2I8DA

Crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
GSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized conserved protein of COG5646 (ZP_00384875.1) from Lactobacillus casei ATCC 334 at 1.69 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Structural genomics/unknown function
molecule keywords Uncharacterized conserved protein of COG5646
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2i8dA01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2i8dA02
4GOFA 3S1KA 5DJTB 4GODA 2M5AA 4HB1A 2K3RA 3QWOC 4ASVA 4ZMDA 2B89A 2P58A 5K5GB 2KL4A 2KS1B 5EFWB 4IOIH 4CPGA 1FC2C 1SS1A 1U7MA 3FXEA 1JMBA 2M5AB 2HR3A 3FXDA 2KUBA 5CBNA 4NPFX 1MFTA 1BDCA 2M0BA 4BXLA 3MHVA 2WMMA 1OVVA 1BDDA 1EDIA 2Q1KA 4HKZH 4K35A 4K3AA 1EDJA 2OC6A 4JBZA 1EDKA 1DEEG 4KJMA 2LXCB 1LT1A 3MZWB 1NVOA 1ZW0A 2QVAA 2ZAEB 3RGUA 1LP1A 2B88A 4NPDA 2UWJE 1S3JA 1EDLA 1X0TA 2RKLA 2SPZA 2I8DA 5C39A 2KZIA 2KZJA 1EC5A 1OVUA 2QRXA 4MN4C 3PH0A 4WWIA 5CBOA 1LP1B 1H0TA 4EYYQ 1ZXGA 2R44A 1H0TB 4GOEA 4ASWA 1OVRA 1Q2NA 1JM0A 2OTKE 3ZDMA 4HJGH 4ZNCA 2B87A 2LXBA 2KIKA 2B87B 2KI7B 1U7JA 5DJUB 2JWDA 2LR2A 4NPEA 1Y47A
chains in the Genus database with same CATH superfamily
4YIFA 3W2AA 1NTZK 3S1KA 4BNCA 3CC2P 2KPMA 5F64A 1M57D 1RZ4A 2HOAA 2HZTA 1QPMA 4X1EA 2MLGA 2JA6J 1MBFA 1SQQG 3KCCA 1WI3A 1G1JA 5BU5A 1FX7A 1G8XA 2Y0CA 4ASVA 4RJTA 3ABMH 4ZMDA 4HQMA 4IPAA 3W6VA 5JVTA 3DKYA 1ON2A 1ZK8A 1WFXA 4QTRA 4MHGA 3M1EA 3H1KJ 1B72A 4XR6A 2XV4S 4KIFA 5BNGA 2WSCH 3R60A 5K1YA 1JTXA 3CMAI 3HRTA 5IT9Z 1JY3N 1R23A 3KYQA 1XMXA 4Q4ZF 1RE3C 3SFDC 3CCLP 1AFOA 1S5LC 2DA7A 4NNJA 4DIQA 3GHGC 2QKMB 3FXUA 1IFNA 2ZJRF 4KFCA 2A6TA 5LBQA 4HNVA 2N1TD 2R7UA 3LA7A 1XTAA 2POHA 2KOGA 2F5CA 1L0LG 5AW8B 2YXQB 4D6TG 5CBNA 3PLNA 2NVXJ 1AKHA 2EK5A 1L0ND 4L18B 3LIEA 3CF2A 1X79B 1BA5A 1L0OC 4OU0A 4G7HF 1SLQA 1FDMA 3RK3C 5LRSA 3KP6A 1GK6A 1HOMA 3RJPA 2GIZA 1Z7UA 1NTKG 1BW6A 5KAFE 2DDAA 2YUSA 1XDSA 4FX4A 1YI2P 1SFCA 3ABLH 3QPTA 1QU3A 1MNDA 3I0TA 2OD5A 1H8AC 1AWCA 5LEJA 1N78A 2O8XA 4MEYF 3F5HA 3L74E 3K9TA 4HKZH 3VYIA 3T8RA 4AM3A 2TRTA 1K79A 3T97B 4U87A 1M1JC 1E79H 3GO5A 1ZR2A 3CMEP 5CCGC 3KLOA 1V5GA 2X4HA 1DD4A 4L73A 2DA3A 3N05A 2G7HA 1FZEA 2KKOA 3H5RA 1VQLI 3C1LA 2CG4A 5DUKA 5CVVA 3SQNA 4LGWA 4F93B 3ZMTA 2KYVA 1JUSA 1AU7A 4UB6E 3CDLA 1YHQI 4XORA 4EGYA 2YKPA 3II6A 1YE9A 3OSGA 3D5LA 2GA2A 2ZT9B 2M8GX 1ZLLA 3HGYA 3NWTA 2XPUA 2EZLA 2Y48A 4DYCA 1P2FA 4E7LA 1EZVG 1VF5D 4IVNA 1BCCE 2E60A 3FXRA 5HLIA 1P4AA 4ZDOA 2AEMA 3GTQJ 1U8BA 3GUDA 1X19A 1QQIA 2KRCA 1ETOA 2VB6A 3C2BA 3H9QA 4YIIA 1PUEE 3S16J 2O01H 4HQEA 2KIUA 3TW6A 4LLNA 4ON0A 3WTUC 1LNQA 4G6QA 2DYRH 2BEZF 1R5HA 3RK2C 3TDKA 3M4OJ 2LC2A 3HPHA 4LITA 2OQQA 2Z5UA 1OR7A 1M7LA 1BGYD 3AEDC 2Q7CA 2CQKA 4LMYA 3D6YA 3TDUC 3L73J 2CYYA 2DW4A 1FBUA 2AQFA 3ECOA 1T0FA 3S3NA 2YKQA 2CQ7A 1J0RA 1JJ6C 5AW3B 4Z2YA 5BU8B 2O1JA 1TW3A 1Z77A 2ZXHA 1I39A 1FT9A 1KQLA 2LR2A 2VRSA 2R0QC 4G9YA 3VMZA 3LW5H 3WTXC 4OOIA 3TOBA 2QM7A 4BQAA 1CI6A 4I6MC 3S2HJ 4HAMA 2VBZA 1RF1B 3L2RA 1FZCB 2WWYA 3AG1H 1SQVG 1Z56A 3F21A 1D5YA 4G7OF 1W36C 1KB9D 2X51A 4IHVA 3TGUG 1ENHA 3W67A 1BOAA 4KDPA 1BC7C 3D5RC 4LK0F 1ORKA 2V6EA 1N7LA 1NYHA 5EFWB 1W0UA 2F4IA 4CDGA 3H1IE 1FC2C 4RAFA 4M3LA 1R5GA 3V7SA 1L4AB 1NAFA 2CW0F 2L9SA 1USSA 3CC2I 3FX3A 1B9MA 1FYLA 1KQ9A 4HA8A 3L7WA 3HD7B 1NHLA 3CO6C 1WWXA 2DJIA 1NTMK 3H1HG 1N73B 1FOXA 2ID6A 2OCCH 4JYKA 2KUBA 3Q5SA 1IN8A 3H1CA 2ZFUA 3GF2A 3OL3A 4BY7J 1KA8A 3AE3C 1RF1C 2HXIA 2JTVA 1A02J 1JI8A 4BXLA 2E5ZA 2M45A 4IL6X 1SQVK 1HKTA 2KK7A 3D5SC 4B86A 3DEEA 3G6EP 3G71I 3BTJA 1FE6A 3K4BA 4C3JJ 2DPUA 2OF7A 2QUFA 4QMAA 1K78A 1SVLA 1BCCD 3S3MA 2LKPA 2OQGA 1VQ7I 1GMJA 2E5TA 2JDIH 2WWWA 3RL0C 3H0DA 1LDKB 4HYEA 5C4JJ 2IBZE 3S1NJ 3A4CA 2BCCJ 2E75B 3LMMA 4EJWA 1L2PA 3V4WA 4A3EJ 2WAFA 4BQQA 3MZWB 3ZXSA 1KORA 2R7XA 3L35A 1R36A 3KLNA 4KMUX 5KK1A 5BVZA 5AW2B 3CCRI 2UWMA 1KYZA 1USTA 5DD4A 2HPCB 3CDIA 3ZMUA 1S4XA 5TJJA 3RBXA 3RYRA 3KQGA 5LD2C 5F1JA 3K4KA 3H3ZA 3KPHA 2JJ7A 3IFMA 3MP7B 5C39A 2QLZA 2W1OA 2IGOA 5APSA 1F36A 2P6TA 2ZC2A 2QGUA 3H92A 1OVUA 2KXPB 2JA7J 1QGPA 1Y39A 4QSHA 1AVYA 1GW4A 5ERIA 3I64A 3O2PE 3BPVA 5DM6F 4Y13A 3J80K 1D8JA 1IFMA 5HOOA 1NKZB 3DTKA 3K5BA 1NU1D 4HPQA 1BI0A 1MSFC 1FOSE 2FXOA 1A6QA 2IW5A 3L2CA 2AXTC 5JI6A 4RB3C 3DCFA 1P6RA 1VL2A 5GPCA 2VODA 3SFEC 1T3UA 1FZGA 1NOHA 2YS9A 1UAAA 4AYCA 4P96A 4RGSA 4HX4A 2P5VA 3TYYA 1KTMA 3QU3A 5F0CA 4HLXA 4OWRB 1TU3F 5A2QZ 1S5LH 1R1VA 4PSWA 1A04A 3D0SA 4UV9A 4JX4A 1WJBA 4AIHA 2BCCD 3FWEA 2NZ2A 1VQNP 3C9IA 4WBAA 2DI3A 2Q9IA 1ETYA 1IDZA 5HVQC 4IL6H 2NPSB 3CCMP 1LTTC 1KD1Q 5HS7A 1SD6A 2CH0A 2G7UA 4ZYEA 2JJLA 2KSJA 5APUA 5ILUA 1RF0C 3CCQP 4UUSB 2VE9A 3J7YJ 3B6CA 4EGZA 2ZB9A 3OL4A 2EPFA 4IL6E 3QWOC 3VOPA 1FBSA 3FHZA 3HKZA 1Z91A 3LQRA 3R4KA 2A07F 2NYXA 1A31A 2IRFG 3H6PA 4PUSA 3E1RA 4AIDA 4UVAA 1B72B 3JCUH 1OJLA 2JT1A 2KL4A 2YU3A 1REPC 2O9LA 1JT6A 4OGQB 2GUVA 1BBYA 1NH4A 2QQ9A 3BCCJ 4PJ0C 3MZYA 2DCEA 2DTZA 2W48A 3CCMI 4O3MA 1OW7A 2HFED 4GDOA 2A06G 5B66H 3H3UA 5B5EH 3KP2A 5CJ9A 3CMMA 5FRNA 2N9YB 1QA6A 4GYIA 3RK3D 4H0LC 3AE2C 3L71G 1IN4A 2HR3A 3FK7A 1OR7C 4Y99C 5H2FE 1Z21A 1X3WB 2XRLA 2I1KA 2IFMA 4PD4D 3AE9C 5GAGJ 1MFTA 4PJ0H 2E74C 1HJ0A 2PMUA 2CV1A 3VTPC 3PQJA 4UUTA 3TGNA 2FJ1A 1EXIA 1SMYF 2FD5A 1GT0C 3QQAA 2E76B 3B73A 2Z1DA 3WG9A 4D9JA 2DFHA 4IJAA 3M8JA 4II3A 5D6EA 4CCOA 1SQXG 4I7ZB 1S9KD 1XCVA 3S3OA 1RHZB 3PL8A 4CSWA 4XNFA 3OYMA 1HKSA 1UG0A 5E1XA 1KZHA 3HL2A 4MEXF 1FJLA 2E76D 5KLVG 2XNDH 5HDGA 2OTLP 3KFWX 1FY7A 1NTMJ 2ITAA 2C9NY 1NTKE 2FE3A 2IJLA 3FK6A 1HF9A 4U7DA 3HOWJ 1BIAA 5KAIH 1SQPG 5DV5A 1TBXA 1LTGC 5KLVE 2Q2EA 3LSJA 3H1HJ 1TZLA 1LFBA 2EIMH 2XF6A 2Y75A 3Q0VA 3BR3A 3H1LJ 3TMOA 2Q1ZB 1TL8A 2LLKA 1S1CX 3KZZA 1P9QC 2GQQA 3DEWA 3QAHA 1SQVD 3PP5A 3CWBD 1GVDA 2Q3IA 3HSEA 6PAXA 3ZGKA 1GL2D 2RGVA 4UVBA 4GGGA 1IFIA 1QO0D 4JBAA 2VASA 2RKLA 3TF5A 5FKNA 2D2CD 3DEUA 1UMQA 1IV6A 2MJZA 3IH3A 4N4NB 3AEBC 1OCRH 1IN7A 4UV8A 4C3IJ 3K4NA 4D7NA 2BCCE 3CZ6A 3ITKA 4MIMA 1SVOA 4WCGA 3FGAD 2YX7A 3F8MA 1IFJA 2EH3A 4ENJA 4NC7A 5H2FH 5BPDA 1BOBA 3HDDA 3RPUD 1ZHFA 3GCMA 3B4SA 1ZXGA 1FZAA 1BCCG 1WJDA 4GOEA 2VPRA 5IYDJ 3KZIE 4BY1J 1BI3A 2J59M 1OMIA 2C9LY 2BV6A 4A69C 3M8FA 1LWUA 2OAZA 4OIOF 3LOCA 3RQ4A 1D3YA 2KNCA 3V7RA 2MYSA 1W5TA 1SQQK 3BCCG 1F1ZA 1D1AA 3K2ZA 4GCVA 2O1KA 2QYOA 2YXRB 2JK3A 2FFDA 2QSIA 3U1KA 4H0EA 2WB1N 4ASNA 1IG7A 1KB9I 2HPCA 3W6KB 4M6VA 3DTEA 3T8TA 3AG3H 2R5YA 2EFWA 1SQBD 1KU2A 3OYKA 1S72I 1K8AQ 3RYPA 3A1YA 5LHGA 1GUUA 4L9VA 5HLHA 3HOXJ 2H27A 1T2KD 2PJPA 2DK5A 2K3RA 3OYNA 1LTBC 2VKDA 1QX8A 3L70D 1YS7A 2X48A 5IP7J 3LWFA 2MGQA 2B89A 1X58A 4UB6C 4OVNF 4H44C 3FMRA 2R7VA 1BE3G 5FFZA 3OYAA 1Z05A 4G6TB 1HDPA 3SWKA 2E43A 2RN0A 3NEUA 1W2EA 2VXZA 2KS1A 3HD7D 4XA4A 4DJGA 2ZNZA 3Q5RA 4G12A 2O6GE 3S32A 2KDZA 3S2DJ 2R5ZA 2W00A 2LH9A 3F6VA 3JRHA 3M1CA 3CXHE 4ZTJA 2FYNC 4RB0A 1YJWP 3M9BA 2JKVA 4PD4H 2HS5A 2NRAC 1HUCA 3Q9SA 3OS2A 2X1CA 3L71D 2HGCA 3KZIH 5DCMB 1YJ9P 3EQLF 2X1DA 3KX2A 3CD6I 2WSCJ 3HM5A 3S17J 2D2WA 1KQGB 4LB6B 3V2RA 3M0AA 1DPRA 1WJ5A 2M30A 5J6XA 5CVIA 3CCRP 3J81K 2XV5A 2MSYA 4N9IA 4IRHA 3I58A 2C0XA 1U9NA 2K9QA 1KYOI 3MQ0A 2XUBA 3CO7C 1X2NA 2ADUA 3ZQQA 2CK3H 1U9OA 2Q1KA 5E3LA 2OC6A 2J58A 4HBLA 3L1PA 3SSUA 5EGOA 1QHGA 1YTYA 3L72J 1FP2A 3L72E 2L2OA 3F8NA 2L91A 3H1JJ 2LD5A 1YHQP 1HBWA 2PJRB 1TQIA 1YOVB 3BJOA 3I71A 4TV7A 4GDFA 2VONA 3BR2A 2OYHC 2ZKZA 3SXYA 3V42A 3VSKA 4W7YA 3HG9A 2KT0A 1BE3D 4R8HA 2OCEA 3FXLA 1QHHD 2K86A 3O6QA 1BI2A 5M5XJ 4ZDPA 1ZLKA 1ZRFA 1KZUB 3EPZA 1M1KQ 2HOSA 1A35A 3RL0B 3OSFA 2EIKH 4M9ZA 2F2EA 3HSFA 2GA1A 4UY8I 1EV7A 3MZHA 1SQBK 3JW4A 4Y17A 5HLTA 3N97A 4ETSA 1HH0A 3RKYA 5AW9B 2W8ZA 5ICEA 1NTKD 1EZVD 3OIQA 4LIVA 1EZVE 1K9MQ 4G7ZF 2X6XA 4OWFA 3FXQA 4D5FA 3NMDA 2FFDB 3DU5A 5KAFC 2XPWA 1KFNA 3MTUE 1R22A 3GHGA 1XMKA 2QJKC 2STWA 4YEJA 3G4SP 1R7JA 2DLLA 1E5WA 3H1KG 2RQQA 4N78D 2CQQA 3L4FA 4OIQF 1ZELA 3HTUA 3ISPA 1L0LK 3ZDMA 1D0XA 1DD3A 4XICA 1GW3A 1R00A 1WJEA 3HD7C 3L73E 2LR8A 4N3YB 4UB8H 2XAUA 4ZNCA 4FE7A 3RSNA 2NOGA 1OKRA 1OYWA 4CYDA 1XS9A 1H89C 1Q81Q 2M34A 3CCLI 4GKGA 3BCBA 2IZ0A 3A0BH 5AW6B 1NK2P 1RF1A 5APYA 1X1CA 2K9JA 2PRRA 2YO3A 4WY4A 1DIPA 2M5AA 5M1BA 1WI9A 5FD5A 1N8RQ 2PP6A 2MW8A 2L7MP 2HG5D 4HYTB 3QU6A 2WV0A 1KILC 3OS0A 1YJ9I 1FC3A 3OS1A 2ZO4A 1K83J 3TGUJ 4WXDA 1N77A 2GUSA 2XRNA 4A6EA 1J75A 4OIRF 1IUFA 1FJKA 5K5QA 2FOWA 2EB7A 4BKXA 2BEQD 1MMGA 1ETWA 4AVPA 3L00A 4M9SA 2K4BA 4UB8E 2E5YA 2WPRA 3LSKA 1IDYA 2ID3A 2M5WA 1KYOD 1JB0J 2AQEA 2E71A 5K5OA 4JP0A 1IFPA 1N86A 2RNGA 3CWBJ 1BSHA 1IF1A 1XMAA 2BBYA 3BJ6A 3MCZA 2H1KA 2H94A 2J5PA 3H36A 3A2KA 3ABUA 4IOAF 2CMPA 1SFUA 3FXDA 2JPBA 3E5XA 3A0BE 4HH2A 3H1HD 5F0FA 1OCCH 1ULYA 2EINH 2M2EA 1LE8B 3J7AO 2DQLA 2BHZA 2WSEJ 3LIDA 2AEJA 1UHWA 4DZPA 1IGNA 1NHAA 1H9GA 2DT5A 2P5LC 1URQD 2JMWA 1JKRC 3N4MA 3TEDA 2LNBA 4ZDLA 2PFXA 2LKSA 1YBKA 2QM8A 1N7SA 2OQRA 2F5DA 3ZCOA 1B59A 4N4OB 1DUXC 2B0LA 1G6NA 4IZZA 1LWUB 2LKMA 4L74A 1ETXA 4XLAA 1ZLJA 3IR9A 4BL0B 4R1HA 1J1EB 4G6DA 1YTZI 1O3QA 5FLXZ 2IVMA 2VN2A 2XF7A 2Z99A 4YIRX 1YFHA 1W5CE 3E1SA 5IT3A 3VP9A 4IOCF 4E7SA 2E1OA 4I99C 1FZFA 2QA4I 3CLQA 3MKLA 1AQTA 2A45H 4PGHA 1OW6A 1ETQA 3TO9A 2P1JA 5F04A 4FHTA 4WF2A 4J19A 3LSRA 3OV8A 4A3IJ 1X22A 3FKIJ 1NG7A 1GD2E 1JHHA 1W7PB 3Q0WA 1SQQD 1V5FA 1O7FA 3T97A 1R71A 1DU0A 1P84H 1CF7B 1EH7A 5CQGA 4CHUA 3PH0A 4WXHA 4BXXJ 1V3FA 2ZNYA 4KT5C 3ASNH 3PIPF 1NU1J 4H0LB 3RK3B 2BCCG 1PZQA 4ABZA 4BACA 3FXMA 4XMYA 3FBNB 5J1RA 1LGHB 1P84I 3GLMA 3A01B 1YJNI 3HYIA 2VPLA 3F3XA 3KE2A 2R5ZB 3UKGA 1HGVA 3OA7A 2NVTJ 1HSJA 2GBYA 5J4YA 2X6OA 4A3FJ 2AEFA 2FBIA 3GTGJ 1TWHJ 3M0DC 2RH0A 2M4GA 1FBQA 4C3HJ 4IHSA 3CF5F 1FDIA 3L2UA 1AOYA 2YIUB 1K04A 1QL2A 3O8HA 4A0YA 4B3AA 1YG2A 1O3RA 2ZXEB 3DU6A 3IHUA 3BG5A 1S72P 3BG3A 1GK4A 3RL0D 3H0GJ 3ZQFA 1DX7A 1SVMA 2D1HA 2VJ5A 2ETHA 3QWLA 1X3UA 4U88A 1JE8A 2QBYB 3GEZA 3FXJA 2H88C 5GTIE 4F91B 1USEA 4UUSA 3M3YJ 2ZVOB 2O8KA 1E3PA 4AIJA 3QODA 2W83C 1SQXE 1B8IB 5E3OA 3TO7A 1KILB 3OW2O 5L3GA 1TQMA 4BE1A 4HV5A 3VODA 1O3TA 1OCTC 3RTRA 1KV4A 5L3DA 4U7BA 1W7PA 4IFDK 4OMZA 2XB0X 4XOPA 3K70C 2O0YA 4PFOA 1IRZA 1VTNC 4J00A 2HFHA 3G73A 1OXZA 3GFJA 1J1DC 5FO5A 4U0YA 4IRGA 4YPCA 2WZ7A 4OAZA 1OZHA 3BPXA 3BDDA 1M90Q 5JR3A 1OFCX 2JRMA 4XRMA 5EG0A 3G71P 3A01A 3E7KA 3SWYA 4RM2A 3HRUA 5TISC 3SEQA 3OYIA 3CCVI 3RZDJ 3FXEA 3O6QB 3P7KA 1TLHB 4DCKA 3DQVC 3E0JB 1L0NG 1NJIQ 1T3JA 4LIUA 1LDJA 1Q1HA 5DCMA 2XKOA 3I53A 2X0LA 1IK7A 4NPFX 1WZ2A 2EIJH 1BDCA 5AVSB 1YRNA 2H6BA 2NVUB 3TDZC 1TT0A 1ZOYC 1EZVI 1EA3A 4FT8A 4JYBA 5EF6A 3M0DA 5M5YJ 4UUVA 2WMMA 1AV1A 1SD7A 2GXAA 1IO4A 2DMTA 1FS0E 4XSZF 5CPRB 3VYUB 5HNFA 1K6OA 3EQ2A 3P7NA 2XF5A 1SFEA 3FXOA 4D6TD 1HQCA 1EDIA 2VBWA 4KYWA 3IAOA 1RKTA 1PFIA 2R7WA 5E1WA 2DA6A 4DYQA 3IRRA 1EJ9A 2E75C 3DXJF 2WSFJ 3OYGA 1VQOI 4PD4E 2W82A 3S4RA 3D70A 3Q2YA 2K1AA 4WB4A 1FP1D 1O7LA 3DPLC 3MMYB 4KA4A 3V5BA 3L70E 2M0MA 1U3EM 1Q1VA 5LLQA 5D4RA 1VPCA 2WPQA 2WAQA 5E79C 3V6IA 4I02A 3I56P 2RVCA 1K78B 2VC0A 4A5NA 5K7HA 2BHYA 4LOCA 5FRMA 4CXFA 1R49A 1ZGAA 5K5RA 1SQPD 2KLVA 4I1LA 3KYCB 3ESWB 3QPHA 4E4HA 1J2JB 3TP3A 3U9GA 3CC4P 1P7JA 2LY9A 2JRTA 1U6GA 2WV1A 2Q2EB 3KEYA 4UVCA 3F22A 5TISE 5CBOA 1OYIA 3HBLA 4LD5A 2Q8KA 4CYCA 4BRYA 2NVYJ 1LP1B 2MH9A 2H1LA 1E3HA 1B6AA 2KJBA 3IV5A 4IQJA 1N7SC 1SFCC 1SQXK 1XSVA 3WHCA 3RK2B 2WT7B 1JUMA 2VBXA 3HUSB 2EV5A 2AXTH 1LVAA 4W80A 2F5FA 2HVSA 4XONA 5D4SA 3OAKA 1T6SA 1ZKGA 1PGPA 2EV0A 1JMMA 2BEOA 3K7AJ 2XAHA 3L73D 3CESA 2E1CA 2HDCA 1SQPK 1PJRA 4RA2A 1WJCA 1BGYJ 2CV2A 3CWBG 4MNUA 1W5CC 2WADA 2B87B 2IPQX 1KMIZ 3P8CE 4DGWB 2ZT9C 3LAPA 1FZCC 4OMYA 3S1MJ 1IC2A 3W3CA 2IBZD 5GTIC 2JWDA 4D6TJ 3CCJP 5DJTB 1HXDA 1T33A 3JSVC 5TISH 5FKMA 5GP9A 1ZGWA 4IHXA 3KP7A 4LK1F 4RAGA 4J01A 4I2OA 2LF8A 1CI6B 4U3FD 1FZCA 2ZSHB 1RE4A 5IP9J 4CCMA 2CGPA 2VI6A 4RGRA 3MKWB 3DTIA 3GG2A 1JTHA 4FE4A 3ZQGA 1JKQC 3HC7A 3F0CA 4LG3A 1GVJA 1TT5B 4H44D 2DN0A 1JHFA 4R4MA 2D5VA 1XGMA 3SYTA 1VF5B 5H6RA 2BY3A 2QENA 3OJAB 4Z6YA 1JY3O 2EFQA 2LBFA 1PDNC 4IO9F 3FX0A 5LHIA 1HC8A 3IRQA 5CCHD 1GU5A 1JO5A 3KP3A 3F8FA 1FNNA 2ME0A 3LQQA 2FF4A 4I76A 3CP2A 4GIFA 5D6FA 5H20A 2DPDA 3BG9A 4IRIA 2L5QA 5LHHA 1FLIA 2HODB 4M3DA 4G8XA 1IAWA 3BLYA 2NRGA 2WY7Q 3E6MA 4JX5A 4BHPA 3G1OA 3I5UA 5FLMJ 3Q5PA 4MQVA 2FKWB 1ZRCA 4DBRA 5CHXA 5KCMA 4I7HA 2PLYA 1DDNA 2YMYA 1L0NK 2FX0A 3F89A 4YXDC 2FY8A 3P32A 1FMWA 4NUBA 4P55A 4K35A 3KZYA 5BQTA 5FKOA 4E70A 1TQPA 2I1JA 4CZZA 3O6BB 2QJYC 2L7FP 2L9NA 4JBZA 4KJMA 1LKXA 5C44J 3KPEA 4V19K 3VMAA 1VDFA 2M3EA 5DDGA 2EBIA 2IGNA 2W6AA 4ENKA 5C3EJ 2DAOA 1ZG5A 5F1RA 3KYLA 5CCHA 2XKMA 5H6QA 1BN5A 1FMVA 2CPBA 1VQ8P 1IN6A 2HYFA 1R5LA 3AECC 5KKZC 2MG4A 1VQ5I 1VQ9P 1UHSA 2IAIA 5IOZA 2BXZA 3WU2C 3WGIA 3CX5H 3I5CA 2IBDA 2ZFWA 3OYFA 4W7ZA 2EZKA 1KGSA 1WH5A 2L7KA 4AIKA 4ESJA 3AEAC 5LGTA 1NK3P 2A6HF 3NFQA 2H8RA 2VOOA 2OZUA 1GLNA 3I59A 5J8CA 2RV8A 4JYCA 1ODDA 4ZYAA 1VFCA 3RCOA 1PIXA 2HDWA 2GOMA 1MMAA 3VFZA 2IFNA 1CGPA 4I7ZC 1T98A 3HKZN 4EJTA 4A3LJ 4S04A 4EYYQ 4M6YA 2EILH 3GHGB 1KILD 3C2HA 2K9YA 3HTKA 3K1NA 1MBKA 1AJYA 2FFDC 2K9SA 2FUG2 2QQAA 1HBXG 2JEEA 2H7HA 3U2RA 3CMEI 1JUPA 1PPJE 2UXNA 2V79A 4FQGA 5GTHC 1POGA 4I0BA 1H88C 4XKWA 2LP0A 3RZOJ 1R58A 2WAQN 3OYJA 4MTEA 1F4KA 1LEBA 2OPTA 3K1MA 3L73G 4N6JA 1TNTA 1TWAJ 2FBHA 3WTTC 4RGUA 1RE3A 3RBZA 2N1TA 2HOEA 1T95A 3MVPA 4EM1A 2YPRA 3KP4A 2A45I 2M8EA 5APXA 2I10A 1P84E 3S8PA 2X1EA 3E97A 1HSTA 2PN6A 2DK8A 2Y31A 3PFYA 3ZMSA 4CH7A 2HDDA 4KUMA 1GHCA 5FD6A 3L2QA 1Q90D 1KU9A 2WAEA 3MKZA 4D1QA 1VI0A 2OYHB 3PSFA 2HQAA 1T0FC 3A0HC 1MDMB 3SJMA 1ONVA 4XQFA 4L75A 3CD6P 2DYSH 2VQHA 3OYCA 2IPPA 1PGQA 4C2TA 3U1CA 2CFXA 4XKCA 4ENMA 3PSIA 1GZLA 3H1JE 1X1AA 3B5NC 1X9VA 2Z5HA 1UCRA 2HQNA 2PBIA 2F4MB 2JWTA 2XDVA 3MD0A 4AQRD 3K10A 3HTKB 5AVTB 3ELKA 2F5EA 4HX7A 3JREA 4UXNA 2M5AB 4Q48A 5ICFA 1IK9A 3UR3C 2XAGA 2HQ5A 4JOMA 2NNNA 5TGTA 1JOCA 3JAMK 1JY2O 4TLFA 4GO1A 1W5SA 1TTYA 2ZSIB 3T0YA 3JSOA 2XDJA 1G3SA 2XGDA 2DOAA 4BWNA 2M0CA 3ABKH 3HHHA 2FYUJ 1LVKA 1SQVE 2FYUE 2D1VA 3RKQA 2OZ6A 1ZV8A 3SZTA 1CQTA 3GBGA 1VQKP 3GTOJ 1VQ8I 2EFPA 2K3FA 2OYIC 1VQLP 4QIWN 3J81Z 1MFZA 4EM2A 1G2HA 3WE3A 4KIBA 1BSNA 3GW2A 1NTME 2QSHX 3WU1B 2KFDA 3ERMA 2R92J 1X2MA 1Y1VJ 3TNUA 1I3AA 4DOJA 3BCAA 3EYYA 2QWWA 2C0WA 1QVTA 1ZQ3P 2KB7P 5CLSA 4JQ0D 1OWAA 4BBRJ 1LT1A 2O01N 3H1HE 1J5YA 2AXLA 2H43A 1YX3A 3IWFA 1XGNA 2WC2A 1WCMJ 2ZAEB 2EQRA 3B8EB 3DLAA 3AE6C 1S3JA 3R6SA 1B4AA 4I09A 3TW7A 3UNGC 2FU4A 3IUOA 1XDUA 2DFIA 1XSXA 1APLC 4EJOA 1HWTC 3HHGA 3G1LA 3WHBA 2MC4A 3N4XA 1QRYA 4Q5SF 2EA2A 4FX0A 1MBEA 1OCPA 2KSEA 3DP7A 1Y0NA 2DO7A 2OA4A 1FBMA 4QLCU 3BVHA 2IYPA 1MZBA 4BDYA 1QBJA 2QRXA 2V4HA 3H32A 1E3OC 2FA5A 4KMFA 3BCCD 2DDBA 3QYFA 4HG2A 1AVOA 2Y0SN 3F6OA 5HDNA 1ZTRA 3EFFK 1MUUA 1SANA 3EWKA 5D5WB 1XN7A 2BASA 1R4MB 2ZXIA 5HDKA 2K9JB 2M8RA 2K5CA 3RPQA 2IGKA 5D5UB 5AVRB 4ASWA 5EZGA 1KB9H 2ZJSE 3KDPB 3G2BA 3I4MJ 1BE3J 1BJAA 5KVRA 3CCYA 3GLLA 2VXDA 1Q2NA 2FYUK 1VQMP 1N73C 4E7IA 3GTMJ 2Z2SB 1D0ZA 2PG4A 3OIOA 4A2UA 1LTJA 5K7ZA 3GFMA 2CUJA 5B5EE 1NTMG 3E6DA 2PEXA 5APVA 5CQEA 1ZAOA 2JWAA 3F8BA 1R5SA 3ZMDA 3BR5A 3A03A 1IJWC 1SQBG 3M9QA 4GOFA 5KLVK 3JRGA 3KP5A 1JKPC 2B63J 1JCDA 3WUVA 3E5QA 2TDXA 1NTKK 3PNTA 3P9KA 3WTZA 3VYRB 3HTSB 2MKVA 3ZQIA 2MD0A 3FMQA 2NAZA 2EA4A 1DQUA 3WTSC 3H1LE 1XTGB 5D8LB 4XKVA 1URQB 1YO5C 4IOIH 4PZJA 5J3LA 2VUMJ 3EUKL 4UB6H 4D5CA 4DQ2A 1PL5A 1MIJA 3FM5A 3CC7I 4GT1A 1DU6A 4E7HA 4FISA 3B02A 3GX4X 3D1NI 2IX7C 4OGQD 1E17A 1J09A 1ZRTE 3COAC 3CCEP 4ZC3A 3GZ5A 4CUGA 3L70G 3VB2A 1OPCA 5J1UA 3F72A 2HOTA 4C2UA 4KT0J 4B8XA 4LGDE 3ML6A 2KMUA 2LFBA 3MN2A 4DNCA 3C8VA 3H5AA 1LTAC 4MLOA 1J59A 3H1IG 3AEGC 1XCBA 1KB9E 3WUUA 3T5XA 1WVRA 3CPWO 3JRBA 2HYNA 2R5BA 3BY6A 2WSFH 2O03A 2W24A 3E6CC 2FMLA 5FJ8J 5GADJ 5AVYB 1OVVA 4LG0B 2RN7A 1SFXA 1BDDA 2RAEA 2CUFA 2FXPA 5EEAA 3JR9A 3L75E 2OUMA 1QVUA 3WODF 3L75D 3SEZA 3GYHX 1Z0XA 2V9VA 3M9HA 2JVHA 2F4OB 4D0PA 1PGJA 5AVWB 5AW0B 2OYHA 3OYLA 1QNTA 1FYMA 2G3AA 1YW7A 4GFBA 2HNHA 1JY2N 3V2QA 2OTLI 1IRXA 1JGSA 1T8IA 5IPAA 4A6DA 4KIGA 3HE4A 3WU2E 1Z3YA 3J7AY 3L71E 2XASA 4FCYA 4QWQA 1VQMI 4HNTA 4PV1C 5HS8A 1D0YA 4KHXA 1I3QJ 2K9NA 2Y0EA 3LSPA 3P9CA 3FXKA 2FNAA 2V1DA 4NPDA 4QPQA 3WGHA 1A5JA 3NXSA 4MTDA 3FMSA 1LDDA 5IYCJ 4L9NA 5AIQA 3EUAA 3V4GA 1FAVA 1GL2C 5DYMA 1MGTA 4DBQA 2V7QH 2BW3B 4XLPF 2O5RA 3DKWA 4A93J 3R4YA 2XAJA 5KAFH 2DXIA 1SP4A 1WH7A 2Z4EA 2PFBA 3JRCA 1S7EA 3MKYB 5AIPA 2MD5A 5IOYA 2XSDC 2Y69H 4DOZA 4FTHA 2NPSC 1D7MA 3M8EA 2BGCA 4NDLA 4EEFG 4U3FJ 4U3FE 1L0NE 2G8YA 1R8EA 1U5TA 1O3SA 3R0AA 2WBMA 3HD7A 3ZQ7A 1IJDB 2JUCA 2QSFX 2LVSA 4HF2A 2X6WA 2ZBKA 2JSCA 2CRGA 4B3XA 3JRIA 3AE5C 1GL2B 3HIFA 5APQA 1G3WA 3H1LD 5C4XJ 3GWZA 3HOZJ 2K3PA 2M9HA 3HUSC 2W84A 1ZREA 5CCGD 2QSGX 4B43A 3DBLB 5AVQB 1IRFA 1HA8A 2B87A 2NS0A 2CUEA 4PFPA 5EYRA 4XL9A 4ZZLA 2UXXA 1N2DC 2V9PA 4CCJA 4RDUA 3QOPA 1A6IA 3S14J 3BCCE 2E75D 3CUOA 4JPZB 4YFKF 3WU2H 3CCSI 4YXWH 5BMZA 3K4JA 3GMEA 1BR1A 1RQVA 3ZN0A 3ULQB 2BW3A 2BY1A 4Y33A 1RE4C 1YIOA 1WGXA 2XHKA 3GVAA 2R7SA 2IBZI 4EV0A 1S8NA 4GXOA 2UZKA 3CX5D 1WPKA 3AFHA 2NS8A 2W4SA 3IH4A 4RGXA 2DA4A 3BWGA 1NG6A 2GXGA 4B44A 3MUDA 1R6RA 1YYCA 5APTA 4CPGA 1YJNP 2V7FA 2M4KA 1P4WA 2M7AA 1J1DB 2CW7A 1WJAA 2HQRA 2QKLB 5FB2A 4JQFA 1QZEA 4XLFA 3WUTA 3HEFA 1Q7YQ 1OQYA 2A69F 3PNVA 1KC8Q 3VSLA 3DF8A 3GMAA 2ZVNB 2L3DA 3QP6A 5H2FC 2Q3EA 4IXAA 2JSPA 3H9GA 1FTZA 2QCOA 3L2VA 3FDYA 5D5XB 5L3EA 1G4DA 2M0BA 3MGNA 2HU9A 1Z7LA 4CICA 4A12A 5TRDA 1X8YA 2RREA 3RQIA 1PGOA 2PX9A 5D8KB 1SFOJ 2QF7A 2BZTA 2A5WA 4XK4A 1Y8AA 3FF5A 1U5TC 2GIVA 2VE8A 3MAJA 1MMSA 4R4LA 4F7ZA 1NKNA 4OH8B 3O8GA 3IH2A 1RR7A 1RRJA 2W7NA 2HLOA 3RL0g 3SWFA 1TNSA 5LGUA 1PUFA 3VN0A 3F23A 2LREA 1EDKA 1HKQA 1FDOA 1LNWA 4ZJZA 3O3KA 1T2KC 1L3LA 1IXRC 3LFKA 1U57A 4N9HA 3ZR8X 1S9HA 4EJUA 1XGOA 2ZMEA 3V8KA 2IS6A 1S9KE 2CQXA 4LLLA 2P10A 1X0TA 5KKZB 4C7NB 3F8CA 4Y7NJ 2P2UA 1D1BA 5J47A 3PJSK 4MO7A 3JRDA 2L4MA 3FIWA 3FHNA 4H4KC 4E7KA 1I1SA 4WY4D 1R4NB 1XG1A 2FNPA 5DTDA 1FOYA 1DP7P 2R7QA 4IQ4A 3KEQA 4HF1A 2H09A 3BQYA 1W36D 3FZVA 2COBA 2BY2A 2HEOA 1XX5A 3JRFA 2PGDA 2DODA 1K73Q 3DPTA 1IFDA 3LSHA 1NU1E 5HNHA 4U0WA 2IS2A 2FQ3A 3ABTA 3OR2C 4M3GA 2FOKA 3CMYA 3DFGA 1G1IA 5AVUB 1N75A 2P7VB 1VQKI 2Y9YA 1B8IA 2WITA 3A5TA 4K2EA 3PHLA 4L76A 5KLIC 3AE8C 1KFMA 2OTJI 1RETA 5FFXA 3Q0UA 1ETKA 3MEXA 3HE5B 4HJGH 2P67A 1XPXA 2L7ZA 3V2NA 4KN7X 3U1DA 4XN0A 1W2BO 3JSPA 2O3JA 4A3KJ 3H1KE 2COMA 3CLOA 3K4CA 4N0BA 2KI7B 2W27A 4RKUJ 3OYBA 4RS8A 3PQKA 4RLFA 4BJ5C 2VQGA 4NPEA 2FYZA 5KLIB 5AW4B 5ILSA 1ZH5A 4GODA 2ZMEB 4LFUA 2JR8A 1K6YA 2P0WA 3FM3A 5JHUA 1CZQA 2FXMA 4BXUA 4HB1A 3PO3J 2BOLA 5AVVB 3DWLE 1S7AA 2MABA 5AONA 3HJEA 1YIJP 2GAUA 3HUGB 4OGQC 4L9JA 2CW8A 1IO2A 1MBJA 1JXSA 5M3FJ 4WWCA 5K5GB 4BGDA 1PPJD 2LKXA 3B71A 4HF0A 3TOAA 4IFMA 2E36A 1U2WA 2JA2A 1YJWI 4XRFA 2WPSA 3GTKJ 1S5LE 2K7LA 1OYYA 2A61A 4BEHA 4O5VA 1SS1A 1FIPA 2YU9J 1J1EC 3L37A 4A3MJ 2DA2A 5E8GA 1ZARA 4CCKA 3BRVB 2X9DA 1NU1G 4U7JA 2DOEA 1GV5A 1H89A 1RKWA 4LLGF 2YR2A 2CV0A 2L5GB 3KIOA 3QYBA 2OTJP 4XLEA 3HB9A 2CPSA 1UB9A 1S29A 3AE4C 3VP8A 3LSTA 1YITP 1LJ9A 3MHVA 1MNEA 5JHFA 1GXPA 3W2WA 4BEHB 5FLXK 2HKOA 3K69A 3PJRA 2R3CA 5EEGA 2NPSA 1TP4A 1G3YA 5B1AH 1Y6IA 1K7AA 4RO0A 1EH8A 3KEOA 3TGUD 1BGYG 3CCJI 3CJRB 1FEXA 2E1NA 1U5TB 4L0YB 1AA0A 4H13B 2L9RA 5JLXA 4IF4A 1JGGA 1N7SB 3VMXA 2QEXP 5B66E 3OIPA 3EUHC 1AA7A 3IKTA 5E3NA 4EMSA 2H6CA 2XB5A 2R4GA 1Z1DA 3Q9VA 3A2AA 1GL2A 1Z6TA 3IAS2 2QM3A 1OCZH 2PQ8A 4E7JA 4A3GJ 2ZJQF 3N7NA 1KYWA 3J7ZI 2P7JA 5A2QK 1MKMA 2CSOA 3DPUA 5F0HA 1ZW0A 2OGUA 4EDFA 3C7JA 5E17F 2WVRA 3I55P 1PPJG 2R5YB 3NQOA 1JCCA 1RUNA 2E35A 2UWJE 2DT7B 1VQ6P 4P1WA 4C30A 3DBRB 4EQQA 4YG2F 2A06D 3C2GA 1OX3A 2E74D 5J8FA 4H13C 1RF0A 1IUYA 1S7OA 2BE5F 3FKJA 1KYOH 1NTZD 4NQWA 3QPLA 1T8ZA 2NXNB 1FOKA 1HVVA 2XGXA 4BXFA 3BJAA 3M07A 2WPVB 3CMAP 2Q6QA 2JP3A 2N1TB 4PJ0E 5BPIA 1TW2A 4WY4C 4A0XA 4IHTA 2QQBA 4M73A 1H0TB 4HLYA 1DEBA 2N9BA 2BVMA 4YFXF 2FXAA 1BE3E 2KDOA 2IXSA 2KLOA 3LL7A 5FKLA 5J4VA 4BHCA 5GTHE 3BG6A 4HOBA 2E2HJ 1GU4A 1A36A 1MDMA 3CC4I 1ZN5A 3G4SI 2R7RA 2V1NA 1HCRA 1NGMB 2IS1A 1D1CA 3W2VA 1LTJC 1VZ0A 5E1ZB 1Y0UA 5FROA 3BZKA 2O01J 2ZYDA 2MBFA 1PP9G 2V1UA 5IY5H 1AQ5A 1SMTA 3CJNA 2HPIA 4EIJA 2DBBA 2M7BA 2HYGD 3L75J 1ZG3A 4CZCA 3OR1C 2V6CA 4W97A 2KIQA 2R7OA 3B6AA 3A7OA 3L72D 1R1UA 4A5MA 1YQAA 1KILA 2GZWA 2FYUG 3HOYJ 1IW7F 3D6ZA 4EI2A 3ZOBA 3HPGA 4V2FA 4IEJA 3TQNA 1NTKJ 1URQA 2K88A 4C2MJ 3AEFC 4ZH4F 4NB5A 2Y0DA 3GW6A 2K40A 1IC8A 5GTHH 2DJNA 1N7SD 3EETA 2LMDA 2EFNA 3M9AA 1RH5B 3C1DA 1NWQA 2RQPA 5GPAA 2A5YB 1E2XA 4NC8A 1T56A 3CCVP 3GXOA 3P5JA 2L9VA 3Q1MA 3AG2H 2VQCA 1LT9C 2H89C 5AVXB 2IGMA 1DH3A 1Y56A 1YYVA 3K2AA 2V4JC 4WX9A 2AO9A 2ISYA 3H1JG 2XSJC 3OY9A 2V26A 2Y0MA 2E7WA 3Q3SA 3CI9A 1YW8A 4A3BJ 3CCUI 3VOEA 5EGOB 3VYSB 3UIAA 1CF7A 4HRIA 1RIOH 5FLVA 3CCQI 3I4NJ 3E7LA 1LWUC 4XE5B 2TCTA 1BGYE 2VJJA 1MH4A 2X6YA 3S15J 3S1QJ 4DZOA 3LNQA 4XKBA 4R79A 5E20A 3A3YB 2IA0A 1NTCA 2ZJPF 2ZFCA 3ZP5A 4YFNF 2E1MB 1S2EA 4BQOA 3CXHI 2P5KA 4BJTA 3L74J 1NAYA 4K3AA 3MWMA 1ITYA 1R9TJ 3USSA 2LDUA 3L75G 2ZXJA 1ZN2A 2DOFA 5HS9A 3ZQLA 4IX7A 1DEEG 4AYBN 2KQRA 1SQBJ 3I59B 3CXHH 1SQBE 2DMNA 1RR8C 2NVQJ 3L71J 4Q47A 4XOTA 1JT0A 4XLHA 2Y2ZA 3HRNA 4O9BA 5AW7B 2RNJA 4B4CA 2E1MC 5EG0B 1X1DA 1NVOA 1QEXA 3K4MA 1ZRDA 1TC3C 5FKKA 2B7EA 4ENNA 2ISZA 1DP3A 2B88A 4H44B 1ZMEC 2Y9ZA 3K70D 3GTLJ 4FASD 2OARA 4M3EA 1MMNA 4G94A 2SPZA 2CU7A 3RIRA 1V54H 3GF3A 3CUQA 3EYIA 1HW1A 3I3LA 3WTVC 3E3VA 2KZVA 2KZIA 4I2LC 1EC5A 1MD0A 3ZMVA 4ZYHA 1LTJB 2CWEA 2HXOA 3NWSA 1URQC 2PJRA 4IKFA 2VKEA 4ANJA 4IHYA 3R2PA 4A3CJ 4P9UA 1GTWA 3L70J 1QL1A 3KXDA 4WWIA 2OYIA 1FZPB 1XB4A 1Y8RB 1HTLC 4RB1A 4HSTA 3NAUA 2K4JA 2HPMA 5LEKA 2VL8A 4M3FA 2R7ZJ 1GV2A 2YMKA 2XGCA 2QJPB 3PIOF 2FBKA 4UB8C 4MQ9F 1H0MA 1LT9B 1MZ9A 1E0EA 2LK2A 3ROUA 5DUIA 1T6AA 1IZ1A 4CO8A 5L3BA 3BASA 4GYGA 2HVQA 2OTKE 1Z6RA 3BZ6A 2P6SA 3K1PA 4Y15A 1Y9BA 3C3WA 1SVFA 2JO1A 3J80Z 4F55A 1QLED 2LXBA 1UG2A 5CVRA 4ZYGA 5E3MA 3P8CD 2ACJA 1QPIA 3CC7P 3GZNB 3GFLA 1HW5A 1Z9CA 2GXBA 1TWFJ 2A6EF 3E6BA 2A45G 5KAIE 1PV3A 4M72A 1BJZA 1JEKA 2DMQA 2CFOA 2DQRA 2W85A 3WU0A 5HODA 4ITVA 2FYUD 4BYYA 1BC8C 2AHQA 2F48A 4LC1A 4C7RA 1KN7A 3IWZA 2BXYA 3BC8A 1FWZA 1L4AA 2QEXI 1Q86Q 4B09A 2JUGA 4HSRA 3VPRA 2VQLA 3DLLF 1J7KA 1RI7A 1W4MA 3C18A 3LA3A 4PCQA 4D6TE 5CCGA 2R7TA 2LTPA 3DV8A 1DPUA 4WY4B 2DA5A 2IT0A 2KHMA 1VQNI 3Q3DA 2LG4A 1ETVA 1I5ZA 1JMBA 1NO4A 3I9V2 5CCHC 3R0JA 1VNDA 4HV6A 4RMNA 5LRRA 2ME6A 3VDXA 2ICWG 2WB1A 1FPQA 2Y30A 4JX6A 4DYRA 2AS5F 3ABVC 2YO2A 1VQ4I 1GDTA 2DMUA 2AXTE 4V2GA 4DZJA 1G59A 2JA8J 3VMYA 3H9JA 2CO5A 2ELHA 2YX4A 3S93A 2QG4A 3S9OA 3CUQC 2Q0OA 2C6YA 1XGSA 2E76C 2QE7H 3JCUE 2WTYA 2R32A 4A3JJ 2UV1A 1SQXJ 4XM3A 1WJFA 4NHJA 2YSRA 1WQ2A 1F43A 2E74B 2XAFA 2H8WA 3IP4B 3HUSA 3LFUA 5APWA 2IA2A 2Y0SA 2GOXB 4KT6A 1X1BA 3RKWA 4X0GA 4HZFA 1AHDP 2JN6A 1X4PA 2NPSD 5ED4A 2IA1A 2QJYB 1VQ7P 4U3FG 2CJJA 1U78A 3JTHA 4BBSJ 1YIJI 4W1UA 3CCEI 3AL0B 1CSBA 2B9BA 1LFPA 4YTPC 4XRSG 4PV1B 5KHDA 1R5ID 2D45A 2K27A 4KJZA 4PJJA 3BATA 3G6EI 1F9NA 1HGZA 2D2CB 1JY2P 2H8PD 1M1EB 1U0JA 1OISA 3MD2A 2ZMEC 3OYHA 1EQ7A 1O4XA 2B9SA 2R7DA 4AVZA 3CCUP 4ESFA 1EKEA 4B47A 5JVGF 1BL0A 2I8DA 5EEHA 3PO2J 2DT6A 4M3BA 3B5NB 2EJRA 5B1BH 3BRTB 1ZRTD 1K4SA 2RMZA 2XAQA 1HF0A 3U1AA 4YELA 1JTYA 2P7CB 4MN4C 5J1YA 3TK1A 2E34A 1C0WA 2G9WA 3WE2A 4KISA 4A3DJ 2GLOA 4XFJA 5CMZA 3H1IJ 4E6KG 4F92B 4BJ6C 3I55I 1KQSO 3CJQB 4RBOA 2PMZA 2LSOA 2NS7A 3BROA 5M5WJ 5EJCA 2DW3A 3CQZJ 5KJ7D 1G3TA 3B5NA 1USDA 3TL4X 3MZ8A 3MIWA 3BQZA 3BT9A 4CCNA 3A0BC 3BP8A 2HKXA 4L5EA 2WQYC 1BR2A 3CDHA 2XKPA 1KU3A 2K85A 2LYCA 1P4XA 3LSIA 3L74G 2R7FA 3W68A 4PJMA 4EJVA 3OWTA 2E19A 2FYNB 3PM1A 4M6XA 5KNLA 1KYOE 2XGEA 1MBHA 4QPOA 2EZIA 1PP9E 4JK1X 4RAZA 5JFRA 5KTBA 2HI3A 1LPQA 2XROA 1M8OB 5F6FA 1BCCJ 4AC0A 4L5JA 1HJBA 4HW0A 3EFGA 4A0ZA 1LJ2A 3FWLA 1MJBA 2M87A 3FISA 3RPUA 5E18F 2ECBA 2LY1A 5DS9A 4XRSA 1L0LD 1L0LE 2OJED 4Y4RA 1SFCD 3H1ID 3M91A 5AW1B 1W1WE 2BVLA 2QBYA 3GTPJ 5ILVA 2G0EA 2JVGA 2EZHA 3ZRGA 1BM9A 1ZYRF 4U0VA 3B5ND 1W7PD 1SFCB 1M56D 3K6GA 5L3FA 2DMPA 1KQFB 1FOWA 3LSMA 1S5LX 4PJLA 2GWRA 2WSEH 3LA2A 3LAJA 5BOXA 2KLUA 5GTIH 1PYVA 4RAYA 1G2CA 2HTSA 1WKMA 2K37A 2FSWA 1B9NA 4HDVA 4HDUA 4OINF 2IZ1A 3HUGA 4AD9A 1TWCJ 3T1BA 2PAJA 3AEEC 4ESBA 2KISA 3WMM0 4KITB 1AKHB 2ESHA 5DEQA 2ELJA 1YLFA 1MJAA 2OU2A 2VJ4A 3GF7A 2ZJ2A 1LUJB 1WRJA 4CYCB 3GFIA 2XC7A 4LLHA 4BRYB 4C9YA 5B3SH 4X6AJ 3CP8A 1FOSF 3NTNA 4BAYA 2EFOA 1NH3A 4E7ZA 3S1RJ 4PK4A 1SD4A 4KNYA 4EVIA 1FIAA 3IC7A 3KYDB 1LT9A 3FBIB 3LSGA 5B5EC 4RESB 4C7NA 3NRVA 3H5NA 1ACIA 2A68F 4KN4X 2A05A 4DW6A 1N73A 5B66C 1J9IA 3TP0A 5DCFA 3G1MA 3L09A 5JLWA 4L5IA 3EDPA 2HTJA 4HNUA 1VQ9I 2LXCB 3V7CA 5CJ4A 1VQ5P 2R93J 1BIBA 2ECCA 2V1XA 3MFKA 2QVOA 1KILE 1MV8A 2J5UA 2MA3A 2FQ4A 3WTYC 2M3BA 1GXQA 5EDNA 2VT3A 4AUXA 1LP1A 2KRHA 1MW7A 2Z5IA 3SHFA 1JJ8C 1LEAA 2ZCWA 4HX8A 3CJTB 1YITI 3CL3D 1ZGJA 2OYOA 3RKXA 4AWXB 4RLQA 1PP9J 3PNYA 1UZCA 1VF5C 2XNXA 4L0ZB 3HOTA 1N25A 2FBWC 1OCOH 2MC3A 4L9TA 3IL2A 1YS6A 2R5DA 5E79H 2KP8A 3FWNA 2OYIB 3TO6A 5BS6A 5GAEJ 3PTZA 2K02A 3M7GA 3RK3E 2QQ8A 3PFIA 1SQPJ 1H0TA 4XLCA 1PP9D 3IKVA 2R44A 1QZZA 2DTRA 2FEZA 4FETA 2I5UA 4GRIA 2CQNA 1LTIC 2HZDA 1WMKA 3RI4A 2VOPA 2KJCA 3OYEA 1FTTA 3TKYA 1KU7A 1O57A 4EOTA 3SZPA 1UIIA 3KHUA 2VC1A 4NBQA 2YNYA 1MJ9A 1I6HJ 3HRMA 3G9RA 4DT0A 1LE8A 3TGUE 3CX5I 4BUPA 2KP6A 2WT7A 2E42A 3JCUC 2AXCA 1Y47A 2W25A 5E79E 2VIXA 4XIDA 5LGNA 2HYJA 1V5EA 1PP8F 5IT9K 3BG7A 3SDBA 3QP5A 1OIPA 2W6JH 2J5OA 3R61A 2W90A 1IV8A 4HEA2 4P9FA 1LB2A 3TNUB 3LW5J 2KRFA 1WT6A 3WGGA 4F52A 2L01A 2PMZN 1STZA 2KS1B 4OIPF 4UNOA 5J40A 1IXCA 1ERDA 5KLVJ 2DFFA 5CJ0A 2OV7A 3H35A 1Q82Q 3CCSP 1EXJA 4H13D 3AL0C 1I1GA 5ICCA 3BTLA 1VF9A 3E5UA 1M1JB 4BHBA 1L0NJ 3EUHA 2IP2A 4WXCA 2X85A 4I01A 2WA0A 4PJNA 3BZCA 2CUZA 3Q5FA 3HRSA 2Z3YA 4BE0A 3OYDA 5CVUA 2P81A 3I54A 4PV1D 2E2JJ 2ESNA 2MH2A 1L0LJ 2WY8Q 4O6JA 4LB5A 3U59A 1YI2I 4MFEA 3OMYA 4M9XA 2IDBA 1RESA 4PSXA 3AE7C 2BY0A 1P7IA 2XPVA 1T39A 2N1TC 3CX5E 3DBHB 2L54A 4LJZF 4AU7A 4PD4I 3BR0A 1SQPE 1JKOC 2STTA 3M06A 1IZNB 4XN3A 3VEPA 1I27A 3OOUA 2IBZG 2RKHA 1FSEA 1ON1A 4BQNA 4MFDA 1HW2A 1T38A 2NNYA 2Z33A 1IRGA 2V7QJ 1T08B 1QZYA 4H0LD 1DGWY 1I50J 5GAHJ 4ZYDA 4WVZA 1JTHB 5L8RJ 2WSSH 1W0TA 4ZZDA 3BOQA 1ZR4A 3HSRA 1A02F 2GM4A 3HE4B 1BI1A 4TT3H 2JQ7A 3L9FA 2OBPA 2DA1A 3NARA 4Z1MH 2QVAA 5E8IA 3RGUA 3L2WA 1SFKA 2BYVE 1TWGJ 4XBFA 1RY3A 3A0HH 1VQ4P 1M1JA 1EDLA 3DKXA 2KIMA 3JAMZ 2QIWA 2M1BA 1PVEA 2CS3A 4A7PA 2DFEA 5IYBJ 3ZPLA 1PP7U 3TSIA 3BTCA 3P8MC 2Z9OA 1VQPP 3AAFA 1MNMC 3REOA 3TBIA 1SEUA 1L4AC 2KNCB 3D71A 1QVGO 2EWNA 1H8AA 2KZJA 3H1KD 5AW5B 1VQPI 1J2XA 1YRNB 3QH9A 2HODA 4OAYA 1X4OA 3QYEA 3H3VK 3E1IA 1SQQJ 2E5NA 5HLGA 3HZJA 4F3QA 2JPCA 2Z16A 2HVRA 1V55H 2W57A 3KZIC 4AYBA 4C46A 1Y1WJ 3PUBA 1SAUA 3OOPA 1LQ1A 2QJPC 5EZHA 3V8LA 2L4AA 1FSHA 1OVRA 1YQ3C 5D5VB 1RUOA 1JM0A 2XVCA 3I4PA 3QPSA 4PDKA 1K61A 4D7MA 1IXSB 2XU6A 1D5VA 2VKHA 2VBYA 4B48A 2KIKA 4AUWA 1ZP0C 1H9TA 3BR6A 1NU1K 2YIUC 1QVFO 5KJ7A 5F27A 2UUZA 2XZRA 1YQ4C 3PRJA 5DJUB 5FGMA 2PI0A 4LG0A 4WK8F 4ZKPA 2V9KA 2MFZA 3JRAA 1D8KA 3WG7H 1SQXD 5CKTA 5TJHA 1MBGA 2L02A 4RB2C 2LF7A 1XSDA 2F6CA 2LY2A 4BE2A 1V4RA 2K9MA 3ECHA 3A0HE 1MH3A 1RQUA 3X2QH 3AKZA 1XC5A 2P58A 3S2WA 2MLKA 3W6JB 1BW5A 4BH9A 3VWBA 2LRDA 3CTAA 3V8JA 1BR4A 2A06E 1S6LA 3ZMZA 1JUNA 3QRFF 5KLVD 1X3ZB 2QJKB 4NC6A 3ASOH 2FMYA 3ZQHA 2VJIA 1SC7A 1Z3XA 1NTZJ 2L0KA 1UJ8A 2JA5J 1NTZE 2ZXWH 2JZYA 1VQOP 1U7MA 4Y99B 2FRHA 3CXHD 2VLAA 2HWVA 3ONQA 4S05A 4BS9A 1G2CB 1KONA 3AE1C 2NOJB 4YRVA 1IN5A 4ZTFA 1R1TA 1OW8A 3BR1A 5ICGA 3SZGA 3SFIA 1RC9A 1Y8QB 3I56I 3ERED 2E2IJ 3V2PA 2IEKA 3H32B 1OLTA 1SQVJ 2W6BA 2IS4A 3P9IA 2RC4A 3HOVJ 1YTZT 1FZBA 2Q5UA 2WTEA 1JNMA 3G3ZA 4UHTA 2DU9A 1WRGA 1FU1A 3QOEA 1WHUA 1L4AD 3IN6A 5IP6A 1CW5A 4I6ZA 1LTSC 1U8RA 1K05A 4I98B 3HXLA 2KIFA 2VT2A 4S0HB 1EF4A 1EDJA 1NTMD 1WSUA 3BTIA 1UFMA 4I0AA 1KQ0A 1ZG1A 1EH6A 3A02A 1PUFB 3ZN1A 1P84D 3PUFA 1XD7A 5KAIC 4EM0B 3IAM2 4M74A 1UHMA 3JTGA 4Y28J 2QA4P 3F9KA 4B1RA 4IL6C 1MSEC 3L36A 2N8GA 5KJ7C 1KQ8A 2QZ8A 4IHWA 3SDGA 4BDZA 1HLVA 3HOSA 2LBFB 5AVZB 3MUDC 2D2CC 1P92A 3U21A 1H88A 5CVJA 3JC22 2ZYAA 3O8ZA 1LFUP 1JY3P 2E7XA 2ELKA 3HOUJ 4P5OA 5DD8A 4Y52J 2P8TA 3GLXA 4KICA 3ZQCA 3GZ6A 5M3MJ 9ANTA 1NTZG 4BU2A 2O61A 1FJPA 3VYTB 2P4WA 2O3FA 3AG4H 2F5VA 1F5TA 3RK2D 4XLNF 4IFFA 3RDIA 2A3SA 4NQWB 3IF4A 3SFZA 2R3SA 4II2A 4EATA 2YKOA 3HGGA 2ZXXA 3K4LA 4DJAA 1T2KA 1K4TA 2IYOA 1DGRM 4JF7A 5K7FA 2PMHA 1VQ6I 1I6XA 4PGGA 3KETA 5DM7F 2EV6A 3K0LA 2RDPA 1YX5A 4CA0A 5L3CA 1SAXA 3H1LG 5F08A 1SD5A 4Y3OA 3WTWC 1QGKB 3CUQB 3CWBE 4N78E 1Z67A 5LFAA 2KZGA 1YW9A 2K9LA 2M3AA 1FYKA 3HE5A 1X1PA 2LOOA 1HDDC 1RNLA 2VKVA 4RM3A 1RPWA 5CYVA 3GTJJ 4XSXF 2ZYGA 1SQQE 3H1JD 1UELB 3V4QA 4ZKUA 3H25A 4CGZA 2ZT9D 4M71A 1B1BA 4CCLA 1XTCC 1MMDA 2XIGA 1UIXA 3L74D 1U7JA 4MGRA 2O7OA 3L72G
chains in the Genus database with same CATH topology
3W2AA 4GOFA 3S1KA 1X1CA 2KPMA 2M5AA 3PNTA 1G8XA 3VYRB 4ASVA 4ZMDA 2MD0A 3OS0A 2CFOA 3DKYA 4ITVA 3OS1A 1WFXA 1DQUA 1N77A 4XKVA 4XR6A 4IOIH 3BC8A 3EUKL 2JUGA 1MMGA 4HSRA 2VQLA 4E7HA 2R7TA 3LSKA 4NNJA 4DIQA 1J09A 2AQEA 2QKMB 2KHMA 4ZC3A 2RNGA 2LG4A 2A6TA 4CUGA 1JMBA 3I9V2 3A2KA 2R7UA 4C2UA 3VDXA 2CMPA 4RMNA 3FXDA 2WB1A 2KMUA 5CBNA 3H5AA 4MLOA 3CF2A 1G59A 3H9JA 3S93A 1OVVA 2UV1A 4ZDLA 1BDDA 4XM3A 1WJFA 1QU3A 1MNDA 3IP4B 2OUMA 3LFUA 3SEZA 3ZCOA 2JVHA 2Y0SA 2GOXB 4KT6A 1X1BA 4N4OB 4X0GA 3OYLA 1N78A 4HKZH 4IZZA 2HNHA 4XLAA 1X4PA 4BL0B 1IRXA 4U87A 3AL0B 2XF7A 1Z3YA 1V5GA 1LFPA 3J7AY 3E1SA 3N05A 5KHDA 4HNTA 4E7SA 4KJZA 3H5RA 1D0YA 4PJJA 4F93B 1U0JA 3MD2A 3OYHA 4NPDA 4QPQA 4XORA 3EUAA 4AVZA 1YE9A 4DBQA 3D5LA 2BW3B 1NG7A 4B47A 2O5RA 2I8DA 3NWTA 2DT6A 2DXIA 3MKYB 4E7LA 1V5FA 2E60A 4DOZA 4YELA 4MN4C 4ZDOA 5CQGA 3PH0A 4KISA 1X19A 2KRCA 2VB6A 3H9QA 4E6KG 4F92B 4BACA 4XMYA 3FBNB 4BJ6C 2WBMA 3CJQB 2PMZA 2VPLA 2X6WA 2LC2A 3HPHA 4LITA 4B3XA 3TL4X 4CCNA 2M4GA 2K3PA 3L2UA 4B43A 1BR2A 1HA8A 2B87A 3DU6A 2AQFA 4PFPA 3S3NA 4XL9A 2LYCA 3LSIA 4CCJA 2VJ5A 4PJMA 2ZXHA 3OWTA 2LR2A 4F91B 5KNLA 4QPOA 3QODA 3L2RA 3K4JA 1BR1A 1W36C 4BE1A 2BW3A 4Y33A 2X51A 3RTRA 2R7SA 4U7BA 3D5RC 4XOPA 2V6EA 2LY1A 3K70C 3AFHA 4PFOA 2W4SA 5EFWB 4Y4RA 4J00A 2F4IA 4B44A 1NG6A 2BVLA 4CPGA 1R6RA 1FC2C 2JVGA 2V7FA 2M4KA 2M7AA 3ZRGA 4OAZA 2L9SA 2CW7A 1WJAA 2QKLB 4JQFA 3K6GA 4XLFA 4RM2A 3LSMA 3PNVA 3SEQA 3OYIA 3FXEA 2DJIA 4PJLA 3VSLA 3DQVC 3E0JB 1PYVA 2KUBA 4LIUA 4NPFX 1BDCA 2JSPA 2ZFUA 3H9GA 1TT0A 3OL3A 4KITB 3L2VA 3FDYA 1EA3A 2ELJA 2M0BA 2VJ4A 2HU9A 1JI8A 4BXLA 1Z7LA 2E5ZA 2XC7A 2WMMA 2RREA 4C9YA 3D5SC 2A5WA 3CP8A 3DEEA 5CPRB 3VYUB 5HNFA 3K4BA 4E7ZA 4PK4A 2XF5A 3FBIB 3LSGA 1EDIA 3H5NA 3S3MA 2W7NA 3H0DA 1LDKB 2R7WA 2LREA 1EDKA 3A4CA 3LMMA 3OYGA 2W82A 4ZJZA 2LXCB 2WAFA 4BQQA 4HNUA 3MZWB 3ZXSA 2R7XA 3DPLC 3MMYB 2M0MA 2UWMA 3ZR8X 2WAQA 1S9HA 2IS6A 1LP1A 2KRHA 5LD2C 1MW7A 1X0TA 3K4KA 1D1BA 4RLQA 5FRMA 3PNYA 3FHNA 4H4KC 4E7KA 2W1OA 5C39A 2IGOA 4E4HA 2R7QA 4IQ4A 3HOTA 1OVUA 1W36D 3KEYA 2Q2EB 3DPTA 5CBOA 3LSHA 5HNHA 5HOOA 3DTKA 2IS2A 1LP1B 1H0TA 4HPQA 4XLCA 4IQJA 3OR2C 2R44A 1N75A 4FETA 4GRIA 1UAAA 2HZDA 2HVSA 4XONA 3OYEA 4HJGH 4OWRB 4PSWA 4XN0A 3CESA 1WJBA 1PJRA 1WJCA 2CV2A 3K4CA 2WADA 2B87B 4BUPA 2KI7B 2KP6A 4DGWB 5HVQC 3OYBA 4RLFA 4BJ5C 2JWDA 3W3CA 2VQGA 2CH0A 4NPEA 1Y47A 2VIXA 4GODA 5DJTB 1K6YA 1V5EA 2P0WA 3BG7A 3SDBA 4HB1A 4J01A 2BOLA 3DWLE 3OL4A 2ZSHB 2MABA 4HEA2 3QWOC 3HKZA 3HUGB 4CCMA 3MKWB 2CW8A 3DTIA 4PUSA 4F52A 5K5GB 3HC7A 4BGDA 4LG3A 2KL4A 2KS1B 2JA2A 1ERDA 2OV7A 3H35A 3SYTA 2DCEA 3AL0C 4BEHA 1SS1A 2LBFA 3CMMA 5FRNA 4CCKA 2X85A 2HR3A 2WA0A 4PJNA 3CP2A 1OR7C 2CUZA 1Z21A 2CV0A 4BE0A 3OYDA 3QYBA 4XLEA 1MFTA 2L5QA 2CV1A 2WY8Q 3BLYA 2WY7Q 3OMYA 4PSXA 2Z1DA 3MHVA 4D9JA 1MNEA 4II3A 3M8JA 5JHFA 4CCOA 3W2WA 4BEHB 3S3OA 3PJRA 4AU7A 3PL8A 4CSWA 4XNFA 4DBRA 5KCMA 1Y6IA 1UG0A 3OYMA 3HL2A 3CJRB 4XN3A 3OOUA 1FMWA 4NUBA 4BQNA 4K35A 3OIPA 3EUHC 1AA7A 4JBZA 2L9NA 2R4GA 1DGWY 4KJMA 1LKXA 3IAS2 4E7JA 2IGNA 1TZLA 2XF6A 3DPUA 3TMOA 2Q1ZB 3KYLA 1ZW0A 1P9QC 2QVAA 1FMVA 3RGUA 3L2WA 1SFKA 3ZGKA 2UWJE 2DT7B 1EDLA 3DKXA 4P1WA 2CS3A 4C30A 2VASA 2RKLA 3OYFA 3C2GA 4N4NB 3TBIA 2L7KA 3K4NA 3CZ6A 2KZJA 1GLNA 3FKJA 4OAYA 1X4OA 4NC7A 3QYEA 4ZYAA 3RCOA 4BXFA 2HDWA 2GOMA 1MMAA 2E5NA 1BOBA 3RPUD 4F3QA 4EYYQ 2Z16A 2HVRA 1ZXGA 1H0TB 1WJDA 3C2HA 4GOEA 4AYBA 2BVMA 3PUBA 1SAUA 2FUG2 1OVRA 2KDOA 2IXSA 2KLOA 3LL7A 1JM0A 3BG6A 3RQ4A 4XKWA 2MYSA 2R7RA 2V1NA 3OYJA 2IS1A 1D1AA 1D1CA 3W2VA 2VKHA 1VZ0A 4B48A 5FROA 2KIKA 2HPIA 2UUZA 2M7BA 1T95A 5DJUB 4CZCA 2V9KA 2MFZA 3DTEA 3OR1C 2R7OA 2X1EA 3PFYA 3S8PA 3OYKA 5CKTA 4CH7A 3A1YA 3L2QA 2WAEA 3MKZA 4D1QA 2F6CA 2LY2A 4BE2A 2K3RA 3PSFA 2K9MA 2VKDA 3OYNA 2HQAA 1T0FC 3HPGA 4XQFA 2B89A 3AKZA 2P58A 2R7VA 3OYAA 2VQHA 3OYCA 3VWBA 4G6TB 2LRDA 4C2TA 1BR4A 4XKCA 2VXZA 3PSIA 1X1AA 3S32A 4NC8A 2VJIA 1Z3XA 2W00A 2LH9A 2VQCA 2XDVA 2IGMA 3M1CA 1Y56A 3K10A 4ZTJA 2V4JC 1U7MA 2VLAA 2M5AB 3ONQA 3UR3C 4BS9A 1KONA 4JOMA 2NOJB 2XSJC 5TGTA 2V26A 2X1CA 4YRVA 3OS2A 3OY9A 4ZTFA 3SZGA 2ZSIB 2X1DA 3KX2A 2DOAA 3VYSB 1OLTA 1WJ5A 4HRIA 1LVKA 2IS4A 3GBGA 2VJJA 2X6YA 4XKBA 4R79A 3QOEA 2E1MB 3ZQQA 4BQOA 4BJTA 3HXLA 2Q1KA 4K3AA 1EDJA 2OC6A 4IX7A 1QHGA 3BCAA 2KQRA 1DEEG 2L2OA 3IAM2 1LT1A 4XOTA 4XLHA 2PJRB 1YX3A 3F9KA 2E1MC 1NVOA 1X1DA 3V42A 3VSKA 3K4MA 3HG9A 2ZAEB 1QHHD 4BDZA 1DP3A 3DLAA 4ZDPA 3HOSA 2LBFB 2B88A 1S3JA 3K70D 4FASD 3UNGC 3EPZA 3IUOA 3U21A 1MMNA 2SPZA 3I3LA 2MC4A 4P5OA 2KZVA 2KZIA 4BU2A 1EC5A 3VYTB 5HLTA 3NWSA 2F5VA 2QRXA 4BDYA 2PJRA 4IKFA 4ANJA 3OIQA 4LIVA 4WWIA 4NQWB 3QYFA 4HG2A 4EATA 4II2A 2X6XA 4HSTA 3K4LA 4DJAA 2HPMA 2VL8A 1DGRM 3DU5A 2ZXIA 2K5CA 1E0EA 2IGKA 4ASWA 1YX5A 4CA0A 4YEJA 3G2BA 1Q2NA 4Y3OA 2VXDA 2HVQA 2RQQA 2OTKE 5LFAA 4E7IA 3ZDMA 1ZELA 2K9LA 2M3AA 1D0ZA 2Z2SB 1D0XA 1WJEA 2LOOA 4F55A 4RM3A 2XAUA 4ZNCA 2CUJA 2LXBA 1UELB 3RSNA 5CQEA 4CCLA 1MMDA 1U7JA 3BCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOF A;  3S1K A;  5DJT B;  4GOD A;  2M5A A;  4HB1 A;  2K3R A;  3QWO C;  4ASV A;  4ZMD A;  2B89 A;  2P58 A;  5K5G B;  2KL4 A;  2KS1 B;  5EFW B;  4IOI H;  4CPG A;  1FC2 C;  1SS1 A;  1U7M A;  3FXE A;  1JMB A;  2M5A B;  2HR3 A;  3FXD A;  2KUB A;  5CBN A;  4NPF X;  1MFT A;  1BDC A;  2M0B A;  4BXL A;  3MHV A;  2WMM A;  1OVV A;  1BDD A;  1EDI A;  2Q1K A;  4HKZ H;  4K35 A;  4K3A A;  1EDJ A;  2OC6 A;  4JBZ A;  1EDK A;  1DEE G;  4KJM A;  2LXC B;  1LT1 A;  3MZW B;  1NVO A;  1ZW0 A;  2QVA A;  2ZAE B;  3RGU A;  1LP1 A;  2B88 A;  4NPD A;  2UWJ E;  1S3J A;  1EDL A;  1X0T A;  2RKL A;  2SPZ A;  2I8D A;  5C39 A;  2KZI A;  2KZJ A;  1EC5 A;  1OVU A;  2QRX A;  4MN4 C;  3PH0 A;  4WWI A;  5CBO A;  1LP1 B;  1H0T A;  4EYY Q;  1ZXG A;  2R44 A;  1H0T B;  4GOE A;  4ASW A;  1OVR A;  1Q2N A;  1JM0 A;  2OTK E;  3ZDM A;  4HJG H;  4ZNC A;  2B87 A;  2LXB A;  2KIK A;  2B87 B;  2KI7 B;  1U7J A;  5DJU B;  2JWD A;  2LR2 A;  4NPE A;  1Y47 A; 
#chains in the Genus database with same CATH topology
 4YIF A;  3W2A A;  1NTZ K;  3S1K A;  4BNC A;  3CC2 P;  2KPM A;  5F64 A;  1M57 D;  1RZ4 A;  2HOA A;  2HZT A;  1QPM A;  4X1E A;  2MLG A;  2JA6 J;  1MBF A;  1SQQ G;  3KCC A;  1WI3 A;  1G1J A;  5BU5 A;  1FX7 A;  1G8X A;  2Y0C A;  4ASV A;  4RJT A;  3ABM H;  4ZMD A;  4HQM A;  4IPA A;  3W6V A;  5JVT A;  3DKY A;  1ON2 A;  1ZK8 A;  1WFX A;  4QTR A;  4MHG A;  3M1E A;  3H1K J;  1B72 A;  4XR6 A;  2XV4 S;  4KIF A;  5BNG A;  2WSC H;  3R60 A;  5K1Y A;  1JTX A;  3CMA I;  3HRT A;  5IT9 Z;  1JY3 N;  1R23 A;  3KYQ A;  1XMX A;  4Q4Z F;  1RE3 C;  3SFD C;  3CCL P;  1AFO A;  1S5L C;  2DA7 A;  4NNJ A;  4DIQ A;  3GHG C;  2QKM B;  3FXU A;  1IFN A;  2ZJR F;  4KFC A;  2A6T A;  5LBQ A;  4HNV A;  2N1T D;  2R7U A;  3LA7 A;  1XTA A;  2POH A;  2KOG A;  2F5C A;  1L0L G;  5AW8 B;  2YXQ B;  4D6T G;  5CBN A;  3PLN A;  2NVX J;  1AKH A;  2EK5 A;  1L0N D;  4L18 B;  3LIE A;  3CF2 A;  1X79 B;  1BA5 A;  1L0O C;  4OU0 A;  4G7H F;  1SLQ A;  1FDM A;  3RK3 C;  5LRS A;  3KP6 A;  1GK6 A;  1HOM A;  3RJP A;  2GIZ A;  1Z7U A;  1NTK G;  1BW6 A;  5KAF E;  2DDA A;  2YUS A;  1XDS A;  4FX4 A;  1YI2 P;  1SFC A;  3ABL H;  3QPT A;  1QU3 A;  1MND A;  3I0T A;  2OD5 A;  1H8A C;  1AWC A;  5LEJ A;  1N78 A;  2O8X A;  4MEY F;  3F5H A;  3L74 E;  3K9T A;  4HKZ H;  3VYI A;  3T8R A;  4AM3 A;  2TRT A;  1K79 A;  3T97 B;  4U87 A;  1M1J C;  1E79 H;  3GO5 A;  1ZR2 A;  3CME P;  5CCG C;  3KLO A;  1V5G A;  2X4H A;  1DD4 A;  4L73 A;  2DA3 A;  3N05 A;  2G7H A;  1FZE A;  2KKO A;  3H5R A;  1VQL I;  3C1L A;  2CG4 A;  5DUK A;  5CVV A;  3SQN A;  4LGW A;  4F93 B;  3ZMT A;  2KYV A;  1JUS A;  1AU7 A;  4UB6 E;  3CDL A;  1YHQ I;  4XOR A;  4EGY A;  2YKP A;  3II6 A;  1YE9 A;  3OSG A;  3D5L A;  2GA2 A;  2ZT9 B;  2M8G X;  1ZLL A;  3HGY A;  3NWT A;  2XPU A;  2EZL A;  2Y48 A;  4DYC A;  1P2F A;  4E7L A;  1EZV G;  1VF5 D;  4IVN A;  1BCC E;  2E60 A;  3FXR A;  5HLI A;  1P4A A;  4ZDO A;  2AEM A;  3GTQ J;  1U8B A;  3GUD A;  1X19 A;  1QQI A;  2KRC A;  1ETO A;  2VB6 A;  3C2B A;  3H9Q A;  4YII A;  1PUE E;  3S16 J;  2O01 H;  4HQE A;  2KIU A;  3TW6 A;  4LLN A;  4ON0 A;  3WTU C;  1LNQ A;  4G6Q A;  2DYR H;  2BEZ F;  1R5H A;  3RK2 C;  3TDK A;  3M4O J;  2LC2 A;  3HPH A;  4LIT A;  2OQQ A;  2Z5U A;  1OR7 A;  1M7L A;  1BGY D;  3AED C;  2Q7C A;  2CQK A;  4LMY A;  3D6Y A;  3TDU C;  3L73 J;  2CYY A;  2DW4 A;  1FBU A;  2AQF A;  3ECO A;  1T0F A;  3S3N A;  2YKQ A;  2CQ7 A;  1J0R A;  1JJ6 C;  5AW3 B;  4Z2Y A;  5BU8 B;  2O1J A;  1TW3 A;  1Z77 A;  2ZXH A;  1I39 A;  1FT9 A;  1KQL A;  2LR2 A;  2VRS A;  2R0Q C;  4G9Y A;  3VMZ A;  3LW5 H;  3WTX C;  4OOI A;  3TOB A;  2QM7 A;  4BQA A;  1CI6 A;  4I6M C;  3S2H J;  4HAM A;  2VBZ A;  1RF1 B;  3L2R A;  1FZC B;  2WWY A;  3AG1 H;  1SQV G;  1Z56 A;  3F21 A;  1D5Y A;  4G7O F;  1W36 C;  1KB9 D;  2X51 A;  4IHV A;  3TGU G;  1ENH A;  3W67 A;  1BOA A;  4KDP A;  1BC7 C;  3D5R C;  4LK0 F;  1ORK A;  2V6E A;  1N7L A;  1NYH A;  5EFW B;  1W0U A;  2F4I A;  4CDG A;  3H1I E;  1FC2 C;  4RAF A;  4M3L A;  1R5G A;  3V7S A;  1L4A B;  1NAF A;  2CW0 F;  2L9S A;  1USS A;  3CC2 I;  3FX3 A;  1B9M A;  1FYL A;  1KQ9 A;  4HA8 A;  3L7W A;  3HD7 B;  1NHL A;  3CO6 C;  1WWX A;  2DJI A;  1NTM K;  3H1H G;  1N73 B;  1FOX A;  2ID6 A;  2OCC H;  4JYK A;  2KUB A;  3Q5S A;  1IN8 A;  3H1C A;  2ZFU A;  3GF2 A;  3OL3 A;  4BY7 J;  1KA8 A;  3AE3 C;  1RF1 C;  2HXI A;  2JTV A;  1A02 J;  1JI8 A;  4BXL A;  2E5Z A;  2M45 A;  4IL6 X;  1SQV K;  1HKT A;  2KK7 A;  3D5S C;  4B86 A;  3DEE A;  3G6E P;  3G71 I;  3BTJ A;  1FE6 A;  3K4B A;  4C3J J;  2DPU A;  2OF7 A;  2QUF A;  4QMA A;  1K78 A;  1SVL A;  1BCC D;  3S3M A;  2LKP A;  2OQG A;  1VQ7 I;  1GMJ A;  2E5T A;  2JDI H;  2WWW A;  3RL0 C;  3H0D A;  1LDK B;  4HYE A;  5C4J J;  2IBZ E;  3S1N J;  3A4C A;  2BCC J;  2E75 B;  3LMM A;  4EJW A;  1L2P A;  3V4W A;  4A3E J;  2WAF A;  4BQQ A;  3MZW B;  3ZXS A;  1KOR A;  2R7X A;  3L35 A;  1R36 A;  3KLN A;  4KMU X;  5KK1 A;  5BVZ A;  5AW2 B;  3CCR I;  2UWM A;  1KYZ A;  1UST A;  5DD4 A;  2HPC B;  3CDI A;  3ZMU A;  1S4X A;  5TJJ A;  3RBX A;  3RYR A;  3KQG A;  5LD2 C;  5F1J A;  3K4K A;  3H3Z A;  3KPH A;  2JJ7 A;  3IFM A;  3MP7 B;  5C39 A;  2QLZ A;  2W1O A;  2IGO A;  5APS A;  1F36 A;  2P6T A;  2ZC2 A;  2QGU A;  3H92 A;  1OVU A;  2KXP B;  2JA7 J;  1QGP A;  1Y39 A;  4QSH A;  1AVY A;  1GW4 A;  5ERI A;  3I64 A;  3O2P E;  3BPV A;  5DM6 F;  4Y13 A;  3J80 K;  1D8J A;  1IFM A;  5HOO A;  1NKZ B;  3DTK A;  3K5B A;  1NU1 D;  4HPQ A;  1BI0 A;  1MSF C;  1FOS E;  2FXO A;  1A6Q A;  2IW5 A;  3L2C A;  2AXT C;  5JI6 A;  4RB3 C;  3DCF A;  1P6R A;  1VL2 A;  5GPC A;  2VOD A;  3SFE C;  1T3U A;  1FZG A;  1NOH A;  2YS9 A;  1UAA A;  4AYC A;  4P96 A;  4RGS A;  4HX4 A;  2P5V A;  3TYY A;  1KTM A;  3QU3 A;  5F0C A;  4HLX A;  4OWR B;  1TU3 F;  5A2Q Z;  1S5L H;  1R1V A;  4PSW A;  1A04 A;  3D0S A;  4UV9 A;  4JX4 A;  1WJB A;  4AIH A;  2BCC D;  3FWE A;  2NZ2 A;  1VQN P;  3C9I A;  4WBA A;  2DI3 A;  2Q9I A;  1ETY A;  1IDZ A;  5HVQ C;  4IL6 H;  2NPS B;  3CCM P;  1LTT C;  1KD1 Q;  5HS7 A;  1SD6 A;  2CH0 A;  2G7U A;  4ZYE A;  2JJL A;  2KSJ A;  5APU A;  5ILU A;  1RF0 C;  3CCQ P;  4UUS B;  2VE9 A;  3J7Y J;  3B6C A;  4EGZ A;  2ZB9 A;  3OL4 A;  2EPF A;  4IL6 E;  3QWO C;  3VOP A;  1FBS A;  3FHZ A;  3HKZ A;  1Z91 A;  3LQR A;  3R4K A;  2A07 F;  2NYX A;  1A31 A;  2IRF G;  3H6P A;  4PUS A;  3E1R A;  4AID A;  4UVA A;  1B72 B;  3JCU H;  1OJL A;  2JT1 A;  2KL4 A;  2YU3 A;  1REP C;  2O9L A;  1JT6 A;  4OGQ B;  2GUV A;  1BBY A;  1NH4 A;  2QQ9 A;  3BCC J;  4PJ0 C;  3MZY A;  2DCE A;  2DTZ A;  2W48 A;  3CCM I;  4O3M A;  1OW7 A;  2HFE D;  4GDO A;  2A06 G;  5B66 H;  3H3U A;  5B5E H;  3KP2 A;  5CJ9 A;  3CMM A;  5FRN A;  2N9Y B;  1QA6 A;  4GYI A;  3RK3 D;  4H0L C;  3AE2 C;  3L71 G;  1IN4 A;  2HR3 A;  3FK7 A;  1OR7 C;  4Y99 C;  5H2F E;  1Z21 A;  1X3W B;  2XRL A;  2I1K A;  2IFM A;  4PD4 D;  3AE9 C;  5GAG J;  1MFT A;  4PJ0 H;  2E74 C;  1HJ0 A;  2PMU A;  2CV1 A;  3VTP C;  3PQJ A;  4UUT A;  3TGN A;  2FJ1 A;  1EXI A;  1SMY F;  2FD5 A;  1GT0 C;  3QQA A;  2E76 B;  3B73 A;  2Z1D A;  3WG9 A;  4D9J A;  2DFH A;  4IJA A;  3M8J A;  4II3 A;  5D6E A;  4CCO A;  1SQX G;  4I7Z B;  1S9K D;  1XCV A;  3S3O A;  1RHZ B;  3PL8 A;  4CSW A;  4XNF A;  3OYM A;  1HKS A;  1UG0 A;  5E1X A;  1KZH A;  3HL2 A;  4MEX F;  1FJL A;  2E76 D;  5KLV G;  2XND H;  5HDG A;  2OTL P;  3KFW X;  1FY7 A;  1NTM J;  2ITA A;  2C9N Y;  1NTK E;  2FE3 A;  2IJL A;  3FK6 A;  1HF9 A;  4U7D A;  3HOW J;  1BIA A;  5KAI H;  1SQP G;  5DV5 A;  1TBX A;  1LTG C;  5KLV E;  2Q2E A;  3LSJ A;  3H1H J;  1TZL A;  1LFB A;  2EIM H;  2XF6 A;  2Y75 A;  3Q0V A;  3BR3 A;  3H1L J;  3TMO A;  2Q1Z B;  1TL8 A;  2LLK A;  1S1C X;  3KZZ A;  1P9Q C;  2GQQ A;  3DEW A;  3QAH A;  1SQV D;  3PP5 A;  3CWB D;  1GVD A;  2Q3I A;  3HSE A;  6PAX A;  3ZGK A;  1GL2 D;  2RGV A;  4UVB A;  4GGG A;  1IFI A;  1QO0 D;  4JBA A;  2VAS A;  2RKL A;  3TF5 A;  5FKN A;  2D2C D;  3DEU A;  1UMQ A;  1IV6 A;  2MJZ A;  3IH3 A;  4N4N B;  3AEB C;  1OCR H;  1IN7 A;  4UV8 A;  4C3I J;  3K4N A;  4D7N A;  2BCC E;  3CZ6 A;  3ITK A;  4MIM A;  1SVO A;  4WCG A;  3FGA D;  2YX7 A;  3F8M A;  1IFJ A;  2EH3 A;  4ENJ A;  4NC7 A;  5H2F H;  5BPD A;  1BOB A;  3HDD A;  3RPU D;  1ZHF A;  3GCM A;  3B4S A;  1ZXG A;  1FZA A;  1BCC G;  1WJD A;  4GOE A;  2VPR A;  5IYD J;  3KZI E;  4BY1 J;  1BI3 A;  2J59 M;  1OMI A;  2C9L Y;  2BV6 A;  4A69 C;  3M8F A;  1LWU A;  2OAZ A;  4OIO F;  3LOC A;  3RQ4 A;  1D3Y A;  2KNC A;  3V7R A;  2MYS A;  1W5T A;  1SQQ K;  3BCC G;  1F1Z A;  1D1A A;  3K2Z A;  4GCV A;  2O1K A;  2QYO A;  2YXR B;  2JK3 A;  2FFD A;  2QSI A;  3U1K A;  4H0E A;  2WB1 N;  4ASN A;  1IG7 A;  1KB9 I;  2HPC A;  3W6K B;  4M6V A;  3DTE A;  3T8T A;  3AG3 H;  2R5Y A;  2EFW A;  1SQB D;  1KU2 A;  3OYK A;  1S72 I;  1K8A Q;  3RYP A;  3A1Y A;  5LHG A;  1GUU A;  4L9V A;  5HLH A;  3HOX J;  2H27 A;  1T2K D;  2PJP A;  2DK5 A;  2K3R A;  3OYN A;  1LTB C;  2VKD A;  1QX8 A;  3L70 D;  1YS7 A;  2X48 A;  5IP7 J;  3LWF A;  2MGQ A;  2B89 A;  1X58 A;  4UB6 C;  4OVN F;  4H44 C;  3FMR A;  2R7V A;  1BE3 G;  5FFZ A;  3OYA A;  1Z05 A;  4G6T B;  1HDP A;  3SWK A;  2E43 A;  2RN0 A;  3NEU A;  1W2E A;  2VXZ A;  2KS1 A;  3HD7 D;  4XA4 A;  4DJG A;  2ZNZ A;  3Q5R A;  4G12 A;  2O6G E;  3S32 A;  2KDZ A;  3S2D J;  2R5Z A;  2W00 A;  2LH9 A;  3F6V A;  3JRH A;  3M1C A;  3CXH E;  4ZTJ A;  2FYN C;  4RB0 A;  1YJW P;  3M9B A;  2JKV A;  4PD4 H;  2HS5 A;  2NRA C;  1HUC A;  3Q9S A;  3OS2 A;  2X1C A;  3L71 D;  2HGC A;  3KZI H;  5DCM B;  1YJ9 P;  3EQL F;  2X1D A;  3KX2 A;  3CD6 I;  2WSC J;  3HM5 A;  3S17 J;  2D2W A;  1KQG B;  4LB6 B;  3V2R A;  3M0A A;  1DPR A;  1WJ5 A;  2M30 A;  5J6X A;  5CVI A;  3CCR P;  3J81 K;  2XV5 A;  2MSY A;  4N9I A;  4IRH A;  3I58 A;  2C0X A;  1U9N A;  2K9Q A;  1KYO I;  3MQ0 A;  2XUB A;  3CO7 C;  1X2N A;  2ADU A;  3ZQQ A;  2CK3 H;  1U9O A;  2Q1K A;  5E3L A;  2OC6 A;  2J58 A;  4HBL A;  3L1P A;  3SSU A;  5EGO A;  1QHG A;  1YTY A;  3L72 J;  1FP2 A;  3L72 E;  2L2O A;  3F8N A;  2L91 A;  3H1J J;  2LD5 A;  1YHQ P;  1HBW A;  2PJR B;  1TQI A;  1YOV B;  3BJO A;  3I71 A;  4TV7 A;  4GDF A;  2VON A;  3BR2 A;  2OYH C;  2ZKZ A;  3SXY A;  3V42 A;  3VSK A;  4W7Y A;  3HG9 A;  2KT0 A;  1BE3 D;  4R8H A;  2OCE A;  3FXL A;  1QHH D;  2K86 A;  3O6Q A;  1BI2 A;  5M5X J;  4ZDP A;  1ZLK A;  1ZRF A;  1KZU B;  3EPZ A;  1M1K Q;  2HOS A;  1A35 A;  3RL0 B;  3OSF A;  2EIK H;  4M9Z A;  2F2E A;  3HSF A;  2GA1 A;  4UY8 I;  1EV7 A;  3MZH A;  1SQB K;  3JW4 A;  4Y17 A;  5HLT A;  3N97 A;  4ETS A;  1HH0 A;  3RKY A;  5AW9 B;  2W8Z A;  5ICE A;  1NTK D;  1EZV D;  3OIQ A;  4LIV A;  1EZV E;  1K9M Q;  4G7Z F;  2X6X A;  4OWF A;  3FXQ A;  4D5F A;  3NMD A;  2FFD B;  3DU5 A;  5KAF C;  2XPW A;  1KFN A;  3MTU E;  1R22 A;  3GHG A;  1XMK A;  2QJK C;  2STW A;  4YEJ A;  3G4S P;  1R7J A;  2DLL A;  1E5W A;  3H1K G;  2RQQ A;  4N78 D;  2CQQ A;  3L4F A;  4OIQ F;  1ZEL A;  3HTU A;  3ISP A;  1L0L K;  3ZDM A;  1D0X A;  1DD3 A;  4XIC A;  1GW3 A;  1R00 A;  1WJE A;  3HD7 C;  3L73 E;  2LR8 A;  4N3Y B;  4UB8 H;  2XAU A;  4ZNC A;  4FE7 A;  3RSN A;  2NOG A;  1OKR A;  1OYW A;  4CYD A;  1XS9 A;  1H89 C;  1Q81 Q;  2M34 A;  3CCL I;  4GKG A;  3BCB A;  2IZ0 A;  3A0B H;  5AW6 B;  1NK2 P;  1RF1 A;  5APY A;  1X1C A;  2K9J A;  2PRR A;  2YO3 A;  4WY4 A;  1DIP A;  2M5A A;  5M1B A;  1WI9 A;  5FD5 A;  1N8R Q;  2PP6 A;  2MW8 A;  2L7M P;  2HG5 D;  4HYT B;  3QU6 A;  2WV0 A;  1KIL C;  3OS0 A;  1YJ9 I;  1FC3 A;  3OS1 A;  2ZO4 A;  1K83 J;  3TGU J;  4WXD A;  1N77 A;  2GUS A;  2XRN A;  4A6E A;  1J75 A;  4OIR F;  1IUF A;  1FJK A;  5K5Q A;  2FOW A;  2EB7 A;  4BKX A;  2BEQ D;  1MMG A;  1ETW A;  4AVP A;  3L00 A;  4M9S A;  2K4B A;  4UB8 E;  2E5Y A;  2WPR A;  3LSK A;  1IDY A;  2ID3 A;  2M5W A;  1KYO D;  1JB0 J;  2AQE A;  2E71 A;  5K5O A;  4JP0 A;  1IFP A;  1N86 A;  2RNG A;  3CWB J;  1BSH A;  1IF1 A;  1XMA A;  2BBY A;  3BJ6 A;  3MCZ A;  2H1K A;  2H94 A;  2J5P A;  3H36 A;  3A2K A;  3ABU A;  4IOA F;  2CMP A;  1SFU A;  3FXD A;  2JPB A;  3E5X A;  3A0B E;  4HH2 A;  3H1H D;  5F0F A;  1OCC H;  1ULY A;  2EIN H;  2M2E A;  1LE8 B;  3J7A O;  2DQL A;  2BHZ A;  2WSE J;  3LID A;  2AEJ A;  1UHW A;  4DZP A;  1IGN A;  1NHA A;  1H9G A;  2DT5 A;  2P5L C;  1URQ D;  2JMW A;  1JKR C;  3N4M A;  3TED A;  2LNB A;  4ZDL A;  2PFX A;  2LKS A;  1YBK A;  2QM8 A;  1N7S A;  2OQR A;  2F5D A;  3ZCO A;  1B59 A;  4N4O B;  1DUX C;  2B0L A;  1G6N A;  4IZZ A;  1LWU B;  2LKM A;  4L74 A;  1ETX A;  4XLA A;  1ZLJ A;  3IR9 A;  4BL0 B;  4R1H A;  1J1E B;  4G6D A;  1YTZ I;  1O3Q A;  5FLX Z;  2IVM A;  2VN2 A;  2XF7 A;  2Z99 A;  4YIR X;  1YFH A;  1W5C E;  3E1S A;  5IT3 A;  3VP9 A;  4IOC F;  4E7S A;  2E1O A;  4I99 C;  1FZF A;  2QA4 I;  3CLQ A;  3MKL A;  1AQT A;  2A45 H;  4PGH A;  1OW6 A;  1ETQ A;  3TO9 A;  2P1J A;  5F04 A;  4FHT A;  4WF2 A;  4J19 A;  3LSR A;  3OV8 A;  4A3I J;  1X22 A;  3FKI J;  1NG7 A;  1GD2 E;  1JHH A;  1W7P B;  3Q0W A;  1SQQ D;  1V5F A;  1O7F A;  3T97 A;  1R71 A;  1DU0 A;  1P84 H;  1CF7 B;  1EH7 A;  5CQG A;  4CHU A;  3PH0 A;  4WXH A;  4BXX J;  1V3F A;  2ZNY A;  4KT5 C;  3ASN H;  3PIP F;  1NU1 J;  4H0L B;  3RK3 B;  2BCC G;  1PZQ A;  4ABZ A;  4BAC A;  3FXM A;  4XMY A;  3FBN B;  5J1R A;  1LGH B;  1P84 I;  3GLM A;  3A01 B;  1YJN I;  3HYI A;  2VPL A;  3F3X A;  3KE2 A;  2R5Z B;  3UKG A;  1HGV A;  3OA7 A;  2NVT J;  1HSJ A;  2GBY A;  5J4Y A;  2X6O A;  4A3F J;  2AEF A;  2FBI A;  3GTG J;  1TWH J;  3M0D C;  2RH0 A;  2M4G A;  1FBQ A;  4C3H J;  4IHS A;  3CF5 F;  1FDI A;  3L2U A;  1AOY A;  2YIU B;  1K04 A;  1QL2 A;  3O8H A;  4A0Y A;  4B3A A;  1YG2 A;  1O3R A;  2ZXE B;  3DU6 A;  3IHU A;  3BG5 A;  1S72 P;  3BG3 A;  1GK4 A;  3RL0 D;  3H0G J;  3ZQF A;  1DX7 A;  1SVM A;  2D1H A;  2VJ5 A;  2ETH A;  3QWL A;  1X3U A;  4U88 A;  1JE8 A;  2QBY B;  3GEZ A;  3FXJ A;  2H88 C;  5GTI E;  4F91 B;  1USE A;  4UUS A;  3M3Y J;  2ZVO B;  2O8K A;  1E3P A;  4AIJ A;  3QOD A;  2W83 C;  1SQX E;  1B8I B;  5E3O A;  3TO7 A;  1KIL B;  3OW2 O;  5L3G A;  1TQM A;  4BE1 A;  4HV5 A;  3VOD A;  1O3T A;  1OCT C;  3RTR A;  1KV4 A;  5L3D A;  4U7B A;  1W7P A;  4IFD K;  4OMZ A;  2XB0 X;  4XOP A;  3K70 C;  2O0Y A;  4PFO A;  1IRZ A;  1VTN C;  4J00 A;  2HFH A;  3G73 A;  1OXZ A;  3GFJ A;  1J1D C;  5FO5 A;  4U0Y A;  4IRG A;  4YPC A;  2WZ7 A;  4OAZ A;  1OZH A;  3BPX A;  3BDD A;  1M90 Q;  5JR3 A;  1OFC X;  2JRM A;  4XRM A;  5EG0 A;  3G71 P;  3A01 A;  3E7K A;  3SWY A;  4RM2 A;  3HRU A;  5TIS C;  3SEQ A;  3OYI A;  3CCV I;  3RZD J;  3FXE A;  3O6Q B;  3P7K A;  1TLH B;  4DCK A;  3DQV C;  3E0J B;  1L0N G;  1NJI Q;  1T3J A;  4LIU A;  1LDJ A;  1Q1H A;  5DCM A;  2XKO A;  3I53 A;  2X0L A;  1IK7 A;  4NPF X;  1WZ2 A;  2EIJ H;  1BDC A;  5AVS B;  1YRN A;  2H6B A;  2NVU B;  3TDZ C;  1TT0 A;  1ZOY C;  1EZV I;  1EA3 A;  4FT8 A;  4JYB A;  5EF6 A;  3M0D A;  5M5Y J;  4UUV A;  2WMM A;  1AV1 A;  1SD7 A;  2GXA A;  1IO4 A;  2DMT A;  1FS0 E;  4XSZ F;  5CPR B;  3VYU B;  5HNF A;  1K6O A;  3EQ2 A;  3P7N A;  2XF5 A;  1SFE A;  3FXO A;  4D6T D;  1HQC A;  1EDI A;  2VBW A;  4KYW A;  3IAO A;  1RKT A;  1PFI A;  2R7W A;  5E1W A;  2DA6 A;  4DYQ A;  3IRR A;  1EJ9 A;  2E75 C;  3DXJ F;  2WSF J;  3OYG A;  1VQO I;  4PD4 E;  2W82 A;  3S4R A;  3D70 A;  3Q2Y A;  2K1A A;  4WB4 A;  1FP1 D;  1O7L A;  3DPL C;  3MMY B;  4KA4 A;  3V5B A;  3L70 E;  2M0M A;  1U3E M;  1Q1V A;  5LLQ A;  5D4R A;  1VPC A;  2WPQ A;  2WAQ A;  5E79 C;  3V6I A;  4I02 A;  3I56 P;  2RVC A;  1K78 B;  2VC0 A;  4A5N A;  5K7H A;  2BHY A;  4LOC A;  5FRM A;  4CXF A;  1R49 A;  1ZGA A;  5K5R A;  1SQP D;  2KLV A;  4I1L A;  3KYC B;  3ESW B;  3QPH A;  4E4H A;  1J2J B;  3TP3 A;  3U9G A;  3CC4 P;  1P7J A;  2LY9 A;  2JRT A;  1U6G A;  2WV1 A;  2Q2E B;  3KEY A;  4UVC A;  3F22 A;  5TIS E;  5CBO A;  1OYI A;  3HBL A;  4LD5 A;  2Q8K A;  4CYC A;  4BRY A;  2NVY J;  1LP1 B;  2MH9 A;  2H1L A;  1E3H A;  1B6A A;  2KJB A;  3IV5 A;  4IQJ A;  1N7S C;  1SFC C;  1SQX K;  1XSV A;  3WHC A;  3RK2 B;  2WT7 B;  1JUM A;  2VBX A;  3HUS B;  2EV5 A;  2AXT H;  1LVA A;  4W80 A;  2F5F A;  2HVS A;  4XON A;  5D4S A;  3OAK A;  1T6S A;  1ZKG A;  1PGP A;  2EV0 A;  1JMM A;  2BEO A;  3K7A J;  2XAH A;  3L73 D;  3CES A;  2E1C A;  2HDC A;  1SQP K;  1PJR A;  4RA2 A;  1WJC A;  1BGY J;  2CV2 A;  3CWB G;  4MNU A;  1W5C C;  2WAD A;  2B87 B;  2IPQ X;  1KMI Z;  3P8C E;  4DGW B;  2ZT9 C;  3LAP A;  1FZC C;  4OMY A;  3S1M J;  1IC2 A;  3W3C A;  2IBZ D;  5GTI C;  2JWD A;  4D6T J;  3CCJ P;  5DJT B;  1HXD A;  1T33 A;  3JSV C;  5TIS H;  5FKM A;  5GP9 A;  1ZGW A;  4IHX A;  3KP7 A;  4LK1 F;  4RAG A;  4J01 A;  4I2O A;  2LF8 A;  1CI6 B;  4U3F D;  1FZC A;  2ZSH B;  1RE4 A;  5IP9 J;  4CCM A;  2CGP A;  2VI6 A;  4RGR A;  3MKW B;  3DTI A;  3GG2 A;  1JTH A;  4FE4 A;  3ZQG A;  1JKQ C;  3HC7 A;  3F0C A;  4LG3 A;  1GVJ A;  1TT5 B;  4H44 D;  2DN0 A;  1JHF A;  4R4M A;  2D5V A;  1XGM A;  3SYT A;  1VF5 B;  5H6R A;  2BY3 A;  2QEN A;  3OJA B;  4Z6Y A;  1JY3 O;  2EFQ A;  2LBF A;  1PDN C;  4IO9 F;  3FX0 A;  5LHI A;  1HC8 A;  3IRQ A;  5CCH D;  1GU5 A;  1JO5 A;  3KP3 A;  3F8F A;  1FNN A;  2ME0 A;  3LQQ A;  2FF4 A;  4I76 A;  3CP2 A;  4GIF A;  5D6F A;  5H20 A;  2DPD A;  3BG9 A;  4IRI A;  2L5Q A;  5LHH A;  1FLI A;  2HOD B;  4M3D A;  4G8X A;  1IAW A;  3BLY A;  2NRG A;  2WY7 Q;  3E6M A;  4JX5 A;  4BHP A;  3G1O A;  3I5U A;  5FLM J;  3Q5P A;  4MQV A;  2FKW B;  1ZRC A;  4DBR A;  5CHX A;  5KCM A;  4I7H A;  2PLY A;  1DDN A;  2YMY A;  1L0N K;  2FX0 A;  3F89 A;  4YXD C;  2FY8 A;  3P32 A;  1FMW A;  4NUB A;  4P55 A;  4K35 A;  3KZY A;  5BQT A;  5FKO A;  4E70 A;  1TQP A;  2I1J A;  4CZZ A;  3O6B B;  2QJY C;  2L7F P;  2L9N A;  4JBZ A;  4KJM A;  1LKX A;  5C44 J;  3KPE A;  4V19 K;  3VMA A;  1VDF A;  2M3E A;  5DDG A;  2EBI A;  2IGN A;  2W6A A;  4ENK A;  5C3E J;  2DAO A;  1ZG5 A;  5F1R A;  3KYL A;  5CCH A;  2XKM A;  5H6Q A;  1BN5 A;  1FMV A;  2CPB A;  1VQ8 P;  1IN6 A;  2HYF A;  1R5L A;  3AEC C;  5KKZ C;  2MG4 A;  1VQ5 I;  1VQ9 P;  1UHS A;  2IAI A;  5IOZ A;  2BXZ A;  3WU2 C;  3WGI A;  3CX5 H;  3I5C A;  2IBD A;  2ZFW A;  3OYF A;  4W7Z A;  2EZK A;  1KGS A;  1WH5 A;  2L7K A;  4AIK A;  4ESJ A;  3AEA C;  5LGT A;  1NK3 P;  2A6H F;  3NFQ A;  2H8R A;  2VOO A;  2OZU A;  1GLN A;  3I59 A;  5J8C A;  2RV8 A;  4JYC A;  1ODD A;  4ZYA A;  1VFC A;  3RCO A;  1PIX A;  2HDW A;  2GOM A;  1MMA A;  3VFZ A;  2IFN A;  1CGP A;  4I7Z C;  1T98 A;  3HKZ N;  4EJT A;  4A3L J;  4S04 A;  4EYY Q;  4M6Y A;  2EIL H;  3GHG B;  1KIL D;  3C2H A;  2K9Y A;  3HTK A;  3K1N A;  1MBK A;  1AJY A;  2FFD C;  2K9S A;  2FUG 2;  2QQA A;  1HBX G;  2JEE A;  2H7H A;  3U2R A;  3CME I;  1JUP A;  1PPJ E;  2UXN A;  2V79 A;  4FQG A;  5GTH C;  1POG A;  4I0B A;  1H88 C;  4XKW A;  2LP0 A;  3RZO J;  1R58 A;  2WAQ N;  3OYJ A;  4MTE A;  1F4K A;  1LEB A;  2OPT A;  3K1M A;  3L73 G;  4N6J A;  1TNT A;  1TWA J;  2FBH A;  3WTT C;  4RGU A;  1RE3 A;  3RBZ A;  2N1T A;  2HOE A;  1T95 A;  3MVP A;  4EM1 A;  2YPR A;  3KP4 A;  2A45 I;  2M8E A;  5APX A;  2I10 A;  1P84 E;  3S8P A;  2X1E A;  3E97 A;  1HST A;  2PN6 A;  2DK8 A;  2Y31 A;  3PFY A;  3ZMS A;  4CH7 A;  2HDD A;  4KUM A;  1GHC A;  5FD6 A;  3L2Q A;  1Q90 D;  1KU9 A;  2WAE A;  3MKZ A;  4D1Q A;  1VI0 A;  2OYH B;  3PSF A;  2HQA A;  1T0F C;  3A0H C;  1MDM B;  3SJM A;  1ONV A;  4XQF A;  4L75 A;  3CD6 P;  2DYS H;  2VQH A;  3OYC A;  2IPP A;  1PGQ A;  4C2T A;  3U1C A;  2CFX A;  4XKC A;  4ENM A;  3PSI A;  1GZL A;  3H1J E;  1X1A A;  3B5N C;  1X9V A;  2Z5H A;  1UCR A;  2HQN A;  2PBI A;  2F4M B;  2JWT A;  2XDV A;  3MD0 A;  4AQR D;  3K10 A;  3HTK B;  5AVT B;  3ELK A;  2F5E A;  4HX7 A;  3JRE A;  4UXN A;  2M5A B;  4Q48 A;  5ICF A;  1IK9 A;  3UR3 C;  2XAG A;  2HQ5 A;  4JOM A;  2NNN A;  5TGT A;  1JOC A;  3JAM K;  1JY2 O;  4TLF A;  4GO1 A;  1W5S A;  1TTY A;  2ZSI B;  3T0Y A;  3JSO A;  2XDJ A;  1G3S A;  2XGD A;  2DOA A;  4BWN A;  2M0C A;  3ABK H;  3HHH A;  2FYU J;  1LVK A;  1SQV E;  2FYU E;  2D1V A;  3RKQ A;  2OZ6 A;  1ZV8 A;  3SZT A;  1CQT A;  3GBG A;  1VQK P;  3GTO J;  1VQ8 I;  2EFP A;  2K3F A;  2OYI C;  1VQL P;  4QIW N;  3J81 Z;  1MFZ A;  4EM2 A;  1G2H A;  3WE3 A;  4KIB A;  1BSN A;  3GW2 A;  1NTM E;  2QSH X;  3WU1 B;  2KFD A;  3ERM A;  2R92 J;  1X2M A;  1Y1V J;  3TNU A;  1I3A A;  4DOJ A;  3BCA A;  3EYY A;  2QWW A;  2C0W A;  1QVT A;  1ZQ3 P;  2KB7 P;  5CLS A;  4JQ0 D;  1OWA A;  4BBR J;  1LT1 A;  2O01 N;  3H1H E;  1J5Y A;  2AXL A;  2H43 A;  1YX3 A;  3IWF A;  1XGN A;  2WC2 A;  1WCM J;  2ZAE B;  2EQR A;  3B8E B;  3DLA A;  3AE6 C;  1S3J A;  3R6S A;  1B4A A;  4I09 A;  3TW7 A;  3UNG C;  2FU4 A;  3IUO A;  1XDU A;  2DFI A;  1XSX A;  1APL C;  4EJO A;  1HWT C;  3HHG A;  3G1L A;  3WHB A;  2MC4 A;  3N4X A;  1QRY A;  4Q5S F;  2EA2 A;  4FX0 A;  1MBE A;  1OCP A;  2KSE A;  3DP7 A;  1Y0N A;  2DO7 A;  2OA4 A;  1FBM A;  4QLC U;  3BVH A;  2IYP A;  1MZB A;  4BDY A;  1QBJ A;  2QRX A;  2V4H A;  3H32 A;  1E3O C;  2FA5 A;  4KMF A;  3BCC D;  2DDB A;  3QYF A;  4HG2 A;  1AVO A;  2Y0S N;  3F6O A;  5HDN A;  1ZTR A;  3EFF K;  1MUU A;  1SAN A;  3EWK A;  5D5W B;  1XN7 A;  2BAS A;  1R4M B;  2ZXI A;  5HDK A;  2K9J B;  2M8R A;  2K5C A;  3RPQ A;  2IGK A;  5D5U B;  5AVR B;  4ASW A;  5EZG A;  1KB9 H;  2ZJS E;  3KDP B;  3G2B A;  3I4M J;  1BE3 J;  1BJA A;  5KVR A;  3CCY A;  3GLL A;  2VXD A;  1Q2N A;  2FYU K;  1VQM P;  1N73 C;  4E7I A;  3GTM J;  2Z2S B;  1D0Z A;  2PG4 A;  3OIO A;  4A2U A;  1LTJ A;  5K7Z A;  3GFM A;  2CUJ A;  5B5E E;  1NTM G;  3E6D A;  2PEX A;  5APV A;  5CQE A;  1ZAO A;  2JWA A;  3F8B A;  1R5S A;  3ZMD A;  3BR5 A;  3A03 A;  1IJW C;  1SQB G;  3M9Q A;  4GOF A;  5KLV K;  3JRG A;  3KP5 A;  1JKP C;  2B63 J;  1JCD A;  3WUV A;  3E5Q A;  2TDX A;  1NTK K;  3PNT A;  3P9K A;  3WTZ A;  3VYR B;  3HTS B;  2MKV A;  3ZQI A;  2MD0 A;  3FMQ A;  2NAZ A;  2EA4 A;  1DQU A;  3WTS C;  3H1L E;  1XTG B;  5D8L B;  4XKV A;  1URQ B;  1YO5 C;  4IOI H;  4PZJ A;  5J3L A;  2VUM J;  3EUK L;  4UB6 H;  4D5C A;  4DQ2 A;  1PL5 A;  1MIJ A;  3FM5 A;  3CC7 I;  4GT1 A;  1DU6 A;  4E7H A;  4FIS A;  3B02 A;  3GX4 X;  3D1N I;  2IX7 C;  4OGQ D;  1E17 A;  1J09 A;  1ZRT E;  3COA C;  3CCE P;  4ZC3 A;  3GZ5 A;  4CUG A;  3L70 G;  3VB2 A;  1OPC A;  5J1U A;  3F72 A;  2HOT A;  4C2U A;  4KT0 J;  4B8X A;  4LGD E;  3ML6 A;  2KMU A;  2LFB A;  3MN2 A;  4DNC A;  3C8V A;  3H5A A;  1LTA C;  4MLO A;  1J59 A;  3H1I G;  3AEG C;  1XCB A;  1KB9 E;  3WUU A;  3T5X A;  1WVR A;  3CPW O;  3JRB A;  2HYN A;  2R5B A;  3BY6 A;  2WSF H;  2O03 A;  2W24 A;  3E6C C;  2FML A;  5FJ8 J;  5GAD J;  5AVY B;  1OVV A;  4LG0 B;  2RN7 A;  1SFX A;  1BDD A;  2RAE A;  2CUF A;  2FXP A;  5EEA A;  3JR9 A;  3L75 E;  2OUM A;  1QVU A;  3WOD F;  3L75 D;  3SEZ A;  3GYH X;  1Z0X A;  2V9V A;  3M9H A;  2JVH A;  2F4O B;  4D0P A;  1PGJ A;  5AVW B;  5AW0 B;  2OYH A;  3OYL A;  1QNT A;  1FYM A;  2G3A A;  1YW7 A;  4GFB A;  2HNH A;  1JY2 N;  3V2Q A;  2OTL I;  1IRX A;  1JGS A;  1T8I A;  5IPA A;  4A6D A;  4KIG A;  3HE4 A;  3WU2 E;  1Z3Y A;  3J7A Y;  3L71 E;  2XAS A;  4FCY A;  4QWQ A;  1VQM I;  4HNT A;  4PV1 C;  5HS8 A;  1D0Y A;  4KHX A;  1I3Q J;  2K9N A;  2Y0E A;  3LSP A;  3P9C A;  3FXK A;  2FNA A;  2V1D A;  4NPD A;  4QPQ A;  3WGH A;  1A5J A;  3NXS A;  4MTD A;  3FMS A;  1LDD A;  5IYC J;  4L9N A;  5AIQ A;  3EUA A;  3V4G A;  1FAV A;  1GL2 C;  5DYM A;  1MGT A;  4DBQ A;  2V7Q H;  2BW3 B;  4XLP F;  2O5R A;  3DKW A;  4A93 J;  3R4Y A;  2XAJ A;  5KAF H;  2DXI A;  1SP4 A;  1WH7 A;  2Z4E A;  2PFB A;  3JRC A;  1S7E A;  3MKY B;  5AIP A;  2MD5 A;  5IOY A;  2XSD C;  2Y69 H;  4DOZ A;  4FTH A;  2NPS C;  1D7M A;  3M8E A;  2BGC A;  4NDL A;  4EEF G;  4U3F J;  4U3F E;  1L0N E;  2G8Y A;  1R8E A;  1U5T A;  1O3S A;  3R0A A;  2WBM A;  3HD7 A;  3ZQ7 A;  1IJD B;  2JUC A;  2QSF X;  2LVS A;  4HF2 A;  2X6W A;  2ZBK A;  2JSC A;  2CRG A;  4B3X A;  3JRI A;  3AE5 C;  1GL2 B;  3HIF A;  5APQ A;  1G3W A;  3H1L D;  5C4X J;  3GWZ A;  3HOZ J;  2K3P A;  2M9H A;  3HUS C;  2W84 A;  1ZRE A;  5CCG D;  2QSG X;  4B43 A;  3DBL B;  5AVQ B;  1IRF A;  1HA8 A;  2B87 A;  2NS0 A;  2CUE A;  4PFP A;  5EYR A;  4XL9 A;  4ZZL A;  2UXX A;  1N2D C;  2V9P A;  4CCJ A;  4RDU A;  3QOP A;  1A6I A;  3S14 J;  3BCC E;  2E75 D;  3CUO A;  4JPZ B;  4YFK F;  3WU2 H;  3CCS I;  4YXW H;  5BMZ A;  3K4J A;  3GME A;  1BR1 A;  1RQV A;  3ZN0 A;  3ULQ B;  2BW3 A;  2BY1 A;  4Y33 A;  1RE4 C;  1YIO A;  1WGX A;  2XHK A;  3GVA A;  2R7S A;  2IBZ I;  4EV0 A;  1S8N A;  4GXO A;  2UZK A;  3CX5 D;  1WPK A;  3AFH A;  2NS8 A;  2W4S A;  3IH4 A;  4RGX A;  2DA4 A;  3BWG A;  1NG6 A;  2GXG A;  4B44 A;  3MUD A;  1R6R A;  1YYC A;  5APT A;  4CPG A;  1YJN P;  2V7F A;  2M4K A;  1P4W A;  2M7A A;  1J1D B;  2CW7 A;  1WJA A;  2HQR A;  2QKL B;  5FB2 A;  4JQF A;  1QZE A;  4XLF A;  3WUT A;  3HEF A;  1Q7Y Q;  1OQY A;  2A69 F;  3PNV A;  1KC8 Q;  3VSL A;  3DF8 A;  3GMA A;  2ZVN B;  2L3D A;  3QP6 A;  5H2F C;  2Q3E A;  4IXA A;  2JSP A;  3H9G A;  1FTZ A;  2QCO A;  3L2V A;  3FDY A;  5D5X B;  5L3E A;  1G4D A;  2M0B A;  3MGN A;  2HU9 A;  1Z7L A;  4CIC A;  4A12 A;  5TRD A;  1X8Y A;  2RRE A;  3RQI A;  1PGO A;  2PX9 A;  5D8K B;  1SFO J;  2QF7 A;  2BZT A;  2A5W A;  4XK4 A;  1Y8A A;  3FF5 A;  1U5T C;  2GIV A;  2VE8 A;  3MAJ A;  1MMS A;  4R4L A;  4F7Z A;  1NKN A;  4OH8 B;  3O8G A;  3IH2 A;  1RR7 A;  1RRJ A;  2W7N A;  2HLO A;  3RL0 g;  3SWF A;  1TNS A;  5LGU A;  1PUF A;  3VN0 A;  3F23 A;  2LRE A;  1EDK A;  1HKQ A;  1FDO A;  1LNW A;  4ZJZ A;  3O3K A;  1T2K C;  1L3L A;  1IXR C;  3LFK A;  1U57 A;  4N9H A;  3ZR8 X;  1S9H A;  4EJU A;  1XGO A;  2ZME A;  3V8K A;  2IS6 A;  1S9K E;  2CQX A;  4LLL A;  2P10 A;  1X0T A;  5KKZ B;  4C7N B;  3F8C A;  4Y7N J;  2P2U A;  1D1B A;  5J47 A;  3PJS K;  4MO7 A;  3JRD A;  2L4M A;  3FIW A;  3FHN A;  4H4K C;  4E7K A;  1I1S A;  4WY4 D;  1R4N B;  1XG1 A;  2FNP A;  5DTD A;  1FOY A;  1DP7 P;  2R7Q A;  4IQ4 A;  3KEQ A;  4HF1 A;  2H09 A;  3BQY A;  1W36 D;  3FZV A;  2COB A;  2BY2 A;  2HEO A;  1XX5 A;  3JRF A;  2PGD A;  2DOD A;  1K73 Q;  3DPT A;  1IFD A;  3LSH A;  1NU1 E;  5HNH A;  4U0W A;  2IS2 A;  2FQ3 A;  3ABT A;  3OR2 C;  4M3G A;  2FOK A;  3CMY A;  3DFG A;  1G1I A;  5AVU B;  1N75 A;  2P7V B;  1VQK I;  2Y9Y A;  1B8I A;  2WIT A;  3A5T A;  4K2E A;  3PHL A;  4L76 A;  5KLI C;  3AE8 C;  1KFM A;  2OTJ I;  1RET A;  5FFX A;  3Q0U A;  1ETK A;  3MEX A;  3HE5 B;  4HJG H;  2P67 A;  1XPX A;  2L7Z A;  3V2N A;  4KN7 X;  3U1D A;  4XN0 A;  1W2B O;  3JSP A;  2O3J A;  4A3K J;  3H1K E;  2COM A;  3CLO A;  3K4C A;  4N0B A;  2KI7 B;  2W27 A;  4RKU J;  3OYB A;  4RS8 A;  3PQK A;  4RLF A;  4BJ5 C;  2VQG A;  4NPE A;  2FYZ A;  5KLI B;  5AW4 B;  5ILS A;  1ZH5 A;  4GOD A;  2ZME B;  4LFU A;  2JR8 A;  1K6Y A;  2P0W A;  3FM3 A;  5JHU A;  1CZQ A;  2FXM A;  4BXU A;  4HB1 A;  3PO3 J;  2BOL A;  5AVV B;  3DWL E;  1S7A A;  2MAB A;  5AON A;  3HJE A;  1YIJ P;  2GAU A;  3HUG B;  4OGQ C;  4L9J A;  2CW8 A;  1IO2 A;  1MBJ A;  1JXS A;  5M3F J;  4WWC A;  5K5G B;  4BGD A;  1PPJ D;  2LKX A;  3B71 A;  4HF0 A;  3TOA A;  4IFM A;  2E36 A;  1U2W A;  2JA2 A;  1YJW I;  4XRF A;  2WPS A;  3GTK J;  1S5L E;  2K7L A;  1OYY A;  2A61 A;  4BEH A;  4O5V A;  1SS1 A;  1FIP A;  2YU9 J;  1J1E C;  3L37 A;  4A3M J;  2DA2 A;  5E8G A;  1ZAR A;  4CCK A;  3BRV B;  2X9D A;  1NU1 G;  4U7J A;  2DOE A;  1GV5 A;  1H89 A;  1RKW A;  4LLG F;  2YR2 A;  2CV0 A;  2L5G B;  3KIO A;  3QYB A;  2OTJ P;  4XLE A;  3HB9 A;  2CPS A;  1UB9 A;  1S29 A;  3AE4 C;  3VP8 A;  3LST A;  1YIT P;  1LJ9 A;  3MHV A;  1MNE A;  5JHF A;  1GXP A;  3W2W A;  4BEH B;  5FLX K;  2HKO A;  3K69 A;  3PJR A;  2R3C A;  5EEG A;  2NPS A;  1TP4 A;  1G3Y A;  5B1A H;  1Y6I A;  1K7A A;  4RO0 A;  1EH8 A;  3KEO A;  3TGU D;  1BGY G;  3CCJ I;  3CJR B;  1FEX A;  2E1N A;  1U5T B;  4L0Y B;  1AA0 A;  4H13 B;  2L9R A;  5JLX A;  4IF4 A;  1JGG A;  1N7S B;  3VMX A;  2QEX P;  5B66 E;  3OIP A;  3EUH C;  1AA7 A;  3IKT A;  5E3N A;  4EMS A;  2H6C A;  2XB5 A;  2R4G A;  1Z1D A;  3Q9V A;  3A2A A;  1GL2 A;  1Z6T A;  3IAS 2;  2QM3 A;  1OCZ H;  2PQ8 A;  4E7J A;  4A3G J;  2ZJQ F;  3N7N A;  1KYW A;  3J7Z I;  2P7J A;  5A2Q K;  1MKM A;  2CSO A;  3DPU A;  5F0H A;  1ZW0 A;  2OGU A;  4EDF A;  3C7J A;  5E17 F;  2WVR A;  3I55 P;  1PPJ G;  2R5Y B;  3NQO A;  1JCC A;  1RUN A;  2E35 A;  2UWJ E;  2DT7 B;  1VQ6 P;  4P1W A;  4C30 A;  3DBR B;  4EQQ A;  4YG2 F;  2A06 D;  3C2G A;  1OX3 A;  2E74 D;  5J8F A;  4H13 C;  1RF0 A;  1IUY A;  1S7O A;  2BE5 F;  3FKJ A;  1KYO H;  1NTZ D;  4NQW A;  3QPL A;  1T8Z A;  2NXN B;  1FOK A;  1HVV A;  2XGX A;  4BXF A;  3BJA A;  3M07 A;  2WPV B;  3CMA P;  2Q6Q A;  2JP3 A;  2N1T B;  4PJ0 E;  5BPI A;  1TW2 A;  4WY4 C;  4A0X A;  4IHT A;  2QQB A;  4M73 A;  1H0T B;  4HLY A;  1DEB A;  2N9B A;  2BVM A;  4YFX F;  2FXA A;  1BE3 E;  2KDO A;  2IXS A;  2KLO A;  3LL7 A;  5FKL A;  5J4V A;  4BHC A;  5GTH E;  3BG6 A;  4HOB A;  2E2H J;  1GU4 A;  1A36 A;  1MDM A;  3CC4 I;  1ZN5 A;  3G4S I;  2R7R A;  2V1N A;  1HCR A;  1NGM B;  2IS1 A;  1D1C A;  3W2V A;  1LTJ C;  1VZ0 A;  5E1Z B;  1Y0U A;  5FRO A;  3BZK A;  2O01 J;  2ZYD A;  2MBF A;  1PP9 G;  2V1U A;  5IY5 H;  1AQ5 A;  1SMT A;  3CJN A;  2HPI A;  4EIJ A;  2DBB A;  2M7B A;  2HYG D;  3L75 J;  1ZG3 A;  4CZC A;  3OR1 C;  2V6C A;  4W97 A;  2KIQ A;  2R7O A;  3B6A A;  3A7O A;  3L72 D;  1R1U A;  4A5M A;  1YQA A;  1KIL A;  2GZW A;  2FYU G;  3HOY J;  1IW7 F;  3D6Z A;  4EI2 A;  3ZOB A;  3HPG A;  4V2F A;  4IEJ A;  3TQN A;  1NTK J;  1URQ A;  2K88 A;  4C2M J;  3AEF C;  4ZH4 F;  4NB5 A;  2Y0D A;  3GW6 A;  2K40 A;  1IC8 A;  5GTH H;  2DJN A;  1N7S D;  3EET A;  2LMD A;  2EFN A;  3M9A A;  1RH5 B;  3C1D A;  1NWQ A;  2RQP A;  5GPA A;  2A5Y B;  1E2X A;  4NC8 A;  1T56 A;  3CCV P;  3GXO A;  3P5J A;  2L9V A;  3Q1M A;  3AG2 H;  2VQC A;  1LT9 C;  2H89 C;  5AVX B;  2IGM A;  1DH3 A;  1Y56 A;  1YYV A;  3K2A A;  2V4J C;  4WX9 A;  2AO9 A;  2ISY A;  3H1J G;  2XSJ C;  3OY9 A;  2V26 A;  2Y0M A;  2E7W A;  3Q3S A;  3CI9 A;  1YW8 A;  4A3B J;  3CCU I;  3VOE A;  5EGO B;  3VYS B;  3UIA A;  1CF7 A;  4HRI A;  1RIO H;  5FLV A;  3CCQ I;  3I4N J;  3E7L A;  1LWU C;  4XE5 B;  2TCT A;  1BGY E;  2VJJ A;  1MH4 A;  2X6Y A;  3S15 J;  3S1Q J;  4DZO A;  3LNQ A;  4XKB A;  4R79 A;  5E20 A;  3A3Y B;  2IA0 A;  1NTC A;  2ZJP F;  2ZFC A;  3ZP5 A;  4YFN F;  2E1M B;  1S2E A;  4BQO A;  3CXH I;  2P5K A;  4BJT A;  3L74 J;  1NAY A;  4K3A A;  3MWM A;  1ITY A;  1R9T J;  3USS A;  2LDU A;  3L75 G;  2ZXJ A;  1ZN2 A;  2DOF A;  5HS9 A;  3ZQL A;  4IX7 A;  1DEE G;  4AYB N;  2KQR A;  1SQB J;  3I59 B;  3CXH H;  1SQB E;  2DMN A;  1RR8 C;  2NVQ J;  3L71 J;  4Q47 A;  4XOT A;  1JT0 A;  4XLH A;  2Y2Z A;  3HRN A;  4O9B A;  5AW7 B;  2RNJ A;  4B4C A;  2E1M C;  5EG0 B;  1X1D A;  1NVO A;  1QEX A;  3K4M A;  1ZRD A;  1TC3 C;  5FKK A;  2B7E A;  4ENN A;  2ISZ A;  1DP3 A;  2B88 A;  4H44 B;  1ZME C;  2Y9Z A;  3K70 D;  3GTL J;  4FAS D;  2OAR A;  4M3E A;  1MMN A;  4G94 A;  2SPZ A;  2CU7 A;  3RIR A;  1V54 H;  3GF3 A;  3CUQ A;  3EYI A;  1HW1 A;  3I3L A;  3WTV C;  3E3V A;  2KZV A;  2KZI A;  4I2L C;  1EC5 A;  1MD0 A;  3ZMV A;  4ZYH A;  1LTJ B;  2CWE A;  2HXO A;  3NWS A;  1URQ C;  2PJR A;  4IKF A;  2VKE A;  4ANJ A;  4IHY A;  3R2P A;  4A3C J;  4P9U A;  1GTW A;  3L70 J;  1QL1 A;  3KXD A;  4WWI A;  2OYI A;  1FZP B;  1XB4 A;  1Y8R B;  1HTL C;  4RB1 A;  4HST A;  3NAU A;  2K4J A;  2HPM A;  5LEK A;  2VL8 A;  4M3F A;  2R7Z J;  1GV2 A;  2YMK A;  2XGC A;  2QJP B;  3PIO F;  2FBK A;  4UB8 C;  4MQ9 F;  1H0M A;  1LT9 B;  1MZ9 A;  1E0E A;  2LK2 A;  3ROU A;  5DUI A;  1T6A A;  1IZ1 A;  4CO8 A;  5L3B A;  3BAS A;  4GYG A;  2HVQ A;  2OTK E;  1Z6R A;  3BZ6 A;  2P6S A;  3K1P A;  4Y15 A;  1Y9B A;  3C3W A;  1SVF A;  2JO1 A;  3J80 Z;  4F55 A;  1QLE D;  2LXB A;  1UG2 A;  5CVR A;  4ZYG A;  5E3M A;  3P8C D;  2ACJ A;  1QPI A;  3CC7 P;  3GZN B;  3GFL A;  1HW5 A;  1Z9C A;  2GXB A;  1TWF J;  2A6E F;  3E6B A;  2A45 G;  5KAI E;  1PV3 A;  4M72 A;  1BJZ A;  1JEK A;  2DMQ A;  2CFO A;  2DQR A;  2W85 A;  3WU0 A;  5HOD A;  4ITV A;  2FYU D;  4BYY A;  1BC8 C;  2AHQ A;  2F48 A;  4LC1 A;  4C7R A;  1KN7 A;  3IWZ A;  2BXY A;  3BC8 A;  1FWZ A;  1L4A A;  2QEX I;  1Q86 Q;  4B09 A;  2JUG A;  4HSR A;  3VPR A;  2VQL A;  3DLL F;  1J7K A;  1RI7 A;  1W4M A;  3C18 A;  3LA3 A;  4PCQ A;  4D6T E;  5CCG A;  2R7T A;  2LTP A;  3DV8 A;  1DPU A;  4WY4 B;  2DA5 A;  2IT0 A;  2KHM A;  1VQN I;  3Q3D A;  2LG4 A;  1ETV A;  1I5Z A;  1JMB A;  1NO4 A;  3I9V 2;  5CCH C;  3R0J A;  1VND A;  4HV6 A;  4RMN A;  5LRR A;  2ME6 A;  3VDX A;  2ICW G;  2WB1 A;  1FPQ A;  2Y30 A;  4JX6 A;  4DYR A;  2AS5 F;  3ABV C;  2YO2 A;  1VQ4 I;  1GDT A;  2DMU A;  2AXT E;  4V2G A;  4DZJ A;  1G59 A;  2JA8 J;  3VMY A;  3H9J A;  2CO5 A;  2ELH A;  2YX4 A;  3S93 A;  2QG4 A;  3S9O A;  3CUQ C;  2Q0O A;  2C6Y A;  1XGS A;  2E76 C;  2QE7 H;  3JCU E;  2WTY A;  2R32 A;  4A3J J;  2UV1 A;  1SQX J;  4XM3 A;  1WJF A;  4NHJ A;  2YSR A;  1WQ2 A;  1F43 A;  2E74 B;  2XAF A;  2H8W A;  3IP4 B;  3HUS A;  3LFU A;  5APW A;  2IA2 A;  2Y0S A;  2GOX B;  4KT6 A;  1X1B A;  3RKW A;  4X0G A;  4HZF A;  1AHD P;  2JN6 A;  1X4P A;  2NPS D;  5ED4 A;  2IA1 A;  2QJY B;  1VQ7 P;  4U3F G;  2CJJ A;  1U78 A;  3JTH A;  4BBS J;  1YIJ I;  4W1U A;  3CCE I;  3AL0 B;  1CSB A;  2B9B A;  1LFP A;  4YTP C;  4XRS G;  4PV1 B;  5KHD A;  1R5I D;  2D45 A;  2K27 A;  4KJZ A;  4PJJ A;  3BAT A;  3G6E I;  1F9N A;  1HGZ A;  2D2C B;  1JY2 P;  2H8P D;  1M1E B;  1U0J A;  1OIS A;  3MD2 A;  2ZME C;  3OYH A;  1EQ7 A;  1O4X A;  2B9S A;  2R7D A;  4AVZ A;  3CCU P;  4ESF A;  1EKE A;  4B47 A;  5JVG F;  1BL0 A;  2I8D A;  5EEH A;  3PO2 J;  2DT6 A;  4M3B A;  3B5N B;  2EJR A;  5B1B H;  3BRT B;  1ZRT D;  1K4S A;  2RMZ A;  2XAQ A;  1HF0 A;  3U1A A;  4YEL A;  1JTY A;  2P7C B;  4MN4 C;  5J1Y A;  3TK1 A;  2E34 A;  1C0W A;  2G9W A;  3WE2 A;  4KIS A;  4A3D J;  2GLO A;  4XFJ A;  5CMZ A;  3H1I J;  4E6K G;  4F92 B;  4BJ6 C;  3I55 I;  1KQS O;  3CJQ B;  4RBO A;  2PMZ A;  2LSO A;  2NS7 A;  3BRO A;  5M5W J;  5EJC A;  2DW3 A;  3CQZ J;  5KJ7 D;  1G3T A;  3B5N A;  1USD A;  3TL4 X;  3MZ8 A;  3MIW A;  3BQZ A;  3BT9 A;  4CCN A;  3A0B C;  3BP8 A;  2HKX A;  4L5E A;  2WQY C;  1BR2 A;  3CDH A;  2XKP A;  1KU3 A;  2K85 A;  2LYC A;  1P4X A;  3LSI A;  3L74 G;  2R7F A;  3W68 A;  4PJM A;  4EJV A;  3OWT A;  2E19 A;  2FYN B;  3PM1 A;  4M6X A;  5KNL A;  1KYO E;  2XGE A;  1MBH A;  4QPO A;  2EZI A;  1PP9 E;  4JK1 X;  4RAZ A;  5JFR A;  5KTB A;  2HI3 A;  1LPQ A;  2XRO A;  1M8O B;  5F6F A;  1BCC J;  4AC0 A;  4L5J A;  1HJB A;  4HW0 A;  3EFG A;  4A0Z A;  1LJ2 A;  3FWL A;  1MJB A;  2M87 A;  3FIS A;  3RPU A;  5E18 F;  2ECB A;  2LY1 A;  5DS9 A;  4XRS A;  1L0L D;  1L0L E;  2OJE D;  4Y4R A;  1SFC D;  3H1I D;  3M91 A;  5AW1 B;  1W1W E;  2BVL A;  2QBY A;  3GTP J;  5ILV A;  2G0E A;  2JVG A;  2EZH A;  3ZRG A;  1BM9 A;  1ZYR F;  4U0V A;  3B5N D;  1W7P D;  1SFC B;  1M56 D;  3K6G A;  5L3F A;  2DMP A;  1KQF B;  1FOW A;  3LSM A;  1S5L X;  4PJL A;  2GWR A;  2WSE H;  3LA2 A;  3LAJ A;  5BOX A;  2KLU A;  5GTI H;  1PYV A;  4RAY A;  1G2C A;  2HTS A;  1WKM A;  2K37 A;  2FSW A;  1B9N A;  4HDV A;  4HDU A;  4OIN F;  2IZ1 A;  3HUG A;  4AD9 A;  1TWC J;  3T1B A;  2PAJ A;  3AEE C;  4ESB A;  2KIS A;  3WMM 0;  4KIT B;  1AKH B;  2ESH A;  5DEQ A;  2ELJ A;  1YLF A;  1MJA A;  2OU2 A;  2VJ4 A;  3GF7 A;  2ZJ2 A;  1LUJ B;  1WRJ A;  4CYC B;  3GFI A;  2XC7 A;  4LLH A;  4BRY B;  4C9Y A;  5B3S H;  4X6A J;  3CP8 A;  1FOS F;  3NTN A;  4BAY A;  2EFO A;  1NH3 A;  4E7Z A;  3S1R J;  4PK4 A;  1SD4 A;  4KNY A;  4EVI A;  1FIA A;  3IC7 A;  3KYD B;  1LT9 A;  3FBI B;  3LSG A;  5B5E C;  4RES B;  4C7N A;  3NRV A;  3H5N A;  1ACI A;  2A68 F;  4KN4 X;  2A05 A;  4DW6 A;  1N73 A;  5B66 C;  1J9I A;  3TP0 A;  5DCF A;  3G1M A;  3L09 A;  5JLW A;  4L5I A;  3EDP A;  2HTJ A;  4HNU A;  1VQ9 I;  2LXC B;  3V7C A;  5CJ4 A;  1VQ5 P;  2R93 J;  1BIB A;  2ECC A;  2V1X A;  3MFK A;  2QVO A;  1KIL E;  1MV8 A;  2J5U A;  2MA3 A;  2FQ4 A;  3WTY C;  2M3B A;  1GXQ A;  5EDN A;  2VT3 A;  4AUX A;  1LP1 A;  2KRH A;  1MW7 A;  2Z5I A;  3SHF A;  1JJ8 C;  1LEA A;  2ZCW A;  4HX8 A;  3CJT B;  1YIT I;  3CL3 D;  1ZGJ A;  2OYO A;  3RKX A;  4AWX B;  4RLQ A;  1PP9 J;  3PNY A;  1UZC A;  1VF5 C;  2XNX A;  4L0Z B;  3HOT A;  1N25 A;  2FBW C;  1OCO H;  2MC3 A;  4L9T A;  3IL2 A;  1YS6 A;  2R5D A;  5E79 H;  2KP8 A;  3FWN A;  2OYI B;  3TO6 A;  5BS6 A;  5GAE J;  3PTZ A;  2K02 A;  3M7G A;  3RK3 E;  2QQ8 A;  3PFI A;  1SQP J;  1H0T A;  4XLC A;  1PP9 D;  3IKV A;  2R44 A;  1QZZ A;  2DTR A;  2FEZ A;  4FET A;  2I5U A;  4GRI A;  2CQN A;  1LTI C;  2HZD A;  1WMK A;  3RI4 A;  2VOP A;  2KJC A;  3OYE A;  1FTT A;  3TKY A;  1KU7 A;  1O57 A;  4EOT A;  3SZP A;  1UII A;  3KHU A;  2VC1 A;  4NBQ A;  2YNY A;  1MJ9 A;  1I6H J;  3HRM A;  3G9R A;  4DT0 A;  1LE8 A;  3TGU E;  3CX5 I;  4BUP A;  2KP6 A;  2WT7 A;  2E42 A;  3JCU C;  2AXC A;  1Y47 A;  2W25 A;  5E79 E;  2VIX A;  4XID A;  5LGN A;  2HYJ A;  1V5E A;  1PP8 F;  5IT9 K;  3BG7 A;  3SDB A;  3QP5 A;  1OIP A;  2W6J H;  2J5O A;  3R61 A;  2W90 A;  1IV8 A;  4HEA 2;  4P9F A;  1LB2 A;  3TNU B;  3LW5 J;  2KRF A;  1WT6 A;  3WGG A;  4F52 A;  2L01 A;  2PMZ N;  1STZ A;  2KS1 B;  4OIP F;  4UNO A;  5J40 A;  1IXC A;  1ERD A;  5KLV J;  2DFF A;  5CJ0 A;  2OV7 A;  3H35 A;  1Q82 Q;  3CCS P;  1EXJ A;  4H13 D;  3AL0 C;  1I1G A;  5ICC A;  3BTL A;  1VF9 A;  3E5U A;  1M1J B;  4BHB A;  1L0N J;  3EUH A;  2IP2 A;  4WXC A;  2X85 A;  4I01 A;  2WA0 A;  4PJN A;  3BZC A;  2CUZ A;  3Q5F A;  3HRS A;  2Z3Y A;  4BE0 A;  3OYD A;  5CVU A;  2P81 A;  3I54 A;  4PV1 D;  2E2J J;  2ESN A;  2MH2 A;  1L0L J;  2WY8 Q;  4O6J A;  4LB5 A;  3U59 A;  1YI2 I;  4MFE A;  3OMY A;  4M9X A;  2IDB A;  1RES A;  4PSX A;  3AE7 C;  2BY0 A;  1P7I A;  2XPV A;  1T39 A;  2N1T C;  3CX5 E;  3DBH B;  2L54 A;  4LJZ F;  4AU7 A;  4PD4 I;  3BR0 A;  1SQP E;  1JKO C;  2STT A;  3M06 A;  1IZN B;  4XN3 A;  3VEP A;  1I27 A;  3OOU A;  2IBZ G;  2RKH A;  1FSE A;  1ON1 A;  4BQN A;  4MFD A;  1HW2 A;  1T38 A;  2NNY A;  2Z33 A;  1IRG A;  2V7Q J;  1T08 B;  1QZY A;  4H0L D;  1DGW Y;  1I50 J;  5GAH J;  4ZYD A;  4WVZ A;  1JTH B;  5L8R J;  2WSS H;  1W0T A;  4ZZD A;  3BOQ A;  1ZR4 A;  3HSR A;  1A02 F;  2GM4 A;  3HE4 B;  1BI1 A;  4TT3 H;  2JQ7 A;  3L9F A;  2OBP A;  2DA1 A;  3NAR A;  4Z1M H;  2QVA A;  5E8I A;  3RGU A;  3L2W A;  1SFK A;  2BYV E;  1TWG J;  4XBF A;  1RY3 A;  3A0H H;  1VQ4 P;  1M1J A;  1EDL A;  3DKX A;  2KIM A;  3JAM Z;  2QIW A;  2M1B A;  1PVE A;  2CS3 A;  4A7P A;  2DFE A;  5IYB J;  3ZPL A;  1PP7 U;  3TSI A;  3BTC A;  3P8M C;  2Z9O A;  1VQP P;  3AAF A;  1MNM C;  3REO A;  3TBI A;  1SEU A;  1L4A C;  2KNC B;  3D71 A;  1QVG O;  2EWN A;  1H8A A;  2KZJ A;  3H1K D;  5AW5 B;  1VQP I;  1J2X A;  1YRN B;  3QH9 A;  2HOD A;  4OAY A;  1X4O A;  3QYE A;  3H3V K;  3E1I A;  1SQQ J;  2E5N A;  5HLG A;  3HZJ A;  4F3Q A;  2JPC A;  2Z16 A;  2HVR A;  1V55 H;  2W57 A;  3KZI C;  4AYB A;  4C46 A;  1Y1W J;  3PUB A;  1SAU A;  3OOP A;  1LQ1 A;  2QJP C;  5EZH A;  3V8L A;  2L4A A;  1FSH A;  1OVR A;  1YQ3 C;  5D5V B;  1RUO A;  1JM0 A;  2XVC A;  3I4P A;  3QPS A;  4PDK A;  1K61 A;  4D7M A;  1IXS B;  2XU6 A;  1D5V A;  2VKH A;  2VBY A;  4B48 A;  2KIK A;  4AUW A;  1ZP0 C;  1H9T A;  3BR6 A;  1NU1 K;  2YIU C;  1QVF O;  5KJ7 A;  5F27 A;  2UUZ A;  2XZR A;  1YQ4 C;  3PRJ A;  5DJU B;  5FGM A;  2PI0 A;  4LG0 A;  4WK8 F;  4ZKP A;  2V9K A;  2MFZ A;  3JRA A;  1D8K A;  3WG7 H;  1SQX D;  5CKT A;  5TJH A;  1MBG A;  2L02 A;  4RB2 C;  2LF7 A;  1XSD A;  2F6C A;  2LY2 A;  4BE2 A;  1V4R A;  2K9M A;  3ECH A;  3A0H E;  1MH3 A;  1RQU A;  3X2Q H;  3AKZ A;  1XC5 A;  2P58 A;  3S2W A;  2MLK A;  3W6J B;  1BW5 A;  4BH9 A;  3VWB A;  2LRD A;  3CTA A;  3V8J A;  1BR4 A;  2A06 E;  1S6L A;  3ZMZ A;  1JUN A;  3QRF F;  5KLV D;  1X3Z B;  2QJK B;  4NC6 A;  3ASO H;  2FMY A;  3ZQH A;  2VJI A;  1SC7 A;  1Z3X A;  1NTZ J;  2L0K A;  1UJ8 A;  2JA5 J;  1NTZ E;  2ZXW H;  2JZY A;  1VQO P;  1U7M A;  4Y99 B;  2FRH A;  3CXH D;  2VLA A;  2HWV A;  3ONQ A;  4S05 A;  4BS9 A;  1G2C B;  1KON A;  3AE1 C;  2NOJ B;  4YRV A;  1IN5 A;  4ZTF A;  1R1T A;  1OW8 A;  3BR1 A;  5ICG A;  3SZG A;  3SFI A;  1RC9 A;  1Y8Q B;  3I56 I;  3ERE D;  2E2I J;  3V2P A;  2IEK A;  3H32 B;  1OLT A;  1SQV J;  2W6B A;  2IS4 A;  3P9I A;  2RC4 A;  3HOV J;  1YTZ T;  1FZB A;  2Q5U A;  2WTE A;  1JNM A;  3G3Z A;  4UHT A;  2DU9 A;  1WRG A;  1FU1 A;  3QOE A;  1WHU A;  1L4A D;  3IN6 A;  5IP6 A;  1CW5 A;  4I6Z A;  1LTS C;  1U8R A;  1K05 A;  4I98 B;  3HXL A;  2KIF A;  2VT2 A;  4S0H B;  1EF4 A;  1EDJ A;  1NTM D;  1WSU A;  3BTI A;  1UFM A;  4I0A A;  1KQ0 A;  1ZG1 A;  1EH6 A;  3A02 A;  1PUF B;  3ZN1 A;  1P84 D;  3PUF A;  1XD7 A;  5KAI C;  4EM0 B;  3IAM 2;  4M74 A;  1UHM A;  3JTG A;  4Y28 J;  2QA4 P;  3F9K A;  4B1R A;  4IL6 C;  1MSE C;  3L36 A;  2N8G A;  5KJ7 C;  1KQ8 A;  2QZ8 A;  4IHW A;  3SDG A;  4BDZ A;  1HLV A;  3HOS A;  2LBF B;  5AVZ B;  3MUD C;  2D2C C;  1P92 A;  3U21 A;  1H88 A;  5CVJ A;  3JC2 2;  2ZYA A;  3O8Z A;  1LFU P;  1JY3 P;  2E7X A;  2ELK A;  3HOU J;  4P5O A;  5DD8 A;  4Y52 J;  2P8T A;  3GLX A;  4KIC A;  3ZQC A;  3GZ6 A;  5M3M J;  9ANT A;  1NTZ G;  4BU2 A;  2O61 A;  1FJP A;  3VYT B;  2P4W A;  2O3F A;  3AG4 H;  2F5V A;  1F5T A;  3RK2 D;  4XLN F;  4IFF A;  3RDI A;  2A3S A;  4NQW B;  3IF4 A;  3SFZ A;  2R3S A;  4II2 A;  4EAT A;  2YKO A;  3HGG A;  2ZXX A;  3K4L A;  4DJA A;  1T2K A;  1K4T A;  2IYO A;  1DGR M;  4JF7 A;  5K7F A;  2PMH A;  1VQ6 I;  1I6X A;  4PGG A;  3KET A;  5DM7 F;  2EV6 A;  3K0L A;  2RDP A;  1YX5 A;  4CA0 A;  5L3C A;  1SAX A;  3H1L G;  5F08 A;  1SD5 A;  4Y3O A;  3WTW C;  1QGK B;  3CUQ B;  3CWB E;  4N78 E;  1Z67 A;  5LFA A;  2KZG A;  1YW9 A;  2K9L A;  2M3A A;  1FYK A;  3HE5 A;  1X1P A;  2LOO A;  1HDD C;  1RNL A;  2VKV A;  4RM3 A;  1RPW A;  5CYV A;  3GTJ J;  4XSX F;  2ZYG A;  1SQQ E;  3H1J D;  1UEL B;  3V4Q A;  4ZKU A;  3H25 A;  4CGZ A;  2ZT9 D;  4M71 A;  1B1B A;  4CCL A;  1XTC C;  1MMD A;  2XIG A;  1UIX A;  3L74 D;  1U7J A;  4MGR A;  2O7O A;  3L72 G; 
#chains in the Genus database with same CATH homology
 3W2A A;  4GOF A;  3S1K A;  1X1C A;  2KPM A;  2M5A A;  3PNT A;  1G8X A;  3VYR B;  4ASV A;  4ZMD A;  2MD0 A;  3OS0 A;  2CFO A;  3DKY A;  4ITV A;  3OS1 A;  1WFX A;  1DQU A;  1N77 A;  4XKV A;  4XR6 A;  4IOI H;  3BC8 A;  3EUK L;  2JUG A;  1MMG A;  4HSR A;  2VQL A;  4E7H A;  2R7T A;  3LSK A;  4NNJ A;  4DIQ A;  1J09 A;  2AQE A;  2QKM B;  2KHM A;  4ZC3 A;  2RNG A;  2LG4 A;  2A6T A;  4CUG A;  1JMB A;  3I9V 2;  3A2K A;  2R7U A;  4C2U A;  3VDX A;  2CMP A;  4RMN A;  3FXD A;  2WB1 A;  2KMU A;  5CBN A;  3H5A A;  4MLO A;  3CF2 A;  1G59 A;  3H9J A;  3S93 A;  1OVV A;  2UV1 A;  4ZDL A;  1BDD A;  4XM3 A;  1WJF A;  1QU3 A;  1MND A;  3IP4 B;  2OUM A;  3LFU A;  3SEZ A;  3ZCO A;  2JVH A;  2Y0S A;  2GOX B;  4KT6 A;  1X1B A;  4N4O B;  4X0G A;  3OYL A;  1N78 A;  4HKZ H;  4IZZ A;  2HNH A;  4XLA A;  1X4P A;  4BL0 B;  1IRX A;  4U87 A;  3AL0 B;  2XF7 A;  1Z3Y A;  1V5G A;  1LFP A;  3J7A Y;  3E1S A;  3N05 A;  5KHD A;  4HNT A;  4E7S A;  4KJZ A;  3H5R A;  1D0Y A;  4PJJ A;  4F93 B;  1U0J A;  3MD2 A;  3OYH A;  4NPD A;  4QPQ A;  4XOR A;  3EUA A;  4AVZ A;  1YE9 A;  4DBQ A;  3D5L A;  2BW3 B;  1NG7 A;  4B47 A;  2O5R A;  2I8D A;  3NWT A;  2DT6 A;  2DXI A;  3MKY B;  4E7L A;  1V5F A;  2E60 A;  4DOZ A;  4YEL A;  4MN4 C;  4ZDO A;  5CQG A;  3PH0 A;  4KIS A;  1X19 A;  2KRC A;  2VB6 A;  3H9Q A;  4E6K G;  4F92 B;  4BAC A;  4XMY A;  3FBN B;  4BJ6 C;  2WBM A;  3CJQ B;  2PMZ A;  2VPL A;  2X6W A;  2LC2 A;  3HPH A;  4LIT A;  4B3X A;  3TL4 X;  4CCN A;  2M4G A;  2K3P A;  3L2U A;  4B43 A;  1BR2 A;  1HA8 A;  2B87 A;  3DU6 A;  2AQF A;  4PFP A;  3S3N A;  4XL9 A;  2LYC A;  3LSI A;  4CCJ A;  2VJ5 A;  4PJM A;  2ZXH A;  3OWT A;  2LR2 A;  4F91 B;  5KNL A;  4QPO A;  3QOD A;  3L2R A;  3K4J A;  1BR1 A;  1W36 C;  4BE1 A;  2BW3 A;  4Y33 A;  2X51 A;  3RTR A;  2R7S A;  4U7B A;  3D5R C;  4XOP A;  2V6E A;  2LY1 A;  3K70 C;  3AFH A;  4PFO A;  2W4S A;  5EFW B;  4Y4R A;  4J00 A;  2F4I A;  4B44 A;  1NG6 A;  2BVL A;  4CPG A;  1R6R A;  1FC2 C;  2JVG A;  2V7F A;  2M4K A;  2M7A A;  3ZRG A;  4OAZ A;  2L9S A;  2CW7 A;  1WJA A;  2QKL B;  4JQF A;  3K6G A;  4XLF A;  4RM2 A;  3LSM A;  3PNV A;  3SEQ A;  3OYI A;  3FXE A;  2DJI A;  4PJL A;  3VSL A;  3DQV C;  3E0J B;  1PYV A;  2KUB A;  4LIU A;  4NPF X;  1BDC A;  2JSP A;  2ZFU A;  3H9G A;  1TT0 A;  3OL3 A;  4KIT B;  3L2V A;  3FDY A;  1EA3 A;  2ELJ A;  2M0B A;  2VJ4 A;  2HU9 A;  1JI8 A;  4BXL A;  1Z7L A;  2E5Z A;  2XC7 A;  2WMM A;  2RRE A;  4C9Y A;  3D5S C;  2A5W A;  3CP8 A;  3DEE A;  5CPR B;  3VYU B;  5HNF A;  3K4B A;  4E7Z A;  4PK4 A;  2XF5 A;  3FBI B;  3LSG A;  1EDI A;  3H5N A;  3S3M A;  2W7N A;  3H0D A;  1LDK B;  2R7W A;  2LRE A;  1EDK A;  3A4C A;  3LMM A;  3OYG A;  2W82 A;  4ZJZ A;  2LXC B;  2WAF A;  4BQQ A;  4HNU A;  3MZW B;  3ZXS A;  2R7X A;  3DPL C;  3MMY B;  2M0M A;  2UWM A;  3ZR8 X;  2WAQ A;  1S9H A;  2IS6 A;  1LP1 A;  2KRH A;  5LD2 C;  1MW7 A;  1X0T A;  3K4K A;  1D1B A;  4RLQ A;  5FRM A;  3PNY A;  3FHN A;  4H4K C;  4E7K A;  2W1O A;  5C39 A;  2IGO A;  4E4H A;  2R7Q A;  4IQ4 A;  3HOT A;  1OVU A;  1W36 D;  3KEY A;  2Q2E B;  3DPT A;  5CBO A;  3LSH A;  5HNH A;  5HOO A;  3DTK A;  2IS2 A;  1LP1 B;  1H0T A;  4HPQ A;  4XLC A;  4IQJ A;  3OR2 C;  2R44 A;  1N75 A;  4FET A;  4GRI A;  1UAA A;  2HZD A;  2HVS A;  4XON A;  3OYE A;  4HJG H;  4OWR B;  4PSW A;  4XN0 A;  3CES A;  1WJB A;  1PJR A;  1WJC A;  2CV2 A;  3K4C A;  2WAD A;  2B87 B;  4BUP A;  2KI7 B;  2KP6 A;  4DGW B;  5HVQ C;  3OYB A;  4RLF A;  4BJ5 C;  2JWD A;  3W3C A;  2VQG A;  2CH0 A;  4NPE A;  1Y47 A;  2VIX A;  4GOD A;  5DJT B;  1K6Y A;  1V5E A;  2P0W A;  3BG7 A;  3SDB A;  4HB1 A;  4J01 A;  2BOL A;  3DWL E;  3OL4 A;  2ZSH B;  2MAB A;  4HEA 2;  3QWO C;  3HKZ A;  3HUG B;  4CCM A;  3MKW B;  2CW8 A;  3DTI A;  4PUS A;  4F52 A;  5K5G B;  3HC7 A;  4BGD A;  4LG3 A;  2KL4 A;  2KS1 B;  2JA2 A;  1ERD A;  2OV7 A;  3H35 A;  3SYT A;  2DCE A;  3AL0 C;  4BEH A;  1SS1 A;  2LBF A;  3CMM A;  5FRN A;  4CCK A;  2X85 A;  2HR3 A;  2WA0 A;  4PJN A;  3CP2 A;  1OR7 C;  2CUZ A;  1Z21 A;  2CV0 A;  4BE0 A;  3OYD A;  3QYB A;  4XLE A;  1MFT A;  2L5Q A;  2CV1 A;  2WY8 Q;  3BLY A;  2WY7 Q;  3OMY A;  4PSX A;  2Z1D A;  3MHV A;  4D9J A;  1MNE A;  4II3 A;  3M8J A;  5JHF A;  4CCO A;  3W2W A;  4BEH B;  3S3O A;  3PJR A;  4AU7 A;  3PL8 A;  4CSW A;  4XNF A;  4DBR A;  5KCM A;  1Y6I A;  1UG0 A;  3OYM A;  3HL2 A;  3CJR B;  4XN3 A;  3OOU A;  1FMW A;  4NUB A;  4BQN A;  4K35 A;  3OIP A;  3EUH C;  1AA7 A;  4JBZ A;  2L9N A;  2R4G A;  1DGW Y;  4KJM A;  1LKX A;  3IAS 2;  4E7J A;  2IGN A;  1TZL A;  2XF6 A;  3DPU A;  3TMO A;  2Q1Z B;  3KYL A;  1ZW0 A;  1P9Q C;  2QVA A;  1FMV A;  3RGU A;  3L2W A;  1SFK A;  3ZGK A;  2UWJ E;  2DT7 B;  1EDL A;  3DKX A;  4P1W A;  2CS3 A;  4C30 A;  2VAS A;  2RKL A;  3OYF A;  3C2G A;  4N4N B;  3TBI A;  2L7K A;  3K4N A;  3CZ6 A;  2KZJ A;  1GLN A;  3FKJ A;  4OAY A;  1X4O A;  4NC7 A;  3QYE A;  4ZYA A;  3RCO A;  4BXF A;  2HDW A;  2GOM A;  1MMA A;  2E5N A;  1BOB A;  3RPU D;  4F3Q A;  4EYY Q;  2Z16 A;  2HVR A;  1ZXG A;  1H0T B;  1WJD A;  3C2H A;  4GOE A;  4AYB A;  2BVM A;  3PUB A;  1SAU A;  2FUG 2;  1OVR A;  2KDO A;  2IXS A;  2KLO A;  3LL7 A;  1JM0 A;  3BG6 A;  3RQ4 A;  4XKW A;  2MYS A;  2R7R A;  2V1N A;  3OYJ A;  2IS1 A;  1D1A A;  1D1C A;  3W2V A;  2VKH A;  1VZ0 A;  4B48 A;  5FRO A;  2KIK A;  2HPI A;  2UUZ A;  2M7B A;  1T95 A;  5DJU B;  4CZC A;  2V9K A;  2MFZ A;  3DTE A;  3OR1 C;  2R7O A;  2X1E A;  3PFY A;  3S8P A;  3OYK A;  5CKT A;  4CH7 A;  3A1Y A;  3L2Q A;  2WAE A;  3MKZ A;  4D1Q A;  2F6C A;  2LY2 A;  4BE2 A;  2K3R A;  3PSF A;  2K9M A;  2VKD A;  3OYN A;  2HQA A;  1T0F C;  3HPG A;  4XQF A;  2B89 A;  3AKZ A;  2P58 A;  2R7V A;  3OYA A;  2VQH A;  3OYC A;  3VWB A;  4G6T B;  2LRD A;  4C2T A;  1BR4 A;  4XKC A;  2VXZ A;  3PSI A;  1X1A A;  3S32 A;  4NC8 A;  2VJI A;  1Z3X A;  2W00 A;  2LH9 A;  2VQC A;  2XDV A;  2IGM A;  3M1C A;  1Y56 A;  3K10 A;  4ZTJ A;  2V4J C;  1U7M A;  2VLA A;  2M5A B;  3ONQ A;  3UR3 C;  4BS9 A;  1KON A;  4JOM A;  2NOJ B;  2XSJ C;  5TGT A;  2V26 A;  2X1C A;  4YRV A;  3OS2 A;  3OY9 A;  4ZTF A;  3SZG A;  2ZSI B;  2X1D A;  3KX2 A;  2DOA A;  3VYS B;  1OLT A;  1WJ5 A;  4HRI A;  1LVK A;  2IS4 A;  3GBG A;  2VJJ A;  2X6Y A;  4XKB A;  4R79 A;  3QOE A;  2E1M B;  3ZQQ A;  4BQO A;  4BJT A;  3HXL A;  2Q1K A;  4K3A A;  1EDJ A;  2OC6 A;  4IX7 A;  1QHG A;  3BCA A;  2KQR A;  1DEE G;  2L2O A;  3IAM 2;  1LT1 A;  4XOT A;  4XLH A;  2PJR B;  1YX3 A;  3F9K A;  2E1M C;  1NVO A;  1X1D A;  3V42 A;  3VSK A;  3K4M A;  3HG9 A;  2ZAE B;  1QHH D;  4BDZ A;  1DP3 A;  3DLA A;  4ZDP A;  3HOS A;  2LBF B;  2B88 A;  1S3J A;  3K70 D;  4FAS D;  3UNG C;  3EPZ A;  3IUO A;  3U21 A;  1MMN A;  2SPZ A;  3I3L A;  2MC4 A;  4P5O A;  2KZV A;  2KZI A;  4BU2 A;  1EC5 A;  3VYT B;  5HLT A;  3NWS A;  2F5V A;  2QRX A;  4BDY A;  2PJR A;  4IKF A;  4ANJ A;  3OIQ A;  4LIV A;  4WWI A;  4NQW B;  3QYF A;  4HG2 A;  4EAT A;  4II2 A;  2X6X A;  4HST A;  3K4L A;  4DJA A;  2HPM A;  2VL8 A;  1DGR M;  3DU5 A;  2ZXI A;  2K5C A;  1E0E A;  2IGK A;  4ASW A;  1YX5 A;  4CA0 A;  4YEJ A;  3G2B A;  1Q2N A;  4Y3O A;  2VXD A;  2HVQ A;  2RQQ A;  2OTK E;  5LFA A;  4E7I A;  3ZDM A;  1ZEL A;  2K9L A;  2M3A A;  1D0Z A;  2Z2S B;  1D0X A;  1WJE A;  2LOO A;  4F55 A;  4RM3 A;  2XAU A;  4ZNC A;  2CUJ A;  2LXB A;  1UEL B;  3RSN A;  5CQE A;  4CCL A;  1MMD A;  1U7J A;  3BCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...