 4CCLA 4BQQA 4E7KA 2RQQA 4B48A 1Y56A 1S9HA 3KX2A 2LBFB 4F3QA 1R6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIK A;  4BXL A;  4ASW A;  1BDD A;  2QRX A;  1U7M A;  4JBZ A;  4HJG H;  1H0T B;  4WWI A;  2OTK E;  5EFW B;  1NVO A;  1BDC A;  2B87 B;  2K3R A;  4NPF X;  3PH0 A;  2M5A A;  5CBO A;  4ASV A;  4CPG A;  1X0T A;  2KL4 A;  2SPZ A;  4K3A A;  1MFT A;  2M0B A;  3RGU A;  1EDI A;  2B88 A;  2ZAE B;  1LT1 A;  1LP1 A;  1EDK A;  4GOD A;  4HB1 A;  1Q2N A;  2WMM A;  4IOI H;  2B89 A;  1JMB A;  2KZJ A;  2UWJ E;  5CBN A;  3S1K A;  3QWO C;  1EDL A;  5K5G B;  1ZXG A;  4K35 A;  1FC2 C;  4NPD A;  2I8D A;  3FXD A;  1OVR A;  1EDJ A;  1S3J A;  4NPE A;  1JM0 A;  4MN4 C;  1Y47 A;  2KUB A;  2M5A B;  1OVV A;  2RKL A;  1H0T A;  2KS1 B;  2LR2 A;  1DEE G;  2KZI A;  2LXB A;  1SS1 A;  1OVU A;  2OC6 A;  2B87 A;  2R44 A;  1LP1 B;  4GOE A;  3MZW B;  3FXE A;  1U7J A;  4EYY Q;  4HKZ H;  5C39 A;  2KI7 B;  4ZNC A;  2P58 A;  4GOF A;  4KJM A;  2JWD A;  1ZW0 A;  2Q1K A;  5DJT B;  3MHV A;  4ZMD A;  1EC5 A;  2HR3 A;  2QVA A;  5DJU B;  3ZDM A;  2LXC B; 
#chains in the Genus database with same CATH topology
 1LDK B;  5GAH J;  4BXL A;  5APW A;  1ZAO A;  2C0X A;  3K4B A;  4D7M A;  1OJL A;  4UY8 I;  3H1J J;  3C2G A;  4ON0 A;  2DXI A;  2OYH B;  1LT9 A;  4IOA F;  1T8Z A;  3DKY A;  4CUG A;  3L70 E;  2AEF A;  3D5S C;  4BEH B;  1G8X A;  2VPL A;  1I6H J;  2WBM A;  3I55 P;  2CO5 A;  1HF0 A;  2FML A;  1RKW A;  1NTZ K;  2LTP A;  3B02 A;  4E7Z A;  5DV5 A;  3DPU A;  2JZY A;  1ETQ A;  1AFO A;  2B87 B;  1V5G A;  3GCM A;  3OYG A;  1RR8 C;  1IAW A;  1B72 B;  5F6F A;  2VN2 A;  4Y33 A;  3A0H H;  1ZRC A;  3CX5 D;  1IN6 A;  1GUU A;  1OCC H;  1YQA A;  3AED C;  5CBO A;  3E0J B;  2HKO A;  3H1K E;  4U3F D;  3G3Z A;  2NNN A;  1ZG1 A;  2XGX A;  3I4N J;  1R4M B;  1XGS A;  1TC3 C;  2VB6 A;  4MFD A;  4OOI A;  5J8C A;  2ITA A;  3LSM A;  3TOA A;  2HPC B;  4UB8 C;  5FD6 A;  5JHF A;  3IRR A;  1OW8 A;  2LKX A;  1SQP D;  2VT2 A;  1VQ5 I;  4XOP A;  1URQ A;  4HF2 A;  2H89 C;  3K6G A;  4B47 A;  4E6K G;  3EYY A;  3S2H J;  4CHU A;  1MBE A;  2J58 A;  2FUG 2;  4M74 A;  5KAI C;  2FBK A;  5FFZ A;  3OMY A;  3TOB A;  4XLC A;  2STW A;  5E17 F;  1NH3 A;  2O61 A;  2X4H A;  2WZ7 A;  4GDF A;  4IVN A;  4UB6 C;  1FP2 A;  5JR3 A;  3CCJ P;  3DF8 A;  1SP4 A;  3BR0 A;  3M91 A;  3U59 A;  4FE4 A;  1TWC J;  2FFD C;  3S17 J;  3F72 A;  1VTN C;  1T2K C;  4BE1 A;  4M71 A;  1GLN A;  3H92 A;  3OIQ A;  2YXQ B;  1MBG A;  2R7Q A;  1S2E A;  2O3F A;  4N9H A;  2BCC D;  2XAJ A;  3OYL A;  2WY7 Q;  4XMY A;  2MD0 A;  1NU1 D;  1OCR H;  1LEB A;  2FYU K;  3L35 A;  5IP6 A;  3A2A A;  5DM7 F;  1P84 D;  4XLA A;  1FZA A;  1TZL A;  3DKX A;  2CV2 A;  4IHS A;  2OYO A;  2QIW A;  4YTP C;  2LH9 A;  3CMA I;  3JSO A;  3S1R J;  3FWE A;  3VFZ A;  2VXZ A;  2WTY A;  1VQ4 P;  4D6T D;  4KMU X;  3WHB A;  3DEW A;  3AEF C;  1SQV D;  3WUT A;  4JF7 A;  1GVJ A;  4BJ6 C;  4BDZ A;  2CV0 A;  4E7J A;  2CW7 A;  1P7I A;  2O0Y A;  2D1V A;  3LIE A;  2FYN B;  1NGM B;  2EIK H;  1GHC A;  4C7R A;  1SEU A;  3F0C A;  1BGY E;  3F6O A;  4OU0 A;  1LT9 C;  1ZN5 A;  4ENM A;  2E7X A;  3I56 P;  2JK3 A;  4A3B J;  1J1D B;  4HKZ H;  1BE3 J;  3OW2 O;  3H3V K;  3OYB A;  3VOD A;  4PJ0 C;  1GK4 A;  1UIX A;  2DK8 A;  1SFU A;  5DUK A;  4KJM A;  3WGH A;  1IK7 A;  5GTI C;  3LSG A;  2D2C C;  3H5A A;  1DU0 A;  1HGV A;  2N9Y B;  3C3W A;  1ZG3 A;  4YEJ A;  2Q1K A;  2K85 A;  2XV4 S;  4A5M A;  3RPQ A;  4QTR A;  3F21 A;  3ABL H;  2WPS A;  1WJD A;  2NZ2 A;  1HW1 A;  1CSB A;  2H8P D;  3RSN A;  3N97 A;  3CUQ A;  2V6C A;  3M8E A;  4D0P A;  2ISZ A;  1WWX A;  3LA7 A;  4UVC A;  5KNL A;  1QX8 A;  5GTH C;  1URQ C;  2E75 D;  4W97 A;  3HOT A;  3A0B C;  1B8I A;  4CYC B;  2DN0 A;  1YO5 C;  1OIP A;  1BIB A;  1W7P A;  2EA4 A;  3OS2 A;  1XB4 A;  1G6N A;  3QPT A;  1RF1 B;  2FXA A;  3L37 A;  1IN7 A;  2EZK A;  2VQG A;  3M8J A;  4H13 C;  4MNU A;  1QU3 A;  1R23 A;  2OTK E;  3LID A;  2Y0C A;  3AL0 C;  3OYA A;  2KZG A;  3PO3 J;  2A68 F;  3PFY A;  1NAY A;  2GUS A;  3W3C A;  2Y9Z A;  3C9I A;  3HTS B;  1HF9 A;  5KLV E;  1RQV A;  1QPI A;  4ZYH A;  3GTQ J;  2EZH A;  2H8R A;  3U1A A;  5E20 A;  5CCG D;  3L4F A;  2RVC A;  2K7L A;  3M9Q A;  1F36 A;  1JY2 O;  3JC2 2;  5FLX K;  1JGS A;  3SYT A;  4XN3 A;  1EZV I;  2M3E A;  3BCA A;  3FF5 A;  2LRE A;  1JKR C;  2COM A;  1MW7 A;  3OS0 A;  5B3S H;  2HPM A;  1DGW Y;  5C39 A;  2CFX A;  3ASO H;  2E36 A;  2EFW A;  3VWB A;  3BJA A;  4OIP F;  1SQX G;  2L91 A;  4U0V A;  2ME0 A;  2RQP A;  3P5J A;  4M3F A;  5ERI A;  5KAF H;  2KHM A;  1YI2 P;  1F9N A;  2BW3 A;  2ZBK A;  1VZ0 A;  5CLS A;  1MGT A;  4XBF A;  4CZC A;  4G94 A;  3E1I A;  2V7Q H;  2E76 D;  3KZI E;  3GTM J;  3I54 A;  5B5E C;  3AEC C;  2OCC H;  1YQ4 C;  1FTZ A;  2GM4 A;  3TGU J;  2CQ7 A;  3CC4 P;  2MC4 A;  1IN4 A;  2YO2 A;  4RKU J;  2XAG A;  5K7H A;  2VC1 A;  2UWM A;  2FXP A;  5CBN A;  2XDJ A;  3L9F A;  3LSH A;  4HNV A;  1EDL A;  3IAM 2;  4WY4 A;  1ETX A;  1A6I A;  4A0Y A;  2HG5 D;  1WHU A;  4JK1 X;  2JT1 A;  4CDG A;  1TWH J;  1SQB E;  1J2X A;  3PNY A;  2X48 A;  3BG3 A;  1XPX A;  4S0H B;  2BEQ D;  1P6R A;  4LD5 A;  4BDY A;  3BRO A;  2PQ8 A;  1AHD P;  3JR9 A;  2YU9 J;  3FBI B;  1J1E C;  4Y99 C;  3CUQ C;  1KIL A;  3BCC E;  1HA8 A;  1LTA C;  1OVV A;  2K27 A;  1J2J B;  1ZRT D;  1LDD A;  4OH8 B;  2ZVN B;  1KOR A;  3AG1 H;  1YJN P;  2LXB A;  1T3U A;  2VRS A;  3KXD A;  5LGU A;  1OVU A;  1USE A;  2O01 J;  3ML6 A;  2X6O A;  1E2X A;  4EJU A;  2Y48 A;  5LGN A;  2OZ6 A;  3QH9 A;  4L9J A;  4ABZ A;  3CC7 I;  1NTZ E;  1E17 A;  3NMD A;  1YX5 A;  2E75 B;  2A69 F;  4EYY Q;  2V9K A;  5FRO A;  1YFH A;  2ZVO B;  4KIB A;  1D3Y A;  5HNH A;  4H0L C;  1AJY A;  2CRG A;  3ZMU A;  2OJE D;  2DOF A;  2DQL A;  1X8Y A;  1VF9 A;  3G1M A;  3EWK A;  1R9T J;  3PJS K;  2BVM A;  2QA4 I;  4DCK A;  1NG6 A;  2N1T B;  1FOW A;  3DPT A;  3FMR A;  2QEN A;  3OYE A;  1KYO I;  1B4A A;  1JEK A;  2IYP A;  2MJZ A;  2W83 C;  4KHX A;  3GFL A;  3GMA A;  4LIT A;  4HNT A;  2CYY A;  2VKD A;  3L72 E;  4E7H A;  2FA5 A;  4L5E A;  1SFO J;  4ZC3 A;  3H1I J;  2FXO A;  1FZF A;  2HQ5 A;  3TNU A;  2OZU A;  3HXL A;  2QSH X;  5JLW A;  2IFM A;  3K5B A;  1SQX D;  1IG7 A;  2M4G A;  1APL C;  1KQ0 A;  2JVG A;  1N77 A;  2A06 E;  2JR8 A;  2MFZ A;  1GTW A;  1AKH B;  3CJT B;  1NTK E;  4N3Y B;  3H1J G;  3V42 A;  4UUS B;  3J7Y J;  4ZKP A;  5KJ7 C;  3QWL A;  3SDB A;  3FXM A;  5F04 A;  3VPR A;  1NK3 P;  3S1N J;  3OSF A;  3CCR I;  2FYU E;  3VMX A;  1D7M A;  2E76 B;  4UNO A;  1W2B O;  3RIR A;  1T0F A;  1BR2 A;  5E1W A;  1BDC A;  1T38 A;  4EMS A;  4EGZ A;  4DZO A;  4WY4 C;  3JCU E;  1YOV B;  1BW5 A;  1KC8 Q;  1EZV E;  1MND A;  1BA5 A;  3Q5F A;  4D7N A;  3BAS A;  1PPJ G;  2IAI A;  2LY2 A;  2R5Z B;  2FY8 A;  2XKM A;  3BR3 A;  2RMZ A;  4OGQ C;  1NO4 A;  1A04 A;  1TU3 F;  2ZME C;  3JRB A;  5J6X A;  3SZP A;  1XDU A;  3HSR A;  3AG4 H;  1KIL C;  3S3O A;  2B0L A;  5CHX A;  3HL2 A;  3ABK H;  1FYK A;  2YO3 A;  1LFB A;  3K1P A;  1W0U A;  2AXL A;  3H1H J;  1UEL B;  2X0L A;  4HB1 A;  3O6B B;  5BU8 B;  2HQA A;  1QVT A;  1TWG J;  3DPL C;  1N73 C;  3A01 B;  4HW0 A;  5HS9 A;  4GCV A;  3KYD B;  2W7N A;  1N2D C;  4V2G A;  5CVV A;  3WOD F;  2WPQ A;  2L0K A;  3Q0W A;  4FTH A;  3L09 A;  2QSG X;  2V4J C;  1BCC E;  2V1U A;  1XC5 A;  4J01 A;  2FXM A;  1FT9 A;  1R5I D;  2DMN A;  5LEJ A;  3TW6 A;  2IS1 A;  3S1M J;  1JXS A;  4B3A A;  1Z77 A;  2P7C B;  1TW3 A;  1P92 A;  4A6E A;  1CW5 A;  3O8G A;  4LK0 F;  3R60 A;  3B6A A;  5EEG A;  1OCZ H;  4HQM A;  3WE2 A;  3JAM Z;  4P9U A;  2FX0 A;  5J3L A;  2MSY A;  1WVR A;  3JRH A;  3F22 A;  1ZHF A;  1IFP A;  2IBZ G;  2P2U A;  4CCM A;  3SSU A;  3MQ0 A;  3WTY C;  3EFF K;  1BC8 C;  2NPS A;  4EM0 B;  1HOM A;  2K9Y A;  1X58 A;  3I55 I;  2GA2 A;  5JI6 A;  3KYL A;  4ENK A;  1IO4 A;  3GW6 A;  5AW0 B;  1WQ2 A;  3BDD A;  2FQ4 A;  1G59 A;  4IQJ A;  2KZI A;  3OOU A;  2H43 A;  2IBD A;  3Q3D A;  1IW7 F;  5IY5 H;  2DAO A;  4FX4 A;  2CUE A;  1A6Q A;  2BY3 A;  5HDN A;  4UB8 E;  3ULQ B;  1K4T A;  1A02 J;  2WVR A;  1S72 I;  1PV3 A;  3QYF A;  4DYR A;  1T0F C;  2QEX I;  4OIO F;  1B6A A;  3M0D C;  3D0S A;  1KYO E;  3KLN A;  1XTA A;  2XB0 X;  4UB6 E;  1G2C B;  2HZT A;  3LMM A;  2A3S A;  4RB2 C;  2BE5 F;  2K1A A;  1K7A A;  3OYF A;  3F8B A;  3HOW J;  2XSJ C;  1FBQ A;  2GOM A;  3WTZ A;  1PPJ D;  2Q7C A;  3RK3 C;  3JRD A;  3CCJ I;  2KT0 A;  3F8F A;  3I71 A;  2EFQ A;  4UVB A;  1JNM A;  4EGY A;  5JVG F;  3Q0V A;  3GLM A;  3H1K J;  3IKV A;  2A45 H;  2V4H A;  4ASW A;  2CH0 A;  2XF5 A;  3RKY A;  3RI4 A;  1A36 A;  1IFM A;  2GXG A;  1OR7 A;  5DD4 A;  4RAZ A;  2DA1 A;  1HXD A;  3FDY A;  3V2P A;  1OFC X;  3IRQ A;  2Z5U A;  2F6C A;  1SFE A;  5IYC J;  2IVM A;  2O1J A;  1OMI A;  2CUZ A;  2MLK A;  4MGR A;  1QEX A;  3WUU A;  1STZ A;  1YIJ P;  3IV5 A;  1T3J A;  2ZXX A;  2WWY A;  3VDX A;  2QQB A;  3AEG C;  3C1L A;  1E3H A;  3BP8 A;  3COA C;  4HV5 A;  1FJL A;  2SPZ A;  3B5N A;  3F6V A;  2PJR A;  5KK1 A;  2XRO A;  4CIC A;  2EA2 A;  1U8B A;  2GIZ A;  1BE3 E;  2VBW A;  1G3S A;  1HDP A;  2P10 A;  2VON A;  2EV6 A;  1P2F A;  5EGO B;  4RES B;  3V8L A;  3I56 I;  5GTI E;  2NPS C;  1VQK P;  2ELJ A;  3HOY J;  1LP1 A;  2IBZ D;  2ZO4 A;  2ZXW H;  2X85 A;  1OLT A;  1WI9 A;  5M5W J;  1PP9 E;  3R0A A;  3P8C D;  2VJI A;  3CMA P;  1S6L A;  1Z91 A;  4EJT A;  3HM5 A;  2QSF X;  2HOT A;  3OIP A;  3HKZ A;  1JY3 N;  4L9V A;  1FOS F;  5CVJ A;  5DCF A;  2EV5 A;  1RHZ B;  1Y8R B;  3V8K A;  3BR6 A;  5GTH E;  2HOD B;  4IRH A;  5H2F E;  3H32 B;  5LHG A;  2M9H A;  5LBQ A;  4E7S A;  2XPU A;  1RNL A;  2COB A;  2M7A A;  3GLX A;  2JA7 J;  1HCR A;  3A0B E;  5AVZ B;  5FLV A;  1YRN A;  2QJP B;  5CCH A;  3CF5 F;  2G0E A;  5K5G B;  4I09 A;  3L71 D;  4PD4 I;  1BGY J;  3IH4 A;  1QL1 A;  2IGM A;  2K3F A;  2E19 A;  2ICW G;  3SWF A;  5D5U B;  1QGK B;  2M0C A;  1NOH A;  4XON A;  5KTB A;  1S9K D;  1JM0 A;  4KT6 A;  4C2M J;  3BWG A;  2VKH A;  2E5T A;  3L75 G;  4QPO A;  1FZC A;  3S32 A;  2CQQ A;  1T6A A;  5HOO A;  3BR5 A;  4FT8 A;  5BMZ A;  1JMM A;  4RJT A;  4II3 A;  3I5U A;  4ZJZ A;  5A2Q K;  1USS A;  5FFX A;  5DEQ A;  4M6X A;  1NKN A;  1G3Y A;  4G8X A;  3ZQL A;  1BM9 A;  3ZQC A;  3HJE A;  4AVZ A;  3DBH B;  3H1L J;  1FZB A;  2E42 A;  4NBQ A;  1Q90 D;  1WFX A;  4XRS G;  3E5X A;  4GOE A;  3QOD A;  4PGG A;  4PJL A;  3IUO A;  4KIF A;  1W4M A;  5GPA A;  4BBS J;  1QNT A;  2EK5 A;  2LK2 A;  1D8J A;  1GW3 A;  3HYI A;  2EIJ H;  4KN4 X;  4WX9 A;  1SD6 A;  2R7W A;  1IRZ A;  1KB9 I;  4GOF A;  3F9K A;  1PGP A;  4M6V A;  1XCV A;  5AVT B;  1QQI A;  4AUW A;  2IS6 A;  3M07 A;  5B5E E;  1HSJ A;  2LC2 A;  1MMA A;  4HX8 A;  3M9A A;  4RB0 A;  3CCL I;  1SVO A;  2QJK C;  1U9N A;  4IX7 A;  4LOC A;  3GZ6 A;  3H5N A;  5DYM A;  1K78 B;  2WSF J;  5DJT B;  3AG2 H;  2E1M B;  3Q0U A;  4E4H A;  2QQA A;  4S04 A;  1ZRF A;  2UXN A;  1N86 A;  3B5N C;  3TGU E;  4FIS A;  4Z1M H;  5ICC A;  1J9I A;  2KXP B;  3K2A A;  3HE5 B;  4PGH A;  3ERM A;  4F7Z A;  3IN6 A;  2F2E A;  3GME A;  4E7K A;  3AE4 C;  1IXS B;  4XLP F;  1S5L C;  2E71 A;  3J7Z I;  2JA6 J;  4MTD A;  2JO1 A;  4L0Z B;  1JY3 P;  3KX2 A;  4F3Q A;  4LJZ F;  5AVW B;  4B1R A;  1HVV A;  2KIK A;  2JA2 A;  4CGZ A;  4BAY A;  1D5V A;  4C46 A;  5F27 A;  5JVT A;  2QRX A;  3DU5 A;  4CO8 A;  4JPZ B;  2ZXH A;  2DFH A;  4WB4 A;  3P32 A;  1LTS C;  4XL9 A;  1X1B A;  3H1I G;  3T8R A;  4UVA A;  2JN6 A;  3WTS C;  3BR1 A;  3ZXS A;  1X1D A;  4NB5 A;  2KLU A;  2TDX A;  3HSE A;  3QP6 A;  2YIU C;  4HJG H;  1RPW A;  1LUJ B;  1X2N A;  1G2H A;  1XSV A;  2IJL A;  5LEK A;  2DMU A;  1NVO A;  2EIN H;  1W5T A;  3EQL F;  3CCV I;  1LTJ A;  5FJ8 J;  5C4J J;  3PO2 J;  1JKP C;  3L2Q A;  2ZJQ F;  2AXT E;  2EWN A;  5CCH C;  3I3L A;  3KEY A;  2Q9I A;  1T95 A;  3KZI C;  1SFC D;  1R1U A;  4XR6 A;  4U0Y A;  4CPG A;  4AYC A;  4FQG A;  3BR2 A;  3F8C A;  2WIT A;  4CCO A;  4LC1 A;  4JYB A;  2W24 A;  2LY1 A;  5LRR A;  5HDK A;  2ZT9 D;  1CF7 B;  1U0J A;  3Q1M A;  4RDU A;  4LIU A;  1WMK A;  2PRR A;  3A3Y B;  1MZB A;  2A5W A;  1SQB J;  1X4O A;  1EDI A;  1FZC C;  4BHB A;  1Z6T A;  1JUP A;  3L75 D;  3HE4 B;  1FC3 A;  3L00 A;  1WCM J;  2KP6 A;  3PNV A;  1C0W A;  1FOK A;  1IFI A;  2X6W A;  3LSI A;  5HOD A;  2A6E F;  1WH7 A;  2WMM A;  1NJI Q;  2YU3 A;  1KU3 A;  4U0W A;  3JTG A;  4M9S A;  3BCC J;  3WU0 A;  2QSI A;  2E43 A;  5APY A;  1Y1V J;  1RZ4 A;  4PD4 E;  2H94 A;  2XAQ A;  4A3G J;  5ED4 A;  2Q3I A;  1L4A D;  3CX5 I;  1PIX A;  2E34 A;  5TRD A;  2FKW B;  4N6J A;  3CC7 P;  2Y9Y A;  1JJ6 C;  1TT0 A;  5FKN A;  4I2O A;  3ZR8 X;  1L0L G;  1ORK A;  5F1R A;  2HFE D;  4KDP A;  1WJF A;  3FIW A;  2DFF A;  1X1A A;  2K9J B;  3SEZ A;  2VBY A;  2P6S A;  4G6D A;  4PJJ A;  2BY0 A;  2I8D A;  2JWA A;  3H6P A;  2WC2 A;  1O3T A;  2LP0 A;  1V5F A;  5EGO A;  3K2Z A;  1JCD A;  4I1L A;  3VYT B;  4EEF G;  4XE5 B;  4ZKU A;  1F5T A;  3CTA A;  3I59 A;  3P9K A;  2KSE A;  2Z16 A;  5AVY B;  2R4G A;  1ZP0 C;  3D71 A;  3B4S A;  3HD7 D;  1YJ9 P;  3H0G J;  1LWU A;  2LR2 A;  4H44 C;  4TV7 A;  1LDJ A;  2KLV A;  3MMY B;  1WJB A;  1YLF A;  3SHF A;  2IYO A;  5E1Z B;  4RA2 A;  2O5R A;  1RF0 A;  1UG0 A;  2HOD A;  2CFO A;  3H36 A;  3K1N A;  1KB9 E;  2XF7 A;  2JEE A;  1X2M A;  5DDG A;  1KIL E;  2ME6 A;  3MZH A;  1WZ2 A;  4M9X A;  4C3I J;  1KGS A;  2I1J A;  1SVL A;  3U9G A;  5J47 A;  1YTZ I;  1IGN A;  1P84 I;  2JP3 A;  2JUG A;  3L73 J;  2YMK A;  1D1B A;  1BW6 A;  1W1W E;  1LTJ C;  2DMP A;  2JPC A;  4IHV A;  2HYF A;  3H1H E;  1XD7 A;  4J00 A;  3CP2 A;  1OPC A;  2OQR A;  3FX3 A;  2MBF A;  3V4W A;  4F55 A;  2HZD A;  2X6X A;  3L70 G;  2O8X A;  5DM6 F;  4IXA A;  4YXW H;  1SQQ D;  1PP8 F;  2DFE A;  2XND H;  1KV4 A;  1WT6 A;  3CC2 P;  1SFC B;  2LLK A;  1LFU P;  2CU7 A;  3W2A A;  3VYS B;  1LNQ A;  1X9V A;  2NAZ A;  1MJB A;  2HWV A;  3DWL E;  1N7S A;  3LFK A;  4HV6 A;  5D4S A;  3K69 A;  2ZT9 B;  1BDD A;  2HDW A;  1QGP A;  5HS7 A;  3O6Q A;  4C3J J;  2VOP A;  2XDV A;  4A3J J;  1BOB A;  1JB0 J;  2OYI B;  3CCE I;  1GL2 D;  3E7L A;  3P8M C;  4WXH A;  1TQP A;  1MZ9 A;  3B73 A;  2KP8 A;  1JKQ C;  2GLO A;  1L0O C;  3HOX J;  3K4J A;  3M7G A;  2Y69 H;  4LGW A;  5M3M J;  3AFH A;  2ELK A;  4A0Z A;  3GUD A;  3J80 Z;  4XQF A;  2OAR A;  3D6Z A;  1P4W A;  1SQB K;  5AVR B;  3VYR B;  2E2J J;  2Z5I A;  2B9B A;  5CVR A;  1OCO H;  1V55 H;  5L3G A;  1E3O C;  3V7R A;  3UKG A;  3PJR A;  3TF5 A;  2VOD A;  4A93 J;  1L0L D;  1H0M A;  1BCC J;  1L4A B;  3OS1 A;  4P55 A;  5M5X J;  5JLX A;  3JSP A;  1YTZ T;  3T8T A;  1HH0 A;  2QBY B;  2K4B A;  3K4M A;  3K70 D;  3CLQ A;  5LFA A;  1X19 A;  4ZYE A;  1AU7 A;  3F5H A;  1VQN P;  2B88 A;  3K0L A;  2PAJ A;  4B44 A;  1O7F A;  3JCU H;  1VQL I;  2XNX A;  3SFD C;  4IFD K;  5KHD A;  1LWU C;  2K4J A;  1O57 A;  2R0Q C;  2WSC J;  2NS0 A;  1Q2N A;  1BSN A;  1J5Y A;  2BXZ A;  5B66 E;  2DTR A;  1N75 A;  3CX5 E;  3NXS A;  3LSP A;  4X6A J;  1TW2 A;  3RK3 E;  3H25 A;  3ABM H;  1YG2 A;  4YRV A;  2EBI A;  1RF0 C;  2O01 N;  2EH3 A;  1BSH A;  2DA5 A;  1FTT A;  3L1P A;  3HD7 B;  2L3D A;  5KKZ B;  2X1C A;  4MEX F;  1IC8 A;  1OYY A;  3VOE A;  1S7O A;  1Y6I A;  2K86 A;  2E60 A;  1L3L A;  1EH7 A;  2KNC A;  4RGX A;  2PI0 A;  3ERE D;  3CWB J;  3L2U A;  1ZXG A;  3SWK A;  4K35 A;  4PFO A;  3I64 A;  3WG7 H;  3OV8 A;  5D5X B;  2WV1 A;  2VC0 A;  3R4K A;  3BZK A;  3PUF A;  1S72 P;  2QJY B;  1CF7 A;  2QEX P;  4FCY A;  3CMM A;  1BGY G;  2WSE J;  3FXD A;  3S9O A;  1ZGW A;  2RKH A;  1TT5 B;  5IP7 J;  1FWZ A;  2CUF A;  2RGV A;  4P9F A;  4IHW A;  1Y47 A;  5L3B A;  1R7J A;  1GXP A;  3TDZ C;  5APT A;  1AQ5 A;  4CA0 A;  1TQI A;  3MWM A;  4G12 A;  3DEU A;  2M5A B;  3L70 D;  2POH A;  1M1J B;  2LOO A;  2VJ4 A;  1T33 A;  2HTJ A;  1QHH D;  2Y75 A;  1BBY A;  6PAX A;  1YIJ I;  2OTJ P;  1ZGA A;  3E1R A;  4PZJ A;  4HSR A;  1WPK A;  4EM2 A;  1N7S C;  4QPQ A;  1YS6 A;  5EG0 B;  1YIT P;  2CJJ A;  3BC8 A;  1JO5 A;  4BNC A;  2R5D A;  2NS8 A;  5AW7 B;  3SWY A;  2M8E A;  4ZTF A;  1NTK K;  3Q5S A;  1FMW A;  4XK4 A;  4XN0 A;  1P84 E;  1EQ7 A;  5TGT A;  3G4S I;  3CCS I;  3FXE A;  3MZW B;  3LSR A;  1KQ8 A;  1U5T A;  1RE3 A;  1XG1 A;  1POG A;  4HDU A;  2GXA A;  5ICF A;  1BOA A;  1RUN A;  2H27 A;  3I4M J;  2KMU A;  2HVR A;  1MDM B;  4D6T E;  3FM3 A;  2HS5 A;  1VQK I;  1AWC A;  3G71 I;  2KKO A;  1GL2 B;  1ZV8 A;  5B1B H;  5E1X A;  3FKI J;  2NNY A;  3DU6 A;  4LB6 B;  4UB8 H;  3LA3 A;  1KU9 A;  2DCE A;  4LG3 A;  4ZMD A;  2QM8 A;  1V4R A;  2QVA A;  4G6Q A;  4ZTJ A;  1ZEL A;  3MD2 A;  3PP5 A;  2OD5 A;  1LPQ A;  2VAS A;  1EH6 A;  2L7F P;  2ZFC A;  4HOB A;  1Y0U A;  2WTE A;  3KIO A;  4EV0 A;  5KAI H;  1HKT A;  1L0N J;  1J09 A;  3LOC A;  4DBQ A;  1KYO H;  5KLV G;  4UB6 H;  4BQO A;  1OQY A;  1IDY A;  4HLY A;  3FM5 A;  4I7Z B;  1VQO I;  1DU6 A;  1GD2 E;  1U7M A;  2F5E A;  4NUB A;  2F5F A;  4AID A;  2YSR A;  4BS9 A;  1DPU A;  1XMA A;  3B6C A;  4IFM A;  5ICG A;  4GXO A;  3P7N A;  1IV8 A;  2O8K A;  5CMZ A;  1MH3 A;  4DYC A;  1UAA A;  1PP9 J;  2W6J H;  3W2V A;  2EFN A;  3H5R A;  4L18 B;  1ETK A;  1HWT C;  1MBJ A;  1LTB C;  4KFC A;  1R1T A;  2M45 A;  1T98 A;  3ZMZ A;  5L3C A;  3KYQ A;  2RAE A;  4YPC A;  5FD5 A;  1CGP A;  2CV1 A;  5HLH A;  4BU2 A;  3H1L E;  1LJ9 A;  1IZN B;  1FS0 E;  4BBR J;  4MTE A;  2EQR A;  4AU7 A;  2KPM A;  5H2F C;  2P7V B;  2PJP A;  2XRL A;  4YIR X;  2M0B A;  2P4W A;  2CGP A;  2FSW A;  4ZZD A;  3HOS A;  3BLY A;  3LWF A;  1BGY D;  2R32 A;  4IHT A;  1R71 A;  1EJ9 A;  3BZC A;  2L5Q A;  3KP2 A;  4AYB A;  4U7B A;  1SQB G;  4RS8 A;  3GHG A;  4WVZ A;  1D1C A;  2Q8K A;  4KMF A;  1IK9 A;  1IFD A;  1OW6 A;  1RE4 A;  1VQ7 P;  5JHU A;  3QPS A;  3S1Q J;  1VF5 C;  4PJ0 H;  2O7O A;  3DTK A;  4TLF A;  2E74 C;  3E6D A;  5F0F A;  4ZYG A;  4BRY A;  4PV1 C;  3CCM I;  1S5L E;  1JTH A;  4L5J A;  1JGG A;  3LL7 A;  5GTI H;  3CI9 A;  3BCC G;  4PSX A;  4RAG A;  5DTD A;  1U5T C;  3VN0 A;  3E5U A;  2LR8 A;  3OYI A;  2WAQ N;  4JYK A;  2LKS A;  1WH5 A;  3ABV C;  4JX6 A;  2HLO A;  1BR1 A;  4FET A;  2R5Y A;  3OA7 A;  3A1Y A;  2XUB A;  2Q1Z B;  3MUD A;  1RQU A;  1YHQ P;  4GGG A;  2LBF A;  1ZK8 A;  2XGD A;  2ZCW A;  3RK2 C;  1JE8 A;  3HUG A;  4QMA A;  3BTJ A;  3X2Q H;  1YW9 A;  1Z67 A;  5EF6 A;  4HLX A;  1S3J A;  5J4Y A;  1NTZ G;  5GTH H;  1HW2 A;  3OIO A;  3H3U A;  3CCL P;  4QIW N;  3A0B H;  1TLH B;  2ZJR F;  1Z6R A;  4HZF A;  1JY2 N;  2OYH A;  3HRT A;  3FMS A;  2FNA A;  3SDG A;  2MA3 A;  4BEH A;  5ICE A;  1FEX A;  1MMD A;  3QYB A;  1SD7 A;  4M9Z A;  2L02 A;  4JQ0 D;  2LMD A;  4AQR D;  2J5P A;  1ERD A;  3H1L D;  1RES A;  1X3W B;  2B87 A;  5D5V B;  5KLV D;  3GFM A;  1B72 A;  3FX0 A;  3CES A;  2ZFU A;  1FU1 A;  5AW6 B;  1PUF B;  1P7J A;  4ZDO A;  1O3S A;  1DD3 A;  1NTM J;  1ON2 A;  2PBI A;  2V1X A;  4G9Y A;  5E8G A;  3TP0 A;  2KI7 B;  1ONV A;  1FSH A;  3L72 G;  4I2L C;  3RL0 C;  1N8R Q;  1FOS E;  2DT6 A;  4XOT A;  3WU2 E;  2YKP A;  2HPC A;  2QM3 A;  1D1A A;  4EM1 A;  1W2E A;  1VQ6 P;  2A06 G;  4R4M A;  3GG2 A;  3CCV P;  4HG2 A;  4P1W A;  2NYX A;  3A02 A;  3R4Y A;  3N7N A;  3FXJ A;  5TIS C;  1JHF A;  3SXY A;  1W36 D;  1NTK G;  1LKX A;  3H1C A;  1Q7Y Q;  5CVI A;  1XX5 A;  1I6X A;  5CYV A;  3EQ2 A;  1O7L A;  4B4C A;  4N78 E;  5AW8 B;  1IC2 A;  4D5C A;  4V19 K;  2FYU G;  1Q1H A;  2UZK A;  1FNN A;  1YX3 A;  3M06 A;  3UIA A;  3PIO F;  2VT3 A;  3G2B A;  5DJU B;  5B5E H;  2EIL H;  2AXT C;  4KNY A;  3HOZ J;  1EZV G;  2QE7 H;  3ISP A;  2D1H A;  2P67 A;  3NFQ A;  4Y28 J;  1KFM A;  3U1K A;  3GHG C;  1X4P A;  4ZYA A;  1RE4 C;  4RM3 A;  2IGN A;  5KLI C;  1B9M A;  1KQ9 A;  3HOU J;  1SQB D;  3MD0 A;  3PTZ A;  3CPW O;  3ZMD A;  4X1E A;  3A03 A;  4Q4Z F;  3S3M A;  3GW2 A;  3CDI A;  4YEL A;  3EYI A;  1MJA A;  1S8N A;  2IW5 A;  3OL3 A;  5J4V A;  3F23 A;  1R8E A;  1A02 F;  3VYI A;  1KYW A;  5FB2 A;  1IRG A;  2YKO A;  3QOP A;  1YJ9 I;  1BR4 A;  2VQH A;  4I98 B;  4V2F A;  4YII A;  1JY2 P;  3MUD C;  3H0D A;  2B9S A;  4NQW B;  3CLO A;  1PP7 U;  4HDV A;  1OXZ A;  1SQX E;  1WRG A;  4K3A A;  1AQT A;  1KFN A;  3K10 A;  2DT7 B;  1BCC G;  1IUY A;  5B66 H;  4DZP A;  1NTZ D;  3FXR A;  3L73 E;  2OYH C;  4KT0 J;  2DA6 A;  2W85 A;  5E3N A;  2O01 H;  3UNG C;  4ESJ A;  2JQ7 A;  3E6M A;  4E7L A;  3GVA A;  2LG4 A;  2ELH A;  3DKW A;  4GOD A;  4IFF A;  3BY6 A;  3L7W A;  2Q2E B;  1Q81 Q;  1R58 A;  3DBR B;  4UUV A;  2KDO A;  4AM3 A;  2WAQ A;  3LFU A;  3ZQF A;  3O6Q B;  3ZP5 A;  1JUN A;  1JMB A;  2F4M B;  2PP6 A;  1WJE A;  1Q86 Q;  3NAU A;  4A3K J;  5IT9 K;  3ASN H;  1FMV A;  1I5Z A;  3FBN B;  2JUC A;  1UB9 A;  2MGQ A;  3RQI A;  1J59 A;  3T1B A;  3J81 Z;  2V6E A;  3CC2 I;  1U2W A;  2HPI A;  3DEE A;  3OYM A;  3CME I;  1ZQ3 P;  4G7O F;  1XN7 A;  5J40 A;  3E5Q A;  4IPA A;  3L72 D;  2MKV A;  4DOZ A;  1YW8 A;  3WUV A;  4RLQ A;  3BG6 A;  3JTH A;  2JSC A;  3DTI A;  2LY9 A;  3FXO A;  2IX7 C;  3HUS B;  4PD4 H;  4CYC A;  4YIF A;  2H6C A;  3C18 A;  5BU5 A;  1EXJ A;  3Q9V A;  2KRC A;  3LA2 A;  2P5L C;  2W4S A;  1FPQ A;  1FAV A;  1RF1 A;  2FE3 A;  1ZRD A;  4IL6 C;  1NTK D;  2KK7 A;  1JCC A;  2JA5 J;  3VP9 A;  3S14 J;  1NTM K;  1SVM A;  2CPB A;  1VND A;  4ITV A;  3I58 A;  2FYU D;  5D8K B;  2V9V A;  1GV5 A;  2G7U A;  2BHZ A;  2ACJ A;  3BRT B;  3F89 A;  5IYB J;  2CW0 F;  3PQK A;  4FX0 A;  1EZV D;  3GYH X;  3HKZ N;  1Z56 A;  4A3C J;  1V54 H;  1USD A;  3TO9 A;  3RDI A;  2BOL A;  2LF7 A;  5DCM B;  1RR7 A;  4F91 B;  4I02 A;  4LLG F;  2I5U A;  4MLO A;  2DPU A;  4AVP A;  3WTU C;  2OV7 A;  3FHZ A;  3CCE P;  1NTC A;  2R7U A;  3BAT A;  1VQN I;  3W68 A;  4CZZ A;  1KD1 Q;  1G4D A;  4GT1 A;  5FRM A;  1MIJ A;  1BL0 A;  2FBI A;  1T39 A;  3W6V A;  1KB9 H;  2VI6 A;  4XLN F;  2I10 A;  4MQ9 F;  3RYR A;  1ZRE A;  3E3V A;  1Z7U A;  3JRC A;  2CW8 A;  2HR3 A;  3HHG A;  3QP5 A;  3V8J A;  3GBG A;  3W6K B;  2ZJ2 A;  1MSE C;  1BI3 A;  4Q5S F;  1CI6 B;  2Q6Q A;  5BVZ A;  2QZ8 A;  4ENJ A;  3AE3 C;  2QKL B;  4CCL A;  1VQ9 I;  2FYN C;  1KQS O;  4BQQ A;  4AUX A;  3HTK B;  2HQR A;  1Y56 A;  1S9H A;  1FIA A;  3CWB E;  3CXH H;  1K9M Q;  1J1D C;  2VKV A;  4UV8 A;  3KZY A;  2L4M A;  1VQM I;  5APS A;  2KRH A;  2HXI A;  4RAF A;  4BJ5 C;  4GRI A;  1VQL P;  1JTX A;  3DBL B;  2K37 A;  4I0A A;  1RY3 A;  4CCJ A;  4A3L J;  2DQR A;  4YXD C;  2EIM H;  3PUB A;  2DDA A;  1BE3 G;  2ZNZ A;  3AE8 C;  3H1J D;  2QF7 A;  1H0T B;  1FSE A;  2DMT A;  2IDB A;  4N4N B;  2AXC A;  2DFI A;  3WTT C;  2DW3 A;  1GU5 A;  1G1I A;  3I4P A;  4LG0 B;  3L74 E;  3S2D J;  4RO0 A;  2NOJ B;  1DH3 A;  2FQ3 A;  2BZT A;  2XGE A;  2BXY A;  3H9J A;  5B66 C;  4B8X A;  2OTJ I;  4U3F J;  3WTW C;  1UG2 A;  1KQL A;  4FHT A;  3EUK L;  4AIK A;  1Z1D A;  1Z9C A;  1YIT I;  1HKQ A;  2YPR A;  2CPS A;  1V3F A;  3B71 A;  2IZ1 A;  2Z9O A;  4Y7N J;  2DLL A;  1LT1 A;  2ZKZ A;  2VLA A;  1RF1 C;  4YFN F;  4HEA 2;  5IOY A;  3SJM A;  3KET A;  3LW5 J;  2E1C A;  1GXQ A;  2M1B A;  3AE1 C;  1B9N A;  2L4A A;  3LAP A;  2IP2 A;  3GZN B;  2PFX A;  1AOY A;  1NG7 A;  3C2B A;  1SC7 A;  4JYC A;  1G3W A;  2A5Y B;  1KYO D;  2OA4 A;  2M3A A;  3M4O J;  4M6Y A;  3D70 A;  4XLF A;  4A5N A;  3GFJ A;  1LE8 B;  5BQT A;  4XLE A;  4WK8 F;  5CVU A;  4RB1 A;  1IRF A;  4L74 A;  1YJW I;  2BCC J;  1T2K D;  1J0R A;  1QZY A;  3BOQ A;  3CUO A;  2NVY J;  2PMU A;  4MQV A;  3BQZ A;  2K9L A;  1T6S A;  4EAT A;  1L0N E;  2N1T A;  5L8R J;  1VQ8 I;  3G4S P;  3MEX A;  3CCS P;  2IPP A;  4NQW A;  1RI7 A;  4L73 A;  1X1C A;  5M5Y J;  3Q2Y A;  2A05 A;  5CCG A;  3G9R A;  3LST A;  2DT5 A;  3DCF A;  4JBA A;  3RL0 g;  3G71 P;  2VXD A;  2K9N A;  4D6T J;  2OQQ A;  2ECB A;  2PN6 A;  1SQV J;  3WTX C;  2M4K A;  1AKH A;  4CXF A;  2D2W A;  3N4X A;  4LLH A;  1UHW A;  4IRG A;  2OCE A;  4UUS A;  2KS1 B;  2Q2E A;  4DYQ A;  2BAS A;  2L2O A;  3KP3 A;  3FZV A;  3LNQ A;  3KP4 A;  1IXR C;  3KYC B;  3L71 E;  2YX4 A;  2R44 A;  1NHA A;  4LIV A;  3OYH A;  3GTK J;  4H4K C;  3TGU G;  3HIF A;  1VQO P;  3QU3 A;  4IZZ A;  2P5K A;  2R5Z A;  1S7A A;  3ZRG A;  3SZG A;  1FYL A;  1JT0 A;  1H9G A;  1XMK A;  5DUI A;  2IRF G;  2R7Z J;  1M56 D;  2Y0E A;  4QWQ A;  3CCU I;  1NAF A;  1BE3 D;  3R6S A;  1U9O A;  4MIM A;  2B63 J;  4ZNC A;  4L0Y B;  3K4K A;  2IS2 A;  2JWD A;  1MJ9 A;  3E97 A;  2D2C D;  3Q5R A;  1DEB A;  1T8I A;  4U88 A;  1IN8 A;  2EV0 A;  4I99 C;  2VQL A;  1Q82 Q;  3GZ5 A;  3I9V 2;  5L3F A;  4A3F J;  3HDD A;  1VQ7 I;  3B8E B;  2XPW A;  5KAF E;  2D45 A;  1E0E A;  3ZMV A;  5AW5 B;  3VOP A;  3TMO A;  4EIJ A;  1SFX A;  3ZPL A;  1ETV A;  3A01 A;  1Z7L A;  4HF1 A;  1MV8 A;  2FU4 A;  3BTL A;  1AVY A;  1URQ D;  3GTP J;  1OR7 C;  3ABT A;  2E75 C;  1G1J A;  4ZDL A;  3BTI A;  3V4Q A;  4LLN A;  3H1L G;  5FKM A;  4A2U A;  4LGD E;  3S2W A;  4JBZ A;  3VMA A;  3TDK A;  2KJC A;  3PQJ A;  1YHQ I;  1DPR A;  4UV9 A;  2G3A A;  5CPR B;  2ESN A;  4XSZ F;  4H13 D;  1Z0X A;  5BNG A;  2CQN A;  2NRA C;  3S4R A;  3W67 A;  2ESH A;  5LGT A;  1XGM A;  1MUU A;  1NYH A;  4B43 A;  3CCM P;  3SQN A;  1VPC A;  1IJD B;  2KJB A;  1FY7 A;  4WBA A;  1DX7 A;  4A12 A;  5JFR A;  4AIJ A;  3ECH A;  2QM7 A;  1GW4 A;  3O8H A;  2M5W A;  5FKK A;  2FFD B;  5CCG C;  2E2H J;  2KL4 A;  3MCZ A;  2VOO A;  2DOA A;  3Q3S A;  3GTJ J;  3HG9 A;  1ETO A;  2CS3 A;  4QSH A;  4HQE A;  3DV8 A;  2IXS A;  4I76 A;  3HTK A;  1H89 A;  4PJN A;  1OZH A;  2K3P A;  1NTM E;  3MTU E;  1XGN A;  4R1H A;  4XKV A;  1MSF C;  4OWR B;  3S15 J;  1KZU B;  2LVS A;  3ZMT A;  3OYN A;  4E7I A;  4D9J A;  4KN7 X;  3ZGK A;  2BGC A;  3Q5P A;  4U7D A;  1WRJ A;  2BY2 A;  3REO A;  1O4X A;  4E70 A;  5TIS E;  2NVX J;  2Q5U A;  2E76 C;  4O9B A;  4IOI H;  1FJP A;  3QAH A;  1VQ6 I;  3CCY A;  3Q9S A;  2Z5H A;  3T97 B;  3D5R C;  3WTV C;  2IGK A;  1G2C A;  4DW6 A;  4C7N B;  3OR1 C;  2Y31 A;  3JSV C;  3R2P A;  3HEF A;  2IGO A;  3DTE A;  2Y2Z A;  1LQ1 A;  2DA2 A;  1OIS A;  1WJC A;  3UR3 C;  3TGU D;  2Z4E A;  1SQV K;  3KDP B;  2MH2 A;  4ZZL A;  3N05 A;  5D5W B;  4G7H F;  2HXO A;  1DP7 P;  2R7F A;  3KZZ A;  5A2Q Z;  2KZV A;  2YS9 A;  1LT9 B;  2M3B A;  2WSF H;  2RC4 A;  1N25 A;  3L75 E;  2V79 A;  2GIV A;  2YKQ A;  1UZC A;  1S5L H;  2AQE A;  1EDJ A;  5KVR A;  1S29 A;  3NTN A;  4F52 A;  3K4N A;  2W6A A;  2FMY A;  4B09 A;  1JTY A;  2D2C B;  3IH3 A;  3WU2 C;  1DDN A;  4PK4 A;  2FOW A;  3TKY A;  2EZI A;  1RKT A;  3H1H G;  2A45 I;  3W2W A;  2UUZ A;  3NWS A;  4PDK A;  4BAC A;  2M87 A;  4CSW A;  2XZR A;  4N0B A;  1Q1V A;  2G9W A;  2N1T D;  4BXU A;  3MN2 A;  4XLH A;  4L76 A;  1URQ B;  2HOS A;  2K9S A;  2F5D A;  3FHN A;  4M3G A;  1KU2 A;  2MC3 A;  3KZI H;  1ZME C;  2LYC A;  3V7S A;  3NRV A;  3F8N A;  3VTP C;  4H0L D;  1JT6 A;  1V5E A;  1BC7 C;  1FDI A;  2ZYD A;  1VI0 A;  1FYM A;  4H13 B;  4BHC A;  2KIQ A;  4NC7 A;  3RPU D;  3AL0 B;  2H09 A;  2Y0S A;  1N78 A;  1VL2 A;  1H89 C;  2HYN A;  5E3L A;  2OPT A;  1U6G A;  1W5C C;  5TJH A;  3JRE A;  2O6G E;  3NAR A;  4UHT A;  1UJ8 A;  4XKW A;  4PD4 D;  3ZDM A;  3TL4 X;  3M1E A;  1SQX J;  1M57 D;  3BPV A;  3H32 A;  1PFI A;  1DIP A;  2A6T A;  1K83 J;  2ZXJ A;  2EB7 A;  2G8Y A;  2WPR A;  2FBH A;  3H1I D;  3A7O A;  3RQ4 A;  3MVP A;  3IL2 A;  3NWT A;  1QZZ A;  2DW4 A;  2L7M P;  5E79 C;  1SD4 A;  5GPC A;  1HGZ A;  3M0A A;  1MFZ A;  1FBS A;  4IL6 E;  5KJ7 D;  2WAE A;  4CH7 A;  1ZG5 A;  1ZR4 A;  4DNC A;  1M1K Q;  1R5G A;  2OBP A;  4OAY A;  2V9P A;  1SQQ E;  4KUM A;  5F64 A;  2AS5 F;  1IFN A;  2JSP A;  2QQ8 A;  1IO2 A;  2QVO A;  4NPF X;  3IC7 A;  4WY4 D;  5AW9 B;  5FRN A;  2XV5 A;  2LF8 A;  4QLC U;  1UMQ A;  1UCR A;  3ZQ7 A;  3CME P;  4OGQ D;  1LJ2 A;  2VKE A;  4A3I J;  1MFT A;  1XMX A;  1HDD C;  4A6D A;  1R00 A;  4A69 C;  1PVE A;  1X3Z B;  1EH8 A;  2F5C A;  1KB9 D;  3BT9 A;  4GO1 A;  1E5W A;  1KN7 A;  4DZJ A;  3H1K G;  1K6Y A;  1KIL D;  3JRA A;  1U8R A;  4ZDP A;  4ZH4 F;  1GU4 A;  2WV0 A;  1OWA A;  1R1V A;  4D5F A;  1J1E B;  4Y99 B;  1FIP A;  3HSF A;  3CUQ B;  3TED A;  1GK6 A;  1FOX A;  2W90 A;  3H1H D;  4R4L A;  3CXH D;  4XOR A;  4IHX A;  2AO9 A;  2VE8 A;  1L0L E;  1HC8 A;  1LVK A;  4BQN A;  3OYD A;  2UWJ E;  3KFW X;  1D8K A;  1K78 A;  3FKJ A;  2YNY A;  1BJA A;  1LFP A;  4RGU A;  4XM3 A;  1B8I B;  3S1K A;  5APU A;  1UII A;  1JHH A;  4WF2 A;  3WMM 0;  3HE5 A;  2DPD A;  4D1Q A;  2AHQ A;  1T2K A;  2ZXI A;  3PM1 A;  1ACI A;  5K7F A;  2TCT A;  3KP5 A;  4XKB A;  5AVX B;  1Z05 A;  2V1N A;  1R22 A;  3A0H C;  3IHU A;  3IWF A;  4W7Y A;  1I3Q J;  4H0L B;  1D0Z A;  4KIC A;  3MAJ A;  4D6T G;  2PG4 A;  4AC0 A;  3CMY A;  4U3F E;  1VQ9 P;  3CD6 P;  4AYB N;  3CDL A;  3T97 A;  1KZH A;  2WAF A;  1EKE A;  2RNG A;  4OIQ F;  2Q3E A;  5FO5 A;  2QJP C;  4O6J A;  1SQP E;  1XTG B;  1VQM P;  1ODD A;  2HVQ A;  3MKL A;  1SVF A;  1Y39 A;  1KON A;  2BYV E;  3RKW A;  2WY8 Q;  1QZE A;  2BW3 B;  1L2P A;  1UFM A;  3A2K A;  2IS4 A;  3LSK A;  3HRN A;  2L9S A;  4KYW A;  1KYZ A;  1XTC C;  2RH0 A;  2FOK A;  1VDF A;  3CP8 A;  1MNE A;  3K4C A;  4CCK A;  4GDO A;  2L9V A;  2HU9 A;  1SD5 A;  1YE9 A;  2XKP A;  4BGD A;  1DQU A;  1JKO C;  1SQX K;  2PLY A;  3HZJ A;  2J59 M;  4I6M C;  2FF4 A;  3HE4 A;  1QL2 A;  1EC5 A;  3HRU A;  2OU2 A;  1VQP P;  2IA2 A;  2HTS A;  2XC7 A;  3FIS A;  3L74 J;  5EDN A;  4WY4 B;  3RK3 D;  2BEO A;  3CQZ J;  2BCC E;  2DK5 A;  2H7H A;  1NU1 E;  2AEJ A;  1WSU A;  4BHP A;  4W80 A;  4Y17 A;  2DI3 A;  4A7P A;  2DDB A;  2NS7 A;  3CJN A;  3VEP A;  3L2C A;  3RKQ A;  2WSC H;  2V26 A;  2LXC B;  5E18 F;  3OSG A;  4OGQ B;  1F4K A;  5C3E J;  3H1K D;  4WCG A;  4C2T A;  4P5O A;  4I0B A;  4YFK F;  2ZME B;  4RLF A;  2WAD A;  4MHG A;  5HS8 A;  4WWC A;  3OYC A;  3R61 A;  3G6E I;  3AE7 C;  2EJR A;  3P7K A;  2TRT A;  3OOP A;  3W6J B;  2R7R A;  1KIL B;  3AG3 H;  1FDM A;  3T0Y A;  2W84 A;  4KJZ A;  1Z3X A;  2XF6 A;  2K9J A;  2O03 A;  1SQV E;  4AD9 A;  2E1M C;  5J8F A;  2CWE A;  3U2R A;  2FD5 A;  2OGU A;  2Y0D A;  5LRS A;  4BY1 J;  3GFI A;  2IT0 A;  4IKF A;  1I1S A;  1N73 B;  2KB7 P;  4PSW A;  4OAZ A;  1K6O A;  1YJW P;  2H6B A;  4NC8 A;  2WSE H;  4ASV A;  4U87 A;  2XSD C;  5KLV K;  1X0T A;  1VQ8 P;  3BRV B;  2DO7 A;  2MAB A;  3ZQQ A;  3G73 A;  1SAU A;  3WHC A;  4XIC A;  2V7F A;  1IDZ A;  4HST A;  3KHU A;  2NPS D;  3FGA D;  5L3D A;  3M3Y J;  2FJ1 A;  2KQR A;  2P0W A;  2LNB A;  3GO5 A;  1XSX A;  2C6Y A;  4B86 A;  1Z3Y A;  4XA4 A;  2A07 F;  1HQC A;  3GXO A;  4HA8 A;  4C2U A;  3V2R A;  1MH4 A;  4EQQ A;  2DJI A;  1H9T A;  1J75 A;  2XAH A;  2JPB A;  2GBY A;  4HBL A;  4Y15 A;  4LK1 F;  2GXB A;  2HDC A;  3FXU A;  3ELK A;  2E2I J;  3PNT A;  3M9B A;  1AV1 A;  2DA7 A;  1I27 A;  3TNU B;  3WGG A;  1ZLJ A;  1PJR A;  3L71 J;  3MIW A;  4NC6 A;  2BVL A;  2WA0 A;  2KDZ A;  1SFC A;  3OR2 C;  2WSS H;  1ZGJ A;  1GT0 C;  2CG4 A;  3CCU P;  1TBX A;  2XAF A;  4C30 A;  2R3C A;  3PSF A;  2VUM J;  3AEB C;  5HNF A;  1OYW A;  1WGX A;  2JKV A;  1O3Q A;  1OW7 A;  3V7C A;  3EFG A;  5FKO A;  1P4X A;  4IQ4 A;  5EZH A;  4EJO A;  1SLQ A;  2L9R A;  2OYI A;  2EZL A;  2H1L A;  4I7H A;  1E79 H;  3G1O A;  3TO7 A;  1YYC A;  4GKG A;  3ONQ A;  1GMJ A;  3JRI A;  5LHI A;  4OWF A;  3GF2 A;  3KP7 A;  4DOJ A;  3KEO A;  4OMY A;  3RK3 B;  2OC6 A;  4F92 B;  2HDD A;  1RE3 C;  1RRJ A;  2Z33 A;  1FZG A;  1AA0 A;  5KAF C;  2V7Q J;  2ZSH B;  2ADU A;  1A5J A;  2FYZ A;  2HOA A;  5FLM J;  1S5L X;  2NXN B;  2W57 A;  3D5L A;  2RDP A;  4I6Z A;  1PUE E;  3SFZ A;  2D5V A;  1L4A A;  3RL0 B;  1H88 A;  1H8A A;  3QPH A;  1ZN2 A;  1EV7 A;  1I39 A;  2M30 A;  3BPX A;  4XRS A;  1R49 A;  2STT A;  1ULY A;  2P58 A;  4BL0 B;  2M8R A;  1X22 A;  2QBY A;  1YW7 A;  5APV A;  1DUX C;  1SFK A;  2W82 A;  5H2F H;  2XB5 A;  4FAS D;  4BH9 A;  2K40 A;  2HGC A;  3GWZ A;  3V2N A;  3LSJ A;  3B5N D;  1MMN A;  3GTL J;  4TT3 H;  3WE3 A;  4O3M A;  1N7L A;  1D5Y A;  2MYS A;  4EJW A;  2QGU A;  3AE2 C;  3RPU A;  1QPM A;  1QBJ A;  1T08 B;  3O8Z A;  2GAU A;  3HD7 A;  3PLN A;  2JA8 J;  4GIF A;  5IP9 J;  2ZNY A;  1QVG O;  1R6R A;  4J19 A;  1KA8 A;  4HYE A;  1IRX A;  2GZW A;  3S8P A;  4Q48 A;  4DIQ A;  3AKZ A;  3GX4 X;  3GLL A;  1I1G A;  2ID6 A;  2NPS B;  3VP8 A;  5EEH A;  2VJ5 A;  1ZRT E;  3RJP A;  2LSO A;  2VL8 A;  2DA4 A;  4LFU A;  3MKW B;  1XS9 A;  3EDP A;  1L0N K;  1LTG C;  4Q47 A;  1BI2 A;  2G7H A;  2O9L A;  3L73 G;  5CKT A;  1A31 A;  1EF4 A;  1YTY A;  3L2R A;  4OIR F;  3M1C A;  2ZJS E;  5KJ7 A;  5LD2 C;  4JX4 A;  5CCH D;  2M5A A;  1SFC C;  1M1J A;  5FKL A;  2KOG A;  3TGN A;  5L3E A;  4BE0 A;  1HUC A;  1Y8A A;  3USS A;  3FK6 A;  5EG0 A;  2ZT9 C;  9ANT A;  3AEE C;  2FEZ A;  3MFK A;  1AA7 A;  3L75 J;  3RGU A;  4M3L A;  2A61 A;  2OYI C;  1IUF A;  2JVH A;  5BS6 A;  4IJA A;  5E8I A;  2UXX A;  3CO6 C;  4DQ2 A;  2UV1 A;  2ZME A;  1EDK A;  2XAS A;  1M7L A;  1PGO A;  2K88 A;  5J1Y A;  3LQQ A;  2VIX A;  5K7Z A;  2BY1 A;  5IOZ A;  5K5R A;  4S05 A;  3J81 K;  1JJ8 C;  1LTJ B;  5FLX Z;  2GOX B;  1MDM A;  2X1D A;  1GL2 A;  1W5C E;  1K04 A;  2Z99 A;  1ZOY C;  1W0T A;  5C44 J;  3GTO J;  4M3B A;  3BCC D;  5AVU B;  4BWN A;  2W25 A;  4P96 A;  1N73 A;  1L4A C;  1IV6 A;  3EUH A;  1XSD A;  1H88 C;  1H8A C;  2IA0 A;  4N78 D;  2I1K A;  2E5N A;  1GVD A;  1WI3 A;  4F93 B;  5TIS H;  4KIG A;  4EOT A;  3QOE A;  5E79 E;  1FC2 C;  1JI8 A;  3NQO A;  5FGM A;  5AW2 B;  1JUS A;  4Y4R A;  5HLG A;  2JRM A;  2LD5 A;  2Z3Y A;  2AXT H;  2WWW A;  4MN4 C;  3I53 A;  1PGJ A;  1X1P A;  3ZCO A;  3WU1 B;  3C8V A;  2HQN A;  1IN5 A;  3ABU A;  3KLO A;  1FLI A;  3ZQG A;  2C9L Y;  1FBU A;  3IKT A;  2QJK B;  2FRH A;  2QCO A;  2RKL A;  3L2W A;  3H9Q A;  4M72 A;  4W1U A;  3GF3 A;  3HD7 C;  3IP4 B;  2HOE A;  5KKZ C;  3B5N B;  3TQN A;  4H44 D;  1ETY A;  3RTR A;  4R79 A;  2PJR B;  1TQM A;  1TTY A;  2HYJ A;  2ZB9 A;  3JAM K;  2R92 J;  2IZ0 A;  4ANJ A;  2LDU A;  4NHJ A;  5HVQ C;  2NVU B;  4MFE A;  3PHL A;  2JTV A;  2DA3 A;  4C9Y A;  3FXL A;  2IEK A;  1JOC A;  3WGI A;  2ZXE B;  1LP1 B;  1FZP B;  2BBY A;  3CF2 A;  3ZN0 A;  3PL8 A;  2ZJP F;  3VB2 A;  2QJY C;  2IA1 A;  4HH2 A;  2Y0M A;  3OY9 A;  1SMT A;  2M8G X;  3OAK A;  3DXJ F;  4I01 A;  2DBB A;  5J1R A;  2CUJ A;  5HDG A;  3AEA C;  3CWB G;  4PCQ A;  3MP7 B;  2GQQ A;  2E5Z A;  2ZYA A;  1ON1 A;  2IBZ I;  2DOE A;  2E1O A;  2YIU B;  3L73 D;  2A06 D;  3O2P E;  1M1J C;  2H88 C;  3AE9 C;  4A3D J;  3P9C A;  3M0D A;  1SQQ J;  1QO0 D;  1P4A A;  1G3T A;  3G1L A;  2YXR B;  3VYU B;  2C9N Y;  2LRD A;  3DP7 A;  3PIP F;  3HC7 A;  1FBM A;  1YRN B;  2WB1 N;  2KIS A;  2P5V A;  1M1E B;  2DYS H;  2ZC2 A;  3VSK A;  3VSL A;  3F3X A;  4ESF A;  3JW4 A;  1KQG B;  3L74 G;  3BZ6 A;  2PMZ N;  2M7B A;  1YS7 A;  3EPZ A;  2FBW C;  4BJT A;  3OWT A;  2O3J A;  3A0H E;  5AW3 B;  1IF1 A;  1XGO A;  1FZC B;  4L75 A;  2OF7 A;  3TW7 A;  4IOC F;  2RNJ A;  2EFP A;  1GL2 C;  2PX9 A;  4JOM A;  5B1A H;  4XID A;  2VBZ A;  5EFW B;  1UST A;  3BTC A;  5ILV A;  3CCQ I;  4BY7 J;  2K9M A;  3EUH C;  1MD0 A;  3FXQ A;  1DP3 A;  3C1D A;  4M3D A;  2BV6 A;  2OTL P;  1O3R A;  3J7A Y;  4CCN A;  1NWQ A;  1Y8Q B;  2MD5 A;  1L0L J;  2E1N A;  1T56 A;  1Z21 A;  4L5I A;  3CD6 I;  3RYP A;  3U21 A;  4IL6 H;  4MEY F;  4Y3O A;  1GV2 A;  1Y9B A;  1ZAR A;  3CL3 D;  4I7Z C;  2M0M A;  2V1D A;  4PFP A;  5EJC A;  3U1D A;  2OUM A;  2J5O A;  1BCC D;  1D0X A;  2ECC A;  3H1J E;  5CJ0 A;  3K70 C;  1L0N G;  2KIF A;  1DGR M;  1IFJ A;  1PUF A;  3G6E P;  5IT9 Z;  2LFB A;  2QWW A;  2F4O B;  3HGY A;  1KMI Z;  4XSX F;  1I50 J;  1K79 A;  1PPJ E;  1HBX G;  3DFG A;  1OX3 A;  4XRF A;  1PP9 G;  2JWT A;  2XHK A;  3C2H A;  2KZJ A;  1JUM A;  2XKO A;  2KFD A;  5K5O A;  5H6R A;  5C4X J;  2HFH A;  4H44 B;  1VQP I;  4DJG A;  1Y1W J;  2NOG A;  3BCB A;  2ISY A;  3ZQH A;  2OQG A;  4II2 A;  1K4S A;  2KSJ A;  5GP9 A;  3E1S A;  2ETH A;  4BE2 A;  3AAF A;  1SQP J;  3RZD J;  5AVV B;  4HX4 A;  3L71 G;  4NPD A;  1U57 A;  3CWB D;  2M2E A;  1I3A A;  3TSI A;  3OJA B;  1FE6 A;  5KAI E;  3D1N I;  1CQT A;  5DS9 A;  2R5B A;  2WPV B;  4ZYD A;  1B59 A;  1HKS A;  5F0C A;  3PRJ A;  3OL4 A;  1VFC A;  5BPI A;  5CQE A;  3MKY B;  4H0E A;  4IO9 F;  3K7A J;  5F08 A;  1A35 A;  3TDU C;  3L70 J;  3IAS 2;  4ASN A;  2W8Z A;  1X3U A;  5K5Q A;  1UHS A;  1LTT C;  2WQY C;  2MG4 A;  3IFM A;  3L36 A;  1MMS A;  2J5U A;  1K61 A;  3SFE C;  1N7S D;  2A6H F;  3A4C A;  3D6Y A;  4G7Z F;  2VJJ A;  1SS1 A;  3L74 D;  2N9B A;  4JP0 A;  1R36 A;  3V5B A;  3RCO A;  2L01 A;  3DQV C;  1NU1 J;  3AE6 C;  2WT7 B;  4LLL A;  2ZFW A;  3TBI A;  1IJW C;  1TL8 A;  2GUV A;  1VQ5 P;  2IBZ E;  1SQQ K;  1K73 Q;  2KRF A;  4EJV A;  3HB9 A;  5K1Y A;  1W5S A;  2C0W A;  4JQF A;  4K2E A;  4EVI A;  4ENN A;  4Y52 J;  3K9T A;  3QU6 A;  2GWR A;  3CX5 H;  3P8C E;  2DMQ A;  2IPQ X;  1LB2 A;  2H1K A;  2XU6 A;  1HJB A;  2HNH A;  1ZLL A;  4XFJ A;  3H3Z A;  1ZW0 A;  3SFI A;  2R93 J;  1NH4 A;  2WB1 A;  4U7J A;  1OCT C;  3TYY A;  2CMP A;  4DJA A;  4N4O B;  1U3E M;  1VQ4 I;  4AIH A;  2R7T A;  2PMZ A;  1R4N B;  2DOD A;  5CJ9 A;  2QYO A;  5EYR A;  4BYY A;  1TNS A;  3RKX A;  2K02 A;  2R7D A;  2RN7 A;  2L5G B;  2HYG D;  2E35 A;  2F5V A;  3LW5 H;  2X9D A;  3CJQ B;  3ECO A;  3TK1 A;  2P6T A;  4ESB A;  4PJ0 E;  4EI2 A;  2NVT J;  3AE5 C;  5M1B A;  1JY3 O;  4RB3 C;  1L0N D;  4RGS A;  3GEZ A;  4O5V A;  5DD8 A;  4HF0 A;  1S9K E;  3ITK A;  1MBF A;  3I59 B;  3CJR B;  4IEJ A;  1L0L K;  3V6I A;  3U1C A;  3KP6 A;  1QHG A;  2KIM A;  2W6B A;  3EUA A;  1NTM G;  1R5L A;  4BXX J;  4A3M J;  3GTG J;  1LWU B;  3OYJ A;  1PP9 D;  3HUS A;  3HRM A;  1P84 H;  2B7E A;  1E3P A;  5E3M A;  4XRM A;  4RBO A;  3MZY A;  5AW1 B;  3QRF F;  3SZT A;  3PH0 A;  4DT0 A;  1HTL C;  3KPE A;  1LVA A;  2CQK A;  5H6Q A;  5M3F J;  2HEO A;  4OVN F;  1AVO A;  4HPQ A;  1WJA A;  3OYK A;  1F1Z A;  4JX5 A;  2LKM A;  3ZN1 A;  5AVQ B;  3IH2 A;  3P9I A;  2L9N A;  2P8T A;  2Y0S N;  4C3H J;  3IWZ A;  4GFB A;  5GAE J;  3KE2 A;  5F0H A;  2RRE A;  2XGC A;  3LQR A;  1HJ0 A;  1ZTR A;  4LMY A;  4CYD A;  2ZAE B;  3FXK A;  2R7O A;  3BJ6 A;  5DCM A;  4XKC A;  1FDO A;  2FNP A;  1ZKG A;  5HLI A;  1OKR A;  4EDF A;  4WXC A;  1SQP K;  1VF5 D;  1M8O B;  2E74 D;  1TWF J;  2B89 A;  2N1T C;  1FX7 A;  4PV1 D;  3ZMS A;  2F4I A;  2JMW A;  3FMQ A;  3HHH A;  2XRN A;  2VBX A;  1N7S B;  4XNF A;  1WKM A;  2R7X A;  2F48 A;  1CI6 A;  3M8F A;  4A0X A;  1QA6 A;  2H8W A;  5IYD J;  4A3E J;  4RGR A;  3C7J A;  4FE7 A;  2KIU A;  1RUO A;  2IFN A;  2JDI H;  3FWL A;  4R8H A;  2K5C A;  2YMY A;  1J7K A;  3RK2 D;  3RBZ A;  2NVQ J;  5CQG A;  5ILU A;  2M34 A;  2KLO A;  2AQF A;  5D6E A;  5IT3 A;  3F8M A;  1YI2 I;  1NU1 K;  2E5Y A;  2KUB A;  3A5T A;  3NEU A;  1RH5 B;  2VE9 A;  5EZG A;  1TWA J;  2HKX A;  3ROU A;  2DYR H;  4Z2Y A;  3T5X A;  1FZE A;  2OAZ A;  3L2V A;  1H0T A;  1HW5 A;  5GAD J;  3CXH I;  2XPV A;  2X1E A;  2X51 A;  3MZ8 A;  5KLV J;  4RAY A;  2L7Z A;  1ZLK A;  3CC4 I;  3HRS A;  4LG0 A;  2K9Q A;  3LAJ A;  2XIG A;  3J7A O;  1XDS A;  4IHY A;  5D6F A;  1TNT A;  2VQC A;  1GZL A;  2MH9 A;  1PYV A;  4M73 A;  2BHY A;  1ZR2 A;  4DGW B;  3RL0 D;  3BVH A;  1S7E A;  3EET A;  5AON A;  2Z2S B;  1NHL A;  2W1O A;  1NTM D;  3O3K A;  3HUS C;  3KPH A;  3FWN A;  5KCM A;  3GF7 A;  1GDT A;  2CK3 H;  5AIQ A;  5GAG J;  1X79 B;  3SEQ A;  3CDH A;  5CJ4 A;  2YR2 A;  5HLT A;  3MGN A;  4RM2 A;  3S93 A;  3MHV A;  5AW4 B;  1REP C;  2KNC B;  1W36 C;  3VMY A;  5APQ A;  3R0J A;  1YYV A;  3BG7 A;  3WG9 A;  1SQQ G;  1YJN I;  3CO7 C;  3K4L A;  2R3S A;  1MKM A;  3BG5 A;  4G6T B;  5LHH A;  1HST A;  1LE8 A;  1HLV A;  2XVC A;  3HTU A;  1W7P D;  4KIT B;  1EXI A;  4N9I A;  1MMG A;  4AWX B;  2WT7 A;  1BJZ A;  1D0Y A;  1PGQ A;  3QQA A;  2HI3 A;  5LLQ A;  5APX A;  2MW8 A;  4NDL A;  2DU9 A;  2L7K A;  1OCP A;  1SAN A;  5H20 A;  1ZYR F;  3IR9 A;  3TP3 A;  4NNJ A;  4WWI A;  1XCB A;  1SMY F;  2PMH A;  1FOY A;  1LEA A;  1LNW A;  4LB5 A;  1VF5 B;  4IRI A;  2K3R A;  4KT5 C;  2YX7 A;  4BKX A;  2E74 B;  2P1J A;  4PV1 B;  4GYG A;  1F43 A;  4PUS A;  1OYI A;  2BEZ F;  4Y13 A;  3HGG A;  1U5T B;  2KS1 A;  2QG4 A;  3WU2 H;  2ZSI B;  1MNM C;  3H1I E;  2PEX A;  3KCC A;  3ESW B;  3HBL A;  4BUP A;  1NTZ J;  1KU7 A;  1QLE D;  1R5H A;  3JRG A;  3J80 K;  3E6C C;  1BN5 A;  1NKZ B;  1TP4 A;  4YFX F;  3RK2 B;  1QRY A;  2N8G A;  2Z1D A;  3H9G A;  1SAX A;  4B3X A;  5AIP A;  5BPD A;  1YBK A;  2DTZ A;  4ETS A;  2W00 A;  4HRI A;  4DBR A;  3PSI A;  2QA4 P;  2X6Y A;  2AEM A;  4M3E A;  3E7K A;  2MLG A;  1R5S A;  3KEQ A;  1EA3 A;  1ITY A;  1S4X A;  3V2Q A;  3BQY A;  1P9Q C;  2P7J A;  3ZQI A;  4IF4 A;  3CZ6 A;  2R7V A;  2A45 G;  1RC9 A;  3N4M A;  4KIS A;  1DD4 A;  1IXC A;  1Y0N A;  3DLA A;  2E7W A;  4HNU A;  1PDN C;  2JJL A;  4IL6 X;  1K8A Q;  5EEA A;  5AVS B;  3QWO C;  3L72 J;  2XAU A;  1QVU A;  2EPF A;  3QYE A;  1WJ5 A;  1B1B A;  4L9T A;  2JJ7 A;  4U3F G;  2Y30 A;  1LGH B;  4L9N A;  4OMZ A;  3VMZ A;  1RET A;  3M9H A;  1SQP G;  1BIA A;  1MBH A;  2ID3 A;  1FJK A;  3RZO J;  4MO7 A;  5D8L B;  1ZH5 A;  1OVR A;  3BG9 A;  4NPE A;  3HPG A;  3HPH A;  1NTK J;  4PJM A;  3CXH E;  3CCR P;  4HX7 A;  5ILS A;  3FK7 A;  2CQX A;  1KQF B;  3MKZ A;  4W7Z A;  5D4R A;  2FYU J;  2O1K A;  2YUS A;  3IAO A;  1QVF O;  2EFO A;  1ENH A;  2PFB A;  2RV8 A;  4RMN A;  4GYI A;  3I0T A;  5E79 H;  4Z6Y A;  2L54 A;  1DEE G;  5F1J A;  4HYT B;  5J1U A;  4HAM A;  3PFI A;  2HVS A;  3I5C A;  2OTL I;  4WXD A;  3RBX A;  1CZQ A;  1HBW A;  4UUT A;  3QPL A;  3JCU C;  1S1C X;  3V4G A;  2PGD A;  2W27 A;  1YIO A;  3ZOB A;  2QKM B;  2VPR A;  4UXN A;  3DLL F;  4X0G A;  2FFD A;  1W7P B;  2R7S A;  1U7J A;  2BCC G;  1NU1 G;  1PL5 A;  2QLZ A;  5E3O A;  1MBK A;  1PZQ A;  1YQ3 C;  3GHG B;  1BI1 A;  2KYV A;  3KQG A;  1U78 A;  2LKP A;  5KLI B;  4YG2 F;  5TJJ A;  1LTI C;  1K05 A;  1M90 Q;  1KTM A;  4KA4 A;  2NRG A;  4BRY B;  3CCQ P;  3K1M A;  2GA1 A;  1JTH B;  2W48 A;  2P81 A;  3BJO A;  3TO6 A;  3II6 A;  2QUF A;  5BOX A;  3IF4 A;  4BXF A;  3S3N A;  3HOV J;  5IPA A;  3E6B A;  3JRF A;  1FP1 D;  2ZYG A;  3H35 A;  1BI0 A;  1SQV G;  2RN0 A;  2CSO A;  2R5Y B;  2Q0O A;  1NK2 P;  2RQQ A;  4BQA A;  4B48 A;  3S16 J;  1ETW A;  1IZ1 A;  1UHM A;  4OIN F;  4C7N A;  2DJN A;  2QQ9 A;  1RIO H;  2LBF B;  2JRT A;  3HUG B; 
#chains in the Genus database with same CATH homology
 1LDK B;  2KIK A;  2JA2 A;  4BXL A;  2QRX A;  1IRX A;  3DU5 A;  3K4B A;  2KRH A;  2ZXH A;  3S8P A;  4BJ5 C;  4DIQ A;  4GRI A;  3AKZ A;  4XL9 A;  1X1B A;  3C2G A;  4CCJ A;  2DXI A;  3ZXS A;  3PUB A;  1X1D A;  3DKY A;  2VJ5 A;  4CUG A;  3D5S C;  4BEH B;  1G8X A;  2VL8 A;  2VPL A;  4HJG H;  2WBM A;  3MKW B;  1H0T B;  4N4N B;  1NVO A;  5CKT A;  4E7Z A;  3L2R A;  3DPU A;  3M1C A;  2B87 B;  1V5G A;  3OYG A;  5LD2 C;  2NOJ B;  3L2Q A;  3H9J A;  2M5A A;  4Y33 A;  3I3L A;  3KEY A;  1T95 A;  5CBO A;  4XR6 A;  3E0J B;  4CPG A;  3EUK L;  4BE0 A;  4CCO A;  2LY1 A;  2VB6 A;  1U0J A;  3LSM A;  1AA7 A;  4LIU A;  5JHF A;  2A5W A;  3RGU A;  1X4O A;  1EDI A;  4XOP A;  1LT1 A;  2VLA A;  3K6G A;  2JVH A;  4B47 A;  4HEA 2;  4E6K G;  1EDK A;  2UV1 A;  2KP6 A;  3PNV A;  2VIX A;  2FUG 2;  2X6W A;  3LSI A;  1NG7 A;  3OMY A;  2GOX B;  2WMM A;  4XLC A;  2X1D A;  2M3A A;  4XLF A;  4XLE A;  4BE1 A;  1GLN A;  2K9L A;  3OIQ A;  4EAT A;  2E5N A;  2R7Q A;  4F93 B;  3OYL A;  2WY7 Q;  1TT0 A;  2MD0 A;  4XMY A;  3ZR8 X;  3QOE A;  1FC2 C;  1X1C A;  1JI8 A;  1WJF A;  1X1A A;  3SEZ A;  4PJJ A;  2I8D A;  4XLA A;  4Y4R A;  1V5F A;  1TZL A;  2VXD A;  3DKX A;  2CV2 A;  4MN4 C;  3VYT B;  3ZCO A;  2LH9 A;  2VXZ A;  2Z16 A;  2M4K A;  2R4G A;  2RKL A;  3L2W A;  3H9Q A;  3IP4 B;  2KS1 B;  2LR2 A;  4BJ6 C;  3RTR A;  4R79 A;  4BDZ A;  2PJR B;  2CV0 A;  2L2O A;  4E7J A;  2CW7 A;  3MMY B;  1WJB A;  4ANJ A;  2R44 A;  2O5R A;  4LIV A;  5HVQ C;  3OYH A;  1UG0 A;  4H4K C;  2CFO A;  4C9Y A;  2XF7 A;  1LP1 B;  4IZZ A;  3CF2 A;  3PL8 A;  4HKZ H;  3ZRG A;  3SZG A;  3OYB A;  3OY9 A;  2CUJ A;  4ZNC A;  4KJM A;  2JUG A;  1D1B A;  2E5Z A;  3K4K A;  2IS2 A;  2JWD A;  3LSG A;  3H5A A;  4J00 A;  3CP2 A;  4YEJ A;  4F55 A;  2Q1K A;  2HZD A;  2VQL A;  3I9V 2;  1WJD A;  2X6X A;  3VYU B;  2LRD A;  3RSN A;  3HC7 A;  1E0E A;  3TMO A;  3VSK A;  3VSL A;  3W2A A;  1Z7L A;  3VYS B;  5KNL A;  2M7B A;  3EPZ A;  1OR7 C;  3DWL E;  4BJT A;  4ZDL A;  3OWT A;  3HOT A;  1BDD A;  2HDW A;  4JBZ A;  2XDV A;  3OS2 A;  1BOB A;  5CPR B;  2VQG A;  3M8J A;  4JOM A;  1QU3 A;  2OTK E;  3K4J A;  5EFW B;  3AFH A;  3AL0 C;  2K9M A;  3EUH C;  4B43 A;  4XQF A;  3PFY A;  3OYA A;  1DP3 A;  3W3C A;  3J7A Y;  4CCN A;  3VYR B;  1Z21 A;  3PJR A;  2KL4 A;  3U21 A;  2DOA A;  3HG9 A;  2CS3 A;  4Y3O A;  3OS1 A;  2M0M A;  2IXS A;  4PFP A;  3SYT A;  4XN3 A;  2OUM A;  3BCA A;  4PJN A;  2LRE A;  1D0X A;  2K3P A;  3OS0 A;  1MW7 A;  3K4M A;  4XKV A;  5LFA A;  1DGW Y;  1X19 A;  4OWR B;  1DGR M;  3K70 D;  3K70 C;  2B88 A;  3VWB A;  4B44 A;  3OYN A;  4E7I A;  4D9J A;  3ZGK A;  2KHM A;  2BW3 A;  5KHD A;  1VZ0 A;  1Q2N A;  1N75 A;  4IOI H;  4YRV A;  3D5R C;  2HPM A;  2IGK A;  3C2H A;  2KZJ A;  2MC4 A;  2X1C A;  3OR1 C;  2UWM A;  5CBN A;  1Y6I A;  2IGO A;  2E60 A;  3DTE A;  3BCB A;  1WJC A;  3UR3 C;  3LSH A;  4II2 A;  1EDL A;  3E1S A;  3IAM 2;  4BE2 A;  3L2U A;  1ZXG A;  4K35 A;  3N05 A;  4PFO A;  2KZV A;  4NPD A;  3PNY A;  3CMM A;  3FXD A;  2AQE A;  1EDJ A;  3OL4 A;  4F52 A;  3K4N A;  5CQE A;  3MKY B;  4BDY A;  1Y47 A;  3IAS 2;  3FBI B;  4CA0 A;  2M5A B;  1HA8 A;  1OVV A;  4PK4 A;  2LOO A;  2VJ4 A;  1QHH D;  4HSR A;  3A4C A;  3W2W A;  2LXB A;  2UUZ A;  2VJJ A;  3NWS A;  4QPQ A;  4BAC A;  4CSW A;  3BC8 A;  1OVU A;  1SS1 A;  3RCO A;  3DQV C;  4ZTF A;  1FMW A;  4XN0 A;  4XLH A;  5TGT A;  3TBI A;  3MZW B;  1YX5 A;  3FHN A;  3FXE A;  4EYY Q;  2V9K A;  5FRO A;  5C39 A;  4JQF A;  2LYC A;  2KMU A;  2HVR A;  2HNH A;  5HNH A;  1ZW0 A;  1V5E A;  2WB1 A;  3DU6 A;  2CMP A;  4DJA A;  4N4O B;  2BVM A;  2DCE A;  4LG3 A;  4NC7 A;  3RPU D;  1NG6 A;  2R7T A;  2PMZ A;  3AL0 B;  4ZMD A;  3OYE A;  3DPT A;  2QVA A;  2Y0S A;  4ZTJ A;  1N78 A;  1ZEL A;  3MD2 A;  2VAS A;  2F5V A;  4LIT A;  4HNT A;  2VKD A;  3CJQ B;  4XKW A;  1J09 A;  4DBQ A;  3ZDM A;  3TL4 X;  4BQO A;  4E7H A;  4ZC3 A;  2A6T A;  3HXL A;  1U7M A;  4NUB A;  2M4G A;  4BS9 A;  2JVG A;  1N77 A;  3RQ4 A;  2MFZ A;  3NWT A;  3CJR B;  1QHG A;  3EUA A;  1UAA A;  2WAE A;  3V42 A;  4CH7 A;  3W2V A;  3SDB A;  4OAY A;  3H5R A;  3OYJ A;  2JSP A;  1BR2 A;  1BDC A;  4NPF X;  3PH0 A;  5FRN A;  1MND A;  2CV1 A;  2LY2 A;  4HPQ A;  4BU2 A;  1WJA A;  1MFT A;  3OYK A;  4AU7 A;  2KPM A;  2L9N A;  2M0B A;  2RRE A;  3HOS A;  3BLY A;  1K6Y A;  2ZAE B;  2R7O A;  3S3O A;  4ZDP A;  2L5Q A;  4XKC A;  3HL2 A;  4AYB A;  4U7B A;  1D1C A;  1UEL B;  4HB1 A;  2HQA A;  3DTK A;  3DPL C;  2B89 A;  4XOR A;  1LVK A;  4BQN A;  3OYD A;  2W7N A;  3LL7 A;  2UWJ E;  2F4I A;  3FKJ A;  4PSX A;  1LFP A;  2V4J C;  4XM3 A;  4XNF A;  2R7X A;  3OYI A;  4J01 A;  3S1K A;  2IS1 A;  1BR1 A;  4FET A;  4D1Q A;  3A1Y A;  2ZXI A;  2Q1Z B;  2K5C A;  2LBF A;  4CZC A;  4XKB A;  5CQG A;  1S3J A;  2V1N A;  2KLO A;  4CCM A;  2AQF A;  2KUB A;  1D0Z A;  4BEH A;  3KYL A;  3L2V A;  1MMD A;  3QYB A;  1H0T A;  2X1E A;  2X51 A;  1G59 A;  4IQJ A;  2KZI A;  1ERD A;  3OOU A;  2WAF A;  2RNG A;  2B87 A;  3CES A;  2ZFU A;  2HVQ A;  4ZDO A;  2VQC A;  1KON A;  1PYV A;  2WY8 Q;  2BW3 B;  2IS4 A;  3A2K A;  2KI7 B;  3LSK A;  4DGW B;  2L9S A;  3QYF A;  2Z2S B;  2DT6 A;  2W1O A;  4XOT A;  1T0F C;  1D1A A;  1MNE A;  3CP8 A;  3K4C A;  5KCM A;  4CCK A;  2HU9 A;  1YE9 A;  4BGD A;  1DQU A;  3LMM A;  3SEQ A;  4HG2 A;  5HLT A;  4P1W A;  4RM2 A;  3S93 A;  3MHV A;  1EC5 A;  3OYF A;  1W36 D;  1W36 C;  1LKX A;  2XC7 A;  2XSJ C;  2GOM A;  3BG7 A;  1YX3 A;  3K4L A;  4G6T B;  3G2B A;  5DJU B;  2V26 A;  3HUG B;  2LXC B;  4KIT B;  1MMG A;  4ASW A;  1D0Y A;  1X4P A;  2CH0 A;  2XF5 A;  4P5O A;  4ZYA A;  4C2T A;  4RLF A;  3OYC A;  2WAD A;  4RM3 A;  2IGN A;  2R7R A;  3FDY A;  2L7K A;  4KJZ A;  1Z3X A;  2XF6 A;  2F6C A;  4NNJ A;  4WWI A;  2CUZ A;  3S3M A;  2E1M C;  4YEL A;  3OL3 A;  3VDX A;  4IKF A;  2K3R A;  4PSW A;  4OAZ A;  4PUS A;  4NC8 A;  1BR4 A;  2VQH A;  4U87 A;  4ASV A;  1X0T A;  3H0D A;  2MAB A;  4NQW B;  2ZSI B;  2SPZ A;  4K3A A;  3ZQQ A;  2PJR A;  1SAU A;  4BUP A;  2V7F A;  2DT7 B;  3K10 A;  4HST A;  2ELJ A;  1LP1 A;  2Z1D A;  3H9G A;  1OLT A;  2KQR A;  2P0W A;  2X85 A;  4B3X A;  2VJI A;  1Z3Y A;  2W00 A;  3UNG C;  4HRI A;  4DBR A;  4E7L A;  4C2U A;  3PSI A;  2LG4 A;  2X6Y A;  4GOD A;  2DJI A;  2Q2E B;  1EA3 A;  3OIP A;  3HKZ A;  2KDO A;  1P9Q C;  2WAQ A;  3LFU A;  2R7V A;  3CZ6 A;  1JMB A;  3PNT A;  1WJE A;  4KIS A;  3DLA A;  4HNU A;  1FMV A;  4E7S A;  3FBN B;  2M7A A;  1PJR A;  3QWO C;  2XAU A;  2V6E A;  3QYE A;  1WJ5 A;  2BVL A;  2HPI A;  2WA0 A;  3DEE A;  3OYM A;  5K5G B;  2IGM A;  3OR2 C;  4DOZ A;  4RLQ A;  3BG6 A;  4C30 A;  3DTI A;  1OVR A;  3PSF A;  4XON A;  4NPE A;  5HNF A;  4KT6 A;  1JM0 A;  3HPG A;  3HPH A;  2VKH A;  4PJM A;  4QPO A;  2KRC A;  4IQ4 A;  3S32 A;  2W4S A;  5HOO A;  3MKZ A;  4II3 A;  4ZJZ A;  4RMN A;  3ONQ A;  4ITV A;  1DEE G;  2HVS A;  2OC6 A;  4F92 B;  4AVZ A;  2ZSH B;  2QKM B;  1WFX A;  4GOE A;  4X0G A;  2BOL A;  4F91 B;  3QOD A;  4PJL A;  2R7S A;  3IUO A;  1U7J A;  3D5L A;  4MLO A;  2OV7 A;  2R7W A;  2P58 A;  4GOF A;  2R7U A;  4BL0 B;  3F9K A;  2IS6 A;  1SFK A;  2W82 A;  2LC2 A;  1MMA A;  5FRM A;  4FAS D;  4IX7 A;  3H5N A;  5DJT B;  2E1M B;  4E4H A;  4BXF A;  3S3N A;  2CW8 A;  1MMN A;  2HR3 A;  3GBG A;  3H35 A;  2MYS A;  2QKL B;  4CCL A;  4BQQ A;  4E7K A;  2RQQ A;  4B48 A;  1Y56 A;  1S9H A;  3KX2 A;  2LBF B;  4F3Q A;  1R6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...