2I8DA

Crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
b'GSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein of COG5646
publication title Crystal structure of an uncharacterized conserved protein of COG5646 (ZP_00384875.1) from Lactobacillus casei ATCC 334 at 1.69 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Structural genomics/unknown function
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2i8dA01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2i8dA02
1BDCA 2B87B 2QVAA 2LXBA 5C39A 5DJTB 2KS1B 1SS1A 1ZW0A 1H0TA 2M5AA 3FXDA 4HKZH 1OVUA 1JMBA 4HB1A 4BXLA 4GOEA 3FXEA 1Q2NA 3ZDMA 1Y47A 2QRXA 4WWIA 1ZXGA 2KZIA 1X0TA 4IOIH 4CPGA 2LXCB 4ZNCA 5DJUB 1BDDA 5EFWB 1OVRA 2Q1KA 1H0TB 2M5AB 4HJGH 1LP1A 3MZWB 1FC2C 1U7JA 2P58A 2I8DA 2SPZA 2KUBA 2OTKE 2WMMA 1NVOA 5CBOA 4JBZA 2K3RA 1EDIA 2R44A 4NPEA 4K3AA 1EDJA 4ASVA 4ASWA 1LP1B 2KIKA 2LR2A 2RKLA 1DEEG 3PH0A 2KL4A 2JWDA 4KJMA 1S3JA 2KI7B 2B87A 1LT1A 1OVVA 1EDKA 4GODA 1U7MA 3RGUA 1JM0A 4MN4C 4GOFA 5CBNA 2KZJA 4EYYQ 2ZAEB 1EC5A 2UWJE 3S1KA 2HR3A 1EDLA 1MFTA 4NPFX 2B89A 2M0BA 3MHVA 2OC6A 4K35A 3QWOC 4ZMDA 2B88A 4NPDA 5K5GB
chains in the Genus database with same CATH superfamily
1ZLKA 5D5VB 3A7OA 2OYIB 4ZKPA 4LG0A 2K9MA 4RM2A 4HQEA 2LKSA 5K7FA 1B72A 3Q9VA 2FY8A 1BE3D 1GW4A 1R5ID 2MG4A 2Z2SB 3CO7C 2V1XA 3G9RA 4RMNA 3M9QA 2K9NA 2KK7A 3AEBC 5AW3B 1JKRC 4M6YA 3W2WA 4C3HJ 5AVTB 5J6XA 2NVXJ 4L9JA 5L3BA 3BTJA 4OINF 3P7KA 2D2WA 2XAGA 3H5AA 1SQBG 4WY4A 2E7XA 3HOXJ 4I7ZB 1Z6TA 3FXEA 1MBFA 2HVRA 3LQRA 3D1NI 2P5LC 3V2NA 1R58A 3WTWC 1N7SB 2E2IJ 2XPVA 3OR2C 2Y0DA 1CGPA 4IOIH 3H9JA 2WQYC 2HDDA 3TGUJ 3NAUA 2DT6A 3JREA 1UELB 2WPRA 5E3LA 3QYEA 5GADJ 1NKNA 4XN0A 2R3CA 1PYVA 3H1LJ 3V8JA 1F4KA 3PP5A 1WVRA 3VOEA 1MSFC 4UB8E 2CW0F 2YX7A 4B8XA 4EQQA 1FBMA 2YIUC 1S5LX 1LP1A 1JE8A 4HH2A 2Z99A 2KNCA 1KQ0A 4XOPA 4BXUA 1WJEA 2XSJC 4JX6A 3RSNA 1FYMA 2K9QA 3K70C 4A3MJ 2R7RA 3AEDC 2W4SA 5E79C 3SEZA 4ESFA 3L7WA 4OGQB 2A5YB 1S72P 2QKLB 5CKTA 3I59A 4P55A 3IL2A 4A3JJ 1ZMEC 2D1HA 1NTMK 1WPKA 2CW7A 5GAGJ 3DU5A 4H44D 5CJ0A 2ID6A 5AVUB 3VYRB 1B72B 4CSWA 1P84H 1L0ND 2FMLA 1LEBA 3B71A 3OL4A 1FDOA 4A0XA 2Y75A 1KILC 3R2PA 2JT1A 2K27A 1V55H 4ASVA 3PJSK 4IHXA 2IA0A 2JVGA 4BJ5C 1VQ7P 1X4OA 3HTSB 4YIIA 5AVZB 1NJIQ 3I5CA 1SFCC 3CMEI 3GTKJ 2Y2ZA 3VMYA 3M0AA 4WY4B 2L5QA 1K61A 3GEZA 1RF1A 1J2JB 2QG4A 1SQQD 1OPCA 5CJ9A 1M56D 1IK7A 2HOSA 1OW6A 1XPXA 4RB0A 1PGOA 2B7EA 1PP9E 3M8JA 2Q3EA 4GODA 2XF7A 4JOMA 3ITKA 2NRAC 3V4WA 2P6SA 4GOFA 3ZN0A 1JT0A 3S1RJ 1PJRA 2JPCA 1ETXA 4L18B 3OYJA 2R7SA 3FXRA 2KRCA 4V19K 1ZGWA 1Q90D 2FMYA 2AXTE 3AE9C 3WTYC 1P84I 2FRHA 3MP7B 5KCMA 1VQOI 1YITP 1FBSA 4XLPF 2KNCB 1PPJD 3AAFA 2MABA 4DYRA 3IAOA 3V2PA 1KU7A 2BXYA 2IXSA 1U9OA 3JCUC 3PIOF 1IFMA 2EJRA 1C0WA 3CXHE 4KT6A 2X6XA 4HEA2 4UB6C 3TGNA 2E1MC 3GW2A 3HBLA 3S2HJ 1YS7A 3JRGA 3GG2A 3OYHA 1WT6A 4BE1A 5TISE 4XBFA 1OFCX 5J47A 3U1DA 3LSMA 3QU6A 4HG2A 3FK6A 3U21A 5BMZA 4BNCA 1IC2A 2IZ1A 3LQQA 4UVAA 3H92A 2F5CA 1LQ1A 3VYIA 1FOSE 2CJJA 2BEZF 2EFPA 3D71A 5B5EC 3GTLJ 1SQVJ 3H9QA 1DDNA 3H3VK 1YJ9P 1L0LD 1W2EA 3HSEA 3F8FA 2GOXB 1N75A 3ONQA 2W83C 1VQPP 1YYCA 1ZREA 2ZSIB 4LC1A 4WK8F 3L2WA 2QJKB 1D3YA 2FF4A 2VXDA 3FXOA 2R7DA 3CDLA 3SDGA 2HPIA 1T08B 1HBXG 3FZVA 4B4CA 2VBXA 4CCNA 4NQWB 1RUNA 4JPZB 2QENA 5CVUA 1IXRC 1G1IA 3S4RA 5D5UB 1YYVA 1NHAA 1USSA 2FQ4A 2GBYA 2IJLA 2LYCA 2ZXEB 1RF1B 4IFDK 3I53A 4NBQA 5FKOA 2M8EA 4BBRJ 2HFED 3VB2A 1IRZA 1D8JA 2BCCJ 2H88C 2QSIA 3R6SA 5BNGA 1BI0A 3VMAA 1KC8Q 1YIJI 3CPWO 1BCCG 1ZLJA 2FOWA 3WGHA 3J80K 2KDZA 2ECBA 3WU2H 5CCGC 5KJ7C 2F4OB 2JWAA 4DCKA 4RJTA 1HQCA 2N9BA 2DA3A 1Z7LA 4E7ZA 2M5AB 3C3WA 2IS6A 5M1BA 1XTGB 2FYUJ 1S9HA 5E18F 2HYNA 3B5NC 3H1HJ 4D6TJ 2OCCH 1A6IA 4OGQD 4KIFA 5KVRA 3KP4A 3BDDA 4AVPA 4WX9A 4E7LA 3QRFF 1T6AA 2HG5D 1BR1A 4QPQA 1WH7A 4QWQA 5F0CA 1RE3A 1FSEA 2JUGA 3TGUD 1DD3A 1IFNA 2GIVA 2R7OA 3GZNB 4HOBA 1TLHB 1R5LA 1VQKP 1V54H 1T0FA 2F4MB 3H1LD 3EFFK 2NPSB 2LSOA 2DN0A 1BE3E 3IC7A 4HRIA 4Y3OA 2VBYA 2NVTJ 3ABUA 5ED4A 3OR1C 4UHTA 2AHQA 2RMZA 3V42A 1ORKA 1ZR2A 3JSVC 3OMYA 3VP9A 1STZA 3E0JB 1E0EA 3ABVC 3U59A 1N73A 3LW5J 3I5UA 3HKZA 1OW8A 3CQZJ 1M8OB 4GT1A 3D0SA 3HD7C 3LIEA 2FBKA 1IN7A 1JUSA 1JKPC 1XTAA 2YX4A 3HGYA 2Y0MA 4LOCA 4YELA 5B1BH 5HDNA 1GL2C 3TNUA 2JRMA 2ZJPF 1FX7A 3CCRI 5KAIC 4LD5A 3CC2I 3K4NA 4NC7A 3HRNA 2GA2A 1B9MA 1RIOH 2OCEA 4S0HB 3TK1A 1Z56A 3EWKA 2F5VA 2KS1A 1UG0A 4KJZA 2NAZA 5E8IA 5CCHC 3V4QA 1X3UA 3LW5H 4A69C 1A36A 4M3FA 2BY3A 4M9SA 5EEGA 2V1UA 3OYFA 3OJAB 2DMPA 1LVAA 1ZELA 2LKMA 1O3RA 2R5BA 1VQ4P 2OTLP 3SWKA 3BJAA 2B0LA 2EK5A 3CWBG 2KSEA 3DXJF 4HV6A 2X1CA 4MHGA 2MD0A 4MGRA 1M90Q 2MW8A 3V6IA 2OC6A 3CESA 1Z1DA 1F9NA 3P9CA 1MDMB 2DA2A 4LIVA 2QCOA 3ZQQA 2YMKA 4HQMA 2E5NA 2X85A 3PFIA 1NKZB 3QOEA 2E7WA 4PJMA 2L2OA 5AIQA 3BR2A 2FNAA 3Q5FA 1HW2A 4OWRB 2WY8Q 2Y9ZA 4FCYA 3I4PA 5DJTB 2OQGA 1YJWI 4IHWA 4IRGA 3S2WA 2Q8KA 3ULQB 5CVRA 4XLFA 4BHBA 5GTHC 2O9LA 1NTMJ 1DH3A 4UUSA 1F5TA 1ITYA 1FDMA 4OU0A 3VYUB 3HB9A 2H6BA 3D6ZA 1YTZT 4MEYF 4BHCA 2JP3A 1CQTA 3JAMK 1MMNA 4EJVA 3NTNA 3GTQJ 5AW8B 2E71A 1RESA 5FKKA 2WSEH 4EOTA 3HXLA 1EXJA 4PJLA 3ROUA 4Y13A 3SFIA 1R5GA 3KE2A 1FZEA 2V4JC 5AW5B 4B47A 1IW7F 1BN5A 3OS0A 1MV8A 3KYDB 3S3MA 1SQVD 1QX8A 2A45G 5DJUB 1RH5B 3SZGA 2EFOA 5E1WA 3BCCJ 2WC2A 1TU3F 2NS7A 2ZB9A 3IR9A 3L71E 1UFMA 1DGRM 3AL0B 2EV0A 1G3WA 4UNOA 5APVA 4BRYA 5DM7F 4JF7A 4E7IA 2RQQA 3CCEI 3MZWB 4JP0A 2E76B 3LFKA 1UJ8A 5JLXA 5APTA 4QPOA 1FIAA 2H94A 3BQYA 3F3XA 3KZIC 1H0MA 2HOTA 1PPJE 3T97A 2FXMA 2BW3A 1XX5A 1TWCJ 3IUOA 3M4OJ 1IXSB 2BCCD 3B8EB 1HC8A 4NC8A 4C2MJ 2IBDA 3CO6C 1NTKG 1GV2A 2ETHA 3MQ0A 4UVCA 1V5EA 4C2TA 2NS0A 4OOIA 1S7AA 1NHLA 1YQ4C 2NPSD 1BM9A 3A4CA 3DLAA 2MBFA 1IJDB 1S1CX 4A12A 1AQTA 2HODB 3R0JA 1L0LE 3M0DA 1BBYA 1IAWA 3CCUI 1ONVA 1X2MA 4ESBA 4ZTJA 4A3LJ 2FYUD 2D45A 2STTA 2P2UA 3OYDA 1YFHA 3N97A 4RB2C 5J4YA 3KFWX 2O1JA 3H1HD 4AC0A 4D5FA 5FRNA 4D6TD 2J5OA 5AONA 1UIXA 2P10A 1WI3A 3WE3A 1APLC 4AU7A 1SFUA 3SFEC 1IFDA 2PLYA 4LGWA 4XL9A 3II6A 3M7GA 4M71A 2WPQA 2P7VB 4II2A 3FWLA 2W85A 3CCMP 1XTCC 1X3ZB 2EIKH 5IOZA 3DP7A 3T8TA 1T2KA 2HDCA 1MBGA 2KZJA 5E3OA 4J00A 2FU4A 1Q1HA 2FYNC 3H1JE 1K79A 2OBPA 2IEKA 5GPAA 1K05A 1LTSC 3E5UA 4IQ4A 5FLXK 2M4GA 1PDNC 2YXRB 2V9VA 1WJ5A 2QYOA 2XC7A 4BRYB 1VQNP 1QRYA 4CH7A 4IOCF 1LE8A 1AOYA 1D1AA 3CDIA 3K1NA 1GHCA 2RV8A 4HAMA 3M1EA 2RAEA 2MFZA 3O6QB 2DI3A 4HSRA 4HYTB 3T97B 4M6XA 1YHQP 1HW5A 2B88A 3AEGC 3K4JA 1VQMI 4U3FG 3MMYB 3HSRA 4JBAA 4HLYA 2DW4A 4Y15A 3TGUE 2WSCH 5IYBJ 4X0GA 2N9YB 2VQGA 1O57A 5APSA 3ZPLA 3R4YA 1KONA 4PJ0H 4MTEA 1K4TA 2XGEA 4P96A 5CHXA 3MZYA 2QE7H 4BXFA 2M2EA 3LSKA 4LIUA 1ETQA 5FKMA 1S72I 3ZQ7A 1B8IB 1FZFA 2WWYA 1FJLA 1P84E 1Z6RA 1HXDA 3KQGA 3QYBA 1R49A 4KT0J 2A68F 4FHTA 2DU9A 4W1UA 1FJPA 1JHHA 1X79B 4CCMA 1BE3G 3OWTA 4KA4A 2Q3IA 5DV5A 1YX3A 3FDYA 4RGRA 3E1SA 1I6HJ 2VBZA 2PX9A 1PP9J 3AG3H 2BOLA 1FJKA 2ZFUA 2IFMA 2O1KA 3FGAD 2LF7A 1Y8RB 2OQQA 4XN3A 1R36A 2QSGX 1QHHD 3IHUA 1NTMD 1A5JA 1FTTA 4E7SA 4I7HA 5EG0B 3TO7A 3L35A 5DM6F 5AW0B 1Y1WJ 4EDFA 1OCPA 3EYIA 3HE4A 2EQRA 3HSFA 1N7LA 2NVUB 4PDKA 3JRBA 2HLOA 1U9NA 2OV7A 3CDHA 3Q9SA 1PP8F 1LTJA 1ERDA 3A5TA 1Y39A 5AVXB 1JGSA 1RPWA 2CH0A 3OS1A 2Q9IA 2HWVA 1SVMA 1S4XA 2IBZD 1ZTRA 2I10A 1LDJA 4BE2A 2ZMEB 2JA2A 2VQHA 4JBZA 1WJBA 1SD6A 4DGWB 4F7ZA 4LITA 2V4HA 1NYHA 1V3FA 3I55P 3B4SA 1Q82Q 1A04A 4ESJA 3OYKA 4CCLA 2DXIA 4C7RA 3MZ8A 1X1AA 3BCCD 4PJ0C 2N8GA 3CC4I 2D2CB 1YITI 1YW8A 5KLVK 4BQOA 5AW4B 3CMYA 4IZZA 3E97A 5DD8A 1IN6A 1E17A 1KU2A 2E34A 2XGCA 2P6TA 1JTYA 5E1XA 2GUSA 2HOAA 2Q1ZB 2L7KA 1MNDA 3W3CA 2A06D 3FWNA 2MYSA 2P5VA 5HODA 4WWCA 2GUVA 2KB7P 5BU8B 1YS6A 4L73A 2WV0A 4IHVA 1AA7A 1P6RA 4DYQA 1YJ9I 3GLMA 3P8CD 3KETA 2GZWA 5JR3A 2DO7A 1L0NG 2E42A 3FK7A 2K5CA 1OIPA 1VQPI 2QBYB 4ANJA 1RE4A 1OVVA 2VQLA 1GVDA 5APYA 4BXXJ 3N05A 2LBFA 3L9FA 2ZYAA 2ZXWH 1IGNA 2Z9OA 4V2GA 1L4AD 3K9TA 5K5QA 2ZO4A 1EKEA 1IZNB 3DKYA 2Z3YA 3DKXA 2E74D 3E7LA 2M34A 3RK3C 3BROA 2V79A 3QP5A 3OIPA 3DEEA 4Q48A 3LIDA 1SQQG 1RKWA 5IP7J 2P1JA 1MD0A 1J1DC 3WU2E 3I3LA 1WHUA 2JMWA 3MHVA 1JNMA 4G6TB 4I02A 2D5VA 4IF4A 2NVYJ 4K35A 1WSUA 2WT7A 3L36A 2X0LA 2BY0A 5J1UA 4CYCB 3K4LA 2JZYA 1KFMA 2O01J 2L7ZA 1G8XA 1ZARA 3CUQA 3FXLA 3BG3A 1OR7A 2R7ZJ 1T3JA 1X4PA 2XKPA 3RJPA 2KZVA 4YIRX 1BE3J 4N3YB 1ZW0A 1M1JC 3PQJA 1W5CC 4CXFA 2NNNA 3V8LA 3H3UA 2JA8J 1RR7A 1BJAA 1B4AA 1S7OA 2R5YA 1O7LA 1DPUA 2HS5A 2AEJA 4BU2A 1LWUA 3K1PA 1JMBA 4ZYAA 4HB1A 1OCRH 2O01H 2R92J 3H1HE 4D6TE 2QM3A 3ERED 3ELKA 4L5EA 1FZBA 1QVGO 4AIHA 4HNUA 3MZHA 4BJ6C 4ZJZA 5KAFH 3UKGA 1XD7A 2DTZA 3GVAA 3I0TA 3AE2C 1H88A 1L0LG 3WGGA 3DTEA 3ABTA 4NB5A 3ECOA 2RKHA 1ZK8A 3WTXC 1GW3A 4C9YA 2PAJA 1R1TA 2DW3A 3WGIA 4I2LC 2QF7A 1LGHB 1N25A 3MCZA 4M73A 3KPHA 4U88A 2WTEA 2WV1A 4ASNA 1TQPA 1FYKA 2XKOA 2Y30A 3GHGC 2Z16A 2L4AA 2V1NA 2W57A 2LLKA 2HQRA 2A6TA 3L75D 1J5YA 1UG2A 4AUXA 1E3OC 2ZCWA 2K9YA 3DPTA 1EA3A 5H6QA 5GTIH 3A0HC 3RKXA 3LA7A 5EGOA 4A93J 1PP9D 3LSIA 2K9SA 3S1NJ 4H13C 1KYOH 2DFIA 3FF5A 1BW5A 1VQ4I 4JQ0D 4A0YA 1DQUA 2OTLI 4CYDA 1AKHA 4O9BA 1W1WE 2LF8A 1WJAA 3EDPA 2RDPA 1JY3P 2UZKA 1P7IA 3ISPA 1LTIC 1Z3YA 5IT9Z 1O3SA 1QLED 2IFNA 3QODA 3W68A 4Y99B 1RF0C 4DIQA 3FBNB 3HUGA 4CCJA 2PJRA 1VQ6I 3CXHD 2G9WA 1RQVA 3C2BA 3RCOA 3PIPF 3TGUG 1MGTA 1Y9BA 5J8CA 2P4WA 3U9GA 4KIBA 2WAQA 2NRGA 3H1LG 3NQOA 5KJ7D 2O0YA 3CCJP 2JPBA 4MIMA 3Q5SA 2CYYA 1POGA 3FHNA 3HHGA 3TYYA 3FHZA 3COAC 4OMYA 4ZYHA 2QA4P 2BHYA 3CCLP 3CJQB 2HTSA 3MTUE 5BPIA 5D4RA 4FETA 3CI9A 4KMUX 3F9KA 5CQGA 3K2ZA 4MFEA 2JR8A 3K6GA 4AWXB 5ICEA 3WTZA 2JSCA 1K6OA 2XNDH 3HC7A 1HCRA 1GUUA 3L2UA 1YW9A 5GTIC 4HW0A 1PP7U 5IOYA 2RQPA 5K5GB 1MNMC 2IBZE 2OYOA 4KN7X 1XMXA 1IFIA 3KZYA 3K4KA 3IKTA 4G7HF 3J7AO 3VSLA 3DV8A 4MTDA 1ZGAA 2VQCA 3RQIA 3F22A 2QIWA 3BCCE 4Y4RA 3NWSA 2MLGA 1IZ1A 2R93J 4A7PA 1L0LJ 3VTPC 2A3SA 2VOPA 3KIOA 1AU7A 1CSBA 3D5SC 2LY1A 4ZYGA 2CFXA 1ON2A 3ZRGA 5FJ8J 1OVUA 2X1EA 1LJ9A 4O6JA 4ZTFA 1D8KA 4YRVA 1DUXC 2VASA 4ENMA 1IO2A 2BEOA 4A3GJ 2EBIA 1JY3N 2IYOA 3FM5A 2A06E 1BOAA 4P1WA 1S6LA 3FXJA 3ZOBA 4IPAA 5E79H 3ABMH 3HIFA 4EGZA 1IN8A 4BE0A 3P8CE 3RL0C 3BC8A 4YG2F 4IKFA 1JKOC 2DA6A 4A5MA 3CP8A 3KYCB 3ZGKA 1A02F 1YLFA 1QGPA 2VE8A 4KHXA 3NARA 1VPCA 3H1JJ 2UXNA 5ILVA 3ABKH 3DWLE 1H88C 1WZ2A 3Q1MA 2L9VA 5KTBA 3NWTA 2ZJRF 1R7JA 2WWWA 4KICA 1T8IA 2TDXA 2I5UA 2E76D 2WSFJ 3CCMI 2N1TD 1J1EB 3HUSB 1U8BA 2KUBA 5ILSA 1I1GA 1DD4A 1SQVG 2B63J 3E1IA 2DFHA 1J75A 1L0OC 5AW1B 2K4JA 1CZQA 1N8RQ 5EZGA 2VJJA 1EQ7A 1CW5A 1SFCB 2P0WA 1XMAA 5DS9A 2AO9A 1Y8QB 3PSIA 1VQNI 5L8RJ 3QU3A 3L2CA 1LTBC 2CFOA 3H1KJ 3BR0A 1KYOD 4BAYA 1FAVA 2WSFH 3F6VA 4DZPA 2QJYB 3K5BA 4PSXA 3BPVA 3WG9A 2HPCB 2GXAA 1GTWA 1U0JA 1D0ZA 2QSFX 5HLGA 3HOVJ 1B6AA 3PUBA 1P4AA 4BH9A 1N86A 2Y0EA 3GMAA 4PJ0E 2R7VA 2BCCG 1QZEA 2G8YA 1UB9A 4J01A 5EF6A 1AJYA 4KJMA 3DFGA 4C3JJ 5IYCJ 2F48A 2M8GX 3RK2C 2VXZA 3JCUH 2KI7B 4UB6H 1YE9A 3HHHA 2BASA 2HVSA 1URQC 3RGUA 2FYUG 4QTRA 4LLLA 2B9SA 3TSIA 2P5KA 3HKZN 5B5EH 1YBKA 4E7HA 3H1HG 4D6TG 2VPLA 2ZAEB 2DA1A 4ZDLA 2CPSA 3CLOA 3Q0UA 5KNLA 2OYIC 1Q1VA 3T0YA 3N7NA 3IFMA 2V6EA 3HRSA 3ZQLA 1XMKA 5BOXA 1HKTA 3GTJJ 3LSPA 1Z21A 3SEQA 3KEOA 4NQWA 3L75E 4BS9A 3WHBA 5GAEJ 2K4BA 2DMNA 1QPIA 2PMZA 4NUBA 1ZG3A 1QL2A 1WQ2A 1XS9A 4BDYA 1BL0A 3PRJA 1A31A 2XDVA 2CS3A 3ZQGA 5HNHA 4U7BA 2B87B 1Y0NA 5ICGA 2QVAA 5B66C 4JQFA 4WCGA 1FE6A 4GDFA 4OAYA 3JRHA 1KFNA 2ZYDA 4IL6C 4C3IJ 4EV0A 4XRSA 4Y28J 3L70J 3CLQA 1N7SC 4XNFA 1ZYRF 1DP7P 2ZKZA 2M5AA 2LY2A 1E79H 1I3AA 3M3YJ 2BY1A 3BT9A 1H9TA 3BPXA 2VC0A 5HS8A 2VRSA 3ASOH 4L9VA 3I55I 1U8RA 1HSTA 3GZ5A 3FXKA 3HTKB 1W5CE 2WTYA 3MWMA 2KZIA 3VPRA 2VJ4A 3WG7H 1JY3O 2XV5A 4CPGA 4RAYA 2XNXA 2FXAA 4FE7A 3DPUA 4F92B 1MMAA 4UXNA 3B5NB 3K70D 2GOMA 2NPSA 4HZFA 1WJFA 2M5WA 3O8HA 4B43A 3V2QA 3QOPA 2VKDA 4ZDPA 3GFJA 5H2FC 1VQ8P 5APXA 1QVFO 3L37A 3HJEA 2XPWA 2XF6A 3M8FA 3JTGA 1UIIA 1H0TB 2RNGA 2WAFA 1FTZA 3MKZA 1TZLA 4PFOA 2LMDA 2PGDA 1FZPB 2J59M 5TJJA 3ASNH 2VC1A 5KK1A 1QQIA 1W7PB 2MLKA 2O6GE 2VODA 1KILD 1WWXA 1FOYA 1MZBA 4N4OB 2IZ0A 2FSWA 2DDAA 4EIJA 1S7EA 1YI2I 2DT5A 3PUFA 4XIDA 1SP4A 5KKZB 3R61A 2H6CA 4A5NA 2ISYA 1JY2P 4LLGF 1IDZA 1NTMG 2FKWB 1SFCD 4KMFA 1ZHFA 5JI6A 3BG9A 2AQFA 4BGDA 1XC5A 3OYAA 1KYZA 3H1JD 4WY4C 5KAIH 3BJOA 4FX4A 1NWQA 4XSXF 3RDIA 1BR4A 3S16J 3ZXSA 3RZOJ 2CK3H 2WSSH 4LK1F 1I1SA 1GL2B 2QJPC 2DYSH 4Q47A 1PVEA 1SAUA 2FD5A 3J80Z 1PGPA 4Q5SF 2VKHA 1EZVG 2IBZG 2PEXA 2KIUA 3OYBA 3SSUA 2DMQA 1T33A 1X19A 3GLLA 3P9KA 5ERIA 3WTTC 1D5VA 1GLNA 2DOAA 4A2UA 1MDMA 4RGXA 3CC7P 4GRIA 3A01B 3MKLA 2IS4A 2H8PD 3HPGA 3T8RA 3BCCG 3CMMA 2ME6A 3A0BC 5F64A 5M5WJ 1T3UA 1QO0D 1LEAA 1FWZA 2NZ2A 3TDKA 2EILH 2ZC2A 1TT0A 4K2EA 4OIOF 2H8RA 2HYJA 1U7MA 1P4XA 4F91B 1W5SA 3H1KD 1YO5C 2F6CA 1XGOA 5JHUA 1ZG1A 1RRJA 2AEMA 5AW6B 5KAFE 2YPRA 4M3BA 1LT9A 1XGSA 1X9VA 3FKIJ 3L71J 1KQ9A 2DPDA 1P9QC 3JRFA 1J59A 5GTHH 2R0QC 2WBMA 2CQXA 2ZVNB 4WXHA 1P84D 3L74D 3DBHB 2M4KA 2MGQA 3VYSB 5DCMA 3C9IA 2Q7CA 5EJCA 1W36C 3JRAA 2H1KA 1RC9A 3TMOA 2ESNA 1YRNB 5F1RA 2AXLA 4GCVA 4FX0A 3AE4C 3JRDA 1SQPK 5AVVB 4XKBA 3LSTA 5LGNA 1K8AQ 2OYHA 1VZ0A 1G2HA 5FFZA 2JTVA 4Y7NJ 4EJTA 3RPUD 4JYCA 1MJ9A 1TWHJ 4ENNA 1GXPA 5GTIE 1IN4A 1JY2N 4N78D 1Z7UA 3RBXA 2M9HA 3FMQA 1D0YA 3K4BA 1RF1C 4R4MA 5EEAA 1KYOE 4GGGA 1LKXA 3PJRA 1MMDA 3OSFA 2R32A 2LOOA 2NYXA 4N6JA 1Y0UA 3B6CA 3SFDC 1MW7A 2K1AA 3G2BA 4BXLA 3O2PE 4ZZDA 3NFQA 1YOVB 2C0WA 3EUHA 4PGGA 3HL2A 2XAFA 1RUOA 2NVQJ 1G3TA 4XMYA 2CUJA 1GMJA 3LWFA 2H8WA 3L1PA 5LGTA 1IK9A 2V26A 2L01A 2VKEA 4FTHA 3KZIH 3LL7A 5HS9A 2O5RA 4BL0B 3V4GA 1P2FA 3FWEA 3J7YJ 1ZN2A 4RDUA 3RKQA 3GTMJ 1KB9I 3VDXA 4N4NB 2QSHX 3H0GJ 4U7DA 3B5ND 2WSEJ 4BACA 2E1OA 4HPQA 1K83J 1PGJA 2XPUA 3BRVB 2W6BA 3FX0A 2IS1A 3EFGA 1NG7A 3IWFA 3L70D 2HODA 5AVWB 1WGXA 2ICWG 1LT9B 4E70A 1KZUB 2KT0A 4O3MA 4XRMA 4A3FJ 2QEXP 2FFDA 4AYBA 2IS2A 3BZKA 1ZR4A 5M5YJ 3K7AJ 2MH9A 1NH4A 1W7PD 1PL5A 1PFIA 4XKWA 3CCJI 2PP6A 3KP2A 3QPHA 5DCMB 3ZQIA 1YTYA 2P58A 4HX7A 3SQNA 3JAMZ 4EGYA 3QQAA 9ANTA 1I39A 3PL8A 1BJZA 1MBJA 4HA8A 2K3PA 2AQEA 1I6XA 1SD5A 2QA4I 3CCLI 3MUDA 2HZDA 3HOWJ 2Z5HA 1QA6A 4U87A 1AWCA 4OIPF 5HNFA 2E5ZA 2DOEA 3R4KA 2EFQA 5M3MJ 3OY9A 3H6PA 1OYYA 3HD7D 1ETVA 1W0TA 2KQRA 3TO9A 2RN7A 2WPSA 2VOOA 1ZOYC 1FZGA 1L4AA 1FC3A 1OKRA 4OIQF 1GL2D 2KFDA 3HPHA 2PG4A 2CG4A 4AVZA 5AW7B 3I71A 1V5GA 5F1JA 3KDPB 2ZXHA 1IN5A 2H7HA 4CICA 1MBKA 2DA4A 2TRTA 5CCHD 2BVMA 4YEJA 4IRHA 4F52A 2DT7B 3O6QA 3PH0A 1PP9G 5APUA 2FYNB 3CCSP 2CRGA 1Z67A 1NU1E 2JVHA 4JYBA 4XOTA 1QEXA 2W00A 4DZJA 1S29A 3BASA 3BP8A 1JUNA 1OISA 2QQ9A 2VT2A 4YIFA 3VWBA 2M45A 2JRTA 2J5PA 1VTNC 1REPC 1SVOA 3H25A 4GFBA 2VIXA 1BOBA 4RAGA 4W7ZA 2MJZA 4PZJA 3F72A 5E79E 3NEUA 3RYPA 2V7QJ 4DT0A 5C4XJ 5L3DA 3O8GA 3S1KA 1FSHA 1RE3C 1ZG5A 5KLVE 1H9GA 1B8IA 3P9IA 4MQVA 2FFDB 2M7BA 2XGXA 4NPFX 4JK1X 4RA2A 3O3KA 1T95A 2M0BA 2JKVA 1XSDA 1T0FC 5HOOA 5BU5A 2HGCA 3M9BA 1FIPA 1USTA 3MVPA 2IPPA 1SQXK 3IWZA 1KILE 1FBQA 2KYVA 2Y0CA 4PD4H 2X6OA 1BIBA 3BRTB 2FA5A 1YJNP 2A5WA 5HDGA 1KZHA 1EH6A 5KLIC 2JUCA 2DPUA 3CCQP 1FT9A 2M3AA 4UVBA 1HA8A 2V7QH 3T1BA 2Y0SA 4G8XA 1GU5A 1QHGA 5BPDA 3K4CA 4G7ZF 1ZQ3P 1N73C 3GFMA 1V5FA 2KLOA 1NK2P 3L71D 2Y9YA 1G1JA 4LGDE 1SS1A 1HDPA 5EG0A 1M1KQ 1L4AB 3I56P 1FEXA 1HVVA 1SFOJ 1JY2O 4HX8A 4DOZA 3M07A 3E7KA 2E74B 1Z3XA 5ICCA 2WSCJ 5FLXZ 1U6GA 1D5YA 1FMVA 5HLHA 2XASA 2CGPA 1SLQA 3E1RA 2HFHA 3KPEA 1XSXA 2JJ7A 3ZMVA 4IL6E 1HJBA 2LG4A 3BY6A 1VQLP 2YO2A 2MH2A 4M3GA 2ZMEA 3LSGA 4NC6A 5J8FA 2CUZA 1PZQA 3DPLC 1XN7A 1LFBA 5L3GA 4EM1A 1MZ9A 4GIFA 1OJLA 4PD4I 1Z05A 2IA2A 2FNPA 2X6YA 2M87A 3PNTA 3GYHX 3H1KE 5JHFA 2PN6A 3JCUE 4UB6E 2W90A 1HJ0A 2BVLA 4RM3A 1YTZI 1ZLLA 3OYIA 2Q1KA 3L73E 1O3TA 4UY8I 4QSHA 4C7NB 1KU9A 3DCFA 3DU6A 2CWEA 3RYRA 3IF4A 3L74E 5B5EE 4MO7A 5H2FE 3L75J 5LHHA 2LFBA 1USDA 3R0AA 3ZQFA 1YX5A 1HDDC 4L76A 4M6VA 1BC7C 4L74A 3BTCA 4BEHB 5IY5H 2Y31A 3S2DJ 1FZCB 1L0NK 2CO5A 2QBYA 2OYHB 5AW2B 4X6AJ 1FBUA 2EA2A 3DKWA 3EUKL 1VQ7I 4KITB 1SQPJ 1TBXA 3HTUA 1PUFB 1FLIA 5AIPA 2QLZA 4K3AA 4XM3A 3VN0A 6PAXA 2E75C 4N78E 3SWFA 1DEBA 3OA7A 1Y56A 2WITA 3Q3SA 2FYZA 5DUKA 4HF1A 4GDOA 3PO2J 1NU1K 4KUMA 1JJ6C 3G71P 1IDYA 3K69A 2NOJB 3PQKA 4NHJA 2X51A 1T98A 2KDOA 4XR6A 3Q0VA 4EM2A 1LFUP 2JWDA 1IF1A 2QKMB 3BR5A 1ACIA 4G9YA 2JDIH 4CYCA 2LTPA 2CQ7A 3RK3B 1I3QJ 3EYYA 4I6MC 4NNJA 2A45H 1EV7A 2KJCA 4U0YA 1FOWA 3B73A 3WHCA 1J1DB 2WVRA 3HE5B 5IT3A 2OZUA 5AVYB 4FISA 4IHTA 3BTLA 5D4SA 4M3DA 2MKVA 3L70E 4ZH4F 3S9OA 1QNTA 1XDUA 1U3EM 3A0BE 2KIFA 1U5TA 1XCBA 2WAQN 2Z5IA 2FBIA 2W6JH 4UUVA 1B1BA 1G4DA 4A3CJ 3OAKA 3A02A 2ELJA 1HSJA 2IT0A 2M1BA 1X1DA 5K5RA 3L2QA 1M1JB 3OOUA 1UHWA 1LTGC 2C6YA 3QWOC 4UB8C 1VQ5P 3KP5A 1D0XA 3M0DC 1JKQC 1VQ8I 2V1DA 4PJJA 2XGDA 1GT0C 1NAFA 3UR3C 1R6RA 4QMAA 3SZTA 5E3NA 2UUZA 4XA4A 1HF9A 4PD4D 2DJIA 3C8VA 1VF5C 1K9MQ 2G3AA 3DEWA 1U57A 2QUFA 2A45I 2A6HF 5L3FA 3AE6C 1W2BO 2X48A 3F89A 3F8NA 3LSRA 2OAZA 3KLOA 1FS0E 3LOCA 4MNUA 1FOXA 4D7MA 4DW6A 2E43A 2XUBA 1SANA 3DBRB 5KAIE 4CA0A 1QU3A 3FBIB 4GOEA 4R4LA 5FLMJ 1ZRDA 1T2KC 2N1TA 1Y47A 2OJED 4WWIA 1LUJB 2GXGA 3F21A 1BGYD 3GHGB 2EV5A 3BG5A 2IRFG 1S5LH 2YKOA 5E20A 3M8EA 1R71A 3A2KA 2ZT9C 4OVNF 4M9XA 3A0HH 2FJ1A 4ZNCA 4BQQA 3OL3A 1E3HA 2F4IA 2L9NA 4CZZA 3MKYB 1NK3P 1KQGB 1MNEA 3ML6A 3PNVA 5EFWB 1GD2E 1NTZK 1H89A 3S8PA 4H0LC 5CLSA 2YU3A 3HOZJ 4A0ZA 3MEXA 5CYVA 3CC7I 4PK4A 3S15J 1PPJG 2W6AA 3TKYA 1XSVA 3JRCA 1U5TB 2XAJA 2ZNYA 4C2UA 4I09A 2I1JA 2A07F 1J09A 1R4NB 2BHZA 3TEDA 1J9IA 2VL8A 4E4HA 3HOUJ 1KQLA 2D2CC 2FQ3A 3LSJA 3CWBD 5GTHE 2UXXA 3KP6A 5CBOA 1ENHA 4Z6YA 1VQKI 2C9LY 3OW2O 2ZJ2A 1HH0A 2D1VA 2IP2A 3AG4H 1KGSA 2EH3A 3BCAA 3EQLF 3HZJA 4EJUA 1G59A 4DOJA 2Y48A 2E5YA 4HYEA 1NOHA 2H27A 2YXQB 4CZCA 4IHYA 3CX5H 2IGNA 2KPMA 4UUTA 1ETOA 2EA4A 3HOSA 4ITVA 5FGMA 1DPRA 3AFHA 4LK0F 2LKPA 3G1MA 1WMKA 3JW4A 2LRDA 3WUVA 3CD6P 2VN2A 2VJ5A 5TISC 1SEUA 3ZMDA 1ZKGA 4L0ZB 2DFFA 3ZMSA 3DQVC 4RAZA 1A02J 4I0AA 2V7FA 4FQGA 3M06A 2AXCA 3IH2A 5EZHA 1S5LC 2W25A 2XDJA 1GV5A 4RAFA 4V2FA 3V5BA 2QQAA 4BQNA 4LB5A 1EH7A 4JX4A 3TP0A 1AA0A 1XCVA 2IGMA 1KMIZ 1UZCA 2X9DA 3H0DA 1QL1A 2VONA 2ITAA 3RK3D 4HF2A 2R7FA 3RKYA 3BATA 3H1JG 1LTAC 3CTAA 1MMSA 3A2AA 2VUMJ 3O8ZA 4M3EA 2L9RA 1SQPD 2EV6A 1R9TJ 1LTJC 3KZIE 3K4MA 1XDSA 3J81K 1EF4A 2X1DA 1LTTC 1MH4A 1UMQA 1HWTC 3H1IJ 5AVQB 1MSEC 2P7JA 3RTRA 1JTXA 4HV5A 1MMGA 3CX5I 1X1PA 1QVTA 4KNYA 1UHSA 1SFXA 5E1ZB 2MA3A 2R7QA 5LBQA 1GXQA 1Y6IA 2DODA 1ON1A 2M7AA 2OZ6A 5K1YA 2OARA 1V4RA 2W48A 3GTGJ 3JC22 1IXCA 5A2QK 3P32A 2HTJA 3N4MA 3H1KG 5LRRA 2RGVA 4L5JA 1I5ZA 5J40A 3KXDA 2FE3A 5BVZA 1TQMA 4TT3H 4MQ9F 3JRIA 3QH9A 2XZRA 3GTPJ 4YFKF 3A3YB 1GZLA 1R1UA 1FNNA 2C9NY 5D8LB 5C3EJ 4L9TA 1JXSA 3ZMTA 3LNQA 2FX0A 3W67A 4AYCA 3TOAA 3PSFA 5JVGF 3ZMZA 1JOCA 2WPVB 1Q7YQ 2Q0OA 4MFDA 3HRUA 1RE4C 4LLHA 1K78A 1IUYA 2M0MA 4DQ2A 2C0XA 3CL3D 1SMYF 2O3FA 1SQBK 3HUSA 4RGSA 3MN2A 3RZDJ 1NU1J 1J0RA 2DLLA 3MFKA 1N78A 1MUUA 3AECC 3GF3A 4A6EA 2R5DA 1HTLC 3L09A 1IC8A 1JHFA 3OV8A 1LNQA 1SFCA 4RESB 4BYYA 3F8CA 5E8GA 4GXOA 3F23A 2K9LA 2VT3A 2W24A 1OVRA 2YO3A 3OYNA 4LG3A 2E60A 5DD4A 4AIKA 4H13D 2HPCA 3LA3A 5D5XB 3S1QJ 5FFXA 4P9FA 3OYLA 1BCCE 2YMYA 2QGUA 3B02A 3IH3A 1FC2C 3C1LA 5AVSB 5KLVJ 3USSA 3RKWA 3C7JA 2ME0A 2R3SA 3CUQC 1NTCA 3IRQA 2HQAA 4FASD 3G4SP 1OR7C 2XAUA 3GX4X 1H89C 2J58A 1BIAA 2W84A 2W1OA 4A3EJ 2MD5A 1LDKB 2DYRH 2YIUB 3HG9A 3UIAA 2VLAA 1QGKB 2HYGD 3L70G 2KP8A 4XLCA 5CQEA 3V7SA 2RN0A 4U3FD 2COMA 1NH3A 1LWUC 2DQRA 2O3JA 1Z77A 5M5XJ 4I1LA 2IVMA 4PD4E 1VFCA 3L2VA 5K7ZA 2LNBA 2X6WA 2LC2A 3H5NA 3S3OA 3RK2B 4KYWA 3Q0WA 3CCVP 1X22A 3CX5D 5K5OA 1G6NA 2DJNA 4YFXF 4CCKA 4ZYDA 1URQB 1WRJA 2LR2A 1RNLA 1DIPA 3FXUA 1X2NA 3CCUP 3CCQI 1CF7B 3V7CA 2ISZA 1K78B 4H44C 3HOYJ 2EIJH 4D5CA 5LGUA 4ABZA 2CSOA 5D5WB 3MD0A 1KILB 1OCCH 1TT5B 3R60A 2OA4A 1Y1VJ 3JTHA 2HPMA 2BE5F 5F04A 1BGYE 3S17J 1ZV8A 1SQXD 2A61A 2B87A 3AE7C 1KN7A 5IP6A 3I56I 2DFEA 4XRSG 3SYTA 4MN4C 2WADA 1IFPA 5CJ4A 2H43A 3RPUA 1RKTA 2OGUA 4IQJA 1Z91A 5B66H 1P4WA 3L4FA 1JCDA 1LJ2A 2IGKA 5LHGA 3V7RA 1SVFA 4IL6H 5APWA 4XK4A 1KTMA 3RI4A 1VQLI 3L73J 1BI2A 2HR3A 2XAHA 1NTZJ 1G2CB 1EXIA 3H32A 2F5DA 3TOBA 4B1RA 3L74J 2NNYA 1DU0A 2XRLA 1HGVA 3HTKA 4H0EA 5KJ7A 5CCGA 1I50J 3GCMA 3UNGC 3CWBE 4S04A 4NPDA 3EETA 4DNCA 2YSRA 2L9SA 3OYGA 4A3KJ 1KQ8A 4R8HA 3U2RA 1RHZB 3B5NA 2M8RA 1KYWA 4AIJA 5C39A 3VSKA 1KQFB 1B9NA 2XB5A 2HKXA 2P7CB 1VQMP 2EB7A 1YIOA 2P8TA 3H1ID 1CI6B 2E1MB 3L72D 1PV3A 2LVSA 3RL0D 4M72A 3CJTB 5H2FH 1H0TA 2PMHA 1Q81Q 1TW2A 1Z0XA 2BZTA 2DK8A 2HI3A 1F43A 4I98B 3WTSC 3VODA 4G6QA 1W7PA 2HVQA 2PJPA 3AG1H 2W8ZA 3TQNA 3S14J 3FISA 4WF2A 3NXSA 3BR6A 1OQYA 5F08A 3BCBA 1ZRFA 4A3BJ 1X0TA 3VMZA 3L71G 2KZGA 2BYVE 3RK3E 1ETKA 2E36A 5D8KB 2LXCB 2K85A 2ECCA 2NXNB 4LG0B 5B3SH 2L0KA 4PUSA 4YFNF 2KKOA 3HD7A 5FKLA 3HUSC 3G71I 3TDUC 1J1EC 1SQPE 4DBRA 4I7ZC 4TV7A 4F55A 2ZXXA 3V2RA 1LVKA 3CJRB 2XKMA 2L7FP 1TTYA 3SXYA 3RIRA 2R7UA 2IAIA 5IPAA 1GL2A 4YTPC 2IW5A 1YQ3C 4D7NA 5H6RA 1R23A 5ILUA 5CCHA 1OXZA 2JO1A 3H32B 2UV1A 1U7JA 1NU1D 2I8DA 1SFKA 1S8NA 3A01A 4BY1J 1NVOA 2QJPB 4IHSA 2ELKA 2QJYC 2PMUA 1XG1A 4N9IA 3ZN1A 3C2GA 4A3IJ 1P92A 2ZFCA 3SWYA 2HXOA 4S05A 3W6VA 3U1CA 4B09A 4AYBN 4I6ZA 3OSGA 3A0BH 2ELHA 1MH3A 1X8YA 1SFEA 3RK2D 4OGQC 1MIJA 3I4NJ 1NTKE 3GFLA 5C44J 4AQRD 4KIGA 4BUPA 3G6EP 5KLVD 3CC4P 1VQ5I 1LP1B 1URQD 3KX2A 2F2EA 5J1YA 3W2VA 2KISA 1RETA 3SJMA 3AEFC 2CUFA 2EWNA 2FOKA 5GPCA 2KL4A 3QPSA 2DA7A 1YRNA 1F1ZA 2DOFA 1SD4A 4Y17A 2G0EA 3T5XA 3VFZA 1S3JA 3G1OA 2EFNA 2JQ7A 3TW7A 2WB1A 3NMDA 3I59B 1SQBJ 3ZMUA 5C4JJ 2Z33A 3OOPA 1E5WA 2K7LA 4IXAA 3VEPA 3IH4A 1EDKA 1OZHA 1USEA 1Y8AA 3G73A 3KYLA 3PO3J 4CDGA 1S5LE 4EYYQ 2O8XA 1MBHA 3HD7B 1YW7A 2W27A 4LJZF 1RY3A 3A0HE 1LFPA 3PNYA 3E5QA 1BW6A 1EDLA 3MGNA 3GF2A 4HF0A 2KSJA 1OCTC 2ZBKA 2QM8A 4KDPA 2O8KA 3A1YA 1H8AA 4B3AA 1VI0A 4CHUA 4RB3C 2YS9A 1TWAJ 1ZRCA 3HEFA 3KLNA 1WRGA 2ZSHB 1N7SD 2VPRA 2CPBA 1D7MA 5D6EA 2GAUA 3QAHA 3GF7A 3M91A 5DEQA 3AEAC 2A69F 4OAZA 4PJNA 2ESHA 2PBIA 4RBOA 4O5VA 4GKGA 1BDCA 3OYEA 1E3PA 4R1HA 2JN6A 1NO4A 2COBA 1S9KD 2HQNA 4BHPA 3U1AA 4U3FE 4E7KA 5TJHA 1UCRA 3CUOA 4Q4ZF 3I64A 3W2AA 3DF8A 3L73D 3D6YA 3HRTA 2OU2A 1U78A 4HKZH 1XGMA 4ZZLA 2A06G 1NTZD 3BJ6A 2VJIA 3ESWB 3CMAP 3ZCOA 2DDBA 2LP0A 3LMMA 3CX5E 4W7YA 5J4VA 2Y0SN 2XF5A 5HVQC 1A35A 2EZLA 1KB9H 5J1RA 1W0UA 2B9BA 1GVJA 2LH9A 3S32A 4ETSA 4Y52J 3CD6I 2NS8A 2QJKC 1P7JA 4WVZA 3C2HA 1SQXE 1TL8A 1T56A 2HDWA 2XAQA 1X1CA 1BI1A 3GLXA 4N0BA 4PGHA 2ID3A 2FBWC 3PLNA 1QZYA 3GXOA 2HQ5A 5M3FJ 5KKZC 3REOA 5TRDA 2JA7J 3IV5A 1VNDA 4E6KG 1HBWA 2DBBA 3GBGA 1S2EA 5EDNA 1LNWA 2KRFA 4M9ZA 2Z1DA 1BGYG 1JI8A 1BR2A 4WY4D 4GYIA 3WU0A 1JGGA 3HGGA 1SMTA 4B44A 4OIRF 2K3RA 4HLXA 4IO9F 5B1AH 1ZH5A 4RLFA 3BWGA 1N2DC 1MJAA 2JWTA 4CGZA 2V9PA 1NTKK 2CQNA 2MC4A 1GK4A 2TCTA 3WU2C 5FROA 3CZ6A 2GQQA 4D9JA 2IDBA 2VI6A 4RGUA 4ZDOA 4KFCA 4JX5A 1R22A 1TW3A 3H1IE 3E5XA 1EDJA 1FPQA 3JSPA 4G94A 2IGOA 3FXMA 3L72E 5FD6A 2FEZA 1X1BA 4AIDA 1D1BA 3GUDA 2KLUA 2E1CA 3ZQCA 1DEEG 4P5OA 2OTJP 1PIXA 2NPSC 1JO5A 1WKMA 2BXZA 3FMSA 1TWGJ 2G7HA 3K2AA 4IVNA 3G3ZA 5HLIA 2BEQD 4WB4A 3P7NA 2Y69H 2RVCA 2R7WA 4BKXA 4L5IA 5LD2C 3S3NA 3JSOA 2M3EA 2IPQX 4IL6X 1SC7A 3JR9A 1VQ6P 2HOEA 3IP4B 3TBIA 3EQ2A 4W80A 3EPZA 3PFYA 1W36D 3LA2A 1R1VA 2DQLA 1FY7A 1W5TA 4M3LA 3IKVA 3E6DA 4XLEA 5L3EA 2DK5A 2ZJQF 1L0NE 1FU1A 5JVTA 1ZP0C 3L75G 2L4MA 1IG7A 5KLIB 1VF9A 1M57D 1T8ZA 2R4GA 1DGWY 5EYRA 1BA5A 1BCCJ 3O6BB 4C46A 1N73B 3H5RA 4EJOA 3TP3A 3A03A 4ON0A 1NAYA 4AUWA 1AV1A 4YXDC 2EZKA 2FUG2 1XB4A 3J7AY 4A6DA 3N4XA 3OIQA 3PTZA 3H35A 1SQPG 3BLYA 4LFUA 1SQBD 2CW8A 1TP4A 2K40A 4AD9A 5KHDA 1JTHA 1SQQE 5GP9A 4WBAA 3TNUB 4RS8A 2VB6A 4D1QA 4Z1MH 3V8KA 1SVLA 3FXQA 2LXBA 4DBQA 1H8AC 1IV8A 4BQAA 3W6JB 3FKJA 3EUAA 2KS1B 2JK3A 1OW7A 1OX3A 1NGMB 3VYTB 1TQIA 2YR2A 2CMPA 3HOTA 3G4SI 2Q5UA 3ZR8X 4IOAF 2XU6A 2O01N 4C7NA 2HXIA 3AG2H 2DA5A 3ZP5A 2R7TA 3C18A 3DTKA 2QVOA 1AVYA 4HSTA 2KHMA 3S93A 5HLTA 1Q2NA 1LT9C 4L75A 2Q2EA 4HBLA 1VQ9P 3L00A 4DZOA 4W97A 4BEHA 4XQFA 5FLVA 2W7NA 1FZCA 1BI3A 3GO5A 1T38A 1BGYJ 1KB9D 3SFZA 2WAEA 3CF2A 2O7OA 3CCVI 4HDVA 1OYWA 2KIQA 5LFAA 1IFJA 4TLFA 5H20A 4XORA 4G12A 1F36A 1PUFA 4AM3A 3QWLA 4UUSB 3K10A 4U0WA 2A6EF 1Q86Q 3LSHA 3TL4X 1HOMA 4RLQA 5L3CA 2ADUA 3BZ6A 4IEJA 2ZYGA 5B66E 4LLNA 2OYHC 5LRSA 5AW9B 3Q3DA 1JUPA 4B86A 3HE5A 3Q2YA 2GM4A 4XE5B 4XICA 1EZVI 3AL0C 2E75B 2IBZI 3WUUA 4XLAA 1HW1A 3H9GA 1HKSA 3SZPA 2LD5A 2ACJA 3CWBJ 5DDGA 3VMXA 1T39A 4IX7A 1JTHB 2L91A 4BY7J 1M1EB 3FX3A 1J7KA 3LAPA 1IJWC 2VBWA 1GK6A 1D1CA 2WA0A 1SD7A 3EUHC 4Y33A 1S9KE 4I0BA 5CBNA 1WJCA 3BG7A 2K02A 3G1LA 5E3MA 3BR1A 2W82A 2DAOA 2KIKA 3QYFA 1T6SA 1E2XA 1ULYA 1NTZE 1DX7A 5DYMA 2QQ8A 4KISA 2YKQA 1GU4A 2KXPB 1MKMA 5LEKA 4DYCA 1M1JA 5GAHJ 2BW3B 2ZXJA 3IAS2 4M74A 2Q2EB 4CCOA 1WJDA 4EEFG 5FB2A 2CV2A 1WFXA 4UB8H 5CCGD 1G3YA 2FFDC 2JEEA 3H3ZA 3TW6A 2O61A 1JM0A 4FT8A 4XSZF 1OWAA 1FP1D 4OMZA 3H1LE 3PHLA 2E19A 2XRNA 3CCYA 3VP8A 3RQ4A 3GW6A 3BVHA 1NG6A 2J5UA 3M1CA 2H89C 1MJBA 2E5TA 1AVOA 3MUDC 4KN4X 3TDZC 1BC8C 1RQUA 3KEYA 1K6YA 1VF5B 1QBJA 2B89A 3ECHA 1B59A 3KYQA 2HYFA 1R00A 1SQQK 2RC4A 4WXDA 1K04A 1SQXG 3TF5A 2QWWA 3KEQA 1ETWA 5F0FA 1SAXA 1L4AC 3GHGA 1EH8A 1ZRTD 1EJ9A 3MD2A 1WI9A 5DTDA 1YHQI 3ERMA 3SHFA 2E74C 3CMEP 4UV8A 3FM3A 1LDDA 1K4SA 1W4MA 2BV6A 3C1DA 2IX7C 1R8EA 4PFPA 2V6CA 4B3XA 4H4KC 3X2QH 4HNTA 1IRXA 3F6OA 3Q5RA 2KOGA 3BZCA 4ZKUA 3RPQA 1TNSA 1KD1Q 4J19A 1OMIA 2BGCA 1NTKJ 2ZT9B 2LY9A 1BCCD 1IRFA 3WTVC 2ZXIA 1MBEA 1LE8B 2GIZA 2Z5UA 2KRHA 1TC3C 5ICFA 2R5ZA 2PI0A 3E3VA 2Q6QA 4XFJA 1RR8C 1RZ4A 2K86A 2DTRA 3I54A 1JUMA 1HLVA 4BWNA 5DCFA 3QPLA 1EZVD 1IV6A 1R4MB 3I9V2 3OIOA 3ZQHA 4H0LB 3KP7A 1ZXGA 4OH8B 3D5LA 2NOGA 1VQOP 3P8MC 2VKVA 4HNVA 2FBHA 3I4MJ 2ZFWA 3HRMA 3AE8C 2KJBA 2PQ8A 2PFBA 3ABLH 2JA5J 4JYKA 3H1IG 1L0LK 2FXPA 1AHDP 1RF0A 3L72G 2HEOA 2AXTH 3E6MA 3PM1A 3G6EI 4ENJA 1X3WB 4EM0B 3SDBA 1FOKA 1BDDA 2XVCA 4NDLA 2CQQA 1K7AA 4RKUJ 5FRMA 4RB1A 3CXHH 2LK2A 2K3FA 2OD5A 2AS5F 4HJGH 1O7FA 2E35A 5LEJA 4DJGA 1FZCC 3HYIA 5TISH 1JCCA 1UAAA 3WTUC 3J7ZI 4ZC3A 4PV1C 2OQRA 3QP6A 1LB2A 2PFXA 2VE9A 2OTKE 2V9KA 3H36A 2E75D 1RI7A 1JT6A 3CF5F 4IFMA 4BBSJ 1IRGA 4XKVA 2EFWA 3QPTA 5JFRA 2EIMH 4LB6B 1SQBE 2YKPA 2KP6A 2LKXA 3KZZA 1SQVE 2R44A 4NPEA 1YI2P 2A05A 1ZN5A 4YPCA 4U3FJ 3FMRA 1J2XA 3LFUA 1O3QA 2STWA 5FKNA 4L0YB 4PV1B 4MLOA 2YNYA 1QZZA 3AE3C 5F0HA 3WMM0 1KORA 1AQ5A 2ZMEC 1NU1G 5BS6A 3HE4B 2WZ7A 4UV9A 4H13B 1YIJP 1IO4A 2H1LA 1HGZA 3BG6A 1LTJB 2DMTA 4HX4A 2E2HJ 1O4XA 2R5ZB 3CXHI 2XV4S 1TWFJ 2BY2A 1FZAA 2BBYA 2DMUA 2DCEA 4G7OF 5J3LA 4IFFA 2M30A 2X4HA 1WCMJ 4XKCA 1KU3A 3HM5A 2BCCE 2AXTC 4RO0A 2IA1A 4X1EA 3M9AA 1A6QA 4B48A 2KMUA 2H09A 3H1CA 1KB9E 1SQXJ 1U2WA 2WY7Q 2XHKA 1VL2A 2I1KA 2ZVOB 3CMAI 2ZNZA 1DU6A 1IUFA 5FD5A 5KLVG 3Q5PA 4L9NA 3NRVA 2OUMA 5HS7A 1EC5A 3KP3A 2K37A 3HDDA 2UWJE 3CP2A 3WODF 2FYUE 1MFTA 3IRRA 2EINH 2M0CA 1VF5D 1MFZA 4N9HA 4I2OA 2KIMA 2N1TB 2MC3A 5CVVA 4GO1A 3D70A 2EZHA 1UHMA 2OPTA 2K9JA 4R79A 1FYLA 3F8BA 2HKOA 2AEFA 2L3DA 3WE2A 3TO6A 3MKWB 3S1MJ 1QPMA 3DEUA 1KQSO 3P5JA 1N77A 4EATA 2E1NA 1L3LA 2FXOA 3DLLF 1X58A 1Z9CA 2CV0A 1T2KD 2LBFB 5JLWA 1OLTA 3OYCA 5E17F 2QZ8A 3FIWA 2RNJA 2CQKA 2ZJSE 4G6DA 2ZT9D 3CCRP 3J81Z 3CC2P 4EJWA 3FXDA 3I58A 4XRFA 3L72J 4XONA 5DUIA 1YQAA 4D0PA 1WH5A 1KA8A 1DP3A 1PUEE 2E2JJ 3F8MA 4MEXF 1LPQA 4Z2YA 4H0LD 1JB0J 1FOSF 2R7XA 3ZDMA 2QRXA 2LR8A 1QVUA 4IJAA 2K88A 5LLQA 2XROA 2WT7B 3AE5C 2GLOA 3B6AA 4EI2A 5A2QZ 2LREA 1L2PA 1U5TC 1R5SA 2XB0X 2CV1A 2D2CD 3DTIA 3AEEC 3CUQB 3L73G 1KV4A 3GMEA 3K0LA 1K73Q 3VOPA 2QEXI 4ZYEA 1G3SA 3GTOJ 1BSNA 3DBLB 3LAJA 1GDTA 1NTZG 1NTKD 2HNHA 3RL0g 1R5HA 3BR3A 1L0NJ 3L74G 3M9HA 5IT9K 2QQBA 2OTJI 2Z4EA 5CVJA 1TNTA 5LHIA 4HDUA 5HDKA 3AKZA 5APQA 2R5YB 3RL0B 2PMZN 2L7MP 1URQA 3F5HA 1YJWP 3MAJA 4PCQA 1LWUB 2XSDC 3OYMA 2M3BA 1I27A 1CF7A 2OF7A 3D5RC 5KAFC 2GA1A 2SPZA 2L54A 4QLCU 3AE1C 1KILA 1FDIA 3KCCA 2K9JB 2WMMA 5BQTA 1XGNA 2CUEA 2EPFA 1SQVK 4EVIA 4C30A 2RH0A 2OYIA 3GWZA 2IYPA 2G7UA 4LMYA 5F27A 1SQQJ 4E7JA 5FO5A 1OYIA 4P9UA 1EDIA 4XLNF 1ZRTE 3KHUA 2UWMA 1OCOH 2KLVA 2PRRA 5F6FA 2QM7A 1ZGJA 1VDFA 4H44B 2P67A 3F0CA 3W6KB 2RREA 2XIGA 3BTIA 2JJLA 4PV1D 2GWRA 3IAM2 2HU9A 1NTME 3BQZA 4XLHA 1KYOI 2E76C 2N1TC 4F93B 3E6BA 2O03A 1JJ8C 5IYDJ 3CCSI 4ASWA 4IRIA 4KT5C 4F3QA 3GZ6A 2F5EA 1G2CA 1FMWA 2RKLA 5CMZA 4CUGA 5TGTA 2HZTA 2JSPA 1FP2A 1HKQA 5D6FA 4FE4A 5CPRB 1JMMA 1N7SA 2EZIA 3CCEP 1EZVE 1BSHA 5EGOB 4QIWN 4BDZA 1M7LA 2POHA 2L02A 2YU9J 3K1MA 5CVIA 4GYGA 1JEKA 1ZAOA 1ETYA 1LT1A 4CO8A 3MIWA 4I76A 4PSWA 2JA6J 4Y99C 5K7HA 2GXBA 1AKHB 4U7JA 3IN6A 1ODDA 4U0VA 2YUSA 4I99C 3U1KA 2FYUK 1YG2A 1CI6A 2L5GB 3WUTA 2LDUA 3BOQA 1OCZH 3CJNA 4I01A 2MSYA 1AFOA 2WB1N 5EEHA 1VQ9I 5IP9J 4OWFA 3WU1B 1YJNI 3HUGB 2PJRB 4BJTA 3GFIA 3RBZA 4ENKA 4WXCA 1HUCA 5AVRB 2P81A 2F5FA 3E6CC 4EMSA 4YXWH 2CU7A 4II3A 4DJAA 3L2RA 1PGQA 4A3DJ 4ZMDA 3OS2A 1HF0A
chains in the Genus database with same CATH topology
1BDCA 2M3AA 3OYEA 1HA8A 2K9MA 2Y0SA 4RM2A 1G8XA 1QHGA 3K4CA 1V5FA 2KLOA 2Z2SB 4RMNA 1X4PA 4E7KA 2KZVA 1SS1A 1ZW0A 3W2AA 3W2WA 4DOZA 4HKZH 1Z3XA 2VJIA 1FMVA 3ZCOA 3LMMA 4BU2A 3H5AA 4ZYAA 1JMBA 4HB1A 2XF5A 5HVQC 3FXEA 2LG4A 4HNUA 2HVRA 4BJ6C 4ZJZA 3LSGA 2CUZA 3OR2C 3DPLC 4IOIH 2LH9A 3S32A 3H9JA 3DTEA 3C2HA 2DT6A 2HDWA 1X1CA 1UELB 4C9YA 3QYEA 2X6YA 3PNTA 4XN0A 5JHFA 1PYVA 2BVLA 4RM3A 3OYIA 2Z16A 2Q1KA 2V1NA 4E6KG 1LP1A 3GBGA 2A6TA 2Z1DA 3DU6A 1JI8A 1BR2A 4XOPA 1WJEA 2XSJC 3RSNA 3K70C 2R7RA 2W4SA 3SEZA 3DPTA 4B44A 2QKLB 5CKTA 1EA3A 1YX5A 2K3RA 4BEHB 3LSIA 4RLFA 2CW7A 3DU5A 1DQUA 2MC4A 3VYRB 4CSWA 3EUKL 5FROA 3CZ6A 4KITB 4D9JA 3OL4A 4ZDOA 4K3AA 4XM3A 1WJAA 1EDJA 4ASVA 2IGOA 1Y56A 2JVGA 4BJ5C 1X4OA 1Z3YA 3QODA 1X1BA 1D1BA 4DIQA 3FBNB 2NOJB 4CCJA 2PJRA 1DEEG 4P5OA 3RCOA 2X51A 2KDOA 2L5QA 4XR6A 2JWDA 2QKMB 2WAQA 2R7WA 5LD2C 3S3NA 4NNJA 3IP4B 3TBIA 3FHNA 3EPZA 3M8JA 3PFYA 1W36D 4GODA 2XF7A 4JOMA 4GOFA 4XLEA 3CJQB 1PJRA 4FETA 3OYJA 3F9KA 5CQGA 2R7SA 2KRCA 3K6GA 2R4GA 1DGWY 5KCMA 3H5RA 2MABA 3HC7A 2ELJA 2IXSA 3L2UA 3L2QA 1X1DA 2FUG2 3J7AY 4KT6A 2X6XA 4HEA2 3OOUA 2E1MC 3OIQA 3QWOC 3H35A 1D0XA 3BLYA 3OYHA 4BE1A 5K5GB 2CW8A 5KHDA 3LSMA 3U21A 4HG2A 4PJJA 3UR3C 1R6RA 2VB6A 3K4KA 4D1QA 2UUZA 3VSLA 2LXBA 4DBQA 2DJIA 2VQCA 3H9QA 3FKJA 3EUAA 2KS1B 4Y4RA 3NWSA 3VYTB 2GOXB 1N75A 3ONQA 2CMPA 3HOTA 2ZSIB 3L2WA 3D5SC 3ZR8X 2VXDA 2LY1A 3ZRGA 1OVUA 2X1EA 4ZTFA 4YRVA 2HPIA 4CA0A 1QU3A 2R7TA 2VASA 3FBIB 4CCNA 4GOEA 3DTKA 4NQWB 4HSTA 2KHMA 3S93A 5HLTA 1Q2NA 1Y47A 4P1WA 4WWIA 2LYCA 4BEHA 4XQFA 2W7NA 4BE0A 3A2KA 3BC8A 2WAEA 3CF2A 4IKFA 4ZNCA 4BQQA 3OL3A 3MKYB 2F4IA 2L9NA 5LFAA 3CP8A 3ZGKA 1MNEA 3PNVA 4XORA 5EFWB 3S8PA 3K10A 3DWLE 3LSHA 3TL4X 1Z7LA 4PK4A 4E7ZA 2M5AB 2IS6A 3NWTA 4RLQA 1S9HA 4C2UA 1J09A 2VL8A 4E4HA 4E7LA 2KUBA 3AL0C 5CBOA 1BR1A 4QPQA 4XLAA 3H9GA 2JUGA 4IX7A 1G59A 3BCAA 2VJJA 2R7OA 2P0WA 3PSIA 4CZCA 2IGNA 2CFOA 2KPMA 1D1CA 2WA0A 3EUHC 4ITVA 3AFHA 4Y33A 4Y3OA 3HOSA 4HRIA 1WJCA 2LRDA 3BG7A 3OR1C 2VJ5A 3V42A 3OMYA 2W82A 4PSXA 2KIKA 3QYFA 1U0JA 1D0ZA 3E0JB 1E0EA 3DQVC 3PUBA 2V7FA 2R7VA 3HKZA 4KISA 4J01A 4KJMA 4BQNA 2BW3B 4YELA 2IGMA 2VXZA 3H0DA 2KI7B 3IAS2 4CCOA 2Q2EB 1WJDA 1YE9A 2CV2A 1WFXA 2HVSA 3K4NA 4NC7A 3RGUA 1JM0A 2F5VA 3K4MA 1UG0A 4KJZA 2X1DA 4E7HA 2VPLA 2ZAEB 3RQ4A 1NG6A 4ZDLA 3M1CA 3OYFA 5KNLA 1ZELA 3RTRA 1MMGA 3KEYA 2V6EA 2R7QA 1K6YA 1Y6IA 2X1CA 2B89A 2M7AA 2MD0A 1Z21A 3SEQA 4BS9A 2OC6A 3CESA 4LIVA 3ZQQA 2PMZA 4NUBA 3MD2A 2X85A 2E5NA 4BDYA 3QOEA 4PJMA 2XDVA 2CS3A 5HNHA 4U7BA 2L2OA 2B87B 2QVAA 4OWRB 2WY8Q 4PFPA 4HNTA 4JQFA 4H4KC 4B3XA 1IRXA 5DJTB 4OAYA 4XLFA 4XNFA 3VYUB 2M5AA 2LY2A 3PSFA 2ZXIA 2KRHA 1MMNA 2M0MA 3HXLA 4PJLA 3I9V2 1N78A 2V4JC 1ZXGA 4B47A 2VJ4A 3D5LA 2KZIA 3OS0A 4CPGA 3DPUA 3S3MA 4F92B 1MMAA 3K70D 5DJUB 3SZGA 2GOMA 1WJFA 4B43A 3SDBA 2VKDA 4ZDPA 1BDDA 3AL0B 1DGRM 2K9LA 1OVRA 5FRMA 3OYNA 4LG3A 2XF6A 2E60A 1H0TB 4HJGH 4E7IA 2RNGA 2RQQA 2WAFA 3OYLA 3MZWB 3MKZA 1TZLA 4PFOA 1FC2C 1UAAA 4QPOA 4ZC3A 2HQAA 4FASD 1OR7C 2XAUA 4N4OB 2V9KA 2OTKE 2BW3A 3IUOA 2W1OA 4XKVA 1LDKB 3HG9A 2VLAA 4NC8A 2KP6A 4XLCA 5CQEA 2AQFA 4BGDA 3OYAA 2R44A 1V5EA 4C2TA 4NPEA 3A4CA 3DLAA 3L2VA 3S3OA 1BR4A 2LC2A 2X6WA 3H5NA 3LFUA 3ZXSA 4MLOA 4ZTJA 1SAUA 3OYDA 4CCKA 2VKHA 5FRNA 3BG6A 2LR2A 3OYBA 1X19A 4AU7A 1GLNA 2DOAA 2DCEA 4GRIA 4XL9A 2IS4A 3HPGA 2HPMA 4XKCA 3CMMA 4II2A 2B87A 4B48A 2KMUA 1TT0A 1U7MA 3SYTA 4F91B 4MN4C 2WADA 2WY7Q 2F6CA 2KZJA 4J00A 4IQJA 2OUMA 1EC5A 4IQ4A 2UWJE 1P9QC 2IGKA 2M4GA 1WJ5A 3CP2A 2WBMA 2XC7A 2HR3A 4CH7A 1MFTA 1D1AA 2M4KA 3VYSB 2MFZA 1W36C 4HSRA 3TMOA 4R79A 2B88A 3UNGC 3K4JA 4NPDA 3MMYB 3OYGA 2L9SA 3MKWB 4XKBA 1N77A 1VZ0A 4EATA 5C39A 4X0GA 3VSKA 2CV0A 2LBFB 3OYCA 1OLTA 2VQGA 3RPUD 1KONA 2E1MB 1D0YA 3K4BA 4BXFA 1H0TA 1LKXA 3LSKA 1MMDA 4LIUA 3PJRA 3FXDA 2LOOA 4XONA 1MW7A 1DP3A 3G2BA 4BXLA 2HVQA 3QYBA 3HL2A 4XMYA 2CUJA 2R7XA 3ZDMA 2QRXA 2V26A 3LL7A 4CCMA 3BCBA 3OWTA 2O5RA 4BL0B 1YX3A 3FDYA 1X0TA 3E1SA 2LREA 2LXCB 3VDXA 4N4NB 2BOLA 2ZFUA 4BACA 2CV1A 3DTIA 4HPQA 4PUSA 4XN3A 1QHHD 4DBRA 2IS1A 1NG7A 4F55A 2HNHA 1LVKA 4E7SA 3CJRB 2R7UA 3AKZA 4AYBA 2IS2A 2OV7A 3OYMA 1ERDA 4XKWA 3D5RC 2UV1A 1U7JA 2P58A 2CH0A 2I8DA 1SFKA 3OS1A 2SPZA 2WMMA 3PL8A 1NVOA 2AQEA 2K3PA 4BE2A 2VQHA 2JA2A 4JBZA 4C30A 1WJBA 4DGWB 4LITA 3C2GA 2HZDA 4E7JA 1EDIA 2UWMA 4U87A 2DXIA 3OYKA 4CCLA 5HNFA 2E5ZA 1X1AA 3OY9A 2RREA 2KQRA 4BQOA 3IAM2 2HU9A 4XLHA 4F93B 3K4LA 4IZZA 3HPHA 4BUPA 4ASWA 4AVZA 1LP1B 3KX2A 4F3QA 1V5GA 3W2VA 2ZXHA 1FMWA 2Q1ZB 2BVMA 2L7KA 4YEJA 4F52A 2DT7B 1MNDA 3W3CA 2RKLA 3PH0A 2MYSA 2KL4A 4CUGA 5TGTA 2JSPA 2JVHA 4XOTA 5CPRB 2W00A 1AA7A 1S3JA 4BDZA 2WB1A 3VWBA 1LT1A 2K5CA 4ANJA 1OVVA 2VQLA 4PSWA 1EDKA 2VIXA 3N05A 2LBFA 1BOBA 3KYLA 5CBNA 4EYYQ 3DKYA 3DKXA 1LFPA 3PNYA 3S1KA 1EDLA 3OIPA 3DEEA 2M7BA 4NPFX 3A1YA 2M0BA 1T95A 3HUGB 2PJRB 4BJTA 1T0FC 3I3LA 5HOOA 3MHVA 4G6TB 2ZSHB 3L2RA 4II3A 4DJAA 4K35A 4ZMDA 3OS2A 4PJNA 4OAZA 2A5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDC A;  2B87 B;  2QVA A;  2LXB A;  5C39 A;  5DJT B;  2KS1 B;  1SS1 A;  1ZW0 A;  1H0T A;  2M5A A;  3FXD A;  4HKZ H;  1OVU A;  1JMB A;  4HB1 A;  4BXL A;  4GOE A;  3FXE A;  1Q2N A;  3ZDM A;  1Y47 A;  2QRX A;  4WWI A;  1ZXG A;  2KZI A;  1X0T A;  4IOI H;  4CPG A;  2LXC B;  4ZNC A;  5DJU B;  1BDD A;  5EFW B;  1OVR A;  2Q1K A;  1H0T B;  2M5A B;  4HJG H;  1LP1 A;  3MZW B;  1FC2 C;  1U7J A;  2P58 A;  2I8D A;  2SPZ A;  2KUB A;  2OTK E;  2WMM A;  1NVO A;  5CBO A;  4JBZ A;  2K3R A;  1EDI A;  2R44 A;  4NPE A;  4K3A A;  1EDJ A;  4ASV A;  4ASW A;  1LP1 B;  2KIK A;  2LR2 A;  2RKL A;  1DEE G;  3PH0 A;  2KL4 A;  2JWD A;  4KJM A;  1S3J A;  2KI7 B;  2B87 A;  1LT1 A;  1OVV A;  1EDK A;  4GOD A;  1U7M A;  3RGU A;  1JM0 A;  4MN4 C;  4GOF A;  5CBN A;  2KZJ A;  4EYY Q;  2ZAE B;  1EC5 A;  2UWJ E;  3S1K A;  2HR3 A;  1EDL A;  1MFT A;  4NPF X;  2B89 A;  2M0B A;  3MHV A;  2OC6 A;  4K35 A;  3QWO C;  4ZMD A;  2B88 A;  4NPD A;  5K5G B; 
#chains in the Genus database with same CATH topology
 1ZLK A;  5D5V B;  3A7O A;  2OYI B;  4ZKP A;  4LG0 A;  2K9M A;  4RM2 A;  4HQE A;  2LKS A;  5K7F A;  1B72 A;  3Q9V A;  2FY8 A;  1BE3 D;  1GW4 A;  1R5I D;  2MG4 A;  2Z2S B;  3CO7 C;  2V1X A;  3G9R A;  4RMN A;  3M9Q A;  2K9N A;  2KK7 A;  3AEB C;  5AW3 B;  1JKR C;  4M6Y A;  3W2W A;  4C3H J;  5AVT B;  5J6X A;  2NVX J;  4L9J A;  5L3B A;  3BTJ A;  4OIN F;  3P7K A;  2D2W A;  2XAG A;  3H5A A;  1SQB G;  4WY4 A;  2E7X A;  3HOX J;  4I7Z B;  1Z6T A;  3FXE A;  1MBF A;  2HVR A;  3LQR A;  3D1N I;  2P5L C;  3V2N A;  1R58 A;  3WTW C;  1N7S B;  2E2I J;  2XPV A;  3OR2 C;  2Y0D A;  1CGP A;  4IOI H;  3H9J A;  2WQY C;  2HDD A;  3TGU J;  3NAU A;  2DT6 A;  3JRE A;  1UEL B;  2WPR A;  5E3L A;  3QYE A;  5GAD J;  1NKN A;  4XN0 A;  2R3C A;  1PYV A;  3H1L J;  3V8J A;  1F4K A;  3PP5 A;  1WVR A;  3VOE A;  1MSF C;  4UB8 E;  2CW0 F;  2YX7 A;  4B8X A;  4EQQ A;  1FBM A;  2YIU C;  1S5L X;  1LP1 A;  1JE8 A;  4HH2 A;  2Z99 A;  2KNC A;  1KQ0 A;  4XOP A;  4BXU A;  1WJE A;  2XSJ C;  4JX6 A;  3RSN A;  1FYM A;  2K9Q A;  3K70 C;  4A3M J;  2R7R A;  3AED C;  2W4S A;  5E79 C;  3SEZ A;  4ESF A;  3L7W A;  4OGQ B;  2A5Y B;  1S72 P;  2QKL B;  5CKT A;  3I59 A;  4P55 A;  3IL2 A;  4A3J J;  1ZME C;  2D1H A;  1NTM K;  1WPK A;  2CW7 A;  5GAG J;  3DU5 A;  4H44 D;  5CJ0 A;  2ID6 A;  5AVU B;  3VYR B;  1B72 B;  4CSW A;  1P84 H;  1L0N D;  2FML A;  1LEB A;  3B71 A;  3OL4 A;  1FDO A;  4A0X A;  2Y75 A;  1KIL C;  3R2P A;  2JT1 A;  2K27 A;  1V55 H;  4ASV A;  3PJS K;  4IHX A;  2IA0 A;  2JVG A;  4BJ5 C;  1VQ7 P;  1X4O A;  3HTS B;  4YII A;  5AVZ B;  1NJI Q;  3I5C A;  1SFC C;  3CME I;  3GTK J;  2Y2Z A;  3VMY A;  3M0A A;  4WY4 B;  2L5Q A;  1K61 A;  3GEZ A;  1RF1 A;  1J2J B;  2QG4 A;  1SQQ D;  1OPC A;  5CJ9 A;  1M56 D;  1IK7 A;  2HOS A;  1OW6 A;  1XPX A;  4RB0 A;  1PGO A;  2B7E A;  1PP9 E;  3M8J A;  2Q3E A;  4GOD A;  2XF7 A;  4JOM A;  3ITK A;  2NRA C;  3V4W A;  2P6S A;  4GOF A;  3ZN0 A;  1JT0 A;  3S1R J;  1PJR A;  2JPC A;  1ETX A;  4L18 B;  3OYJ A;  2R7S A;  3FXR A;  2KRC A;  4V19 K;  1ZGW A;  1Q90 D;  2FMY A;  2AXT E;  3AE9 C;  3WTY C;  1P84 I;  2FRH A;  3MP7 B;  5KCM A;  1VQO I;  1YIT P;  1FBS A;  4XLP F;  2KNC B;  1PPJ D;  3AAF A;  2MAB A;  4DYR A;  3IAO A;  3V2P A;  1KU7 A;  2BXY A;  2IXS A;  1U9O A;  3JCU C;  3PIO F;  1IFM A;  2EJR A;  1C0W A;  3CXH E;  4KT6 A;  2X6X A;  4HEA 2;  4UB6 C;  3TGN A;  2E1M C;  3GW2 A;  3HBL A;  3S2H J;  1YS7 A;  3JRG A;  3GG2 A;  3OYH A;  1WT6 A;  4BE1 A;  5TIS E;  4XBF A;  1OFC X;  5J47 A;  3U1D A;  3LSM A;  3QU6 A;  4HG2 A;  3FK6 A;  3U21 A;  5BMZ A;  4BNC A;  1IC2 A;  2IZ1 A;  3LQQ A;  4UVA A;  3H92 A;  2F5C A;  1LQ1 A;  3VYI A;  1FOS E;  2CJJ A;  2BEZ F;  2EFP A;  3D71 A;  5B5E C;  3GTL J;  1SQV J;  3H9Q A;  1DDN A;  3H3V K;  1YJ9 P;  1L0L D;  1W2E A;  3HSE A;  3F8F A;  2GOX B;  1N75 A;  3ONQ A;  2W83 C;  1VQP P;  1YYC A;  1ZRE A;  2ZSI B;  4LC1 A;  4WK8 F;  3L2W A;  2QJK B;  1D3Y A;  2FF4 A;  2VXD A;  3FXO A;  2R7D A;  3CDL A;  3SDG A;  2HPI A;  1T08 B;  1HBX G;  3FZV A;  4B4C A;  2VBX A;  4CCN A;  4NQW B;  1RUN A;  4JPZ B;  2QEN A;  5CVU A;  1IXR C;  1G1I A;  3S4R A;  5D5U B;  1YYV A;  1NHA A;  1USS A;  2FQ4 A;  2GBY A;  2IJL A;  2LYC A;  2ZXE B;  1RF1 B;  4IFD K;  3I53 A;  4NBQ A;  5FKO A;  2M8E A;  4BBR J;  2HFE D;  3VB2 A;  1IRZ A;  1D8J A;  2BCC J;  2H88 C;  2QSI A;  3R6S A;  5BNG A;  1BI0 A;  3VMA A;  1KC8 Q;  1YIJ I;  3CPW O;  1BCC G;  1ZLJ A;  2FOW A;  3WGH A;  3J80 K;  2KDZ A;  2ECB A;  3WU2 H;  5CCG C;  5KJ7 C;  2F4O B;  2JWA A;  4DCK A;  4RJT A;  1HQC A;  2N9B A;  2DA3 A;  1Z7L A;  4E7Z A;  2M5A B;  3C3W A;  2IS6 A;  5M1B A;  1XTG B;  2FYU J;  1S9H A;  5E18 F;  2HYN A;  3B5N C;  3H1H J;  4D6T J;  2OCC H;  1A6I A;  4OGQ D;  4KIF A;  5KVR A;  3KP4 A;  3BDD A;  4AVP A;  4WX9 A;  4E7L A;  3QRF F;  1T6A A;  2HG5 D;  1BR1 A;  4QPQ A;  1WH7 A;  4QWQ A;  5F0C A;  1RE3 A;  1FSE A;  2JUG A;  3TGU D;  1DD3 A;  1IFN A;  2GIV A;  2R7O A;  3GZN B;  4HOB A;  1TLH B;  1R5L A;  1VQK P;  1V54 H;  1T0F A;  2F4M B;  3H1L D;  3EFF K;  2NPS B;  2LSO A;  2DN0 A;  1BE3 E;  3IC7 A;  4HRI A;  4Y3O A;  2VBY A;  2NVT J;  3ABU A;  5ED4 A;  3OR1 C;  4UHT A;  2AHQ A;  2RMZ A;  3V42 A;  1ORK A;  1ZR2 A;  3JSV C;  3OMY A;  3VP9 A;  1STZ A;  3E0J B;  1E0E A;  3ABV C;  3U59 A;  1N73 A;  3LW5 J;  3I5U A;  3HKZ A;  1OW8 A;  3CQZ J;  1M8O B;  4GT1 A;  3D0S A;  3HD7 C;  3LIE A;  2FBK A;  1IN7 A;  1JUS A;  1JKP C;  1XTA A;  2YX4 A;  3HGY A;  2Y0M A;  4LOC A;  4YEL A;  5B1B H;  5HDN A;  1GL2 C;  3TNU A;  2JRM A;  2ZJP F;  1FX7 A;  3CCR I;  5KAI C;  4LD5 A;  3CC2 I;  3K4N A;  4NC7 A;  3HRN A;  2GA2 A;  1B9M A;  1RIO H;  2OCE A;  4S0H B;  3TK1 A;  1Z56 A;  3EWK A;  2F5V A;  2KS1 A;  1UG0 A;  4KJZ A;  2NAZ A;  5E8I A;  5CCH C;  3V4Q A;  1X3U A;  3LW5 H;  4A69 C;  1A36 A;  4M3F A;  2BY3 A;  4M9S A;  5EEG A;  2V1U A;  3OYF A;  3OJA B;  2DMP A;  1LVA A;  1ZEL A;  2LKM A;  1O3R A;  2R5B A;  1VQ4 P;  2OTL P;  3SWK A;  3BJA A;  2B0L A;  2EK5 A;  3CWB G;  2KSE A;  3DXJ F;  4HV6 A;  2X1C A;  4MHG A;  2MD0 A;  4MGR A;  1M90 Q;  2MW8 A;  3V6I A;  2OC6 A;  3CES A;  1Z1D A;  1F9N A;  3P9C A;  1MDM B;  2DA2 A;  4LIV A;  2QCO A;  3ZQQ A;  2YMK A;  4HQM A;  2E5N A;  2X85 A;  3PFI A;  1NKZ B;  3QOE A;  2E7W A;  4PJM A;  2L2O A;  5AIQ A;  3BR2 A;  2FNA A;  3Q5F A;  1HW2 A;  4OWR B;  2WY8 Q;  2Y9Z A;  4FCY A;  3I4P A;  5DJT B;  2OQG A;  1YJW I;  4IHW A;  4IRG A;  3S2W A;  2Q8K A;  3ULQ B;  5CVR A;  4XLF A;  4BHB A;  5GTH C;  2O9L A;  1NTM J;  1DH3 A;  4UUS A;  1F5T A;  1ITY A;  1FDM A;  4OU0 A;  3VYU B;  3HB9 A;  2H6B A;  3D6Z A;  1YTZ T;  4MEY F;  4BHC A;  2JP3 A;  1CQT A;  3JAM K;  1MMN A;  4EJV A;  3NTN A;  3GTQ J;  5AW8 B;  2E71 A;  1RES A;  5FKK A;  2WSE H;  4EOT A;  3HXL A;  1EXJ A;  4PJL A;  3ROU A;  4Y13 A;  3SFI A;  1R5G A;  3KE2 A;  1FZE A;  2V4J C;  5AW5 B;  4B47 A;  1IW7 F;  1BN5 A;  3OS0 A;  1MV8 A;  3KYD B;  3S3M A;  1SQV D;  1QX8 A;  2A45 G;  5DJU B;  1RH5 B;  3SZG A;  2EFO A;  5E1W A;  3BCC J;  2WC2 A;  1TU3 F;  2NS7 A;  2ZB9 A;  3IR9 A;  3L71 E;  1UFM A;  1DGR M;  3AL0 B;  2EV0 A;  1G3W A;  4UNO A;  5APV A;  4BRY A;  5DM7 F;  4JF7 A;  4E7I A;  2RQQ A;  3CCE I;  3MZW B;  4JP0 A;  2E76 B;  3LFK A;  1UJ8 A;  5JLX A;  5APT A;  4QPO A;  1FIA A;  2H94 A;  3BQY A;  3F3X A;  3KZI C;  1H0M A;  2HOT A;  1PPJ E;  3T97 A;  2FXM A;  2BW3 A;  1XX5 A;  1TWC J;  3IUO A;  3M4O J;  1IXS B;  2BCC D;  3B8E B;  1HC8 A;  4NC8 A;  4C2M J;  2IBD A;  3CO6 C;  1NTK G;  1GV2 A;  2ETH A;  3MQ0 A;  4UVC A;  1V5E A;  4C2T A;  2NS0 A;  4OOI A;  1S7A A;  1NHL A;  1YQ4 C;  2NPS D;  1BM9 A;  3A4C A;  3DLA A;  2MBF A;  1IJD B;  1S1C X;  4A12 A;  1AQT A;  2HOD B;  3R0J A;  1L0L E;  3M0D A;  1BBY A;  1IAW A;  3CCU I;  1ONV A;  1X2M A;  4ESB A;  4ZTJ A;  4A3L J;  2FYU D;  2D45 A;  2STT A;  2P2U A;  3OYD A;  1YFH A;  3N97 A;  4RB2 C;  5J4Y A;  3KFW X;  2O1J A;  3H1H D;  4AC0 A;  4D5F A;  5FRN A;  4D6T D;  2J5O A;  5AON A;  1UIX A;  2P10 A;  1WI3 A;  3WE3 A;  1APL C;  4AU7 A;  1SFU A;  3SFE C;  1IFD A;  2PLY A;  4LGW A;  4XL9 A;  3II6 A;  3M7G A;  4M71 A;  2WPQ A;  2P7V B;  4II2 A;  3FWL A;  2W85 A;  3CCM P;  1XTC C;  1X3Z B;  2EIK H;  5IOZ A;  3DP7 A;  3T8T A;  1T2K A;  2HDC A;  1MBG A;  2KZJ A;  5E3O A;  4J00 A;  2FU4 A;  1Q1H A;  2FYN C;  3H1J E;  1K79 A;  2OBP A;  2IEK A;  5GPA A;  1K05 A;  1LTS C;  3E5U A;  4IQ4 A;  5FLX K;  2M4G A;  1PDN C;  2YXR B;  2V9V A;  1WJ5 A;  2QYO A;  2XC7 A;  4BRY B;  1VQN P;  1QRY A;  4CH7 A;  4IOC F;  1LE8 A;  1AOY A;  1D1A A;  3CDI A;  3K1N A;  1GHC A;  2RV8 A;  4HAM A;  3M1E A;  2RAE A;  2MFZ A;  3O6Q B;  2DI3 A;  4HSR A;  4HYT B;  3T97 B;  4M6X A;  1YHQ P;  1HW5 A;  2B88 A;  3AEG C;  3K4J A;  1VQM I;  4U3F G;  3MMY B;  3HSR A;  4JBA A;  4HLY A;  2DW4 A;  4Y15 A;  3TGU E;  2WSC H;  5IYB J;  4X0G A;  2N9Y B;  2VQG A;  1O57 A;  5APS A;  3ZPL A;  3R4Y A;  1KON A;  4PJ0 H;  4MTE A;  1K4T A;  2XGE A;  4P96 A;  5CHX A;  3MZY A;  2QE7 H;  4BXF A;  2M2E A;  3LSK A;  4LIU A;  1ETQ A;  5FKM A;  1S72 I;  3ZQ7 A;  1B8I B;  1FZF A;  2WWY A;  1FJL A;  1P84 E;  1Z6R A;  1HXD A;  3KQG A;  3QYB A;  1R49 A;  4KT0 J;  2A68 F;  4FHT A;  2DU9 A;  4W1U A;  1FJP A;  1JHH A;  1X79 B;  4CCM A;  1BE3 G;  3OWT A;  4KA4 A;  2Q3I A;  5DV5 A;  1YX3 A;  3FDY A;  4RGR A;  3E1S A;  1I6H J;  2VBZ A;  2PX9 A;  1PP9 J;  3AG3 H;  2BOL A;  1FJK A;  2ZFU A;  2IFM A;  2O1K A;  3FGA D;  2LF7 A;  1Y8R B;  2OQQ A;  4XN3 A;  1R36 A;  2QSG X;  1QHH D;  3IHU A;  1NTM D;  1A5J A;  1FTT A;  4E7S A;  4I7H A;  5EG0 B;  3TO7 A;  3L35 A;  5DM6 F;  5AW0 B;  1Y1W J;  4EDF A;  1OCP A;  3EYI A;  3HE4 A;  2EQR A;  3HSF A;  1N7L A;  2NVU B;  4PDK A;  3JRB A;  2HLO A;  1U9N A;  2OV7 A;  3CDH A;  3Q9S A;  1PP8 F;  1LTJ A;  1ERD A;  3A5T A;  1Y39 A;  5AVX B;  1JGS A;  1RPW A;  2CH0 A;  3OS1 A;  2Q9I A;  2HWV A;  1SVM A;  1S4X A;  2IBZ D;  1ZTR A;  2I10 A;  1LDJ A;  4BE2 A;  2ZME B;  2JA2 A;  2VQH A;  4JBZ A;  1WJB A;  1SD6 A;  4DGW B;  4F7Z A;  4LIT A;  2V4H A;  1NYH A;  1V3F A;  3I55 P;  3B4S A;  1Q82 Q;  1A04 A;  4ESJ A;  3OYK A;  4CCL A;  2DXI A;  4C7R A;  3MZ8 A;  1X1A A;  3BCC D;  4PJ0 C;  2N8G A;  3CC4 I;  2D2C B;  1YIT I;  1YW8 A;  5KLV K;  4BQO A;  5AW4 B;  3CMY A;  4IZZ A;  3E97 A;  5DD8 A;  1IN6 A;  1E17 A;  1KU2 A;  2E34 A;  2XGC A;  2P6T A;  1JTY A;  5E1X A;  2GUS A;  2HOA A;  2Q1Z B;  2L7K A;  1MND A;  3W3C A;  2A06 D;  3FWN A;  2MYS A;  2P5V A;  5HOD A;  4WWC A;  2GUV A;  2KB7 P;  5BU8 B;  1YS6 A;  4L73 A;  2WV0 A;  4IHV A;  1AA7 A;  1P6R A;  4DYQ A;  1YJ9 I;  3GLM A;  3P8C D;  3KET A;  2GZW A;  5JR3 A;  2DO7 A;  1L0N G;  2E42 A;  3FK7 A;  2K5C A;  1OIP A;  1VQP I;  2QBY B;  4ANJ A;  1RE4 A;  1OVV A;  2VQL A;  1GVD A;  5APY A;  4BXX J;  3N05 A;  2LBF A;  3L9F A;  2ZYA A;  2ZXW H;  1IGN A;  2Z9O A;  4V2G A;  1L4A D;  3K9T A;  5K5Q A;  2ZO4 A;  1EKE A;  1IZN B;  3DKY A;  2Z3Y A;  3DKX A;  2E74 D;  3E7L A;  2M34 A;  3RK3 C;  3BRO A;  2V79 A;  3QP5 A;  3OIP A;  3DEE A;  4Q48 A;  3LID A;  1SQQ G;  1RKW A;  5IP7 J;  2P1J A;  1MD0 A;  1J1D C;  3WU2 E;  3I3L A;  1WHU A;  2JMW A;  3MHV A;  1JNM A;  4G6T B;  4I02 A;  2D5V A;  4IF4 A;  2NVY J;  4K35 A;  1WSU A;  2WT7 A;  3L36 A;  2X0L A;  2BY0 A;  5J1U A;  4CYC B;  3K4L A;  2JZY A;  1KFM A;  2O01 J;  2L7Z A;  1G8X A;  1ZAR A;  3CUQ A;  3FXL A;  3BG3 A;  1OR7 A;  2R7Z J;  1T3J A;  1X4P A;  2XKP A;  3RJP A;  2KZV A;  4YIR X;  1BE3 J;  4N3Y B;  1ZW0 A;  1M1J C;  3PQJ A;  1W5C C;  4CXF A;  2NNN A;  3V8L A;  3H3U A;  2JA8 J;  1RR7 A;  1BJA A;  1B4A A;  1S7O A;  2R5Y A;  1O7L A;  1DPU A;  2HS5 A;  2AEJ A;  4BU2 A;  1LWU A;  3K1P A;  1JMB A;  4ZYA A;  4HB1 A;  1OCR H;  2O01 H;  2R92 J;  3H1H E;  4D6T E;  2QM3 A;  3ERE D;  3ELK A;  4L5E A;  1FZB A;  1QVG O;  4AIH A;  4HNU A;  3MZH A;  4BJ6 C;  4ZJZ A;  5KAF H;  3UKG A;  1XD7 A;  2DTZ A;  3GVA A;  3I0T A;  3AE2 C;  1H88 A;  1L0L G;  3WGG A;  3DTE A;  3ABT A;  4NB5 A;  3ECO A;  2RKH A;  1ZK8 A;  3WTX C;  1GW3 A;  4C9Y A;  2PAJ A;  1R1T A;  2DW3 A;  3WGI A;  4I2L C;  2QF7 A;  1LGH B;  1N25 A;  3MCZ A;  4M73 A;  3KPH A;  4U88 A;  2WTE A;  2WV1 A;  4ASN A;  1TQP A;  1FYK A;  2XKO A;  2Y30 A;  3GHG C;  2Z16 A;  2L4A A;  2V1N A;  2W57 A;  2LLK A;  2HQR A;  2A6T A;  3L75 D;  1J5Y A;  1UG2 A;  4AUX A;  1E3O C;  2ZCW A;  2K9Y A;  3DPT A;  1EA3 A;  5H6Q A;  5GTI H;  3A0H C;  3RKX A;  3LA7 A;  5EGO A;  4A93 J;  1PP9 D;  3LSI A;  2K9S A;  3S1N J;  4H13 C;  1KYO H;  2DFI A;  3FF5 A;  1BW5 A;  1VQ4 I;  4JQ0 D;  4A0Y A;  1DQU A;  2OTL I;  4CYD A;  1AKH A;  4O9B A;  1W1W E;  2LF8 A;  1WJA A;  3EDP A;  2RDP A;  1JY3 P;  2UZK A;  1P7I A;  3ISP A;  1LTI C;  1Z3Y A;  5IT9 Z;  1O3S A;  1QLE D;  2IFN A;  3QOD A;  3W68 A;  4Y99 B;  1RF0 C;  4DIQ A;  3FBN B;  3HUG A;  4CCJ A;  2PJR A;  1VQ6 I;  3CXH D;  2G9W A;  1RQV A;  3C2B A;  3RCO A;  3PIP F;  3TGU G;  1MGT A;  1Y9B A;  5J8C A;  2P4W A;  3U9G A;  4KIB A;  2WAQ A;  2NRG A;  3H1L G;  3NQO A;  5KJ7 D;  2O0Y A;  3CCJ P;  2JPB A;  4MIM A;  3Q5S A;  2CYY A;  1POG A;  3FHN A;  3HHG A;  3TYY A;  3FHZ A;  3COA C;  4OMY A;  4ZYH A;  2QA4 P;  2BHY A;  3CCL P;  3CJQ B;  2HTS A;  3MTU E;  5BPI A;  5D4R A;  4FET A;  3CI9 A;  4KMU X;  3F9K A;  5CQG A;  3K2Z A;  4MFE A;  2JR8 A;  3K6G A;  4AWX B;  5ICE A;  3WTZ A;  2JSC A;  1K6O A;  2XND H;  3HC7 A;  1HCR A;  1GUU A;  3L2U A;  1YW9 A;  5GTI C;  4HW0 A;  1PP7 U;  5IOY A;  2RQP A;  5K5G B;  1MNM C;  2IBZ E;  2OYO A;  4KN7 X;  1XMX A;  1IFI A;  3KZY A;  3K4K A;  3IKT A;  4G7H F;  3J7A O;  3VSL A;  3DV8 A;  4MTD A;  1ZGA A;  2VQC A;  3RQI A;  3F22 A;  2QIW A;  3BCC E;  4Y4R A;  3NWS A;  2MLG A;  1IZ1 A;  2R93 J;  4A7P A;  1L0L J;  3VTP C;  2A3S A;  2VOP A;  3KIO A;  1AU7 A;  1CSB A;  3D5S C;  2LY1 A;  4ZYG A;  2CFX A;  1ON2 A;  3ZRG A;  5FJ8 J;  1OVU A;  2X1E A;  1LJ9 A;  4O6J A;  4ZTF A;  1D8K A;  4YRV A;  1DUX C;  2VAS A;  4ENM A;  1IO2 A;  2BEO A;  4A3G J;  2EBI A;  1JY3 N;  2IYO A;  3FM5 A;  2A06 E;  1BOA A;  4P1W A;  1S6L A;  3FXJ A;  3ZOB A;  4IPA A;  5E79 H;  3ABM H;  3HIF A;  4EGZ A;  1IN8 A;  4BE0 A;  3P8C E;  3RL0 C;  3BC8 A;  4YG2 F;  4IKF A;  1JKO C;  2DA6 A;  4A5M A;  3CP8 A;  3KYC B;  3ZGK A;  1A02 F;  1YLF A;  1QGP A;  2VE8 A;  4KHX A;  3NAR A;  1VPC A;  3H1J J;  2UXN A;  5ILV A;  3ABK H;  3DWL E;  1H88 C;  1WZ2 A;  3Q1M A;  2L9V A;  5KTB A;  3NWT A;  2ZJR F;  1R7J A;  2WWW A;  4KIC A;  1T8I A;  2TDX A;  2I5U A;  2E76 D;  2WSF J;  3CCM I;  2N1T D;  1J1E B;  3HUS B;  1U8B A;  2KUB A;  5ILS A;  1I1G A;  1DD4 A;  1SQV G;  2B63 J;  3E1I A;  2DFH A;  1J75 A;  1L0O C;  5AW1 B;  2K4J A;  1CZQ A;  1N8R Q;  5EZG A;  2VJJ A;  1EQ7 A;  1CW5 A;  1SFC B;  2P0W A;  1XMA A;  5DS9 A;  2AO9 A;  1Y8Q B;  3PSI A;  1VQN I;  5L8R J;  3QU3 A;  3L2C A;  1LTB C;  2CFO A;  3H1K J;  3BR0 A;  1KYO D;  4BAY A;  1FAV A;  2WSF H;  3F6V A;  4DZP A;  2QJY B;  3K5B A;  4PSX A;  3BPV A;  3WG9 A;  2HPC B;  2GXA A;  1GTW A;  1U0J A;  1D0Z A;  2QSF X;  5HLG A;  3HOV J;  1B6A A;  3PUB A;  1P4A A;  4BH9 A;  1N86 A;  2Y0E A;  3GMA A;  4PJ0 E;  2R7V A;  2BCC G;  1QZE A;  2G8Y A;  1UB9 A;  4J01 A;  5EF6 A;  1AJY A;  4KJM A;  3DFG A;  4C3J J;  5IYC J;  2F48 A;  2M8G X;  3RK2 C;  2VXZ A;  3JCU H;  2KI7 B;  4UB6 H;  1YE9 A;  3HHH A;  2BAS A;  2HVS A;  1URQ C;  3RGU A;  2FYU G;  4QTR A;  4LLL A;  2B9S A;  3TSI A;  2P5K A;  3HKZ N;  5B5E H;  1YBK A;  4E7H A;  3H1H G;  4D6T G;  2VPL A;  2ZAE B;  2DA1 A;  4ZDL A;  2CPS A;  3CLO A;  3Q0U A;  5KNL A;  2OYI C;  1Q1V A;  3T0Y A;  3N7N A;  3IFM A;  2V6E A;  3HRS A;  3ZQL A;  1XMK A;  5BOX A;  1HKT A;  3GTJ J;  3LSP A;  1Z21 A;  3SEQ A;  3KEO A;  4NQW A;  3L75 E;  4BS9 A;  3WHB A;  5GAE J;  2K4B A;  2DMN A;  1QPI A;  2PMZ A;  4NUB A;  1ZG3 A;  1QL2 A;  1WQ2 A;  1XS9 A;  4BDY A;  1BL0 A;  3PRJ A;  1A31 A;  2XDV A;  2CS3 A;  3ZQG A;  5HNH A;  4U7B A;  2B87 B;  1Y0N A;  5ICG A;  2QVA A;  5B66 C;  4JQF A;  4WCG A;  1FE6 A;  4GDF A;  4OAY A;  3JRH A;  1KFN A;  2ZYD A;  4IL6 C;  4C3I J;  4EV0 A;  4XRS A;  4Y28 J;  3L70 J;  3CLQ A;  1N7S C;  4XNF A;  1ZYR F;  1DP7 P;  2ZKZ A;  2M5A A;  2LY2 A;  1E79 H;  1I3A A;  3M3Y J;  2BY1 A;  3BT9 A;  1H9T A;  3BPX A;  2VC0 A;  5HS8 A;  2VRS A;  3ASO H;  4L9V A;  3I55 I;  1U8R A;  1HST A;  3GZ5 A;  3FXK A;  3HTK B;  1W5C E;  2WTY A;  3MWM A;  2KZI A;  3VPR A;  2VJ4 A;  3WG7 H;  1JY3 O;  2XV5 A;  4CPG A;  4RAY A;  2XNX A;  2FXA A;  4FE7 A;  3DPU A;  4F92 B;  1MMA A;  4UXN A;  3B5N B;  3K70 D;  2GOM A;  2NPS A;  4HZF A;  1WJF A;  2M5W A;  3O8H A;  4B43 A;  3V2Q A;  3QOP A;  2VKD A;  4ZDP A;  3GFJ A;  5H2F C;  1VQ8 P;  5APX A;  1QVF O;  3L37 A;  3HJE A;  2XPW A;  2XF6 A;  3M8F A;  3JTG A;  1UII A;  1H0T B;  2RNG A;  2WAF A;  1FTZ A;  3MKZ A;  1TZL A;  4PFO A;  2LMD A;  2PGD A;  1FZP B;  2J59 M;  5TJJ A;  3ASN H;  2VC1 A;  5KK1 A;  1QQI A;  1W7P B;  2MLK A;  2O6G E;  2VOD A;  1KIL D;  1WWX A;  1FOY A;  1MZB A;  4N4O B;  2IZ0 A;  2FSW A;  2DDA A;  4EIJ A;  1S7E A;  1YI2 I;  2DT5 A;  3PUF A;  4XID A;  1SP4 A;  5KKZ B;  3R61 A;  2H6C A;  4A5N A;  2ISY A;  1JY2 P;  4LLG F;  1IDZ A;  1NTM G;  2FKW B;  1SFC D;  4KMF A;  1ZHF A;  5JI6 A;  3BG9 A;  2AQF A;  4BGD A;  1XC5 A;  3OYA A;  1KYZ A;  3H1J D;  4WY4 C;  5KAI H;  3BJO A;  4FX4 A;  1NWQ A;  4XSX F;  3RDI A;  1BR4 A;  3S16 J;  3ZXS A;  3RZO J;  2CK3 H;  2WSS H;  4LK1 F;  1I1S A;  1GL2 B;  2QJP C;  2DYS H;  4Q47 A;  1PVE A;  1SAU A;  2FD5 A;  3J80 Z;  1PGP A;  4Q5S F;  2VKH A;  1EZV G;  2IBZ G;  2PEX A;  2KIU A;  3OYB A;  3SSU A;  2DMQ A;  1T33 A;  1X19 A;  3GLL A;  3P9K A;  5ERI A;  3WTT C;  1D5V A;  1GLN A;  2DOA A;  4A2U A;  1MDM A;  4RGX A;  3CC7 P;  4GRI A;  3A01 B;  3MKL A;  2IS4 A;  2H8P D;  3HPG A;  3T8R A;  3BCC G;  3CMM A;  2ME6 A;  3A0B C;  5F64 A;  5M5W J;  1T3U A;  1QO0 D;  1LEA A;  1FWZ A;  2NZ2 A;  3TDK A;  2EIL H;  2ZC2 A;  1TT0 A;  4K2E A;  4OIO F;  2H8R A;  2HYJ A;  1U7M A;  1P4X A;  4F91 B;  1W5S A;  3H1K D;  1YO5 C;  2F6C A;  1XGO A;  5JHU A;  1ZG1 A;  1RRJ A;  2AEM A;  5AW6 B;  5KAF E;  2YPR A;  4M3B A;  1LT9 A;  1XGS A;  1X9V A;  3FKI J;  3L71 J;  1KQ9 A;  2DPD A;  1P9Q C;  3JRF A;  1J59 A;  5GTH H;  2R0Q C;  2WBM A;  2CQX A;  2ZVN B;  4WXH A;  1P84 D;  3L74 D;  3DBH B;  2M4K A;  2MGQ A;  3VYS B;  5DCM A;  3C9I A;  2Q7C A;  5EJC A;  1W36 C;  3JRA A;  2H1K A;  1RC9 A;  3TMO A;  2ESN A;  1YRN B;  5F1R A;  2AXL A;  4GCV A;  4FX0 A;  3AE4 C;  3JRD A;  1SQP K;  5AVV B;  4XKB A;  3LST A;  5LGN A;  1K8A Q;  2OYH A;  1VZ0 A;  1G2H A;  5FFZ A;  2JTV A;  4Y7N J;  4EJT A;  3RPU D;  4JYC A;  1MJ9 A;  1TWH J;  4ENN A;  1GXP A;  5GTI E;  1IN4 A;  1JY2 N;  4N78 D;  1Z7U A;  3RBX A;  2M9H A;  3FMQ A;  1D0Y A;  3K4B A;  1RF1 C;  4R4M A;  5EEA A;  1KYO E;  4GGG A;  1LKX A;  3PJR A;  1MMD A;  3OSF A;  2R32 A;  2LOO A;  2NYX A;  4N6J A;  1Y0U A;  3B6C A;  3SFD C;  1MW7 A;  2K1A A;  3G2B A;  4BXL A;  3O2P E;  4ZZD A;  3NFQ A;  1YOV B;  2C0W A;  3EUH A;  4PGG A;  3HL2 A;  2XAF A;  1RUO A;  2NVQ J;  1G3T A;  4XMY A;  2CUJ A;  1GMJ A;  3LWF A;  2H8W A;  3L1P A;  5LGT A;  1IK9 A;  2V26 A;  2L01 A;  2VKE A;  4FTH A;  3KZI H;  3LL7 A;  5HS9 A;  2O5R A;  4BL0 B;  3V4G A;  1P2F A;  3FWE A;  3J7Y J;  1ZN2 A;  4RDU A;  3RKQ A;  3GTM J;  1KB9 I;  3VDX A;  4N4N B;  2QSH X;  3H0G J;  4U7D A;  3B5N D;  2WSE J;  4BAC A;  2E1O A;  4HPQ A;  1K83 J;  1PGJ A;  2XPU A;  3BRV B;  2W6B A;  3FX0 A;  2IS1 A;  3EFG A;  1NG7 A;  3IWF A;  3L70 D;  2HOD A;  5AVW B;  1WGX A;  2ICW G;  1LT9 B;  4E70 A;  1KZU B;  2KT0 A;  4O3M A;  4XRM A;  4A3F J;  2QEX P;  2FFD A;  4AYB A;  2IS2 A;  3BZK A;  1ZR4 A;  5M5Y J;  3K7A J;  2MH9 A;  1NH4 A;  1W7P D;  1PL5 A;  1PFI A;  4XKW A;  3CCJ I;  2PP6 A;  3KP2 A;  3QPH A;  5DCM B;  3ZQI A;  1YTY A;  2P58 A;  4HX7 A;  3SQN A;  3JAM Z;  4EGY A;  3QQA A;  9ANT A;  1I39 A;  3PL8 A;  1BJZ A;  1MBJ A;  4HA8 A;  2K3P A;  2AQE A;  1I6X A;  1SD5 A;  2QA4 I;  3CCL I;  3MUD A;  2HZD A;  3HOW J;  2Z5H A;  1QA6 A;  4U87 A;  1AWC A;  4OIP F;  5HNF A;  2E5Z A;  2DOE A;  3R4K A;  2EFQ A;  5M3M J;  3OY9 A;  3H6P A;  1OYY A;  3HD7 D;  1ETV A;  1W0T A;  2KQR A;  3TO9 A;  2RN7 A;  2WPS A;  2VOO A;  1ZOY C;  1FZG A;  1L4A A;  1FC3 A;  1OKR A;  4OIQ F;  1GL2 D;  2KFD A;  3HPH A;  2PG4 A;  2CG4 A;  4AVZ A;  5AW7 B;  3I71 A;  1V5G A;  5F1J A;  3KDP B;  2ZXH A;  1IN5 A;  2H7H A;  4CIC A;  1MBK A;  2DA4 A;  2TRT A;  5CCH D;  2BVM A;  4YEJ A;  4IRH A;  4F52 A;  2DT7 B;  3O6Q A;  3PH0 A;  1PP9 G;  5APU A;  2FYN B;  3CCS P;  2CRG A;  1Z67 A;  1NU1 E;  2JVH A;  4JYB A;  4XOT A;  1QEX A;  2W00 A;  4DZJ A;  1S29 A;  3BAS A;  3BP8 A;  1JUN A;  1OIS A;  2QQ9 A;  2VT2 A;  4YIF A;  3VWB A;  2M45 A;  2JRT A;  2J5P A;  1VTN C;  1REP C;  1SVO A;  3H25 A;  4GFB A;  2VIX A;  1BOB A;  4RAG A;  4W7Z A;  2MJZ A;  4PZJ A;  3F72 A;  5E79 E;  3NEU A;  3RYP A;  2V7Q J;  4DT0 A;  5C4X J;  5L3D A;  3O8G A;  3S1K A;  1FSH A;  1RE3 C;  1ZG5 A;  5KLV E;  1H9G A;  1B8I A;  3P9I A;  4MQV A;  2FFD B;  2M7B A;  2XGX A;  4NPF X;  4JK1 X;  4RA2 A;  3O3K A;  1T95 A;  2M0B A;  2JKV A;  1XSD A;  1T0F C;  5HOO A;  5BU5 A;  2HGC A;  3M9B A;  1FIP A;  1UST A;  3MVP A;  2IPP A;  1SQX K;  3IWZ A;  1KIL E;  1FBQ A;  2KYV A;  2Y0C A;  4PD4 H;  2X6O A;  1BIB A;  3BRT B;  2FA5 A;  1YJN P;  2A5W A;  5HDG A;  1KZH A;  1EH6 A;  5KLI C;  2JUC A;  2DPU A;  3CCQ P;  1FT9 A;  2M3A A;  4UVB A;  1HA8 A;  2V7Q H;  3T1B A;  2Y0S A;  4G8X A;  1GU5 A;  1QHG A;  5BPD A;  3K4C A;  4G7Z F;  1ZQ3 P;  1N73 C;  3GFM A;  1V5F A;  2KLO A;  1NK2 P;  3L71 D;  2Y9Y A;  1G1J A;  4LGD E;  1SS1 A;  1HDP A;  5EG0 A;  1M1K Q;  1L4A B;  3I56 P;  1FEX A;  1HVV A;  1SFO J;  1JY2 O;  4HX8 A;  4DOZ A;  3M07 A;  3E7K A;  2E74 B;  1Z3X A;  5ICC A;  2WSC J;  5FLX Z;  1U6G A;  1D5Y A;  1FMV A;  5HLH A;  2XAS A;  2CGP A;  1SLQ A;  3E1R A;  2HFH A;  3KPE A;  1XSX A;  2JJ7 A;  3ZMV A;  4IL6 E;  1HJB A;  2LG4 A;  3BY6 A;  1VQL P;  2YO2 A;  2MH2 A;  4M3G A;  2ZME A;  3LSG A;  4NC6 A;  5J8F A;  2CUZ A;  1PZQ A;  3DPL C;  1XN7 A;  1LFB A;  5L3G A;  4EM1 A;  1MZ9 A;  4GIF A;  1OJL A;  4PD4 I;  1Z05 A;  2IA2 A;  2FNP A;  2X6Y A;  2M87 A;  3PNT A;  3GYH X;  3H1K E;  5JHF A;  2PN6 A;  3JCU E;  4UB6 E;  2W90 A;  1HJ0 A;  2BVL A;  4RM3 A;  1YTZ I;  1ZLL A;  3OYI A;  2Q1K A;  3L73 E;  1O3T A;  4UY8 I;  4QSH A;  4C7N B;  1KU9 A;  3DCF A;  3DU6 A;  2CWE A;  3RYR A;  3IF4 A;  3L74 E;  5B5E E;  4MO7 A;  5H2F E;  3L75 J;  5LHH A;  2LFB A;  1USD A;  3R0A A;  3ZQF A;  1YX5 A;  1HDD C;  4L76 A;  4M6V A;  1BC7 C;  4L74 A;  3BTC A;  4BEH B;  5IY5 H;  2Y31 A;  3S2D J;  1FZC B;  1L0N K;  2CO5 A;  2QBY A;  2OYH B;  5AW2 B;  4X6A J;  1FBU A;  2EA2 A;  3DKW A;  3EUK L;  1VQ7 I;  4KIT B;  1SQP J;  1TBX A;  3HTU A;  1PUF B;  1FLI A;  5AIP A;  2QLZ A;  4K3A A;  4XM3 A;  3VN0 A;  6PAX A;  2E75 C;  4N78 E;  3SWF A;  1DEB A;  3OA7 A;  1Y56 A;  2WIT A;  3Q3S A;  2FYZ A;  5DUK A;  4HF1 A;  4GDO A;  3PO2 J;  1NU1 K;  4KUM A;  1JJ6 C;  3G71 P;  1IDY A;  3K69 A;  2NOJ B;  3PQK A;  4NHJ A;  2X51 A;  1T98 A;  2KDO A;  4XR6 A;  3Q0V A;  4EM2 A;  1LFU P;  2JWD A;  1IF1 A;  2QKM B;  3BR5 A;  1ACI A;  4G9Y A;  2JDI H;  4CYC A;  2LTP A;  2CQ7 A;  3RK3 B;  1I3Q J;  3EYY A;  4I6M C;  4NNJ A;  2A45 H;  1EV7 A;  2KJC A;  4U0Y A;  1FOW A;  3B73 A;  3WHC A;  1J1D B;  2WVR A;  3HE5 B;  5IT3 A;  2OZU A;  5AVY B;  4FIS A;  4IHT A;  3BTL A;  5D4S A;  4M3D A;  2MKV A;  3L70 E;  4ZH4 F;  3S9O A;  1QNT A;  1XDU A;  1U3E M;  3A0B E;  2KIF A;  1U5T A;  1XCB A;  2WAQ N;  2Z5I A;  2FBI A;  2W6J H;  4UUV A;  1B1B A;  1G4D A;  4A3C J;  3OAK A;  3A02 A;  2ELJ A;  1HSJ A;  2IT0 A;  2M1B A;  1X1D A;  5K5R A;  3L2Q A;  1M1J B;  3OOU A;  1UHW A;  1LTG C;  2C6Y A;  3QWO C;  4UB8 C;  1VQ5 P;  3KP5 A;  1D0X A;  3M0D C;  1JKQ C;  1VQ8 I;  2V1D A;  4PJJ A;  2XGD A;  1GT0 C;  1NAF A;  3UR3 C;  1R6R A;  4QMA A;  3SZT A;  5E3N A;  2UUZ A;  4XA4 A;  1HF9 A;  4PD4 D;  2DJI A;  3C8V A;  1VF5 C;  1K9M Q;  2G3A A;  3DEW A;  1U57 A;  2QUF A;  2A45 I;  2A6H F;  5L3F A;  3AE6 C;  1W2B O;  2X48 A;  3F89 A;  3F8N A;  3LSR A;  2OAZ A;  3KLO A;  1FS0 E;  3LOC A;  4MNU A;  1FOX A;  4D7M A;  4DW6 A;  2E43 A;  2XUB A;  1SAN A;  3DBR B;  5KAI E;  4CA0 A;  1QU3 A;  3FBI B;  4GOE A;  4R4L A;  5FLM J;  1ZRD A;  1T2K C;  2N1T A;  1Y47 A;  2OJE D;  4WWI A;  1LUJ B;  2GXG A;  3F21 A;  1BGY D;  3GHG B;  2EV5 A;  3BG5 A;  2IRF G;  1S5L H;  2YKO A;  5E20 A;  3M8E A;  1R71 A;  3A2K A;  2ZT9 C;  4OVN F;  4M9X A;  3A0H H;  2FJ1 A;  4ZNC A;  4BQQ A;  3OL3 A;  1E3H A;  2F4I A;  2L9N A;  4CZZ A;  3MKY B;  1NK3 P;  1KQG B;  1MNE A;  3ML6 A;  3PNV A;  5EFW B;  1GD2 E;  1NTZ K;  1H89 A;  3S8P A;  4H0L C;  5CLS A;  2YU3 A;  3HOZ J;  4A0Z A;  3MEX A;  5CYV A;  3CC7 I;  4PK4 A;  3S15 J;  1PPJ G;  2W6A A;  3TKY A;  1XSV A;  3JRC A;  1U5T B;  2XAJ A;  2ZNY A;  4C2U A;  4I09 A;  2I1J A;  2A07 F;  1J09 A;  1R4N B;  2BHZ A;  3TED A;  1J9I A;  2VL8 A;  4E4H A;  3HOU J;  1KQL A;  2D2C C;  2FQ3 A;  3LSJ A;  3CWB D;  5GTH E;  2UXX A;  3KP6 A;  5CBO A;  1ENH A;  4Z6Y A;  1VQK I;  2C9L Y;  3OW2 O;  2ZJ2 A;  1HH0 A;  2D1V A;  2IP2 A;  3AG4 H;  1KGS A;  2EH3 A;  3BCA A;  3EQL F;  3HZJ A;  4EJU A;  1G59 A;  4DOJ A;  2Y48 A;  2E5Y A;  4HYE A;  1NOH A;  2H27 A;  2YXQ B;  4CZC A;  4IHY A;  3CX5 H;  2IGN A;  2KPM A;  4UUT A;  1ETO A;  2EA4 A;  3HOS A;  4ITV A;  5FGM A;  1DPR A;  3AFH A;  4LK0 F;  2LKP A;  3G1M A;  1WMK A;  3JW4 A;  2LRD A;  3WUV A;  3CD6 P;  2VN2 A;  2VJ5 A;  5TIS C;  1SEU A;  3ZMD A;  1ZKG A;  4L0Z B;  2DFF A;  3ZMS A;  3DQV C;  4RAZ A;  1A02 J;  4I0A A;  2V7F A;  4FQG A;  3M06 A;  2AXC A;  3IH2 A;  5EZH A;  1S5L C;  2W25 A;  2XDJ A;  1GV5 A;  4RAF A;  4V2F A;  3V5B A;  2QQA A;  4BQN A;  4LB5 A;  1EH7 A;  4JX4 A;  3TP0 A;  1AA0 A;  1XCV A;  2IGM A;  1KMI Z;  1UZC A;  2X9D A;  3H0D A;  1QL1 A;  2VON A;  2ITA A;  3RK3 D;  4HF2 A;  2R7F A;  3RKY A;  3BAT A;  3H1J G;  1LTA C;  3CTA A;  1MMS A;  3A2A A;  2VUM J;  3O8Z A;  4M3E A;  2L9R A;  1SQP D;  2EV6 A;  1R9T J;  1LTJ C;  3KZI E;  3K4M A;  1XDS A;  3J81 K;  1EF4 A;  2X1D A;  1LTT C;  1MH4 A;  1UMQ A;  1HWT C;  3H1I J;  5AVQ B;  1MSE C;  2P7J A;  3RTR A;  1JTX A;  4HV5 A;  1MMG A;  3CX5 I;  1X1P A;  1QVT A;  4KNY A;  1UHS A;  1SFX A;  5E1Z B;  2MA3 A;  2R7Q A;  5LBQ A;  1GXQ A;  1Y6I A;  2DOD A;  1ON1 A;  2M7A A;  2OZ6 A;  5K1Y A;  2OAR A;  1V4R A;  2W48 A;  3GTG J;  3JC2 2;  1IXC A;  5A2Q K;  3P32 A;  2HTJ A;  3N4M A;  3H1K G;  5LRR A;  2RGV A;  4L5J A;  1I5Z A;  5J40 A;  3KXD A;  2FE3 A;  5BVZ A;  1TQM A;  4TT3 H;  4MQ9 F;  3JRI A;  3QH9 A;  2XZR A;  3GTP J;  4YFK F;  3A3Y B;  1GZL A;  1R1U A;  1FNN A;  2C9N Y;  5D8L B;  5C3E J;  4L9T A;  1JXS A;  3ZMT A;  3LNQ A;  2FX0 A;  3W67 A;  4AYC A;  3TOA A;  3PSF A;  5JVG F;  3ZMZ A;  1JOC A;  2WPV B;  1Q7Y Q;  2Q0O A;  4MFD A;  3HRU A;  1RE4 C;  4LLH A;  1K78 A;  1IUY A;  2M0M A;  4DQ2 A;  2C0X A;  3CL3 D;  1SMY F;  2O3F A;  1SQB K;  3HUS A;  4RGS A;  3MN2 A;  3RZD J;  1NU1 J;  1J0R A;  2DLL A;  3MFK A;  1N78 A;  1MUU A;  3AEC C;  3GF3 A;  4A6E A;  2R5D A;  1HTL C;  3L09 A;  1IC8 A;  1JHF A;  3OV8 A;  1LNQ A;  1SFC A;  4RES B;  4BYY A;  3F8C A;  5E8G A;  4GXO A;  3F23 A;  2K9L A;  2VT3 A;  2W24 A;  1OVR A;  2YO3 A;  3OYN A;  4LG3 A;  2E60 A;  5DD4 A;  4AIK A;  4H13 D;  2HPC A;  3LA3 A;  5D5X B;  3S1Q J;  5FFX A;  4P9F A;  3OYL A;  1BCC E;  2YMY A;  2QGU A;  3B02 A;  3IH3 A;  1FC2 C;  3C1L A;  5AVS B;  5KLV J;  3USS A;  3RKW A;  3C7J A;  2ME0 A;  2R3S A;  3CUQ C;  1NTC A;  3IRQ A;  2HQA A;  4FAS D;  3G4S P;  1OR7 C;  2XAU A;  3GX4 X;  1H89 C;  2J58 A;  1BIA A;  2W84 A;  2W1O A;  4A3E J;  2MD5 A;  1LDK B;  2DYR H;  2YIU B;  3HG9 A;  3UIA A;  2VLA A;  1QGK B;  2HYG D;  3L70 G;  2KP8 A;  4XLC A;  5CQE A;  3V7S A;  2RN0 A;  4U3F D;  2COM A;  1NH3 A;  1LWU C;  2DQR A;  2O3J A;  1Z77 A;  5M5X J;  4I1L A;  2IVM A;  4PD4 E;  1VFC A;  3L2V A;  5K7Z A;  2LNB A;  2X6W A;  2LC2 A;  3H5N A;  3S3O A;  3RK2 B;  4KYW A;  3Q0W A;  3CCV P;  1X22 A;  3CX5 D;  5K5O A;  1G6N A;  2DJN A;  4YFX F;  4CCK A;  4ZYD A;  1URQ B;  1WRJ A;  2LR2 A;  1RNL A;  1DIP A;  3FXU A;  1X2N A;  3CCU P;  3CCQ I;  1CF7 B;  3V7C A;  2ISZ A;  1K78 B;  4H44 C;  3HOY J;  2EIJ H;  4D5C A;  5LGU A;  4ABZ A;  2CSO A;  5D5W B;  3MD0 A;  1KIL B;  1OCC H;  1TT5 B;  3R60 A;  2OA4 A;  1Y1V J;  3JTH A;  2HPM A;  2BE5 F;  5F04 A;  1BGY E;  3S17 J;  1ZV8 A;  1SQX D;  2A61 A;  2B87 A;  3AE7 C;  1KN7 A;  5IP6 A;  3I56 I;  2DFE A;  4XRS G;  3SYT A;  4MN4 C;  2WAD A;  1IFP A;  5CJ4 A;  2H43 A;  3RPU A;  1RKT A;  2OGU A;  4IQJ A;  1Z91 A;  5B66 H;  1P4W A;  3L4F A;  1JCD A;  1LJ2 A;  2IGK A;  5LHG A;  3V7R A;  1SVF A;  4IL6 H;  5APW A;  4XK4 A;  1KTM A;  3RI4 A;  1VQL I;  3L73 J;  1BI2 A;  2HR3 A;  2XAH A;  1NTZ J;  1G2C B;  1EXI A;  3H32 A;  2F5D A;  3TOB A;  4B1R A;  3L74 J;  2NNY A;  1DU0 A;  2XRL A;  1HGV A;  3HTK A;  4H0E A;  5KJ7 A;  5CCG A;  1I50 J;  3GCM A;  3UNG C;  3CWB E;  4S04 A;  4NPD A;  3EET A;  4DNC A;  2YSR A;  2L9S A;  3OYG A;  4A3K J;  1KQ8 A;  4R8H A;  3U2R A;  1RHZ B;  3B5N A;  2M8R A;  1KYW A;  4AIJ A;  5C39 A;  3VSK A;  1KQF B;  1B9N A;  2XB5 A;  2HKX A;  2P7C B;  1VQM P;  2EB7 A;  1YIO A;  2P8T A;  3H1I D;  1CI6 B;  2E1M B;  3L72 D;  1PV3 A;  2LVS A;  3RL0 D;  4M72 A;  3CJT B;  5H2F H;  1H0T A;  2PMH A;  1Q81 Q;  1TW2 A;  1Z0X A;  2BZT A;  2DK8 A;  2HI3 A;  1F43 A;  4I98 B;  3WTS C;  3VOD A;  4G6Q A;  1W7P A;  2HVQ A;  2PJP A;  3AG1 H;  2W8Z A;  3TQN A;  3S14 J;  3FIS A;  4WF2 A;  3NXS A;  3BR6 A;  1OQY A;  5F08 A;  3BCB A;  1ZRF A;  4A3B J;  1X0T A;  3VMZ A;  3L71 G;  2KZG A;  2BYV E;  3RK3 E;  1ETK A;  2E36 A;  5D8K B;  2LXC B;  2K85 A;  2ECC A;  2NXN B;  4LG0 B;  5B3S H;  2L0K A;  4PUS A;  4YFN F;  2KKO A;  3HD7 A;  5FKL A;  3HUS C;  3G71 I;  3TDU C;  1J1E C;  1SQP E;  4DBR A;  4I7Z C;  4TV7 A;  4F55 A;  2ZXX A;  3V2R A;  1LVK A;  3CJR B;  2XKM A;  2L7F P;  1TTY A;  3SXY A;  3RIR A;  2R7U A;  2IAI A;  5IPA A;  1GL2 A;  4YTP C;  2IW5 A;  1YQ3 C;  4D7N A;  5H6R A;  1R23 A;  5ILU A;  5CCH A;  1OXZ A;  2JO1 A;  3H32 B;  2UV1 A;  1U7J A;  1NU1 D;  2I8D A;  1SFK A;  1S8N A;  3A01 A;  4BY1 J;  1NVO A;  2QJP B;  4IHS A;  2ELK A;  2QJY C;  2PMU A;  1XG1 A;  4N9I A;  3ZN1 A;  3C2G A;  4A3I J;  1P92 A;  2ZFC A;  3SWY A;  2HXO A;  4S05 A;  3W6V A;  3U1C A;  4B09 A;  4AYB N;  4I6Z A;  3OSG A;  3A0B H;  2ELH A;  1MH3 A;  1X8Y A;  1SFE A;  3RK2 D;  4OGQ C;  1MIJ A;  3I4N J;  1NTK E;  3GFL A;  5C44 J;  4AQR D;  4KIG A;  4BUP A;  3G6E P;  5KLV D;  3CC4 P;  1VQ5 I;  1LP1 B;  1URQ D;  3KX2 A;  2F2E A;  5J1Y A;  3W2V A;  2KIS A;  1RET A;  3SJM A;  3AEF C;  2CUF A;  2EWN A;  2FOK A;  5GPC A;  2KL4 A;  3QPS A;  2DA7 A;  1YRN A;  1F1Z A;  2DOF A;  1SD4 A;  4Y17 A;  2G0E A;  3T5X A;  3VFZ A;  1S3J A;  3G1O A;  2EFN A;  2JQ7 A;  3TW7 A;  2WB1 A;  3NMD A;  3I59 B;  1SQB J;  3ZMU A;  5C4J J;  2Z33 A;  3OOP A;  1E5W A;  2K7L A;  4IXA A;  3VEP A;  3IH4 A;  1EDK A;  1OZH A;  1USE A;  1Y8A A;  3G73 A;  3KYL A;  3PO3 J;  4CDG A;  1S5L E;  4EYY Q;  2O8X A;  1MBH A;  3HD7 B;  1YW7 A;  2W27 A;  4LJZ F;  1RY3 A;  3A0H E;  1LFP A;  3PNY A;  3E5Q A;  1BW6 A;  1EDL A;  3MGN A;  3GF2 A;  4HF0 A;  2KSJ A;  1OCT C;  2ZBK A;  2QM8 A;  4KDP A;  2O8K A;  3A1Y A;  1H8A A;  4B3A A;  1VI0 A;  4CHU A;  4RB3 C;  2YS9 A;  1TWA J;  1ZRC A;  3HEF A;  3KLN A;  1WRG A;  2ZSH B;  1N7S D;  2VPR A;  2CPB A;  1D7M A;  5D6E A;  2GAU A;  3QAH A;  3GF7 A;  3M91 A;  5DEQ A;  3AEA C;  2A69 F;  4OAZ A;  4PJN A;  2ESH A;  2PBI A;  4RBO A;  4O5V A;  4GKG A;  1BDC A;  3OYE A;  1E3P A;  4R1H A;  2JN6 A;  1NO4 A;  2COB A;  1S9K D;  2HQN A;  4BHP A;  3U1A A;  4U3F E;  4E7K A;  5TJH A;  1UCR A;  3CUO A;  4Q4Z F;  3I64 A;  3W2A A;  3DF8 A;  3L73 D;  3D6Y A;  3HRT A;  2OU2 A;  1U78 A;  4HKZ H;  1XGM A;  4ZZL A;  2A06 G;  1NTZ D;  3BJ6 A;  2VJI A;  3ESW B;  3CMA P;  3ZCO A;  2DDB A;  2LP0 A;  3LMM A;  3CX5 E;  4W7Y A;  5J4V A;  2Y0S N;  2XF5 A;  5HVQ C;  1A35 A;  2EZL A;  1KB9 H;  5J1R A;  1W0U A;  2B9B A;  1GVJ A;  2LH9 A;  3S32 A;  4ETS A;  4Y52 J;  3CD6 I;  2NS8 A;  2QJK C;  1P7J A;  4WVZ A;  3C2H A;  1SQX E;  1TL8 A;  1T56 A;  2HDW A;  2XAQ A;  1X1C A;  1BI1 A;  3GLX A;  4N0B A;  4PGH A;  2ID3 A;  2FBW C;  3PLN A;  1QZY A;  3GXO A;  2HQ5 A;  5M3F J;  5KKZ C;  3REO A;  5TRD A;  2JA7 J;  3IV5 A;  1VND A;  4E6K G;  1HBW A;  2DBB A;  3GBG A;  1S2E A;  5EDN A;  1LNW A;  2KRF A;  4M9Z A;  2Z1D A;  1BGY G;  1JI8 A;  1BR2 A;  4WY4 D;  4GYI A;  3WU0 A;  1JGG A;  3HGG A;  1SMT A;  4B44 A;  4OIR F;  2K3R A;  4HLX A;  4IO9 F;  5B1A H;  1ZH5 A;  4RLF A;  3BWG A;  1N2D C;  1MJA A;  2JWT A;  4CGZ A;  2V9P A;  1NTK K;  2CQN A;  2MC4 A;  1GK4 A;  2TCT A;  3WU2 C;  5FRO A;  3CZ6 A;  2GQQ A;  4D9J A;  2IDB A;  2VI6 A;  4RGU A;  4ZDO A;  4KFC A;  4JX5 A;  1R22 A;  1TW3 A;  3H1I E;  3E5X A;  1EDJ A;  1FPQ A;  3JSP A;  4G94 A;  2IGO A;  3FXM A;  3L72 E;  5FD6 A;  2FEZ A;  1X1B A;  4AID A;  1D1B A;  3GUD A;  2KLU A;  2E1C A;  3ZQC A;  1DEE G;  4P5O A;  2OTJ P;  1PIX A;  2NPS C;  1JO5 A;  1WKM A;  2BXZ A;  3FMS A;  1TWG J;  2G7H A;  3K2A A;  4IVN A;  3G3Z A;  5HLI A;  2BEQ D;  4WB4 A;  3P7N A;  2Y69 H;  2RVC A;  2R7W A;  4BKX A;  4L5I A;  5LD2 C;  3S3N A;  3JSO A;  2M3E A;  2IPQ X;  4IL6 X;  1SC7 A;  3JR9 A;  1VQ6 P;  2HOE A;  3IP4 B;  3TBI A;  3EQ2 A;  4W80 A;  3EPZ A;  3PFY A;  1W36 D;  3LA2 A;  1R1V A;  2DQL A;  1FY7 A;  1W5T A;  4M3L A;  3IKV A;  3E6D A;  4XLE A;  5L3E A;  2DK5 A;  2ZJQ F;  1L0N E;  1FU1 A;  5JVT A;  1ZP0 C;  3L75 G;  2L4M A;  1IG7 A;  5KLI B;  1VF9 A;  1M57 D;  1T8Z A;  2R4G A;  1DGW Y;  5EYR A;  1BA5 A;  1BCC J;  3O6B B;  4C46 A;  1N73 B;  3H5R A;  4EJO A;  3TP3 A;  3A03 A;  4ON0 A;  1NAY A;  4AUW A;  1AV1 A;  4YXD C;  2EZK A;  2FUG 2;  1XB4 A;  3J7A Y;  4A6D A;  3N4X A;  3OIQ A;  3PTZ A;  3H35 A;  1SQP G;  3BLY A;  4LFU A;  1SQB D;  2CW8 A;  1TP4 A;  2K40 A;  4AD9 A;  5KHD A;  1JTH A;  1SQQ E;  5GP9 A;  4WBA A;  3TNU B;  4RS8 A;  2VB6 A;  4D1Q A;  4Z1M H;  3V8K A;  1SVL A;  3FXQ A;  2LXB A;  4DBQ A;  1H8A C;  1IV8 A;  4BQA A;  3W6J B;  3FKJ A;  3EUA A;  2KS1 B;  2JK3 A;  1OW7 A;  1OX3 A;  1NGM B;  3VYT B;  1TQI A;  2YR2 A;  2CMP A;  3HOT A;  3G4S I;  2Q5U A;  3ZR8 X;  4IOA F;  2XU6 A;  2O01 N;  4C7N A;  2HXI A;  3AG2 H;  2DA5 A;  3ZP5 A;  2R7T A;  3C18 A;  3DTK A;  2QVO A;  1AVY A;  4HST A;  2KHM A;  3S93 A;  5HLT A;  1Q2N A;  1LT9 C;  4L75 A;  2Q2E A;  4HBL A;  1VQ9 P;  3L00 A;  4DZO A;  4W97 A;  4BEH A;  4XQF A;  5FLV A;  2W7N A;  1FZC A;  1BI3 A;  3GO5 A;  1T38 A;  1BGY J;  1KB9 D;  3SFZ A;  2WAE A;  3CF2 A;  2O7O A;  3CCV I;  4HDV A;  1OYW A;  2KIQ A;  5LFA A;  1IFJ A;  4TLF A;  5H20 A;  4XOR A;  4G12 A;  1F36 A;  1PUF A;  4AM3 A;  3QWL A;  4UUS B;  3K10 A;  4U0W A;  2A6E F;  1Q86 Q;  3LSH A;  3TL4 X;  1HOM A;  4RLQ A;  5L3C A;  2ADU A;  3BZ6 A;  4IEJ A;  2ZYG A;  5B66 E;  4LLN A;  2OYH C;  5LRS A;  5AW9 B;  3Q3D A;  1JUP A;  4B86 A;  3HE5 A;  3Q2Y A;  2GM4 A;  4XE5 B;  4XIC A;  1EZV I;  3AL0 C;  2E75 B;  2IBZ I;  3WUU A;  4XLA A;  1HW1 A;  3H9G A;  1HKS A;  3SZP A;  2LD5 A;  2ACJ A;  3CWB J;  5DDG A;  3VMX A;  1T39 A;  4IX7 A;  1JTH B;  2L91 A;  4BY7 J;  1M1E B;  3FX3 A;  1J7K A;  3LAP A;  1IJW C;  2VBW A;  1GK6 A;  1D1C A;  2WA0 A;  1SD7 A;  3EUH C;  4Y33 A;  1S9K E;  4I0B A;  5CBN A;  1WJC A;  3BG7 A;  2K02 A;  3G1L A;  5E3M A;  3BR1 A;  2W82 A;  2DAO A;  2KIK A;  3QYF A;  1T6S A;  1E2X A;  1ULY A;  1NTZ E;  1DX7 A;  5DYM A;  2QQ8 A;  4KIS A;  2YKQ A;  1GU4 A;  2KXP B;  1MKM A;  5LEK A;  4DYC A;  1M1J A;  5GAH J;  2BW3 B;  2ZXJ A;  3IAS 2;  4M74 A;  2Q2E B;  4CCO A;  1WJD A;  4EEF G;  5FB2 A;  2CV2 A;  1WFX A;  4UB8 H;  5CCG D;  1G3Y A;  2FFD C;  2JEE A;  3H3Z A;  3TW6 A;  2O61 A;  1JM0 A;  4FT8 A;  4XSZ F;  1OWA A;  1FP1 D;  4OMZ A;  3H1L E;  3PHL A;  2E19 A;  2XRN A;  3CCY A;  3VP8 A;  3RQ4 A;  3GW6 A;  3BVH A;  1NG6 A;  2J5U A;  3M1C A;  2H89 C;  1MJB A;  2E5T A;  1AVO A;  3MUD C;  4KN4 X;  3TDZ C;  1BC8 C;  1RQU A;  3KEY A;  1K6Y A;  1VF5 B;  1QBJ A;  2B89 A;  3ECH A;  1B59 A;  3KYQ A;  2HYF A;  1R00 A;  1SQQ K;  2RC4 A;  4WXD A;  1K04 A;  1SQX G;  3TF5 A;  2QWW A;  3KEQ A;  1ETW A;  5F0F A;  1SAX A;  1L4A C;  3GHG A;  1EH8 A;  1ZRT D;  1EJ9 A;  3MD2 A;  1WI9 A;  5DTD A;  1YHQ I;  3ERM A;  3SHF A;  2E74 C;  3CME P;  4UV8 A;  3FM3 A;  1LDD A;  1K4S A;  1W4M A;  2BV6 A;  3C1D A;  2IX7 C;  1R8E A;  4PFP A;  2V6C A;  4B3X A;  4H4K C;  3X2Q H;  4HNT A;  1IRX A;  3F6O A;  3Q5R A;  2KOG A;  3BZC A;  4ZKU A;  3RPQ A;  1TNS A;  1KD1 Q;  4J19 A;  1OMI A;  2BGC A;  1NTK J;  2ZT9 B;  2LY9 A;  1BCC D;  1IRF A;  3WTV C;  2ZXI A;  1MBE A;  1LE8 B;  2GIZ A;  2Z5U A;  2KRH A;  1TC3 C;  5ICF A;  2R5Z A;  2PI0 A;  3E3V A;  2Q6Q A;  4XFJ A;  1RR8 C;  1RZ4 A;  2K86 A;  2DTR A;  3I54 A;  1JUM A;  1HLV A;  4BWN A;  5DCF A;  3QPL A;  1EZV D;  1IV6 A;  1R4M B;  3I9V 2;  3OIO A;  3ZQH A;  4H0L B;  3KP7 A;  1ZXG A;  4OH8 B;  3D5L A;  2NOG A;  1VQO P;  3P8M C;  2VKV A;  4HNV A;  2FBH A;  3I4M J;  2ZFW A;  3HRM A;  3AE8 C;  2KJB A;  2PQ8 A;  2PFB A;  3ABL H;  2JA5 J;  4JYK A;  3H1I G;  1L0L K;  2FXP A;  1AHD P;  1RF0 A;  3L72 G;  2HEO A;  2AXT H;  3E6M A;  3PM1 A;  3G6E I;  4ENJ A;  1X3W B;  4EM0 B;  3SDB A;  1FOK A;  1BDD A;  2XVC A;  4NDL A;  2CQQ A;  1K7A A;  4RKU J;  5FRM A;  4RB1 A;  3CXH H;  2LK2 A;  2K3F A;  2OD5 A;  2AS5 F;  4HJG H;  1O7F A;  2E35 A;  5LEJ A;  4DJG A;  1FZC C;  3HYI A;  5TIS H;  1JCC A;  1UAA A;  3WTU C;  3J7Z I;  4ZC3 A;  4PV1 C;  2OQR A;  3QP6 A;  1LB2 A;  2PFX A;  2VE9 A;  2OTK E;  2V9K A;  3H36 A;  2E75 D;  1RI7 A;  1JT6 A;  3CF5 F;  4IFM A;  4BBS J;  1IRG A;  4XKV A;  2EFW A;  3QPT A;  5JFR A;  2EIM H;  4LB6 B;  1SQB E;  2YKP A;  2KP6 A;  2LKX A;  3KZZ A;  1SQV E;  2R44 A;  4NPE A;  1YI2 P;  2A05 A;  1ZN5 A;  4YPC A;  4U3F J;  3FMR A;  1J2X A;  3LFU A;  1O3Q A;  2STW A;  5FKN A;  4L0Y B;  4PV1 B;  4MLO A;  2YNY A;  1QZZ A;  3AE3 C;  5F0H A;  3WMM 0;  1KOR A;  1AQ5 A;  2ZME C;  1NU1 G;  5BS6 A;  3HE4 B;  2WZ7 A;  4UV9 A;  4H13 B;  1YIJ P;  1IO4 A;  2H1L A;  1HGZ A;  3BG6 A;  1LTJ B;  2DMT A;  4HX4 A;  2E2H J;  1O4X A;  2R5Z B;  3CXH I;  2XV4 S;  1TWF J;  2BY2 A;  1FZA A;  2BBY A;  2DMU A;  2DCE A;  4G7O F;  5J3L A;  4IFF A;  2M30 A;  2X4H A;  1WCM J;  4XKC A;  1KU3 A;  3HM5 A;  2BCC E;  2AXT C;  4RO0 A;  2IA1 A;  4X1E A;  3M9A A;  1A6Q A;  4B48 A;  2KMU A;  2H09 A;  3H1C A;  1KB9 E;  1SQX J;  1U2W A;  2WY7 Q;  2XHK A;  1VL2 A;  2I1K A;  2ZVO B;  3CMA I;  2ZNZ A;  1DU6 A;  1IUF A;  5FD5 A;  5KLV G;  3Q5P A;  4L9N A;  3NRV A;  2OUM A;  5HS7 A;  1EC5 A;  3KP3 A;  2K37 A;  3HDD A;  2UWJ E;  3CP2 A;  3WOD F;  2FYU E;  1MFT A;  3IRR A;  2EIN H;  2M0C A;  1VF5 D;  1MFZ A;  4N9H A;  4I2O A;  2KIM A;  2N1T B;  2MC3 A;  5CVV A;  4GO1 A;  3D70 A;  2EZH A;  1UHM A;  2OPT A;  2K9J A;  4R79 A;  1FYL A;  3F8B A;  2HKO A;  2AEF A;  2L3D A;  3WE2 A;  3TO6 A;  3MKW B;  3S1M J;  1QPM A;  3DEU A;  1KQS O;  3P5J A;  1N77 A;  4EAT A;  2E1N A;  1L3L A;  2FXO A;  3DLL F;  1X58 A;  1Z9C A;  2CV0 A;  1T2K D;  2LBF B;  5JLW A;  1OLT A;  3OYC A;  5E17 F;  2QZ8 A;  3FIW A;  2RNJ A;  2CQK A;  2ZJS E;  4G6D A;  2ZT9 D;  3CCR P;  3J81 Z;  3CC2 P;  4EJW A;  3FXD A;  3I58 A;  4XRF A;  3L72 J;  4XON A;  5DUI A;  1YQA A;  4D0P A;  1WH5 A;  1KA8 A;  1DP3 A;  1PUE E;  2E2J J;  3F8M A;  4MEX F;  1LPQ A;  4Z2Y A;  4H0L D;  1JB0 J;  1FOS F;  2R7X A;  3ZDM A;  2QRX A;  2LR8 A;  1QVU A;  4IJA A;  2K88 A;  5LLQ A;  2XRO A;  2WT7 B;  3AE5 C;  2GLO A;  3B6A A;  4EI2 A;  5A2Q Z;  2LRE A;  1L2P A;  1U5T C;  1R5S A;  2XB0 X;  2CV1 A;  2D2C D;  3DTI A;  3AEE C;  3CUQ B;  3L73 G;  1KV4 A;  3GME A;  3K0L A;  1K73 Q;  3VOP A;  2QEX I;  4ZYE A;  1G3S A;  3GTO J;  1BSN A;  3DBL B;  3LAJ A;  1GDT A;  1NTZ G;  1NTK D;  2HNH A;  3RL0 g;  1R5H A;  3BR3 A;  1L0N J;  3L74 G;  3M9H A;  5IT9 K;  2QQB A;  2OTJ I;  2Z4E A;  5CVJ A;  1TNT A;  5LHI A;  4HDU A;  5HDK A;  3AKZ A;  5APQ A;  2R5Y B;  3RL0 B;  2PMZ N;  2L7M P;  1URQ A;  3F5H A;  1YJW P;  3MAJ A;  4PCQ A;  1LWU B;  2XSD C;  3OYM A;  2M3B A;  1I27 A;  1CF7 A;  2OF7 A;  3D5R C;  5KAF C;  2GA1 A;  2SPZ A;  2L54 A;  4QLC U;  3AE1 C;  1KIL A;  1FDI A;  3KCC A;  2K9J B;  2WMM A;  5BQT A;  1XGN A;  2CUE A;  2EPF A;  1SQV K;  4EVI A;  4C30 A;  2RH0 A;  2OYI A;  3GWZ A;  2IYP A;  2G7U A;  4LMY A;  5F27 A;  1SQQ J;  4E7J A;  5FO5 A;  1OYI A;  4P9U A;  1EDI A;  4XLN F;  1ZRT E;  3KHU A;  2UWM A;  1OCO H;  2KLV A;  2PRR A;  5F6F A;  2QM7 A;  1ZGJ A;  1VDF A;  4H44 B;  2P67 A;  3F0C A;  3W6K B;  2RRE A;  2XIG A;  3BTI A;  2JJL A;  4PV1 D;  2GWR A;  3IAM 2;  2HU9 A;  1NTM E;  3BQZ A;  4XLH A;  1KYO I;  2E76 C;  2N1T C;  4F93 B;  3E6B A;  2O03 A;  1JJ8 C;  5IYD J;  3CCS I;  4ASW A;  4IRI A;  4KT5 C;  4F3Q A;  3GZ6 A;  2F5E A;  1G2C A;  1FMW A;  2RKL A;  5CMZ A;  4CUG A;  5TGT A;  2HZT A;  2JSP A;  1FP2 A;  1HKQ A;  5D6F A;  4FE4 A;  5CPR B;  1JMM A;  1N7S A;  2EZI A;  3CCE P;  1EZV E;  1BSH A;  5EGO B;  4QIW N;  4BDZ A;  1M7L A;  2POH A;  2L02 A;  2YU9 J;  3K1M A;  5CVI A;  4GYG A;  1JEK A;  1ZAO A;  1ETY A;  1LT1 A;  4CO8 A;  3MIW A;  4I76 A;  4PSW A;  2JA6 J;  4Y99 C;  5K7H A;  2GXB A;  1AKH B;  4U7J A;  3IN6 A;  1ODD A;  4U0V A;  2YUS A;  4I99 C;  3U1K A;  2FYU K;  1YG2 A;  1CI6 A;  2L5G B;  3WUT A;  2LDU A;  3BOQ A;  1OCZ H;  3CJN A;  4I01 A;  2MSY A;  1AFO A;  2WB1 N;  5EEH A;  1VQ9 I;  5IP9 J;  4OWF A;  3WU1 B;  1YJN I;  3HUG B;  2PJR B;  4BJT A;  3GFI A;  3RBZ A;  4ENK A;  4WXC A;  1HUC A;  5AVR B;  2P81 A;  2F5F A;  3E6C C;  4EMS A;  4YXW H;  2CU7 A;  4II3 A;  4DJA A;  3L2R A;  1PGQ A;  4A3D J;  4ZMD A;  3OS2 A;  1HF0 A; 
#chains in the Genus database with same CATH homology
 1BDC A;  2M3A A;  3OYE A;  1HA8 A;  2K9M A;  2Y0S A;  4RM2 A;  1G8X A;  1QHG A;  3K4C A;  1V5F A;  2KLO A;  2Z2S B;  4RMN A;  1X4P A;  4E7K A;  2KZV A;  1SS1 A;  1ZW0 A;  3W2A A;  3W2W A;  4DOZ A;  4HKZ H;  1Z3X A;  2VJI A;  1FMV A;  3ZCO A;  3LMM A;  4BU2 A;  3H5A A;  4ZYA A;  1JMB A;  4HB1 A;  2XF5 A;  5HVQ C;  3FXE A;  2LG4 A;  4HNU A;  2HVR A;  4BJ6 C;  4ZJZ A;  3LSG A;  2CUZ A;  3OR2 C;  3DPL C;  4IOI H;  2LH9 A;  3S32 A;  3H9J A;  3DTE A;  3C2H A;  2DT6 A;  2HDW A;  1X1C A;  1UEL B;  4C9Y A;  3QYE A;  2X6Y A;  3PNT A;  4XN0 A;  5JHF A;  1PYV A;  2BVL A;  4RM3 A;  3OYI A;  2Z16 A;  2Q1K A;  2V1N A;  4E6K G;  1LP1 A;  3GBG A;  2A6T A;  2Z1D A;  3DU6 A;  1JI8 A;  1BR2 A;  4XOP A;  1WJE A;  2XSJ C;  3RSN A;  3K70 C;  2R7R A;  2W4S A;  3SEZ A;  3DPT A;  4B44 A;  2QKL B;  5CKT A;  1EA3 A;  1YX5 A;  2K3R A;  4BEH B;  3LSI A;  4RLF A;  2CW7 A;  3DU5 A;  1DQU A;  2MC4 A;  3VYR B;  4CSW A;  3EUK L;  5FRO A;  3CZ6 A;  4KIT B;  4D9J A;  3OL4 A;  4ZDO A;  4K3A A;  4XM3 A;  1WJA A;  1EDJ A;  4ASV A;  2IGO A;  1Y56 A;  2JVG A;  4BJ5 C;  1X4O A;  1Z3Y A;  3QOD A;  1X1B A;  1D1B A;  4DIQ A;  3FBN B;  2NOJ B;  4CCJ A;  2PJR A;  1DEE G;  4P5O A;  3RCO A;  2X51 A;  2KDO A;  2L5Q A;  4XR6 A;  2JWD A;  2QKM B;  2WAQ A;  2R7W A;  5LD2 C;  3S3N A;  4NNJ A;  3IP4 B;  3TBI A;  3FHN A;  3EPZ A;  3M8J A;  3PFY A;  1W36 D;  4GOD A;  2XF7 A;  4JOM A;  4GOF A;  4XLE A;  3CJQ B;  1PJR A;  4FET A;  3OYJ A;  3F9K A;  5CQG A;  2R7S A;  2KRC A;  3K6G A;  2R4G A;  1DGW Y;  5KCM A;  3H5R A;  2MAB A;  3HC7 A;  2ELJ A;  2IXS A;  3L2U A;  3L2Q A;  1X1D A;  2FUG 2;  3J7A Y;  4KT6 A;  2X6X A;  4HEA 2;  3OOU A;  2E1M C;  3OIQ A;  3QWO C;  3H35 A;  1D0X A;  3BLY A;  3OYH A;  4BE1 A;  5K5G B;  2CW8 A;  5KHD A;  3LSM A;  3U21 A;  4HG2 A;  4PJJ A;  3UR3 C;  1R6R A;  2VB6 A;  3K4K A;  4D1Q A;  2UUZ A;  3VSL A;  2LXB A;  4DBQ A;  2DJI A;  2VQC A;  3H9Q A;  3FKJ A;  3EUA A;  2KS1 B;  4Y4R A;  3NWS A;  3VYT B;  2GOX B;  1N75 A;  3ONQ A;  2CMP A;  3HOT A;  2ZSI B;  3L2W A;  3D5S C;  3ZR8 X;  2VXD A;  2LY1 A;  3ZRG A;  1OVU A;  2X1E A;  4ZTF A;  4YRV A;  2HPI A;  4CA0 A;  1QU3 A;  2R7T A;  2VAS A;  3FBI B;  4CCN A;  4GOE A;  3DTK A;  4NQW B;  4HST A;  2KHM A;  3S93 A;  5HLT A;  1Q2N A;  1Y47 A;  4P1W A;  4WWI A;  2LYC A;  4BEH A;  4XQF A;  2W7N A;  4BE0 A;  3A2K A;  3BC8 A;  2WAE A;  3CF2 A;  4IKF A;  4ZNC A;  4BQQ A;  3OL3 A;  3MKY B;  2F4I A;  2L9N A;  5LFA A;  3CP8 A;  3ZGK A;  1MNE A;  3PNV A;  4XOR A;  5EFW B;  3S8P A;  3K10 A;  3DWL E;  3LSH A;  3TL4 X;  1Z7L A;  4PK4 A;  4E7Z A;  2M5A B;  2IS6 A;  3NWT A;  4RLQ A;  1S9H A;  4C2U A;  1J09 A;  2VL8 A;  4E4H A;  4E7L A;  2KUB A;  3AL0 C;  5CBO A;  1BR1 A;  4QPQ A;  4XLA A;  3H9G A;  2JUG A;  4IX7 A;  1G59 A;  3BCA A;  2VJJ A;  2R7O A;  2P0W A;  3PSI A;  4CZC A;  2IGN A;  2CFO A;  2KPM A;  1D1C A;  2WA0 A;  3EUH C;  4ITV A;  3AFH A;  4Y33 A;  4Y3O A;  3HOS A;  4HRI A;  1WJC A;  2LRD A;  3BG7 A;  3OR1 C;  2VJ5 A;  3V42 A;  3OMY A;  2W82 A;  4PSX A;  2KIK A;  3QYF A;  1U0J A;  1D0Z A;  3E0J B;  1E0E A;  3DQV C;  3PUB A;  2V7F A;  2R7V A;  3HKZ A;  4KIS A;  4J01 A;  4KJM A;  4BQN A;  2BW3 B;  4YEL A;  2IGM A;  2VXZ A;  3H0D A;  2KI7 B;  3IAS 2;  4CCO A;  2Q2E B;  1WJD A;  1YE9 A;  2CV2 A;  1WFX A;  2HVS A;  3K4N A;  4NC7 A;  3RGU A;  1JM0 A;  2F5V A;  3K4M A;  1UG0 A;  4KJZ A;  2X1D A;  4E7H A;  2VPL A;  2ZAE B;  3RQ4 A;  1NG6 A;  4ZDL A;  3M1C A;  3OYF A;  5KNL A;  1ZEL A;  3RTR A;  1MMG A;  3KEY A;  2V6E A;  2R7Q A;  1K6Y A;  1Y6I A;  2X1C A;  2B89 A;  2M7A A;  2MD0 A;  1Z21 A;  3SEQ A;  4BS9 A;  2OC6 A;  3CES A;  4LIV A;  3ZQQ A;  2PMZ A;  4NUB A;  3MD2 A;  2X85 A;  2E5N A;  4BDY A;  3QOE A;  4PJM A;  2XDV A;  2CS3 A;  5HNH A;  4U7B A;  2L2O A;  2B87 B;  2QVA A;  4OWR B;  2WY8 Q;  4PFP A;  4HNT A;  4JQF A;  4H4K C;  4B3X A;  1IRX A;  5DJT B;  4OAY A;  4XLF A;  4XNF A;  3VYU B;  2M5A A;  2LY2 A;  3PSF A;  2ZXI A;  2KRH A;  1MMN A;  2M0M A;  3HXL A;  4PJL A;  3I9V 2;  1N78 A;  2V4J C;  1ZXG A;  4B47 A;  2VJ4 A;  3D5L A;  2KZI A;  3OS0 A;  4CPG A;  3DPU A;  3S3M A;  4F92 B;  1MMA A;  3K70 D;  5DJU B;  3SZG A;  2GOM A;  1WJF A;  4B43 A;  3SDB A;  2VKD A;  4ZDP A;  1BDD A;  3AL0 B;  1DGR M;  2K9L A;  1OVR A;  5FRM A;  3OYN A;  4LG3 A;  2XF6 A;  2E60 A;  1H0T B;  4HJG H;  4E7I A;  2RNG A;  2RQQ A;  2WAF A;  3OYL A;  3MZW B;  3MKZ A;  1TZL A;  4PFO A;  1FC2 C;  1UAA A;  4QPO A;  4ZC3 A;  2HQA A;  4FAS D;  1OR7 C;  2XAU A;  4N4O B;  2V9K A;  2OTK E;  2BW3 A;  3IUO A;  2W1O A;  4XKV A;  1LDK B;  3HG9 A;  2VLA A;  4NC8 A;  2KP6 A;  4XLC A;  5CQE A;  2AQF A;  4BGD A;  3OYA A;  2R44 A;  1V5E A;  4C2T A;  4NPE A;  3A4C A;  3DLA A;  3L2V A;  3S3O A;  1BR4 A;  2LC2 A;  2X6W A;  3H5N A;  3LFU A;  3ZXS A;  4MLO A;  4ZTJ A;  1SAU A;  3OYD A;  4CCK A;  2VKH A;  5FRN A;  3BG6 A;  2LR2 A;  3OYB A;  1X19 A;  4AU7 A;  1GLN A;  2DOA A;  2DCE A;  4GRI A;  4XL9 A;  2IS4 A;  3HPG A;  2HPM A;  4XKC A;  3CMM A;  4II2 A;  2B87 A;  4B48 A;  2KMU A;  1TT0 A;  1U7M A;  3SYT A;  4F91 B;  4MN4 C;  2WAD A;  2WY7 Q;  2F6C A;  2KZJ A;  4J00 A;  4IQJ A;  2OUM A;  1EC5 A;  4IQ4 A;  2UWJ E;  1P9Q C;  2IGK A;  2M4G A;  1WJ5 A;  3CP2 A;  2WBM A;  2XC7 A;  2HR3 A;  4CH7 A;  1MFT A;  1D1A A;  2M4K A;  3VYS B;  2MFZ A;  1W36 C;  4HSR A;  3TMO A;  4R79 A;  2B88 A;  3UNG C;  3K4J A;  4NPD A;  3MMY B;  3OYG A;  2L9S A;  3MKW B;  4XKB A;  1N77 A;  1VZ0 A;  4EAT A;  5C39 A;  4X0G A;  3VSK A;  2CV0 A;  2LBF B;  3OYC A;  1OLT A;  2VQG A;  3RPU D;  1KON A;  2E1M B;  1D0Y A;  3K4B A;  4BXF A;  1H0T A;  1LKX A;  3LSK A;  1MMD A;  4LIU A;  3PJR A;  3FXD A;  2LOO A;  4XON A;  1MW7 A;  1DP3 A;  3G2B A;  4BXL A;  2HVQ A;  3QYB A;  3HL2 A;  4XMY A;  2CUJ A;  2R7X A;  3ZDM A;  2QRX A;  2V26 A;  3LL7 A;  4CCM A;  3BCB A;  3OWT A;  2O5R A;  4BL0 B;  1YX3 A;  3FDY A;  1X0T A;  3E1S A;  2LRE A;  2LXC B;  3VDX A;  4N4N B;  2BOL A;  2ZFU A;  4BAC A;  2CV1 A;  3DTI A;  4HPQ A;  4PUS A;  4XN3 A;  1QHH D;  4DBR A;  2IS1 A;  1NG7 A;  4F55 A;  2HNH A;  1LVK A;  4E7S A;  3CJR B;  2R7U A;  3AKZ A;  4AYB A;  2IS2 A;  2OV7 A;  3OYM A;  1ERD A;  4XKW A;  3D5R C;  2UV1 A;  1U7J A;  2P58 A;  2CH0 A;  2I8D A;  1SFK A;  3OS1 A;  2SPZ A;  2WMM A;  3PL8 A;  1NVO A;  2AQE A;  2K3P A;  4BE2 A;  2VQH A;  2JA2 A;  4JBZ A;  4C30 A;  1WJB A;  4DGW B;  4LIT A;  3C2G A;  2HZD A;  4E7J A;  1EDI A;  2UWM A;  4U87 A;  2DXI A;  3OYK A;  4CCL A;  5HNF A;  2E5Z A;  1X1A A;  3OY9 A;  2RRE A;  2KQR A;  4BQO A;  3IAM 2;  2HU9 A;  4XLH A;  4F93 B;  3K4L A;  4IZZ A;  3HPH A;  4BUP A;  4ASW A;  4AVZ A;  1LP1 B;  3KX2 A;  4F3Q A;  1V5G A;  3W2V A;  2ZXH A;  1FMW A;  2Q1Z B;  2BVM A;  2L7K A;  4YEJ A;  4F52 A;  2DT7 B;  1MND A;  3W3C A;  2RKL A;  3PH0 A;  2MYS A;  2KL4 A;  4CUG A;  5TGT A;  2JSP A;  2JVH A;  4XOT A;  5CPR B;  2W00 A;  1AA7 A;  1S3J A;  4BDZ A;  2WB1 A;  3VWB A;  1LT1 A;  2K5C A;  4ANJ A;  1OVV A;  2VQL A;  4PSW A;  1EDK A;  2VIX A;  3N05 A;  2LBF A;  1BOB A;  3KYL A;  5CBN A;  4EYY Q;  3DKY A;  3DKX A;  1LFP A;  3PNY A;  3S1K A;  1EDL A;  3OIP A;  3DEE A;  2M7B A;  4NPF X;  3A1Y A;  2M0B A;  1T95 A;  3HUG B;  2PJR B;  4BJT A;  1T0F C;  3I3L A;  5HOO A;  3MHV A;  4G6T B;  2ZSH B;  3L2R A;  4II3 A;  4DJA A;  4K35 A;  4ZMD A;  3OS2 A;  4PJN A;  4OAZ A;  2A5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...