2I8DA

Crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
GSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein of COG5646
publication title Crystal structure of an uncharacterized conserved protein of COG5646 (ZP_00384875.1) from Lactobacillus casei ATCC 334 at 1.69 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Structural genomics/unknown function
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2i8dA01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2i8dA02
2KL4A 4JBZA 4GOFA 2LXCB 1ZXGA 5C39A 3MHVA 4EYYQ 2KZJA 1EDIA 1H0TB 4NPEA 2B87B 2OC6A 4CPGA 1ZW0A 2SPZA 2LXBA 2P58A 1JMBA 3MZWB 1DEEG 2QRXA 3ZDMA 2I8DA 1EDJA 4ZMDA 1LT1A 1OVVA 5CBNA 1EDLA 5CBOA 2M5AB 1LP1A 3PH0A 2KUBA 1OVUA 4K3AA 4MN4C 1BDDA 1OVRA 4NPDA 2M0BA 3QWOC 1SS1A 4HKZH 5DJTB 2KI7B 5K5GB 4ASVA 2QVAA 4GOEA 2KIKA 2ZAEB 2HR3A 1Q2NA 2LR2A 4IOIH 1H0TA 3S1KA 2B89A 2KS1B 1EC5A 5EFWB 2K3RA 2B87A 2JWDA 3RGUA 1NVOA 1MFTA 2WMMA 1EDKA 4WWIA 1JM0A 4ASWA 5DJUB 2UWJE 1U7JA 3FXEA 4BXLA 2KZIA 2RKLA 2M5AA 2Q1KA 4K35A 2R44A 3FXDA 4NPFX 2B88A 1U7MA 4HB1A 1LP1B 4KJMA 4HJGH 4ZNCA 1BDCA 1Y47A 4GODA 1FC2C 1X0TA 2OTKE 1S3JA
chains in the Genus database with same CATH superfamily
2Q8KA 1MV8A 1Q86Q 2DN0A 1LE8B 2Y0DA 1ZRTE 2YXRB 4PD4H 2E43A 1S9KD 1TW2A 3K1PA 2DPDA 4IJAA 1M56D 1X22A 5CJ0A 2VT2A 4RB3C 1BI1A 3RQ4A 3CO6C 2LY1A 4AIDA 2YU3A 4FHTA 4L9TA 1PPJE 1BE3G 1BSNA 2EIJH 3ABLH 4XKWA 5D6EA 5E1XA 1K9MQ 3RL0C 3WTZA 2HXIA 1QO0D 2M30A 3O2PE 2R32A 1D0XA 5AW9B 1JNMA 1NU1D 1YIJI 3VODA 1T8ZA 1ZW0A 2G9WA 2PN6A 1SQVE 4Y17A 4EM2A 2IP2A 4A0XA 4IHYA 1UIIA 1W7PA 2ZXEB 4BBSJ 2IS6A 5LGUA 4TT3H 5CLSA 2VQCA 3QPLA 1DH3A 3CUOA 3U1DA 3SFDC 4G8XA 1KU7A 1JHHA 3L74G 1EDLA 4PFPA 4JX5A 4WVZA 5CBOA 5AVRB 3E97A 1K79A 2CG4A 2M87A 3GMAA 4B4CA 3DPLC 2H8RA 3OW2O 5LGNA 1B9NA 2H8PD 2R7OA 3E5QA 4KJZA 4RDUA 2DQLA 1BDDA 2FRHA 1Y1VJ 3PFIA 5AIQA 2IA0A 3MZ8A 1N7SB 2FYUE 1ITYA 4XLFA 2M0BA 2FFDA 3HUGA 2PFXA 2B9BA 2BVMA 3TW7A 4A3LJ 2R5YB 2KXPB 1WVRA 1HSTA 3LMMA 3LSIA 1LE8A 3ZGKA 2B0LA 5HLTA 2K27A 1ZQ3P 2H6BA 3EFFK 3GUDA 3TOBA 1JJ8C 1YBKA 4HF1A 3K0LA 3KIOA 1PGQA 2VRSA 3IHUA 1VF5B 3CESA 3Q0WA 2AQEA 1Z3XA 3ZN0A 4E6KG 3D6YA 4RJTA 1N73C 3CUQC 3MEXA 3IN6A 4GGGA 2YPRA 3Q0VA 2KS1B 1MH3A 3WTTC 4YELA 5B1AH 3V2QA 4DZPA 4D6TJ 3T97B 1DQUA 4BHCA 5APWA 2L2OA 4RM3A 2L02A 2OAZA 3G73A 2ME6A 1URQC 2N1TD 1ZMEC 2WWYA 3K4JA 5ED4A 5L3EA 5B1BH 1EZVE 2Y69H 2M0MA 3K70D 4F52A 3H1LG 2GXGA 2FBWC 3WHBA 1MNEA 2JSCA 2CPBA 2XDVA 3G1LA 2OQQA 3JCUH 1OJLA 1SFEA 1KYOD 4YXDC 1FJPA 3ZMVA 3ZMZA 5GPAA 1MMSA 4DCKA 1RESA 3B5ND 4IXAA 2OYHB 1K78B 4QPQA 4LG0B 3MZYA 2I1JA 3L71D 3QOPA 3SEZA 4G7ZF 3L2VA 2B88A 1KQ9A 1UFMA 1N7SA 3M1CA 1NTZJ 2ZFWA 1KB9E 1I1GA 1SQQG 4YFNF 3DLLF 2K9YA 1WT6A 2RN0A 2CSOA 1R5HA 1S7AA 4LLHA 5APTA 3A0BC 4M73A 1I5ZA 2R5YA 2MBFA 2XSDC 1PZQA 4UV9A 2D2CB 4JYCA 4PUSA 2BY0A 2KK7A 2AHQA 2K88A 3LFKA 3BRTB 2NXNB 3WE2A 3IWZA 3LIEA 3SYTA 2BASA 4OH8B 1Y0UA 2BCCJ 4XLNF 1H9TA 1G8XA 3DKYA 4GCVA 1P4WA 1R8EA 4IRGA 2LREA 3B8EB 2KS1A 4D0PA 1IJDB 3VFZA 3AEAC 2MG4A 4BEHB 1LWUB 3T97A 3ASNH 2LNBA 1AJYA 1NTZK 2A05A 2DMNA 2X1CA 2XAHA 1ZG3A 4I09A 3WGHA 4FCYA 4UB8H 1IUYA 4ENNA 1X4PA 3ROUA 3M4OJ 1I39A 2MD0A 1RR8C 1IN7A 1E5WA 4U3FJ 1R58A 1GXPA 4EEFG 3P7KA 4UXNA 4R4MA 1WJCA 1A04A 1X2NA 1USTA 4CYDA 4NB5A 2ZKZA 1IZ1A 4Y3OA 2E19A 3CJNA 3CC7P 3ZDMA 3ZRGA 1XGSA 1IV6A 2OYHA 3I54A 1JJ6C 2VXDA 2YKPA 1K78A 3L72D 4LG0A 4NC8A 4EJUA 5FO5A 3U21A 1SP4A 2RREA 3DF8A 2DT5A 3KX2A 1UG0A 3RL0g 4IZZA 2ECCA 3K4BA 1NTCA 4A3GJ 2L7KA 4BKXA 5CCHC 4UUSB 1WMKA 3L2WA 1S5LX 2ZCWA 1T56A 3G2BA 4MN4C 2HOEA 1Z77A 1U9OA 3LNQA 1OVRA 1TLHB 5KLVG 1HF9A 4P9UA 1AV1A 1PP9J 5AVYB 2JEEA 2Y75A 3DEUA 4G6DA 2YIUB 2FYNC 2PAJA 1ZGJA 4F92B 1A36A 3HRNA 2EFQA 4DT0A 1W4MA 2KJCA 2UZKA 2F4OB 1ZELA 3FX3A 1YX5A 4U88A 2WSFJ 1KC8Q 1PVEA 1VQ5I 3CC7I 3NWTA 1VDFA 1LDJA 4D6TD 2O8XA 2YSRA 1E17A 4BEHA 1LWUA 1X3ZB 1PUFB 3S1KA 2ITAA 2H43A 1Y39A 4XLAA 4C3HJ 2V9PA 2A6EF 4E7IA 3S3MA 2K3RA 1WKMA 1FJLA 1T39A 4XR6A 1RH5B 1HWTC 5TISE 1NVOA 3H1IG 5AW7B 2CFXA 4HSTA 2LLKA 1ODDA 1YOVB 2TDXA 4PSXA 2GA1A 2ZJPF 2E1CA 1EDKA 1YITP 1BCCG 4J19A 2X1DA 3VYRB 4RM2A 1FU1A 1P84I 2CW8A 2HQAA 2JA6J 3HUSB 3M9HA 2HVRA 3RKXA 2BBYA 3AKZA 2RKLA 2NPSC 2VT3A 4EGYA 1MSFC 4MGRA 3RK3E 5AIPA 2W25A 1BE3J 1NTZD 1MBKA 3HHGA 5HNHA 1SFCD 4B8XA 3BCAA 1IK7A 4KT0J 4P5OA 3ZPLA 4UUSA 1VZ0A 3HOTA 1L2PA 1FZCC 5DD4A 2PBIA 2L3DA 1J2XA 2V6CA 3C2GA 2DAOA 4HBLA 5GPCA 4KT6A 3FM5A 4CCLA 2CV2A 4ZNCA 4HX8A 2DDAA 3R60A 4CZZA 2IGOA 2BCCD 4GDFA 3O8GA 4C30A 3OR2C 2HDDA 4C2MJ 2W82A 3AE9C 2KDOA 5E79C 1YITI 2M8GX 1XC5A 4XOPA 1IFMA 2IZ1A 2A06G 3H9QA 1JGGA 3SZPA 3FXMA 5K1YA 4G7HF 1L4AC 3L74J 1JGSA 1T98A 1Z56A 1SD6A 4GOFA 4ABZA 5B66C 3G71P 2DA1A 1PUFA 2L01A 4EATA 1KB9H 5LFAA 2M34A 2VBZA 2IA1A 3AE3C 3W6KB 5AVSB 4AVZA 4M3FA 1FDMA 5AVVB 3PFYA 1V55H 1MNMC 4U3FD 2JJ7A 3RL0D 4HX7A 3B5NB 5M5YJ 1CZQA 5KJ7C 1SVFA 3BTIA 4BHPA 2VB6A 1FZBA 3OR1C 2VJJA 2F5EA 3EQLF 2RN7A 1I6XA 2M8RA 3GW6A 3L73G 2VKHA 3G3ZA 4H44C 2ACJA 1Y6IA 2CUZA 3M91A 3HUSA 3HE5B 3RK2C 5C3EJ 2M2EA 1HKSA 3OIPA 3JR9A 2ZVNB 3OIQA 3A2AA 5L3CA 3S1MJ 1F1ZA 2ESNA 1IN8A 4PJ0C 1G1IA 2QJKB 1QVUA 3NXSA 4A3KJ 3LAJA 4IL6X 1I50J 1L0NE 3G71I 5LHHA 1U5TC 4DNCA 4DJGA 5DM6F 1SVLA 1SQXE 3QP5A 3CCRP 2OZ6A 1PP9D 4RKUJ 2RKHA 1FZFA 2MSYA 4WK8F 3HOWJ 3HSFA 5IT9K 1A31A 3A02A 2CQKA 2Y9ZA 5FB2A 5L3DA 2E74D 2VE9A 3H1LJ 1IJWC 2KSJA 4HKZH 4W97A 1RR7A 5HLIA 2GAUA 2NZ2A 3BR3A 4OMZA 3OSFA 2RDPA 1S5LE 2WY8Q 1JKQC 2HVQA 2YMKA 2XHKA 2YUSA 2R3CA 2JP3A 2AEFA 2QVAA 1SVOA 2DW3A 2ZXHA 5D5UB 1RRJA 2AXTC 1XSVA 3T5XA 3Q5RA 2E76C 1V3FA 1KYZA 1Z21A 4MNUA 3HOZJ 4M9SA 4LD5A 2OYOA 3N4MA 3KDPB 2EINH 3UIAA 4AD9A 5F08A 1T8IA 3V8JA 2E60A 2OPTA 2D1VA 1EC5A 1SQQJ 3B5NA 4RGXA 1XTGB 2HDWA 5AONA 2LDUA 3CZ6A 2FMYA 2DCEA 3K2ZA 3CCRI 3KLOA 3IAS2 1SFOJ 1URQD 1NWQA 5E3MA 2V1NA 1YS6A 1NKZB 3H36A 4Z2YA 2CGPA 1R4NB 3SJMA 4V2GA 1DP7P 4AYBA 1OCTC 1FTTA 1HTLC 3HE5A 2QJYB 4H13C 3R4YA 4KN4X 2VOOA 5KCMA 3M07A 2Q9IA 3NQOA 1QVTA 1BE3D 2QSFX 5H2FE 3CCSP 4MIMA 3CWBE 2HZDA 2RC4A 2OBPA 1XDSA 2ZSIB 1SD4A 5K5QA 1ZR4A 1ZRCA 4ZYDA 4JPZB 4Y15A 2Q1KA 3BPXA 3S15J 2OTJP 1R7JA 3WUTA 3MKZA 1KA8A 5M1BA 2VXZA 1G3SA 1IFDA 3HSEA 3V7RA 1DGWY 2KP6A 3JSOA 1T33A 1REPC 1DPUA 1BI3A 1GV2A 1T38A 2QM3A 4B1RA 5F27A 2E5ZA 2LKMA 4ZDOA 1XGOA 2HYFA 3HKZA 2CO5A 3UNGC 2EK5A 3BZ6A 1HJ0A 3V5BA 3L74D 2BOLA 1MBEA 1WFXA 4OVNF 2C0WA 2EV5A 5M5WJ 1OR7A 2QQBA 1L0OC 3S3OA 1XSXA 4A2UA 5J1UA 3CCSI 2QKLB 2FSWA 1GUUA 4WWCA 1LTJC 2X85A 1XS9A 3PJRA 1FDIA 1U57A 1ZOYC 2A61A 3BR2A 4M72A 2V1UA 3NWSA 3H1HG 1X1CA 1IN5A 1H9GA 3QYFA 4MQ9F 2OTJI 1HH0A 2B7EA 2BZTA 2RH0A 5APQA 4I98B 3UKGA 5KLVJ 2O3JA 4Y99B 3D71A 3MP7B 2L0KA 5AW5B 3Q5PA 2KKOA 2ZFCA 1TNSA 4M6VA 3TGUG 1GLNA 2E36A 3W2WA 4MTEA 3I4NJ 1Y8AA 3FMRA 2ZJSE 2DLLA 2LSOA 3EETA 3D6ZA 2WB1A 2BW3B 1BW6A 3GLLA 3U2RA 2ZFUA 3ZOBA 1NH4A 1S9KE 4BL0B 2KMUA 3BG7A 3FX0A 4WXCA 5GADJ 1Y1WJ 3COAC 3I9V2 1JOCA 1APLC 2DW4A 3DPUA 2PMHA 3HE4B 1TZLA 2BHYA 4PSWA 5FD6A 1H89C 2PRRA 1RKTA 1FOKA 1LT1A 3FWNA 3JRBA 2NVQJ 1JY3N 3L70E 1F36A 1BL0A 4KUMA 4B86A 4PK4A 1S4XA 3VTPC 1WQ2A 3H1LD 3E1SA 1O3RA 5CCHD 5J40A 4JYBA 3BPVA 5D6FA 4EJVA 3H1IJ 5CVUA 3EWKA 4IL6E 4RGSA 2JT1A 2YR2A 3C1LA 2WB1N 1OCOH 1ENHA 3E5UA 1O3QA 2XIGA 1TWFJ 2VONA 2PX9A 3GZ6A 1OCPA 2YMYA 3KE2A 1D0YA 1L0LK 3KEOA 2IRFG 2VJ4A 1D1BA 4BXUA 3PLNA 2E42A 3N97A 1DX7A 2Z5HA 2HOSA 1OYYA 1R1UA 3WGIA 2W24A 2L9NA 3I4PA 1SQPK 3GZ5A 2ZAEB 1FC3A 4XONA 2HYNA 3CDLA 5GTIE 2OCCH 3KYCB 1WJFA 3A03A 2COMA 2JTVA 4KNYA 3PO2J 4PCQA 1DPRA 1ZV8A 3Q5FA 3OJAB 2EV6A 2KIMA 3HPHA 4PFOA 3WTWC 4ZH4F 2ISZA 2AS5F 3VB2A 4IHXA 2BW3A 3FK6A 1RC9A 4D7NA 1DP3A 1D3YA 2LOOA 1FJKA 1YG2A 1QZYA 2CRGA 4KDPA 1DD3A 1S72P 4A5MA 1NO4A 4A69C 2ZJRF 1HW2A 1JHFA 2IPPA 5FKOA 3HE4A 2E74B 2NPSD 3AE4C 2KSEA 1U3EM 2CQNA 1S2EA 1SQBG 3B71A 3RYPA 4LK0F 5K7HA 2PGDA 1H88A 4EM0B 1ON1A 3HOUJ 4OIPF 3KZIE 1NHAA 2LC2A 2R93J 2WVRA 5ILVA 1TQIA 3C3WA 1K6OA 1F5TA 2EIMH 1FNNA 1FYMA 5CHXA 3JSPA 5F6FA 2DTZA 4EQQA 3OMYA 4MHGA 2HZTA 3CQZJ 2A45I 1W36C 2KPMA 3D1NI 3W67A 3KP6A 1N73B 1OYIA 1Y47A 2Q3IA 2HS5A 3QYBA 1WI9A 2EZIA 5DEQA 2QBYB 1KYOE 4I7ZB 5H2FH 4C3IJ 4W80A 1LKXA 5D8LB 5EEAA 3AEEC 1S7EA 1URQB 3L71E 4C3JJ 1S72I 2P4WA 1SFKA 4A3DJ 1LFBA 3FXJA 1L4AD 3A7OA 4U87A 5E3LA 2QQAA 1O4XA 5D5VB 4PJJA 3B6CA 1YJNP 3VYSB 5KLVD 4DZOA 1LVKA 2R5ZB 1X4OA 1OKRA 4XKCA 4AYCA 3SHFA 5C4JJ 1G3TA 1O3TA 3A0HC 1NOHA 1RE4C 2G3AA 1ZGAA 4UB6C 5APYA 3KFWX 2E75C 4V19K 4CUGA 3DEWA 3P8MC 3ABVC 2Z99A 2E34A 2OD5A 1Q1VA 1HW5A 1FOSE 4XLPF 3Q3SA 4YIFA 4CPGA 5IYDJ 1L0LD 2J5OA 2V6EA 2FXPA 3OS2A 5DUKA 4I2LC 2E5YA 2L54A 3BQZA 4GRIA 4LK1F 5ILUA 1T0FA 2HGCA 2MC4A 1EZVI 4XRSG 3DTEA 2VC1A 1EF4A 1ZTRA 4CXFA 4KIFA 3VWBA 2KIUA 2X6YA 3VP8A 3H1ID 1YJNI 4RESB 3EUHC 4M3EA 3PUFA 1UELB 2MC3A 4HG2A 5KK1A 4BYYA 5HNFA 4UY8I 2M5AB 2DU9A 1S6LA 1U9NA 1RPWA 2V7FA 3DQVC 2W4SA 3BP8A 4ZC3A 1LT9C 3RBXA 2ID3A 1N73A 2ZMEC 4KISA 4NBQA 4X6AJ 1JUMA 3AE6C 2QJPC 1D1CA 2QBYA 1ZHFA 4DJAA 3AE8C 2VASA 4WXHA 2BEZF 3L72E 3C2BA 5ILSA 4LB6B 3H5NA 2Z1DA 1URQA 3L75D 5DJTB 5AW0B 2XRNA 2HFHA 2NVXJ 2GUSA 4CCOA 3JAMK 3ITKA 2FUG2 4HA8A 3OV8A 3AG3H 3HOYJ 5GAEJ 2R5ZA 3KLNA 2XC7A 1IRGA 1FMWA 1SEUA 2E76D 4RLFA 2H6CA 2QLZA 3RQIA 3GTJJ 3GFIA 1HQCA 3HOSA 3HOVJ 2NS7A 3NRVA 3GTLJ 2EFWA 2P1JA 2XAGA 3EYIA 1UJ8A 1SFUA 3KETA 4B43A 3E6BA 2JA8J 1AOYA 3TQNA 3TL4X 3C8VA 1YFHA 1OPCA 1UHWA 1PL5A 2W27A 2HWVA 1XN7A 4A3IJ 3WODF 2XROA 3DU6A 2P67A 1HC8A 2X51A 5M5XJ 5CVVA 2OU2A 4EJOA 1DU0A 2CH0A 1VQ7P 1S29A 2AO9A 2XPVA 1R9TJ 3SWFA 5BNGA 3S2DJ 1MNDA 2VKDA 1O7FA 4B44A 1NH3A 2DOFA 2FYNB 2CQ7A 2QQ8A 1X3WB 3Q9SA 5IP6A 3H1HJ 4RO0A 2V26A 3E0JB 3O8HA 1J0RA 2FEZA 2M5AA 4HQEA 1MFZA 1E3PA 3BROA 3VSKA 1TC3C 2FOWA 4LITA 2K7LA 4F7ZA 3JCUE 3FIWA 3PJSK 3TGUJ 3L4FA 1U7MA 3MUDA 1KQLA 5J6XA 1KORA 5GTHC 2BVLA 2DJIA 4JBAA 3C18A 3M7GA 2WPQA 1TQPA 2KFDA 4BACA 1FYLA 5KHDA 2L7MP 4MEYF 4LLLA 3M0AA 1ZYRF 1XGMA 3V4WA 3WGGA 3F6OA 3OOUA 3IC7A 4X0GA 4HRIA 1NTZE 4M6XA 4XLEA 4O6JA 1IXRC 1X3UA 4GYIA 2NVUB 3TO9A 4E70A 1VQ7I 3F5HA 5LBQA 1FBMA 2YU9J 3WTUC 3F21A 1RF1B 1PPJG 2VJIA 2O3FA 1GVDA 2MGQA 1RE3A 4U0YA 1ZRDA 4MLOA 4UVCA 2ZXWH 2YX7A 3LSHA 3PHLA 2BCCE 3QQAA 1KYOH 1EDIA 3M06A 4YEJA 4KMFA 1ZR2A 2V1DA 1FAVA 1GL2B 1JB0J 1YW9A 1M1EB 2HTJA 1SQVG 2M9HA 2BY2A 5FRNA 3BT9A 2PJPA 2DT6A 4CHUA 1IV8A 1KZHA 4Y7NJ 1HVVA 4HDUA 1FOSF 2G7UA 2FF4A 2O61A 1KU2A 4UB8E 3FWEA 1JKRC 1N7LA 1QVGO 5CPRB 5KAFH 2L91A 4U3FE 4LFUA 3CPWO 3ABKH 4J00A 4AVPA 3GTOJ 3I3LA 2A45G 1RQUA 3B4SA 2AXCA 1X19A 1J5YA 1U0JA 1T2KC 3O6QB 1VQLP 1FE6A 2MFZA 2O7OA 3WU0A 1YTYA 2AEJA 2Z4EA 1M57D 2KUBA 4LLNA 2FYUG 2FBHA 1A02F 2OUMA 2HNHA 4MTDA 4H0LC 1HUCA 2DYRH 2P6TA 3U1CA 2IYOA 2YNYA 3NAUA 1ZLLA 2Z5UA 4NDLA 1SAXA 2I10A 1E2XA 2IS4A 2M8EA 3LFUA 1RF1A 2WAFA 1EH7A 2ZT9B 4U7BA 2PQ8A 1XMAA 2L9RA 2PG4A 4RAYA 1S9HA 3TP3A 2LR2A 4BE0A 1SFXA 3VMZA 1ZH5A 1XB4A 3LSTA 1VQLI 1GL2A 1NTMG 3HD7C 4L0ZB 3RZOJ 3TYYA 1NKNA 2BE5F 2FU4A 2VC0A 1BGYJ 1EZVG 2WSEJ 1B8IB 1MFTA 1LB2A 2E1MC 1OFCX 5CYVA 2FXMA 1PUEE 2JRMA 2F2EA 2RAEA 3R6SA 3H1HD 1NG7A 2D2WA 1JM0A 2Q5UA 1UB9A 3HHHA 3BVHA 3FMQA 2K85A 1U7JA 4WB4A 1HDPA 3WU2H 4L0YB 1E79H 5KAIC 1H8AC 1NTKG 3V6IA 3TGUD 2NS8A 4CZCA 1P84D 3O6QA 3G4SP 2QYOA 2VBWA 2ETHA 5IOYA 1H0MA 1K7AA 4P96A 2FOKA 3JC22 3M8JA 2K9NA 2Q6QA 2F4IA 1UMQA 2EBIA 3DKXA 5EYRA 3TDUC 3V2RA 1RETA 1OXZA 2W6JH 4EVIA 5FKKA 1W36D 3BJOA 2GUVA 1FBSA 3G6EP 1BE3E 1F4KA 4ENMA 3OYLA 2CUJA 3SFEC 1AQ5A 1USSA 3CDIA 4YFXF 5A2QZ 5AVZB 1FIPA 1V4RA 4XIDA 1VTNC 1N25A 1BI2A 2G0EA 4AC0A 4B48A 2P5LC 3DXJF 3W6VA 1HOMA 2E5NA 3PQJA 5HDKA 2NVTJ 1GHCA 5BPIA 3GTKJ 1DIPA 1SLQA 2O6GE 2IT0A 3GG2A 2KLVA 2NRAC 3EUKL 2J59M 1USEA 3P5JA 4OOIA 3IAM2 3G4SI 3L9FA 1EV7A 2E75D 2IGKA 3HG9A 1AVYA 2K4BA 3H1JE 3AE1C 3E5XA 1B8IA 1FZAA 2W8ZA 2EJRA 1J7KA 2A07F 2KOGA 4E7ZA 5B5EH 4XQFA 4W7ZA 3CCEP 2HI3A 1GV5A 3G6EI 4P9FA 4YFKF 3GHGC 3CCQP 4GFBA 2AEMA 2ZO4A 1P4AA 1X1AA 4HLXA 3BC8A 3N4XA 5KLIB 3BR6A 3MZWB 3V2NA 3WUVA 1L3LA 3LSRA 2FX0A 2QF7A 3FXQA 4BY7J 3IF4A 2FQ4A 2DOAA 2AXLA 3FK7A 1HGVA 1NYHA 4ZMDA 2Z16A 2TRTA 1CI6B 3CX5I 1N8RQ 2FYZA 3J7AO 2DFFA 4M74A 1ZLKA 3H1KG 2DYSH 2YX4A 2V9VA 5HLHA 3PNTA 5HOOA 2ICWG 1ZGWA 3WMM0 4ZYEA 4DIQA 2LRDA 2L7ZA 5FFXA 2UUZA 1IRFA 1R5GA 3ABUA 3HM5A 4DZJA 4I99C 2ELKA 1ERDA 3CJQB 3RYRA 2LKSA 2V7QJ 3RPUA 5KKZC 5ICGA 1YS7A 3S9OA 3CCEI 1VQ8P 2NAZA 4BJTA 1HCRA 2OYIB 2WITA 1ZARA 4CH7A 3CCQI 2COBA 3FF5A 1XTCC 4ASVA 5HODA 2K9QA 2ZNZA 3GVAA 3UR3C 2W1OA 2EILH 1KZUB 1FLIA 5F64A 2H09A 2MW8A 3VPRA 3H1LE 1W2BO 4NNJA 3WU1B 4DW6A 4V2FA 3VMYA 2QCOA 5EEHA 1BGYD 5LRRA 3BCCG 1KILD 4M6YA 4ESJA 1MJBA 1PP8F 2VE8A 2XSJC 2RGVA 1MH4A 3M9BA 2A5YB 3K9TA 4DBQA 1GK4A 3VYUB 3ZMUA 3H25A 2E2HJ 1CQTA 5FROA 3VDXA 1D1AA 5GP9A 4HX4A 3T0YA 3OYBA 4ZZDA 2BHZA 1JUSA 2E7XA 1U8RA 1YW8A 4XLHA 1VQ8I 3M0DC 4OIRF 4BY1J 2N9BA 2V4HA 3AE2C 5CCGA 3HPGA 2UWJE 3ERED 1CI6A 4XA4A 3QODA 4IOAF 2BV6A 3FGAD 4L5EA 2WSFH 1IN4A 3F6VA 2DBBA 4YXWH 4LOCA 1R5SA 4N4OB 4CICA 4U7DA 1XCBA 4IFMA 5FGMA 3S93A 1MGTA 4N78D 4NPFX 1UHMA 4IPAA 1AFOA 4RGUA 1SQVJ 4OGQD 1MKMA 2L9SA 3B02A 3FKJA 1S7OA 3JRFA 1GU4A 2DK5A 5LEKA 4L5JA 2XAJA 4M3BA 2QE7H 1Y9BA 3DFGA 5AVWB 2OYIA 2XU6A 5F04A 1Q7YQ 3RKYA 4PDKA 2Z2SB 4WY4D 3CTAA 3G1OA 1J59A 1Z7LA 1NAYA 1E3OC 1NK2P 2WAEA 3ZMTA 5FLVA 1UHSA 2IVMA 1BJZA 2HXOA 1HXDA 2R7FA 1QVFO 3JTHA 1HKQA 3PO3J 3OYEA 2FYUJ 1X9VA 2ZYDA 3AG1H 5APXA 3ZQQA 1D8JA 5HS7A 2XV5A 2IBDA 1MMDA 5EDNA 3A5TA 3DKWA 4HW0A 4A0YA 2OC6A 3K7AJ 1K8AQ 3BWGA 1YQ4C 1TBXA 1X1DA 2HFED 2NNYA 2VJ5A 4ZDLA 1TNTA 2IGMA 4CCKA 4F55A 3MKYB 2HPMA 4W7YA 3A0BH 5TISC 3TNUB 5CJ9A 1I6HJ 3LL7A 1L0NG 2N1TB 5BQTA 4QWQA 3H32B 2FMLA 1PYVA 1D7MA 4XN0A 2F4MB 2IDBA 1NTMJ 1L0LE 3CXHI 4RB2C 4MFEA 3H1CA 3BG3A 5BS6A 1E0EA 5AVXB 3WTVC 3V8KA 1SQPE 2FFDC 3RK3C 4KT5C 1IFJA 2M7AA 4IRIA 3TP0A 1KONA 3GF2A 3DTIA 4M3DA 2DA3A 3PIPF 4OMYA 4BRYB 1F43A 3CCMP 4E7KA 2O5RA 1HA8A 4A93J 3E6CC 2OCEA 1WWXA 1JY2P 1NTKJ 1SD5A 2OZUA 2VBXA 2DTRA 3J80Z 4KA4A 1IRZA 3SSUA 2O1JA 4XL9A 4RAFA 2WSSH 3H6PA 2EFNA 1NTMK 1W2EA 3WHCA 1HGZA 2WPSA 2DMPA 4XOTA 5CVRA 1X79B 1JT6A 3RKWA 4Y28J 1MMAA 2MA3A 3OL4A 2IEKA 4BS9A 3L75E 2IBZE 3M9AA 3BOQA 1TW3A 3HC7A 2HYJA 3Q5SA 3RGUA 5D8KB 4PD4I 2CU7A 3F8CA 4IVNA 1JT0A 3U59A 1PPJD 1WRGA 1B72B 3KP2A 4W1UA 3GTPJ 2WBMA 3QPSA 1GW4A 1GZLA 2G8YA 2JVGA 3M8EA 2UWMA 3CWBG 1NTKK 2FNPA 3F72A 2KQRA 3CCMI 1W5CE 3TNUA 1M90Q 2N1TA 2DA4A 3FXEA 1ACIA 3H32A 2M7BA 4DQ2A 3TSIA 3LA2A 1SQVD 2Q3EA 2KB7P 1P4XA 1MIJA 2ZYAA 5E3NA 1JTXA 3ABMH 3J7ZI 2XB5A 1Y56A 5C44J 3FXDA 2JR8A 3A1YA 4HF2A 2WV1A 3VN0A 2M5WA 4HF0A 2HODB 5J8FA 1LJ2A 5K7ZA 4NHJA 3H5RA 1PDNC 1KILB 1T95A 1D5YA 1GDTA 1IFPA 4XRFA 3KP4A 4BRYA 3CMMA 3V7CA 1CSBA 3F8FA 1OWAA 1Z7UA 2VL8A 3CP8A 1J1DB 2WC2A 2WSCJ 4JP0A 3K4MA 4E7SA 3LSKA 1EKEA 1KV4A 2BXYA 3OYGA 2FYUD 3H1KJ 1WZ2A 1NAFA 3CMEP 3R0AA 2LXCB 4J01A 2PJRB 3P32A 3ZMSA 3SQNA 2K9JB 1QEXA 3FXOA 5F0FA 3PNVA 3CF5F 1NHLA 1S5LC 4XE5B 1VNDA 1FZPB 1BSHA 1RZ4A 3WUUA 1WPKA 3ECOA 1SQQK 3C2HA 3D5RC 2XNDH 1OCRH 1M1KQ 3ONQA 2FKWB 4G7OF 4BUPA 2GIVA 1ZG1A 1J1EB 4FISA 3L2RA 2FQ3A 4HAMA 1M8OB 5EZGA 3HXLA 2XAQA 1B72A 3P8CD 4KN7X 2R7QA 1HBXG 4OGQB 2P58A 5DYMA 2OYHC 1X1BA 1FS0E 3HRSA 1VQPP 4JF7A 2QRXA 4ZKPA 4LB5A 4ZKUA 2E2JJ 3MWMA 1NTMD 1VQMP 3PM1A 3K69A 1XSDA 3BTLA 1RQVA 2FY8A 3E1IA 3L70G 5AW2B 1EZVD 3BCCJ 3CMEI 5E79H 2Y2ZA 3U1AA 2WPVB 2K4JA 3CMYA 4WY4B 2STTA 1MBHA 2HQ5A 2K9MA 2XPWA 3VSLA 5F1RA 2DFIA 3BG5A 5K5OA 2Q1ZB 2QZ8A 2HODA 2WQYC 5HDGA 3JRGA 3KCCA 5B66H 4RB1A 4HV5A 1ZREA 2D2CC 1QZZA 2JA2A 2LYCA 4CO8A 1KILA 1OLTA 1OVUA 4OIOF 1LJ9A 1SMTA 1VQNP 2CV0A 2TCTA 3MZHA 2W85A 1TWCJ 3BR0A 5FD5A 1YTZI 1NTKD 1SFCB 3LAPA 3PNYA 1SS1A 5AVUB 2X4HA 3BTJA 2Y9YA 2Y0EA 1QHGA 2L7FP 4KIGA 4PJNA 4ZDPA 1RF0A 2KI7B 2M1BA 5HS8A 1RY3A 2QUFA 2H88C 3DV8A 4M71A 4L76A 3F23A 3MN2A 1JKOC 2W00A 3K10A 3VP9A 2QSGX 2PJRA 1YO5C 1KTMA 1LUJB 3LSMA 3TMOA 1WJEA 1LWUC 2ZC2A 3BQYA 2K9JA 3HTKB 4UUTA 1VQMI 3HYIA 2RQQA 4RAZA 3S1RJ 2O1KA 2YO3A 1J9IA 1IUFA 3CDHA 5AW3B 3RSNA 5E3OA 1NU1E 1Q2NA 1AWCA 4H4KC 5KLVK 1HLVA 4PJ0H 5EFWB 1A6QA 3ZXSA 2JK3A 5FFZA 1T3UA 3PTZA 4ANJA 2V1XA 5CVIA 3ZQLA 1A6IA 1EH8A 3F9KA 1BCCJ 3E7LA 3H9JA 1XD7A 2XGEA 2VN2A 3JRDA 3E3VA 3HL2A 1VQNI 4PGHA 1AA0A 1OISA 1MMNA 3FMSA 4I1LA 3RL0B 1ETVA 3IV5A 2EWNA 2IXSA 3FXLA 3GW2A 1KFNA 1Z9CA 1J2JB 1IC8A 3BDDA 2LF8A 4JX6A 1DGRM 4WY4A 1SQQD 5J47A 2QQ9A 3I0TA 2IYPA 3NFQA 3GMEA 2R44A 3MD2A 1U2WA 1SANA 4FX0A 2AXTH 1PGOA 1Y8RB 2KLOA 3BY6A 1P2FA 2OV7A 2HQNA 3IP4B 2LBFB 2YIUC 4MFDA 4HJGH 1W5TA 2LR8A 4D1QA 3DCFA 1SFCA 1BDCA 3BASA 5AW1B 3C7JA 5TJJA 3L71G 4GO1A 1ETYA 1IC2A 4ZZLA 1X58A 3H1KD 3CCVP 1YE9A 1FYKA 1P84E 2MYSA 2OTKE 4PGGA 4I0BA 1BJAA 1TT5B 2IAIA 4IL6C 1T3JA 4QPOA 3HTKA 1LNWA 1PJRA 1GVJA 1WSUA 4B3AA 2XPUA 2Y31A 4A6EA 1Q82Q 1EXIA 1IXSB 3MHVA 4EOTA 3VMAA 4Y33A 2M3AA 2E7WA 3M9QA 2W84A 2VBYA 2XAFA 3F89A 3D5LA 5GAHJ 2IW5A 3P9IA 4OINF 4ZYGA 3L2UA 3AE7C 5L3BA 4HPQA 4WX9A 2QIWA 3L73J 3CUQB 3GTQJ 2M3EA 5GTIC 2EH3A 4BH9A 1FIAA 3HGGA 2BY3A 2PI0A 3FHNA 5F0HA 2M45A 3BCCD 2X0LA 1BBYA 3FBIB 3QU6A 5E17F 3LW5J 3I5CA 5LHIA 1DEEG 2F48A 3DWLE 2L5QA 2VKEA 4BXXJ 2I1KA 4BBRJ 5CKTA 4EV0A 3MFKA 4NQWB 3KYLA 3OWTA 1Z91A 2Y0MA 2FBIA 1XGNA 1G3WA 1QQIA 3IWFA 3K4CA 4LIUA 3RCOA 4XRMA 2LBFA 2NS0A 4ENKA 1K4TA 5KAFE 1UIXA 1U8BA 4AIKA 2LVSA 2JWTA 3L72G 5D4RA 3R4KA 2F5DA 3KZIC 3G9RA 3K2AA 3CX5H 5KJ7D 2LTPA 1S1CX 2Y0CA 2CW0F 4I2OA 4L74A 3CWBJ 3ABTA 2PLYA 4BXFA 4H44D 2F5FA 3OA7A 2ZNYA 1AHDP 2HPIA 1JTYA 2GBYA 3K70C 4IO9F 2IS2A 2BGCA 3RK2D 2H1KA 4CCJA 1AVOA 3CC2P 1I1SA 3HB9A 1IN6A 2LKPA 1TT0A 4DOZA 3IRQA 2KLUA 1IGNA 4Q48A 4JQ0D 3AFHA 3PL8A 2QA4P 1FSEA 5F0CA 3B5NC 1LDDA 4MO7A 2M4KA 2LKXA 1H8AA 2IS1A 5K5RA 4I02A 2X6XA 3BR1A 3JRCA 4BQOA 3LSJA 1BCCD 2B89A 2YO2A 4ENJA 1FZEA 1O3SA 4I7HA 3CUQA 3TEDA 3FKIJ 1I3AA 4L9JA 2LK2A 3SDGA 3KEYA 3WE3A 4NC6A 3KYQA 1Q1HA 3GCMA 3I64A 3BZKA 2H27A 1KB9I 3KHUA 1WJDA 4BJ6C 2QJKC 3TOAA 2XAUA 4II2A 1BGYE 4ASWA 2A69F 1KILE 5DJUB 2P6SA 2Y30A 2X48A 1X8YA 4HNUA 4LMYA 4XICA 1JCDA 1T08B 1YI2P 4RGRA 4N9IA 3GZNB 3GLXA 4NQWA 3CC2I 2E1OA 5EGOB 1IK9A 1XCVA 3FDYA 3ZN1A 1BOBA 5E1WA 2IFMA 2ZXXA 5DV5A 2QA4I 2C9LY 2K37A 4B09A 4P55A 3ZQGA 1QNTA 3WU2E 1JY2O 1IF1A 1B9MA 1YQ3C 3I56P 1VF9A 2WAQA 3K1MA 3EYYA 3SWKA 1KD1Q 1A5JA 2A06D 2WTEA 1NTZG 2M3BA 4TLFA 4DOJA 3PUBA 5CJ4A 4H13D 1R5LA 9ANTA 2O01J 3OYIA 3S2HJ 5M3FJ 1ETQA 4D6TE 3L70J 2E71A 3J80K 2DFHA 1JUPA 3HRTA 1MW7A 4I0AA 2CK3H 3CCUP 4ZTJA 4Z6YA 1EQ7A 3TDKA 1YI2I 3SFZA 4RLQA 5CQGA 1BM9A 3K6GA 3KP3A 1B59A 2BCCG 1I27A 4JYKA 1WHUA 3KEQA 4R4LA 1WH7A 4QLCU 3N7NA 1ORKA 2FA5A 3L73D 2WAQN 4E4HA 2KISA 1KN7A 5H6QA 1ZAOA 4G6TB 2QJYC 3O3KA 1Z6RA 4CA0A 1P84H 3AE5C 3I56I 1FP2A 4U0WA 2B87B 3W2AA 1JO5A 2JDIH 2JUGA 1BW5A 2W90A 4FT8A 2LXBA 3VMXA 2IFNA 1SAUA 4OU0A 2QENA 4U3FG 2XUBA 4RA2A 3ULQB 2ISYA 3HOXJ 5AVQB 1OMIA 3H0GJ 4TV7A 4ESFA 1G4DA 5B5EE 1MD0A 1KMIZ 3D70A 1YJ9P 1ZKGA 1YYCA 2R7ZJ 1T6SA 5EGOA 2X6OA 3H3ZA 3CCUI 1EDJA 3LWFA 2Q7CA 1V5GA 3OS1A 2WPRA 2VQGA 1GD2E 3H35A 1NJIQ 3GX4X 4HOBA 3C1DA 2MH2A 3CX5D 4WF2A 3CWBD 3S2WA 1RNLA 1FSHA 3ZP5A 3JRIA 2NPSB 4Y4RA 4Q4ZF 4RAGA 4XFJA 2FNAA 3USSA 1P6RA 3H9GA 1JUNA 3W3CA 3A0HH 1YHQP 3S14J 4UB6H 2EFOA 3JCUC 3TO7A 2JQ7A 1D5VA 5CCHA 5DUIA 5IP7J 3E6DA 1FZCB 3QAHA 1X1PA 1JE8A 4G6QA 2DPUA 3ZR8X 4Y13A 3HIFA 5E8IA 2R92J 3IUOA 1HJBA 4LG3A 3HDDA 1BR4A 3RDIA 4GOEA 1KQ0A 3RPQA 4OAZA 5FKMA 1YJ9I 1TQMA 1FEXA 5C4XJ 1M1JC 2CQXA 1QZEA 4OAYA 3DP7A 1CGPA 5DD8A 1QLED 4IOIH 1OCZH 2W7NA 1L4AB 2ZXIA 1OZHA 3MGNA 2XKPA 1QGKB 2O8KA 4AU7A 2B87A 2R7RA 3GF7A 3JSVC 5M3MJ 5IT9Z 2GXBA 1LTAC 1GMJA 2W6AA 1MMGA 2JRTA 3ZMDA 5FRMA 1AU7A 3V7SA 3ISPA 1H88C 2XVCA 2GM4A 1QU3A 2VQLA 3OYCA 1LTBC 2QSIA 1SQBJ 4WBAA 2JSPA 3FBNB 3VOEA 2W83C 2H8WA 1LVAA 2KZIA 4H44B 1VQ9P 1W5SA 4BDYA 1PP9E 1TTYA 2CFOA 1WRJA 2YXQB 4ZYAA 3RK2B 4UB8C 4HLYA 1ETOA 2ZB9A 3OSGA 2NPSA 1TL8A 1N77A 1POGA 4PV1C 2Y0SN 1HSJA 2PP6A 5FLXZ 3R2PA 1LEBA 2VOPA 2EIKH 2HG5D 3S3NA 3JTGA 1LTIC 4R8HA 2WSEH 2P8TA 3L70D 1U5TB 4LJZF 1FZCA 2Z33A 5KAIE 5CQEA 5E1ZB 4G94A 2DODA 2O9LA 2NOGA 5F1JA 4I6MC 4N3YB 4L9NA 5IY5H 3SWYA 1FC2C 2MJZA 5H6RA 3K1NA 3GWZA 3GFMA 2W48A 1SQBK 4AUXA 2IJLA 5E8GA 4MEXF 2R7VA 4HYEA 5L3FA 1A02J 4HZFA 4M9ZA 2XKMA 3BG9A 2M0CA 1OIPA 1ZXGA 3KP7A 3LIDA 4K2EA 2P81A 3H1JG 2DOEA 4RBOA 1VQ9I 3VYTB 3AECC 4I6ZA 1L4AA 5HLGA 3WTYC 1BN5A 1GT0C 3L72J 5BVZA 2CJJA 3BATA 2K9LA 2Q0OA 1BA5A 2WTYA 5D5XB 2E76B 1PFIA 2LF7A 1UG2A 4WXDA 3DBHB 3KPEA 3QPHA 2R7DA 2P7CB 2A68F 2IBZI 3LOCA 1R36A 1MSEC 2HEOA 2E74C 1T0FC 1R71A 3BG6A 5KJ7A 5GTHH 4CGZA 3H92A 4KFCA 1JMBA 3IKVA 1FWZA 4CCNA 3EFGA 4C7NB 2MLGA 1QGPA 2L5GB 5J1YA 4BAYA 4IKFA 3V8LA 4EI2A 3SZGA 2Z3YA 3BJAA 3MMYB 5DCMB 1TWHJ 4UUVA 1IFIA 4IRHA 4H13B 2CW7A 5ICCA 2K3PA 4XN3A 3JRAA 3DTKA 5IPAA 4O9BA 2C0XA 3Q2YA 2JA7J 3KZYA 3P8CE 2EV0A 5JR3A 4IQJA 3A0BE 3PH0A 4I7ZC 2LD5A 2EFPA 1G1JA 1VL2A 3L74E 2NOJB 3LSGA 3GBGA 1U5TA 3CXHD 1MBFA 2NVYJ 1BIBA 4M9XA 1NTME 1V54H 1AA7A 4D5FA 1VQ6P 1YX3A 2F6CA 3ZQIA 1BR1A 3IAOA 4CYCB 4GXOA 1Z3YA 1TP4A 2BEOA 5JLXA 4ESBA 2FE3A 2EZKA 5FJ8J 4IHSA 1KQ8A 2GLOA 1KQSO 3DU5A 3JREA 2VKVA 1J75A 5DM7F 2OQGA 4ETSA 2HR3A 5TGTA 2DQRA 3ZQFA 4KITB 2R0QC 3IR9A 3PQKA 1ULYA 3CLQA 1NTKE 1N78A 4WCGA 2P0WA 1ETXA 3AAFA 3F3XA 1JXSA 1LTJB 4EMSA 4C9YA 1WCMJ 1USDA 4CSWA 2Z9OA 1MZ9A 3KXDA 2IPQX 1QRYA 3QP6A 1XMKA 1SQBD 1X2MA 2WMMA 2V7QH 5JI6A 2MD5A 4AUWA 4GDOA 4C7NA 1U78A 1R4MB 3DPTA 2FXOA 2LH9A 1VQ6I 4PD4D 2F5CA 1F9NA 4JQFA 2IX7C 5DCMA 3HBLA 5DTDA 1GK6A 4E7JA 2DA2A 3DEEA 4HV6A 4DYRA 3LSPA 4KIBA 3S1QJ 2FXAA 5IYBJ 4BXLA 3MCZA 1Y0NA 2J5PA 1K05A 2BY1A 1KQGB 2X6WA 3GTMJ 1K83J 4MQVA 3MUDC 4P1WA 2OF7A 3IH2A 1WI3A 1QBJA 1ZRFA 2QM7A 2ME0A 5APSA 4HB1A 5EJCA 3CO7C 1P7JA 2EPFA 3EDPA 3IH3A 1OYWA 4ZTFA 4S04A 3AL0C 2KRHA 2XKOA 4Q5SF 3BRVB 4N6JA 1TU3F 2HPCB 2V9KA 3VYIA 3KQGA 1G3YA 2E1NA 1R1VA 4QTRA 4CYCA 1RKWA 2ZXJA 4II3A 1AKHB 1DDNA 4AM3A 3OYAA 4JOMA 1SQQE 2WT7B 3MKWB 4IHWA 3KPHA 1VQ5P 2DA5A 1RE3C 1LQ1A 1P92A 3I71A 2KL4A 1WJ5A 2KP8A 2N8GA 2MABA 1P9QC 1HBWA 3MIWA 2EQRA 4LGWA 3QYEA 1YRNB 1BI0A 4OIQF 2C6YA 4YIRX 4EYYQ 3S32A 1Z1DA 1W1WE 3QOEA 1LTJA 3H1KE 1FX7A 3U1KA 2MLKA 5KAIH 4ZJZA 2UXNA 1P7IA 4D7MA 2L4AA 1ZN5A 2QGUA 2C9NY 1ZK8A 4GYGA 2W6BA 4JK1X 4HH2A 4FE4A 2CPSA 4LC1A 4BQNA 5E20A 4CDGA 2B63J 5FLMJ 3B73A 3QWLA 2ZSHB 2HOTA 5J1RA 1R1TA 2SPZA 1YYVA 4GT1A 1VQOP 4UNOA 1TWAJ 3ERMA 2KIQA 4B47A 1IAWA 1FBUA 4HSRA 2A45H 1QL1A 1L0LG 1MJ9A 1BR2A 1AQTA 2XDJA 3HTSB 1GTWA 1QHHD 2WV0A 3O6BB 3W2VA 1SQPG 1SQVK 1QPIA 1H89A 4XBFA 3ESWB 3CLOA 2HDCA 3TBIA 3ZQ7A 3BCCE 2I5UA 5IYCJ 3L1PA 1OX3A 5E79E 2RVCA 2HPCA 1R23A 2ZYGA 4IF4A 4K3AA 4IFFA 1VQKP 2R5DA 1AKHA 1O7LA 4N9HA 2A5WA 4FETA 3QWOC 2BEQD 3D0SA 4XKVA 5B66E 3K4LA 2WT7A 3PSFA 1RF1C 1BOAA 5KLVE 3JRHA 5K5GB 1VQOI 2VUMJ 3QU3A 2DMUA 1N2DC 2QM8A 2JZYA 1EH6A 4EJWA 3OYDA 2A3SA 1YIOA 3OIOA 1YRNA 1T6AA 1PIXA 4QMAA 1W0TA 4LGDE 2XGXA 1LFUP 1SQXG 3L75G 1GL2C 3BZCA 2IBZG 2FYUK 3MD0A 1JTHB 1LTSC 3BR5A 3F8NA 1T2KD 3DBLB 3GXOA 5LD2C 2OARA 5APUA 1B6AA 1BIAA 1FY7A 5FKLA 3REOA 2HVSA 1QX8A 3FM3A 1KYWA 3TF5A 2L4MA 3V4GA 5BOXA 3AEFC 2AQFA 4H0LD 4BHBA 1VQKI 2LY2A 4YG2F 2FD5A 3MAJA 5KNLA 3J81Z 2E75B 2DMTA 4PJ0E 2OTLP 4DYQA 1KYOI 1FMVA 3H1IE 2UXXA 3V4QA 3FHZA 1XDUA 3A01B 1RUNA 3P7NA 1SVMA 3H1JJ 4YIIA 1BCCE 3II6A 3JAMZ 3Q9VA 4L73A 2R7WA 3LQRA 1CF7B 1SD7A 3OYKA 3SDBA 3IRRA 3E7KA 2R7XA 4BE2A 1RUOA 3W68A 4PV1D 1VPCA 5GAGJ 4QIWN 2EA2A 3HD7D 3AG2H 1B1BA 2D45A 1FPQA 1ZRTD 4GIFA 1KU3A 3IKTA 3ZQCA 2O01N 1K73Q 4PJLA 4PJMA 1LT9B 1JI8A 2E2IJ 2AXTE 3X2QH 2VQHA 1K61A 2ZT9C 2EZHA 1FOWA 2ZMEB 1C0WA 4HNTA 1JY3P 4KICA 2DA6A 2QJPB 2EZLA 2OTLI 3NTNA 1BC8C 4UVBA 5D5WB 2W57A 1S3JA 3A2KA 4JX4A 3AG4H 2ZJQF 3L37A 3TW6A 2CUEA 5EF6A 1HKTA 2O0YA 2ZJ2A 4FQGA 1JTHA 3V42A 3SZTA 2A06E 1JEKA 3H5AA 1MUUA 5AVTB 5BU8B 4L5IA 2BXZA 2KZJA 2VI6A 5JLWA 4R1HA 2G7HA 1N7SC 5H20A 3KZZA 3GF3A 1Y8QB 3DLAA 1GU5A 1STZA 2VPLA 4ASNA 1G2CB 2V79A 4A3MJ 2FBKA 4BQAA 4BE1A 5EG0B 3OYJA 3AEGC 1RE4A 1SC7A 2MH9A 3M3YJ 1K6YA 1KFMA 1R22A 1FTZA 2K1AA 1ETKA 4L18B 5KVRA 2CS3A 3CP2A 2HOAA 3A01A 4IFDK 2JN6A 3ZCOA 3LQQA 2GWRA 2WSCH 1RI7A 1VF5C 3L73E 4C7RA 1G6NA 2A6HF 1HW1A 2IA2A 1CF7A 1YQAA 1UZCA 2Y48A 5LGTA 3E6MA 2UV1A 2IZ0A 1WJAA 3OYFA 3H3UA 1VFCA 1OVVA 5J4VA 4IHTA 1W5CC 2R7TA 3QRFF 5FLXK 4KMUX 1PGJA 2OJED 5APVA 1IZNB 3AEDC 1FP1D 1I3QJ 3EUHA 1IDYA 1QL2A 3K5BA 1Z05A 4EIJA 5LEJA 4YRVA 3BCBA 2R7UA 1LT9A 4A3JJ 2HYGD 2ID6A 2D1HA 2HLOA 2ZMEA 2XF6A 1HF0A 2STWA 2QSHX 1YW7A 4E7LA 3FZVA 3CCJP 2WADA 3N05A 3CX5E 5KTBA 3TO6A 1NU1G 2JJLA 2KIKA 1SMYF 5AW4B 4ZYHA 2XF7A 4BGDA 4M3GA 1LGHB 5CMZA 2KHMA 5TISH 1TWGJ 3S17J 3GFJA 1G2CA 2RNJA 1ZG5A 4KYWA 1BC7C 1U6GA 4Y52J 5EG0A 5H2FC 3OYHA 3K4KA 5KLIC 3FXKA 2JWDA 2V4JC 2J5UA 1S8NA 4EDFA 4AYBN 4BQQA 4A5NA 5A2QK 5CCGC 3ML6A 4O5VA 1D8KA 4ITVA 3L00A 3P9CA 5JFRA 3H1JD 4HYTB 2RV8A 4UHTA 4XNFA 1MBJA 2LY9A 2CV1A 3WTSC 2DFEA 1MZBA 5L3GA 3DBRB 4F91B 3I58A 2HQRA 4A12A 1KB9D 2POHA 3B6AA 3CCJI 2YS9A 5FKNA 1VQPI 2GZWA 4A6DA 4F93B 4AIJA 6PAXA 2P7VB 3JW4A 4IX7A 3CC4P 3BJ6A 4IQ4A 5E18F 4Z1MH 3R0JA 3H0DA 4K35A 3I4MJ 1IFNA 3WG7H 1XMXA 1LTGC 4U0VA 3RTRA 2VODA 2KRFA 4IOCF 2LFBA 1Z67A 3GO5A 2WY7Q 1JY2N 3A3YB 1DU6A 3QH9A 1LP1B 4UV8A 4AWXB 1M1JB 2OYIC 3HKZN 2PEXA 2JUCA 4A7PA 3V2PA 4D9JA 2GOMA 3OS0A 3F8MA 2DO7A 2DK8A 2KJBA 4E7HA 2LG4A 4FASD 2K40A 1X0TA 2H89C 1NK3P 4XRSA 1IO2A 4IEJA 5BU5A 1L0LJ 4BWNA 1RHZB 4AIHA 2XGDA 1PGPA 1RIOH 4H0LB 4JBZA 3RKQA 4F3QA 4LLGF 4D5CA 3CCYA 5ERIA 3BTCA 1SQPJ 5C39A 5B3SH 1K04A 3CC4I 3PRJA 1MBGA 3CJTB 2LP0A 3CJRB 5BMZA 3RI4A 2CUFA 1XG1A 1PP7U 2JVHA 1EXJA 3CL3D 1IO4A 2CWEA 3HSRA 3NARA 2NRGA 3H1HE 3Q0UA 2YKQA 4PV1B 1IW7F 3LA7A 2QWWA 1Q90D 1OW8A 1B4AA 2J58A 3FXUA 3HD7B 2KT0A 2XV4S 3TGUE 3FXRA 4DYCA 2GXAA 2QEXP 3F0CA 2KRCA 5DS9A 1M7LA 1LDKB 1GW3A 4EJTA 1L0NJ 2E1MB 2HKXA 2JWAA 1FZGA 3AEBC 1FT9A 4QSHA 2I8DA 4C2UA 1SQXJ 3L75J 4A3BJ 3PP5A 1V5FA 1WH5A 5D4SA 1MDMB 2P10A 2XZRA 5CBNA 1UCRA 3HRUA 4A3FJ 2JPCA 1OW7A 3G1MA 2XASA 3K4NA 4HDVA 3FISA 1LP1A 3T8TA 2VLAA 1D0ZA 1M1JA 4C46A 3Q3DA 3RZDJ 1W0UA 2K86A 1T2KA 5LHGA 1FOXA 1S5LH 3W6JB 4ON0A 2XNXA 4NPDA 4A3CJ 3D5SC 5TRDA 2JPBA 3OYNA 3HUSC 1W7PD 1QPMA 1V5EA 5BPDA 2PMZA 5J8CA 1L0NK 3ECHA 3OAKA 3L09A 1XPXA 2R7SA 1SQXK 5EEGA 4FX4A 3CCVI 4XKBA 3A0HE 3HTUA 2QEXI 2KIFA 3FWLA 3LW5H 4GKGA 4UB6E 2NYXA 4NUBA 3C9IA 1R49A 1ZN2A 4XLCA 3LA3A 3S16J 3Q1MA 1IG7A 1GL2D 1DD4A 3CXHE 4FE7A 1XX5A 2F5VA 3MVPA 1UAAA 1FBQA 2OQRA 1OW6A 5IOZA 5LLQA 2DJNA 5K7FA 2P5VA 5ICFA 5IT3A 3BLYA 2XB0X 3RK3D 1XTAA 3WG9A 3PSIA 4RMNA 4RS8A 3MTUE 3HD7A 1BGYG 2GOXB 2PMZN 4HNVA 2N1TC 1K4SA 2K02A 4XSXF 4IHVA 1YLFA 2K3FA 4FTHA 2CMPA 1PV3A 4XMYA 5HVQC 1LEAA 4G9YA 4LIVA 3L2QA 2KYVA 1G2HA 1ZLJA 4DGWB 3GHGB 4X1EA 5DCFA 1MDMA 2YKOA 3HRMA 2DA7A 3QPTA 4BJ5C 4S0HB 4UVAA 3L36A 3S4RA 3OL3A 2XF5A 1SQBE 1WGXA 2B9SA 3I53A 3TKYA 1R5ID 5TJHA 3OY9A 3SFIA 1NGMB 4PD4E 3SEQA 4B3XA 1IXCA 2RQPA 2R3SA 3J7AY 2NNNA 5LRSA 1J09A 3J7YJ 4BNCA 1EA3A 2ECBA 3HJEA 4D6TG 4L75A 2DXIA 2ZT9D 3L7WA 2MKVA 5KAFC 4GODA 4YPCA 2JMWA 1IRXA 3IH4A 2JA5J 2ZVOB 4YTPC 4AQRD 3F22A 4Q47A 1SQPD 2P7JA 2HU9A 3RBZA 1YJWP 2VIXA 3I59B 1WJBA 5AW8B 5KKZB 3KYDB 3R61A 2M4GA 2X1EA 4A0ZA 5IP9J 4M3LA 3RJPA 2P5KA 3KP5A 3HGYA 3L2CA 2LMDA 1CW5A 5J3LA 5HS9A 3ELKA 2GA2A 4KHXA 2H94A 2ELHA 2ADUA 1E3HA 3OYMA 4DBRA 1N7SD 3U9GA 2HKOA 2OA4A 1H0TB 5J4YA 2WWWA 3GYHX 4NPEA 2D5VA 2Z5IA 3P9KA 3O8ZA 2O03A 3J81K 1G59A 4OWRB 4C2TA 1L0ND 3M8FA 3EUAA 4XORA 1SQXD 3T8RA 1VQ4P 4XK4A 3T1BA 3AL0B 2IBZD 3CMAP 1VI0A 1OR7C 2KZVA 2EB7A 2O01H 5AW6B 2KZGA 3MKLA 1JKPC 1NU1J 1VF5D 3GHGA 2R5BA 2A6TA 4NC7A 1QA6A 3IFMA 1A35A 3CCLP 4N78E 1YJWI 4HEA2 2E5TA 2XGCA 1O57A 5GTHE 1GXQA 2KNCB 4R79A 2IGNA 4IL6H 2CQQA 1JY3O 1KILC 4XSZF 2DDBA 1N75A 3RPUD 1OCCH 1JCCA 3EPZA 4U7JA 3HEFA 4G12A 5HDNA 4N0BA 1J1DC 1JMMA 5EZHA 2CYYA 2PMUA 1LNQA 3NEUA 1RF0C 3CD6P 5DDGA 2E35A 1LPQA 3H3VK 3WU2C 2Q2EB 4EGZA 4I76A 1NU1K 3I59A 4OWFA 3IL2A 1DUXC 1VQ4I 2XRLA 3ASOH 2X9DA 3CMAI 1N86A 5GTIH 2N9YB 3EQ2A 1KQFB 3WTXC 3CCLI 3GTGJ 2RMZA 2HTSA 3VOPA 3S1NJ 3CI9A 5JHFA 2H1LA 1MJAA 3A4CA 4N4NB 4BDZA 4A3EJ 1J1EC 1ZP0C 1KGSA 3VEPA 1Z6TA 2K9SA 3I55P 4RB0A 4L9VA 5JHUA 1H0TA 1FDOA 1HDDC 4OGQC 2KDZA 2D2CD 1ETWA 2P2UA 2L9VA 2PFBA 2WZ7A 2H7HA 2R4GA 1R00A 1R6RA 4H0EA 5CCGD 2JKVA 1FOYA 1OQYA 5CVJA 3GEZA 3TK1A 4WWIA 1EJ9A 2EA4A 4I01A 3CD6I 2ELJA 4S05A 4CCMA 3KZIH 1PP9G 3CXHH 3M1EA 2GIZA 4WY4C 3OOPA 2KNCA 3TGNA 1W7PB 4HQMA 3PIOF 3L35A 5JVGF 3M0DA 1Z0XA 3E1RA 2DI3A 3TDZC 4Y99C 2FJ1A 3CF2A 4O3MA 2BYVE 5B5EC 5ICEA 2OGUA 1SFCC 2ESHA 4EM1A 2DMQA 2RNGA 3GFLA 5JVTA 3I55I 2WA0A 4KJMA 1YIJP 2DT7B 2K5CA 3HZJA 3I5UA 1IDZA 2Y0SA 1KU9A 2QKMB 3L71J 3NMDA 4XM3A 2Q2EA 3MQ0A 3RIRA 3F8BA 3SXYA 1Q81Q 1ONVA 1LFPA 1ON2A 2VPRA 1YHQI 2JO1A 3ZQHA 2QG4A 2FFDB 2ZBKA 5L8RJ 2GQQA 3HUGB 4PZJA 4BU2A 1NG6A 1DEBA 3RK3B 2QVOA 1YTZT 1LTTC 3GLMA 3S8PA
chains in the Genus database with same CATH topology
2KL4A 1WJ5A 4U87A 2MABA 1P9QC 4PJJA 2LXCB 4J01A 2PJRB 3VYSB 3QYEA 1LVKA 1X4OA 3PNVA 4EYYQ 3RQ4A 4XKCA 3S32A 2LY1A 3QOEA 3C2HA 3D5RC 4ZJZA 3ONQA 4XKWA 4CUGA 4BUPA 3L2RA 1D0XA 4BQNA 3HXLA 4CPGA 1ZW0A 2R7QA 2ZSHB 2SPZA 2V6EA 2P58A 3OS2A 1X1BA 4GRIA 2MC4A 2QRXA 4B47A 4HSRA 2IS6A 3DTEA 2VQCA 1BR2A 3VWBA 2X6YA 1QHHD 1EDLA 4PFPA 3EUHC 3VSLA 2K9MA 4HG2A 1UELB 3W2VA 5HNFA 5CBOA 2M5AB 2Q1ZB 2V7FA 3DQVC 4ZC3A 2W4SA 3DPLC 3TBIA 2JA2A 2R7OA 4KJZA 4KISA 2LYCA 1OLTA 1OVUA 4K3AA 1D1CA 2CV0A 1BDDA 4DJAA 2VASA 2A5WA 4XLFA 3PNYA 4FETA 1SS1A 2M0BA 4XKVA 3QWOC 3K4LA 3H5NA 3PSFA 2Z1DA 1QHGA 4ZDPA 5DJTB 4PJNA 2BVMA 2KI7B 5K5GB 4CCOA 3LMMA 2FUG2 2W00A 3K10A 3LSIA 3OYDA 3ZGKA 2PJRA 3LSMA 3TMOA 5HLTA 1WJEA 2XC7A 1FMWA 4RLFA 2RQQA 3CESA 3HOSA 2AQEA 1Z3XA 3RSNA 4E6KG 1Q2NA 5LD2C 4H4KC 2HVSA 2KS1B 5EFWB 3ZXSA 4B43A 4YELA 4ANJA 1DQUA 3TL4X 2L2OA 4RM3A 2AQFA 3F9KA 3HL2A 3DU6A 3H9JA 3K4JA 2LY2A 2X51A 5KNLA 1MMNA 2M0MA 3K70D 2CH0A 4F52A 1FMVA 1MNEA 2XDVA 2IXSA 1MNDA 2VKDA 4B44A 2R7WA 1DGRM 2V26A 3OYKA 3E0JB 3SDBA 2M5AA 2R7XA 4BE2A 4QPQA 3VSKA 3MD2A 2R44A 4LITA 3SEZA 3L2VA 1U7MA 2KLOA 2B88A 2OV7A 2LBFB 3IP4B 4HJGH 2BVLA 2DJIA 3M1CA 4D1QA 1BDCA 4BACA 5KHDA 4PJLA 4PJMA 1JI8A 2VQHA 1YE9A 2OTKE 2MYSA 4PUSA 4HNTA 3OOUA 4X0GA 4HRIA 4XLEA 3SYTA 1S3JA 3A2KA 4QPOA 1PJRA 1G8XA 3DKYA 2VJIA 3V42A 4MLOA 2LREA 3MHVA 3H5AA 4Y33A 2M3AA 3LSHA 2KZJA 4BEHB 1EDIA 3DLAA 2X1CA 4YEJA 3D5LA 2VPLA 3L2UA 4BE1A 3OYJA 4HPQA 1X4PA 5FRNA 2MD0A 2DT6A 1K6YA 1WJCA 2CS3A 3FHNA 3CP2A 3FBIB 3ZCOA 4Y3OA 1DEEG 5CPRB 3DWLE 2L5QA 3ZRGA 3ZDMA 5CKTA 2VXDA 2UV1A 4J00A 1WJAA 3I3LA 3OYFA 4NQWB 4NC8A 3KYLA 1OVVA 3U21A 1X19A 2RREA 1U0JA 3OWTA 2R7TA 3KX2A 1UG0A 4LIUA 3K4CA 3RCOA 4IZZA 3K4BA 2LBFA 2MFZA 2L7KA 2KUBA 3L2WA 3G2BA 2OUMA 3BCBA 4YRVA 2R7UA 4MN4C 1OVRA 2HNHA 4BXFA 2XF6A 2HPIA 4E7LA 3K70C 4F92B 2IS2A 2WADA 3N05A 4CCJA 2IS4A 1ZELA 3LFUA 1TT0A 2WAFA 1YX5A 4DOZA 2KIKA 3NWTA 4U7BA 2XF7A 3AFHA 3PL8A 4BGDA 2KHMA 2M4KA 1S9HA 4BEHA 2LR2A 4BE0A 2IS1A 3S1KA 2X6XA 2B89A 4XLAA 4BQOA 4E7IA 3S3MA 3OYHA 3K4KA 2K3RA 2JWDA 2V4JC 4XR6A 4BQQA 1NVOA 1MFTA 2E1MC 3KEYA 4HSTA 4ITVA 1EDKA 4PSXA 1WJDA 2X1DA 4XNFA 4BJ6C 2CV1A 1NG7A 2XAUA 4II2A 1JM0A 4ASWA 4F91B 5DJUB 3VYRB 4RM2A 1U7JA 4HNUA 2CW8A 2HQAA 2HVRA 4F93B 3AKZA 2RKLA 4IX7A 4CZCA 3FDYA 4IQ4A 1BOBA 3H0DA 4K35A 5HNHA 3M8JA 3BCAA 3RTRA 2F4IA 3DKXA 4P5OA 2WY7Q 1VZ0A 3HOTA 2WAQA 1W36D 1LP1B 3C2GA 4KT6A 4CCLA 3OYLA 2CUJA 2CV2A 4ZNCA 4D9JA 2GOMA 2IGOA 3PUBA 3OS0A 4E7HA 4C30A 2LG4A 3OR2C 4FASD 3OYIA 1X0TA 2W82A 2KDOA 4B48A 4XOPA 2E5NA 1MW7A 3H9QA 4JBZA 4ZTJA 4F3QA 4GOFA 4RLQA 5CQGA 3EUKL 3K6GA 5C39A 3IAM2 4EATA 5LFAA 4E4HA 2IGKA 3CJRB 3HG9A 4AVZA 3PFYA 2JVHA 4G6TB 4CA0A 4E7ZA 4XQFA 2B87B 3W2AA 2VB6A 3OR1C 2JUGA 2VJJA 2LXBA 2VKHA 1X1AA 1SAUA 3BC8A 3MZWB 1Y6IA 2CUZA 2KRCA 1LDKB 2E1MB 3OYGA 3OIPA 2I8DA 4C2UA 2DOAA 3OIQA 1EDJA 4ZMDA 2Z16A 1V5GA 3OS1A 1V5FA 2VQGA 5CBNA 3PNTA 3H35A 5HOOA 3K4NA 1LP1A 2VLAA 1D0ZA 4DIQA 2LRDA 2UUZA 4Y4RA 3H9GA 1ERDA 3CJQB 3W3CA 4NPDA 3D5SC 3OYNA 4HKZH 1V5EA 4BJTA 2PMZA 3ZR8X 2WY8Q 4CH7A 2HVQA 2R7SA 4ASVA 4XKBA 3UR3C 2W1OA 3IUOA 4LG3A 2QVAA 1BR4A 4NUBA 4GOEA 4NNJA 2ZXHA 4XLCA 4OAZA 1UAAA 2F5VA 1Z21A 4OAYA 4IOIH 2W7NA 2E60A 2XSJC 2ZXIA 1EC5A 2HDWA 3CZ6A 3BLYA 2DCEA 3VYUB 4AU7A 4DBQA 2R7RA 2B87A 3IAS2 5FROA 3VDXA 3PSIA 4RMNA 2V1NA 1D1AA 2GOXB 3OYBA 1MMGA 4AYBA 5FRMA 2CMPA 4XMYA 5HVQC 4XLHA 5KCMA 2VQLA 3OYCA 1QU3A 4LIVA 3HPGA 3L2QA 2UWJE 4DGWB 2JSPA 3FBNB 3QODA 2KZIA 2HZDA 4BDYA 2ZSIB 2CFOA 4BJ5C 4N4OB 4ZYAA 3OL3A 2Q1KA 2XF5A 3S93A 3MKZA 4NPFX 2VXZA 1N77A 3OY9A 1DGWY 3SEQA 2KP6A 4B3XA 2L9SA 3FKJA 3J7AY 3S3NA 1J09A 2E5ZA 4ZDOA 1EA3A 2DXIA 3HKZA 5CQEA 3UNGC 4GODA 1IRXA 2BOLA 1FC2C 1WFXA 2HU9A 2Z2SB 2R7VA 2VIXA 1Z7LA 1WJBA 3S8PA 3S3OA 2WAEA 2M4GA 2X1EA 2QKLB 1ZXGA 2X85A 3PJRA 3VYTB 3NWSA 3OYEA 1X1CA 3OYMA 4DBRA 3QYFA 3ZQQA 1H0TB 2K9LA 1MMDA 4NPEA 1GLNA 3W2WA 1G59A 4OWRB 4C2TA 2OC6A 3LSKA 1T0FC 3EUAA 4XORA 1X1DA 2WB1A 3BG6A 2VJ5A 2BW3B 3AL0B 2ZFUA 1OR7C 2KZVA 4ZDLA 4BL0B 4CCNA 2KMUA 3BG7A 1JMBA 2IGMA 4CCKA 2A6TA 4NC7A 4F55A 3MKYB 2HPMA 4IKFA 3I9V2 3SZGA 4HEA2 3MMYB 3LL7A 3DPUA 1TZLA 4PSWA 2CW7A 1PYVA 2K3PA 4XN3A 4XN0A 4R79A 2IGNA 3DTKA 1LT1A 4IQJA 4PK4A 3PH0A 1N75A 3RPUD 3E1SA 3EPZA 2NOJB 3LSGA 1E0EA 3GBGA 2M7AA 1AA7A 1YX3A 1KONA 2F6CA 3DTIA 1BR1A 2Q2EB 4E7KA 2O5RA 1D0YA 1HA8A 1Z3YA 2VJ4A 1D1BA 3DU5A 4XL9A 2L9NA 2ZAEB 4XONA 5TGTA 2HR3A 5JHFA 4KITB 4N4NB 3A4CA 4BDZA 4XOTA 1WJFA 1H0TA 1N78A 1MMAA 2P0WA 3OL4A 4BS9A 4C9YA 3HPHA 3HC7A 4PFOA 2R4GA 1R6RA 4CSWA 3RGUA 2BW3A 2WMMA 1DP3A 4WWIA 2LOOA 3DPTA 2WBMA 2ELJA 2LH9A 4CCMA 2JVGA 2UWMA 4JQFA 2KQRA 4E7JA 3DEEA 3FXEA 4BXLA 2M7BA 2X6WA 3CF2A 2LC2A 4P1WA 1Y56A 3FXDA 3A1YA 2RNGA 3OMYA 4HB1A 2WA0A 4KJMA 2DT7B 4ZTFA 2K5CA 1W36C 2KPMA 2KRHA 2Y0SA 3AL0C 2QKMB 3H5RA 4XM3A 1Y47A 1T95A 2V9KA 3QYBA 3CMMA 1LFPA 4II3A 1LKXA 2VL8A 3OYAA 3CP8A 4JOMA 3MKWB 4BU2A 3HUGB 3K4MA 4E7SA 1NG6A 1SFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KL4 A;  4JBZ A;  4GOF A;  2LXC B;  1ZXG A;  5C39 A;  3MHV A;  4EYY Q;  2KZJ A;  1EDI A;  1H0T B;  4NPE A;  2B87 B;  2OC6 A;  4CPG A;  1ZW0 A;  2SPZ A;  2LXB A;  2P58 A;  1JMB A;  3MZW B;  1DEE G;  2QRX A;  3ZDM A;  2I8D A;  1EDJ A;  4ZMD A;  1LT1 A;  1OVV A;  5CBN A;  1EDL A;  5CBO A;  2M5A B;  1LP1 A;  3PH0 A;  2KUB A;  1OVU A;  4K3A A;  4MN4 C;  1BDD A;  1OVR A;  4NPD A;  2M0B A;  3QWO C;  1SS1 A;  4HKZ H;  5DJT B;  2KI7 B;  5K5G B;  4ASV A;  2QVA A;  4GOE A;  2KIK A;  2ZAE B;  2HR3 A;  1Q2N A;  2LR2 A;  4IOI H;  1H0T A;  3S1K A;  2B89 A;  2KS1 B;  1EC5 A;  5EFW B;  2K3R A;  2B87 A;  2JWD A;  3RGU A;  1NVO A;  1MFT A;  2WMM A;  1EDK A;  4WWI A;  1JM0 A;  4ASW A;  5DJU B;  2UWJ E;  1U7J A;  3FXE A;  4BXL A;  2KZI A;  2RKL A;  2M5A A;  2Q1K A;  4K35 A;  2R44 A;  3FXD A;  4NPF X;  2B88 A;  1U7M A;  4HB1 A;  1LP1 B;  4KJM A;  4HJG H;  4ZNC A;  1BDC A;  1Y47 A;  4GOD A;  1FC2 C;  1X0T A;  2OTK E;  1S3J A; 
#chains in the Genus database with same CATH topology
 2Q8K A;  1MV8 A;  1Q86 Q;  2DN0 A;  1LE8 B;  2Y0D A;  1ZRT E;  2YXR B;  4PD4 H;  2E43 A;  1S9K D;  1TW2 A;  3K1P A;  2DPD A;  4IJA A;  1M56 D;  1X22 A;  5CJ0 A;  2VT2 A;  4RB3 C;  1BI1 A;  3RQ4 A;  3CO6 C;  2LY1 A;  4AID A;  2YU3 A;  4FHT A;  4L9T A;  1PPJ E;  1BE3 G;  1BSN A;  2EIJ H;  3ABL H;  4XKW A;  5D6E A;  5E1X A;  1K9M Q;  3RL0 C;  3WTZ A;  2HXI A;  1QO0 D;  2M30 A;  3O2P E;  2R32 A;  1D0X A;  5AW9 B;  1JNM A;  1NU1 D;  1YIJ I;  3VOD A;  1T8Z A;  1ZW0 A;  2G9W A;  2PN6 A;  1SQV E;  4Y17 A;  4EM2 A;  2IP2 A;  4A0X A;  4IHY A;  1UII A;  1W7P A;  2ZXE B;  4BBS J;  2IS6 A;  5LGU A;  4TT3 H;  5CLS A;  2VQC A;  3QPL A;  1DH3 A;  3CUO A;  3U1D A;  3SFD C;  4G8X A;  1KU7 A;  1JHH A;  3L74 G;  1EDL A;  4PFP A;  4JX5 A;  4WVZ A;  5CBO A;  5AVR B;  3E97 A;  1K79 A;  2CG4 A;  2M87 A;  3GMA A;  4B4C A;  3DPL C;  2H8R A;  3OW2 O;  5LGN A;  1B9N A;  2H8P D;  2R7O A;  3E5Q A;  4KJZ A;  4RDU A;  2DQL A;  1BDD A;  2FRH A;  1Y1V J;  3PFI A;  5AIQ A;  2IA0 A;  3MZ8 A;  1N7S B;  2FYU E;  1ITY A;  4XLF A;  2M0B A;  2FFD A;  3HUG A;  2PFX A;  2B9B A;  2BVM A;  3TW7 A;  4A3L J;  2R5Y B;  2KXP B;  1WVR A;  1HST A;  3LMM A;  3LSI A;  1LE8 A;  3ZGK A;  2B0L A;  5HLT A;  2K27 A;  1ZQ3 P;  2H6B A;  3EFF K;  3GUD A;  3TOB A;  1JJ8 C;  1YBK A;  4HF1 A;  3K0L A;  3KIO A;  1PGQ A;  2VRS A;  3IHU A;  1VF5 B;  3CES A;  3Q0W A;  2AQE A;  1Z3X A;  3ZN0 A;  4E6K G;  3D6Y A;  4RJT A;  1N73 C;  3CUQ C;  3MEX A;  3IN6 A;  4GGG A;  2YPR A;  3Q0V A;  2KS1 B;  1MH3 A;  3WTT C;  4YEL A;  5B1A H;  3V2Q A;  4DZP A;  4D6T J;  3T97 B;  1DQU A;  4BHC A;  5APW A;  2L2O A;  4RM3 A;  2L02 A;  2OAZ A;  3G73 A;  2ME6 A;  1URQ C;  2N1T D;  1ZME C;  2WWY A;  3K4J A;  5ED4 A;  5L3E A;  5B1B H;  1EZV E;  2Y69 H;  2M0M A;  3K70 D;  4F52 A;  3H1L G;  2GXG A;  2FBW C;  3WHB A;  1MNE A;  2JSC A;  2CPB A;  2XDV A;  3G1L A;  2OQQ A;  3JCU H;  1OJL A;  1SFE A;  1KYO D;  4YXD C;  1FJP A;  3ZMV A;  3ZMZ A;  5GPA A;  1MMS A;  4DCK A;  1RES A;  3B5N D;  4IXA A;  2OYH B;  1K78 B;  4QPQ A;  4LG0 B;  3MZY A;  2I1J A;  3L71 D;  3QOP A;  3SEZ A;  4G7Z F;  3L2V A;  2B88 A;  1KQ9 A;  1UFM A;  1N7S A;  3M1C A;  1NTZ J;  2ZFW A;  1KB9 E;  1I1G A;  1SQQ G;  4YFN F;  3DLL F;  2K9Y A;  1WT6 A;  2RN0 A;  2CSO A;  1R5H A;  1S7A A;  4LLH A;  5APT A;  3A0B C;  4M73 A;  1I5Z A;  2R5Y A;  2MBF A;  2XSD C;  1PZQ A;  4UV9 A;  2D2C B;  4JYC A;  4PUS A;  2BY0 A;  2KK7 A;  2AHQ A;  2K88 A;  3LFK A;  3BRT B;  2NXN B;  3WE2 A;  3IWZ A;  3LIE A;  3SYT A;  2BAS A;  4OH8 B;  1Y0U A;  2BCC J;  4XLN F;  1H9T A;  1G8X A;  3DKY A;  4GCV A;  1P4W A;  1R8E A;  4IRG A;  2LRE A;  3B8E B;  2KS1 A;  4D0P A;  1IJD B;  3VFZ A;  3AEA C;  2MG4 A;  4BEH B;  1LWU B;  3T97 A;  3ASN H;  2LNB A;  1AJY A;  1NTZ K;  2A05 A;  2DMN A;  2X1C A;  2XAH A;  1ZG3 A;  4I09 A;  3WGH A;  4FCY A;  4UB8 H;  1IUY A;  4ENN A;  1X4P A;  3ROU A;  3M4O J;  1I39 A;  2MD0 A;  1RR8 C;  1IN7 A;  1E5W A;  4U3F J;  1R58 A;  1GXP A;  4EEF G;  3P7K A;  4UXN A;  4R4M A;  1WJC A;  1A04 A;  1X2N A;  1UST A;  4CYD A;  4NB5 A;  2ZKZ A;  1IZ1 A;  4Y3O A;  2E19 A;  3CJN A;  3CC7 P;  3ZDM A;  3ZRG A;  1XGS A;  1IV6 A;  2OYH A;  3I54 A;  1JJ6 C;  2VXD A;  2YKP A;  1K78 A;  3L72 D;  4LG0 A;  4NC8 A;  4EJU A;  5FO5 A;  3U21 A;  1SP4 A;  2RRE A;  3DF8 A;  2DT5 A;  3KX2 A;  1UG0 A;  3RL0 g;  4IZZ A;  2ECC A;  3K4B A;  1NTC A;  4A3G J;  2L7K A;  4BKX A;  5CCH C;  4UUS B;  1WMK A;  3L2W A;  1S5L X;  2ZCW A;  1T56 A;  3G2B A;  4MN4 C;  2HOE A;  1Z77 A;  1U9O A;  3LNQ A;  1OVR A;  1TLH B;  5KLV G;  1HF9 A;  4P9U A;  1AV1 A;  1PP9 J;  5AVY B;  2JEE A;  2Y75 A;  3DEU A;  4G6D A;  2YIU B;  2FYN C;  2PAJ A;  1ZGJ A;  4F92 B;  1A36 A;  3HRN A;  2EFQ A;  4DT0 A;  1W4M A;  2KJC A;  2UZK A;  2F4O B;  1ZEL A;  3FX3 A;  1YX5 A;  4U88 A;  2WSF J;  1KC8 Q;  1PVE A;  1VQ5 I;  3CC7 I;  3NWT A;  1VDF A;  1LDJ A;  4D6T D;  2O8X A;  2YSR A;  1E17 A;  4BEH A;  1LWU A;  1X3Z B;  1PUF B;  3S1K A;  2ITA A;  2H43 A;  1Y39 A;  4XLA A;  4C3H J;  2V9P A;  2A6E F;  4E7I A;  3S3M A;  2K3R A;  1WKM A;  1FJL A;  1T39 A;  4XR6 A;  1RH5 B;  1HWT C;  5TIS E;  1NVO A;  3H1I G;  5AW7 B;  2CFX A;  4HST A;  2LLK A;  1ODD A;  1YOV B;  2TDX A;  4PSX A;  2GA1 A;  2ZJP F;  2E1C A;  1EDK A;  1YIT P;  1BCC G;  4J19 A;  2X1D A;  3VYR B;  4RM2 A;  1FU1 A;  1P84 I;  2CW8 A;  2HQA A;  2JA6 J;  3HUS B;  3M9H A;  2HVR A;  3RKX A;  2BBY A;  3AKZ A;  2RKL A;  2NPS C;  2VT3 A;  4EGY A;  1MSF C;  4MGR A;  3RK3 E;  5AIP A;  2W25 A;  1BE3 J;  1NTZ D;  1MBK A;  3HHG A;  5HNH A;  1SFC D;  4B8X A;  3BCA A;  1IK7 A;  4KT0 J;  4P5O A;  3ZPL A;  4UUS A;  1VZ0 A;  3HOT A;  1L2P A;  1FZC C;  5DD4 A;  2PBI A;  2L3D A;  1J2X A;  2V6C A;  3C2G A;  2DAO A;  4HBL A;  5GPC A;  4KT6 A;  3FM5 A;  4CCL A;  2CV2 A;  4ZNC A;  4HX8 A;  2DDA A;  3R60 A;  4CZZ A;  2IGO A;  2BCC D;  4GDF A;  3O8G A;  4C30 A;  3OR2 C;  2HDD A;  4C2M J;  2W82 A;  3AE9 C;  2KDO A;  5E79 C;  1YIT I;  2M8G X;  1XC5 A;  4XOP A;  1IFM A;  2IZ1 A;  2A06 G;  3H9Q A;  1JGG A;  3SZP A;  3FXM A;  5K1Y A;  4G7H F;  1L4A C;  3L74 J;  1JGS A;  1T98 A;  1Z56 A;  1SD6 A;  4GOF A;  4ABZ A;  5B66 C;  3G71 P;  2DA1 A;  1PUF A;  2L01 A;  4EAT A;  1KB9 H;  5LFA A;  2M34 A;  2VBZ A;  2IA1 A;  3AE3 C;  3W6K B;  5AVS B;  4AVZ A;  4M3F A;  1FDM A;  5AVV B;  3PFY A;  1V55 H;  1MNM C;  4U3F D;  2JJ7 A;  3RL0 D;  4HX7 A;  3B5N B;  5M5Y J;  1CZQ A;  5KJ7 C;  1SVF A;  3BTI A;  4BHP A;  2VB6 A;  1FZB A;  3OR1 C;  2VJJ A;  2F5E A;  3EQL F;  2RN7 A;  1I6X A;  2M8R A;  3GW6 A;  3L73 G;  2VKH A;  3G3Z A;  4H44 C;  2ACJ A;  1Y6I A;  2CUZ A;  3M91 A;  3HUS A;  3HE5 B;  3RK2 C;  5C3E J;  2M2E A;  1HKS A;  3OIP A;  3JR9 A;  2ZVN B;  3OIQ A;  3A2A A;  5L3C A;  3S1M J;  1F1Z A;  2ESN A;  1IN8 A;  4PJ0 C;  1G1I A;  2QJK B;  1QVU A;  3NXS A;  4A3K J;  3LAJ A;  4IL6 X;  1I50 J;  1L0N E;  3G71 I;  5LHH A;  1U5T C;  4DNC A;  4DJG A;  5DM6 F;  1SVL A;  1SQX E;  3QP5 A;  3CCR P;  2OZ6 A;  1PP9 D;  4RKU J;  2RKH A;  1FZF A;  2MSY A;  4WK8 F;  3HOW J;  3HSF A;  5IT9 K;  1A31 A;  3A02 A;  2CQK A;  2Y9Z A;  5FB2 A;  5L3D A;  2E74 D;  2VE9 A;  3H1L J;  1IJW C;  2KSJ A;  4HKZ H;  4W97 A;  1RR7 A;  5HLI A;  2GAU A;  2NZ2 A;  3BR3 A;  4OMZ A;  3OSF A;  2RDP A;  1S5L E;  2WY8 Q;  1JKQ C;  2HVQ A;  2YMK A;  2XHK A;  2YUS A;  2R3C A;  2JP3 A;  2AEF A;  2QVA A;  1SVO A;  2DW3 A;  2ZXH A;  5D5U B;  1RRJ A;  2AXT C;  1XSV A;  3T5X A;  3Q5R A;  2E76 C;  1V3F A;  1KYZ A;  1Z21 A;  4MNU A;  3HOZ J;  4M9S A;  4LD5 A;  2OYO A;  3N4M A;  3KDP B;  2EIN H;  3UIA A;  4AD9 A;  5F08 A;  1T8I A;  3V8J A;  2E60 A;  2OPT A;  2D1V A;  1EC5 A;  1SQQ J;  3B5N A;  4RGX A;  1XTG B;  2HDW A;  5AON A;  2LDU A;  3CZ6 A;  2FMY A;  2DCE A;  3K2Z A;  3CCR I;  3KLO A;  3IAS 2;  1SFO J;  1URQ D;  1NWQ A;  5E3M A;  2V1N A;  1YS6 A;  1NKZ B;  3H36 A;  4Z2Y A;  2CGP A;  1R4N B;  3SJM A;  4V2G A;  1DP7 P;  4AYB A;  1OCT C;  1FTT A;  1HTL C;  3HE5 A;  2QJY B;  4H13 C;  3R4Y A;  4KN4 X;  2VOO A;  5KCM A;  3M07 A;  2Q9I A;  3NQO A;  1QVT A;  1BE3 D;  2QSF X;  5H2F E;  3CCS P;  4MIM A;  3CWB E;  2HZD A;  2RC4 A;  2OBP A;  1XDS A;  2ZSI B;  1SD4 A;  5K5Q A;  1ZR4 A;  1ZRC A;  4ZYD A;  4JPZ B;  4Y15 A;  2Q1K A;  3BPX A;  3S15 J;  2OTJ P;  1R7J A;  3WUT A;  3MKZ A;  1KA8 A;  5M1B A;  2VXZ A;  1G3S A;  1IFD A;  3HSE A;  3V7R A;  1DGW Y;  2KP6 A;  3JSO A;  1T33 A;  1REP C;  1DPU A;  1BI3 A;  1GV2 A;  1T38 A;  2QM3 A;  4B1R A;  5F27 A;  2E5Z A;  2LKM A;  4ZDO A;  1XGO A;  2HYF A;  3HKZ A;  2CO5 A;  3UNG C;  2EK5 A;  3BZ6 A;  1HJ0 A;  3V5B A;  3L74 D;  2BOL A;  1MBE A;  1WFX A;  4OVN F;  2C0W A;  2EV5 A;  5M5W J;  1OR7 A;  2QQB A;  1L0O C;  3S3O A;  1XSX A;  4A2U A;  5J1U A;  3CCS I;  2QKL B;  2FSW A;  1GUU A;  4WWC A;  1LTJ C;  2X85 A;  1XS9 A;  3PJR A;  1FDI A;  1U57 A;  1ZOY C;  2A61 A;  3BR2 A;  4M72 A;  2V1U A;  3NWS A;  3H1H G;  1X1C A;  1IN5 A;  1H9G A;  3QYF A;  4MQ9 F;  2OTJ I;  1HH0 A;  2B7E A;  2BZT A;  2RH0 A;  5APQ A;  4I98 B;  3UKG A;  5KLV J;  2O3J A;  4Y99 B;  3D71 A;  3MP7 B;  2L0K A;  5AW5 B;  3Q5P A;  2KKO A;  2ZFC A;  1TNS A;  4M6V A;  3TGU G;  1GLN A;  2E36 A;  3W2W A;  4MTE A;  3I4N J;  1Y8A A;  3FMR A;  2ZJS E;  2DLL A;  2LSO A;  3EET A;  3D6Z A;  2WB1 A;  2BW3 B;  1BW6 A;  3GLL A;  3U2R A;  2ZFU A;  3ZOB A;  1NH4 A;  1S9K E;  4BL0 B;  2KMU A;  3BG7 A;  3FX0 A;  4WXC A;  5GAD J;  1Y1W J;  3COA C;  3I9V 2;  1JOC A;  1APL C;  2DW4 A;  3DPU A;  2PMH A;  3HE4 B;  1TZL A;  2BHY A;  4PSW A;  5FD6 A;  1H89 C;  2PRR A;  1RKT A;  1FOK A;  1LT1 A;  3FWN A;  3JRB A;  2NVQ J;  1JY3 N;  3L70 E;  1F36 A;  1BL0 A;  4KUM A;  4B86 A;  4PK4 A;  1S4X A;  3VTP C;  1WQ2 A;  3H1L D;  3E1S A;  1O3R A;  5CCH D;  5J40 A;  4JYB A;  3BPV A;  5D6F A;  4EJV A;  3H1I J;  5CVU A;  3EWK A;  4IL6 E;  4RGS A;  2JT1 A;  2YR2 A;  3C1L A;  2WB1 N;  1OCO H;  1ENH A;  3E5U A;  1O3Q A;  2XIG A;  1TWF J;  2VON A;  2PX9 A;  3GZ6 A;  1OCP A;  2YMY A;  3KE2 A;  1D0Y A;  1L0L K;  3KEO A;  2IRF G;  2VJ4 A;  1D1B A;  4BXU A;  3PLN A;  2E42 A;  3N97 A;  1DX7 A;  2Z5H A;  2HOS A;  1OYY A;  1R1U A;  3WGI A;  2W24 A;  2L9N A;  3I4P A;  1SQP K;  3GZ5 A;  2ZAE B;  1FC3 A;  4XON A;  2HYN A;  3CDL A;  5GTI E;  2OCC H;  3KYC B;  1WJF A;  3A03 A;  2COM A;  2JTV A;  4KNY A;  3PO2 J;  4PCQ A;  1DPR A;  1ZV8 A;  3Q5F A;  3OJA B;  2EV6 A;  2KIM A;  3HPH A;  4PFO A;  3WTW C;  4ZH4 F;  2ISZ A;  2AS5 F;  3VB2 A;  4IHX A;  2BW3 A;  3FK6 A;  1RC9 A;  4D7N A;  1DP3 A;  1D3Y A;  2LOO A;  1FJK A;  1YG2 A;  1QZY A;  2CRG A;  4KDP A;  1DD3 A;  1S72 P;  4A5M A;  1NO4 A;  4A69 C;  2ZJR F;  1HW2 A;  1JHF A;  2IPP A;  5FKO A;  3HE4 A;  2E74 B;  2NPS D;  3AE4 C;  2KSE A;  1U3E M;  2CQN A;  1S2E A;  1SQB G;  3B71 A;  3RYP A;  4LK0 F;  5K7H A;  2PGD A;  1H88 A;  4EM0 B;  1ON1 A;  3HOU J;  4OIP F;  3KZI E;  1NHA A;  2LC2 A;  2R93 J;  2WVR A;  5ILV A;  1TQI A;  3C3W A;  1K6O A;  1F5T A;  2EIM H;  1FNN A;  1FYM A;  5CHX A;  3JSP A;  5F6F A;  2DTZ A;  4EQQ A;  3OMY A;  4MHG A;  2HZT A;  3CQZ J;  2A45 I;  1W36 C;  2KPM A;  3D1N I;  3W67 A;  3KP6 A;  1N73 B;  1OYI A;  1Y47 A;  2Q3I A;  2HS5 A;  3QYB A;  1WI9 A;  2EZI A;  5DEQ A;  2QBY B;  1KYO E;  4I7Z B;  5H2F H;  4C3I J;  4W80 A;  1LKX A;  5D8L B;  5EEA A;  3AEE C;  1S7E A;  1URQ B;  3L71 E;  4C3J J;  1S72 I;  2P4W A;  1SFK A;  4A3D J;  1LFB A;  3FXJ A;  1L4A D;  3A7O A;  4U87 A;  5E3L A;  2QQA A;  1O4X A;  5D5V B;  4PJJ A;  3B6C A;  1YJN P;  3VYS B;  5KLV D;  4DZO A;  1LVK A;  2R5Z B;  1X4O A;  1OKR A;  4XKC A;  4AYC A;  3SHF A;  5C4J J;  1G3T A;  1O3T A;  3A0H C;  1NOH A;  1RE4 C;  2G3A A;  1ZGA A;  4UB6 C;  5APY A;  3KFW X;  2E75 C;  4V19 K;  4CUG A;  3DEW A;  3P8M C;  3ABV C;  2Z99 A;  2E34 A;  2OD5 A;  1Q1V A;  1HW5 A;  1FOS E;  4XLP F;  3Q3S A;  4YIF A;  4CPG A;  5IYD J;  1L0L D;  2J5O A;  2V6E A;  2FXP A;  3OS2 A;  5DUK A;  4I2L C;  2E5Y A;  2L54 A;  3BQZ A;  4GRI A;  4LK1 F;  5ILU A;  1T0F A;  2HGC A;  2MC4 A;  1EZV I;  4XRS G;  3DTE A;  2VC1 A;  1EF4 A;  1ZTR A;  4CXF A;  4KIF A;  3VWB A;  2KIU A;  2X6Y A;  3VP8 A;  3H1I D;  1YJN I;  4RES B;  3EUH C;  4M3E A;  3PUF A;  1UEL B;  2MC3 A;  4HG2 A;  5KK1 A;  4BYY A;  5HNF A;  4UY8 I;  2M5A B;  2DU9 A;  1S6L A;  1U9N A;  1RPW A;  2V7F A;  3DQV C;  2W4S A;  3BP8 A;  4ZC3 A;  1LT9 C;  3RBX A;  2ID3 A;  1N73 A;  2ZME C;  4KIS A;  4NBQ A;  4X6A J;  1JUM A;  3AE6 C;  2QJP C;  1D1C A;  2QBY A;  1ZHF A;  4DJA A;  3AE8 C;  2VAS A;  4WXH A;  2BEZ F;  3L72 E;  3C2B A;  5ILS A;  4LB6 B;  3H5N A;  2Z1D A;  1URQ A;  3L75 D;  5DJT B;  5AW0 B;  2XRN A;  2HFH A;  2NVX J;  2GUS A;  4CCO A;  3JAM K;  3ITK A;  2FUG 2;  4HA8 A;  3OV8 A;  3AG3 H;  3HOY J;  5GAE J;  2R5Z A;  3KLN A;  2XC7 A;  1IRG A;  1FMW A;  1SEU A;  2E76 D;  4RLF A;  2H6C A;  2QLZ A;  3RQI A;  3GTJ J;  3GFI A;  1HQC A;  3HOS A;  3HOV J;  2NS7 A;  3NRV A;  3GTL J;  2EFW A;  2P1J A;  2XAG A;  3EYI A;  1UJ8 A;  1SFU A;  3KET A;  4B43 A;  3E6B A;  2JA8 J;  1AOY A;  3TQN A;  3TL4 X;  3C8V A;  1YFH A;  1OPC A;  1UHW A;  1PL5 A;  2W27 A;  2HWV A;  1XN7 A;  4A3I J;  3WOD F;  2XRO A;  3DU6 A;  2P67 A;  1HC8 A;  2X51 A;  5M5X J;  5CVV A;  2OU2 A;  4EJO A;  1DU0 A;  2CH0 A;  1VQ7 P;  1S29 A;  2AO9 A;  2XPV A;  1R9T J;  3SWF A;  5BNG A;  3S2D J;  1MND A;  2VKD A;  1O7F A;  4B44 A;  1NH3 A;  2DOF A;  2FYN B;  2CQ7 A;  2QQ8 A;  1X3W B;  3Q9S A;  5IP6 A;  3H1H J;  4RO0 A;  2V26 A;  3E0J B;  3O8H A;  1J0R A;  2FEZ A;  2M5A A;  4HQE A;  1MFZ A;  1E3P A;  3BRO A;  3VSK A;  1TC3 C;  2FOW A;  4LIT A;  2K7L A;  4F7Z A;  3JCU E;  3FIW A;  3PJS K;  3TGU J;  3L4F A;  1U7M A;  3MUD A;  1KQL A;  5J6X A;  1KOR A;  5GTH C;  2BVL A;  2DJI A;  4JBA A;  3C18 A;  3M7G A;  2WPQ A;  1TQP A;  2KFD A;  4BAC A;  1FYL A;  5KHD A;  2L7M P;  4MEY F;  4LLL A;  3M0A A;  1ZYR F;  1XGM A;  3V4W A;  3WGG A;  3F6O A;  3OOU A;  3IC7 A;  4X0G A;  4HRI A;  1NTZ E;  4M6X A;  4XLE A;  4O6J A;  1IXR C;  1X3U A;  4GYI A;  2NVU B;  3TO9 A;  4E70 A;  1VQ7 I;  3F5H A;  5LBQ A;  1FBM A;  2YU9 J;  3WTU C;  3F21 A;  1RF1 B;  1PPJ G;  2VJI A;  2O3F A;  1GVD A;  2MGQ A;  1RE3 A;  4U0Y A;  1ZRD A;  4MLO A;  4UVC A;  2ZXW H;  2YX7 A;  3LSH A;  3PHL A;  2BCC E;  3QQA A;  1KYO H;  1EDI A;  3M06 A;  4YEJ A;  4KMF A;  1ZR2 A;  2V1D A;  1FAV A;  1GL2 B;  1JB0 J;  1YW9 A;  1M1E B;  2HTJ A;  1SQV G;  2M9H A;  2BY2 A;  5FRN A;  3BT9 A;  2PJP A;  2DT6 A;  4CHU A;  1IV8 A;  1KZH A;  4Y7N J;  1HVV A;  4HDU A;  1FOS F;  2G7U A;  2FF4 A;  2O61 A;  1KU2 A;  4UB8 E;  3FWE A;  1JKR C;  1N7L A;  1QVG O;  5CPR B;  5KAF H;  2L91 A;  4U3F E;  4LFU A;  3CPW O;  3ABK H;  4J00 A;  4AVP A;  3GTO J;  3I3L A;  2A45 G;  1RQU A;  3B4S A;  2AXC A;  1X19 A;  1J5Y A;  1U0J A;  1T2K C;  3O6Q B;  1VQL P;  1FE6 A;  2MFZ A;  2O7O A;  3WU0 A;  1YTY A;  2AEJ A;  2Z4E A;  1M57 D;  2KUB A;  4LLN A;  2FYU G;  2FBH A;  1A02 F;  2OUM A;  2HNH A;  4MTD A;  4H0L C;  1HUC A;  2DYR H;  2P6T A;  3U1C A;  2IYO A;  2YNY A;  3NAU A;  1ZLL A;  2Z5U A;  4NDL A;  1SAX A;  2I10 A;  1E2X A;  2IS4 A;  2M8E A;  3LFU A;  1RF1 A;  2WAF A;  1EH7 A;  2ZT9 B;  4U7B A;  2PQ8 A;  1XMA A;  2L9R A;  2PG4 A;  4RAY A;  1S9H A;  3TP3 A;  2LR2 A;  4BE0 A;  1SFX A;  3VMZ A;  1ZH5 A;  1XB4 A;  3LST A;  1VQL I;  1GL2 A;  1NTM G;  3HD7 C;  4L0Z B;  3RZO J;  3TYY A;  1NKN A;  2BE5 F;  2FU4 A;  2VC0 A;  1BGY J;  1EZV G;  2WSE J;  1B8I B;  1MFT A;  1LB2 A;  2E1M C;  1OFC X;  5CYV A;  2FXM A;  1PUE E;  2JRM A;  2F2E A;  2RAE A;  3R6S A;  3H1H D;  1NG7 A;  2D2W A;  1JM0 A;  2Q5U A;  1UB9 A;  3HHH A;  3BVH A;  3FMQ A;  2K85 A;  1U7J A;  4WB4 A;  1HDP A;  3WU2 H;  4L0Y B;  1E79 H;  5KAI C;  1H8A C;  1NTK G;  3V6I A;  3TGU D;  2NS8 A;  4CZC A;  1P84 D;  3O6Q A;  3G4S P;  2QYO A;  2VBW A;  2ETH A;  5IOY A;  1H0M A;  1K7A A;  4P96 A;  2FOK A;  3JC2 2;  3M8J A;  2K9N A;  2Q6Q A;  2F4I A;  1UMQ A;  2EBI A;  3DKX A;  5EYR A;  3TDU C;  3V2R A;  1RET A;  1OXZ A;  2W6J H;  4EVI A;  5FKK A;  1W36 D;  3BJO A;  2GUV A;  1FBS A;  3G6E P;  1BE3 E;  1F4K A;  4ENM A;  3OYL A;  2CUJ A;  3SFE C;  1AQ5 A;  1USS A;  3CDI A;  4YFX F;  5A2Q Z;  5AVZ B;  1FIP A;  1V4R A;  4XID A;  1VTN C;  1N25 A;  1BI2 A;  2G0E A;  4AC0 A;  4B48 A;  2P5L C;  3DXJ F;  3W6V A;  1HOM A;  2E5N A;  3PQJ A;  5HDK A;  2NVT J;  1GHC A;  5BPI A;  3GTK J;  1DIP A;  1SLQ A;  2O6G E;  2IT0 A;  3GG2 A;  2KLV A;  2NRA C;  3EUK L;  2J59 M;  1USE A;  3P5J A;  4OOI A;  3IAM 2;  3G4S I;  3L9F A;  1EV7 A;  2E75 D;  2IGK A;  3HG9 A;  1AVY A;  2K4B A;  3H1J E;  3AE1 C;  3E5X A;  1B8I A;  1FZA A;  2W8Z A;  2EJR A;  1J7K A;  2A07 F;  2KOG A;  4E7Z A;  5B5E H;  4XQF A;  4W7Z A;  3CCE P;  2HI3 A;  1GV5 A;  3G6E I;  4P9F A;  4YFK F;  3GHG C;  3CCQ P;  4GFB A;  2AEM A;  2ZO4 A;  1P4A A;  1X1A A;  4HLX A;  3BC8 A;  3N4X A;  5KLI B;  3BR6 A;  3MZW B;  3V2N A;  3WUV A;  1L3L A;  3LSR A;  2FX0 A;  2QF7 A;  3FXQ A;  4BY7 J;  3IF4 A;  2FQ4 A;  2DOA A;  2AXL A;  3FK7 A;  1HGV A;  1NYH A;  4ZMD A;  2Z16 A;  2TRT A;  1CI6 B;  3CX5 I;  1N8R Q;  2FYZ A;  3J7A O;  2DFF A;  4M74 A;  1ZLK A;  3H1K G;  2DYS H;  2YX4 A;  2V9V A;  5HLH A;  3PNT A;  5HOO A;  2ICW G;  1ZGW A;  3WMM 0;  4ZYE A;  4DIQ A;  2LRD A;  2L7Z A;  5FFX A;  2UUZ A;  1IRF A;  1R5G A;  3ABU A;  3HM5 A;  4DZJ A;  4I99 C;  2ELK A;  1ERD A;  3CJQ B;  3RYR A;  2LKS A;  2V7Q J;  3RPU A;  5KKZ C;  5ICG A;  1YS7 A;  3S9O A;  3CCE I;  1VQ8 P;  2NAZ A;  4BJT A;  1HCR A;  2OYI B;  2WIT A;  1ZAR A;  4CH7 A;  3CCQ I;  2COB A;  3FF5 A;  1XTC C;  4ASV A;  5HOD A;  2K9Q A;  2ZNZ A;  3GVA A;  3UR3 C;  2W1O A;  2EIL H;  1KZU B;  1FLI A;  5F64 A;  2H09 A;  2MW8 A;  3VPR A;  3H1L E;  1W2B O;  4NNJ A;  3WU1 B;  4DW6 A;  4V2F A;  3VMY A;  2QCO A;  5EEH A;  1BGY D;  5LRR A;  3BCC G;  1KIL D;  4M6Y A;  4ESJ A;  1MJB A;  1PP8 F;  2VE8 A;  2XSJ C;  2RGV A;  1MH4 A;  3M9B A;  2A5Y B;  3K9T A;  4DBQ A;  1GK4 A;  3VYU B;  3ZMU A;  3H25 A;  2E2H J;  1CQT A;  5FRO A;  3VDX A;  1D1A A;  5GP9 A;  4HX4 A;  3T0Y A;  3OYB A;  4ZZD A;  2BHZ A;  1JUS A;  2E7X A;  1U8R A;  1YW8 A;  4XLH A;  1VQ8 I;  3M0D C;  4OIR F;  4BY1 J;  2N9B A;  2V4H A;  3AE2 C;  5CCG A;  3HPG A;  2UWJ E;  3ERE D;  1CI6 A;  4XA4 A;  3QOD A;  4IOA F;  2BV6 A;  3FGA D;  4L5E A;  2WSF H;  1IN4 A;  3F6V A;  2DBB A;  4YXW H;  4LOC A;  1R5S A;  4N4O B;  4CIC A;  4U7D A;  1XCB A;  4IFM A;  5FGM A;  3S93 A;  1MGT A;  4N78 D;  4NPF X;  1UHM A;  4IPA A;  1AFO A;  4RGU A;  1SQV J;  4OGQ D;  1MKM A;  2L9S A;  3B02 A;  3FKJ A;  1S7O A;  3JRF A;  1GU4 A;  2DK5 A;  5LEK A;  4L5J A;  2XAJ A;  4M3B A;  2QE7 H;  1Y9B A;  3DFG A;  5AVW B;  2OYI A;  2XU6 A;  5F04 A;  1Q7Y Q;  3RKY A;  4PDK A;  2Z2S B;  4WY4 D;  3CTA A;  3G1O A;  1J59 A;  1Z7L A;  1NAY A;  1E3O C;  1NK2 P;  2WAE A;  3ZMT A;  5FLV A;  1UHS A;  2IVM A;  1BJZ A;  2HXO A;  1HXD A;  2R7F A;  1QVF O;  3JTH A;  1HKQ A;  3PO3 J;  3OYE A;  2FYU J;  1X9V A;  2ZYD A;  3AG1 H;  5APX A;  3ZQQ A;  1D8J A;  5HS7 A;  2XV5 A;  2IBD A;  1MMD A;  5EDN A;  3A5T A;  3DKW A;  4HW0 A;  4A0Y A;  2OC6 A;  3K7A J;  1K8A Q;  3BWG A;  1YQ4 C;  1TBX A;  1X1D A;  2HFE D;  2NNY A;  2VJ5 A;  4ZDL A;  1TNT A;  2IGM A;  4CCK A;  4F55 A;  3MKY B;  2HPM A;  4W7Y A;  3A0B H;  5TIS C;  3TNU B;  5CJ9 A;  1I6H J;  3LL7 A;  1L0N G;  2N1T B;  5BQT A;  4QWQ A;  3H32 B;  2FML A;  1PYV A;  1D7M A;  4XN0 A;  2F4M B;  2IDB A;  1NTM J;  1L0L E;  3CXH I;  4RB2 C;  4MFE A;  3H1C A;  3BG3 A;  5BS6 A;  1E0E A;  5AVX B;  3WTV C;  3V8K A;  1SQP E;  2FFD C;  3RK3 C;  4KT5 C;  1IFJ A;  2M7A A;  4IRI A;  3TP0 A;  1KON A;  3GF2 A;  3DTI A;  4M3D A;  2DA3 A;  3PIP F;  4OMY A;  4BRY B;  1F43 A;  3CCM P;  4E7K A;  2O5R A;  1HA8 A;  4A93 J;  3E6C C;  2OCE A;  1WWX A;  1JY2 P;  1NTK J;  1SD5 A;  2OZU A;  2VBX A;  2DTR A;  3J80 Z;  4KA4 A;  1IRZ A;  3SSU A;  2O1J A;  4XL9 A;  4RAF A;  2WSS H;  3H6P A;  2EFN A;  1NTM K;  1W2E A;  3WHC A;  1HGZ A;  2WPS A;  2DMP A;  4XOT A;  5CVR A;  1X79 B;  1JT6 A;  3RKW A;  4Y28 J;  1MMA A;  2MA3 A;  3OL4 A;  2IEK A;  4BS9 A;  3L75 E;  2IBZ E;  3M9A A;  3BOQ A;  1TW3 A;  3HC7 A;  2HYJ A;  3Q5S A;  3RGU A;  5D8K B;  4PD4 I;  2CU7 A;  3F8C A;  4IVN A;  1JT0 A;  3U59 A;  1PPJ D;  1WRG A;  1B72 B;  3KP2 A;  4W1U A;  3GTP J;  2WBM A;  3QPS A;  1GW4 A;  1GZL A;  2G8Y A;  2JVG A;  3M8E A;  2UWM A;  3CWB G;  1NTK K;  2FNP A;  3F72 A;  2KQR A;  3CCM I;  1W5C E;  3TNU A;  1M90 Q;  2N1T A;  2DA4 A;  3FXE A;  1ACI A;  3H32 A;  2M7B A;  4DQ2 A;  3TSI A;  3LA2 A;  1SQV D;  2Q3E A;  2KB7 P;  1P4X A;  1MIJ A;  2ZYA A;  5E3N A;  1JTX A;  3ABM H;  3J7Z I;  2XB5 A;  1Y56 A;  5C44 J;  3FXD A;  2JR8 A;  3A1Y A;  4HF2 A;  2WV1 A;  3VN0 A;  2M5W A;  4HF0 A;  2HOD B;  5J8F A;  1LJ2 A;  5K7Z A;  4NHJ A;  3H5R A;  1PDN C;  1KIL B;  1T95 A;  1D5Y A;  1GDT A;  1IFP A;  4XRF A;  3KP4 A;  4BRY A;  3CMM A;  3V7C A;  1CSB A;  3F8F A;  1OWA A;  1Z7U A;  2VL8 A;  3CP8 A;  1J1D B;  2WC2 A;  2WSC J;  4JP0 A;  3K4M A;  4E7S A;  3LSK A;  1EKE A;  1KV4 A;  2BXY A;  3OYG A;  2FYU D;  3H1K J;  1WZ2 A;  1NAF A;  3CME P;  3R0A A;  2LXC B;  4J01 A;  2PJR B;  3P32 A;  3ZMS A;  3SQN A;  2K9J B;  1QEX A;  3FXO A;  5F0F A;  3PNV A;  3CF5 F;  1NHL A;  1S5L C;  4XE5 B;  1VND A;  1FZP B;  1BSH A;  1RZ4 A;  3WUU A;  1WPK A;  3ECO A;  1SQQ K;  3C2H A;  3D5R C;  2XND H;  1OCR H;  1M1K Q;  3ONQ A;  2FKW B;  4G7O F;  4BUP A;  2GIV A;  1ZG1 A;  1J1E B;  4FIS A;  3L2R A;  2FQ3 A;  4HAM A;  1M8O B;  5EZG A;  3HXL A;  2XAQ A;  1B72 A;  3P8C D;  4KN7 X;  2R7Q A;  1HBX G;  4OGQ B;  2P58 A;  5DYM A;  2OYH C;  1X1B A;  1FS0 E;  3HRS A;  1VQP P;  4JF7 A;  2QRX A;  4ZKP A;  4LB5 A;  4ZKU A;  2E2J J;  3MWM A;  1NTM D;  1VQM P;  3PM1 A;  3K69 A;  1XSD A;  3BTL A;  1RQV A;  2FY8 A;  3E1I A;  3L70 G;  5AW2 B;  1EZV D;  3BCC J;  3CME I;  5E79 H;  2Y2Z A;  3U1A A;  2WPV B;  2K4J A;  3CMY A;  4WY4 B;  2STT A;  1MBH A;  2HQ5 A;  2K9M A;  2XPW A;  3VSL A;  5F1R A;  2DFI A;  3BG5 A;  5K5O A;  2Q1Z B;  2QZ8 A;  2HOD A;  2WQY C;  5HDG A;  3JRG A;  3KCC A;  5B66 H;  4RB1 A;  4HV5 A;  1ZRE A;  2D2C C;  1QZZ A;  2JA2 A;  2LYC A;  4CO8 A;  1KIL A;  1OLT A;  1OVU A;  4OIO F;  1LJ9 A;  1SMT A;  1VQN P;  2CV0 A;  2TCT A;  3MZH A;  2W85 A;  1TWC J;  3BR0 A;  5FD5 A;  1YTZ I;  1NTK D;  1SFC B;  3LAP A;  3PNY A;  1SS1 A;  5AVU B;  2X4H A;  3BTJ A;  2Y9Y A;  2Y0E A;  1QHG A;  2L7F P;  4KIG A;  4PJN A;  4ZDP A;  1RF0 A;  2KI7 B;  2M1B A;  5HS8 A;  1RY3 A;  2QUF A;  2H88 C;  3DV8 A;  4M71 A;  4L76 A;  3F23 A;  3MN2 A;  1JKO C;  2W00 A;  3K10 A;  3VP9 A;  2QSG X;  2PJR A;  1YO5 C;  1KTM A;  1LUJ B;  3LSM A;  3TMO A;  1WJE A;  1LWU C;  2ZC2 A;  3BQY A;  2K9J A;  3HTK B;  4UUT A;  1VQM I;  3HYI A;  2RQQ A;  4RAZ A;  3S1R J;  2O1K A;  2YO3 A;  1J9I A;  1IUF A;  3CDH A;  5AW3 B;  3RSN A;  5E3O A;  1NU1 E;  1Q2N A;  1AWC A;  4H4K C;  5KLV K;  1HLV A;  4PJ0 H;  5EFW B;  1A6Q A;  3ZXS A;  2JK3 A;  5FFZ A;  1T3U A;  3PTZ A;  4ANJ A;  2V1X A;  5CVI A;  3ZQL A;  1A6I A;  1EH8 A;  3F9K A;  1BCC J;  3E7L A;  3H9J A;  1XD7 A;  2XGE A;  2VN2 A;  3JRD A;  3E3V A;  3HL2 A;  1VQN I;  4PGH A;  1AA0 A;  1OIS A;  1MMN A;  3FMS A;  4I1L A;  3RL0 B;  1ETV A;  3IV5 A;  2EWN A;  2IXS A;  3FXL A;  3GW2 A;  1KFN A;  1Z9C A;  1J2J B;  1IC8 A;  3BDD A;  2LF8 A;  4JX6 A;  1DGR M;  4WY4 A;  1SQQ D;  5J47 A;  2QQ9 A;  3I0T A;  2IYP A;  3NFQ A;  3GME A;  2R44 A;  3MD2 A;  1U2W A;  1SAN A;  4FX0 A;  2AXT H;  1PGO A;  1Y8R B;  2KLO A;  3BY6 A;  1P2F A;  2OV7 A;  2HQN A;  3IP4 B;  2LBF B;  2YIU C;  4MFD A;  4HJG H;  1W5T A;  2LR8 A;  4D1Q A;  3DCF A;  1SFC A;  1BDC A;  3BAS A;  5AW1 B;  3C7J A;  5TJJ A;  3L71 G;  4GO1 A;  1ETY A;  1IC2 A;  4ZZL A;  1X58 A;  3H1K D;  3CCV P;  1YE9 A;  1FYK A;  1P84 E;  2MYS A;  2OTK E;  4PGG A;  4I0B A;  1BJA A;  1TT5 B;  2IAI A;  4IL6 C;  1T3J A;  4QPO A;  3HTK A;  1LNW A;  1PJR A;  1GVJ A;  1WSU A;  4B3A A;  2XPU A;  2Y31 A;  4A6E A;  1Q82 Q;  1EXI A;  1IXS B;  3MHV A;  4EOT A;  3VMA A;  4Y33 A;  2M3A A;  2E7W A;  3M9Q A;  2W84 A;  2VBY A;  2XAF A;  3F89 A;  3D5L A;  5GAH J;  2IW5 A;  3P9I A;  4OIN F;  4ZYG A;  3L2U A;  3AE7 C;  5L3B A;  4HPQ A;  4WX9 A;  2QIW A;  3L73 J;  3CUQ B;  3GTQ J;  2M3E A;  5GTI C;  2EH3 A;  4BH9 A;  1FIA A;  3HGG A;  2BY3 A;  2PI0 A;  3FHN A;  5F0H A;  2M45 A;  3BCC D;  2X0L A;  1BBY A;  3FBI B;  3QU6 A;  5E17 F;  3LW5 J;  3I5C A;  5LHI A;  1DEE G;  2F48 A;  3DWL E;  2L5Q A;  2VKE A;  4BXX J;  2I1K A;  4BBR J;  5CKT A;  4EV0 A;  3MFK A;  4NQW B;  3KYL A;  3OWT A;  1Z91 A;  2Y0M A;  2FBI A;  1XGN A;  1G3W A;  1QQI A;  3IWF A;  3K4C A;  4LIU A;  3RCO A;  4XRM A;  2LBF A;  2NS0 A;  4ENK A;  1K4T A;  5KAF E;  1UIX A;  1U8B A;  4AIK A;  2LVS A;  2JWT A;  3L72 G;  5D4R A;  3R4K A;  2F5D A;  3KZI C;  3G9R A;  3K2A A;  3CX5 H;  5KJ7 D;  2LTP A;  1S1C X;  2Y0C A;  2CW0 F;  4I2O A;  4L74 A;  3CWB J;  3ABT A;  2PLY A;  4BXF A;  4H44 D;  2F5F A;  3OA7 A;  2ZNY A;  1AHD P;  2HPI A;  1JTY A;  2GBY A;  3K70 C;  4IO9 F;  2IS2 A;  2BGC A;  3RK2 D;  2H1K A;  4CCJ A;  1AVO A;  3CC2 P;  1I1S A;  3HB9 A;  1IN6 A;  2LKP A;  1TT0 A;  4DOZ A;  3IRQ A;  2KLU A;  1IGN A;  4Q48 A;  4JQ0 D;  3AFH A;  3PL8 A;  2QA4 P;  1FSE A;  5F0C A;  3B5N C;  1LDD A;  4MO7 A;  2M4K A;  2LKX A;  1H8A A;  2IS1 A;  5K5R A;  4I02 A;  2X6X A;  3BR1 A;  3JRC A;  4BQO A;  3LSJ A;  1BCC D;  2B89 A;  2YO2 A;  4ENJ A;  1FZE A;  1O3S A;  4I7H A;  3CUQ A;  3TED A;  3FKI J;  1I3A A;  4L9J A;  2LK2 A;  3SDG A;  3KEY A;  3WE3 A;  4NC6 A;  3KYQ A;  1Q1H A;  3GCM A;  3I64 A;  3BZK A;  2H27 A;  1KB9 I;  3KHU A;  1WJD A;  4BJ6 C;  2QJK C;  3TOA A;  2XAU A;  4II2 A;  1BGY E;  4ASW A;  2A69 F;  1KIL E;  5DJU B;  2P6S A;  2Y30 A;  2X48 A;  1X8Y A;  4HNU A;  4LMY A;  4XIC A;  1JCD A;  1T08 B;  1YI2 P;  4RGR A;  4N9I A;  3GZN B;  3GLX A;  4NQW A;  3CC2 I;  2E1O A;  5EGO B;  1IK9 A;  1XCV A;  3FDY A;  3ZN1 A;  1BOB A;  5E1W A;  2IFM A;  2ZXX A;  5DV5 A;  2QA4 I;  2C9L Y;  2K37 A;  4B09 A;  4P55 A;  3ZQG A;  1QNT A;  3WU2 E;  1JY2 O;  1IF1 A;  1B9M A;  1YQ3 C;  3I56 P;  1VF9 A;  2WAQ A;  3K1M A;  3EYY A;  3SWK A;  1KD1 Q;  1A5J A;  2A06 D;  2WTE A;  1NTZ G;  2M3B A;  4TLF A;  4DOJ A;  3PUB A;  5CJ4 A;  4H13 D;  1R5L A;  9ANT A;  2O01 J;  3OYI A;  3S2H J;  5M3F J;  1ETQ A;  4D6T E;  3L70 J;  2E71 A;  3J80 K;  2DFH A;  1JUP A;  3HRT A;  1MW7 A;  4I0A A;  2CK3 H;  3CCU P;  4ZTJ A;  4Z6Y A;  1EQ7 A;  3TDK A;  1YI2 I;  3SFZ A;  4RLQ A;  5CQG A;  1BM9 A;  3K6G A;  3KP3 A;  1B59 A;  2BCC G;  1I27 A;  4JYK A;  1WHU A;  3KEQ A;  4R4L A;  1WH7 A;  4QLC U;  3N7N A;  1ORK A;  2FA5 A;  3L73 D;  2WAQ N;  4E4H A;  2KIS A;  1KN7 A;  5H6Q A;  1ZAO A;  4G6T B;  2QJY C;  3O3K A;  1Z6R A;  4CA0 A;  1P84 H;  3AE5 C;  3I56 I;  1FP2 A;  4U0W A;  2B87 B;  3W2A A;  1JO5 A;  2JDI H;  2JUG A;  1BW5 A;  2W90 A;  4FT8 A;  2LXB A;  3VMX A;  2IFN A;  1SAU A;  4OU0 A;  2QEN A;  4U3F G;  2XUB A;  4RA2 A;  3ULQ B;  2ISY A;  3HOX J;  5AVQ B;  1OMI A;  3H0G J;  4TV7 A;  4ESF A;  1G4D A;  5B5E E;  1MD0 A;  1KMI Z;  3D70 A;  1YJ9 P;  1ZKG A;  1YYC A;  2R7Z J;  1T6S A;  5EGO A;  2X6O A;  3H3Z A;  3CCU I;  1EDJ A;  3LWF A;  2Q7C A;  1V5G A;  3OS1 A;  2WPR A;  2VQG A;  1GD2 E;  3H35 A;  1NJI Q;  3GX4 X;  4HOB A;  3C1D A;  2MH2 A;  3CX5 D;  4WF2 A;  3CWB D;  3S2W A;  1RNL A;  1FSH A;  3ZP5 A;  3JRI A;  2NPS B;  4Y4R A;  4Q4Z F;  4RAG A;  4XFJ A;  2FNA A;  3USS A;  1P6R A;  3H9G A;  1JUN A;  3W3C A;  3A0H H;  1YHQ P;  3S14 J;  4UB6 H;  2EFO A;  3JCU C;  3TO7 A;  2JQ7 A;  1D5V A;  5CCH A;  5DUI A;  5IP7 J;  3E6D A;  1FZC B;  3QAH A;  1X1P A;  1JE8 A;  4G6Q A;  2DPU A;  3ZR8 X;  4Y13 A;  3HIF A;  5E8I A;  2R92 J;  3IUO A;  1HJB A;  4LG3 A;  3HDD A;  1BR4 A;  3RDI A;  4GOE A;  1KQ0 A;  3RPQ A;  4OAZ A;  5FKM A;  1YJ9 I;  1TQM A;  1FEX A;  5C4X J;  1M1J C;  2CQX A;  1QZE A;  4OAY A;  3DP7 A;  1CGP A;  5DD8 A;  1QLE D;  4IOI H;  1OCZ H;  2W7N A;  1L4A B;  2ZXI A;  1OZH A;  3MGN A;  2XKP A;  1QGK B;  2O8K A;  4AU7 A;  2B87 A;  2R7R A;  3GF7 A;  3JSV C;  5M3M J;  5IT9 Z;  2GXB A;  1LTA C;  1GMJ A;  2W6A A;  1MMG A;  2JRT A;  3ZMD A;  5FRM A;  1AU7 A;  3V7S A;  3ISP A;  1H88 C;  2XVC A;  2GM4 A;  1QU3 A;  2VQL A;  3OYC A;  1LTB C;  2QSI A;  1SQB J;  4WBA A;  2JSP A;  3FBN B;  3VOE A;  2W83 C;  2H8W A;  1LVA A;  2KZI A;  4H44 B;  1VQ9 P;  1W5S A;  4BDY A;  1PP9 E;  1TTY A;  2CFO A;  1WRJ A;  2YXQ B;  4ZYA A;  3RK2 B;  4UB8 C;  4HLY A;  1ETO A;  2ZB9 A;  3OSG A;  2NPS A;  1TL8 A;  1N77 A;  1POG A;  4PV1 C;  2Y0S N;  1HSJ A;  2PP6 A;  5FLX Z;  3R2P A;  1LEB A;  2VOP A;  2EIK H;  2HG5 D;  3S3N A;  3JTG A;  1LTI C;  4R8H A;  2WSE H;  2P8T A;  3L70 D;  1U5T B;  4LJZ F;  1FZC A;  2Z33 A;  5KAI E;  5CQE A;  5E1Z B;  4G94 A;  2DOD A;  2O9L A;  2NOG A;  5F1J A;  4I6M C;  4N3Y B;  4L9N A;  5IY5 H;  3SWY A;  1FC2 C;  2MJZ A;  5H6R A;  3K1N A;  3GWZ A;  3GFM A;  2W48 A;  1SQB K;  4AUX A;  2IJL A;  5E8G A;  4MEX F;  2R7V A;  4HYE A;  5L3F A;  1A02 J;  4HZF A;  4M9Z A;  2XKM A;  3BG9 A;  2M0C A;  1OIP A;  1ZXG A;  3KP7 A;  3LID A;  4K2E A;  2P81 A;  3H1J G;  2DOE A;  4RBO A;  1VQ9 I;  3VYT B;  3AEC C;  4I6Z A;  1L4A A;  5HLG A;  3WTY C;  1BN5 A;  1GT0 C;  3L72 J;  5BVZ A;  2CJJ A;  3BAT A;  2K9L A;  2Q0O A;  1BA5 A;  2WTY A;  5D5X B;  2E76 B;  1PFI A;  2LF7 A;  1UG2 A;  4WXD A;  3DBH B;  3KPE A;  3QPH A;  2R7D A;  2P7C B;  2A68 F;  2IBZ I;  3LOC A;  1R36 A;  1MSE C;  2HEO A;  2E74 C;  1T0F C;  1R71 A;  3BG6 A;  5KJ7 A;  5GTH H;  4CGZ A;  3H92 A;  4KFC A;  1JMB A;  3IKV A;  1FWZ A;  4CCN A;  3EFG A;  4C7N B;  2MLG A;  1QGP A;  2L5G B;  5J1Y A;  4BAY A;  4IKF A;  3V8L A;  4EI2 A;  3SZG A;  2Z3Y A;  3BJA A;  3MMY B;  5DCM B;  1TWH J;  4UUV A;  1IFI A;  4IRH A;  4H13 B;  2CW7 A;  5ICC A;  2K3P A;  4XN3 A;  3JRA A;  3DTK A;  5IPA A;  4O9B A;  2C0X A;  3Q2Y A;  2JA7 J;  3KZY A;  3P8C E;  2EV0 A;  5JR3 A;  4IQJ A;  3A0B E;  3PH0 A;  4I7Z C;  2LD5 A;  2EFP A;  1G1J A;  1VL2 A;  3L74 E;  2NOJ B;  3LSG A;  3GBG A;  1U5T A;  3CXH D;  1MBF A;  2NVY J;  1BIB A;  4M9X A;  1NTM E;  1V54 H;  1AA7 A;  4D5F A;  1VQ6 P;  1YX3 A;  2F6C A;  3ZQI A;  1BR1 A;  3IAO A;  4CYC B;  4GXO A;  1Z3Y A;  1TP4 A;  2BEO A;  5JLX A;  4ESB A;  2FE3 A;  2EZK A;  5FJ8 J;  4IHS A;  1KQ8 A;  2GLO A;  1KQS O;  3DU5 A;  3JRE A;  2VKV A;  1J75 A;  5DM7 F;  2OQG A;  4ETS A;  2HR3 A;  5TGT A;  2DQR A;  3ZQF A;  4KIT B;  2R0Q C;  3IR9 A;  3PQK A;  1ULY A;  3CLQ A;  1NTK E;  1N78 A;  4WCG A;  2P0W A;  1ETX A;  3AAF A;  3F3X A;  1JXS A;  1LTJ B;  4EMS A;  4C9Y A;  1WCM J;  1USD A;  4CSW A;  2Z9O A;  1MZ9 A;  3KXD A;  2IPQ X;  1QRY A;  3QP6 A;  1XMK A;  1SQB D;  1X2M A;  2WMM A;  2V7Q H;  5JI6 A;  2MD5 A;  4AUW A;  4GDO A;  4C7N A;  1U78 A;  1R4M B;  3DPT A;  2FXO A;  2LH9 A;  1VQ6 I;  4PD4 D;  2F5C A;  1F9N A;  4JQF A;  2IX7 C;  5DCM A;  3HBL A;  5DTD A;  1GK6 A;  4E7J A;  2DA2 A;  3DEE A;  4HV6 A;  4DYR A;  3LSP A;  4KIB A;  3S1Q J;  2FXA A;  5IYB J;  4BXL A;  3MCZ A;  1Y0N A;  2J5P A;  1K05 A;  2BY1 A;  1KQG B;  2X6W A;  3GTM J;  1K83 J;  4MQV A;  3MUD C;  4P1W A;  2OF7 A;  3IH2 A;  1WI3 A;  1QBJ A;  1ZRF A;  2QM7 A;  2ME0 A;  5APS A;  4HB1 A;  5EJC A;  3CO7 C;  1P7J A;  2EPF A;  3EDP A;  3IH3 A;  1OYW A;  4ZTF A;  4S04 A;  3AL0 C;  2KRH A;  2XKO A;  4Q5S F;  3BRV B;  4N6J A;  1TU3 F;  2HPC B;  2V9K A;  3VYI A;  3KQG A;  1G3Y A;  2E1N A;  1R1V A;  4QTR A;  4CYC A;  1RKW A;  2ZXJ A;  4II3 A;  1AKH B;  1DDN A;  4AM3 A;  3OYA A;  4JOM A;  1SQQ E;  2WT7 B;  3MKW B;  4IHW A;  3KPH A;  1VQ5 P;  2DA5 A;  1RE3 C;  1LQ1 A;  1P92 A;  3I71 A;  2KL4 A;  1WJ5 A;  2KP8 A;  2N8G A;  2MAB A;  1P9Q C;  1HBW A;  3MIW A;  2EQR A;  4LGW A;  3QYE A;  1YRN B;  1BI0 A;  4OIQ F;  2C6Y A;  4YIR X;  4EYY Q;  3S32 A;  1Z1D A;  1W1W E;  3QOE A;  1LTJ A;  3H1K E;  1FX7 A;  3U1K A;  2MLK A;  5KAI H;  4ZJZ A;  2UXN A;  1P7I A;  4D7M A;  2L4A A;  1ZN5 A;  2QGU A;  2C9N Y;  1ZK8 A;  4GYG A;  2W6B A;  4JK1 X;  4HH2 A;  4FE4 A;  2CPS A;  4LC1 A;  4BQN A;  5E20 A;  4CDG A;  2B63 J;  5FLM J;  3B73 A;  3QWL A;  2ZSH B;  2HOT A;  5J1R A;  1R1T A;  2SPZ A;  1YYV A;  4GT1 A;  1VQO P;  4UNO A;  1TWA J;  3ERM A;  2KIQ A;  4B47 A;  1IAW A;  1FBU A;  4HSR A;  2A45 H;  1QL1 A;  1L0L G;  1MJ9 A;  1BR2 A;  1AQT A;  2XDJ A;  3HTS B;  1GTW A;  1QHH D;  2WV0 A;  3O6B B;  3W2V A;  1SQP G;  1SQV K;  1QPI A;  1H89 A;  4XBF A;  3ESW B;  3CLO A;  2HDC A;  3TBI A;  3ZQ7 A;  3BCC E;  2I5U A;  5IYC J;  3L1P A;  1OX3 A;  5E79 E;  2RVC A;  2HPC A;  1R23 A;  2ZYG A;  4IF4 A;  4K3A A;  4IFF A;  1VQK P;  2R5D A;  1AKH A;  1O7L A;  4N9H A;  2A5W A;  4FET A;  3QWO C;  2BEQ D;  3D0S A;  4XKV A;  5B66 E;  3K4L A;  2WT7 A;  3PSF A;  1RF1 C;  1BOA A;  5KLV E;  3JRH A;  5K5G B;  1VQO I;  2VUM J;  3QU3 A;  2DMU A;  1N2D C;  2QM8 A;  2JZY A;  1EH6 A;  4EJW A;  3OYD A;  2A3S A;  1YIO A;  3OIO A;  1YRN A;  1T6A A;  1PIX A;  4QMA A;  1W0T A;  4LGD E;  2XGX A;  1LFU P;  1SQX G;  3L75 G;  1GL2 C;  3BZC A;  2IBZ G;  2FYU K;  3MD0 A;  1JTH B;  1LTS C;  3BR5 A;  3F8N A;  1T2K D;  3DBL B;  3GXO A;  5LD2 C;  2OAR A;  5APU A;  1B6A A;  1BIA A;  1FY7 A;  5FKL A;  3REO A;  2HVS A;  1QX8 A;  3FM3 A;  1KYW A;  3TF5 A;  2L4M A;  3V4G A;  5BOX A;  3AEF C;  2AQF A;  4H0L D;  4BHB A;  1VQK I;  2LY2 A;  4YG2 F;  2FD5 A;  3MAJ A;  5KNL A;  3J81 Z;  2E75 B;  2DMT A;  4PJ0 E;  2OTL P;  4DYQ A;  1KYO I;  1FMV A;  3H1I E;  2UXX A;  3V4Q A;  3FHZ A;  1XDU A;  3A01 B;  1RUN A;  3P7N A;  1SVM A;  3H1J J;  4YII A;  1BCC E;  3II6 A;  3JAM Z;  3Q9V A;  4L73 A;  2R7W A;  3LQR A;  1CF7 B;  1SD7 A;  3OYK A;  3SDB A;  3IRR A;  3E7K A;  2R7X A;  4BE2 A;  1RUO A;  3W68 A;  4PV1 D;  1VPC A;  5GAG J;  4QIW N;  2EA2 A;  3HD7 D;  3AG2 H;  1B1B A;  2D45 A;  1FPQ A;  1ZRT D;  4GIF A;  1KU3 A;  3IKT A;  3ZQC A;  2O01 N;  1K73 Q;  4PJL A;  4PJM A;  1LT9 B;  1JI8 A;  2E2I J;  2AXT E;  3X2Q H;  2VQH A;  1K61 A;  2ZT9 C;  2EZH A;  1FOW A;  2ZME B;  1C0W A;  4HNT A;  1JY3 P;  4KIC A;  2DA6 A;  2QJP B;  2EZL A;  2OTL I;  3NTN A;  1BC8 C;  4UVB A;  5D5W B;  2W57 A;  1S3J A;  3A2K A;  4JX4 A;  3AG4 H;  2ZJQ F;  3L37 A;  3TW6 A;  2CUE A;  5EF6 A;  1HKT A;  2O0Y A;  2ZJ2 A;  4FQG A;  1JTH A;  3V42 A;  3SZT A;  2A06 E;  1JEK A;  3H5A A;  1MUU A;  5AVT B;  5BU8 B;  4L5I A;  2BXZ A;  2KZJ A;  2VI6 A;  5JLW A;  4R1H A;  2G7H A;  1N7S C;  5H20 A;  3KZZ A;  3GF3 A;  1Y8Q B;  3DLA A;  1GU5 A;  1STZ A;  2VPL A;  4ASN A;  1G2C B;  2V79 A;  4A3M J;  2FBK A;  4BQA A;  4BE1 A;  5EG0 B;  3OYJ A;  3AEG C;  1RE4 A;  1SC7 A;  2MH9 A;  3M3Y J;  1K6Y A;  1KFM A;  1R22 A;  1FTZ A;  2K1A A;  1ETK A;  4L18 B;  5KVR A;  2CS3 A;  3CP2 A;  2HOA A;  3A01 A;  4IFD K;  2JN6 A;  3ZCO A;  3LQQ A;  2GWR A;  2WSC H;  1RI7 A;  1VF5 C;  3L73 E;  4C7R A;  1G6N A;  2A6H F;  1HW1 A;  2IA2 A;  1CF7 A;  1YQA A;  1UZC A;  2Y48 A;  5LGT A;  3E6M A;  2UV1 A;  2IZ0 A;  1WJA A;  3OYF A;  3H3U A;  1VFC A;  1OVV A;  5J4V A;  4IHT A;  1W5C C;  2R7T A;  3QRF F;  5FLX K;  4KMU X;  1PGJ A;  2OJE D;  5APV A;  1IZN B;  3AED C;  1FP1 D;  1I3Q J;  3EUH A;  1IDY A;  1QL2 A;  3K5B A;  1Z05 A;  4EIJ A;  5LEJ A;  4YRV A;  3BCB A;  2R7U A;  1LT9 A;  4A3J J;  2HYG D;  2ID6 A;  2D1H A;  2HLO A;  2ZME A;  2XF6 A;  1HF0 A;  2STW A;  2QSH X;  1YW7 A;  4E7L A;  3FZV A;  3CCJ P;  2WAD A;  3N05 A;  3CX5 E;  5KTB A;  3TO6 A;  1NU1 G;  2JJL A;  2KIK A;  1SMY F;  5AW4 B;  4ZYH A;  2XF7 A;  4BGD A;  4M3G A;  1LGH B;  5CMZ A;  2KHM A;  5TIS H;  1TWG J;  3S17 J;  3GFJ A;  1G2C A;  2RNJ A;  1ZG5 A;  4KYW A;  1BC7 C;  1U6G A;  4Y52 J;  5EG0 A;  5H2F C;  3OYH A;  3K4K A;  5KLI C;  3FXK A;  2JWD A;  2V4J C;  2J5U A;  1S8N A;  4EDF A;  4AYB N;  4BQQ A;  4A5N A;  5A2Q K;  5CCG C;  3ML6 A;  4O5V A;  1D8K A;  4ITV A;  3L00 A;  3P9C A;  5JFR A;  3H1J D;  4HYT B;  2RV8 A;  4UHT A;  4XNF A;  1MBJ A;  2LY9 A;  2CV1 A;  3WTS C;  2DFE A;  1MZB A;  5L3G A;  3DBR B;  4F91 B;  3I58 A;  2HQR A;  4A12 A;  1KB9 D;  2POH A;  3B6A A;  3CCJ I;  2YS9 A;  5FKN A;  1VQP I;  2GZW A;  4A6D A;  4F93 B;  4AIJ A;  6PAX A;  2P7V B;  3JW4 A;  4IX7 A;  3CC4 P;  3BJ6 A;  4IQ4 A;  5E18 F;  4Z1M H;  3R0J A;  3H0D A;  4K35 A;  3I4M J;  1IFN A;  3WG7 H;  1XMX A;  1LTG C;  4U0V A;  3RTR A;  2VOD A;  2KRF A;  4IOC F;  2LFB A;  1Z67 A;  3GO5 A;  2WY7 Q;  1JY2 N;  3A3Y B;  1DU6 A;  3QH9 A;  1LP1 B;  4UV8 A;  4AWX B;  1M1J B;  2OYI C;  3HKZ N;  2PEX A;  2JUC A;  4A7P A;  3V2P A;  4D9J A;  2GOM A;  3OS0 A;  3F8M A;  2DO7 A;  2DK8 A;  2KJB A;  4E7H A;  2LG4 A;  4FAS D;  2K40 A;  1X0T A;  2H89 C;  1NK3 P;  4XRS A;  1IO2 A;  4IEJ A;  5BU5 A;  1L0L J;  4BWN A;  1RHZ B;  4AIH A;  2XGD A;  1PGP A;  1RIO H;  4H0L B;  4JBZ A;  3RKQ A;  4F3Q A;  4LLG F;  4D5C A;  3CCY A;  5ERI A;  3BTC A;  1SQP J;  5C39 A;  5B3S H;  1K04 A;  3CC4 I;  3PRJ A;  1MBG A;  3CJT B;  2LP0 A;  3CJR B;  5BMZ A;  3RI4 A;  2CUF A;  1XG1 A;  1PP7 U;  2JVH A;  1EXJ A;  3CL3 D;  1IO4 A;  2CWE A;  3HSR A;  3NAR A;  2NRG A;  3H1H E;  3Q0U A;  2YKQ A;  4PV1 B;  1IW7 F;  3LA7 A;  2QWW A;  1Q90 D;  1OW8 A;  1B4A A;  2J58 A;  3FXU A;  3HD7 B;  2KT0 A;  2XV4 S;  3TGU E;  3FXR A;  4DYC A;  2GXA A;  2QEX P;  3F0C A;  2KRC A;  5DS9 A;  1M7L A;  1LDK B;  1GW3 A;  4EJT A;  1L0N J;  2E1M B;  2HKX A;  2JWA A;  1FZG A;  3AEB C;  1FT9 A;  4QSH A;  2I8D A;  4C2U A;  1SQX J;  3L75 J;  4A3B J;  3PP5 A;  1V5F A;  1WH5 A;  5D4S A;  1MDM B;  2P10 A;  2XZR A;  5CBN A;  1UCR A;  3HRU A;  4A3F J;  2JPC A;  1OW7 A;  3G1M A;  2XAS A;  3K4N A;  4HDV A;  3FIS A;  1LP1 A;  3T8T A;  2VLA A;  1D0Z A;  1M1J A;  4C46 A;  3Q3D A;  3RZD J;  1W0U A;  2K86 A;  1T2K A;  5LHG A;  1FOX A;  1S5L H;  3W6J B;  4ON0 A;  2XNX A;  4NPD A;  4A3C J;  3D5S C;  5TRD A;  2JPB A;  3OYN A;  3HUS C;  1W7P D;  1QPM A;  1V5E A;  5BPD A;  2PMZ A;  5J8C A;  1L0N K;  3ECH A;  3OAK A;  3L09 A;  1XPX A;  2R7S A;  1SQX K;  5EEG A;  4FX4 A;  3CCV I;  4XKB A;  3A0H E;  3HTU A;  2QEX I;  2KIF A;  3FWL A;  3LW5 H;  4GKG A;  4UB6 E;  2NYX A;  4NUB A;  3C9I A;  1R49 A;  1ZN2 A;  4XLC A;  3LA3 A;  3S16 J;  3Q1M A;  1IG7 A;  1GL2 D;  1DD4 A;  3CXH E;  4FE7 A;  1XX5 A;  2F5V A;  3MVP A;  1UAA A;  1FBQ A;  2OQR A;  1OW6 A;  5IOZ A;  5LLQ A;  2DJN A;  5K7F A;  2P5V A;  5ICF A;  5IT3 A;  3BLY A;  2XB0 X;  3RK3 D;  1XTA A;  3WG9 A;  3PSI A;  4RMN A;  4RS8 A;  3MTU E;  3HD7 A;  1BGY G;  2GOX B;  2PMZ N;  4HNV A;  2N1T C;  1K4S A;  2K02 A;  4XSX F;  4IHV A;  1YLF A;  2K3F A;  4FTH A;  2CMP A;  1PV3 A;  4XMY A;  5HVQ C;  1LEA A;  4G9Y A;  4LIV A;  3L2Q A;  2KYV A;  1G2H A;  1ZLJ A;  4DGW B;  3GHG B;  4X1E A;  5DCF A;  1MDM A;  2YKO A;  3HRM A;  2DA7 A;  3QPT A;  4BJ5 C;  4S0H B;  4UVA A;  3L36 A;  3S4R A;  3OL3 A;  2XF5 A;  1SQB E;  1WGX A;  2B9S A;  3I53 A;  3TKY A;  1R5I D;  5TJH A;  3OY9 A;  3SFI A;  1NGM B;  4PD4 E;  3SEQ A;  4B3X A;  1IXC A;  2RQP A;  2R3S A;  3J7A Y;  2NNN A;  5LRS A;  1J09 A;  3J7Y J;  4BNC A;  1EA3 A;  2ECB A;  3HJE A;  4D6T G;  4L75 A;  2DXI A;  2ZT9 D;  3L7W A;  2MKV A;  5KAF C;  4GOD A;  4YPC A;  2JMW A;  1IRX A;  3IH4 A;  2JA5 J;  2ZVO B;  4YTP C;  4AQR D;  3F22 A;  4Q47 A;  1SQP D;  2P7J A;  2HU9 A;  3RBZ A;  1YJW P;  2VIX A;  3I59 B;  1WJB A;  5AW8 B;  5KKZ B;  3KYD B;  3R61 A;  2M4G A;  2X1E A;  4A0Z A;  5IP9 J;  4M3L A;  3RJP A;  2P5K A;  3KP5 A;  3HGY A;  3L2C A;  2LMD A;  1CW5 A;  5J3L A;  5HS9 A;  3ELK A;  2GA2 A;  4KHX A;  2H94 A;  2ELH A;  2ADU A;  1E3H A;  3OYM A;  4DBR A;  1N7S D;  3U9G A;  2HKO A;  2OA4 A;  1H0T B;  5J4Y A;  2WWW A;  3GYH X;  4NPE A;  2D5V A;  2Z5I A;  3P9K A;  3O8Z A;  2O03 A;  3J81 K;  1G59 A;  4OWR B;  4C2T A;  1L0N D;  3M8F A;  3EUA A;  4XOR A;  1SQX D;  3T8R A;  1VQ4 P;  4XK4 A;  3T1B A;  3AL0 B;  2IBZ D;  3CMA P;  1VI0 A;  1OR7 C;  2KZV A;  2EB7 A;  2O01 H;  5AW6 B;  2KZG A;  3MKL A;  1JKP C;  1NU1 J;  1VF5 D;  3GHG A;  2R5B A;  2A6T A;  4NC7 A;  1QA6 A;  3IFM A;  1A35 A;  3CCL P;  4N78 E;  1YJW I;  4HEA 2;  2E5T A;  2XGC A;  1O57 A;  5GTH E;  1GXQ A;  2KNC B;  4R79 A;  2IGN A;  4IL6 H;  2CQQ A;  1JY3 O;  1KIL C;  4XSZ F;  2DDB A;  1N75 A;  3RPU D;  1OCC H;  1JCC A;  3EPZ A;  4U7J A;  3HEF A;  4G12 A;  5HDN A;  4N0B A;  1J1D C;  1JMM A;  5EZH A;  2CYY A;  2PMU A;  1LNQ A;  3NEU A;  1RF0 C;  3CD6 P;  5DDG A;  2E35 A;  1LPQ A;  3H3V K;  3WU2 C;  2Q2E B;  4EGZ A;  4I76 A;  1NU1 K;  3I59 A;  4OWF A;  3IL2 A;  1DUX C;  1VQ4 I;  2XRL A;  3ASO H;  2X9D A;  3CMA I;  1N86 A;  5GTI H;  2N9Y B;  3EQ2 A;  1KQF B;  3WTX C;  3CCL I;  3GTG J;  2RMZ A;  2HTS A;  3VOP A;  3S1N J;  3CI9 A;  5JHF A;  2H1L A;  1MJA A;  3A4C A;  4N4N B;  4BDZ A;  4A3E J;  1J1E C;  1ZP0 C;  1KGS A;  3VEP A;  1Z6T A;  2K9S A;  3I55 P;  4RB0 A;  4L9V A;  5JHU A;  1H0T A;  1FDO A;  1HDD C;  4OGQ C;  2KDZ A;  2D2C D;  1ETW A;  2P2U A;  2L9V A;  2PFB A;  2WZ7 A;  2H7H A;  2R4G A;  1R00 A;  1R6R A;  4H0E A;  5CCG D;  2JKV A;  1FOY A;  1OQY A;  5CVJ A;  3GEZ A;  3TK1 A;  4WWI A;  1EJ9 A;  2EA4 A;  4I01 A;  3CD6 I;  2ELJ A;  4S05 A;  4CCM A;  3KZI H;  1PP9 G;  3CXH H;  3M1E A;  2GIZ A;  4WY4 C;  3OOP A;  2KNC A;  3TGN A;  1W7P B;  4HQM A;  3PIO F;  3L35 A;  5JVG F;  3M0D A;  1Z0X A;  3E1R A;  2DI3 A;  3TDZ C;  4Y99 C;  2FJ1 A;  3CF2 A;  4O3M A;  2BYV E;  5B5E C;  5ICE A;  2OGU A;  1SFC C;  2ESH A;  4EM1 A;  2DMQ A;  2RNG A;  3GFL A;  5JVT A;  3I55 I;  2WA0 A;  4KJM A;  1YIJ P;  2DT7 B;  2K5C A;  3HZJ A;  3I5U A;  1IDZ A;  2Y0S A;  1KU9 A;  2QKM B;  3L71 J;  3NMD A;  4XM3 A;  2Q2E A;  3MQ0 A;  3RIR A;  3F8B A;  3SXY A;  1Q81 Q;  1ONV A;  1LFP A;  1ON2 A;  2VPR A;  1YHQ I;  2JO1 A;  3ZQH A;  2QG4 A;  2FFD B;  2ZBK A;  5L8R J;  2GQQ A;  3HUG B;  4PZJ A;  4BU2 A;  1NG6 A;  1DEB A;  3RK3 B;  2QVO A;  1YTZ T;  1LTT C;  3GLM A;  3S8P A; 
#chains in the Genus database with same CATH homology
 2KL4 A;  1WJ5 A;  4U87 A;  2MAB A;  1P9Q C;  4PJJ A;  2LXC B;  4J01 A;  2PJR B;  3VYS B;  3QYE A;  1LVK A;  1X4O A;  3PNV A;  4EYY Q;  3RQ4 A;  4XKC A;  3S32 A;  2LY1 A;  3QOE A;  3C2H A;  3D5R C;  4ZJZ A;  3ONQ A;  4XKW A;  4CUG A;  4BUP A;  3L2R A;  1D0X A;  4BQN A;  3HXL A;  4CPG A;  1ZW0 A;  2R7Q A;  2ZSH B;  2SPZ A;  2V6E A;  2P58 A;  3OS2 A;  1X1B A;  4GRI A;  2MC4 A;  2QRX A;  4B47 A;  4HSR A;  2IS6 A;  3DTE A;  2VQC A;  1BR2 A;  3VWB A;  2X6Y A;  1QHH D;  1EDL A;  4PFP A;  3EUH C;  3VSL A;  2K9M A;  4HG2 A;  1UEL B;  3W2V A;  5HNF A;  5CBO A;  2M5A B;  2Q1Z B;  2V7F A;  3DQV C;  4ZC3 A;  2W4S A;  3DPL C;  3TBI A;  2JA2 A;  2R7O A;  4KJZ A;  4KIS A;  2LYC A;  1OLT A;  1OVU A;  4K3A A;  1D1C A;  2CV0 A;  1BDD A;  4DJA A;  2VAS A;  2A5W A;  4XLF A;  3PNY A;  4FET A;  1SS1 A;  2M0B A;  4XKV A;  3QWO C;  3K4L A;  3H5N A;  3PSF A;  2Z1D A;  1QHG A;  4ZDP A;  5DJT B;  4PJN A;  2BVM A;  2KI7 B;  5K5G B;  4CCO A;  3LMM A;  2FUG 2;  2W00 A;  3K10 A;  3LSI A;  3OYD A;  3ZGK A;  2PJR A;  3LSM A;  3TMO A;  5HLT A;  1WJE A;  2XC7 A;  1FMW A;  4RLF A;  2RQQ A;  3CES A;  3HOS A;  2AQE A;  1Z3X A;  3RSN A;  4E6K G;  1Q2N A;  5LD2 C;  4H4K C;  2HVS A;  2KS1 B;  5EFW B;  3ZXS A;  4B43 A;  4YEL A;  4ANJ A;  1DQU A;  3TL4 X;  2L2O A;  4RM3 A;  2AQF A;  3F9K A;  3HL2 A;  3DU6 A;  3H9J A;  3K4J A;  2LY2 A;  2X51 A;  5KNL A;  1MMN A;  2M0M A;  3K70 D;  2CH0 A;  4F52 A;  1FMV A;  1MNE A;  2XDV A;  2IXS A;  1MND A;  2VKD A;  4B44 A;  2R7W A;  1DGR M;  2V26 A;  3OYK A;  3E0J B;  3SDB A;  2M5A A;  2R7X A;  4BE2 A;  4QPQ A;  3VSK A;  3MD2 A;  2R44 A;  4LIT A;  3SEZ A;  3L2V A;  1U7M A;  2KLO A;  2B88 A;  2OV7 A;  2LBF B;  3IP4 B;  4HJG H;  2BVL A;  2DJI A;  3M1C A;  4D1Q A;  1BDC A;  4BAC A;  5KHD A;  4PJL A;  4PJM A;  1JI8 A;  2VQH A;  1YE9 A;  2OTK E;  2MYS A;  4PUS A;  4HNT A;  3OOU A;  4X0G A;  4HRI A;  4XLE A;  3SYT A;  1S3J A;  3A2K A;  4QPO A;  1PJR A;  1G8X A;  3DKY A;  2VJI A;  3V42 A;  4MLO A;  2LRE A;  3MHV A;  3H5A A;  4Y33 A;  2M3A A;  3LSH A;  2KZJ A;  4BEH B;  1EDI A;  3DLA A;  2X1C A;  4YEJ A;  3D5L A;  2VPL A;  3L2U A;  4BE1 A;  3OYJ A;  4HPQ A;  1X4P A;  5FRN A;  2MD0 A;  2DT6 A;  1K6Y A;  1WJC A;  2CS3 A;  3FHN A;  3CP2 A;  3FBI B;  3ZCO A;  4Y3O A;  1DEE G;  5CPR B;  3DWL E;  2L5Q A;  3ZRG A;  3ZDM A;  5CKT A;  2VXD A;  2UV1 A;  4J00 A;  1WJA A;  3I3L A;  3OYF A;  4NQW B;  4NC8 A;  3KYL A;  1OVV A;  3U21 A;  1X19 A;  2RRE A;  1U0J A;  3OWT A;  2R7T A;  3KX2 A;  1UG0 A;  4LIU A;  3K4C A;  3RCO A;  4IZZ A;  3K4B A;  2LBF A;  2MFZ A;  2L7K A;  2KUB A;  3L2W A;  3G2B A;  2OUM A;  3BCB A;  4YRV A;  2R7U A;  4MN4 C;  1OVR A;  2HNH A;  4BXF A;  2XF6 A;  2HPI A;  4E7L A;  3K70 C;  4F92 B;  2IS2 A;  2WAD A;  3N05 A;  4CCJ A;  2IS4 A;  1ZEL A;  3LFU A;  1TT0 A;  2WAF A;  1YX5 A;  4DOZ A;  2KIK A;  3NWT A;  4U7B A;  2XF7 A;  3AFH A;  3PL8 A;  4BGD A;  2KHM A;  2M4K A;  1S9H A;  4BEH A;  2LR2 A;  4BE0 A;  2IS1 A;  3S1K A;  2X6X A;  2B89 A;  4XLA A;  4BQO A;  4E7I A;  3S3M A;  3OYH A;  3K4K A;  2K3R A;  2JWD A;  2V4J C;  4XR6 A;  4BQQ A;  1NVO A;  1MFT A;  2E1M C;  3KEY A;  4HST A;  4ITV A;  1EDK A;  4PSX A;  1WJD A;  2X1D A;  4XNF A;  4BJ6 C;  2CV1 A;  1NG7 A;  2XAU A;  4II2 A;  1JM0 A;  4ASW A;  4F91 B;  5DJU B;  3VYR B;  4RM2 A;  1U7J A;  4HNU A;  2CW8 A;  2HQA A;  2HVR A;  4F93 B;  3AKZ A;  2RKL A;  4IX7 A;  4CZC A;  3FDY A;  4IQ4 A;  1BOB A;  3H0D A;  4K35 A;  5HNH A;  3M8J A;  3BCA A;  3RTR A;  2F4I A;  3DKX A;  4P5O A;  2WY7 Q;  1VZ0 A;  3HOT A;  2WAQ A;  1W36 D;  1LP1 B;  3C2G A;  4KT6 A;  4CCL A;  3OYL A;  2CUJ A;  2CV2 A;  4ZNC A;  4D9J A;  2GOM A;  2IGO A;  3PUB A;  3OS0 A;  4E7H A;  4C30 A;  2LG4 A;  3OR2 C;  4FAS D;  3OYI A;  1X0T A;  2W82 A;  2KDO A;  4B48 A;  4XOP A;  2E5N A;  1MW7 A;  3H9Q A;  4JBZ A;  4ZTJ A;  4F3Q A;  4GOF A;  4RLQ A;  5CQG A;  3EUK L;  3K6G A;  5C39 A;  3IAM 2;  4EAT A;  5LFA A;  4E4H A;  2IGK A;  3CJR B;  3HG9 A;  4AVZ A;  3PFY A;  2JVH A;  4G6T B;  4CA0 A;  4E7Z A;  4XQF A;  2B87 B;  3W2A A;  2VB6 A;  3OR1 C;  2JUG A;  2VJJ A;  2LXB A;  2VKH A;  1X1A A;  1SAU A;  3BC8 A;  3MZW B;  1Y6I A;  2CUZ A;  2KRC A;  1LDK B;  2E1M B;  3OYG A;  3OIP A;  2I8D A;  4C2U A;  2DOA A;  3OIQ A;  1EDJ A;  4ZMD A;  2Z16 A;  1V5G A;  3OS1 A;  1V5F A;  2VQG A;  5CBN A;  3PNT A;  3H35 A;  5HOO A;  3K4N A;  1LP1 A;  2VLA A;  1D0Z A;  4DIQ A;  2LRD A;  2UUZ A;  4Y4R A;  3H9G A;  1ERD A;  3CJQ B;  3W3C A;  4NPD A;  3D5S C;  3OYN A;  4HKZ H;  1V5E A;  4BJT A;  2PMZ A;  3ZR8 X;  2WY8 Q;  4CH7 A;  2HVQ A;  2R7S A;  4ASV A;  4XKB A;  3UR3 C;  2W1O A;  3IUO A;  4LG3 A;  2QVA A;  1BR4 A;  4NUB A;  4GOE A;  4NNJ A;  2ZXH A;  4XLC A;  4OAZ A;  1UAA A;  2F5V A;  1Z21 A;  4OAY A;  4IOI H;  2W7N A;  2E60 A;  2XSJ C;  2ZXI A;  1EC5 A;  2HDW A;  3CZ6 A;  3BLY A;  2DCE A;  3VYU B;  4AU7 A;  4DBQ A;  2R7R A;  2B87 A;  3IAS 2;  5FRO A;  3VDX A;  3PSI A;  4RMN A;  2V1N A;  1D1A A;  2GOX B;  3OYB A;  1MMG A;  4AYB A;  5FRM A;  2CMP A;  4XMY A;  5HVQ C;  4XLH A;  5KCM A;  2VQL A;  3OYC A;  1QU3 A;  4LIV A;  3HPG A;  3L2Q A;  2UWJ E;  4DGW B;  2JSP A;  3FBN B;  3QOD A;  2KZI A;  2HZD A;  4BDY A;  2ZSI B;  2CFO A;  4BJ5 C;  4N4O B;  4ZYA A;  3OL3 A;  2Q1K A;  2XF5 A;  3S93 A;  3MKZ A;  4NPF X;  2VXZ A;  1N77 A;  3OY9 A;  1DGW Y;  3SEQ A;  2KP6 A;  4B3X A;  2L9S A;  3FKJ A;  3J7A Y;  3S3N A;  1J09 A;  2E5Z A;  4ZDO A;  1EA3 A;  2DXI A;  3HKZ A;  5CQE A;  3UNG C;  4GOD A;  1IRX A;  2BOL A;  1FC2 C;  1WFX A;  2HU9 A;  2Z2S B;  2R7V A;  2VIX A;  1Z7L A;  1WJB A;  3S8P A;  3S3O A;  2WAE A;  2M4G A;  2X1E A;  2QKL B;  1ZXG A;  2X85 A;  3PJR A;  3VYT B;  3NWS A;  3OYE A;  1X1C A;  3OYM A;  4DBR A;  3QYF A;  3ZQQ A;  1H0T B;  2K9L A;  1MMD A;  4NPE A;  1GLN A;  3W2W A;  1G59 A;  4OWR B;  4C2T A;  2OC6 A;  3LSK A;  1T0F C;  3EUA A;  4XOR A;  1X1D A;  2WB1 A;  3BG6 A;  2VJ5 A;  2BW3 B;  3AL0 B;  2ZFU A;  1OR7 C;  2KZV A;  4ZDL A;  4BL0 B;  4CCN A;  2KMU A;  3BG7 A;  1JMB A;  2IGM A;  4CCK A;  2A6T A;  4NC7 A;  4F55 A;  3MKY B;  2HPM A;  4IKF A;  3I9V 2;  3SZG A;  4HEA 2;  3MMY B;  3LL7 A;  3DPU A;  1TZL A;  4PSW A;  2CW7 A;  1PYV A;  2K3P A;  4XN3 A;  4XN0 A;  4R79 A;  2IGN A;  3DTK A;  1LT1 A;  4IQJ A;  4PK4 A;  3PH0 A;  1N75 A;  3RPU D;  3E1S A;  3EPZ A;  2NOJ B;  3LSG A;  1E0E A;  3GBG A;  2M7A A;  1AA7 A;  1YX3 A;  1KON A;  2F6C A;  3DTI A;  1BR1 A;  2Q2E B;  4E7K A;  2O5R A;  1D0Y A;  1HA8 A;  1Z3Y A;  2VJ4 A;  1D1B A;  3DU5 A;  4XL9 A;  2L9N A;  2ZAE B;  4XON A;  5TGT A;  2HR3 A;  5JHF A;  4KIT B;  4N4N B;  3A4C A;  4BDZ A;  4XOT A;  1WJF A;  1H0T A;  1N78 A;  1MMA A;  2P0W A;  3OL4 A;  4BS9 A;  4C9Y A;  3HPH A;  3HC7 A;  4PFO A;  2R4G A;  1R6R A;  4CSW A;  3RGU A;  2BW3 A;  2WMM A;  1DP3 A;  4WWI A;  2LOO A;  3DPT A;  2WBM A;  2ELJ A;  2LH9 A;  4CCM A;  2JVG A;  2UWM A;  4JQF A;  2KQR A;  4E7J A;  3DEE A;  3FXE A;  4BXL A;  2M7B A;  2X6W A;  3CF2 A;  2LC2 A;  4P1W A;  1Y56 A;  3FXD A;  3A1Y A;  2RNG A;  3OMY A;  4HB1 A;  2WA0 A;  4KJM A;  2DT7 B;  4ZTF A;  2K5C A;  1W36 C;  2KPM A;  2KRH A;  2Y0S A;  3AL0 C;  2QKM B;  3H5R A;  4XM3 A;  1Y47 A;  1T95 A;  2V9K A;  3QYB A;  3CMM A;  1LFP A;  4II3 A;  1LKX A;  2VL8 A;  3OYA A;  3CP8 A;  4JOM A;  3MKW B;  4BU2 A;  3HUG B;  3K4M A;  4E7S A;  1NG6 A;  1SFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...