2I8DA

Crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
GSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized conserved protein of COG5646 (ZP_00384875.1) from Lactobacillus casei ATCC 334 at 1.69 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Structural genomics/unknown function
molecule keywords Uncharacterized conserved protein of COG5646
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2i8dA01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2i8dA02
2B89A 3RGUA 4GOEA 5CBNA 1ZXGA 2KUBA 3PH0A 2B88A 2OTKE 1EDJA 1LP1A 2OC6A 4HKZH 2LXBA 2I8DA 4KJMA 1BDDA 4WWIA 5DJTB 4EYYQ 4ZMDA 4IOIH 2KZJA 4BXLA 2Q1KA 1SS1A 2ZAEB 2R44A 2LR2A 4HJGH 4NPFX 2JWDA 1EDKA 4NPEA 2KI7B 2QRXA 1EC5A 1DEEG 4NPDA 3QWOC 2RKLA 2KL4A 3FXDA 4MN4C 5DJUB 1H0TB 1U7MA 1OVUA 2KIKA 1X0TA 1JMBA 2K3RA 5CBOA 1OVVA 3MHVA 5K5GB 1NVOA 1LP1B 4K3AA 4HB1A 3S1KA 1MFTA 2HR3A 5EFWB 1EDLA 5C39A 2M5AA 2SPZA 1EDIA 4GODA 2M0BA 1JM0A 1H0TA 2P58A 4ASWA 3ZDMA 2B87B 1OVRA 2KZIA 1Q2NA 3FXEA 2QVAA 2UWJE 2M5AB 4ZNCA 2LXCB 2B87A 1ZW0A 1BDCA 4ASVA 1Y47A 1FC2C 4GOFA 1LT1A 2WMMA 2KS1B 1S3JA 4CPGA 3MZWB 4K35A 1U7JA 4JBZA
chains in the Genus database with same CATH superfamily
1LVKA 3HJEA 4OAYA 4GO1A 3SDGA 1ZREA 2WAEA 1N77A 3VN0A 3RL0D 3V8KA 4P9UA 4FE7A 1X3WB 3EPZA 1UHSA 2W84A 3EUAA 3D1NI 5ERIA 2OYHA 1OCPA 2BVLA 2DJNA 2K9SA 2MH9A 1APLC 1ZXGA 4EEFG 2R5YB 2WV1A 4F92B 2CK3H 2CQ7A 3GO5A 3DU5A 1JT6A 5KK1A 1G3TA 2OTKE 3V2QA 2BVMA 4V19K 2D2CD 3CP2A 3VP8A 2ADUA 2QQBA 5F08A 4FISA 3WTUC 3JRBA 1R5GA 4M3GA 3SDBA 4L18B 3HRNA 4PV1D 3H1LJ 2OGUA 2VC1A 2QJYC 3BVHA 4M3DA 2LF8A 4ZDLA 5GPCA 3UR3C 2DT6A 3J80Z 5KAFH 1X58A 1NTZE 4NBQA 3AECC 3NXSA 2C0WA 2OCCH 5GAHJ 3BR2A 1K6YA 3HGGA 4X6AJ 2Q1KA 1SS1A 5FD5A 3ROUA 2NRGA 5EGOB 4AC0A 4HJGH 5IPAA 3AE6C 4LB6B 1M7LA 3M8FA 3H1LG 1XTGB 2KI7B 2QRXA 2R0QC 3C1LA 4NPEA 3GW2A 4E7ZA 1T56A 2AQEA 4RAZA 2VC0A 2LBFA 4D5FA 1XTAA 2R5DA 2YMKA 2DA7A 2IDBA 1T95A 3DKWA 1MFZA 2Q3IA 4MN4C 1OKRA 2DQLA 2MLGA 3SWYA 3FWNA 3IUOA 2H8RA 3IRRA 1YHQI 4U88A 3KCCA 4O6JA 3C2BA 1JGGA 1S9HA 4RBOA 1NU1G 2L7ZA 2P0WA 2M3AA 1OVVA 1FP1D 3V8LA 4YEJA 1WRGA 2HQ5A 3CC7I 3EWKA 3K5BA 3M9AA 2A45H 2Q9IA 3L2VA 1Q1VA 2QM8A 2EJRA 3P7NA 2N1TA 1ITYA 3OYAA 3HE5B 2CH0A 2CRGA 4U0YA 3B4SA 1F1ZA 2X6YA 6PAXA 2FXAA 2RQPA 3TO9A 3HE4B 2FSWA 2G3AA 3LSTA 5APQA 1TWCJ 4E4HA 3K4CA 3W6KB 2FYUD 4DNCA 4M3FA 4GODA 2OYIA 3RQ4A 3B6CA 3CMMA 3SXYA 3CXHI 1IJDB 3AG1H 4KA4A 2JA5J 3S3OA 1EZVG 2YS9A 2YR2A 2QLZA 2K9MA 2P7CB 4GYIA 1PVEA 5B5EH 1BI1A 5IT3A 3P8CE 1GXQA 3QH9A 4XONA 2VBYA 5EG0B 2OYOA 4EM2A 5H2FH 3WU0A 2EIJH 1HKTA 3MP7B 2HGCA 3OYJA 3HOZJ 1PGQA 1EH6A 1D5VA 5CVJA 1J0RA 4IVNA 2NAZA 2W90A 3TW7A 2JJLA 1HW1A 4IL6C 2OTJI 1EZVD 3WHBA 1Z0XA 1JY3N 3PJRA 1PGOA 3OYDA 1NTMD 4YG2F 2QJPC 2LY9A 2GXAA 3RK3B 5B66H 1LFBA 2VQHA 1U6GA 5TJHA 2M0MA 2ZXXA 2V1NA 2PFBA 3C9IA 1ZH5A 3GTMJ 2G9WA 3CWBJ 2BBYA 4LG3A 5J1YA 4CYCA 5KVRA 1DIPA 4C3HJ 1XG1A 1Y6IA 4EVIA 1L4AB 2XSJC 1SQPG 5APYA 1FZBA 1ZGJA 3HHHA 4QIWN 4XICA 2LF7A 1TP4A 3DKXA 5HOOA 2KT0A 1OXZA 3I56I 1XMXA 2KZGA 4U0VA 3B5NC 4HLXA 4LGDE 2L02A 4IHWA 4BXUA 3RI4A 2QEXI 3HTKA 1Q82Q 3KP3A 4BH9A 2P6TA 2N9BA 3U1CA 3LQQA 3H1HD 1G6NA 4LGWA 5A2QZ 3HKZN 2ZNZA 2EBIA 2Y0SN 5LRSA 4AYBN 1O3SA 4ZMDA 3I0TA 3NTNA 1FTZA 5KHDA 2YKOA 3HBLA 5M5YJ 3H25A 4G6QA 1KQGB 2W25A 3CLOA 4U7JA 1JO5A 2R32A 5H6QA 1WPKA 4BU2A 3NWSA 2JR8A 3JRIA 3WUTA 1QQIA 3HRSA 3G2BA 2IW5A 2JN6A 3V6IA 2K5CA 1A02J 2JWTA 1YQ3C 2JQ7A 2LR2A 2IA2A 2JZYA 1TWGJ 4PD4I 2VXDA 2M3EA 2CO5A 1OQYA 2HTJA 1F43A 4C7NB 3G73A 2GM4A 3I5CA 1DQUA 1EH8A 1SVOA 3PL8A 2PJRB 3OIPA 3G6EI 2Y2ZA 3PSFA 2D1HA 5KLVG 3H1IG 5D5VB 2AXCA 4JYBA 2XGDA 1IUFA 1BW6A 3RL0B 2NNNA 4F7ZA 1H0TB 5KTBA 3CCJI 1SFCA 1URQA 3BR5A 1FDIA 4DT0A 2DA5A 2M4KA 2V6CA 2WAQN 3BG9A 4I7HA 3MKLA 4D7NA 2CG4A 1G3SA 4DYRA 4RGXA 1PPJE 4UNOA 3L73E 2ECCA 2EZIA 2IGMA 4OU0A 1D8JA 1MMSA 2JP3A 3M0AA 2NZ2A 5E20A 2M5AA 2FFDC 2WSFH 3ULQB 1H89A 1EDIA 4KFCA 1GUUA 1ZN2A 5D6EA 3J7AO 1R49A 4OH8B 3ZP5A 2E76C 2MBFA 2XIGA 3SFEC 2XF5A 1X3ZB 2X6WA 1VPCA 1Z1DA 4OMZA 3CCMI 3H1LD 2L5QA 1I1GA 2DN0A 2P58A 4XIDA 4A0ZA 3F89A 3HOXJ 2KKOA 5KLVJ 2DU9A 1USSA 5KLVE 1ZRTE 4FQGA 1F9NA 2R7RA 1RF0C 4WY4A 2NVYJ 2QJYB 1KYZA 4RB2C 4BXFA 3HYIA 5JI6A 1VDFA 1AKHA 4PFOA 4ZYGA 1QBJA 2B87A 3Q2YA 4N4OB 4UUTA 1LNQA 4KT6A 2H09A 3U1KA 1YJWI 3WGHA 5E1XA 3GFMA 1QPIA 1OFCX 3GFLA 4GCVA 2HPIA 2ZXWH 1X4PA 3OJAB 2PMHA 2B63J 1XD7A 4LIUA 1O3QA 2QM7A 1EXJA 3COAC 1ACIA 1MD0A 2QIWA 3O8GA 5KAIC 5J4YA 1I3QJ 1KFNA 2HQAA 3ABVC 2R7ZJ 3GTPJ 2B89A 3G71I 3P8CD 1FBSA 3GMAA 5EF6A 3OOUA 5CBNA 2DCEA 1JCCA 2HODB 1VQ6I 3HE4A 1W2EA 4PFPA 2DLLA 3LAPA 1FMVA 1FY7A 2WADA 3GLXA 4CH7A 2B88A 2GQQA 1Q86Q 1BI0A 1Y8QB 2E35A 3F6OA 5HNHA 1KQFB 3FXUA 3M0DA 2OYIB 1X9VA 2RN7A 3VPRA 3D5LA 1ZR2A 4Y28J 3HC7A 1ETOA 1S9KD 1BGYE 4D0PA 3O2PE 3PQKA 4RS8A 3PIOF 3CUQA 4LLLA 1X1PA 4KN7X 5DCMB 2XROA 4L5IA 3CMYA 5TGTA 2BEZF 3H32A 1G3WA 4IL6H 4IOIH 3IH3A 3H1HJ 5AVVB 1J1EB 4P5OA 3V2RA 1REPC 1NYHA 4IFFA 4D7MA 4CCOA 3HRUA 3CXHD 3MKZA 1ETYA 1S7EA 2NS8A 5F0HA 2VONA 4XSZF 2FBWC 3QQAA 2KZVA 5AW9B 1X19A 4ZH4F 2XF6A 1IRZA 3RYRA 1A02F 3VP9A 2IS1A 1SFEA 3PNVA 2E75C 2WTYA 3H92A 3NARA 2X48A 3KP2A 2ESHA 4NB5A 2ELJA 1NTKK 1YE9A 1GD2E 3OYLA 4DOZA 2K9JA 1I27A 3J81K 3AEDC 3LWFA 4Z2YA 3A5TA 2JWAA 1KU7A 2KPMA 3ZR8X 4HOBA 3KHUA 1P7IA 2J5OA 1BJAA 2E60A 1BE3D 2I1KA 3NAUA 1NOHA 5EJCA 3ZMSA 2OYHC 1FX7A 1OVUA 3S16J 3R4YA 5CVUA 3TSIA 4KNYA 5FD6A 1Z7LA 4D6TG 2QYOA 1V55H 1CI6B 1HH0A 1HKQA 2ECBA 5HLHA 3B5ND 4I98B 4CO8A 1KILC 2MW8A 2P10A 2NPSC 2IA0A 2LKXA 1OISA 3FBNB 4KMUX 4HEA2 2BW3B 3T8RA 1BSHA 3P9IA 3K2AA 1HBWA 3CL3D 4DZPA 5EEGA 3J7ZI 1J09A 5GPAA 2BZTA 1IDZA 1RE3A 2CFXA 1J75A 1VI0A 2MC3A 4C3IJ 4Q48A 2VE9A 1NAYA 2EZHA 3GZ6A 2VE8A 3ZQHA 3RZDJ 3KYLA 3ZQCA 1IV6A 4LK1F 4CCJA 3JW4A 1W7PA 5DYMA 1KU2A 3KXDA 4HBLA 2MKVA 4WVZA 1LDKB 3WTVC 1JUMA 2ELHA 1YJNI 1E0EA 4WY4B 1YQAA 1S7AA 2LD5A 3AKZA 2HZTA 1MIJA 3L70G 1OW7A 2ZXEB 2MLKA 2VXZA 4UB8C 2OU2A 4BY7J 2FU4A 5HS8A 4UB6E 5AW1B 1BDCA 1ZHFA 5HVQC 4KDPA 4EJVA 4LB5A 1BOBA 1ZRTD 2CV1A 1FC2C 2OARA 3BC8A 1RKWA 2FXMA 1LJ9A 2CW8A 4Y99B 1ZYRF 2GIVA 1OWAA 1FJLA 2KQRA 4L0YB 2D5VA 2EQRA 1LQ1A 1YX3A 3CC4P 5E1WA 5J3LA 4HNVA 4WY4C 3ISPA 2Y0SA 4KT5C 1UIXA 1SQQD 2X6OA 1R36A 1OYIA 4KJZA 1J5YA 2ZBKA 3TDUC 2ZYDA 1G1JA 1R1UA 1LTSC 4GOEA 1WKMA 5EYRA 1YJ9I 1J7KA 1IO4A 3WGGA 2PRRA 4QSHA 2NVUB 1W7PD 1C0WA 4RGUA 2VT2A 4A93J 1SQXJ 2KLVA 4I6ZA 2W24A 5AW4B 1WJBA 3PNYA 4G8XA 4KN4X 2Q6QA 1GW3A 3GTQJ 3RBXA 4EIJA 3TP0A 2DK8A 3HDDA 5M3FJ 3Q0WA 2WSFJ 2ACJA 5ILSA 2YIUC 4UVAA 4H13C 3RYPA 5GTHC 5FKOA 2K88A 3H0DA 4FX4A 4E7HA 4EYYQ 3OYHA 4RB0A 1FYLA 1OYYA 1VQKP 3QP6A 4XSXF 3F23A 3D70A 2HKXA 4WWCA 1N7SA 2EIKH 3F3XA 1U0JA 2BHYA 1KYOD 5BPIA 2R7QA 3BQZA 2M34A 2WAQA 5L3CA 3OYNA 4S0HB 2L2OA 1BA5A 3A0BC 2NVTJ 2IBZD 3K10A 4PSWA 2F6CA 1W7PB 3HRMA 3PTZA 3TGUG 1GDTA 4Y7NJ 2WC2A 4L74A 3QAHA 2V1UA 1IN4A 1MNEA 2H94A 3CJRB 4D5CA 1NK2P 5M5XJ 2WPVB 2P5KA 1EF4A 2Z16A 1KGSA 5M3MJ 4H13D 1M1JA 1MBKA 3H1JE 5DM7F 2LK2A 5AVWB 2KL4A 2HPMA 2ZJSE 2CUFA 2Y0EA 1I39A 1V5EA 2LNBA 1KZUB 2O8XA 3FX3A 1HJ0A 1JCDA 1TQPA 2KIKA 4L0ZB 2P4WA 2K3RA 2F5CA 4ZYDA 1T3UA 1KU3A 2LR8A 2KS1A 3HIFA 3M9BA 2CUEA 2D2CC 1NVOA 3S1RJ 1VQPP 3CCUI 2P1JA 1XB4A 4MQVA 2Y9YA 1HCRA 2IBZG 1MBEA 3RKWA 2HR3A 3HTUA 2HNHA 4Y13A 1WCMJ 2VKHA 1N7SD 3L00A 2CPSA 4B8XA 4WY4D 3HHGA 2OA4A 4DQ2A 2VJIA 2XB0X 2FOKA 2L4AA 1IRFA 3ZMDA 1JXSA 2CUZA 1NTZK 4PCQA 3HSRA 4L5EA 1YW9A 3H1JJ 2YSRA 2QZ8A 2K3FA 3TOAA 3P5JA 3ZQGA 4BEHA 5J47A 4E7KA 1Y0UA 4HF1A 1JT0A 2D2CB 4L73A 5APWA 1UHMA 1XTCC 1Q7YQ 1IFNA 1DPRA 1UMQA 3GEZA 4XKVA 2ISZA 3T97A 2UV1A 5BNGA 1BGYG 1M1JB 4EATA 3H1ID 1BOAA 1L0NE 3ASNH 4I76A 4BDYA 1L4AC 3ZMZA 2XV5A 1VQLP 4O3MA 3LSGA 3VFZA 1J1EC 1NTZD 1M1EB 4DZOA 3ZOBA 2K4BA 1XSDA 3L72D 1RE3C 4B1RA 5BU5A 1Z05A 1MDMB 4EM1A 4PJ0H 2AHQA 4RM3A 1N73B 4DBQA 1OR7C 2OPTA 2JVHA 3OYMA 4XLPF 1D0ZA 4E7IA 2P7JA 3ELKA 2E1OA 1SFCC 1URQC 2RVCA 1ZMEC 2ZXHA 2GXBA 1SQPK 5E8GA 4CPGA 1SFUA 2QCOA 3RDIA 1W0UA 2IYPA 1AVOA 3WU2H 2FF4A 4P1WA 2IYOA 3EUKL 2FJ1A 3VMZA 5IOZA 2ELKA 1LTJA 4V2FA 4UHTA 2HODA 1LT9B 3L2QA 4PJ0E 3RJPA 4IPAA 3O3KA 1GT0C 5FJ8J 3RQIA 2LH9A 1GL2B 4CCMA 2E43A 1RE4C 1VFCA 2O0YA 2KP8A 2CW7A 4Q5SF 2R7XA 4A2UA 4MEXF 1IFDA 4H13B 2C9NY 1J59A 4OIRF 4UV8A 5ICFA 2VLAA 3EUHA 1B72B 2LMDA 1VQPI 3CO6C 1JTXA 1QX8A 5D8KB 4A3BJ 2BCCG 3T5XA 3L2RA 3V5BA 2XAFA 1BIAA 5KLVD 3CUQC 4U3FJ 2VKEA 1FLIA 1EA3A 4A0XA 4B48A 1JMMA 4XK4A 1U2WA 2Y75A 3DKYA 3RKYA 1W36D 3CCLP 1N86A 3S3NA 3BTLA 1U8BA 1P84I 1ZTRA 1R4MB 2ZVOB 2M45A 4F93B 4OVNF 2KZJA 1LDJA 2B9BA 1YIJP 3LSHA 2MFZA 2JK3A 4UVBA 2Q1ZB 4R1HA 2FXPA 2MSYA 3Q5FA 2R5YA 1DEBA 1YW7A 4YIIA 2NOGA 4EOTA 2K02A 4GFBA 2W83C 1NG7A 3OR1C 3B02A 2IXSA 5J8CA 3H1KG 1QZZA 1T0FA 2LY2A 5E3NA 2HI3A 4NPDA 1BCCD 3TDKA 3GXOA 1D8KA 3CF5F 3SWFA 2H6CA 1BR4A 2L3DA 3VYRB 3G9RA 1VQ5P 2A6TA 3L2WA 2NPSA 3DWLE 4ASNA 2FNAA 1GU5A 2QQ9A 1IDYA 4GYGA 5HS7A 5E3LA 1ZP0C 3W67A 1OW6A 1VQOP 2OTLP 2RNGA 1Z56A 4BY1J 2KDOA 3K2ZA 2JO1A 3S1KA 3U2RA 3G1OA 2Q5UA 1U8RA 4NNJA 3FF5A 2A07F 1T38A 4Z1MH 3M3YJ 1TU3F 1YX5A 4ETSA 2PLYA 3L71D 5BVZA 1OCRH 3TGUD 1IO2A 3R0JA 3PUBA 1FOSE 1ZG5A 1YI2P 3C8VA 5HDKA 2EWNA 3NMDA 5CVIA 2QBYA 4D6TD 2A45I 2WPRA 4DW6A 3AE8C 2R3CA 4AUWA 5DUIA 3FXJA 4G6TB 2R7DA 3W6JB 1ZG3A 3M8EA 3ERED 3K70D 5DTDA 1L0NK 1P4WA 1FZPB 1RETA 2DTRA 2EPFA 2JRMA 3I59B 4FE4A 2KSJA 3BCCD 3WTSC 4BXXJ 1PZQA 2H8WA 1P4AA 3KYDB 3UNGC 5JLXA 2KNCA 2XDJA 4ZNCA 4PD4E 3BCCE 3AAFA 2DMNA 2Z1DA 2GOXB 4BS9A 1B4AA 1ZR4A 2A06D 3HUGA 5J4VA 1SFCD 1URQD 3DF8A 5B66E 3CPWO 1VQ7I 4U7BA 1HF9A 1GHCA 5AW5B 2W7NA 3MQ0A 1PUEE 2IBZI 2MG4A 3AE5C 2JA7J 4GOFA 4OGQC 3CCSP 2JA6J 2Z5IA 2LKMA 1KQ9A 1X3UA 2Y30A 3E5UA 4RB1A 1L0ND 3Q5SA 2Y0MA 5K1YA 1BE3E 2PEXA 4JP0A 1ZV8A 2FXOA 1NTMJ 5CCGC 1YFHA 2QM3A 5GTIH 4RAYA 2OBPA 1HF0A 3GYHX 1HOMA 3AG2H 3QRFF 3H9QA 2IPPA 2DTZA 4XLHA 2MH2A 2XNXA 3L9FA 3OIOA 1GTWA 3MMYB 2V9VA 4F55A 1LT9C 2DA6A 2RV8A 3L72E 3TYYA 1K78A 2O3JA 1QRYA 4GXOA 3PIPF 3JSOA 2GUVA 5DEQA 3WG9A 2C9LY 3FXKA 2EFNA 5F1RA 3G1MA 1I6XA 1POGA 1S4XA 2GWRA 1SC7A 4LD5A 1SQBD 2W8ZA 3L73D 5CCGD 2OTJP 2K9NA 3ZQ7A 1FZCB 3KP5A 5FRNA 1FYKA 2EINH 4WWIA 4QWQA 1R1TA 2VT3A 4ZYAA 3BTJA 2R5ZA 4DOJA 4B43A 1MSEC 2E2IJ 3V4WA 3EUHC 1LB2A 2E76B 3L71G 2Y0DA 3Q9SA 4HYEA 4B3XA 4ZC3A 3CCLI 3C1DA 3TGNA 1NH3A 2E7XA 2QUFA 2R7TA 4Q4ZF 4XLNF 2IAIA 3RK2D 1HA8A 2GLOA 1IXCA 1JHHA 1LTGC 3AE3C 4R4MA 4YTPC 2BGCA 4XA4A 2VJ5A 1NO4A 1X1BA 2N1TC 3O8HA 4LITA 1AWCA 1ODDA 4XMYA 2VBXA 2W00A 4BJTA 3QP5A 5AIQA 3DLLF 3GTOJ 5FLXK 5TRDA 4A12A 2KB7P 1IXRC 2X6XA 4EM0B 4PD4H 3PSIA 4HDVA 1BC8C 3GFIA 4H0LB 2GIZA 1YRNB 2YO2A 3BG6A 2D2WA 2BY3A 1XGMA 5CCHC 1ZGWA 5KAIE 2R93J 3SWKA 1L0NG 5F27A 3B73A 1XSXA 1Q1HA 4L75A 4IQ4A 3GF7A 3DEUA 3HM5A 1R7JA 1HTLC 1PIXA 4XLFA 2STWA 2V26A 1K4TA 1GL2A 3EFGA 2HOEA 4N9HA 1MW7A 4E70A 1MDMA 1KQLA 4IL6E 4Y99C 5CVRA 1H88A 1FOSF 2XAJA 1P9QC 1NKNA 2QKMB 1MKMA 2KISA 2L01A 1WGXA 2M4GA 3V7SA 3CCEI 1H0MA 1H0TA 1YJ9P 4G12A 1D0XA 1YIOA 3BDDA 3BG3A 1U9OA 2EH3A 2ZC2A 2XASA 2WAFA 3QYEA 1FOWA 2PQ8A 1OVRA 1FBQA 2B87B 5DUKA 1JY2P 2ZNYA 1ERDA 3KPEA 1NTKD 4FETA 3H35A 4D9JA 1O4XA 5B1BH 3CDHA 4HQEA 1VQ4I 4XBFA 2LXCB 4H0LD 4OWFA 4DJGA 4UXNA 1RR8C 1RF1B 4G9YA 3E7KA 1TNTA 3L7WA 4MHGA 2J58A 1HJBA 2UZKA 1ENHA 2VQLA 3OMYA 4GRIA 1J1DB 4JX5A 3TGUE 3ABTA 3CX5E 1AFOA 4DJAA 3OY9A 4I02A 1MJBA 5FKLA 3ERMA 3JRGA 3DBRB 4CYDA 1VQKI 1A36A 4B4CA 3BRVB 3E6CC 2LLKA 4PD4D 3SEQA 1RUOA 3W2VA 5JLWA 3S14J 1FTTA 2JA2A 1YS6A 3H1JG 2OZ6A 4RAGA 1BR1A 1Z3XA 3WTZA 1U5TB 1FWZA 1GL2D 1WJCA 3USSA 3SFZA 3H36A 1YS7A 2R7FA 5AVUB 1WI9A 1QHHD 3MZ8A 2YMYA 1XS9A 2E5ZA 2O01N 3K6GA 5JHFA 1TQIA 2VB6A 2DAOA 3I58A 4R8HA 3V7CA 5D6FA 4OGQB 2WVRA 4HAMA 1LUJB 1K78B 2M30A 3QOEA 4PV1C 4L9VA 1GW4A 4KYWA 1L0LK 3GG2A 1AVYA 1VQ6P 3PLNA 2W6JH 3E7LA 3E1RA 1YW8A 5FKKA 3MGNA 3A1YA 4BL0B 2XKPA 2PMZA 4LOCA 1K6OA 5BU8B 5KKZB 1RNLA 1DH3A 3TEDA 4NC6A 4L9NA 1T39A 2ZSHB 4G94A 4AIHA 2ZYGA 2JVGA 4LLGF 4HH2A 2KIMA 3AE2C 4XM3A 3R60A 1M56D 2KLUA 1WVRA 3FWEA 1T2KA 1OW8A 4M3LA 2FA5A 3DBHB 1IRGA 1MZ9A 3CTAA 3NWTA 1Y1VJ 2KP6A 2O6GE 2IPQX 3DQVC 4M9ZA 4EJWA 3BPVA 4LFUA 1GLNA 1K79A 3NQOA 1OCCH 5ED4A 2IGKA 3LMMA 2XAUA 1SEUA 1YTZI 4GT1A 1Z21A 1WZ2A 2A69F 1DEEG 3BJAA 4KISA 1LTJC 1P7JA 1LE8B 4EMSA 1N7SB 2HLOA 1JY3O 2P81A 1PPJD 5FB2A 2TCTA 2HYNA 1K05A 1QO0D 1W1WE 2EB7A 4RESB 3VTPC 2K37A 4I0BA 4YRVA 4XLCA 1ZK8A 2Y31A 3BCAA 2NOJB 2E34A 4FT8A 3I4NJ 1KB9H 2OQQA 1VF5B 2Q3EA 1RKTA 2E2JJ 4RM2A 2IZ0A 2Z4EA 2MA3A 2GBYA 5KLVK 3M07A 2VQGA 3KP6A 2KSEA 2Z33A 2P2UA 1RF0A 5AW8B 4S04A 1E79H 3CD6I 1JY2N 2CPBA 3A0HH 1BC7C 3C18A 2SPZA 1LEBA 1IJWC 2WB1A 5H6RA 1KA8A 3LFUA 2ZT9B 3JSVC 2NNYA 4TLFA 1F36A 1NTZG 2RREA 2ETHA 3T8TA 2CUJA 2UXXA 3TKYA 2DPDA 2XAGA 5J40A 3WGIA 2YX4A 1D3YA 1YJWP 2E42A 2DYRH 2LOOA 3C2HA 4M71A 4ASWA 4RKUJ 4BHPA 4B3AA 4AQRD 4IRIA 1QNTA 4ZZDA 4YFXF 2FYUE 2KRHA 2L7FP 4M72A 4II3A 5GAGJ 4KUMA 1JKPC 2HEOA 1SQVE 1HDPA 4C9YA 2M5AB 3MVPA 3WUUA 3V42A 2A3SA 2ZMEA 3H1CA 4JX6A 1SQVD 4RLFA 1JI8A 1KYOE 3D71A 3ZN0A 1FPQA 3EDPA 3AE4C 1R22A 3C3WA 5J6XA 2NXNB 1W4MA 2E71A 1LT1A 1CW5A 5K5QA 3FK6A 4IHYA 4HLYA 1L0LD 2V1XA 2Z99A 3BTIA 2NYXA 2QG4A 3MZWB 5KJ7D 5GTHE 4K35A 3LSMA 1U7JA 2NVQJ 4ZDPA 2G7HA 3U1AA 2R7WA 3M8JA 4BRYB 5IYBJ 3HSEA 1ETXA 1LT9A 3DBLB 1IUYA 1K4SA 1CGPA 3ITKA 2V1DA 4H44C 1BGYD 4W7ZA 2Q0OA 1TW3A 2KUBA 2R3SA 1E3HA 3L71E 3LSIA 3MEXA 5EEHA 2FNPA 2OCEA 2R4GA 1G2CA 3TO6A 2V7FA 2JA8J 1JNMA 1WT6A 2GZWA 4V2GA 1PFIA 3HB9A 2CWEA 3IH2A 3KFWX 1PDNC 2XZRA 2AEFA 2IFMA 4NC8A 3VEPA 3CWBE 3TQNA 4EQQA 3LSPA 1RE4A 2WSCH 3H1HE 2KIQA 5HLIA 4ZYHA 1BN5A 3RK2C 1NGMB 1VQOI 3OYFA 2I1JA 5CKTA 3S9OA 3CC7P 3IAS2 2Y48A 1UAAA 1NU1D 2UXNA 1G3YA 3EYIA 1OLTA 2HG5D 4HYTB 2IS6A 3A2AA 1TW2A 2HYFA 2MD0A 1DU0A 1J2XA 1SQBG 3S1QJ 1SANA 3DPLC 4E6KG 3AEFC 2FMYA 1VF5D 3JTGA 4DYQA 3I71A 1HSJA 2JWDA 5EG0A 1JY2O 2GA1A 3AFHA 5DD4A 5EEAA 1ZLLA 3PHLA 1ZLKA 2OZUA 1RY3A 2O01J 1K73Q 2FQ4A 1FAVA 1B1BA 3TMOA 1V5FA 2XF7A 5DJUB 2W6BA 1MBJA 2XRLA 3K1MA 4I0AA 2XGXA 4Z6YA 1QA6A 1X0TA 1W2BO 1X1CA 2OYHB 1FBUA 4RMNA 4WK8F 5CVVA 2QF7A 5E18F 5BPDA 4L5JA 1G2CB 4N3YB 3FHZA 2DBBA 1NTMK 5APXA 5K5GB 5DD8A 1QHGA 1EH7A 1O3TA 2PI0A 1FJKA 1T0FC 1Q90D 4BQQA 4A3MJ 3H9JA 4HA8A 1BW5A 3IFMA 5TISH 2OQGA 3PP5A 3OOPA 2QEXP 4DCKA 1K04A 3K69A 1M57D 2W4SA 1JKRC 2LY1A 2E1MC 2IA1A 4OAZA 3KP7A 5IYCJ 4BE2A 2VPLA 2A06G 1EV7A 1RIOH 1HXDA 2XV4S 3BWGA 3M1EA 2CMPA 1BJZA 2HFHA 4IFMA 3F8MA 3VMYA 5CPRB 5IT9Z 1NTMG 4M9XA 4B09A 2NVXJ 1ON1A 3IRQA 1N25A 2JJ7A 2L9VA 3I9V2 1B59A 3Q0UA 4N78D 3HOYJ 3ZDMA 3O8ZA 1XC5A 1DU6A 2XSDC 1PGPA 3WTYC 1LTAC 1G2HA 3FMSA 3E1SA 2BEOA 4H0EA 2STTA 4C7RA 2YIUB 3E5QA 3H5NA 2DO7A 1E3PA 4JQ0D 2FYUG 5BQTA 3IWFA 1KQSO 2F4MB 2RAEA 1QGPA 5FLMJ 1QPMA 3OYEA 2ZFCA 2FFDB 4A3FJ 1YTZT 5AVZB 1KORA 2IS4A 1WSUA 3L2UA 2WSEH 1UB9A 5GADJ 1H8AC 4YIRX 2KS1B 1I5ZA 2V4HA 2K85A 2QSIA 3L74D 1N73A 3VYTB 4LJZF 2HVQA 2KJBA 2VPRA 4YFNF 4OWRB 1A6IA 3BQYA 3VSKA 1LVAA 4EGZA 1PYVA 3Q3SA 4BHBA 4F91B 1SAXA 1JEKA 3SJMA 4H44D 1SD5A 2Z5HA 1SQPJ 1R58A 1XGNA 1BIBA 3U9GA 5IP6A 2VKDA 3FKIJ 4AIJA 1NHLA 2W6AA 3S8PA 3CCJP 1Q81Q 4Y15A 1FZGA 4IF4A 5LHGA 1U3EM 1WQ2A 4U3FG 1TQMA 1N78A 4AYBA 3W6VA 2OC6A 1J2JB 3JAMZ 1WJFA 2ZJQF 1X22A 3VYUB 2IFNA 1LNWA 3H0GJ 1HGZA 2DPUA 1T2KD 2M7AA 4BAYA 1LWUA 1BI2A 2M7BA 1R5LA 1L0LE 4R4LA 3KYCB 4JX4A 1UZCA 2DA2A 2WZ7A 2ZSIB 4H44B 3GF3A 2DOFA 1PP8F 3KLOA 1JKQC 4N4NB 1LTIC 3QYBA 2R5BA 3KX2A 2FYUK 3JRCA 3FKJA 5JHUA 2AXTH 4CCKA 5L3BA 1O7LA 4ENNA 3H1KJ 1LEAA 1YLFA 2XU6A 2CV2A 3L75E 1IAWA 1LKXA 5AW0B 1ETQA 3VDXA 4FX0A 2H1LA 5LHIA 5AW7B 1PV3A 3SFDC 2KDZA 1R23A 1Z77A 3L73G 4I7ZC 2RKHA 1EC5A 2DODA 3I56P 3L75G 2XB5A 2F4IA 1NU1E 3TO7A 4U7DA 3BZKA 3CCYA 2VRSA 1T98A 2CGPA 2O1JA 3FXDA 2A6HF 5CJ4A 3H3ZA 2EFWA 1SFXA 3ECOA 3QPTA 1RH5B 3BJOA 4MO7A 3H5RA 3BPXA 4IRGA 4C2MJ 2M0CA 3LAJA 1R5ID 3S93A 1WMKA 3SZTA 2A06E 2KOGA 1VQNP 3EETA 3PO2J 2VJ4A 3LOCA 5AVSB 4LC1A 3V7RA 2IBDA 2M5WA 2G0EA 4JPZB 1D0YA 3O6QB 5H2FE 1PJRA 1ZRFA 2E76D 3HD7C 2V4JC 1MFTA 1MH4A 1JOCA 2KRCA 1VQ8I 5C39A 1T6SA 2K9JB 2E1MB 3CCRP 1KILE 1X2MA 2E5NA 4YXWH 3KEQA 1QZEA 3ZQQA 4KT0J 4HSTA 5D5UB 4ZTJA 2VL8A 3LFKA 3JSPA 1EZVI 2N8GA 1NWQA 2H43A 1EKEA 3IH4A 2A45G 2HPCA 3JC22 2VJJA 4E7JA 2HWVA 4E7SA 2IS2A 1KILB 5J8FA 5CCHA 2GXGA 3BR1A 2JDIH 2Q2EB 2V79A 3L74G 1RPWA 3H3UA 1JKOC 3ZXSA 2DK5A 3LA7A 2WTEA 1BI3A 2M87A 5KJ7A 2P5LC 2I5UA 2IT0A 3I55I 3BG5A 3FXQA 1ZN5A 2M3BA 4JOMA 1SMTA 4ANJA 1TWAJ 3OS2A 3G4SI 4MFEA 4ON0A 3HZJA 1BDDA 4WXCA 1OYWA 1I6HJ 1IG7A 1TL8A 3QPHA 2I10A 3V8JA 1IFIA 2J5UA 3K70C 1WH7A 3ZRGA 3LQRA 1SMYF 5FKNA 3J80K 3D6YA 3N05A 1FOXA 4FCYA 1MMDA 2EILH 2ZFUA 1OJLA 2JPCA 4ESBA 2N1TB 3HRTA 3F6VA 2E74B 1M1JC 2H8PD 4ENKA 1RF1A 4PDKA 1FDOA 2XDVA 5F64A 5IP7J 1IGNA 1FIPA 5LEJA 1DP3A 3RGUA 1FZAA 2DDBA 3M9HA 1OCTC 2CW0F 3LW5J 3HUSC 4WBAA 5L3GA 2VBZA 3CJNA 5TISC 1B72A 2OQRA 5DCFA 3OYIA 2WT7A 1UELB 4XR6A 1B8IA 5M1BA 4IHTA 3F9KA 2O03A 4BQOA 1QZYA 2ME0A 4BACA 4ZZLA 1DD4A 2VBWA 1AQTA 2QA4I 2WPSA 4IRHA 2LXBA 3K4BA 2ZXIA 5IT9K 2WWWA 4C7NA 3F8FA 1LTJB 2AXTE 4KJMA 1FC3A 2HVSA 2WWYA 2VI6A 4EJTA 4A7PA 1P6RA 2HYJA 3AG4H 1UCRA 3ZQIA 1CZQA 2ZT9C 1GZLA 5DCMA 3CESA 3H32B 1TT0A 3FHNA 5BS6A 3CC4I 3L4FA 4UB8H 5AW3B 1X2NA 2R7OA 3NRVA 2L9NA 2DDAA 3IR9A 2MYSA 4U87A 4XRSA 1MNMC 3BR0A 2B9SA 1ZRCA 1TC3C 2XKMA 5GTHH 4BDZA 3E5XA 4UV9A 5ILUA 2F5FA 1NKZB 3IF4A 3CZ6A 3A0HE 5JFRA 3HOSA 1DDNA 4KICA 2TRTA 2KIFA 3PUFA 3M4OJ 4UUVA 1YOVB 1NH4A 4N6JA 3CI9A 1XCBA 3HEFA 2BCCD 2L4MA 5KCMA 2JT1A 3CDLA 2KXPB 3RCOA 2A5YB 1T8IA 4D6TE 5FROA 2Q7CA 1BM9A 5H20A 3J7AY 2KIUA 1WFXA 1WJDA 3K4NA 1MGTA 1VQLI 2BY0A 2VQCA 3HOWJ 3PO3J 1CI6A 1K9MQ 2O3FA 3CMEP 3FXLA 2M9HA 1MMGA 2EZLA 3L72G 3MHVA 2FMLA 4I1LA 3DPUA 3CX5D 5CHXA 4K3AA 4LIVA 3W3CA 1S7OA 1BCCG 5APUA 2OUMA 4S05A 2HOSA 3R6SA 1HGVA 1FJPA 3A0HC 3IC7A 1CF7A 1DGRM 3EQ2A 2L91A 1SQVK 1M8OB 1K8AQ 3L1PA 5LFAA 4J00A 3IP4B 4CDGA 2DA4A 2E36A 3K4LA 1NAFA 1IXSB 2HFED 2M0BA 2B0LA 2GUSA 1HC8A 1IK7A 1S5LC 4DBRA 2P8TA 3CF2A 5IP9J 1ZELA 2AO9A 3OL4A 5D4SA 4A3JJ 3D5SC 3DEWA 2QQAA 4Y3OA 2AXTC 2QSFX 4F52A 1YRNA 1VQMI 1KB9E 3GHGC 4RJTA 3GTGJ 4PJ0C 4MLOA 1FP2A 4I99C 3ZCOA 2UWMA 1LGHB 1FZCC 4KIFA 2E74D 3OS0A 4ENJA 1KQ0A 4NC7A 4BJ5C 3IL2A 3HUGB 4CGZA 1VF9A 3HG9A 5H2FC 4YFKF 3BOQA 1XDSA 3RTRA 4KMFA 3KDPB 2GA2A 4J01A 1S8NA 2F5DA 3Q5PA 1N73C 4II2A 5HODA 4O5VA 2W57A 3A4CA 3D5RC 1E2XA 2F2EA 4AD9A 1WJEA 4G7ZF 1G4DA 1MJ9A 3FM5A 4WXDA 5IY5H 1YQ4C 2ZVNB 2WY8Q 1YBKA 1RUNA 4I7ZB 5AVQB 1DGWY 2BV6A 2VOOA 9ANTA 2DQRA 5FLXZ 1S29A 1SQQJ 1U57A 4C30A 1X8YA 3TL4X 4MNUA 1HUCA 2BCCJ 1BBYA 4HX4A 1L0LJ 4B86A 1TTYA 2EV0A 1F4KA 1N7SC 4I6MC 2H1KA 2DMQA 1SQXG 1O7FA 2IRFG 2VKVA 3GLLA 1MMNA 1HQCA 4A3CJ 3RL0C 2DMPA 3P9KA 4XOPA 3BZCA 2FX0A 1LWUC 3N4XA 1RR7A 3ABMH 5E8IA 4OGQD 3BCBA 3IAOA 2FY8A 3GW6A 2YXRB 4X1EA 1TBXA 4N78E 2COBA 2PN6A 2K86A 2M8EA 1XPXA 1SQQG 4JBAA 1JTHB 3AE9C 5APSA 2PFXA 3AEEC 2QSGX 1R4NB 1SAUA 1L0LG 2EK5A 1MBHA 3GVAA 2R7SA 2BYVE 4IJAA 3R4KA 4CXFA 2AXLA 3SEZA 4BBSJ 3O6BB 3A01A 1GVDA 4HG2A 3QODA 5AVYB 4M3BA 2JUCA 4M73A 1ZAOA 3WE3A 2H89C 2FD5A 3WTWC 2R44A 4XOTA 4E7LA 1VF5C 3TNUA 3PFIA 3WU2C 1FOKA 1ON2A 1QVUA 4LG0A 4IOAF 2E7WA 2BW3A 5M5WJ 4G7HF 2FUG2 3S2WA 3RZOJ 1G1IA 1OZHA 4I01A 2KYVA 3M9QA 3CX5H 4BE1A 1QEXA 4XE5B 4LLHA 2EFOA 3RK3E 1JUNA 1S6LA 4MIMA 4NQWA 1W0TA 3IHUA 1VQNI 1OX3A 1HDDC 5AVRB 1MMAA 1TNSA 3P32A 3OV8A 1GK4A 4CCLA 4QLCU 3GZ5A 1AU7A 3V2PA 3E1IA 1ORKA 1U7MA 1A6QA 1NU1K 3H6PA 2B7EA 3DFGA 1E17A 1USDA 4HQMA 4LLNA 4OMYA 2R7VA 1EJ9A 2JKVA 2DA1A 1FZEA 3K7AJ 1AOYA 3I4MJ 3ONQA 1PGJA 2HTSA 4XFJA 3BLYA 1EQ7A 4ESFA 4HF2A 1Y9BA 2BXZA 2FEZA 3J81Z 3KEYA 1YG2A 3Q9VA 3S32A 1NTKE 2RDPA 5F0FA 1KB9I 2M8GX 5LEKA 4QMAA 1IN6A 3BCCJ 2FOWA 4QPOA 5B3SH 1AJYA 1T3JA 1OR7A 1L2PA 5KAIH 3CJQB 3V2NA 1JM0A 2EFPA 1P2FA 2OD5A 1T08B 5CQEA 1S2EA 4W80A 2F48A 2QVOA 2WSCJ 4CA0A 1MUUA 3KYQA 4KHXA 2QVAA 2UWJE 2W85A 3WU1B 1A31A 1KONA 1ZW0A 1OPCA 5F6FA 1USTA 1KYWA 3GCMA 1DX7A 4GDOA 2WV0A 5LGNA 2OJED 1MZBA 1NTME 3GZNB 2P67A 1IW7F 5K7ZA 1XGSA 3E6BA 5C44J 1PP9D 2DI3A 1S3JA 2RNJA 2QJPB 5FFZA 2XNDH 1ZARA 2H27A 1RF1C 4UY8I 3CDIA 1IZ1A 1STZA 2O01H 2KLOA 2OYIC 1KV4A 4UB6C 4XLEA 1AV1A 2XRNA 3HSFA 2QWWA 1BL0A 1ZGAA 4I2OA 1S72P 3KETA 1J1DC 5CLSA 4N9IA 3DEEA 2JUGA 1SFOJ 4W7YA 5CCGA 3EFFK 3BR3A 2E1CA 1IRXA 2IGOA 3RKXA 1UIIA 2XPUA 1KYOI 5APTA 1RC9A 5HNFA 2ITAA 4BRYA 1D7MA 1H8AA 1I3AA 1OCZH 5IOYA 2P7VB 4A6DA 4PSXA 1SQPE 3JRAA 3AEAC 5LBQA 2OTLI 1GU4A 2E75B 1KILD 2PX9A 1YTYA 1SQXE 1EDJA 1SFKA 3B5NB 1A35A 2YXQB 3Q1MA 2GAUA 2I8DA 2XKOA 3CX5I 3B71A 1GV2A 3IN6A 3L75J 3D6ZA 5L3EA 1PPJG 1U5TA 2XGEA 3LL7A 5E79H 4ZTFA 1SQXK 4HSRA 3BASA 4XKBA 2PMUA 4D1QA 2Y9ZA 4IQJA 3ZMVA 2RGVA 3ZMUA 1NK3P 4A3LJ 1HW2A 2HQNA 4ABZA 5HDNA 1GL2C 4HF0A 1JTHA 3GBGA 5L8RJ 3ZQFA 1WWXA 1RQUA 3U59A 4HX7A 2QBYB 5CYVA 2V9PA 4GGGA 2DW3A 1MBGA 3I4PA 1FOYA 1SQBE 3KQGA 4PUSA 2M1BA 3KLNA 3FMQA 3KEOA 4WCGA 4BNCA 5ICGA 2E75D 5D8LB 3VODA 4HW0A 3TBIA 3HOTA 1O3RA 2JTVA 2ZAEB 2X1CA 2BXYA 3HL2A 5JVTA 3TNUB 1MJAA 2DT5A 3VWBA 2QGUA 1Z6TA 3UIAA 2CU7A 2X0LA 2ICWG 3CCVI 3QWOC 4LMYA 4CCNA 2E5YA 2EV6A 3H3VK 4IL6X 3W68A 4HNTA 1GXPA 1DUXC 3CCMP 4A5MA 1N8RQ 2NS7A 4PJMA 4HNUA 2WT7B 4MFDA 1JB0J 3WODF 2W82A 3OYBA 3HUSA 5CQGA 4M9SA 4BE0A 4HRIA 3WMM0 3HKZA 3G71P 3L74J 1WJAA 1TLHB 3QWLA 1SLQA 3FM3A 4MGRA 4R79A 1YIJI 3A0BH 1K61A 3G4SP 1YHQP 1MNDA 2VN2A 1RRJA 1VQ5I 1WJ5A 3FXRA 2ZJ2A 3S2DJ 2O61A 1Y8AA 3GUDA 2QE7H 2DFEA 5FKMA 3DV8A 1Z3YA 5ILVA 3AEBC 2CSOA 2KHMA 4PJJA 1BCCE 1SQVG 4H4KC 1P4XA 3CMEI 1SP4A 2ZKZA 3CUOA 3MKWB 1P92A 4AIDA 4EI2A 2IJLA 2R7UA 2HS5A 5E79C 4DZJA 3F22A 3OYKA 2WY7Q 3HUSB 4FASD 2Z3YA 2P6SA 4AWXB 2H88C 4RO0A 2A6EF 1FZCA 3OYCA 2F5VA 3HD7A 2KZIA 2HKOA 1SQBK 3ZQLA 1PL5A 1Q2NA 3NFQA 5J1RA 3FXEA 1ETWA 2XPWA 4CSWA 2K4JA 2IBZE 3RPUD 1XSVA 1O57A 2V7QJ 4ZJZA 1N75A 5GP9A 2BCCE 1SQBJ 3BTCA 3JR9A 1X1DA 1Z67A 4NQWB 1HWTC 2HPCB 2LP0A 3S15J 1S1CX 2BEQD 3VMAA 2ISYA 1Y0NA 1KZHA 1IFMA 3JAMK 3LA2A 2WMMA 3QYFA 3TW6A 3ZMTA 1WRJA 4J19A 2CQQA 3CXHE 1S5LH 4BKXA 4UB8E 4B47A 3QU3A 3SHFA 5HLTA 3CWBD 1JTYA 2ZCWA 1IC8A 3MAJA 2LVSA 2CQNA 4HZFA 4HX8A 1T6AA 3MKYB 3TF5A 1TZLA 1EZVE 1IN8A 1FSEA 3E6MA 5IYDJ 1Z6RA 3FX0A 2X4HA 4DGWB 1OMIA 1Y8RB 2CJJA 1FEXA 2BASA 2RQQA 3C7JA 5J1UA 2ME6A 3U1DA 1L3LA 1L0NJ 2ZFWA 3N4MA 3I53A 3PRJA 2LG4A 4JQFA 2BY2A 2P5VA 4PJNA 4IHVA 3AEGC 3BATA 1ETVA 3PH0A 4MEYF 2C6YA 2L9RA 3T0YA 1LP1A 3MIWA 3Q3DA 3RK3C 3OL3A 5K7FA 4IZZA 1JGSA 1VQ8P 3NEUA 5CBOA 3VYSB 4P55A 3MTUE 2QQ8A 4CZZA 1HVVA 4A5NA 2AEMA 1ZLJA 2HXIA 3WU2E 3GHGB 3P7KA 1ZG1A 3CCUP 5FRMA 3TK1A 4XRMA 2EFQA 3DXJF 1UHWA 1W5CE 2DT7B 4A6EA 3G6EP 2HOTA 4ESJA 3L09A 4IKFA 2DYSH 3F5HA 2G8YA 3WUVA 2QKLB 1D5YA 2FYUJ 3IWZA 2BE5F 1SQPD 5AW2B 2V9KA 4ZYEA 2MABA 5C3EJ 2CYYA 3P9CA 3HE5A 3TGUJ 1U5TC 3L71J 2A68F 2WPQA 2L7MP 2W48A 2DMUA 3L70E 3I59A 4G6DA 2Z9OA 1VQ9P 2LKSA 2ZMEC 4O9BA 1ZOYC 3M7GA 3FGAD 4TT3H 3I54A 5LD2C 3A03A 3EQLF 5E1ZB 1CF7B 1P84D 4MTEA 3VMXA 1AQ5A 4L76A 3RL0g 1KMIZ 5GTIE 1T33A 2O7OA 4WXHA 1LE8A 3F8CA 4C3JJ 4CICA 4GKGA 4AIKA 4HDUA 3K4MA 4RLQA 2W27A 1GVJA 5B1AH 3H9GA 5KAFE 4XORA 4XN3A 4P96A 4C2UA 3KZZA 3M06A 4HB1A 1TT5B 2H6BA 5E17F 2J5PA 1SD6A 3CUQB 3KE2A 4YELA 1MV8A 1UFMA 2YU3A 5HS9A 1H9TA 5KLIC 2LC2A 4UUSA 4BGDA 4RGSA 3U21A 3HOVJ 1SFCB 1URQB 4MTDA 4PGGA 1YITI 2FYZA 3CCRI 4AYCA 3SZGA 3JRFA 3JREA 1NHAA 2DFHA 5LGUA 3F8BA 2BHZA 4AVZA 2KK7A 1KD1Q 2FE3A 2EV5A 1QVGO 2X85A 5F04A 3RIRA 5E3MA 3CMAI 2IEKA 3BZ6A 4EJOA 4M6VA 3EYYA 3CCSI 2E74C 1NG6A 1W5TA 1DD3A 4AVPA 1H89C 3DTIA 1D1CA 2OV7A 3A02A 3KZIE 2CV0A 1S5LE 3CXHH 4JYCA 3M1CA 3CLQA 4ASVA 4BHCA 4DIQA 2Y0CA 1A04A 4XRSG 1MBFA 4IHXA 5K7HA 3WG7H 1PUFB 4XKCA 4RA2A 1KILA 3JRHA 2K7LA 5GAEJ 1Y56A 1P84H 2HDWA 2V7QH 2KNCB 3D0SA 3OR2C 4UUSB 3VOEA 4FHTA 1QVTA 3RPQA 4NDLA 4Y52J 1BSNA 2K9YA 1IV8A 2K1AA 3CD6P 1NU1J 3GTLJ 1UG0A 5APVA 1X4OA 2BOLA 3GWZA 5DDGA 1R9TJ 3DU6A 3MUDC 4Y4RA 3M91A 5TJJA 4HKZH 4RGRA 4P9FA 2K3PA 2Q2EA 1XX5A 1ETKA 3TOBA 1K83J 2ESNA 1FS0E 1XN7A 3MZHA 3DCFA 1JY3P 1SQQK 2L0KA 2C0XA 3L75D 2OF7A 3CQZJ 1XGOA 2HOAA 5AONA 2FYNC 4C46A 1AHDP 3FDYA 1PP9G 2EIMH 1NTCA 1IFPA 5D5XB 2DJIA 1FMWA 1BGYJ 1FE6A 3H1JD 2Z2SB 4OINF 2WB1N 3W2AA 3GTKJ 3BROA 1U9NA 3M0DC 4IOCF 3DPTA 2CQKA 3SQNA 4UB6H 3RBZA 2A5WA 4NPFX 3FMRA 4ZKUA 3BT9A 1FDMA 3KZIC 1E5WA 1VQ7P 2LSOA 3R0AA 5FFXA 2ZB9A 1GMJA 2IX7C 2WITA 5KKZC 1WHUA 1NTKJ 3A7OA 2IVMA 1E3OC 2LRDA 1W5SA 3GFJA 2L5GB 5A2QK 2NRAC 2CFOA 3LIDA 1PP9J 1NJIQ 1LJ2A 1V54H 4JK1X 2X1DA 1V3FA 1R00A 1W36C 5TISE 3E0JB 5C4JJ 1BCCJ 3S2HJ 1A5JA 1LFUP 4DYCA 1R71A 3L70D 1TWHJ 4M6YA 2K40A 2CQXA 3AG3H 1D1AA 4GDFA 3HOUJ 1G59A 1LP1B 1LTBC 1V4RA 1KN7A 3CCEP 3HPGA 5HLGA 4ZDOA 3H1KD 5EFWB 2XGCA 1VTNC 1I50J 3BJ6A 3OYGA 2JEEA 2F4OB 2VIXA 1KQ8A 5ICCA 4OIOF 2JPBA 3KPHA 1P84E 4JF7A 3ABLH 2LREA 5GTIC 5DV5A 3I64A 1HSTA 1RI7A 3F8NA 4XKWA 1XMAA 3TDZC 5KLIB 1VNDA 1Y39A 1IN7A 3FXMA 3H1IE 2AS5F 2MGQA 3K4JA 3O6QA 3AE7C 4XN0A 2DFIA 4RAFA 4U0WA 1M1KQ 2NS0A 2RN0A 1USEA 2CS3A 1QL1A 2J59M 2HZDA 2DFFA 2YPRA 4MQ9F 4W1UA 3IKTA 4I2LC 1PP7U 2D45A 1JJ6C 1JUSA 1R1VA 3I5UA 1Z9CA 1AKHB 2ID6A 2LKPA 1S9KE 5HDGA 2VASA 3N97A 1L4AD 4EGYA 3PFYA 5B5EE 2PP6A 1W5CC 3ABKH 2O5RA 5AIPA 4AUXA 3ZPLA 2TDXA 1F5TA 4G7OF 2NPSB 3MZYA 3S17J 3OWTA 1NTKG 1GK6A 3I3LA 1ONVA 3L74E 4XL9A 4A3GJ 2XAQA 3AE1C 1MH3A 3RK3D 1YO5C 4CYCB 2PMZN 3E6DA 3CCQP 5ICEA 4EJUA 3WE2A 3L72J 4IHSA 3H1LE 4RDUA 1WI3A 4LK0F 4U3FE 3Q0VA 2JSPA 3MN2A 2K9LA 1DPUA 1R5HA 1FIAA 5B66C 2V6EA 4WB4A 3VYIA 3OSFA 3BCCG 4K2EA 2KRFA 1LPQA 1QLED 3H1IJ 1X1AA 2HU9A 1LTTC 2QENA 5C4XJ 4EV0A 2PG4A 3F72A 3JTHA 3CWBG 1VL2A 3PM1A 2O1KA 2K27A 3T1BA 1R6RA 1L0OC 4PK4A 5D4RA 1SD4A 3WHCA 5FLVA 3BG7A 3ZN1A 3MWMA 3GTJJ 1G8XA 2YKQA 1B9MA 1X79B 3BR6A 1D1BA 2OAZA 3KP4A 1L4AA 1EXIA 2ZXJA 3V4GA 1YYCA 3OIQA 1BE3G 4BJ6C 3SZPA 1SQQE 1OCOH 1CSBA 3PJSK 2YX7A 2R92J 1QL2A 3L73J 2X51A 5FO5A 3QU6A 1FBMA 3GF2A 1JE8A 1AA0A 3L36A 2ZJPF 3CC2P 4BWNA 5AW6B 1I1SA 1QVFO 4BQAA 3IAM2 3WTTC 2HXOA 4H0LC 1OIPA 2L54A 3OAKA 4KIGA 1EDKA 2F5EA 2YUSA 3P8MC 2KJCA 2W1OA 2L7KA 1ZRDA 4OIPF 2QJKC 5AVTB 2FRHA 1XDUA 2FBHA 1KU9A 4Y33A 4PZJA 5FGMA 3G3ZA 4OIQF 2RMZA 3S4RA 1B9NA 1UJ8A 2FFDA 3DTKA 1GV5A 1YYVA 1IF1A 2O9LA 2ZT9D 3OW2O 3E97A 1K7AA 2JRTA 4A0YA 1IZNB 1JMBA 2KMUA 2X1EA 2Z5UA 3AL0B 3RK2B 4YXDC 4XLAA 3X2QH 1BE3J 3CCQI 3BY6A 3L37A 2XUBA 1IC2A 3OSGA 4CZCA 1R5SA 5EDNA 1B6AA 5CCHD 2JMWA 3RSNA 1QGKB 4BUPA 3GHGA 2E2HJ 2XHKA 4PJLA 5KAFC 1YITP 1EDLA 2VUMJ 3VOPA 2FYNB 3IKVA 4IO9F 3LA3A 4PGHA 2LBFB 1VQMP 2M2EA 2N9YB 2NPSD 3CCVP 3WTXC 1BR2A 2ZJRF 2R5ZB 1SVFA 4HV6A 2RC4A 3ABUA 3LNQA 1Y1WJ 1PUFA 3K1PA 4BEHB 3IV5A 5EGOA 3FXOA 1LWUB 2N1TD 3OA7A 4PV1B 4NUBA 3LW5H 3HXLA 2A05A 2MJZA 3PNTA 3HD7B 3A2KA 2MC4A 2XPVA 1SQXD 2FBKA 5L3FA 3MD2A 5EZGA 4A3IJ 3H1KE 3FK7A 1M90Q 1N2DC 3FWLA 4OOIA 1SD7A 4ITVA 1Z91A 4YIFA 1FNNA 4WX9A 1JJ8C 4A3DJ 2BY1A 1U78A 4AM3A 1VZ0A 3K9TA 2EA4A 1VQ9I 3BP8A 3CMAP 5K5OA 3S3MA 3JCUE 3JCUC 3JRDA 1FZFA 1KYOH 2YKPA 3H1HG 4XNFA 2LFBA 3F21A 4IEJA 3H5AA 3ASOH 3ML6A 5D5WB 2L9SA 1J9IA 3F0CA 5L3DA 3B6AA 2O8KA 5JVGF 2VOPA 2HYGD 1HBXG 1CQTA 2YNYA 3ZGKA 1SVMA 3CO7C 3CP8A 5AVXB 2WSSH 1FU1A 4BQNA 2YU9J 5JR3A 2XC7A 4TV7A 4A3EJ 1IFJA 1SQVJ 2ZYAA 4YPCA 1UG2A 3C2GA 2EZKA 1S72I 1RQVA 3CJTB 2WSEJ 4QTRA 2HVRA 3HD7D 2EA2A 4XRFA 2X9DA 3A0BE 3V4QA 4M6XA 2FQ3A 3KIOA 3KZIH 3GX4X 4HPQA 2Y69H 3RPUA 3E3VA 5EZHA 4ENMA 3RKQA 2M8RA 2RH0A 5CMZA 2PJRA 1Z7UA 5DM6F 3QPLA 4C2TA 1TWFJ 3REOA 2AQFA 5LRRA 2A61A 2WBMA 4N0BA 1AA7A 4RB3C 4LG0B 2PJPA 2ZO4A 3S1MJ 1MSFC 3B5NA 1KFMA 1KC8Q 3LSRA 3FZVA 4Q47A 5DJTB 4IFDK 2D1VA 4JYKA 3II6A 3N7NA 4BBRJ 3A3YB 2LDUA 3K1NA 1V5GA 4UVCA 3A01B 4U3FD 1YJNP 2HQRA 2E19A 4BXLA 1R8EA 2DOEA 3VB2A 2MD5A 2FBIA 5E3OA 1B8IB 3PQJA 1ZQ3P 5LLQA 2WQYC 4Y17A 3HGYA 3W2WA 3R61A 1VQ4P 4CUGA 2PAJA 3CC2I 4QPQA 3HTKB 3Q5RA 3UKGA 3SSUA 3JCUH 2DW4A 2RKLA 5LGTA 3MD0A 4IXAA 4HV5A 1IK9A 2IZ1A 3LSKA 5CJ9A 4BYYA 3MCZA 3L70J 1FYMA 1WH5A 2H7HA 1IN5A 3QOPA 4WF2A 2LTPA 4L9JA 3SFIA 2UUZA 5LHHA 3GLMA 5CJ0A 5E79E 2IGNA 2LYCA 2POHA 1JHFA 1T2KC 1YI2I 4AU7A 3L35A 3LIEA 3MUDA 2K9QA 2JSCA 1XCVA 3DP7A 4A3KJ 2VODA 3R2PA 4NHJA 1H9GA 2XVCA 3K0LA 4B44A 2DMTA 1DP7P 4M3EA 3AL0C 1LFPA 5BMZA 3S1NJ 4F3QA 1S5LX 1T8ZA 2WA0A 4M74A 2AEJA 4L9TA 2HDDA 3ECHA 1NTZJ 5K5RA 4X0GA 2DXIA 1HLVA 2PGDA 4ZKPA 5KJ7C 1H88C 2Q8KA 3B8EB 1FT9A 3OS1A 5BOXA 3L2CA 2QA4P 3KZYA 3FBIB 3GMEA 3DLAA 4GIFA 2GOMA 4D6TJ 1PP9E 1LDDA 4FTHA 2E5TA 2DOAA 4CHUA 1N7LA 1ULYA 5F1JA 4EDFA 3BRTB 4KITB 3ESWB 1HW5A 3HPHA 3FIWA 4W97A 5F0CA 1RHZB 2DA3A 4XQFA 2PBIA 3LSJA 3T97B 2ID3A 1ZKGA 3FISA 2IP2A 3G1LA 4I09A 2YO3A 5DS9A 3DTEA 3VSLA 1HKSA 2FKWB 2ZMEB 3HTSB 2HDCA 3SYTA 1FSHA 1Y47A 1SVLA 1KB9D 1XMKA 5B5EC 4A69C 3K4KA 2XAHA 4KIBA 2G7UA 2COMA 1KTMA 3I55P 1QU3A 1RZ4A 1JUPA 2E1NA 5KNLA 3MFKA 2QSHX 3QPSA 2KFDA 2QJKB 4IX7A 1RESA 3TP3A 4JBZA 3J7YJ
chains in the Genus database with same CATH topology
1LVKA 4OAYA 3L2QA 2WAEA 3MKYB 1TZLA 1N77A 2VKDA 3S8PA 2LH9A 4DGWB 3EPZA 3EUAA 4CCMA 2RQQA 2BVLA 2CW7A 2R7XA 1ZXGA 2VLAA 2LG4A 4JQFA 4PJNA 4F92B 3PH0A 1N78A 3DU5A 4AYBA 2OTKE 2BVMA 1LP1A 3CP2A 2OC6A 1WJFA 3VYUB 3L2RA 3OL3A 4IZZA 3SDBA 2M7AA 3VYSB 2M7BA 1EA3A 4B48A 3DKYA 2ZSIB 1W36D 4ZDLA 3S3NA 3UR3C 2DT6A 5FRMA 4F93B 4N4NB 2KZJA 3QYBA 3KX2A 2DT7B 3LSHA 3FKJA 2MFZA 4CCKA 2Q1ZB 1K6YA 4IKFA 2Q1KA 1SS1A 2CV2A 2QKLB 1LKXA 4HJGH 2V9KA 2MABA 3VDXA 1NG7A 3OR1C 2IXSA 4NPEA 2KI7B 2QRXA 2LY2A 1EC5A 4NPDA 4E7ZA 2AQEA 2F4IA 2LBFA 5LD2C 3FXDA 1T95A 4MN4C 1BR4A 3VYRB 3IUOA 3H5RA 2A6TA 3L2WA 3S93A 1S9HA 3DWLE 3K4MA 2P0WA 4RLQA 2VJ4A 2M3AA 1OVVA 4YEJA 3L2VA 3H9GA 2RNGA 4XN3A 4XORA 1D0YA 4C2UA 1PJRA 2KDOA 4HB1A 3OYAA 2V4JC 2CH0A 3S1KA 1MFTA 2X6YA 4YELA 4NNJA 2KRCA 5C39A 1YX5A 2E1MB 2E5NA 3ZQQA 3PUBA 4HSTA 2LC2A 4ZTJA 4E4HA 3K4CA 2VL8A 3U21A 4BGDA 4GODA 3RQ4A 3SZGA 3CMMA 2VJJA 4E7JA 4E7SA 2IS2A 4G6TB 3S3OA 4AVZA 2K9MA 3K70D 2X85A 2Q2EB 3ZXSA 1NG6A 3UNGC 4ZNCA 3DTIA 1D1CA 2OV7A 4XONA 4BS9A 2Z1DA 2GOXB 2CV0A 3OYJA 4JOMA 4U7BA 4ANJA 3OS2A 3M1CA 2W7NA 4ASVA 4DIQA 4GOFA 3K70C 3ZRGA 3PJRA 3OYDA 3N05A 1MMDA 2ZFUA 4XKCA 2VQHA 2M0MA 1Y56A 2V1NA 2HDWA 2XDVA 3H9QA 4LG3A 1DP3A 3OR2C 4XLHA 3RGUA 1Y6IA 2XSJC 3MMYB 4F55A 1UG0A 1X4OA 2BOLA 3OYIA 1UELB 4XR6A 5HOOA 3DU6A 3DKXA 3F9KA 4BACA 4Y4RA 4BQOA 2LXBA 2K3PA 2ZXIA 3K4BA 4KJMA 2HVSA 5FRNA 3CESA 4WWIA 1TT0A 3FHNA 4ZMDA 4ZYAA 5KHDA 2R7OA 3FDYA 2L9NA 2MYSA 4U87A 4BU2A 3NWSA 4B43A 2DJIA 1FMWA 3EUHC 3G2BA 2Z2SB 4BDZA 2K5CA 3W2AA 4B3XA 3CZ6A 4ZC3A 3DPTA 3HOSA 2R7TA 2LR2A 2A5WA 4NPFX 2VXDA 1HA8A 2VJ5A 1DQUA 3PL8A 2PJRB 1X1BA 3OIPA 4LITA 2LRDA 4XMYA 5KCMA 2W00A 2CFOA 3PSFA 4BJTA 3RCOA 2X1DA 5FROA 3J7AY 1H0TB 1W36C 1WFXA 1WJDA 2X6XA 3K4NA 3E0JB 3PSIA 2VQCA 2M4KA 1MMGA 3MHVA 3BG6A 3DPUA 1D1AA 1LP1B 4LIVA 3W3CA 1G59A 4K3AA 3HPGA 2OUMA 4ZDOA 2IGMA 5EFWB 4IQ4A 2M5AA 1DGRM 3OYGA 4XLFA 2V26A 1EDIA 2VIXA 5LFAA 1MW7A 4J00A 3IP4B 3K4LA 2M0BA 2XF5A 1P9QC 2QKMB 2X6WA 2M4GA 2LREA 4DBRA 2L5QA 3CF2A 4XKWA 1ZELA 3OL4A 2P58A 1H0TA 3D5SC 1D0XA 3K4JA 3QYEA 2B87B 2WAFA 4Y3OA 4F52A 1OVRA 4XN0A 2R7RA 1ERDA 2CS3A 4FETA 4MLOA 3H35A 3ZCOA 2HZDA 4BXFA 4D9JA 4PFOA 2UWMA 2B87A 3OS0A 2LXCB 4NC7A 4BJ5C 4N4OB 3HUGB 4KT6A 3HG9A 3RTRA 2VQLA 3OMYA 4GRIA 4J01A 2VASA 4II2A 2HPIA 4DJAA 1X4PA 3PFYA 3OY9A 3A4CA 3D5RC 2O5RA 1WJEA 4LIUA 3SEQA 3W2VA 3OWTA 2WY8Q 2JA2A 3I3LA 1DGWY 1BR1A 4XL9A 1Z3XA 4C30A 1WJCA 3TL4X 2HQAA 1QHHD 2B89A 2E5ZA 3K6GA 3OOUA 5JHFA 2DCEA 5CBNA 2VB6A 2JSPA 4PFPA 2K9LA 1FMVA 1MMNA 2WADA 2V6EA 3QOEA 4CH7A 2B88A 4XOPA 1X1AA 2HU9A 5HNHA 3BCBA 3D5LA 3A1YA 3HC7A 4BL0B 1R6RA 4PK4A 2PMZA 3BG7A 1G8XA 1D1BA 1SAUA 2ZSHB 5TGTA 3OIQA 4IOIH 4BJ6C 2R7SA 2JVGA 4P5OA 3SEZA 4CCOA 2X51A 4XM3A 4HG2A 3QODA 3MKZA 2R44A 2KZVA 4XOTA 4E7LA 1X19A 3IAM2 2XF6A 3NWTA 2KP6A 2IS1A 3DQVC 3PNVA 2BW3A 1GLNA 2FUG2 1EDKA 2IGKA 3LMMA 2XAUA 1Z21A 2W1OA 2L7KA 2ELJA 4BE1A 1DEEG 1YE9A 3OYLA 4Y33A 4DOZA 4KISA 1MMAA 2KPMA 3ZR8X 3DTKA 4CCLA 2E60A 1U7MA 1OVUA 4YRVA 4XLCA 1JMBA 2KMUA 2X1EA 3BCAA 2NOJB 3AL0B 1Z7LA 5CBOA 4XLAA 4RM2A 2R7VA 3FBNB 4HEA2 4CZCA 2BW3B 2VQGA 3RSNA 3ONQA 4BUPA 1EDLA 4PJLA 3BLYA 1J09A 2SPZA 3KEYA 2LBFB 2WB1A 3S32A 3LFUA 2RREA 4QPOA 1BR2A 2CUJA 3CJQB 1JM0A 4BEHB 3C2HA 2LOOA 3KYLA 4ASWA 5CQEA 4CCJA 4NUBA 3HXLA 3PNTA 1LDKB 4CA0A 3A2KA 2KRHA 2MC4A 2QVAA 2UWJE 4II3A 1E0EA 2M5AB 4C9YA 3AKZA 1KONA 3MD2A 3V42A 1ZW0A 2VXZA 1BDCA 5HVQC 4ITVA 4RLFA 1JI8A 1BOBA 1VZ0A 2CV1A 1FC2C 3S3MA 3BC8A 1LT1A 2CW8A 4XNFA 1S3JA 3H5AA 2KQRA 3MZWB 2L9SA 2KLOA 1YX3A 4XLEA 2Y0SA 4K35A 3LSMA 1U7JA 4ZDPA 2R7WA 3M8JA 3ZGKA 3DEEA 2JUGA 4KJZA 3CP8A 1IRXA 4GOEA 4BQNA 2IGOA 2XC7A 5HNFA 3C2GA 2KUBA 4PSXA 2HVRA 1EDJA 3LSIA 4HKZH 1SFKA 4HPQA 1WJBA 2R4GA 3PNYA 2I8DA 2V7FA 2PJRA 4C2TA 3LL7A 2AQFA 4ZTFA 1BDDA 2WBMA 4HSRA 1AA7A 4XKBA 4D1QA 4IQJA 3H0DA 4E7HA 4NC8A 5DJTB 3OYHA 4EYYQ 3GBGA 1U0JA 1V5GA 3OYFA 5CKTA 4PUSA 2R7QA 2WAQA 3IAS2 3OYNA 1UAAA 4BXLA 1OLTA 2L2OA 3K10A 4PSWA 2F6CA 3TBIA 2MD0A 3HOTA 2IS6A 2ZAEB 2X1CA 3DPLC 3W2WA 4E6KG 3HL2A 1MNEA 3CJRB 4CUGA 3VWBA 2JWDA 2Z16A 4QPQA 3AFHA 3QWOC 4CCNA 2RKLA 4HNTA 3TMOA 2KL4A 3LSKA 1V5FA 2HPMA 2XF7A 4PJMA 4HNUA 1V5EA 5DJUB 2W82A 3OYBA 2UUZA 5CQGA 4BE0A 4HRIA 1X0TA 1X1CA 3HKZA 2K3RA 2IGNA 2KIKA 2LYCA 4RMNA 1WJAA 4AU7A 5K5GB 1NVOA 4R79A 1QHGA 1MNDA 1T0FC 1WJ5A 4B44A 3AL0C 1LFPA 4BQQA 4F3QA 1Z3YA 2WA0A 3H9JA 2HR3A 2HNHA 2KHMA 2VKHA 4PJJA 4X0GA 2DXIA 4H4KC 2W4SA 2LY1A 2E1MC 2VJIA 4OAZA 3OS1A 3MKWB 2VPLA 4BE2A 3FBIB 3DLAA 2GOMA 2R7UA 2CUZA 2CMPA 2DOAA 3OYKA 2WY7Q 4E7KA 4FASD 5CPRB 4BEHA 4KITB 3I9V2 3ZDMA 4XKVA 2F5VA 3OYCA 3HPHA 2KZIA 1Q2NA 2UV1A 3FXEA 4EATA 3E1SA 4CSWA 4XQFA 4BDYA 3RPUD 3H5NA 4ZJZA 1N75A 3LSGA 3DTEA 3VSLA 1X1DA 3SYTA 4NQWB 3OYEA 1Y47A 4RM3A 4DBQA 2IS4A 1OR7C 3OYMA 2JVHA 3L2UA 3K4KA 1D0ZA 4E7IA 2WMMA 2KS1B 3QYFA 2ZXHA 3VYTB 2HVQA 1QU3A 5KNLA 4CPGA 4OWRB 3VSKA 4P1WA 4B47A 3EUKL 1PYVA 5HLTA 4IX7A 4F91B 4JBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B89 A;  3RGU A;  4GOE A;  5CBN A;  1ZXG A;  2KUB A;  3PH0 A;  2B88 A;  2OTK E;  1EDJ A;  1LP1 A;  2OC6 A;  4HKZ H;  2LXB A;  2I8D A;  4KJM A;  1BDD A;  4WWI A;  5DJT B;  4EYY Q;  4ZMD A;  4IOI H;  2KZJ A;  4BXL A;  2Q1K A;  1SS1 A;  2ZAE B;  2R44 A;  2LR2 A;  4HJG H;  4NPF X;  2JWD A;  1EDK A;  4NPE A;  2KI7 B;  2QRX A;  1EC5 A;  1DEE G;  4NPD A;  3QWO C;  2RKL A;  2KL4 A;  3FXD A;  4MN4 C;  5DJU B;  1H0T B;  1U7M A;  1OVU A;  2KIK A;  1X0T A;  1JMB A;  2K3R A;  5CBO A;  1OVV A;  3MHV A;  5K5G B;  1NVO A;  1LP1 B;  4K3A A;  4HB1 A;  3S1K A;  1MFT A;  2HR3 A;  5EFW B;  1EDL A;  5C39 A;  2M5A A;  2SPZ A;  1EDI A;  4GOD A;  2M0B A;  1JM0 A;  1H0T A;  2P58 A;  4ASW A;  3ZDM A;  2B87 B;  1OVR A;  2KZI A;  1Q2N A;  3FXE A;  2QVA A;  2UWJ E;  2M5A B;  4ZNC A;  2LXC B;  2B87 A;  1ZW0 A;  1BDC A;  4ASV A;  1Y47 A;  1FC2 C;  4GOF A;  1LT1 A;  2WMM A;  2KS1 B;  1S3J A;  4CPG A;  3MZW B;  4K35 A;  1U7J A;  4JBZ A; 
#chains in the Genus database with same CATH topology
 1LVK A;  3HJE A;  4OAY A;  4GO1 A;  3SDG A;  1ZRE A;  2WAE A;  1N77 A;  3VN0 A;  3RL0 D;  3V8K A;  4P9U A;  4FE7 A;  1X3W B;  3EPZ A;  1UHS A;  2W84 A;  3EUA A;  3D1N I;  5ERI A;  2OYH A;  1OCP A;  2BVL A;  2DJN A;  2K9S A;  2MH9 A;  1APL C;  1ZXG A;  4EEF G;  2R5Y B;  2WV1 A;  4F92 B;  2CK3 H;  2CQ7 A;  3GO5 A;  3DU5 A;  1JT6 A;  5KK1 A;  1G3T A;  2OTK E;  3V2Q A;  2BVM A;  4V19 K;  2D2C D;  3CP2 A;  3VP8 A;  2ADU A;  2QQB A;  5F08 A;  4FIS A;  3WTU C;  3JRB A;  1R5G A;  4M3G A;  3SDB A;  4L18 B;  3HRN A;  4PV1 D;  3H1L J;  2OGU A;  2VC1 A;  2QJY C;  3BVH A;  4M3D A;  2LF8 A;  4ZDL A;  5GPC A;  3UR3 C;  2DT6 A;  3J80 Z;  5KAF H;  1X58 A;  1NTZ E;  4NBQ A;  3AEC C;  3NXS A;  2C0W A;  2OCC H;  5GAH J;  3BR2 A;  1K6Y A;  3HGG A;  4X6A J;  2Q1K A;  1SS1 A;  5FD5 A;  3ROU A;  2NRG A;  5EGO B;  4AC0 A;  4HJG H;  5IPA A;  3AE6 C;  4LB6 B;  1M7L A;  3M8F A;  3H1L G;  1XTG B;  2KI7 B;  2QRX A;  2R0Q C;  3C1L A;  4NPE A;  3GW2 A;  4E7Z A;  1T56 A;  2AQE A;  4RAZ A;  2VC0 A;  2LBF A;  4D5F A;  1XTA A;  2R5D A;  2YMK A;  2DA7 A;  2IDB A;  1T95 A;  3DKW A;  1MFZ A;  2Q3I A;  4MN4 C;  1OKR A;  2DQL A;  2MLG A;  3SWY A;  3FWN A;  3IUO A;  2H8R A;  3IRR A;  1YHQ I;  4U88 A;  3KCC A;  4O6J A;  3C2B A;  1JGG A;  1S9H A;  4RBO A;  1NU1 G;  2L7Z A;  2P0W A;  2M3A A;  1OVV A;  1FP1 D;  3V8L A;  4YEJ A;  1WRG A;  2HQ5 A;  3CC7 I;  3EWK A;  3K5B A;  3M9A A;  2A45 H;  2Q9I A;  3L2V A;  1Q1V A;  2QM8 A;  2EJR A;  3P7N A;  2N1T A;  1ITY A;  3OYA A;  3HE5 B;  2CH0 A;  2CRG A;  4U0Y A;  3B4S A;  1F1Z A;  2X6Y A;  6PAX A;  2FXA A;  2RQP A;  3TO9 A;  3HE4 B;  2FSW A;  2G3A A;  3LST A;  5APQ A;  1TWC J;  4E4H A;  3K4C A;  3W6K B;  2FYU D;  4DNC A;  4M3F A;  4GOD A;  2OYI A;  3RQ4 A;  3B6C A;  3CMM A;  3SXY A;  3CXH I;  1IJD B;  3AG1 H;  4KA4 A;  2JA5 J;  3S3O A;  1EZV G;  2YS9 A;  2YR2 A;  2QLZ A;  2K9M A;  2P7C B;  4GYI A;  1PVE A;  5B5E H;  1BI1 A;  5IT3 A;  3P8C E;  1GXQ A;  3QH9 A;  4XON A;  2VBY A;  5EG0 B;  2OYO A;  4EM2 A;  5H2F H;  3WU0 A;  2EIJ H;  1HKT A;  3MP7 B;  2HGC A;  3OYJ A;  3HOZ J;  1PGQ A;  1EH6 A;  1D5V A;  5CVJ A;  1J0R A;  4IVN A;  2NAZ A;  2W90 A;  3TW7 A;  2JJL A;  1HW1 A;  4IL6 C;  2OTJ I;  1EZV D;  3WHB A;  1Z0X A;  1JY3 N;  3PJR A;  1PGO A;  3OYD A;  1NTM D;  4YG2 F;  2QJP C;  2LY9 A;  2GXA A;  3RK3 B;  5B66 H;  1LFB A;  2VQH A;  1U6G A;  5TJH A;  2M0M A;  2ZXX A;  2V1N A;  2PFB A;  3C9I A;  1ZH5 A;  3GTM J;  2G9W A;  3CWB J;  2BBY A;  4LG3 A;  5J1Y A;  4CYC A;  5KVR A;  1DIP A;  4C3H J;  1XG1 A;  1Y6I A;  4EVI A;  1L4A B;  2XSJ C;  1SQP G;  5APY A;  1FZB A;  1ZGJ A;  3HHH A;  4QIW N;  4XIC A;  2LF7 A;  1TP4 A;  3DKX A;  5HOO A;  2KT0 A;  1OXZ A;  3I56 I;  1XMX A;  2KZG A;  4U0V A;  3B5N C;  4HLX A;  4LGD E;  2L02 A;  4IHW A;  4BXU A;  3RI4 A;  2QEX I;  3HTK A;  1Q82 Q;  3KP3 A;  4BH9 A;  2P6T A;  2N9B A;  3U1C A;  3LQQ A;  3H1H D;  1G6N A;  4LGW A;  5A2Q Z;  3HKZ N;  2ZNZ A;  2EBI A;  2Y0S N;  5LRS A;  4AYB N;  1O3S A;  4ZMD A;  3I0T A;  3NTN A;  1FTZ A;  5KHD A;  2YKO A;  3HBL A;  5M5Y J;  3H25 A;  4G6Q A;  1KQG B;  2W25 A;  3CLO A;  4U7J A;  1JO5 A;  2R32 A;  5H6Q A;  1WPK A;  4BU2 A;  3NWS A;  2JR8 A;  3JRI A;  3WUT A;  1QQI A;  3HRS A;  3G2B A;  2IW5 A;  2JN6 A;  3V6I A;  2K5C A;  1A02 J;  2JWT A;  1YQ3 C;  2JQ7 A;  2LR2 A;  2IA2 A;  2JZY A;  1TWG J;  4PD4 I;  2VXD A;  2M3E A;  2CO5 A;  1OQY A;  2HTJ A;  1F43 A;  4C7N B;  3G73 A;  2GM4 A;  3I5C A;  1DQU A;  1EH8 A;  1SVO A;  3PL8 A;  2PJR B;  3OIP A;  3G6E I;  2Y2Z A;  3PSF A;  2D1H A;  5KLV G;  3H1I G;  5D5V B;  2AXC A;  4JYB A;  2XGD A;  1IUF A;  1BW6 A;  3RL0 B;  2NNN A;  4F7Z A;  1H0T B;  5KTB A;  3CCJ I;  1SFC A;  1URQ A;  3BR5 A;  1FDI A;  4DT0 A;  2DA5 A;  2M4K A;  2V6C A;  2WAQ N;  3BG9 A;  4I7H A;  3MKL A;  4D7N A;  2CG4 A;  1G3S A;  4DYR A;  4RGX A;  1PPJ E;  4UNO A;  3L73 E;  2ECC A;  2EZI A;  2IGM A;  4OU0 A;  1D8J A;  1MMS A;  2JP3 A;  3M0A A;  2NZ2 A;  5E20 A;  2M5A A;  2FFD C;  2WSF H;  3ULQ B;  1H89 A;  1EDI A;  4KFC A;  1GUU A;  1ZN2 A;  5D6E A;  3J7A O;  1R49 A;  4OH8 B;  3ZP5 A;  2E76 C;  2MBF A;  2XIG A;  3SFE C;  2XF5 A;  1X3Z B;  2X6W A;  1VPC A;  1Z1D A;  4OMZ A;  3CCM I;  3H1L D;  2L5Q A;  1I1G A;  2DN0 A;  2P58 A;  4XID A;  4A0Z A;  3F89 A;  3HOX J;  2KKO A;  5KLV J;  2DU9 A;  1USS A;  5KLV E;  1ZRT E;  4FQG A;  1F9N A;  2R7R A;  1RF0 C;  4WY4 A;  2NVY J;  2QJY B;  1KYZ A;  4RB2 C;  4BXF A;  3HYI A;  5JI6 A;  1VDF A;  1AKH A;  4PFO A;  4ZYG A;  1QBJ A;  2B87 A;  3Q2Y A;  4N4O B;  4UUT A;  1LNQ A;  4KT6 A;  2H09 A;  3U1K A;  1YJW I;  3WGH A;  5E1X A;  3GFM A;  1QPI A;  1OFC X;  3GFL A;  4GCV A;  2HPI A;  2ZXW H;  1X4P A;  3OJA B;  2PMH A;  2B63 J;  1XD7 A;  4LIU A;  1O3Q A;  2QM7 A;  1EXJ A;  3COA C;  1ACI A;  1MD0 A;  2QIW A;  3O8G A;  5KAI C;  5J4Y A;  1I3Q J;  1KFN A;  2HQA A;  3ABV C;  2R7Z J;  3GTP J;  2B89 A;  3G71 I;  3P8C D;  1FBS A;  3GMA A;  5EF6 A;  3OOU A;  5CBN A;  2DCE A;  1JCC A;  2HOD B;  1VQ6 I;  3HE4 A;  1W2E A;  4PFP A;  2DLL A;  3LAP A;  1FMV A;  1FY7 A;  2WAD A;  3GLX A;  4CH7 A;  2B88 A;  2GQQ A;  1Q86 Q;  1BI0 A;  1Y8Q B;  2E35 A;  3F6O A;  5HNH A;  1KQF B;  3FXU A;  3M0D A;  2OYI B;  1X9V A;  2RN7 A;  3VPR A;  3D5L A;  1ZR2 A;  4Y28 J;  3HC7 A;  1ETO A;  1S9K D;  1BGY E;  4D0P A;  3O2P E;  3PQK A;  4RS8 A;  3PIO F;  3CUQ A;  4LLL A;  1X1P A;  4KN7 X;  5DCM B;  2XRO A;  4L5I A;  3CMY A;  5TGT A;  2BEZ F;  3H32 A;  1G3W A;  4IL6 H;  4IOI H;  3IH3 A;  3H1H J;  5AVV B;  1J1E B;  4P5O A;  3V2R A;  1REP C;  1NYH A;  4IFF A;  4D7M A;  4CCO A;  3HRU A;  3CXH D;  3MKZ A;  1ETY A;  1S7E A;  2NS8 A;  5F0H A;  2VON A;  4XSZ F;  2FBW C;  3QQA A;  2KZV A;  5AW9 B;  1X19 A;  4ZH4 F;  2XF6 A;  1IRZ A;  3RYR A;  1A02 F;  3VP9 A;  2IS1 A;  1SFE A;  3PNV A;  2E75 C;  2WTY A;  3H92 A;  3NAR A;  2X48 A;  3KP2 A;  2ESH A;  4NB5 A;  2ELJ A;  1NTK K;  1YE9 A;  1GD2 E;  3OYL A;  4DOZ A;  2K9J A;  1I27 A;  3J81 K;  3AED C;  3LWF A;  4Z2Y A;  3A5T A;  2JWA A;  1KU7 A;  2KPM A;  3ZR8 X;  4HOB A;  3KHU A;  1P7I A;  2J5O A;  1BJA A;  2E60 A;  1BE3 D;  2I1K A;  3NAU A;  1NOH A;  5EJC A;  3ZMS A;  2OYH C;  1FX7 A;  1OVU A;  3S16 J;  3R4Y A;  5CVU A;  3TSI A;  4KNY A;  5FD6 A;  1Z7L A;  4D6T G;  2QYO A;  1V55 H;  1CI6 B;  1HH0 A;  1HKQ A;  2ECB A;  5HLH A;  3B5N D;  4I98 B;  4CO8 A;  1KIL C;  2MW8 A;  2P10 A;  2NPS C;  2IA0 A;  2LKX A;  1OIS A;  3FBN B;  4KMU X;  4HEA 2;  2BW3 B;  3T8R A;  1BSH A;  3P9I A;  3K2A A;  1HBW A;  3CL3 D;  4DZP A;  5EEG A;  3J7Z I;  1J09 A;  5GPA A;  2BZT A;  1IDZ A;  1RE3 A;  2CFX A;  1J75 A;  1VI0 A;  2MC3 A;  4C3I J;  4Q48 A;  2VE9 A;  1NAY A;  2EZH A;  3GZ6 A;  2VE8 A;  3ZQH A;  3RZD J;  3KYL A;  3ZQC A;  1IV6 A;  4LK1 F;  4CCJ A;  3JW4 A;  1W7P A;  5DYM A;  1KU2 A;  3KXD A;  4HBL A;  2MKV A;  4WVZ A;  1LDK B;  3WTV C;  1JUM A;  2ELH A;  1YJN I;  1E0E A;  4WY4 B;  1YQA A;  1S7A A;  2LD5 A;  3AKZ A;  2HZT A;  1MIJ A;  3L70 G;  1OW7 A;  2ZXE B;  2MLK A;  2VXZ A;  4UB8 C;  2OU2 A;  4BY7 J;  2FU4 A;  5HS8 A;  4UB6 E;  5AW1 B;  1BDC A;  1ZHF A;  5HVQ C;  4KDP A;  4EJV A;  4LB5 A;  1BOB A;  1ZRT D;  2CV1 A;  1FC2 C;  2OAR A;  3BC8 A;  1RKW A;  2FXM A;  1LJ9 A;  2CW8 A;  4Y99 B;  1ZYR F;  2GIV A;  1OWA A;  1FJL A;  2KQR A;  4L0Y B;  2D5V A;  2EQR A;  1LQ1 A;  1YX3 A;  3CC4 P;  5E1W A;  5J3L A;  4HNV A;  4WY4 C;  3ISP A;  2Y0S A;  4KT5 C;  1UIX A;  1SQQ D;  2X6O A;  1R36 A;  1OYI A;  4KJZ A;  1J5Y A;  2ZBK A;  3TDU C;  2ZYD A;  1G1J A;  1R1U A;  1LTS C;  4GOE A;  1WKM A;  5EYR A;  1YJ9 I;  1J7K A;  1IO4 A;  3WGG A;  2PRR A;  4QSH A;  2NVU B;  1W7P D;  1C0W A;  4RGU A;  2VT2 A;  4A93 J;  1SQX J;  2KLV A;  4I6Z A;  2W24 A;  5AW4 B;  1WJB A;  3PNY A;  4G8X A;  4KN4 X;  2Q6Q A;  1GW3 A;  3GTQ J;  3RBX A;  4EIJ A;  3TP0 A;  2DK8 A;  3HDD A;  5M3F J;  3Q0W A;  2WSF J;  2ACJ A;  5ILS A;  2YIU C;  4UVA A;  4H13 C;  3RYP A;  5GTH C;  5FKO A;  2K88 A;  3H0D A;  4FX4 A;  4E7H A;  4EYY Q;  3OYH A;  4RB0 A;  1FYL A;  1OYY A;  1VQK P;  3QP6 A;  4XSX F;  3F23 A;  3D70 A;  2HKX A;  4WWC A;  1N7S A;  2EIK H;  3F3X A;  1U0J A;  2BHY A;  1KYO D;  5BPI A;  2R7Q A;  3BQZ A;  2M34 A;  2WAQ A;  5L3C A;  3OYN A;  4S0H B;  2L2O A;  1BA5 A;  3A0B C;  2NVT J;  2IBZ D;  3K10 A;  4PSW A;  2F6C A;  1W7P B;  3HRM A;  3PTZ A;  3TGU G;  1GDT A;  4Y7N J;  2WC2 A;  4L74 A;  3QAH A;  2V1U A;  1IN4 A;  1MNE A;  2H94 A;  3CJR B;  4D5C A;  1NK2 P;  5M5X J;  2WPV B;  2P5K A;  1EF4 A;  2Z16 A;  1KGS A;  5M3M J;  4H13 D;  1M1J A;  1MBK A;  3H1J E;  5DM7 F;  2LK2 A;  5AVW B;  2KL4 A;  2HPM A;  2ZJS E;  2CUF A;  2Y0E A;  1I39 A;  1V5E A;  2LNB A;  1KZU B;  2O8X A;  3FX3 A;  1HJ0 A;  1JCD A;  1TQP A;  2KIK A;  4L0Z B;  2P4W A;  2K3R A;  2F5C A;  4ZYD A;  1T3U A;  1KU3 A;  2LR8 A;  2KS1 A;  3HIF A;  3M9B A;  2CUE A;  2D2C C;  1NVO A;  3S1R J;  1VQP P;  3CCU I;  2P1J A;  1XB4 A;  4MQV A;  2Y9Y A;  1HCR A;  2IBZ G;  1MBE A;  3RKW A;  2HR3 A;  3HTU A;  2HNH A;  4Y13 A;  1WCM J;  2VKH A;  1N7S D;  3L00 A;  2CPS A;  4B8X A;  4WY4 D;  3HHG A;  2OA4 A;  4DQ2 A;  2VJI A;  2XB0 X;  2FOK A;  2L4A A;  1IRF A;  3ZMD A;  1JXS A;  2CUZ A;  1NTZ K;  4PCQ A;  3HSR A;  4L5E A;  1YW9 A;  3H1J J;  2YSR A;  2QZ8 A;  2K3F A;  3TOA A;  3P5J A;  3ZQG A;  4BEH A;  5J47 A;  4E7K A;  1Y0U A;  4HF1 A;  1JT0 A;  2D2C B;  4L73 A;  5APW A;  1UHM A;  1XTC C;  1Q7Y Q;  1IFN A;  1DPR A;  1UMQ A;  3GEZ A;  4XKV A;  2ISZ A;  3T97 A;  2UV1 A;  5BNG A;  1BGY G;  1M1J B;  4EAT A;  3H1I D;  1BOA A;  1L0N E;  3ASN H;  4I76 A;  4BDY A;  1L4A C;  3ZMZ A;  2XV5 A;  1VQL P;  4O3M A;  3LSG A;  3VFZ A;  1J1E C;  1NTZ D;  1M1E B;  4DZO A;  3ZOB A;  2K4B A;  1XSD A;  3L72 D;  1RE3 C;  4B1R A;  5BU5 A;  1Z05 A;  1MDM B;  4EM1 A;  4PJ0 H;  2AHQ A;  4RM3 A;  1N73 B;  4DBQ A;  1OR7 C;  2OPT A;  2JVH A;  3OYM A;  4XLP F;  1D0Z A;  4E7I A;  2P7J A;  3ELK A;  2E1O A;  1SFC C;  1URQ C;  2RVC A;  1ZME C;  2ZXH A;  2GXB A;  1SQP K;  5E8G A;  4CPG A;  1SFU A;  2QCO A;  3RDI A;  1W0U A;  2IYP A;  1AVO A;  3WU2 H;  2FF4 A;  4P1W A;  2IYO A;  3EUK L;  2FJ1 A;  3VMZ A;  5IOZ A;  2ELK A;  1LTJ A;  4V2F A;  4UHT A;  2HOD A;  1LT9 B;  3L2Q A;  4PJ0 E;  3RJP A;  4IPA A;  3O3K A;  1GT0 C;  5FJ8 J;  3RQI A;  2LH9 A;  1GL2 B;  4CCM A;  2E43 A;  1RE4 C;  1VFC A;  2O0Y A;  2KP8 A;  2CW7 A;  4Q5S F;  2R7X A;  4A2U A;  4MEX F;  1IFD A;  4H13 B;  2C9N Y;  1J59 A;  4OIR F;  4UV8 A;  5ICF A;  2VLA A;  3EUH A;  1B72 B;  2LMD A;  1VQP I;  3CO6 C;  1JTX A;  1QX8 A;  5D8K B;  4A3B J;  2BCC G;  3T5X A;  3L2R A;  3V5B A;  2XAF A;  1BIA A;  5KLV D;  3CUQ C;  4U3F J;  2VKE A;  1FLI A;  1EA3 A;  4A0X A;  4B48 A;  1JMM A;  4XK4 A;  1U2W A;  2Y75 A;  3DKY A;  3RKY A;  1W36 D;  3CCL P;  1N86 A;  3S3N A;  3BTL A;  1U8B A;  1P84 I;  1ZTR A;  1R4M B;  2ZVO B;  2M45 A;  4F93 B;  4OVN F;  2KZJ A;  1LDJ A;  2B9B A;  1YIJ P;  3LSH A;  2MFZ A;  2JK3 A;  4UVB A;  2Q1Z B;  4R1H A;  2FXP A;  2MSY A;  3Q5F A;  2R5Y A;  1DEB A;  1YW7 A;  4YII A;  2NOG A;  4EOT A;  2K02 A;  4GFB A;  2W83 C;  1NG7 A;  3OR1 C;  3B02 A;  2IXS A;  5J8C A;  3H1K G;  1QZZ A;  1T0F A;  2LY2 A;  5E3N A;  2HI3 A;  4NPD A;  1BCC D;  3TDK A;  3GXO A;  1D8K A;  3CF5 F;  3SWF A;  2H6C A;  1BR4 A;  2L3D A;  3VYR B;  3G9R A;  1VQ5 P;  2A6T A;  3L2W A;  2NPS A;  3DWL E;  4ASN A;  2FNA A;  1GU5 A;  2QQ9 A;  1IDY A;  4GYG A;  5HS7 A;  5E3L A;  1ZP0 C;  3W67 A;  1OW6 A;  1VQO P;  2OTL P;  2RNG A;  1Z56 A;  4BY1 J;  2KDO A;  3K2Z A;  2JO1 A;  3S1K A;  3U2R A;  3G1O A;  2Q5U A;  1U8R A;  4NNJ A;  3FF5 A;  2A07 F;  1T38 A;  4Z1M H;  3M3Y J;  1TU3 F;  1YX5 A;  4ETS A;  2PLY A;  3L71 D;  5BVZ A;  1OCR H;  3TGU D;  1IO2 A;  3R0J A;  3PUB A;  1FOS E;  1ZG5 A;  1YI2 P;  3C8V A;  5HDK A;  2EWN A;  3NMD A;  5CVI A;  2QBY A;  4D6T D;  2A45 I;  2WPR A;  4DW6 A;  3AE8 C;  2R3C A;  4AUW A;  5DUI A;  3FXJ A;  4G6T B;  2R7D A;  3W6J B;  1ZG3 A;  3M8E A;  3ERE D;  3K70 D;  5DTD A;  1L0N K;  1P4W A;  1FZP B;  1RET A;  2DTR A;  2EPF A;  2JRM A;  3I59 B;  4FE4 A;  2KSJ A;  3BCC D;  3WTS C;  4BXX J;  1PZQ A;  2H8W A;  1P4A A;  3KYD B;  3UNG C;  5JLX A;  2KNC A;  2XDJ A;  4ZNC A;  4PD4 E;  3BCC E;  3AAF A;  2DMN A;  2Z1D A;  2GOX B;  4BS9 A;  1B4A A;  1ZR4 A;  2A06 D;  3HUG A;  5J4V A;  1SFC D;  1URQ D;  3DF8 A;  5B66 E;  3CPW O;  1VQ7 I;  4U7B A;  1HF9 A;  1GHC A;  5AW5 B;  2W7N A;  3MQ0 A;  1PUE E;  2IBZ I;  2MG4 A;  3AE5 C;  2JA7 J;  4GOF A;  4OGQ C;  3CCS P;  2JA6 J;  2Z5I A;  2LKM A;  1KQ9 A;  1X3U A;  2Y30 A;  3E5U A;  4RB1 A;  1L0N D;  3Q5S A;  2Y0M A;  5K1Y A;  1BE3 E;  2PEX A;  4JP0 A;  1ZV8 A;  2FXO A;  1NTM J;  5CCG C;  1YFH A;  2QM3 A;  5GTI H;  4RAY A;  2OBP A;  1HF0 A;  3GYH X;  1HOM A;  3AG2 H;  3QRF F;  3H9Q A;  2IPP A;  2DTZ A;  4XLH A;  2MH2 A;  2XNX A;  3L9F A;  3OIO A;  1GTW A;  3MMY B;  2V9V A;  4F55 A;  1LT9 C;  2DA6 A;  2RV8 A;  3L72 E;  3TYY A;  1K78 A;  2O3J A;  1QRY A;  4GXO A;  3PIP F;  3JSO A;  2GUV A;  5DEQ A;  3WG9 A;  2C9L Y;  3FXK A;  2EFN A;  5F1R A;  3G1M A;  1I6X A;  1POG A;  1S4X A;  2GWR A;  1SC7 A;  4LD5 A;  1SQB D;  2W8Z A;  3L73 D;  5CCG D;  2OTJ P;  2K9N A;  3ZQ7 A;  1FZC B;  3KP5 A;  5FRN A;  1FYK A;  2EIN H;  4WWI A;  4QWQ A;  1R1T A;  2VT3 A;  4ZYA A;  3BTJ A;  2R5Z A;  4DOJ A;  4B43 A;  1MSE C;  2E2I J;  3V4W A;  3EUH C;  1LB2 A;  2E76 B;  3L71 G;  2Y0D A;  3Q9S A;  4HYE A;  4B3X A;  4ZC3 A;  3CCL I;  3C1D A;  3TGN A;  1NH3 A;  2E7X A;  2QUF A;  2R7T A;  4Q4Z F;  4XLN F;  2IAI A;  3RK2 D;  1HA8 A;  2GLO A;  1IXC A;  1JHH A;  1LTG C;  3AE3 C;  4R4M A;  4YTP C;  2BGC A;  4XA4 A;  2VJ5 A;  1NO4 A;  1X1B A;  2N1T C;  3O8H A;  4LIT A;  1AWC A;  1ODD A;  4XMY A;  2VBX A;  2W00 A;  4BJT A;  3QP5 A;  5AIQ A;  3DLL F;  3GTO J;  5FLX K;  5TRD A;  4A12 A;  2KB7 P;  1IXR C;  2X6X A;  4EM0 B;  4PD4 H;  3PSI A;  4HDV A;  1BC8 C;  3GFI A;  4H0L B;  2GIZ A;  1YRN B;  2YO2 A;  3BG6 A;  2D2W A;  2BY3 A;  1XGM A;  5CCH C;  1ZGW A;  5KAI E;  2R93 J;  3SWK A;  1L0N G;  5F27 A;  3B73 A;  1XSX A;  1Q1H A;  4L75 A;  4IQ4 A;  3GF7 A;  3DEU A;  3HM5 A;  1R7J A;  1HTL C;  1PIX A;  4XLF A;  2STW A;  2V26 A;  1K4T A;  1GL2 A;  3EFG A;  2HOE A;  4N9H A;  1MW7 A;  4E70 A;  1MDM A;  1KQL A;  4IL6 E;  4Y99 C;  5CVR A;  1H88 A;  1FOS F;  2XAJ A;  1P9Q C;  1NKN A;  2QKM B;  1MKM A;  2KIS A;  2L01 A;  1WGX A;  2M4G A;  3V7S A;  3CCE I;  1H0M A;  1H0T A;  1YJ9 P;  4G12 A;  1D0X A;  1YIO A;  3BDD A;  3BG3 A;  1U9O A;  2EH3 A;  2ZC2 A;  2XAS A;  2WAF A;  3QYE A;  1FOW A;  2PQ8 A;  1OVR A;  1FBQ A;  2B87 B;  5DUK A;  1JY2 P;  2ZNY A;  1ERD A;  3KPE A;  1NTK D;  4FET A;  3H35 A;  4D9J A;  1O4X A;  5B1B H;  3CDH A;  4HQE A;  1VQ4 I;  4XBF A;  2LXC B;  4H0L D;  4OWF A;  4DJG A;  4UXN A;  1RR8 C;  1RF1 B;  4G9Y A;  3E7K A;  1TNT A;  3L7W A;  4MHG A;  2J58 A;  1HJB A;  2UZK A;  1ENH A;  2VQL A;  3OMY A;  4GRI A;  1J1D B;  4JX5 A;  3TGU E;  3ABT A;  3CX5 E;  1AFO A;  4DJA A;  3OY9 A;  4I02 A;  1MJB A;  5FKL A;  3ERM A;  3JRG A;  3DBR B;  4CYD A;  1VQK I;  1A36 A;  4B4C A;  3BRV B;  3E6C C;  2LLK A;  4PD4 D;  3SEQ A;  1RUO A;  3W2V A;  5JLW A;  3S14 J;  1FTT A;  2JA2 A;  1YS6 A;  3H1J G;  2OZ6 A;  4RAG A;  1BR1 A;  1Z3X A;  3WTZ A;  1U5T B;  1FWZ A;  1GL2 D;  1WJC A;  3USS A;  3SFZ A;  3H36 A;  1YS7 A;  2R7F A;  5AVU B;  1WI9 A;  1QHH D;  3MZ8 A;  2YMY A;  1XS9 A;  2E5Z A;  2O01 N;  3K6G A;  5JHF A;  1TQI A;  2VB6 A;  2DAO A;  3I58 A;  4R8H A;  3V7C A;  5D6F A;  4OGQ B;  2WVR A;  4HAM A;  1LUJ B;  1K78 B;  2M30 A;  3QOE A;  4PV1 C;  4L9V A;  1GW4 A;  4KYW A;  1L0L K;  3GG2 A;  1AVY A;  1VQ6 P;  3PLN A;  2W6J H;  3E7L A;  3E1R A;  1YW8 A;  5FKK A;  3MGN A;  3A1Y A;  4BL0 B;  2XKP A;  2PMZ A;  4LOC A;  1K6O A;  5BU8 B;  5KKZ B;  1RNL A;  1DH3 A;  3TED A;  4NC6 A;  4L9N A;  1T39 A;  2ZSH B;  4G94 A;  4AIH A;  2ZYG A;  2JVG A;  4LLG F;  4HH2 A;  2KIM A;  3AE2 C;  4XM3 A;  3R60 A;  1M56 D;  2KLU A;  1WVR A;  3FWE A;  1T2K A;  1OW8 A;  4M3L A;  2FA5 A;  3DBH B;  1IRG A;  1MZ9 A;  3CTA A;  3NWT A;  1Y1V J;  2KP6 A;  2O6G E;  2IPQ X;  3DQV C;  4M9Z A;  4EJW A;  3BPV A;  4LFU A;  1GLN A;  1K79 A;  3NQO A;  1OCC H;  5ED4 A;  2IGK A;  3LMM A;  2XAU A;  1SEU A;  1YTZ I;  4GT1 A;  1Z21 A;  1WZ2 A;  2A69 F;  1DEE G;  3BJA A;  4KIS A;  1LTJ C;  1P7J A;  1LE8 B;  4EMS A;  1N7S B;  2HLO A;  1JY3 O;  2P81 A;  1PPJ D;  5FB2 A;  2TCT A;  2HYN A;  1K05 A;  1QO0 D;  1W1W E;  2EB7 A;  4RES B;  3VTP C;  2K37 A;  4I0B A;  4YRV A;  4XLC A;  1ZK8 A;  2Y31 A;  3BCA A;  2NOJ B;  2E34 A;  4FT8 A;  3I4N J;  1KB9 H;  2OQQ A;  1VF5 B;  2Q3E A;  1RKT A;  2E2J J;  4RM2 A;  2IZ0 A;  2Z4E A;  2MA3 A;  2GBY A;  5KLV K;  3M07 A;  2VQG A;  3KP6 A;  2KSE A;  2Z33 A;  2P2U A;  1RF0 A;  5AW8 B;  4S04 A;  1E79 H;  3CD6 I;  1JY2 N;  2CPB A;  3A0H H;  1BC7 C;  3C18 A;  2SPZ A;  1LEB A;  1IJW C;  2WB1 A;  5H6R A;  1KA8 A;  3LFU A;  2ZT9 B;  3JSV C;  2NNY A;  4TLF A;  1F36 A;  1NTZ G;  2RRE A;  2ETH A;  3T8T A;  2CUJ A;  2UXX A;  3TKY A;  2DPD A;  2XAG A;  5J40 A;  3WGI A;  2YX4 A;  1D3Y A;  1YJW P;  2E42 A;  2DYR H;  2LOO A;  3C2H A;  4M71 A;  4ASW A;  4RKU J;  4BHP A;  4B3A A;  4AQR D;  4IRI A;  1QNT A;  4ZZD A;  4YFX F;  2FYU E;  2KRH A;  2L7F P;  4M72 A;  4II3 A;  5GAG J;  4KUM A;  1JKP C;  2HEO A;  1SQV E;  1HDP A;  4C9Y A;  2M5A B;  3MVP A;  3WUU A;  3V42 A;  2A3S A;  2ZME A;  3H1C A;  4JX6 A;  1SQV D;  4RLF A;  1JI8 A;  1KYO E;  3D71 A;  3ZN0 A;  1FPQ A;  3EDP A;  3AE4 C;  1R22 A;  3C3W A;  5J6X A;  2NXN B;  1W4M A;  2E71 A;  1LT1 A;  1CW5 A;  5K5Q A;  3FK6 A;  4IHY A;  4HLY A;  1L0L D;  2V1X A;  2Z99 A;  3BTI A;  2NYX A;  2QG4 A;  3MZW B;  5KJ7 D;  5GTH E;  4K35 A;  3LSM A;  1U7J A;  2NVQ J;  4ZDP A;  2G7H A;  3U1A A;  2R7W A;  3M8J A;  4BRY B;  5IYB J;  3HSE A;  1ETX A;  1LT9 A;  3DBL B;  1IUY A;  1K4S A;  1CGP A;  3ITK A;  2V1D A;  4H44 C;  1BGY D;  4W7Z A;  2Q0O A;  1TW3 A;  2KUB A;  2R3S A;  1E3H A;  3L71 E;  3LSI A;  3MEX A;  5EEH A;  2FNP A;  2OCE A;  2R4G A;  1G2C A;  3TO6 A;  2V7F A;  2JA8 J;  1JNM A;  1WT6 A;  2GZW A;  4V2G A;  1PFI A;  3HB9 A;  2CWE A;  3IH2 A;  3KFW X;  1PDN C;  2XZR A;  2AEF A;  2IFM A;  4NC8 A;  3VEP A;  3CWB E;  3TQN A;  4EQQ A;  3LSP A;  1RE4 A;  2WSC H;  3H1H E;  2KIQ A;  5HLI A;  4ZYH A;  1BN5 A;  3RK2 C;  1NGM B;  1VQO I;  3OYF A;  2I1J A;  5CKT A;  3S9O A;  3CC7 P;  3IAS 2;  2Y48 A;  1UAA A;  1NU1 D;  2UXN A;  1G3Y A;  3EYI A;  1OLT A;  2HG5 D;  4HYT B;  2IS6 A;  3A2A A;  1TW2 A;  2HYF A;  2MD0 A;  1DU0 A;  1J2X A;  1SQB G;  3S1Q J;  1SAN A;  3DPL C;  4E6K G;  3AEF C;  2FMY A;  1VF5 D;  3JTG A;  4DYQ A;  3I71 A;  1HSJ A;  2JWD A;  5EG0 A;  1JY2 O;  2GA1 A;  3AFH A;  5DD4 A;  5EEA A;  1ZLL A;  3PHL A;  1ZLK A;  2OZU A;  1RY3 A;  2O01 J;  1K73 Q;  2FQ4 A;  1FAV A;  1B1B A;  3TMO A;  1V5F A;  2XF7 A;  5DJU B;  2W6B A;  1MBJ A;  2XRL A;  3K1M A;  4I0A A;  2XGX A;  4Z6Y A;  1QA6 A;  1X0T A;  1W2B O;  1X1C A;  2OYH B;  1FBU A;  4RMN A;  4WK8 F;  5CVV A;  2QF7 A;  5E18 F;  5BPD A;  4L5J A;  1G2C B;  4N3Y B;  3FHZ A;  2DBB A;  1NTM K;  5APX A;  5K5G B;  5DD8 A;  1QHG A;  1EH7 A;  1O3T A;  2PI0 A;  1FJK A;  1T0F C;  1Q90 D;  4BQQ A;  4A3M J;  3H9J A;  4HA8 A;  1BW5 A;  3IFM A;  5TIS H;  2OQG A;  3PP5 A;  3OOP A;  2QEX P;  4DCK A;  1K04 A;  3K69 A;  1M57 D;  2W4S A;  1JKR C;  2LY1 A;  2E1M C;  2IA1 A;  4OAZ A;  3KP7 A;  5IYC J;  4BE2 A;  2VPL A;  2A06 G;  1EV7 A;  1RIO H;  1HXD A;  2XV4 S;  3BWG A;  3M1E A;  2CMP A;  1BJZ A;  2HFH A;  4IFM A;  3F8M A;  3VMY A;  5CPR B;  5IT9 Z;  1NTM G;  4M9X A;  4B09 A;  2NVX J;  1ON1 A;  3IRQ A;  1N25 A;  2JJ7 A;  2L9V A;  3I9V 2;  1B59 A;  3Q0U A;  4N78 D;  3HOY J;  3ZDM A;  3O8Z A;  1XC5 A;  1DU6 A;  2XSD C;  1PGP A;  3WTY C;  1LTA C;  1G2H A;  3FMS A;  3E1S A;  2BEO A;  4H0E A;  2STT A;  4C7R A;  2YIU B;  3E5Q A;  3H5N A;  2DO7 A;  1E3P A;  4JQ0 D;  2FYU G;  5BQT A;  3IWF A;  1KQS O;  2F4M B;  2RAE A;  1QGP A;  5FLM J;  1QPM A;  3OYE A;  2ZFC A;  2FFD B;  4A3F J;  1YTZ T;  5AVZ B;  1KOR A;  2IS4 A;  1WSU A;  3L2U A;  2WSE H;  1UB9 A;  5GAD J;  1H8A C;  4YIR X;  2KS1 B;  1I5Z A;  2V4H A;  2K85 A;  2QSI A;  3L74 D;  1N73 A;  3VYT B;  4LJZ F;  2HVQ A;  2KJB A;  2VPR A;  4YFN F;  4OWR B;  1A6I A;  3BQY A;  3VSK A;  1LVA A;  4EGZ A;  1PYV A;  3Q3S A;  4BHB A;  4F91 B;  1SAX A;  1JEK A;  3SJM A;  4H44 D;  1SD5 A;  2Z5H A;  1SQP J;  1R58 A;  1XGN A;  1BIB A;  3U9G A;  5IP6 A;  2VKD A;  3FKI J;  4AIJ A;  1NHL A;  2W6A A;  3S8P A;  3CCJ P;  1Q81 Q;  4Y15 A;  1FZG A;  4IF4 A;  5LHG A;  1U3E M;  1WQ2 A;  4U3F G;  1TQM A;  1N78 A;  4AYB A;  3W6V A;  2OC6 A;  1J2J B;  3JAM Z;  1WJF A;  2ZJQ F;  1X22 A;  3VYU B;  2IFN A;  1LNW A;  3H0G J;  1HGZ A;  2DPU A;  1T2K D;  2M7A A;  4BAY A;  1LWU A;  1BI2 A;  2M7B A;  1R5L A;  1L0L E;  4R4L A;  3KYC B;  4JX4 A;  1UZC A;  2DA2 A;  2WZ7 A;  2ZSI B;  4H44 B;  3GF3 A;  2DOF A;  1PP8 F;  3KLO A;  1JKQ C;  4N4N B;  1LTI C;  3QYB A;  2R5B A;  3KX2 A;  2FYU K;  3JRC A;  3FKJ A;  5JHU A;  2AXT H;  4CCK A;  5L3B A;  1O7L A;  4ENN A;  3H1K J;  1LEA A;  1YLF A;  2XU6 A;  2CV2 A;  3L75 E;  1IAW A;  1LKX A;  5AW0 B;  1ETQ A;  3VDX A;  4FX0 A;  2H1L A;  5LHI A;  5AW7 B;  1PV3 A;  3SFD C;  2KDZ A;  1R23 A;  1Z77 A;  3L73 G;  4I7Z C;  2RKH A;  1EC5 A;  2DOD A;  3I56 P;  3L75 G;  2XB5 A;  2F4I A;  1NU1 E;  3TO7 A;  4U7D A;  3BZK A;  3CCY A;  2VRS A;  1T98 A;  2CGP A;  2O1J A;  3FXD A;  2A6H F;  5CJ4 A;  3H3Z A;  2EFW A;  1SFX A;  3ECO A;  3QPT A;  1RH5 B;  3BJO A;  4MO7 A;  3H5R A;  3BPX A;  4IRG A;  4C2M J;  2M0C A;  3LAJ A;  1R5I D;  3S93 A;  1WMK A;  3SZT A;  2A06 E;  2KOG A;  1VQN P;  3EET A;  3PO2 J;  2VJ4 A;  3LOC A;  5AVS B;  4LC1 A;  3V7R A;  2IBD A;  2M5W A;  2G0E A;  4JPZ B;  1D0Y A;  3O6Q B;  5H2F E;  1PJR A;  1ZRF A;  2E76 D;  3HD7 C;  2V4J C;  1MFT A;  1MH4 A;  1JOC A;  2KRC A;  1VQ8 I;  5C39 A;  1T6S A;  2K9J B;  2E1M B;  3CCR P;  1KIL E;  1X2M A;  2E5N A;  4YXW H;  3KEQ A;  1QZE A;  3ZQQ A;  4KT0 J;  4HST A;  5D5U B;  4ZTJ A;  2VL8 A;  3LFK A;  3JSP A;  1EZV I;  2N8G A;  1NWQ A;  2H43 A;  1EKE A;  3IH4 A;  2A45 G;  2HPC A;  3JC2 2;  2VJJ A;  4E7J A;  2HWV A;  4E7S A;  2IS2 A;  1KIL B;  5J8F A;  5CCH A;  2GXG A;  3BR1 A;  2JDI H;  2Q2E B;  2V79 A;  3L74 G;  1RPW A;  3H3U A;  1JKO C;  3ZXS A;  2DK5 A;  3LA7 A;  2WTE A;  1BI3 A;  2M87 A;  5KJ7 A;  2P5L C;  2I5U A;  2IT0 A;  3I55 I;  3BG5 A;  3FXQ A;  1ZN5 A;  2M3B A;  4JOM A;  1SMT A;  4ANJ A;  1TWA J;  3OS2 A;  3G4S I;  4MFE A;  4ON0 A;  3HZJ A;  1BDD A;  4WXC A;  1OYW A;  1I6H J;  1IG7 A;  1TL8 A;  3QPH A;  2I10 A;  3V8J A;  1IFI A;  2J5U A;  3K70 C;  1WH7 A;  3ZRG A;  3LQR A;  1SMY F;  5FKN A;  3J80 K;  3D6Y A;  3N05 A;  1FOX A;  4FCY A;  1MMD A;  2EIL H;  2ZFU A;  1OJL A;  2JPC A;  4ESB A;  2N1T B;  3HRT A;  3F6V A;  2E74 B;  1M1J C;  2H8P D;  4ENK A;  1RF1 A;  4PDK A;  1FDO A;  2XDV A;  5F64 A;  5IP7 J;  1IGN A;  1FIP A;  5LEJ A;  1DP3 A;  3RGU A;  1FZA A;  2DDB A;  3M9H A;  1OCT C;  2CW0 F;  3LW5 J;  3HUS C;  4WBA A;  5L3G A;  2VBZ A;  3CJN A;  5TIS C;  1B72 A;  2OQR A;  5DCF A;  3OYI A;  2WT7 A;  1UEL B;  4XR6 A;  1B8I A;  5M1B A;  4IHT A;  3F9K A;  2O03 A;  4BQO A;  1QZY A;  2ME0 A;  4BAC A;  4ZZL A;  1DD4 A;  2VBW A;  1AQT A;  2QA4 I;  2WPS A;  4IRH A;  2LXB A;  3K4B A;  2ZXI A;  5IT9 K;  2WWW A;  4C7N A;  3F8F A;  1LTJ B;  2AXT E;  4KJM A;  1FC3 A;  2HVS A;  2WWY A;  2VI6 A;  4EJT A;  4A7P A;  1P6R A;  2HYJ A;  3AG4 H;  1UCR A;  3ZQI A;  1CZQ A;  2ZT9 C;  1GZL A;  5DCM A;  3CES A;  3H32 B;  1TT0 A;  3FHN A;  5BS6 A;  3CC4 I;  3L4F A;  4UB8 H;  5AW3 B;  1X2N A;  2R7O A;  3NRV A;  2L9N A;  2DDA A;  3IR9 A;  2MYS A;  4U87 A;  4XRS A;  1MNM C;  3BR0 A;  2B9S A;  1ZRC A;  1TC3 C;  2XKM A;  5GTH H;  4BDZ A;  3E5X A;  4UV9 A;  5ILU A;  2F5F A;  1NKZ B;  3IF4 A;  3CZ6 A;  3A0H E;  5JFR A;  3HOS A;  1DDN A;  4KIC A;  2TRT A;  2KIF A;  3PUF A;  3M4O J;  4UUV A;  1YOV B;  1NH4 A;  4N6J A;  3CI9 A;  1XCB A;  3HEF A;  2BCC D;  2L4M A;  5KCM A;  2JT1 A;  3CDL A;  2KXP B;  3RCO A;  2A5Y B;  1T8I A;  4D6T E;  5FRO A;  2Q7C A;  1BM9 A;  5H20 A;  3J7A Y;  2KIU A;  1WFX A;  1WJD A;  3K4N A;  1MGT A;  1VQL I;  2BY0 A;  2VQC A;  3HOW J;  3PO3 J;  1CI6 A;  1K9M Q;  2O3F A;  3CME P;  3FXL A;  2M9H A;  1MMG A;  2EZL A;  3L72 G;  3MHV A;  2FML A;  4I1L A;  3DPU A;  3CX5 D;  5CHX A;  4K3A A;  4LIV A;  3W3C A;  1S7O A;  1BCC G;  5APU A;  2OUM A;  4S05 A;  2HOS A;  3R6S A;  1HGV A;  1FJP A;  3A0H C;  3IC7 A;  1CF7 A;  1DGR M;  3EQ2 A;  2L91 A;  1SQV K;  1M8O B;  1K8A Q;  3L1P A;  5LFA A;  4J00 A;  3IP4 B;  4CDG A;  2DA4 A;  2E36 A;  3K4L A;  1NAF A;  1IXS B;  2HFE D;  2M0B A;  2B0L A;  2GUS A;  1HC8 A;  1IK7 A;  1S5L C;  4DBR A;  2P8T A;  3CF2 A;  5IP9 J;  1ZEL A;  2AO9 A;  3OL4 A;  5D4S A;  4A3J J;  3D5S C;  3DEW A;  2QQA A;  4Y3O A;  2AXT C;  2QSF X;  4F52 A;  1YRN A;  1VQM I;  1KB9 E;  3GHG C;  4RJT A;  3GTG J;  4PJ0 C;  4MLO A;  1FP2 A;  4I99 C;  3ZCO A;  2UWM A;  1LGH B;  1FZC C;  4KIF A;  2E74 D;  3OS0 A;  4ENJ A;  1KQ0 A;  4NC7 A;  4BJ5 C;  3IL2 A;  3HUG B;  4CGZ A;  1VF9 A;  3HG9 A;  5H2F C;  4YFK F;  3BOQ A;  1XDS A;  3RTR A;  4KMF A;  3KDP B;  2GA2 A;  4J01 A;  1S8N A;  2F5D A;  3Q5P A;  1N73 C;  4II2 A;  5HOD A;  4O5V A;  2W57 A;  3A4C A;  3D5R C;  1E2X A;  2F2E A;  4AD9 A;  1WJE A;  4G7Z F;  1G4D A;  1MJ9 A;  3FM5 A;  4WXD A;  5IY5 H;  1YQ4 C;  2ZVN B;  2WY8 Q;  1YBK A;  1RUN A;  4I7Z B;  5AVQ B;  1DGW Y;  2BV6 A;  2VOO A;  9ANT A;  2DQR A;  5FLX Z;  1S29 A;  1SQQ J;  1U57 A;  4C30 A;  1X8Y A;  3TL4 X;  4MNU A;  1HUC A;  2BCC J;  1BBY A;  4HX4 A;  1L0L J;  4B86 A;  1TTY A;  2EV0 A;  1F4K A;  1N7S C;  4I6M C;  2H1K A;  2DMQ A;  1SQX G;  1O7F A;  2IRF G;  2VKV A;  3GLL A;  1MMN A;  1HQC A;  4A3C J;  3RL0 C;  2DMP A;  3P9K A;  4XOP A;  3BZC A;  2FX0 A;  1LWU C;  3N4X A;  1RR7 A;  3ABM H;  5E8I A;  4OGQ D;  3BCB A;  3IAO A;  2FY8 A;  3GW6 A;  2YXR B;  4X1E A;  1TBX A;  4N78 E;  2COB A;  2PN6 A;  2K86 A;  2M8E A;  1XPX A;  1SQQ G;  4JBA A;  1JTH B;  3AE9 C;  5APS A;  2PFX A;  3AEE C;  2QSG X;  1R4N B;  1SAU A;  1L0L G;  2EK5 A;  1MBH A;  3GVA A;  2R7S A;  2BYV E;  4IJA A;  3R4K A;  4CXF A;  2AXL A;  3SEZ A;  4BBS J;  3O6B B;  3A01 A;  1GVD A;  4HG2 A;  3QOD A;  5AVY B;  4M3B A;  2JUC A;  4M73 A;  1ZAO A;  3WE3 A;  2H89 C;  2FD5 A;  3WTW C;  2R44 A;  4XOT A;  4E7L A;  1VF5 C;  3TNU A;  3PFI A;  3WU2 C;  1FOK A;  1ON2 A;  1QVU A;  4LG0 A;  4IOA F;  2E7W A;  2BW3 A;  5M5W J;  4G7H F;  2FUG 2;  3S2W A;  3RZO J;  1G1I A;  1OZH A;  4I01 A;  2KYV A;  3M9Q A;  3CX5 H;  4BE1 A;  1QEX A;  4XE5 B;  4LLH A;  2EFO A;  3RK3 E;  1JUN A;  1S6L A;  4MIM A;  4NQW A;  1W0T A;  3IHU A;  1VQN I;  1OX3 A;  1HDD C;  5AVR B;  1MMA A;  1TNS A;  3P32 A;  3OV8 A;  1GK4 A;  4CCL A;  4QLC U;  3GZ5 A;  1AU7 A;  3V2P A;  3E1I A;  1ORK A;  1U7M A;  1A6Q A;  1NU1 K;  3H6P A;  2B7E A;  3DFG A;  1E17 A;  1USD A;  4HQM A;  4LLN A;  4OMY A;  2R7V A;  1EJ9 A;  2JKV A;  2DA1 A;  1FZE A;  3K7A J;  1AOY A;  3I4M J;  3ONQ A;  1PGJ A;  2HTS A;  4XFJ A;  3BLY A;  1EQ7 A;  4ESF A;  4HF2 A;  1Y9B A;  2BXZ A;  2FEZ A;  3J81 Z;  3KEY A;  1YG2 A;  3Q9V A;  3S32 A;  1NTK E;  2RDP A;  5F0F A;  1KB9 I;  2M8G X;  5LEK A;  4QMA A;  1IN6 A;  3BCC J;  2FOW A;  4QPO A;  5B3S H;  1AJY A;  1T3J A;  1OR7 A;  1L2P A;  5KAI H;  3CJQ B;  3V2N A;  1JM0 A;  2EFP A;  1P2F A;  2OD5 A;  1T08 B;  5CQE A;  1S2E A;  4W80 A;  2F48 A;  2QVO A;  2WSC J;  4CA0 A;  1MUU A;  3KYQ A;  4KHX A;  2QVA A;  2UWJ E;  2W85 A;  3WU1 B;  1A31 A;  1KON A;  1ZW0 A;  1OPC A;  5F6F A;  1UST A;  1KYW A;  3GCM A;  1DX7 A;  4GDO A;  2WV0 A;  5LGN A;  2OJE D;  1MZB A;  1NTM E;  3GZN B;  2P67 A;  1IW7 F;  5K7Z A;  1XGS A;  3E6B A;  5C44 J;  1PP9 D;  2DI3 A;  1S3J A;  2RNJ A;  2QJP B;  5FFZ A;  2XND H;  1ZAR A;  2H27 A;  1RF1 C;  4UY8 I;  3CDI A;  1IZ1 A;  1STZ A;  2O01 H;  2KLO A;  2OYI C;  1KV4 A;  4UB6 C;  4XLE A;  1AV1 A;  2XRN A;  3HSF A;  2QWW A;  1BL0 A;  1ZGA A;  4I2O A;  1S72 P;  3KET A;  1J1D C;  5CLS A;  4N9I A;  3DEE A;  2JUG A;  1SFO J;  4W7Y A;  5CCG A;  3EFF K;  3BR3 A;  2E1C A;  1IRX A;  2IGO A;  3RKX A;  1UII A;  2XPU A;  1KYO I;  5APT A;  1RC9 A;  5HNF A;  2ITA A;  4BRY A;  1D7M A;  1H8A A;  1I3A A;  1OCZ H;  5IOY A;  2P7V B;  4A6D A;  4PSX A;  1SQP E;  3JRA A;  3AEA C;  5LBQ A;  2OTL I;  1GU4 A;  2E75 B;  1KIL D;  2PX9 A;  1YTY A;  1SQX E;  1EDJ A;  1SFK A;  3B5N B;  1A35 A;  2YXQ B;  3Q1M A;  2GAU A;  2I8D A;  2XKO A;  3CX5 I;  3B71 A;  1GV2 A;  3IN6 A;  3L75 J;  3D6Z A;  5L3E A;  1PPJ G;  1U5T A;  2XGE A;  3LL7 A;  5E79 H;  4ZTF A;  1SQX K;  4HSR A;  3BAS A;  4XKB A;  2PMU A;  4D1Q A;  2Y9Z A;  4IQJ A;  3ZMV A;  2RGV A;  3ZMU A;  1NK3 P;  4A3L J;  1HW2 A;  2HQN A;  4ABZ A;  5HDN A;  1GL2 C;  4HF0 A;  1JTH A;  3GBG A;  5L8R J;  3ZQF A;  1WWX A;  1RQU A;  3U59 A;  4HX7 A;  2QBY B;  5CYV A;  2V9P A;  4GGG A;  2DW3 A;  1MBG A;  3I4P A;  1FOY A;  1SQB E;  3KQG A;  4PUS A;  2M1B A;  3KLN A;  3FMQ A;  3KEO A;  4WCG A;  4BNC A;  5ICG A;  2E75 D;  5D8L B;  3VOD A;  4HW0 A;  3TBI A;  3HOT A;  1O3R A;  2JTV A;  2ZAE B;  2X1C A;  2BXY A;  3HL2 A;  5JVT A;  3TNU B;  1MJA A;  2DT5 A;  3VWB A;  2QGU A;  1Z6T A;  3UIA A;  2CU7 A;  2X0L A;  2ICW G;  3CCV I;  3QWO C;  4LMY A;  4CCN A;  2E5Y A;  2EV6 A;  3H3V K;  4IL6 X;  3W68 A;  4HNT A;  1GXP A;  1DUX C;  3CCM P;  4A5M A;  1N8R Q;  2NS7 A;  4PJM A;  4HNU A;  2WT7 B;  4MFD A;  1JB0 J;  3WOD F;  2W82 A;  3OYB A;  3HUS A;  5CQG A;  4M9S A;  4BE0 A;  4HRI A;  3WMM 0;  3HKZ A;  3G71 P;  3L74 J;  1WJA A;  1TLH B;  3QWL A;  1SLQ A;  3FM3 A;  4MGR A;  4R79 A;  1YIJ I;  3A0B H;  1K61 A;  3G4S P;  1YHQ P;  1MND A;  2VN2 A;  1RRJ A;  1VQ5 I;  1WJ5 A;  3FXR A;  2ZJ2 A;  3S2D J;  2O61 A;  1Y8A A;  3GUD A;  2QE7 H;  2DFE A;  5FKM A;  3DV8 A;  1Z3Y A;  5ILV A;  3AEB C;  2CSO A;  2KHM A;  4PJJ A;  1BCC E;  1SQV G;  4H4K C;  1P4X A;  3CME I;  1SP4 A;  2ZKZ A;  3CUO A;  3MKW B;  1P92 A;  4AID A;  4EI2 A;  2IJL A;  2R7U A;  2HS5 A;  5E79 C;  4DZJ A;  3F22 A;  3OYK A;  2WY7 Q;  3HUS B;  4FAS D;  2Z3Y A;  2P6S A;  4AWX B;  2H88 C;  4RO0 A;  2A6E F;  1FZC A;  3OYC A;  2F5V A;  3HD7 A;  2KZI A;  2HKO A;  1SQB K;  3ZQL A;  1PL5 A;  1Q2N A;  3NFQ A;  5J1R A;  3FXE A;  1ETW A;  2XPW A;  4CSW A;  2K4J A;  2IBZ E;  3RPU D;  1XSV A;  1O57 A;  2V7Q J;  4ZJZ A;  1N75 A;  5GP9 A;  2BCC E;  1SQB J;  3BTC A;  3JR9 A;  1X1D A;  1Z67 A;  4NQW B;  1HWT C;  2HPC B;  2LP0 A;  3S15 J;  1S1C X;  2BEQ D;  3VMA A;  2ISY A;  1Y0N A;  1KZH A;  1IFM A;  3JAM K;  3LA2 A;  2WMM A;  3QYF A;  3TW6 A;  3ZMT A;  1WRJ A;  4J19 A;  2CQQ A;  3CXH E;  1S5L H;  4BKX A;  4UB8 E;  4B47 A;  3QU3 A;  3SHF A;  5HLT A;  3CWB D;  1JTY A;  2ZCW A;  1IC8 A;  3MAJ A;  2LVS A;  2CQN A;  4HZF A;  4HX8 A;  1T6A A;  3MKY B;  3TF5 A;  1TZL A;  1EZV E;  1IN8 A;  1FSE A;  3E6M A;  5IYD J;  1Z6R A;  3FX0 A;  2X4H A;  4DGW B;  1OMI A;  1Y8R B;  2CJJ A;  1FEX A;  2BAS A;  2RQQ A;  3C7J A;  5J1U A;  2ME6 A;  3U1D A;  1L3L A;  1L0N J;  2ZFW A;  3N4M A;  3I53 A;  3PRJ A;  2LG4 A;  4JQF A;  2BY2 A;  2P5V A;  4PJN A;  4IHV A;  3AEG C;  3BAT A;  1ETV A;  3PH0 A;  4MEY F;  2C6Y A;  2L9R A;  3T0Y A;  1LP1 A;  3MIW A;  3Q3D A;  3RK3 C;  3OL3 A;  5K7F A;  4IZZ A;  1JGS A;  1VQ8 P;  3NEU A;  5CBO A;  3VYS B;  4P55 A;  3MTU E;  2QQ8 A;  4CZZ A;  1HVV A;  4A5N A;  2AEM A;  1ZLJ A;  2HXI A;  3WU2 E;  3GHG B;  3P7K A;  1ZG1 A;  3CCU P;  5FRM A;  3TK1 A;  4XRM A;  2EFQ A;  3DXJ F;  1UHW A;  1W5C E;  2DT7 B;  4A6E A;  3G6E P;  2HOT A;  4ESJ A;  3L09 A;  4IKF A;  2DYS H;  3F5H A;  2G8Y A;  3WUV A;  2QKL B;  1D5Y A;  2FYU J;  3IWZ A;  2BE5 F;  1SQP D;  5AW2 B;  2V9K A;  4ZYE A;  2MAB A;  5C3E J;  2CYY A;  3P9C A;  3HE5 A;  3TGU J;  1U5T C;  3L71 J;  2A68 F;  2WPQ A;  2L7M P;  2W48 A;  2DMU A;  3L70 E;  3I59 A;  4G6D A;  2Z9O A;  1VQ9 P;  2LKS A;  2ZME C;  4O9B A;  1ZOY C;  3M7G A;  3FGA D;  4TT3 H;  3I54 A;  5LD2 C;  3A03 A;  3EQL F;  5E1Z B;  1CF7 B;  1P84 D;  4MTE A;  3VMX A;  1AQ5 A;  4L76 A;  3RL0 g;  1KMI Z;  5GTI E;  1T33 A;  2O7O A;  4WXH A;  1LE8 A;  3F8C A;  4C3J J;  4CIC A;  4GKG A;  4AIK A;  4HDU A;  3K4M A;  4RLQ A;  2W27 A;  1GVJ A;  5B1A H;  3H9G A;  5KAF E;  4XOR A;  4XN3 A;  4P96 A;  4C2U A;  3KZZ A;  3M06 A;  4HB1 A;  1TT5 B;  2H6B A;  5E17 F;  2J5P A;  1SD6 A;  3CUQ B;  3KE2 A;  4YEL A;  1MV8 A;  1UFM A;  2YU3 A;  5HS9 A;  1H9T A;  5KLI C;  2LC2 A;  4UUS A;  4BGD A;  4RGS A;  3U21 A;  3HOV J;  1SFC B;  1URQ B;  4MTD A;  4PGG A;  1YIT I;  2FYZ A;  3CCR I;  4AYC A;  3SZG A;  3JRF A;  3JRE A;  1NHA A;  2DFH A;  5LGU A;  3F8B A;  2BHZ A;  4AVZ A;  2KK7 A;  1KD1 Q;  2FE3 A;  2EV5 A;  1QVG O;  2X85 A;  5F04 A;  3RIR A;  5E3M A;  3CMA I;  2IEK A;  3BZ6 A;  4EJO A;  4M6V A;  3EYY A;  3CCS I;  2E74 C;  1NG6 A;  1W5T A;  1DD3 A;  4AVP A;  1H89 C;  3DTI A;  1D1C A;  2OV7 A;  3A02 A;  3KZI E;  2CV0 A;  1S5L E;  3CXH H;  4JYC A;  3M1C A;  3CLQ A;  4ASV A;  4BHC A;  4DIQ A;  2Y0C A;  1A04 A;  4XRS G;  1MBF A;  4IHX A;  5K7H A;  3WG7 H;  1PUF B;  4XKC A;  4RA2 A;  1KIL A;  3JRH A;  2K7L A;  5GAE J;  1Y56 A;  1P84 H;  2HDW A;  2V7Q H;  2KNC B;  3D0S A;  3OR2 C;  4UUS B;  3VOE A;  4FHT A;  1QVT A;  3RPQ A;  4NDL A;  4Y52 J;  1BSN A;  2K9Y A;  1IV8 A;  2K1A A;  3CD6 P;  1NU1 J;  3GTL J;  1UG0 A;  5APV A;  1X4O A;  2BOL A;  3GWZ A;  5DDG A;  1R9T J;  3DU6 A;  3MUD C;  4Y4R A;  3M91 A;  5TJJ A;  4HKZ H;  4RGR A;  4P9F A;  2K3P A;  2Q2E A;  1XX5 A;  1ETK A;  3TOB A;  1K83 J;  2ESN A;  1FS0 E;  1XN7 A;  3MZH A;  3DCF A;  1JY3 P;  1SQQ K;  2L0K A;  2C0X A;  3L75 D;  2OF7 A;  3CQZ J;  1XGO A;  2HOA A;  5AON A;  2FYN C;  4C46 A;  1AHD P;  3FDY A;  1PP9 G;  2EIM H;  1NTC A;  1IFP A;  5D5X B;  2DJI A;  1FMW A;  1BGY J;  1FE6 A;  3H1J D;  2Z2S B;  4OIN F;  2WB1 N;  3W2A A;  3GTK J;  3BRO A;  1U9N A;  3M0D C;  4IOC F;  3DPT A;  2CQK A;  3SQN A;  4UB6 H;  3RBZ A;  2A5W A;  4NPF X;  3FMR A;  4ZKU A;  3BT9 A;  1FDM A;  3KZI C;  1E5W A;  1VQ7 P;  2LSO A;  3R0A A;  5FFX A;  2ZB9 A;  1GMJ A;  2IX7 C;  2WIT A;  5KKZ C;  1WHU A;  1NTK J;  3A7O A;  2IVM A;  1E3O C;  2LRD A;  1W5S A;  3GFJ A;  2L5G B;  5A2Q K;  2NRA C;  2CFO A;  3LID A;  1PP9 J;  1NJI Q;  1LJ2 A;  1V54 H;  4JK1 X;  2X1D A;  1V3F A;  1R00 A;  1W36 C;  5TIS E;  3E0J B;  5C4J J;  1BCC J;  3S2H J;  1A5J A;  1LFU P;  4DYC A;  1R71 A;  3L70 D;  1TWH J;  4M6Y A;  2K40 A;  2CQX A;  3AG3 H;  1D1A A;  4GDF A;  3HOU J;  1G59 A;  1LP1 B;  1LTB C;  1V4R A;  1KN7 A;  3CCE P;  3HPG A;  5HLG A;  4ZDO A;  3H1K D;  5EFW B;  2XGC A;  1VTN C;  1I50 J;  3BJ6 A;  3OYG A;  2JEE A;  2F4O B;  2VIX A;  1KQ8 A;  5ICC A;  4OIO F;  2JPB A;  3KPH A;  1P84 E;  4JF7 A;  3ABL H;  2LRE A;  5GTI C;  5DV5 A;  3I64 A;  1HST A;  1RI7 A;  3F8N A;  4XKW A;  1XMA A;  3TDZ C;  5KLI B;  1VND A;  1Y39 A;  1IN7 A;  3FXM A;  3H1I E;  2AS5 F;  2MGQ A;  3K4J A;  3O6Q A;  3AE7 C;  4XN0 A;  2DFI A;  4RAF A;  4U0W A;  1M1K Q;  2NS0 A;  2RN0 A;  1USE A;  2CS3 A;  1QL1 A;  2J59 M;  2HZD A;  2DFF A;  2YPR A;  4MQ9 F;  4W1U A;  3IKT A;  4I2L C;  1PP7 U;  2D45 A;  1JJ6 C;  1JUS A;  1R1V A;  3I5U A;  1Z9C A;  1AKH B;  2ID6 A;  2LKP A;  1S9K E;  5HDG A;  2VAS A;  3N97 A;  1L4A D;  4EGY A;  3PFY A;  5B5E E;  2PP6 A;  1W5C C;  3ABK H;  2O5R A;  5AIP A;  4AUX A;  3ZPL A;  2TDX A;  1F5T A;  4G7O F;  2NPS B;  3MZY A;  3S17 J;  3OWT A;  1NTK G;  1GK6 A;  3I3L A;  1ONV A;  3L74 E;  4XL9 A;  4A3G J;  2XAQ A;  3AE1 C;  1MH3 A;  3RK3 D;  1YO5 C;  4CYC B;  2PMZ N;  3E6D A;  3CCQ P;  5ICE A;  4EJU A;  3WE2 A;  3L72 J;  4IHS A;  3H1L E;  4RDU A;  1WI3 A;  4LK0 F;  4U3F E;  3Q0V A;  2JSP A;  3MN2 A;  2K9L A;  1DPU A;  1R5H A;  1FIA A;  5B66 C;  2V6E A;  4WB4 A;  3VYI A;  3OSF A;  3BCC G;  4K2E A;  2KRF A;  1LPQ A;  1QLE D;  3H1I J;  1X1A A;  2HU9 A;  1LTT C;  2QEN A;  5C4X J;  4EV0 A;  2PG4 A;  3F72 A;  3JTH A;  3CWB G;  1VL2 A;  3PM1 A;  2O1K A;  2K27 A;  3T1B A;  1R6R A;  1L0O C;  4PK4 A;  5D4R A;  1SD4 A;  3WHC A;  5FLV A;  3BG7 A;  3ZN1 A;  3MWM A;  3GTJ J;  1G8X A;  2YKQ A;  1B9M A;  1X79 B;  3BR6 A;  1D1B A;  2OAZ A;  3KP4 A;  1L4A A;  1EXI A;  2ZXJ A;  3V4G A;  1YYC A;  3OIQ A;  1BE3 G;  4BJ6 C;  3SZP A;  1SQQ E;  1OCO H;  1CSB A;  3PJS K;  2YX7 A;  2R92 J;  1QL2 A;  3L73 J;  2X51 A;  5FO5 A;  3QU6 A;  1FBM A;  3GF2 A;  1JE8 A;  1AA0 A;  3L36 A;  2ZJP F;  3CC2 P;  4BWN A;  5AW6 B;  1I1S A;  1QVF O;  4BQA A;  3IAM 2;  3WTT C;  2HXO A;  4H0L C;  1OIP A;  2L54 A;  3OAK A;  4KIG A;  1EDK A;  2F5E A;  2YUS A;  3P8M C;  2KJC A;  2W1O A;  2L7K A;  1ZRD A;  4OIP F;  2QJK C;  5AVT B;  2FRH A;  1XDU A;  2FBH A;  1KU9 A;  4Y33 A;  4PZJ A;  5FGM A;  3G3Z A;  4OIQ F;  2RMZ A;  3S4R A;  1B9N A;  1UJ8 A;  2FFD A;  3DTK A;  1GV5 A;  1YYV A;  1IF1 A;  2O9L A;  2ZT9 D;  3OW2 O;  3E97 A;  1K7A A;  2JRT A;  4A0Y A;  1IZN B;  1JMB A;  2KMU A;  2X1E A;  2Z5U A;  3AL0 B;  3RK2 B;  4YXD C;  4XLA A;  3X2Q H;  1BE3 J;  3CCQ I;  3BY6 A;  3L37 A;  2XUB A;  1IC2 A;  3OSG A;  4CZC A;  1R5S A;  5EDN A;  1B6A A;  5CCH D;  2JMW A;  3RSN A;  1QGK B;  4BUP A;  3GHG A;  2E2H J;  2XHK A;  4PJL A;  5KAF C;  1YIT P;  1EDL A;  2VUM J;  3VOP A;  2FYN B;  3IKV A;  4IO9 F;  3LA3 A;  4PGH A;  2LBF B;  1VQM P;  2M2E A;  2N9Y B;  2NPS D;  3CCV P;  3WTX C;  1BR2 A;  2ZJR F;  2R5Z B;  1SVF A;  4HV6 A;  2RC4 A;  3ABU A;  3LNQ A;  1Y1W J;  1PUF A;  3K1P A;  4BEH B;  3IV5 A;  5EGO A;  3FXO A;  1LWU B;  2N1T D;  3OA7 A;  4PV1 B;  4NUB A;  3LW5 H;  3HXL A;  2A05 A;  2MJZ A;  3PNT A;  3HD7 B;  3A2K A;  2MC4 A;  2XPV A;  1SQX D;  2FBK A;  5L3F A;  3MD2 A;  5EZG A;  4A3I J;  3H1K E;  3FK7 A;  1M90 Q;  1N2D C;  3FWL A;  4OOI A;  1SD7 A;  4ITV A;  1Z91 A;  4YIF A;  1FNN A;  4WX9 A;  1JJ8 C;  4A3D J;  2BY1 A;  1U78 A;  4AM3 A;  1VZ0 A;  3K9T A;  2EA4 A;  1VQ9 I;  3BP8 A;  3CMA P;  5K5O A;  3S3M A;  3JCU E;  3JCU C;  3JRD A;  1FZF A;  1KYO H;  2YKP A;  3H1H G;  4XNF A;  2LFB A;  3F21 A;  4IEJ A;  3H5A A;  3ASO H;  3ML6 A;  5D5W B;  2L9S A;  1J9I A;  3F0C A;  5L3D A;  3B6A A;  2O8K A;  5JVG F;  2VOP A;  2HYG D;  1HBX G;  1CQT A;  2YNY A;  3ZGK A;  1SVM A;  3CO7 C;  3CP8 A;  5AVX B;  2WSS H;  1FU1 A;  4BQN A;  2YU9 J;  5JR3 A;  2XC7 A;  4TV7 A;  4A3E J;  1IFJ A;  1SQV J;  2ZYA A;  4YPC A;  1UG2 A;  3C2G A;  2EZK A;  1S72 I;  1RQV A;  3CJT B;  2WSE J;  4QTR A;  2HVR A;  3HD7 D;  2EA2 A;  4XRF A;  2X9D A;  3A0B E;  3V4Q A;  4M6X A;  2FQ3 A;  3KIO A;  3KZI H;  3GX4 X;  4HPQ A;  2Y69 H;  3RPU A;  3E3V A;  5EZH A;  4ENM A;  3RKQ A;  2M8R A;  2RH0 A;  5CMZ A;  2PJR A;  1Z7U A;  5DM6 F;  3QPL A;  4C2T A;  1TWF J;  3REO A;  2AQF A;  5LRR A;  2A61 A;  2WBM A;  4N0B A;  1AA7 A;  4RB3 C;  4LG0 B;  2PJP A;  2ZO4 A;  3S1M J;  1MSF C;  3B5N A;  1KFM A;  1KC8 Q;  3LSR A;  3FZV A;  4Q47 A;  5DJT B;  4IFD K;  2D1V A;  4JYK A;  3II6 A;  3N7N A;  4BBR J;  3A3Y B;  2LDU A;  3K1N A;  1V5G A;  4UVC A;  3A01 B;  4U3F D;  1YJN P;  2HQR A;  2E19 A;  4BXL A;  1R8E A;  2DOE A;  3VB2 A;  2MD5 A;  2FBI A;  5E3O A;  1B8I B;  3PQJ A;  1ZQ3 P;  5LLQ A;  2WQY C;  4Y17 A;  3HGY A;  3W2W A;  3R61 A;  1VQ4 P;  4CUG A;  2PAJ A;  3CC2 I;  4QPQ A;  3HTK B;  3Q5R A;  3UKG A;  3SSU A;  3JCU H;  2DW4 A;  2RKL A;  5LGT A;  3MD0 A;  4IXA A;  4HV5 A;  1IK9 A;  2IZ1 A;  3LSK A;  5CJ9 A;  4BYY A;  3MCZ A;  3L70 J;  1FYM A;  1WH5 A;  2H7H A;  1IN5 A;  3QOP A;  4WF2 A;  2LTP A;  4L9J A;  3SFI A;  2UUZ A;  5LHH A;  3GLM A;  5CJ0 A;  5E79 E;  2IGN A;  2LYC A;  2POH A;  1JHF A;  1T2K C;  1YI2 I;  4AU7 A;  3L35 A;  3LIE A;  3MUD A;  2K9Q A;  2JSC A;  1XCV A;  3DP7 A;  4A3K J;  2VOD A;  3R2P A;  4NHJ A;  1H9G A;  2XVC A;  3K0L A;  4B44 A;  2DMT A;  1DP7 P;  4M3E A;  3AL0 C;  1LFP A;  5BMZ A;  3S1N J;  4F3Q A;  1S5L X;  1T8Z A;  2WA0 A;  4M74 A;  2AEJ A;  4L9T A;  2HDD A;  3ECH A;  1NTZ J;  5K5R A;  4X0G A;  2DXI A;  1HLV A;  2PGD A;  4ZKP A;  5KJ7 C;  1H88 C;  2Q8K A;  3B8E B;  1FT9 A;  3OS1 A;  5BOX A;  3L2C A;  2QA4 P;  3KZY A;  3FBI B;  3GME A;  3DLA A;  4GIF A;  2GOM A;  4D6T J;  1PP9 E;  1LDD A;  4FTH A;  2E5T A;  2DOA A;  4CHU A;  1N7L A;  1ULY A;  5F1J A;  4EDF A;  3BRT B;  4KIT B;  3ESW B;  1HW5 A;  3HPH A;  3FIW A;  4W97 A;  5F0C A;  1RHZ B;  2DA3 A;  4XQF A;  2PBI A;  3LSJ A;  3T97 B;  2ID3 A;  1ZKG A;  3FIS A;  2IP2 A;  3G1L A;  4I09 A;  2YO3 A;  5DS9 A;  3DTE A;  3VSL A;  1HKS A;  2FKW B;  2ZME B;  3HTS B;  2HDC A;  3SYT A;  1FSH A;  1Y47 A;  1SVL A;  1KB9 D;  1XMK A;  5B5E C;  4A69 C;  3K4K A;  2XAH A;  4KIB A;  2G7U A;  2COM A;  1KTM A;  3I55 P;  1QU3 A;  1RZ4 A;  1JUP A;  2E1N A;  5KNL A;  3MFK A;  2QSH X;  3QPS A;  2KFD A;  2QJK B;  4IX7 A;  1RES A;  3TP3 A;  4JBZ A;  3J7Y J; 
#chains in the Genus database with same CATH homology
 1LVK A;  4OAY A;  3L2Q A;  2WAE A;  3MKY B;  1TZL A;  1N77 A;  2VKD A;  3S8P A;  2LH9 A;  4DGW B;  3EPZ A;  3EUA A;  4CCM A;  2RQQ A;  2BVL A;  2CW7 A;  2R7X A;  1ZXG A;  2VLA A;  2LG4 A;  4JQF A;  4PJN A;  4F92 B;  3PH0 A;  1N78 A;  3DU5 A;  4AYB A;  2OTK E;  2BVM A;  1LP1 A;  3CP2 A;  2OC6 A;  1WJF A;  3VYU B;  3L2R A;  3OL3 A;  4IZZ A;  3SDB A;  2M7A A;  3VYS B;  2M7B A;  1EA3 A;  4B48 A;  3DKY A;  2ZSI B;  1W36 D;  4ZDL A;  3S3N A;  3UR3 C;  2DT6 A;  5FRM A;  4F93 B;  4N4N B;  2KZJ A;  3QYB A;  3KX2 A;  2DT7 B;  3LSH A;  3FKJ A;  2MFZ A;  4CCK A;  2Q1Z B;  1K6Y A;  4IKF A;  2Q1K A;  1SS1 A;  2CV2 A;  2QKL B;  1LKX A;  4HJG H;  2V9K A;  2MAB A;  3VDX A;  1NG7 A;  3OR1 C;  2IXS A;  4NPE A;  2KI7 B;  2QRX A;  2LY2 A;  1EC5 A;  4NPD A;  4E7Z A;  2AQE A;  2F4I A;  2LBF A;  5LD2 C;  3FXD A;  1T95 A;  4MN4 C;  1BR4 A;  3VYR B;  3IUO A;  3H5R A;  2A6T A;  3L2W A;  3S93 A;  1S9H A;  3DWL E;  3K4M A;  2P0W A;  4RLQ A;  2VJ4 A;  2M3A A;  1OVV A;  4YEJ A;  3L2V A;  3H9G A;  2RNG A;  4XN3 A;  4XOR A;  1D0Y A;  4C2U A;  1PJR A;  2KDO A;  4HB1 A;  3OYA A;  2V4J C;  2CH0 A;  3S1K A;  1MFT A;  2X6Y A;  4YEL A;  4NNJ A;  2KRC A;  5C39 A;  1YX5 A;  2E1M B;  2E5N A;  3ZQQ A;  3PUB A;  4HST A;  2LC2 A;  4ZTJ A;  4E4H A;  3K4C A;  2VL8 A;  3U21 A;  4BGD A;  4GOD A;  3RQ4 A;  3SZG A;  3CMM A;  2VJJ A;  4E7J A;  4E7S A;  2IS2 A;  4G6T B;  3S3O A;  4AVZ A;  2K9M A;  3K70 D;  2X85 A;  2Q2E B;  3ZXS A;  1NG6 A;  3UNG C;  4ZNC A;  3DTI A;  1D1C A;  2OV7 A;  4XON A;  4BS9 A;  2Z1D A;  2GOX B;  2CV0 A;  3OYJ A;  4JOM A;  4U7B A;  4ANJ A;  3OS2 A;  3M1C A;  2W7N A;  4ASV A;  4DIQ A;  4GOF A;  3K70 C;  3ZRG A;  3PJR A;  3OYD A;  3N05 A;  1MMD A;  2ZFU A;  4XKC A;  2VQH A;  2M0M A;  1Y56 A;  2V1N A;  2HDW A;  2XDV A;  3H9Q A;  4LG3 A;  1DP3 A;  3OR2 C;  4XLH A;  3RGU A;  1Y6I A;  2XSJ C;  3MMY B;  4F55 A;  1UG0 A;  1X4O A;  2BOL A;  3OYI A;  1UEL B;  4XR6 A;  5HOO A;  3DU6 A;  3DKX A;  3F9K A;  4BAC A;  4Y4R A;  4BQO A;  2LXB A;  2K3P A;  2ZXI A;  3K4B A;  4KJM A;  2HVS A;  5FRN A;  3CES A;  4WWI A;  1TT0 A;  3FHN A;  4ZMD A;  4ZYA A;  5KHD A;  2R7O A;  3FDY A;  2L9N A;  2MYS A;  4U87 A;  4BU2 A;  3NWS A;  4B43 A;  2DJI A;  1FMW A;  3EUH C;  3G2B A;  2Z2S B;  4BDZ A;  2K5C A;  3W2A A;  4B3X A;  3CZ6 A;  4ZC3 A;  3DPT A;  3HOS A;  2R7T A;  2LR2 A;  2A5W A;  4NPF X;  2VXD A;  1HA8 A;  2VJ5 A;  1DQU A;  3PL8 A;  2PJR B;  1X1B A;  3OIP A;  4LIT A;  2LRD A;  4XMY A;  5KCM A;  2W00 A;  2CFO A;  3PSF A;  4BJT A;  3RCO A;  2X1D A;  5FRO A;  3J7A Y;  1H0T B;  1W36 C;  1WFX A;  1WJD A;  2X6X A;  3K4N A;  3E0J B;  3PSI A;  2VQC A;  2M4K A;  1MMG A;  3MHV A;  3BG6 A;  3DPU A;  1D1A A;  1LP1 B;  4LIV A;  3W3C A;  1G59 A;  4K3A A;  3HPG A;  2OUM A;  4ZDO A;  2IGM A;  5EFW B;  4IQ4 A;  2M5A A;  1DGR M;  3OYG A;  4XLF A;  2V26 A;  1EDI A;  2VIX A;  5LFA A;  1MW7 A;  4J00 A;  3IP4 B;  3K4L A;  2M0B A;  2XF5 A;  1P9Q C;  2QKM B;  2X6W A;  2M4G A;  2LRE A;  4DBR A;  2L5Q A;  3CF2 A;  4XKW A;  1ZEL A;  3OL4 A;  2P58 A;  1H0T A;  3D5S C;  1D0X A;  3K4J A;  3QYE A;  2B87 B;  2WAF A;  4Y3O A;  4F52 A;  1OVR A;  4XN0 A;  2R7R A;  1ERD A;  2CS3 A;  4FET A;  4MLO A;  3H35 A;  3ZCO A;  2HZD A;  4BXF A;  4D9J A;  4PFO A;  2UWM A;  2B87 A;  3OS0 A;  2LXC B;  4NC7 A;  4BJ5 C;  4N4O B;  3HUG B;  4KT6 A;  3HG9 A;  3RTR A;  2VQL A;  3OMY A;  4GRI A;  4J01 A;  2VAS A;  4II2 A;  2HPI A;  4DJA A;  1X4P A;  3PFY A;  3OY9 A;  3A4C A;  3D5R C;  2O5R A;  1WJE A;  4LIU A;  3SEQ A;  3W2V A;  3OWT A;  2WY8 Q;  2JA2 A;  3I3L A;  1DGW Y;  1BR1 A;  4XL9 A;  1Z3X A;  4C30 A;  1WJC A;  3TL4 X;  2HQA A;  1QHH D;  2B89 A;  2E5Z A;  3K6G A;  3OOU A;  5JHF A;  2DCE A;  5CBN A;  2VB6 A;  2JSP A;  4PFP A;  2K9L A;  1FMV A;  1MMN A;  2WAD A;  2V6E A;  3QOE A;  4CH7 A;  2B88 A;  4XOP A;  1X1A A;  2HU9 A;  5HNH A;  3BCB A;  3D5L A;  3A1Y A;  3HC7 A;  4BL0 B;  1R6R A;  4PK4 A;  2PMZ A;  3BG7 A;  1G8X A;  1D1B A;  1SAU A;  2ZSH B;  5TGT A;  3OIQ A;  4IOI H;  4BJ6 C;  2R7S A;  2JVG A;  4P5O A;  3SEZ A;  4CCO A;  2X51 A;  4XM3 A;  4HG2 A;  3QOD A;  3MKZ A;  2R44 A;  2KZV A;  4XOT A;  4E7L A;  1X19 A;  3IAM 2;  2XF6 A;  3NWT A;  2KP6 A;  2IS1 A;  3DQV C;  3PNV A;  2BW3 A;  1GLN A;  2FUG 2;  1EDK A;  2IGK A;  3LMM A;  2XAU A;  1Z21 A;  2W1O A;  2L7K A;  2ELJ A;  4BE1 A;  1DEE G;  1YE9 A;  3OYL A;  4Y33 A;  4DOZ A;  4KIS A;  1MMA A;  2KPM A;  3ZR8 X;  3DTK A;  4CCL A;  2E60 A;  1U7M A;  1OVU A;  4YRV A;  4XLC A;  1JMB A;  2KMU A;  2X1E A;  3BCA A;  2NOJ B;  3AL0 B;  1Z7L A;  5CBO A;  4XLA A;  4RM2 A;  2R7V A;  3FBN B;  4HEA 2;  4CZC A;  2BW3 B;  2VQG A;  3RSN A;  3ONQ A;  4BUP A;  1EDL A;  4PJL A;  3BLY A;  1J09 A;  2SPZ A;  3KEY A;  2LBF B;  2WB1 A;  3S32 A;  3LFU A;  2RRE A;  4QPO A;  1BR2 A;  2CUJ A;  3CJQ B;  1JM0 A;  4BEH B;  3C2H A;  2LOO A;  3KYL A;  4ASW A;  5CQE A;  4CCJ A;  4NUB A;  3HXL A;  3PNT A;  1LDK B;  4CA0 A;  3A2K A;  2KRH A;  2MC4 A;  2QVA A;  2UWJ E;  4II3 A;  1E0E A;  2M5A B;  4C9Y A;  3AKZ A;  1KON A;  3MD2 A;  3V42 A;  1ZW0 A;  2VXZ A;  1BDC A;  5HVQ C;  4ITV A;  4RLF A;  1JI8 A;  1BOB A;  1VZ0 A;  2CV1 A;  1FC2 C;  3S3M A;  3BC8 A;  1LT1 A;  2CW8 A;  4XNF A;  1S3J A;  3H5A A;  2KQR A;  3MZW B;  2L9S A;  2KLO A;  1YX3 A;  4XLE A;  2Y0S A;  4K35 A;  3LSM A;  1U7J A;  4ZDP A;  2R7W A;  3M8J A;  3ZGK A;  3DEE A;  2JUG A;  4KJZ A;  3CP8 A;  1IRX A;  4GOE A;  4BQN A;  2IGO A;  2XC7 A;  5HNF A;  3C2G A;  2KUB A;  4PSX A;  2HVR A;  1EDJ A;  3LSI A;  4HKZ H;  1SFK A;  4HPQ A;  1WJB A;  2R4G A;  3PNY A;  2I8D A;  2V7F A;  2PJR A;  4C2T A;  3LL7 A;  2AQF A;  4ZTF A;  1BDD A;  2WBM A;  4HSR A;  1AA7 A;  4XKB A;  4D1Q A;  4IQJ A;  3H0D A;  4E7H A;  4NC8 A;  5DJT B;  3OYH A;  4EYY Q;  3GBG A;  1U0J A;  1V5G A;  3OYF A;  5CKT A;  4PUS A;  2R7Q A;  2WAQ A;  3IAS 2;  3OYN A;  1UAA A;  4BXL A;  1OLT A;  2L2O A;  3K10 A;  4PSW A;  2F6C A;  3TBI A;  2MD0 A;  3HOT A;  2IS6 A;  2ZAE B;  2X1C A;  3DPL C;  3W2W A;  4E6K G;  3HL2 A;  1MNE A;  3CJR B;  4CUG A;  3VWB A;  2JWD A;  2Z16 A;  4QPQ A;  3AFH A;  3QWO C;  4CCN A;  2RKL A;  4HNT A;  3TMO A;  2KL4 A;  3LSK A;  1V5F A;  2HPM A;  2XF7 A;  4PJM A;  4HNU A;  1V5E A;  5DJU B;  2W82 A;  3OYB A;  2UUZ A;  5CQG A;  4BE0 A;  4HRI A;  1X0T A;  1X1C A;  3HKZ A;  2K3R A;  2IGN A;  2KIK A;  2LYC A;  4RMN A;  1WJA A;  4AU7 A;  5K5G B;  1NVO A;  4R79 A;  1QHG A;  1MND A;  1T0F C;  1WJ5 A;  4B44 A;  3AL0 C;  1LFP A;  4BQQ A;  4F3Q A;  1Z3Y A;  2WA0 A;  3H9J A;  2HR3 A;  2HNH A;  2KHM A;  2VKH A;  4PJJ A;  4X0G A;  2DXI A;  4H4K C;  2W4S A;  2LY1 A;  2E1M C;  2VJI A;  4OAZ A;  3OS1 A;  3MKW B;  2VPL A;  4BE2 A;  3FBI B;  3DLA A;  2GOM A;  2R7U A;  2CUZ A;  2CMP A;  2DOA A;  3OYK A;  2WY7 Q;  4E7K A;  4FAS D;  5CPR B;  4BEH A;  4KIT B;  3I9V 2;  3ZDM A;  4XKV A;  2F5V A;  3OYC A;  3HPH A;  2KZI A;  1Q2N A;  2UV1 A;  3FXE A;  4EAT A;  3E1S A;  4CSW A;  4XQF A;  4BDY A;  3RPU D;  3H5N A;  4ZJZ A;  1N75 A;  3LSG A;  3DTE A;  3VSL A;  1X1D A;  3SYT A;  4NQW B;  3OYE A;  1Y47 A;  4RM3 A;  4DBQ A;  2IS4 A;  1OR7 C;  3OYM A;  2JVH A;  3L2U A;  3K4K A;  1D0Z A;  4E7I A;  2WMM A;  2KS1 B;  3QYF A;  2ZXH A;  3VYT B;  2HVQ A;  1QU3 A;  5KNL A;  4CPG A;  4OWR B;  3VSK A;  4P1W A;  4B47 A;  3EUK L;  1PYV A;  5HLT A;  4IX7 A;  4F91 B;  4JBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...