2I8DA

Crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
GSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics/unknown function
molecule keywords Uncharacterized conserved protein of COG5646
publication title Crystal structure of an uncharacterized conserved protein of COG5646 (ZP_00384875.1) from Lactobacillus casei ATCC 334 at 1.69 A resolution
rcsb
source organism Lactobacillus casei
total genus 22
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2i8dA01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2i8dA02
4NPDA 2UWJE 2R44A 4KJMA 1BDCA 4GODA 4HB1A 1JMBA 3PH0A 3MZWB 5CBOA 2JWDA 5K5GB 1OVRA 3MHVA 4NPFX 1S3JA 5CBNA 1H0TB 4EYYQ 2Q1KA 4MN4C 2KUBA 2I8DA 2KIKA 1NVOA 4IOIH 1MFTA 4GOFA 1LP1A 2KZIA 5C39A 3QWOC 1X0TA 2B87B 2ZAEB 3ZDMA 1DEEG 2B89A 1SS1A 2KS1B 4K3AA 3S1KA 5EFWB 1U7MA 4BXLA 1Q2NA 5DJUB 2M5AB 2QVAA 1U7JA 2QRXA 3FXDA 1EC5A 2KZJA 1H0TA 4HJGH 4HKZH 3RGUA 1OVUA 1BDDA 2WMMA 2K3RA 2KI7B 4WWIA 1EDJA 2SPZA 5DJTB 2OC6A 4NPEA 2OTKE 2B87A 2P58A 1EDKA 4ASWA 2KL4A 2RKLA 4ZMDA 1Y47A 4K35A 2LXCB 1LT1A 4ZNCA 4GOEA 1ZXGA 2LR2A 1ZW0A 1FC2C 2M5AA 4ASVA 1EDLA 1JM0A 4JBZA 4CPGA 2B88A 1EDIA 2LXBA 3FXEA 1LP1B 2M0BA 1OVVA 2HR3A
chains in the Genus database with same CATH superfamily
2DTRA 4WXCA 1MDMB 2JPBA 5B5EH 1L0LK 3HUSB 1NTKD 1L0LG 3W2WA 3CC2I 1FIAA 3E7LA 3KEYA 5FRMA 3LSKA 2ZT9D 2QBYA 1S4XA 1H88C 4MEXF 2V1UA 1LTGC 1VF9A 4XKWA 4KITB 1X1AA 5FFZA 4UV8A 2ZO4A 2DT6A 4XLCA 2XV4S 1T8IA 1U2WA 5JHFA 3FXKA 1AV1A 2NRGA 1BIBA 1JUNA 2RNJA 3GX4X 4A3IJ 3MD2A 1FYLA 1IO2A 3TDUC 2W25A 4RLFA 5EG0A 2KOGA 1JE8A 3K4KA 4D1QA 3OSGA 3PP5A 4HQMA 3H5AA 1R71A 2H8PD 3I5CA 4YXWH 4ENJA 1YTYA 1UMQA 2F5EA 1D1CA 4XQFA 5KJ7A 3ABTA 2JWTA 3FXUA 5K1YA 3L74E 1D8KA 3V4QA 3JRGA 2YO3A 3CO6C 5LBQA 4KT0J 1J2XA 1KQFB 2POHA 1IN6A 1N7LA 1TQPA 3M0AA 3TGUE 1EH7A 2ZXIA 3VWBA 4OU0A 4NB5A 3AG1H 2ZT9C 5EEHA 1R5GA 1YE9A 4XMYA 3DEUA 1QPMA 2YX4A 2P8TA 4LIUA 3S1KA 2NAZA 2CPSA 3FMSA 2RQPA 5FB2A 2XHKA 4PJJA 4RGRA 3AKZA 3FXLA 1GV5A 2LDUA 2FYZA 2BGCA 4TLFA 3SWYA 3ONQA 3PHLA 5AW8B 3M07A 1OIPA 2QRXA 1W7PD 3FXDA 1N75A 3L37A 2E74D 3H9QA 4O9BA 4DZOA 1W2BO 2V26A 1QL1A 2QQBA 3K0LA 3VMZA 5B1AH 1PPJD 1XGSA 2XGCA 3LSIA 1P7JA 3RI4A 3PLNA 2CYYA 2YXQB 4RM3A 3RGUA 4A0XA 1HA8A 3SWKA 5B1BH 3V7CA 3JCUE 3HOWJ 1BDDA 4JYKA 1P9QC 1RRJA 5K5OA 3B71A 4A2UA 1IDYA 3L2UA 1H9TA 3L36A 1EDJA 2FA5A 3P7NA 4XKVA 1ZK8A 1LNWA 1AHDP 3HOUJ 2PEXA 3LSMA 2GOMA 4QWQA 5GAGJ 5HDNA 4U7DA 4AIKA 2W6JH 2MFZA 4O6JA 1RE4A 2IBZG 4YRVA 3G3ZA 3L2QA 3B5NA 1UIXA 2KNCB 5KHDA 4M74A 4HAMA 3JRFA 1K4SA 1JY2N 3CLOA 1P92A 3RKXA 2WA0A 2VRSA 3WTYC 2QSGX 3H1KG 3IRRA 3H1LE 4YIFA 1SC7A 1MBFA 1Y8RB 3VSLA 4ESFA 1OR7C 3VSKA 3J7ZI 4B4CA 2BCCG 4OAZA 1G59A 3HZJA 2F5DA 2E74C 4AYCA 3K1PA 1T39A 2A07F 1SVMA 2DFFA 1T98A 6PAXA 1R36A 2W84A 1JHHA 2LY1A 1RKTA 3CESA 4L5JA 4AYBN 4AVPA 4OWFA 1ETOA 5FROA 1QBJA 3E5UA 5JHUA 5C3EJ 2JVGA 4Y52J 3M8JA 1FTTA 4YFNF 2JUCA 2I5UA 3CZ6A 1Z3YA 2K9MA 4UVBA 2VI6A 3D6ZA 2M7BA 1A02J 2JRMA 3LSTA 2EIKH 2KB7P 2PFXA 1KQSO 3T5XA 4KJMA 2K4JA 3L73E 3L75E 2CQXA 2PQ8A 4BHBA 1VQLP 3BQYA 4M6YA 1PP9G 3H9GA 3HUSC 2RDPA 2WT7A 3Q3DA 2GXGA 2M4GA 1TZLA 3CX5I 2K9NA 3L72E 3MKLA 3V42A 2OZUA 1J7KA 1TTYA 4LLNA 2X0LA 2JSPA 1V5EA 4ENNA 1LNQA 1LT9B 1K8AQ 2KFDA 2M9HA 3OS0A 4PFPA 1BI2A 1RR8C 4XN3A 5F64A 3BJAA 3F9KA 3KP3A 4ENMA 3P9IA 2DOEA 1KGSA 4JX6A 4EJOA 4IXAA 1S3JA 3NWSA 1QZYA 2CFOA 3WU0A 1VI0A 1ETKA 3I54A 4P1WA 4RAFA 3VFZA 1X1BA 4ZYEA 2PGDA 3H1JJ 1XB4A 2DDAA 2QA4I 2HPCA 2C0WA 5KLVD 1MH4A 4EJWA 3S4RA 3D5RC 2ICWG 2YX7A 4F3QA 2EB7A 3G6EP 3K69A 2L9NA 2P81A 3CUQB 3M9HA 3PJSK 2NVTJ 4HYEA 1BE3J 3L35A 5B66E 1VQLI 1LUJB 3QPTA 1KQ0A 3VYSB 3ERMA 1U9NA 1HW5A 5GAEJ 1BSHA 4XSXF 3BR0A 1ZREA 3HIFA 1POGA 4QSHA 4BJ5C 2P67A 1FIPA 3S1MJ 3OYMA 4GO1A 1HF0A 5BU8B 1ZQ3P 3KZYA 5K5QA 5EFWB 3JRHA 1OLTA 1Z56A 1RF0A 2Q1ZB 5B3SH 3FGAD 1LFUP 1I1SA 2DBBA 2PJPA 1MZBA 3CXHI 1HUCA 2V7QH 5F0FA 1JJ8C 1S72I 2ZFUA 1GLNA 4DNCA 3VPRA 2F6CA 4J00A 2L4MA 5HS7A 2Y0MA 4A93J 4AIJA 1MH3A 2VQGA 2R32A 1BJZA 2FOKA 1IGNA 3GTMJ 3BASA 4U3FE 1PP8F 2KRHA 4NQWB 4L75A 1U9OA 3RKWA 1N78A 1XG1A 2JVHA 2FYNB 2R5YB 4KDPA 3S9OA 2B9BA 3F6OA 3KPHA 4A5NA 4WX9A 1I5ZA 2WWWA 3KYQA 4NPEA 4FE7A 4PD4E 4DBRA 1MMGA 2ETHA 2P58A 2EZKA 2CUJA 1G3TA 3P5JA 2H8RA 4IRHA 3TDZC 5AW7B 1W5TA 4YIIA 1BGYJ 2KISA 2BEZF 2Q9IA 3H1LD 1KYZA 2R7SA 3P9KA 2WPRA 4H0EA 3KLOA 1YJNP 3CF2A 2KMUA 1L0LD 1B8IA 2HTJA 3DBRB 4O5VA 1WH5A 5LEKA 5CHXA 3LSPA 1G1IA 2ZBKA 3UKGA 3BQZA 3BR2A 5B5EE 3CCJP 1BOAA 3CCRI 3P32A 3HTKA 4BEHA 3SZPA 4A0ZA 1K78B 3JCUC 3DBLB 3UIAA 2VPLA 2ZJPF 5HVQC 1F36A 2LYCA 1H89C 3A02A 1K61A 4B3AA 3BCBA 1BDCA 3L70J 4CH7A 1XSXA 4AU7A 4LD5A 1B72B 1WJCA 3L72D 1RKWA 3AE9C 3SFEC 1JT6A 5DV5A 2K9SA 3HSFA 1NK3P 3IWZA 1U8BA 4QPOA 2KIFA 1IN4A 5CBOA 4JP0A 1NKZB 2YR2A 1AU7A 3EDPA 1LT9C 1YJNI 3AE1C 2IX7C 4AIHA 1HXDA 1WFXA 1KONA 4QTRA 3IFMA 1F5TA 2V7FA 3LNQA 4ZKPA 1VQOP 4EYYQ 1SVLA 3V8KA 1XD7A 2IYPA 4RDUA 5GTIH 2HZDA 2YIUB 3HPHA 3H1HG 5GTHH 3GUDA 4XOTA 2I8DA 2IFNA 2GA2A 2W27A 3HJEA 1T6AA 5APSA 3CP8A 1FP2A 1K79A 1QVFO 2HNHA 1O4XA 2GLOA 2VJJA 4N6JA 1LP1A 3H1ID 3CUQC 1LKXA 3SJMA 3AEAC 1R9TJ 1T6SA 3TW6A 3BT9A 2M3EA 1VQ4P 5IYBJ 2KRFA 1YJWI 1TWCJ 5LFAA 1TWHJ 4ESJA 3A01A 2EV0A 3ZMSA 4BQQA 4CZCA 1H0MA 4GFBA 3O8GA 1DP3A 1FY7A 5CJ0A 2V1DA 1FZCB 2QEXI 4NC8A 2R7FA 1DPRA 3KZZA 3RQ4A 3WG9A 2RN0A 5D4SA 2CS3A 1R23A 2VT3A 1SQQE 1ZAOA 1GV2A 2ZXJA 2HWVA 1YRNA 3CXHH 1LQ1A 5BPDA 4M6VA 4JYBA 2M5AB 1MIJA 2OYIA 2XB5A 4O3MA 4OIPF 2EFWA 1FSEA 3KZIC 2WY7Q 4IHTA 4XA4A 1VQ9P 2CK3H 4IFMA 3BP8A 4XIDA 1T3JA 4PJ0H 1FJLA 4GYGA 4IHVA 4BJTA 4EJVA 1Z7UA 1VQPP 2WQYC 4PUSA 4HNTA 4L5EA 3R0JA 4WWIA 4U3FD 2WB1A 4J01A 3BG7A 1VQ4I 4HPQA 2Q5UA 1Y39A 1YS6A 1UHWA 2PBIA 3FISA 3KHUA 2HS5A 2A06G 4PD4D 1OW7A 2FYNC 1DX7A 2CV2A 2Y0EA 1X58A 2QKMB 1LTSC 1V3FA 1ZP0C 2JPCA 2ZYGA 1NU1E 2QG4A 1FZGA 3MGNA 1ACIA 4IQJA 3O6BB 3WU2H 1J75A 1G3YA 1HSTA 3I53A 3L70G 5JR3A 1W5CE 2E2IJ 2BEOA 3HXLA 2IYOA 4OMZA 1LWUA 1VQ9I 4HNUA 1B4AA 3CO7C 1ZLKA 3A0BH 4GOEA 2OTLP 2LRDA 2ISZA 2EJRA 3G2BA 3REOA 1FDIA 4D7MA 3JTGA 1BI0A 2RKHA 3L9FA 4RBOA 3OYNA 2E2HJ 1EDLA 3L2RA 4HLXA 1EDIA 2LXBA 1U5TB 2RC4A 4MLOA 2AQEA 2PMZA 1J1DB 2KPMA 3BC8A 3U21A 4JQ0D 2VASA 2C9LY 1RR7A 2EQRA 4NDLA 1QRYA 3CMYA 2BVMA 3BZKA 2M8EA 5L3EA 3C18A 3JRBA 2GXBA 3L71E 3OIOA 2IW5A 2J59M 1IJWC 3O2PE 2MYSA 1HC8A 2H94A 1NKNA 2WC2A 3N4MA 1FS0E 3M9AA 1YI2I 1WJ5A 1IC2A 2O01N 2XDJA 3E5XA 3H3ZA 1LJ9A 4GYIA 1IK9A 5AVXB 3D1NI 5EJCA 5IT3A 2QE7H 2MH9A 2E1CA 2JQ7A 3N7NA 3HUGB 1HW1A 3O8HA 5CJ4A 1N73B 3S3MA 1OKRA 4B8XA 1ONVA 3C2BA 4N78E 5EZGA 1XGNA 3I5UA 2FMYA 4IL6C 1K7AA 4Q5SF 1PUFA 2FFDA 2HPIA 1E0EA 4ZYGA 2H6BA 5GPCA 4CYCB 1REPC 1M57D 4BQOA 4MN4C 4BU2A 1CSBA 1FE6A 2AQFA 2WV0A 4WBAA 2KUBA 1Z77A 1VQNP 1SQXJ 1IN7A 4RB2C 2MA3A 4I6ZA 4KYWA 4YIRX 2YIUC 4BRYB 2DA5A 1URQA 1R4MB 2WBMA 2E5ZA 3PO3J 1NOHA 2A69F 3S2DJ 3M9BA 4BE2A 3DQVC 3V7SA 4Z1MH 3QWOC 4PFOA 2GM4A 3S14J 1J2JB 4F93B 2TRTA 1KYOI 2H43A 3PUBA 3BLYA 2HQ5A 2HDDA 4CZZA 1Y0NA 4E7LA 4KT5C 4XLEA 2E2JJ 2Q6QA 3T8RA 1A31A 4S0HB 3RK3E 4CXFA 3HHGA 1RE3C 2PI0A 1LEBA 1FZCC 2FYUE 2X51A 3KYCB 1NTKK 4P55A 3WTSC 1NTKG 3BTJA 2KLUA 2Y0CA 1LGHB 2QSFX 2ZNYA 3KP5A 1VQMI 3TOAA 4U88A 1T2KA 3AEEC 4HSTA 2E5TA 4LFUA 2LSOA 5FKKA 4UB6H 1X2MA 5IT9Z 2F2EA 3KX2A 2HXOA 1JT0A 1PDNC 4KN7X 4MTEA 2J58A 3I59B 2KT0A 5DM7F 2KJBA 3S2WA 1OVUA 3CC7P 1DIPA 4KIFA 2H09A 4LB6B 3J80K 2HYNA 2WMMA 1V5FA 4PSWA 5DEQA 1JY3P 3A3YB 2K3FA 3HKZA 2M7AA 2D45A 5AVYB 5LHHA 4N9IA 3VP8A 2SPZA 1RC9A 2FU4A 2QQAA 2IA1A 1NAFA 3N4XA 2OTKE 5CQEA 5TRDA 4RKUJ 1I39A 5E8GA 2DMUA 3RK3B 1NU1D 3UNGC 1HQCA 3OYCA 1BR1A 3JAMZ 4C2UA 1XCBA 2KQRA 2XF7A 1ZLJA 4C2MJ 1YOVB 3HGYA 2RKLA 4R1HA 3AEGC 4N0BA 4IL6X 2P7CB 3IUOA 4U7BA 2OYHB 3FXMA 2DAOA 5DCFA 4EM2A 5AVSB 2K5CA 1HVVA 1M1JA 3ABUA 1ZW0A 3HTUA 2E1NA 2E7WA 1P84I 3RYPA 2F5VA 4D5FA 2XB0X 4NNJA 3CC7I 3I9V2 2HEOA 5KLVJ 1HSJA 4HZFA 2N1TB 3CX5E 4XICA 1U5TC 1N7SB 3AEFC 3OA7A 1ON1A 1L0NE 1IN8A 1J1DC 2WV1A 1Y1VJ 4A3GJ 3FWNA 3HOZJ 2NPSB 3L71D 4R4MA 1AWCA 3CUOA 3FMRA 4DBQA 2ELHA 4B43A 5IOZA 3K70D 2UWJE 3M8FA 5E20A 1PPJG 3H36A 3JW4A 1OCPA 2LLKA 2V1NA 3H5NA 3OYFA 4MIMA 3E6CC 4IFFA 1ETVA 1USSA 3Q5RA 5D5XB 1OCTC 3MZWB 3CWBD 3LA7A 5GTHE 1L3LA 2V9PA 2XIGA 1ZHFA 1W5CC 1ZH5A 4N78D 3P8CE 3H25A 1LEAA 2HYGD 2HU9A 2M1BA 2Z2SB 4XLPF 1XSDA 1Y1WJ 2Q0OA 3TBIA 3GWZA 4UXNA 1N25A 1Y6IA 5KAIH 1BM9A 1IAWA 2EFOA 2QSIA 5APWA 2VIXA 1X9VA 3EFGA 5E1XA 5BPIA 3KETA 2VN2A 3KQGA 1SQPE 3HRMA 2FY8A 2DODA 5KAFH 3GLLA 1F9NA 4LGWA 5C44J 4A3DJ 5HLIA 3KP7A 3ZQCA 2X6OA 1PGJA 3AECC 3OYGA 1IFIA 4A3EJ 4G6QA 3RBXA 1SFXA 4ENKA 4U0VA 2KYVA 3H3UA 3QOPA 1AVYA 3K70C 2HG5D 1UZCA 4HF1A 3CXHE 1LTJA 1EXIA 4DQ2A 1JI8A 2HVQA 2ZVOB 3RK3D 3CCYA 1ZKGA 5F04A 1X22A 3OIPA 1XC5A 2MGQA 1RI7A 4GRIA 1JTHB 3B73A 2ZFWA 3HDDA 4ANJA 1SQVJ 3GVAA 2FYUD 3A2AA 1JHFA 2BW3B 4XLNF 5HNHA 3EUAA 4GGGA 4L9JA 1U7MA 2BHZA 3C9IA 4HH2A 2A06D 2KP8A 3VYUB 4OVNF 3QP5A 3TF5A 1JKPC 1L0LJ 2YKQA 3QPSA 2G8YA 2ZXEB 3ZQLA 5TJHA 2XUBA 3R2PA 3LW5J 4WXHA 1WSUA 4UVAA 4CA0A 4I76A 5LHGA 1OX3A 2OYOA 1G3WA 2VBXA 2KIQA 3HRUA 1GL2B 2N1TD 3Q0UA 4NC6A 1H8AA 2YMYA 1ETWA 1XPXA 2RV8A 5FLVA 1E17A 3TGNA 1N7SD 1SLQA 1T8ZA 4DOJA 4L18B 2WTYA 3KLNA 2NPSD 4DOZA 3N97A 4H13D 4B1RA 4BDZA 1A02F 1CF7A 4BQNA 1GMJA 2OC6A 4L9TA 2CW0F 2W90A 2VB6A 5KLVG 1PGQA 3HHHA 3R61A 1JY3N 5FRNA 4PJNA 3F23A 2LTPA 3MVPA 4MFDA 3JRAA 1LTBC 3QAHA 2L5GB 3RK3C 4GKGA 3GF7A 3NQOA 1MNEA 1E3OC 2WSCH 1MKMA 3BOQA 3L7WA 4D9JA 3A1YA 2KS1A 3E1RA 4XFJA 2FQ4A 4C9YA 3CJTB 3SYTA 4FX4A 1AJYA 1FOXA 1GD2E 2WSCJ 2XASA 4I1LA 2OYHC 2DN0A 3HG9A 1ZELA 4JOMA 1KMIZ 5TISC 1OJLA 2JDIH 2GWRA 1P84H 1X3UA 1UAAA 1BBYA 1Y8QB 2JKVA 3B6AA 4UHTA 2I10A 4XBFA 3HE5B 5F1RA 2BXYA 2EZHA 5HODA 3CX5D 2B88A 5EZHA 4ON0A 2DT7B 3T0YA 2CQNA 1KYWA 2QSHX 4QIWN 5CVRA 3G4SI 2N1TC 2OCCH 3RZOJ 2O6GE 3FXEA 1IN5A 1UB9A 4YELA 1JO5A 4XRSG 1S6LA 1N7SC 2WADA 2QJKB 5KK1A 1LFBA 2HVSA 2DK8A 1GW4A 4PSXA 1LVAA 1G8XA 3H1IJ 2Z3YA 1TQIA 4L0ZB 2NPSC 4H0LB 4H13C 1V55H 5ICGA 4UV9A 1OW6A 4Y3OA 3CMAP 4I6MC 4M71A 4ZDLA 3ZQFA 2A45G 4HYTB 5D5UB 3QYFA 3I4MJ 3IN6A 5CVJA 1DP7P 1QHHD 5BQTA 1TT5B 2KZGA 5BNGA 2K37A 2STWA 1X8YA 3HD7B 3RZDJ 3P8CD 2V9KA 4C2TA 2FX0A 2Y69H 2VLAA 3W2VA 2DCEA 2KSEA 3KP4A 1WMKA 3ROUA 5CBNA 3Q0VA 5FGMA 2DOFA 4F92B 4U87A 1UHMA 3ASOH 3MKWB 4S05A 1SQBD 3SWFA 3H1LG 1K6YA 2JZYA 3H9JA 4MGRA 2AXTH 1QLED 3V2RA 1D0YA 1GL2D 1Q90D 4G7HF 4M3DA 3JREA 1U0JA 3H1KJ 3T97B 1S5LH 2FQ3A 1BW5A 3TEDA 3CMAI 1LE8A 1QVTA 2XPVA 2FXPA 5E1WA 3HM5A 3CJQB 3FK6A 2L9SA 3WGHA 2BCCJ 3CXHD 1WJEA 3FDYA 1S7EA 2B87B 2FXMA 4HBLA 3CDIA 5JLXA 2R5BA 1HBWA 2LREA 2ZNZA 1WJAA 2GZWA 4B44A 5E79H 5DD4A 3VMYA 3VMXA 5LD2C 1YBKA 1Y8AA 1TQMA 1SFCA 2EZLA 4DJAA 1XTAA 2JA7J 3M0DA 3V5BA 3MUDC 4E6KG 1Y56A 2H89C 2ZXWH 3NRVA 3M06A 5DJUB 4IX7A 3L72G 1FEXA 3MWMA 2DLLA 4FE4A 1EC5A 2OD5A 1PP9J 3VB2A 1H0TA 3BJOA 1K4TA 4IHYA 1YHQI 2P1JA 2WSFH 4U7JA 1RF1A 2OPTA 3IAM2 4A3JJ 4OIQF 1DU6A 3W2AA 2MABA 3WTTC 1XMXA 4H4KC 1YO5C 1SMYF 2QJYB 2BZTA 3RYRA 3EUHA 1W36D 1GL2C 2WSFJ 2X1DA 5APQA 2O1JA 1MJBA 2F4IA 1QGPA 3GTOJ 5CCHD 5AVTB 2R7OA 4I0BA 5EEGA 4H0LD 5AW5B 4BBRJ 3AG4H 1MFZA 1R49A 1PIXA 1RH5B 2FEZA 3S1RJ 1XN7A 5D8LB 3C2GA 1IFMA 3ESWB 3HPGA 5M5WJ 2WPVB 1WPKA 1VQ8P 4XN0A 3SEZA 2XAUA 3OOUA 3H1IG 2QGUA 1RHZB 3HD7D 2MSYA 3CCLI 3WTVC 5E3MA 4LG0B 1E3HA 1RUNA 2L4AA 1GUUA 3GHGC 2R4GA 4I02A 3S16J 1FX7A 1K73Q 3D71A 3S1QJ 1LVKA 4LOCA 2VONA 2ZJQF 3CCUI 1EQ7A 1ZXGA 1T0FA 1FC2C 3WE2A 3KDPB 4LIVA 2L3DA 2Y0SN 5IY5H 2LKMA 3CQZJ 2V79A 3DPUA 3SFZA 3J81K 2O03A 1PFIA 4IHXA 5CKTA 3IH4A 4UB8C 5FO5A 4B09A 4BL0B 2PX9A 3W6KB 4L5IA 1W36C 2O61A 1TC3C 2DYSH 2RGVA 2KXPB 2W6BA 3LAJA 2D5VA 2WAQA 5HLHA 1NTME 2WSEH 2R7XA 5CCHC 4R8HA 4DZPA 2QJKC 1MW7A 4XORA 2R44A 2VQLA 1WRGA 3ULQB 2XRNA 4ZH4F 2WSEJ 1KILA 2Y48A 2H8WA 1VQ8I 4H0LC 4GDOA 4PK4A 2Y31A 2V6CA 4UUSA 5KAIE 3I4PA 4L0YB 2P4WA 2ZJSE 1V4RA 4U3FG 2Y75A 3GBGA 4G6DA 5EGOA 3U9GA 2KDZA 2Z33A 1D7MA 5ICEA 2DT5A 1MUUA 4M9ZA 5KAFE 4XLHA 1G1JA 3HD7C 3V2QA 3ZXSA 4LLLA 1XTGB 2EIMH 3LFUA 3C2HA 1HKSA 1R7JA 2JSCA 2DA3A 2KP6A 3LWFA 4V2FA 2ESNA 3IR9A 2QA4P 3V2NA 3GXOA 2ACJA 3PSFA 1OWAA 1XTCC 3KEQA 1ERDA 1KYOE 1LDDA 3KEOA 4I2OA 1NTZE 2BBYA 5F6FA 4ZKUA 2Q3IA 3I0TA 4BQAA 1FOSE 3HE4B 4DT0A 4EEFG 1Z67A 2L7ZA 1ZTRA 2CUEA 2IPQX 5GPAA 1HJBA 3O8ZA 5AONA 2KK7A 1ZG1A 5C4JJ 5H2FE 2R5ZB 2O5RA 4MQVA 3A5TA 2JTVA 2K88A 3CMMA 1FZPB 4G6TB 3IL2A 4V2GA 3ELKA 2VE9A 1Q7YQ 4BY7J 1WH7A 4HG2A 1WHUA 4BH9A 1KC8Q 1LDJA 2XV5A 2ZCWA 3ECHA 1P7IA 4C3IJ 5H6RA 3D0SA 1TW3A 4HX7A 2XGDA 1R1VA 1Y9BA 1ZGJA 1B59A 1AKHB 1BSNA 2IZ1A 3F8BA 4KIGA 2WPQA 2EV5A 2F48A 2XPUA 1S72P 2KZJA 2K1AA 3WTZA 1SFEA 3L74D 3CF5F 2XKOA 4D6TE 1U78A 1JJ6C 1LB2A 2O3FA 2G0EA 4U0YA 1MJAA 2VBWA 3TGUD 4L73A 1IXSB 1P6RA 1HGVA 2CPBA 2JUGA 2IXSA 2QJYC 2ZYDA 4HV6A 3LIDA 5AW3B 2KHMA 2ZSIB 3PRJA 3TOBA 4AM3A 2KKOA 2FRHA 3OS2A 1RZ4A 2D1VA 2KRCA 2BV6A 4ZYDA 5DJTB 3GTQJ 2GBYA 3H1HJ 3DP7A 2QBYB 4WY4A 3TSIA 3QYBA 4BE1A 1SVFA 4C7NA 1B6AA 3OIQA 4LK0F 1P84E 3I71A 3CWBJ 1ZRFA 1TWFJ 4BNCA 2YSRA 3BCCE 3FM5A 2LBFA 3ZMDA 3F0CA 1VTNC 2VJIA 2KIUA 3IKTA 2R0QC 2W24A 3QPHA 1FU1A 5CCGD 2LG4A 4S04A 2HKXA 1ZN5A 5EG0B 2M45A 3QQAA 1KZUB 1CI6A 3JR9A 1FC3A 2LR2A 2L7FP 3CP2A 3CCRP 4E7JA 1QEXA 3K4LA 5KLIB 4BWNA 2BY2A 1KTMA 3ZOBA 1T38A 2UZKA 2QJPB 2X6XA 4RB3C 5CYVA 5HS9A 1B9NA 1S2EA 2H88C 1GVJA 3DF8A 1NTMD 4PV1B 1VQ6I 1EH8A 3JC22 3FBIB 2E5NA 4F91B 3NARA 2DMPA 1GDTA 2R7TA 5E17F 2CO5A 5ERIA 3RKYA 1BCCE 4GODA 4II3A 1IV6A 1VQ5I 4B3XA 4A3CJ 1FT9A 2WSSH 3JTHA 2W57A 4NC7A 1KN7A 4MEYF 1Z21A 2VBZA 1FZAA 2IGOA 1EXJA 4GT1A 1KB9H 3DU5A 1V5GA 1O7FA 3COAC 2PJRA 2KLVA 3GCMA 3K7AJ 1BC8C 3I4NJ 2AXTE 2LY9A 4A0YA 1R22A 2VJ4A 3LQQA 2I1KA 3W68A 3M7GA 2CG4A 4Y17A 2G3AA 2R5DA 3MHVA 5CCGC 4C30A 3GTGJ 1NU1K 2OU2A 2PMZN 1NU1G 1I1GA 2MLGA 3AE6C 4A7PA 5EDNA 1KYOD 1NTZD 4RAYA 4IKFA 2E1OA 2QYOA 2EPFA 4EOTA 5E79E 1MMSA 1GVDA 2ID3A 4JX5A 3L73D 3L75D 4FETA 4ETSA 2LNBA 3NTNA 2GUVA 3QODA 5CVUA 3SFIA 2M87A 1HKQA 3VYRB 4AUXA 2YU9J 1EZVI 1YQ3C 2K4BA 1YJWP 3DWLE 3ZQGA 2HDWA 3PSIA 2KLOA 4CICA 2GXAA 2PP6A 3B5NB 4OAYA 3K4JA 1ORKA 5KAIC 2L54A 1WI3A 3ISPA 2E34A 2O0YA 4AYBA 2IZ0A 2VPRA 4BGDA 3LSHA 2ZJ2A 3TW7A 1YQ4C 2QEXP 5JVTA 1OZHA 2IGNA 3L71G 4HEA2 4E7HA 5APXA 2VQCA 4ABZA 1T33A 1E79H 1MBHA 2EIJH 1SFKA 1NHLA 3I56I 4L76A 5E8IA 2M0MA 2VL8A 2ECBA 1O3SA 2P10A 1FWZA 5DYMA 4RGSA 2MC3A 2VE8A 1FOYA 3S8PA 2QVAA 4BXFA 3CWBG 3ZQIA 4AQRD 4P9FA 4EGZA 4D6TD 2PN6A 2N8GA 5KJ7D 3RPUA 2OARA 2O8XA 3AFHA 5F08A 5AW4B 3DTEA 2P6SA 2HFED 3D70A 1S9HA 4AC0A 2KSJA 2P5KA 4M3LA 5D6EA 3U1CA 4PV1D 3LL7A 3BTCA 3I64A 5H2FC 1R8EA 2WT7B 2HDCA 3HRSA 3HTSB 2L5QA 2NVUB 2M3AA 1OYYA 3S32A 4IO9F 4MTDA 4C3HJ 5E3OA 2JA5J 2EFNA 4PGGA 4E7KA 3BCCD 3GF3A 3O6QA 1T56A 4WCGA 4M6XA 4RGXA 3ZQ7A 3F22A 5CMZA 5F0CA 1W0TA 4BUPA 3LA2A 1FJKA 2XKMA 4FHTA 1OXZA 1VDFA 2AEMA 2LKSA 2LVSA 5BVZA 2IBDA 1LT1A 4Z2YA 1LJ2A 1KZHA 1GU4A 2HPCB 2NNYA 1ULYA 2EA4A 3OW2O 1HOMA 4JX4A 3F89A 1DUXC 2FYUK 2M30A 3FBNB 1OYIA 1DGRM 2OUMA 3V4GA 4ZZDA 5B66C 2FYUG 1OISA 5KLIC 4CPGA 5J1RA 4BDYA 1SQBJ 5KJ7C 4C7RA 2OYHA 4I7ZB 2PMHA 2QJPC 2FXAA 3C1DA 1SD5A 3E0JB 2YKOA 2KDOA 2UXXA 2XPWA 3R0AA 2CRGA 2HR3A 4M73A 2B63J 1R58A 3K4NA 2FMLA 4LG3A 3RTRA 1NTKJ 4PV1C 3HOYJ 3TNUA 1BL0A 2B7EA 4LLHA 2QVOA 1EKEA 1JOCA 3BROA 1YI2P 5APUA 4CSWA 1N7SA 4RB1A 3AG3H 3B5ND 1SD7A 3GTPJ 2EINH 3E7KA 2COMA 2ZMEA 4EATA 3EETA 2HTSA 1JUMA 2JWDA 1OCZH 1FOSF 1L4AA 2NXNB 5IPAA 1R5LA 2OTJP 2Q2EA 2A6TA 1EJ9A 1YIJI 2JN6A 3OOPA 2JO1A 4L74A 2N9BA 1PGPA 1IRZA 3SSUA 3BJ6A 1HCRA 3F8NA 1KA8A 3NMDA 1Y0UA 3P7KA 2XC7A 2WPSA 3DCFA 1JCCA 1ZARA 2XNDH 2ZYAA 1UIIA 3BRVB 3PUFA 3OSFA 1NVOA 1ZG3A 3E6BA 3OV8A 5LEJA 3H1JE 2HVRA 3SHFA 3OYDA 3AE3C 1U6GA 2W48A 1ZR4A 3BY6A 3RDIA 4LB5A 5C39A 3RQIA 4X1EA 4HDVA 2F4OB 2NVXJ 1FAVA 3HEFA 4W7YA 2HPMA 4Q4ZF 1WWXA 3MIWA 1G4DA 1RE4C 4W1UA 3C1LA 3CCMI 1L0NK 1BE3E 3L2VA 3B5NC 4QMAA 2A5YB 1L0NG 1QVUA 1T95A 1QZEA 2DJNA 2DFHA 2NS8A 2XAQA 1YJ9I 2I1JA 3KPEA 4K3AA 2MLKA 4XLFA 3TYYA 1H88A 2OTJI 1I27A 2AXTC 1YTZI 2A3SA 4IPAA 2K9QA 5B5EC 5JFRA 1XGOA 3H5RA 3M1CA 4F7ZA 1B8IB 2R7UA 1FDMA 1VQMP 2OA4A 3ZMVA 3SFDC 3E1SA 1U7JA 2E5YA 2HZTA 1BA5A 2VXZA 3HTKB 4BEHB 5K5RA 2CU7A 3B6CA 1B1BA 1K6OA 1YITI 2AXLA 2E76B 2CWEA 4CGZA 3BPXA 5BS6A 1G2HA 3T8TA 1JY2O 5J4VA 4YXDC 2M3BA 2XNXA 5FKLA 4UVCA 3ZMTA 2H1KA 4AWXB 5CQGA 1S1CX 3DU6A 5DCMA 1SQPK 2EV6A 5L3DA 1SQBK 4MFEA 2HODB 1W1WE 3A7OA 1SQBG 2QM7A 3K4MA 1N8RQ 1W5SA 1SQQD 1GT0C 3KYDB 3BR1A 5J8FA 1NK2P 4HF0A 3DEEA 3Q1MA 4L9VA 4R4LA 4ZMDA 2O01J 5CPRB 1N2DC 4FT8A 1Y47A 2WAEA 1R1TA 2PRRA 2YS9A 5D6FA 4BAYA 1YX5A 2IA0A 1BGYE 3N05A 4HW0A 2OZ6A 4ZYAA 1IXCA 2K9JA 4XRFA 2DA2A 3BRTB 3GHGA 2Y2ZA 2Y9ZA 4HNVA 1VQKI 4GIFA 3MEXA 3P9CA 1OFCX 4M9SA 4DW6A 1PP7U 1EH6A 3TDKA 1LP1B 2O8KA 1JMMA 1OVVA 1RQUA 2J5UA 2F4MB 1ETYA 2W4SA 4I99C 3H32A 1KB9E 3SDBA 1K83J 3K2AA 4EJUA 2IS1A 2WTEA 3WMM0 4Y33A 1GU5A 5DM6F 3HB9A 4IFDK 5EYRA 1QZZA 2DFEA 3IP4B 3MMYB 5FFXA 3BATA 3NAUA 3GMAA 3H1CA 2MD5A 3GZ6A 2DPUA 1JGSA 4HRIA 2B9SA 2EK5A 2D2WA 1DH3A 3L70E 2RREA 3V6IA 1HTLC 5FKNA 1PZQA 3RPQA 1WGXA 2R92J 1WCMJ 1YRNB 3GTKJ 1RF0C 1LDKB 2IEKA 2EBIA 4BS9A 5LGNA 1QPIA 1X4PA 2DFIA 3KCCA 1X3ZB 2OYIB 4Y99B 5CVVA 1OR7A 2XU6A 1OCOH 2MD0A 1W7PA 4IOAF 2KJCA 2K27A 3L74J 2X4HA 4HX4A 1CGPA 3FXJA 2BY0A 1TWGJ 2C6YA 3A03A 3H1JD 1G2CA 3A0HH 3UR3C 2E76D 5AW6B 1UCRA 2M4KA 2BASA 3SZTA 3TGUJ 2UXNA 1I3QJ 3R4KA 1MGTA 2FE3A 1M7LA 3U2RA 3ZN1A 2K85A 1L0ND 5GTIE 2DTZA 2VKHA 3Q9VA 4ASNA 4CCKA 1X0TA 1NTCA 3HOXJ 5DUIA 3IWFA 1MDMA 4BXXJ 1BE3D 1BN5A 2P2UA 4A5MA 1HDPA 1ZOYC 2B89A 2JWAA 2RMZA 3HUSA 1N73C 2EFPA 2L9RA 1A5JA 3L4FA 2IBZI 4UY8I 4I01A 5F0HA 4NUBA 1CQTA 4WVZA 1U57A 4OINF 3JCUH 2VQHA 1LWUB 3E1IA 1R6RA 3MTUE 1WKMA 4A6DA 5KCMA 3V8JA 3WU1B 3SXYA 3FWEA 1F4KA 2RNGA 1SAXA 1IO4A 3OYEA 3I3LA 3FM3A 3IHUA 3ZMUA 5IYCJ 2ZJRF 1JKRC 4BKXA 2VKEA 4HA8A 3FIWA 1L2PA 5ILUA 1T08B 1G6NA 2MH2A 2R7RA 3OYHA 4RLQA 4Y4RA 2E76C 2Z99A 4JYCA 3LOCA 3BCAA 1H9GA 5IP7J 4TV7A 4P96A 1IZNB 1S9KE 1OYWA 1Z1DA 3Q9SA 3M91A 1ON2A 3DXJF 1PL5A 3J80Z 4MO7A 5M1BA 2CV1A 1IFDA 4RS8A 1UG0A 1Z6TA 3F21A 4PJ0E 1KD1Q 1USTA 1L0OC 5EEAA 1SEUA 1SP4A 3H1LJ 5TGTA 1A35A 2M34A 1NYHA 3LW5H 4OMYA 4KIBA 1K9MQ 2V6EA 5ED4A 1YQAA 3GEZA 4FCYA 1PUFB 2FFDB 5BOXA 5LGUA 2LP0A 2V4HA 3IAOA 3PM1A 1BGYD 3C7JA 4XR6A 1C0WA 1ZR2A 1PUEE 4JPZB 1RIOH 3TP3A 3DLLF 3BPVA 2EZIA 1IZ1A 1XCVA 2VKDA 3DKWA 4GCVA 1URQB 4LG0A 3ERED 2Z5IA 3WU2E 3G4SP 4CUGA 3T1BA 3V8LA 2ZVNB 1WT6A 3L73J 1M1KQ 3L75J 2JK3A 5APVA 4D0PA 3OL4A 1Z7LA 2HFHA 4A12A 3A0BE 1JGGA 1RNLA 1WJFA 3L72J 3AEBC 3AE5C 4CDGA 5DTDA 3L74G 4M3GA 4I0AA 1KFMA 2W8ZA 1XX5A 2CJJA 2QKLB 1IFNA 1ZYRF 4LK1F 2Z9OA 2IS4A 1TW2A 4UNOA 3MQ0A 4CCNA 1ZRCA 3TGUG 3EYYA 2DMQA 5LGTA 4CYDA 4OWRB 2R7DA 4QPQA 3AE4C 3PNTA 3KZIH 2KNCA 3PL8A 2WWYA 1NWQA 2BXZA 2R3SA 5ILSA 3RSNA 2VUMJ 1X79B 3ZQQA 1JTYA 3IKVA 4CCJA 3E6DA 2GUSA 4RAGA 3LSJA 1BW6A 4C46A 2V9VA 3OMYA 4KT6A 4XRSA 1EZVE 3IF4A 2EFQA 3EQLF 2OYIC 2X48A 2EH3A 2YU3A 2Q8KA 2DQRA 2PMUA 2XDVA 4A6EA 3MAJA 5LHIA 2XRLA 4XRMA 4HQEA 4RM2A 2H6CA 3S3NA 1IJDB 2CUFA 4I09A 3CCQP 2HQAA 4EI2A 2A5WA 1KU3A 2CSOA 3G71I 4X6AJ 1IXRC 1SQXE 3JRIA 4Y13A 2XAGA 1IK7A 1SVOA 1PPJE 3PIOF 2LOOA 3BWGA 5K7HA 3GYHX 1Z9CA 3KP2A 3LFKA 5E1ZB 1N77A 1IC8A 3GW6A 1H89A 1HWTC 2ZAEB 2W82A 3ASNH 3OS1A 5IYDJ 1DEEG 1R1UA 3CL3D 1R5SA 2JA2A 3K1MA 4RESB 2RH0A 1NTMK 1SS1A 1TWAJ 1NTMG 3F3XA 2QM8A 2Y9YA 1MD0A 1P4WA 3JRDA 3VMAA 1LT9A 4I7HA 2E1MB 2GAUA 4G8XA 2OF7A 5JVGF 4RB0A 4W97A 1M1JB 1SQPD 4IJAA 2DPDA 1LWUC 1HGZA 4CO8A 2GQQA 2EA2A 2W1OA 1YHQP 3F8MA 3IC7A 5GAHJ 3CCQI 5J47A 1Q82Q 1AFOA 2FJ1A 2O7OA 2GIVA 3KIOA 3VN0A 4U3FJ 1UG2A 4OIRF 4PD4H 2LH9A 1URQD 3F8CA 1JUPA 2R7VA 4XOPA 1D1AA 2HOEA 2NOJB 4EQQA 1GHCA 2ADUA 2DI3A 5DS9A 2DW3A 2FBHA 2FSWA 3FHNA 5GTIC 3CUQA 4AD9A 1NTZK 1NTZG 1X1DA 2P7VB 1VF5B 5GTHC 2EILH 2NS7A 4E70A 2DO7A 4I2LC 4UB6E 2ZSHB 1DD4A 4IL6H 2FBIA 5E3LA 1XMAA 5D8KB 3L73G 3OYLA 3L75G 1BJAA 3A2KA 4X0GA 3RK2B 3CCLP 3JSVC 1JXSA 4XSZF 1I3AA 5L3GA 4ZZLA 1QA6A 2G7UA 3WUUA 4K35A 2BOLA 2X6WA 3IAS2 2FFDC 1BR2A 3CCUP 1AA7A 1ZGWA 1T2KD 4RAZA 4HOBA 3RJPA 3K2ZA 1GXQA 2MJZA 4ESBA 2QM3A 5IP6A 1MBJA 3CD6I 1A04A 3Q3SA 1RETA 2X9DA 1VL2A 2C0XA 3BZ6A 2DW4A 2MG4A 2HQNA 4WWCA 2E36A 1URQC 1AQ5A 1DD3A 5F1JA 1ZMEC 1TNSA 4ZYHA 2K9LA 3EPZA 2FKWB 2K3PA 3PO2J 5KLVE 4AUWA 2V4JC 4D6TG 1EA3A 2XSDC 4NQWA 1LTJB 4A3KJ 1W2EA 2C9NY 4PJ0C 3W67A 1VZ0A 4HB1A 4F55A 2R5YA 2W00A 3MKYB 3TP0A 4KNYA 2FOWA 2XAHA 3GTLJ 1SD6A 3WGGA 2BHYA 3GFLA 2FXOA 2V1XA 3KFWX 3H35A 3MN2A 3WE3A 3GFMA 3A0HE 5AW1B 3KE2A 1EZVD 3S93A 3FXQA 1T2KC 3GLXA 4KUMA 2XVCA 4E7IA 2P0WA 2WVRA 3SDGA 1YTZT 3QWLA 4RA2A 3WU2C 3DTKA 3BCCG 4KHXA 2VC1A 4IEJA 2MW8A 4YTPC 2YPRA 3WTUC 2K9YA 2XKPA 4CCOA 3U1AA 5GP9A 3HOVJ 1K78A 1SQXD 3FX0A 2FF4A 1XDSA 1J5YA 3A0BC 5EF6A 1CF7B 1JKOC 2YKPA 4HDUA 3ZR8X 1VF5D 4XL9A 1YYCA 3GZNB 2EWNA 2VJ5A 3OYKA 9ANTA 1KB9I 3TK1A 2W7NA 2HQRA 3QH9A 1JB0J 1B72A 1F43A 3RK2D 1SQQJ 2KS1B 3FXOA 3PJRA 1KU9A 2E71A 2XF6A 3USSA 2IJLA 3IRQA 4XKBA 1BCCG 1RPWA 5J1UA 4RMNA 5AW2B 5DUKA 2E1MC 3NXSA 2R93J 1M1JC 5AVWB 3QU6A 3M4OJ 1XSVA 5HOOA 3VODA 1SQVE 3BR5A 3FHZA 5FD6A 3K10A 4BXUA 1UJ8A 3NEUA 3MZYA 4EMSA 4RO0A 3FKIJ 2GIZA 1KQLA 4E4HA 5AVZB 3V2PA 3ZN0A 2M0CA 3SQNA 1L0LE 3SEQA 5DDGA 2KI7B 3RL0B 2XSJC 4FISA 5FLMJ 1T3UA 2IDBA 4M3BA 3VOPA 3GTJJ 5CVIA 2Q7CA 1Q1VA 1NU1J 3GO5A 2ZKZA 4RGUA 1DEBA 1FYMA 3EYIA 3S3OA 1VF5C 2DU9A 3WUTA 3Q5SA 2HOAA 2L01A 1M1EB 2L0KA 1EDKA 2K86A 3NWTA 4Q48A 3L2CA 3V7RA 4Y28J 3RK2C 4OOIA 2IT0A 2DA7A 1RE3A 5F27A 1YS7A 3QP6A 2B0LA 1FZCA 1IFJA 2Q3EA 3ZMZA 3MKZA 3CDHA 2HOTA 4ZNCA 1A36A 2YNYA 1VNDA 3DEWA 2CW8A 2IA2A 3J7AY 1IRXA 4N4NB 2M5AA 2MBFA 2PLYA 1LTAC 3WODF 2NZ2A 3AAFA 3L71J 2M5WA 2O3JA 1VQ6P 2M0BA 1YW7A 1LE8B 3KP6A 4LGDE 1Q86Q 3BVHA 3KZIE 2VT2A 3HBLA 4II2A 3PIPF 1OMIA 3J81Z 1PYVA 3AE7C 3GFJA 1XS9A 1VQ5P 4UB6C 2H27A 2M2EA 2FD5A 3FX3A 3B02A 3L2WA 3MCZA 5FLXK 1LTJC 3JSPA 3HOTA 4Y15A 3ZCOA 1SFCB 2E42A 3PFIA 1ZN2A 1Z91A 1ZV8A 3DPLC 4MNUA 2OGUA 3H1IE 2O1KA 3PH0A 3G1OA 4M3EA 2TCTA 1O3TA 3F5HA 2FNAA 2BEQD 1JKQC 3ABKH 3ZPLA 1YW9A 5APYA 3KYLA 4L9NA 1QX8A 2M8RA 4IF4A 5LRSA 2DK5A 2TDXA 2WB1N 4IOCF 1HJ0A 2WY8Q 4KFCA 4NHJA 3S2HJ 3EQ2A 1SQQK 3Q5PA 1H0TB 1BI3A 1HBXG 1SQQG 2VOPA 1RF1B 3HOSA 1HLVA 1X4OA 5HS8A 4A3MJ 2XF5A 5CLSA 1GK4A 2GOXB 4F52A 1KQGB 1VFCA 1H8AC 1IDZA 4V19K 1Z3XA 3DKYA 2IBZE 3CLQA 1U5TA 4KJZA 4IRGA 4GXOA 1W0UA 1CZQA 3RL0D 3CC4P 1YIOA 2A61A 3G6EI 2JEEA 2KZIA 3H0DA 4XE5B 5K7ZA 2V7QJ 3QOEA 4LITA 2W83C 5AVQB 4ZDOA 5AVUB 2L7KA 3ITKA 5E18F 2HYJA 2Y0SA 1JCDA 1D1BA 1FDOA 1KILE 1Q1HA 3H1KE 2X85A 2FYUJ 5TISH 5J3LA 1PGOA 2BCCE 5APTA 1EF4A 1S5LE 5GADJ 3LA3A 3I56P 2A05A 2RN7A 3K1NA 3A0HC 2CFXA 3FZVA 4U0WA 1V54H 3HUGA 2AEFA 1N73A 2ID6A 1Q2NA 4N9HA 4R79A 1SQVD 2IRFG 1ZG5A 1AQTA 3J7YJ 1TBXA 1DPUA 2H1LA 3ECOA 3IH3A 4CYCA 1D5YA 1GTWA 1I6HJ 1JY3O 4H44B 2P5LC 1KU2A 4IL6E 3HYIA 4HKZH 3CC4I 3S17J 1S7AA 5L3BA 1PP9E 4KA4A 2WZ7A 3K9TA 4BRYA 1WJBA 2NOGA 2K3RA 3R4YA 3R60A 3HC7A 3TMOA 4LC1A 2ISYA 4QLCU 5BMZA 3RL0C 4XLAA 3SZGA 2IGMA 1P4XA 4FTHA 2KIMA 2K40A 2HYFA 3GFIA 1KILB 1KFNA 2BY3A 3U1DA 3FF5A 2R7QA 4UUSB 5JLWA 1TL8A 1A6IA 5C4XJ 3VEPA 1N86A 3H1JG 1Z6RA 5KAFC 3VYIA 5EGOB 1ETXA 2G9WA 1SFCD 2HXIA 2ZXHA 2W85A 4ZC3A 2QWWA 4ZTFA 3BG6A 5L8RJ 2NS0A 2KL4A 4IZZA 2HODA 3CX5H 3OR1C 1U8RA 2YUSA 2QUFA 3D6YA 4DIQA 3QYEA 1BE3G 5FLXZ 3ABVC 4BBSJ 4ZDPA 3H3VK 1FP1D 1GK6A 4Y99C 1S29A 4W7ZA 4DYCA 1L0NJ 2HI3A 3CDLA 1ZLLA 3W6JB 4WB4A 5KVRA 3D5SC 2UV1A 1D0XA 3F72A 3CCJI 3D5LA 4G94A 1Z0XA 2L91A 2JA6J 2ZC2A 5AW9B 3M9QA 3I59A 2PFBA 1O3QA 1P84D 4OGQB 4BHPA 2DMNA 1ZRDA 2E75B 4UUTA 4Y7NJ 4RJTA 2XAJA 2NNNA 2JRTA 2CGPA 2R7ZJ 1F1ZA 3WGIA 3F6VA 1JMBA 1QO0D 3H0GJ 3A4CA 1SFCC 2IGKA 1NHAA 1TNTA 2CW7A 2HKOA 2L02A 4P5OA 1K04A 1VPCA 1D3YA 2WITA 3M0DC 1X2NA 2ELJA 5K7FA 3ABMH 3HRTA 3FKJA 2DXIA 2KZVA 2NYXA 2DA1A 2UUZA 2VXDA 3OWTA 1M56D 1YIJP 1OCRH 1YX3A 2DOAA 3M8EA 3HKZN 4PGHA 4EDFA 3OYIA 1SQPJ 3W3CA 4OIOF 3CJRB 2AO9A 3BG3A 5CJ9A 1ENHA 2BVLA 3S15J 3WUVA 2FUG2 3R6SA 1VQOI 2LFBA 4BYYA 3BTLA 1APLC 1RF1C 2IP2A 1IRFA 2COBA 1MNDA 4EGYA 4H44D 4JF7A 4A69C 3WTXC 2IBZD 2KIKA 1BCCD 3EUHC 1GXPA 2N1TA 2X1EA 1KQ9A 1RY3A 1BGYG 1YLFA 4IHSA 1WRJA 5D5VB 5ILVA 2VOOA 3TL4X 2NPSA 4WY4B 2LY2A 3H1KD 3CCMP 1KILD 1OCCH 4C7NB 3PQJA 1FBSA 1DU0A 4YG2F 4K2EA 3TO9A 1YJ9P 3AEDC 3WHBA 1AVOA 1I6XA 5D4RA 2BCCD 5M3MJ 1HKTA 2F5FA 2VC0A 2RAEA 4DYQA 1MMNA 4IQ4A 2ECCA 2LBFB 5M5XJ 2E7XA 1AA0A 1WJDA 1PVEA 3EUKL 2ME6A 3MD0A 2XAFA 2QZ8A 3Q0WA 4AIDA 4Z6YA 1YYVA 4BXLA 1CI6B 4UB8H 1J1EB 5L3FA 2BYVE 1EV7A 1JUSA 1HW2A 5IT9K 3RIRA 5AW0B 2OQQA 4FX0A 3RL0g 2IS6A 1T0FC 1D5VA 2E35A 4G9YA 3E5QA 1FZEA 1NH4A 2HLOA 2R3CA 2Z5HA 1YITP 3LSRA 4N3YB 3C8VA 1PP9D 4H44C 3G1LA 3OAKA 4YPCA 2JJ7A 1MBGA 5KNLA 4LMYA 4IRIA 1IV8A 1VQPI 5AIQA 1UFMA 4MQ9F 4KMUX 1IRGA 1OQYA 4OGQD 2E75D 5D5WB 3JAMK 2E43A 2VKVA 1KILC 3VYTB 5H20A 3ZRGA 1KORA 1LTTC 1U3EM 3VTPC 2DDBA 2A6EF 3DFGA 2A45I 4BY1J 1S5LC 2PJRB 1XDUA 3L09A 1I50J 3GMEA 4LLGF 3LQRA 1WZ2A 2VODA 4WXDA 3H1HE 2IS2A 2DJIA 4JK1X 1JTHA 1BI1A 1DQUA 3ML6A 1K05A 1O3RA 1X3WB 3MUDA 1M8OB 1NO4A 2BW3A 4N4OB 2QIWA 3CWBE 5E79C 2YXRB 2Z1DA 1MV8A 4FQGA 3B4SA 4HLYA 2F5CA 2IFMA 3H6PA 1GW3A 1RUOA 3AL0B 1YG2A 3V4WA 1VQKP 2OTLI 4A3FJ 1SAUA 3FMQA 1E2XA 3H92A 4JBZA 2JR8A 4PZJA 4B86A 2QQ8A 1Q81Q 5ICCA 1BOBA 1USDA 3GF2A 4KN4X 1SQPG 1UELB 1GL2A 3E6MA 1R5ID 1ITYA 1NG6A 1ZRTE 3PNYA 2D1HA 2O01H 1FTZA 4OGQC 4ZJZA 1S8NA 2E75C 3BDDA 4WY4D 2ELKA 2NRAC 1CW5A 5J6XA 2BY1A 5J8CA 3II6A 4M72A 3K5BA 3M3YJ 4UUVA 1NGMB 1J9IA 3HSRA 3VDXA 1D0ZA 1R00A 4PJLA 3ZQHA 4D7NA 2P5VA 2IAIA 4CCMA 5K5GB 3KXDA 2Z5UA 3OYAA 3MFKA 2NVQJ 1BR4A 2MKVA 2LMDA 4BE0A 2X6YA 3P8MC 2Z4EA 4A3LJ 5HNFA 3K6GA 4MHGA 1X1PA 3OYBA 3J7AO 2Q1KA 3BTIA 3HSEA 4HF2A 1KV4A 1NJIQ 1S7OA 2LK2A 3QRFF 4I7ZC 3LIEA 2ZFCA 2A06E 1VQNI 4EM0B 3HE5A 2MC4A 5FKMA 5TISE 1JTXA 1TT0A 4ITVA 1A6QA 2AHQA 4YFXF 4WK8F 2QQ9A 2Y30A 1QNTA 3DV8A 1SFOJ 1MSEC 2JJLA 3AE8C 3A01B 4GOFA 2CMPA 3B8EB 2GA1A 5CCHA 2Z16A 5FJ8J 4G7OF 3CCSP 2A6HF 2RQQA 2PG4A 1RESA 3TO6A 1FOKA 3CCEP 3CTAA 2K7LA 3AE2C 4WY4C 3G1MA 2O9LA 2M8GX 2QF7A 1HH0A 4EV0A 1S5LX 3PTZA 3O6QB 1MJ9A 1KU7A 5HLTA 3HGGA 3Q5FA 3L00A 5FD5A 4EM1A 2CQ7A 4B47A 4LJZF 5IP9J 5DD8A 3TQNA 2X1CA 2CUZA 2XZRA 1ODDA 5J40A 3HD7A 4WF2A 3E97A 4A3BJ 1NAYA 4XKCA 2ZXXA 1FOWA 1J1EC 2LF7A 5HDKA 1FYKA 2XGXA 3BG5A 4HJGH 4NBQA 3G9RA 1R4NB 3DTIA 4E7ZA 2LKXA 1NG7A 2XROA 2D2CB 2IVMA 3HL2A 1J0RA 5TJJA 3PQKA 1FBQA 1EZVG 1FZFA 3TNUB 3TO7A 3CCSI 3CCEI 3OJAB 3LSGA 2H7HA 3ZP5A 3EWKA 2CH0A 1MBEA 2RVCA 4CHUA 3T97A 1JEKA 3M1EA 2AS5F 3FK7A 2STTA 1FMVA 1YW8A 2L9VA 1TP4A 1QL2A 2B87A 2A68F 2PAJA 3AG2H 4H13B 3K4BA 1DGWY 2ZMEB 3OR2C 1SQXK 2A45H 5A2QK 1SQXG 3H1HD 3WHCA 3BR6A 2QCOA 4DYRA 1L4AB 4OH8B 4GDFA 5E3NA 2Q2EB 1RQVA 3DLAA 1FBUA 4W80A 2L2OA 4EJTA 2DMTA 2OQGA 4PD4I 4FASD 3LAPA 3X2QH 5M5YJ 4XNFA 1QU3A 1SANA 3GW2A 3RPUD 4J19A 3AL0C 1JM0A 3F8FA 4EVIA 1NTMJ 1P4AA 3ABLH 1J09A 4IHWA 2Y0DA 3RCOA 4DCKA 1Z05A 4TT3H 5AIPA 3VOEA 4M9XA 1M90Q 1FZBA 1D8JA 1ZRTD 1STZA 5L3CA 4BACA 4KMFA 5KKZB 3WTWC 5JI6A 3L1PA 1SQBE 2LD5A 4NPDA 2LKPA 3DPTA 3IV5A 3Q2YA 4CCLA 1SD4A 2J5OA 3DBHB 1USEA 4D5CA 1FJPA 1E5WA 1NTKE 3FWLA 3ZGKA 2OQRA 5LRRA 1VQ7P 2JMWA 3BG9A 3BZCA 1KYOH 2IPPA 2P7JA 5IOYA 1MNMC 1IFPA 3U59A 1PV3A 1FMWA 1XGMA 1TLHB 1O57A 2LF8A 1NTZJ 1GZLA 1OVRA 4PJMA 4YFKF 3JSOA 3I58A 2BE5F 1FNNA 4E7SA 4NPFX 4EIJA 1QGKB 3I55P 2LR8A 2R7WA 2JP3A 5H2FH 1MBKA 1OPCA 1KB9D 4DJGA 4XM3A 1MSFC 1WQ2A 1X1CA 2OAZA 1LPQA 1P2FA 3G71P 5J4YA 1J59A 3LMMA 4JQFA 1UHSA 1B9MA 2HGCA 3FXRA 5HDGA 2D2CD 1MFTA 4IOIH 2ESHA 2QENA 4BJ6C 1LTIC 2ME0A 4AVZA 1SFUA 5DCMB 5H6QA 1IUFA 3MZHA 2YO2A 3U1KA 3CMEP 2QLZA 3OL3A 3L70D 5HLGA 1BC7C 4UB8E 1VQ7I 2E19A 1MMDA 3ZDMA 3TKYA 2JT1A 2ZT9B 2YMKA 1IF1A 1ZGAA 5KLVK 5FKOA 2P6TA 4KISA 1FPQA 3VP9A 3OY9A 2FBWC 1E3PA 2ITAA 5B66H 1L4AD 2JA8J 4XK4A 4PDKA 2OJED 1WVRA 3I55I 3W6VA 4B48A 4DGWB 4D6TJ 2WAQN 5CCGA 2ZB9A 3G73A 2K9JB 5ICFA 4HX8A 1KQ8A 4YEJA 2FNPA 2DYRH 1HDDC 2N9YB 3GHGB 4BHCA 5A2QZ 3JRCA 4ZTJA 3GLMA 3CCVP 1JNMA 4Q47A 4HSRA 5M3FJ 4KICA 2WAFA 1IUYA 3MP7B 1LFPA 3H32B 3CJNA 3O3KA 3WG7H 3CMEI 1NH3A 2OCEA 3S1NJ 1QHGA 1FLIA 1MZ9A 1OW8A 2D2CC 3BR3A 1QQIA 3HE4A 4I98B 1BIAA 2DQLA 4XONA 3K4CA 3MZ8A 2CV0A 2UWMA 2W6AA 1AOYA 1X19A 1FBMA 1XMKA 2DA6A 2OV7A 1JY2P 5KTBA 1SMTA 2CQKA 2R5ZA 3BCCJ 3QPLA 4HV5A 1ETQA 4C3JJ 3OYJA 5BU5A 3QU3A 1IG7A 3CC2P 1DDNA 2LC2A 4ASWA 2ZMEC 1FSHA 2NVYJ 5J1YA 5AVRB 2AXCA 3PFYA 4PCQA 3RBZA 2DA4A 3GG2A 2J5PA 5LLQA 2VBYA 1WI9A 1L4AC 1IW7F 2LXCB 1W4MA 3HRNA 4P9UA 4G7ZF 1TU3F 1MMAA 1W7PB 3CCVI 1AKHA 4M3FA 2E74B 3RKQA 3CI9A 2K02A 2HOSA 3CD6P 3E3VA 2CQQA 3C3WA 4JBAA 4ASVA 3NFQA 2E60A 1G2CB 1S9KD 1G3SA 2FBKA 1QVGO 1O7LA 1PJRA 5AVVB 3CPWO 1R5HA 3EFFK 2L7MP 2OBPA 1BCCJ 3IH2A 1SQVK 4G12A 3PNVA 1SQVG 1YFHA 4IVNA 3DKXA 3GZ5A 2AEJA 4DZJA 2G7HA 1HF9A 2XGEA 5KKZC
chains in the Genus database with same CATH topology
2UWJE 4B43A 3K70D 3L2WA 3W2WA 2V1NA 3H5NA 4CSWA 3OYFA 3HOTA 3ZCOA 3KEYA 5FRMA 3LSKA 3PH0A 3MZWB 3DPLC 4XKWA 4EATA 4KITB 1X1AA 2JWDA 2DT6A 4XLCA 3KYLA 5JHFA 2Z2SB 2HU9A 2WY8Q 2A6TA 3MD2A 3TBIA 1H0TB 4RLFA 1Y6IA 3HOSA 3K4KA 2VIXA 4D1QA 1X4OA 2XC7A 2XF5A 3H5AA 2GOXB 4F52A 1NVOA 4XQFA 1D1CA 2HVRA 1Z3XA 3DKYA 3OYDA 4KJZA 3OYGA 2KZIA 3H0DA 5C39A 3QOEA 4LITA 3K70C 4ZDOA 2L7KA 2HPMA 2ZXIA 2Y0SA 3VWBA 1D1BA 2X85A 3L2VA 1JI8A 2HVQA 1T95A 1YE9A 4XMYA 4XLFA 4K3AA 3S1KA 3OIPA 4LIUA 4GRIA 4ANJA 2BW3B 5HNHA 3EUAA 3H5RA 3M1CA 4PJJA 3AKZA 2R7UA 1U7MA 1Q2NA 3VYUB 4R79A 3ONQA 3E1SA 1U7JA 2QRXA 3FXDA 1N75A 2VXZA 3H9QA 4BEHB 2V26A 3LSIA 4CA0A 4RM3A 4HKZH 1HA8A 3RGUA 1BDDA 1WJBA 2K3RA 1P9QC 3TMOA 3HC7A 1EDJA 3L2UA 4XLAA 4XKVA 2IGMA 3SZGA 5CQGA 4DOZA 4BDZA 3DU6A 4BQNA 3LSMA 2OC6A 2R7QA 2GOMA 2VB6A 2MFZA 3K4MA 5FRNA 4PJNA 4YRVA 3L2QA 5KHDA 2ZXHA 4ZC3A 4ZTFA 1MNEA 3BG6A 4D9JA 3DEEA 3A1YA 2KL4A 2WA0A 4C9YA 4IZZA 3SYTA 3OR1C 4ZMDA 5CPRB 1Y47A 4DIQA 2WAEA 3QYEA 3VSLA 3HG9A 1YX5A 1ZELA 1OR7C 4JOMA 4ZDPA 3VSKA 3N05A 4OAZA 4ZYAA 1G59A 1UAAA 3CESA 3D5SC 2LY1A 2B88A 2UV1A 1D0XA 2DT7B 3D5LA 5FROA 3FXEA 2JVGA 3M8JA 1LP1B 4YELA 1OVVA 3CZ6A 2W4SA 1Z3YA 2K9MA 2WADA 3SDBA 2M7BA 2HVSA 4PSXA 1G8XA 2IS1A 4Y33A 4KJMA 4Y3OA 3IP4B 3MMYB 3H9GA 4ZDLA 2M4GA 1TZLA 1JMBA 3QYFA 3A4CA 4HRIA 2IGKA 2CW7A 3V42A 4P5OA 1QHHD 2JSPA 2RREA 1V5EA 2ELJA 3FKJA 3OS0A 2DXIA 4PFPA 2KZVA 2UUZA 2V9KA 2VXDA 3OWTA 4XN3A 3F9KA 4C2TA 1LDKB 1YX3A 2DOAA 4BS9A 2VLAA 1X4PA 3W2VA 2DCEA 3OYIA 3W3CA 1S3JA 3NWSA 3CJRB 2CFOA 5CBNA 4P1WA 2BVLA 4F92B 1X1BA 2FUG2 2MD0A 4U87A 3MKWB 1MNDA 3D5RC 2KIKA 1K6YA 3H9JA 4F3QA 3EUHC 3UR3C 1D0YA 2M4KA 2X1EA 1U0JA 2L9NA 3CJQB 3TL4X 2L9SA 3VYSB 2VKHA 2LY2A 1WJEA 3FDYA 4CCKA 1X0TA 2B87B 2LREA 1WJAA 4B44A 2B89A 4BJ5C 5LD2C 3OYMA 1MMNA 4IQ4A 2LBFB 4NUBA 4DJAA 1WJDA 3EUKL 5EFWB 4E6KG 1OLTA 1Y56A 2VQHA 4BXLA 2Q1ZB 1R6RA 5DJUB 4IX7A 5KCMA 2RNGA 2IS6A 1T0FC 3I3LA 3OYEA 1EC5A 1H0TA 3IAM2 3W2AA 2MABA 2ZFUA 1GLNA 4H4KC 2F6CA 2R7RA 3OYHA 4RLQA 4J00A 4Y4RA 5KNLA 1W36D 3BCAA 2VQGA 2X1DA 2F4IA 2KRHA 4NQWB 2R7OA 1N78A 2JVHA 2CV1A 4NPEA 1UG0A 3VYTB 3ZRGA 4DBRA 1MMGA 3C2GA 2P58A 2CUJA 3HPGA 5TGTA 4XN0A 2PJRB 3SEZA 2XAUA 3OOUA 2V6EA 2IS2A 2DJIA 1DQUA 2R7SA 2BW3A 3CF2A 2R4GA 2KMUA 4N4OB 2Z1DA 4XR6A 1LVKA 1ZXGA 1FC2C 3AL0B 4LIVA 2VKDA 1SAUA 4BEHA 4JBZA 3DPUA 4CUGA 1BOBA 5CKTA 4BL0B 2VPLA 1UELB 1W36C 3OL4A 1Z7LA 5HVQC 2WAQA 2LYCA 1WJFA 1NG6A 2R7XA 3PNYA 1MW7A 3BCBA 4XORA 2R44A 1BDCA 4CH7A 2QKLB 2VQLA 4AU7A 4ZJZA 1WJCA 2IS4A 4PK4A 4CCNA 3GBGA 4QPOA 1D0ZA 4OWRB 4PJLA 4QPQA 3VDXA 3PNTA 5CBOA 3PL8A 3RSNA 4CCMA 5K5GB 3ZQQA 4XLHA 4CCJA 3OYAA 3ZXSA 1BR4A 1WFXA 3LFUA 3C2HA 1KONA 2KP6A 2X6YA 4BE0A 2V7FA 3OMYA 4KT6A 5HNFA 3K6GA 3OYBA 4EYYQ 2Q1KA 3PSFA 2HZDA 2XDVA 3S3NA 1ERDA 3HPHA 4RM2A 4XOTA 2I8DA 2HQAA 2MC4A 2A5WA 1TT0A 3CP8A 4ITVA 2HNHA 4GOFA 2VJJA 2CMPA 1LP1A 1LKXA 2LOOA 2Z16A 1N77A 2O5RA 2RQQA 2ZAEB 2W82A 3CMMA 3OS1A 4G6TB 1DEEG 5LFAA 2JA2A 4BQQA 4CZCA 1SS1A 5HLTA 1DP3A 4HG2A 4NC8A 4B47A 3RQ4A 2X1CA 2CUZA 2CS3A 2E1MB 4XKCA 2M5AB 2W1OA 2KZJA 4HJGH 2WY7Q 3DTIA 2LH9A 4E7ZA 1NG7A 4BJTA 2R7VA 4XOPA 3HL2A 1D1AA 4PUSA 2NOJB 4HNTA 4WWIA 2JUGA 2IXSA 2WB1A 4J01A 3BG7A 2KHMA 2ZSIB 3LSGA 3FHNA 2CH0A 4HPQA 1X1DA 3OS2A 2KRCA 5DJTB 1FMVA 2ZSHB 2CV2A 2QKMB 2B87A 3QYBA 3OYLA 4BE1A 3K4BA 1DGWY 3OIQA 3OR2C 4X0GA 3A2KA 4IQJA 2LBFA 2Q2EB 2VJIA 3DLAA 4K35A 2BOLA 2X6WA 3HXLA 3IAS2 1BR2A 2L2OA 2LG4A 1AA7A 4HNUA 4FASD 4GOEA 2LR2A 2LRDA 3CP2A 3G2BA 4XNFA 4E7JA 1QU3A 3K4LA 3OYNA 1EDLA 3RPUD 3L2RA 3AL0C 1JM0A 1EDIA 1J09A 2LXBA 2X6XA 4MLOA 2AQEA 2PMZA 3RCOA 2KPMA 2K9LA 3BC8A 3EPZA 3U21A 2VASA 2K3PA 2BVMA 3FBIB 4BACA 2E5NA 4F91B 2V4JC 4NPDA 3DPTA 1EA3A 2R7TA 2MYSA 4GODA 4CCLA 4II3A 1VZ0A 4B3XA 4HB1A 4F55A 2W00A 3ZGKA 1WJ5A 4NC7A 3MKYB 1Z21A 2IGOA 3DU5A 3H35A 1V5GA 3HUGB 2PJRA 3S3MA 1FMWA 2VJ4A 1OVRA 4PJMA 3MHVA 4NPFX 4C30A 2HPIA 3S93A 4E7SA 1E0EA 4E7IA 2P0WA 4BQOA 2R7WA 4MN4C 4BU2A 2AQFA 2KUBA 3DTKA 4XM3A 4IKFA 1X1CA 4CCOA 3LMMA 4FETA 4JQFA 2WBMA 2E5ZA 4IOIH 1MFTA 3QODA 4BJ6C 4AVZA 4BE2A 3DQVC 3VYRB 3QWOC 3OL3A 4PFOA 3ZR8X 3DWLE 4XL9A 2HDWA 4F93B 3PSIA 2KLOA 1MMDA 3PUBA 2VJ5A 3BLYA 3OYKA 3ZDMA 4E7LA 4OAYA 3K4JA 4XLEA 2W7NA 4AYBA 4BGDA 3LSHA 2KS1B 4KISA 3OY9A 3PJRA 2IGNA 4HEA2 2XF6A 4E7HA 2VQCA 4XKBA 1SFKA 2X51A 4RMNA 2M0MA 2VL8A 4B48A 4DGWB 2E1MC 5HOOA 2QVAA 3S8PA 4YEJA 4BXFA 4HSTA 3K10A 4ZTJA 4HSRA 3KX2A 2WAFA 4E4HA 1LFPA 3AFHA 1OVUA 3SEQA 3DTEA 2WMMA 1QHGA 2KI7B 1V5FA 1S9HA 2XSJC 4PSWA 4XONA 3HKZA 2M7AA 3K4CA 3LL7A 2CV0A 2UWMA 2SPZA 1X19A 3S3OA 2OV7A 2OTKE 5CQEA 2L5QA 2M3AA 3S32A 1EDKA 3NWTA 3OYJA 3UNGC 3OYCA 4ASWA 2LC2A 4E7KA 1BR1A 4C2UA 2XF7A 2KQRA 3PFYA 2RKLA 4BUPA 3IUOA 4U7BA 2LXCB 3MKZA 1LT1A 2K5CA 4ZNCA 1MMAA 2CW8A 1ZW0A 3J7AY 1IRXA 4N4NB 2M5AA 2F5VA 4NNJA 4ASVA 3I9V2 3FBNB 2E60A 1DGRM 2OUMA 4CPGA 1PJRA 4BDYA 2M0BA 3PNVA 3E0JB 3DKXA 2KDOA 4II2A 2HR3A 3RTRA 3K4NA 4LG3A 1PYVA 4DBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPD A;  2UWJ E;  2R44 A;  4KJM A;  1BDC A;  4GOD A;  4HB1 A;  1JMB A;  3PH0 A;  3MZW B;  5CBO A;  2JWD A;  5K5G B;  1OVR A;  3MHV A;  4NPF X;  1S3J A;  5CBN A;  1H0T B;  4EYY Q;  2Q1K A;  4MN4 C;  2KUB A;  2I8D A;  2KIK A;  1NVO A;  4IOI H;  1MFT A;  4GOF A;  1LP1 A;  2KZI A;  5C39 A;  3QWO C;  1X0T A;  2B87 B;  2ZAE B;  3ZDM A;  1DEE G;  2B89 A;  1SS1 A;  2KS1 B;  4K3A A;  3S1K A;  5EFW B;  1U7M A;  4BXL A;  1Q2N A;  5DJU B;  2M5A B;  2QVA A;  1U7J A;  2QRX A;  3FXD A;  1EC5 A;  2KZJ A;  1H0T A;  4HJG H;  4HKZ H;  3RGU A;  1OVU A;  1BDD A;  2WMM A;  2K3R A;  2KI7 B;  4WWI A;  1EDJ A;  2SPZ A;  5DJT B;  2OC6 A;  4NPE A;  2OTK E;  2B87 A;  2P58 A;  1EDK A;  4ASW A;  2KL4 A;  2RKL A;  4ZMD A;  1Y47 A;  4K35 A;  2LXC B;  1LT1 A;  4ZNC A;  4GOE A;  1ZXG A;  2LR2 A;  1ZW0 A;  1FC2 C;  2M5A A;  4ASV A;  1EDL A;  1JM0 A;  4JBZ A;  4CPG A;  2B88 A;  1EDI A;  2LXB A;  3FXE A;  1LP1 B;  2M0B A;  1OVV A;  2HR3 A; 
#chains in the Genus database with same CATH topology
 2DTR A;  4WXC A;  1MDM B;  2JPB A;  5B5E H;  1L0L K;  3HUS B;  1NTK D;  1L0L G;  3W2W A;  3CC2 I;  1FIA A;  3E7L A;  3KEY A;  5FRM A;  3LSK A;  2ZT9 D;  2QBY A;  1S4X A;  1H88 C;  4MEX F;  2V1U A;  1LTG C;  1VF9 A;  4XKW A;  4KIT B;  1X1A A;  5FFZ A;  4UV8 A;  2ZO4 A;  2DT6 A;  4XLC A;  2XV4 S;  1T8I A;  1U2W A;  5JHF A;  3FXK A;  1AV1 A;  2NRG A;  1BIB A;  1JUN A;  2RNJ A;  3GX4 X;  4A3I J;  3MD2 A;  1FYL A;  1IO2 A;  3TDU C;  2W25 A;  4RLF A;  5EG0 A;  2KOG A;  1JE8 A;  3K4K A;  4D1Q A;  3OSG A;  3PP5 A;  4HQM A;  3H5A A;  1R71 A;  2H8P D;  3I5C A;  4YXW H;  4ENJ A;  1YTY A;  1UMQ A;  2F5E A;  1D1C A;  4XQF A;  5KJ7 A;  3ABT A;  2JWT A;  3FXU A;  5K1Y A;  3L74 E;  1D8K A;  3V4Q A;  3JRG A;  2YO3 A;  3CO6 C;  5LBQ A;  4KT0 J;  1J2X A;  1KQF B;  2POH A;  1IN6 A;  1N7L A;  1TQP A;  3M0A A;  3TGU E;  1EH7 A;  2ZXI A;  3VWB A;  4OU0 A;  4NB5 A;  3AG1 H;  2ZT9 C;  5EEH A;  1R5G A;  1YE9 A;  4XMY A;  3DEU A;  1QPM A;  2YX4 A;  2P8T A;  4LIU A;  3S1K A;  2NAZ A;  2CPS A;  3FMS A;  2RQP A;  5FB2 A;  2XHK A;  4PJJ A;  4RGR A;  3AKZ A;  3FXL A;  1GV5 A;  2LDU A;  2FYZ A;  2BGC A;  4TLF A;  3SWY A;  3ONQ A;  3PHL A;  5AW8 B;  3M07 A;  1OIP A;  2QRX A;  1W7P D;  3FXD A;  1N75 A;  3L37 A;  2E74 D;  3H9Q A;  4O9B A;  4DZO A;  1W2B O;  2V26 A;  1QL1 A;  2QQB A;  3K0L A;  3VMZ A;  5B1A H;  1PPJ D;  1XGS A;  2XGC A;  3LSI A;  1P7J A;  3RI4 A;  3PLN A;  2CYY A;  2YXQ B;  4RM3 A;  3RGU A;  4A0X A;  1HA8 A;  3SWK A;  5B1B H;  3V7C A;  3JCU E;  3HOW J;  1BDD A;  4JYK A;  1P9Q C;  1RRJ A;  5K5O A;  3B71 A;  4A2U A;  1IDY A;  3L2U A;  1H9T A;  3L36 A;  1EDJ A;  2FA5 A;  3P7N A;  4XKV A;  1ZK8 A;  1LNW A;  1AHD P;  3HOU J;  2PEX A;  3LSM A;  2GOM A;  4QWQ A;  5GAG J;  5HDN A;  4U7D A;  4AIK A;  2W6J H;  2MFZ A;  4O6J A;  1RE4 A;  2IBZ G;  4YRV A;  3G3Z A;  3L2Q A;  3B5N A;  1UIX A;  2KNC B;  5KHD A;  4M74 A;  4HAM A;  3JRF A;  1K4S A;  1JY2 N;  3CLO A;  1P92 A;  3RKX A;  2WA0 A;  2VRS A;  3WTY C;  2QSG X;  3H1K G;  3IRR A;  3H1L E;  4YIF A;  1SC7 A;  1MBF A;  1Y8R B;  3VSL A;  4ESF A;  1OR7 C;  3VSK A;  3J7Z I;  4B4C A;  2BCC G;  4OAZ A;  1G59 A;  3HZJ A;  2F5D A;  2E74 C;  4AYC A;  3K1P A;  1T39 A;  2A07 F;  1SVM A;  2DFF A;  1T98 A;  6PAX A;  1R36 A;  2W84 A;  1JHH A;  2LY1 A;  1RKT A;  3CES A;  4L5J A;  4AYB N;  4AVP A;  4OWF A;  1ETO A;  5FRO A;  1QBJ A;  3E5U A;  5JHU A;  5C3E J;  2JVG A;  4Y52 J;  3M8J A;  1FTT A;  4YFN F;  2JUC A;  2I5U A;  3CZ6 A;  1Z3Y A;  2K9M A;  4UVB A;  2VI6 A;  3D6Z A;  2M7B A;  1A02 J;  2JRM A;  3LST A;  2EIK H;  2KB7 P;  2PFX A;  1KQS O;  3T5X A;  4KJM A;  2K4J A;  3L73 E;  3L75 E;  2CQX A;  2PQ8 A;  4BHB A;  1VQL P;  3BQY A;  4M6Y A;  1PP9 G;  3H9G A;  3HUS C;  2RDP A;  2WT7 A;  3Q3D A;  2GXG A;  2M4G A;  1TZL A;  3CX5 I;  2K9N A;  3L72 E;  3MKL A;  3V42 A;  2OZU A;  1J7K A;  1TTY A;  4LLN A;  2X0L A;  2JSP A;  1V5E A;  4ENN A;  1LNQ A;  1LT9 B;  1K8A Q;  2KFD A;  2M9H A;  3OS0 A;  4PFP A;  1BI2 A;  1RR8 C;  4XN3 A;  5F64 A;  3BJA A;  3F9K A;  3KP3 A;  4ENM A;  3P9I A;  2DOE A;  1KGS A;  4JX6 A;  4EJO A;  4IXA A;  1S3J A;  3NWS A;  1QZY A;  2CFO A;  3WU0 A;  1VI0 A;  1ETK A;  3I54 A;  4P1W A;  4RAF A;  3VFZ A;  1X1B A;  4ZYE A;  2PGD A;  3H1J J;  1XB4 A;  2DDA A;  2QA4 I;  2HPC A;  2C0W A;  5KLV D;  1MH4 A;  4EJW A;  3S4R A;  3D5R C;  2ICW G;  2YX7 A;  4F3Q A;  2EB7 A;  3G6E P;  3K69 A;  2L9N A;  2P81 A;  3CUQ B;  3M9H A;  3PJS K;  2NVT J;  4HYE A;  1BE3 J;  3L35 A;  5B66 E;  1VQL I;  1LUJ B;  3QPT A;  1KQ0 A;  3VYS B;  3ERM A;  1U9N A;  1HW5 A;  5GAE J;  1BSH A;  4XSX F;  3BR0 A;  1ZRE A;  3HIF A;  1POG A;  4QSH A;  4BJ5 C;  2P67 A;  1FIP A;  3S1M J;  3OYM A;  4GO1 A;  1HF0 A;  5BU8 B;  1ZQ3 P;  3KZY A;  5K5Q A;  5EFW B;  3JRH A;  1OLT A;  1Z56 A;  1RF0 A;  2Q1Z B;  5B3S H;  3FGA D;  1LFU P;  1I1S A;  2DBB A;  2PJP A;  1MZB A;  3CXH I;  1HUC A;  2V7Q H;  5F0F A;  1JJ8 C;  1S72 I;  2ZFU A;  1GLN A;  4DNC A;  3VPR A;  2F6C A;  4J00 A;  2L4M A;  5HS7 A;  2Y0M A;  4A93 J;  4AIJ A;  1MH3 A;  2VQG A;  2R32 A;  1BJZ A;  2FOK A;  1IGN A;  3GTM J;  3BAS A;  4U3F E;  1PP8 F;  2KRH A;  4NQW B;  4L75 A;  1U9O A;  3RKW A;  1N78 A;  1XG1 A;  2JVH A;  2FYN B;  2R5Y B;  4KDP A;  3S9O A;  2B9B A;  3F6O A;  3KPH A;  4A5N A;  4WX9 A;  1I5Z A;  2WWW A;  3KYQ A;  4NPE A;  4FE7 A;  4PD4 E;  4DBR A;  1MMG A;  2ETH A;  2P58 A;  2EZK A;  2CUJ A;  1G3T A;  3P5J A;  2H8R A;  4IRH A;  3TDZ C;  5AW7 B;  1W5T A;  4YII A;  1BGY J;  2KIS A;  2BEZ F;  2Q9I A;  3H1L D;  1KYZ A;  2R7S A;  3P9K A;  2WPR A;  4H0E A;  3KLO A;  1YJN P;  3CF2 A;  2KMU A;  1L0L D;  1B8I A;  2HTJ A;  3DBR B;  4O5V A;  1WH5 A;  5LEK A;  5CHX A;  3LSP A;  1G1I A;  2ZBK A;  3UKG A;  3BQZ A;  3BR2 A;  5B5E E;  3CCJ P;  1BOA A;  3CCR I;  3P32 A;  3HTK A;  4BEH A;  3SZP A;  4A0Z A;  1K78 B;  3JCU C;  3DBL B;  3UIA A;  2VPL A;  2ZJP F;  5HVQ C;  1F36 A;  2LYC A;  1H89 C;  3A02 A;  1K61 A;  4B3A A;  3BCB A;  1BDC A;  3L70 J;  4CH7 A;  1XSX A;  4AU7 A;  4LD5 A;  1B72 B;  1WJC A;  3L72 D;  1RKW A;  3AE9 C;  3SFE C;  1JT6 A;  5DV5 A;  2K9S A;  3HSF A;  1NK3 P;  3IWZ A;  1U8B A;  4QPO A;  2KIF A;  1IN4 A;  5CBO A;  4JP0 A;  1NKZ B;  2YR2 A;  1AU7 A;  3EDP A;  1LT9 C;  1YJN I;  3AE1 C;  2IX7 C;  4AIH A;  1HXD A;  1WFX A;  1KON A;  4QTR A;  3IFM A;  1F5T A;  2V7F A;  3LNQ A;  4ZKP A;  1VQO P;  4EYY Q;  1SVL A;  3V8K A;  1XD7 A;  2IYP A;  4RDU A;  5GTI H;  2HZD A;  2YIU B;  3HPH A;  3H1H G;  5GTH H;  3GUD A;  4XOT A;  2I8D A;  2IFN A;  2GA2 A;  2W27 A;  3HJE A;  1T6A A;  5APS A;  3CP8 A;  1FP2 A;  1K79 A;  1QVF O;  2HNH A;  1O4X A;  2GLO A;  2VJJ A;  4N6J A;  1LP1 A;  3H1I D;  3CUQ C;  1LKX A;  3SJM A;  3AEA C;  1R9T J;  1T6S A;  3TW6 A;  3BT9 A;  2M3E A;  1VQ4 P;  5IYB J;  2KRF A;  1YJW I;  1TWC J;  5LFA A;  1TWH J;  4ESJ A;  3A01 A;  2EV0 A;  3ZMS A;  4BQQ A;  4CZC A;  1H0M A;  4GFB A;  3O8G A;  1DP3 A;  1FY7 A;  5CJ0 A;  2V1D A;  1FZC B;  2QEX I;  4NC8 A;  2R7F A;  1DPR A;  3KZZ A;  3RQ4 A;  3WG9 A;  2RN0 A;  5D4S A;  2CS3 A;  1R23 A;  2VT3 A;  1SQQ E;  1ZAO A;  1GV2 A;  2ZXJ A;  2HWV A;  1YRN A;  3CXH H;  1LQ1 A;  5BPD A;  4M6V A;  4JYB A;  2M5A B;  1MIJ A;  2OYI A;  2XB5 A;  4O3M A;  4OIP F;  2EFW A;  1FSE A;  3KZI C;  2WY7 Q;  4IHT A;  4XA4 A;  1VQ9 P;  2CK3 H;  4IFM A;  3BP8 A;  4XID A;  1T3J A;  4PJ0 H;  1FJL A;  4GYG A;  4IHV A;  4BJT A;  4EJV A;  1Z7U A;  1VQP P;  2WQY C;  4PUS A;  4HNT A;  4L5E A;  3R0J A;  4WWI A;  4U3F D;  2WB1 A;  4J01 A;  3BG7 A;  1VQ4 I;  4HPQ A;  2Q5U A;  1Y39 A;  1YS6 A;  1UHW A;  2PBI A;  3FIS A;  3KHU A;  2HS5 A;  2A06 G;  4PD4 D;  1OW7 A;  2FYN C;  1DX7 A;  2CV2 A;  2Y0E A;  1X58 A;  2QKM B;  1LTS C;  1V3F A;  1ZP0 C;  2JPC A;  2ZYG A;  1NU1 E;  2QG4 A;  1FZG A;  3MGN A;  1ACI A;  4IQJ A;  3O6B B;  3WU2 H;  1J75 A;  1G3Y A;  1HST A;  3I53 A;  3L70 G;  5JR3 A;  1W5C E;  2E2I J;  2BEO A;  3HXL A;  2IYO A;  4OMZ A;  1LWU A;  1VQ9 I;  4HNU A;  1B4A A;  3CO7 C;  1ZLK A;  3A0B H;  4GOE A;  2OTL P;  2LRD A;  2ISZ A;  2EJR A;  3G2B A;  3REO A;  1FDI A;  4D7M A;  3JTG A;  1BI0 A;  2RKH A;  3L9F A;  4RBO A;  3OYN A;  2E2H J;  1EDL A;  3L2R A;  4HLX A;  1EDI A;  2LXB A;  1U5T B;  2RC4 A;  4MLO A;  2AQE A;  2PMZ A;  1J1D B;  2KPM A;  3BC8 A;  3U21 A;  4JQ0 D;  2VAS A;  2C9L Y;  1RR7 A;  2EQR A;  4NDL A;  1QRY A;  3CMY A;  2BVM A;  3BZK A;  2M8E A;  5L3E A;  3C18 A;  3JRB A;  2GXB A;  3L71 E;  3OIO A;  2IW5 A;  2J59 M;  1IJW C;  3O2P E;  2MYS A;  1HC8 A;  2H94 A;  1NKN A;  2WC2 A;  3N4M A;  1FS0 E;  3M9A A;  1YI2 I;  1WJ5 A;  1IC2 A;  2O01 N;  2XDJ A;  3E5X A;  3H3Z A;  1LJ9 A;  4GYI A;  1IK9 A;  5AVX B;  3D1N I;  5EJC A;  5IT3 A;  2QE7 H;  2MH9 A;  2E1C A;  2JQ7 A;  3N7N A;  3HUG B;  1HW1 A;  3O8H A;  5CJ4 A;  1N73 B;  3S3M A;  1OKR A;  4B8X A;  1ONV A;  3C2B A;  4N78 E;  5EZG A;  1XGN A;  3I5U A;  2FMY A;  4IL6 C;  1K7A A;  4Q5S F;  1PUF A;  2FFD A;  2HPI A;  1E0E A;  4ZYG A;  2H6B A;  5GPC A;  4CYC B;  1REP C;  1M57 D;  4BQO A;  4MN4 C;  4BU2 A;  1CSB A;  1FE6 A;  2AQF A;  2WV0 A;  4WBA A;  2KUB A;  1Z77 A;  1VQN P;  1SQX J;  1IN7 A;  4RB2 C;  2MA3 A;  4I6Z A;  4KYW A;  4YIR X;  2YIU C;  4BRY B;  2DA5 A;  1URQ A;  1R4M B;  2WBM A;  2E5Z A;  3PO3 J;  1NOH A;  2A69 F;  3S2D J;  3M9B A;  4BE2 A;  3DQV C;  3V7S A;  4Z1M H;  3QWO C;  4PFO A;  2GM4 A;  3S14 J;  1J2J B;  4F93 B;  2TRT A;  1KYO I;  2H43 A;  3PUB A;  3BLY A;  2HQ5 A;  2HDD A;  4CZZ A;  1Y0N A;  4E7L A;  4KT5 C;  4XLE A;  2E2J J;  2Q6Q A;  3T8R A;  1A31 A;  4S0H B;  3RK3 E;  4CXF A;  3HHG A;  1RE3 C;  2PI0 A;  1LEB A;  1FZC C;  2FYU E;  2X51 A;  3KYC B;  1NTK K;  4P55 A;  3WTS C;  1NTK G;  3BTJ A;  2KLU A;  2Y0C A;  1LGH B;  2QSF X;  2ZNY A;  3KP5 A;  1VQM I;  3TOA A;  4U88 A;  1T2K A;  3AEE C;  4HST A;  2E5T A;  4LFU A;  2LSO A;  5FKK A;  4UB6 H;  1X2M A;  5IT9 Z;  2F2E A;  3KX2 A;  2HXO A;  1JT0 A;  1PDN C;  4KN7 X;  4MTE A;  2J58 A;  3I59 B;  2KT0 A;  5DM7 F;  2KJB A;  3S2W A;  1OVU A;  3CC7 P;  1DIP A;  4KIF A;  2H09 A;  4LB6 B;  3J80 K;  2HYN A;  2WMM A;  1V5F A;  4PSW A;  5DEQ A;  1JY3 P;  3A3Y B;  2K3F A;  3HKZ A;  2M7A A;  2D45 A;  5AVY B;  5LHH A;  4N9I A;  3VP8 A;  2SPZ A;  1RC9 A;  2FU4 A;  2QQA A;  2IA1 A;  1NAF A;  3N4X A;  2OTK E;  5CQE A;  5TRD A;  4RKU J;  1I39 A;  5E8G A;  2DMU A;  3RK3 B;  1NU1 D;  3UNG C;  1HQC A;  3OYC A;  1BR1 A;  3JAM Z;  4C2U A;  1XCB A;  2KQR A;  2XF7 A;  1ZLJ A;  4C2M J;  1YOV B;  3HGY A;  2RKL A;  4R1H A;  3AEG C;  4N0B A;  4IL6 X;  2P7C B;  3IUO A;  4U7B A;  2OYH B;  3FXM A;  2DAO A;  5DCF A;  4EM2 A;  5AVS B;  2K5C A;  1HVV A;  1M1J A;  3ABU A;  1ZW0 A;  3HTU A;  2E1N A;  2E7W A;  1P84 I;  3RYP A;  2F5V A;  4D5F A;  2XB0 X;  4NNJ A;  3CC7 I;  3I9V 2;  2HEO A;  5KLV J;  1HSJ A;  4HZF A;  2N1T B;  3CX5 E;  4XIC A;  1U5T C;  1N7S B;  3AEF C;  3OA7 A;  1ON1 A;  1L0N E;  1IN8 A;  1J1D C;  2WV1 A;  1Y1V J;  4A3G J;  3FWN A;  3HOZ J;  2NPS B;  3L71 D;  4R4M A;  1AWC A;  3CUO A;  3FMR A;  4DBQ A;  2ELH A;  4B43 A;  5IOZ A;  3K70 D;  2UWJ E;  3M8F A;  5E20 A;  1PPJ G;  3H36 A;  3JW4 A;  1OCP A;  2LLK A;  2V1N A;  3H5N A;  3OYF A;  4MIM A;  3E6C C;  4IFF A;  1ETV A;  1USS A;  3Q5R A;  5D5X B;  1OCT C;  3MZW B;  3CWB D;  3LA7 A;  5GTH E;  1L3L A;  2V9P A;  2XIG A;  1ZHF A;  1W5C C;  1ZH5 A;  4N78 D;  3P8C E;  3H25 A;  1LEA A;  2HYG D;  2HU9 A;  2M1B A;  2Z2S B;  4XLP F;  1XSD A;  1Y1W J;  2Q0O A;  3TBI A;  3GWZ A;  4UXN A;  1N25 A;  1Y6I A;  5KAI H;  1BM9 A;  1IAW A;  2EFO A;  2QSI A;  5APW A;  2VIX A;  1X9V A;  3EFG A;  5E1X A;  5BPI A;  3KET A;  2VN2 A;  3KQG A;  1SQP E;  3HRM A;  2FY8 A;  2DOD A;  5KAF H;  3GLL A;  1F9N A;  4LGW A;  5C44 J;  4A3D J;  5HLI A;  3KP7 A;  3ZQC A;  2X6O A;  1PGJ A;  3AEC C;  3OYG A;  1IFI A;  4A3E J;  4G6Q A;  3RBX A;  1SFX A;  4ENK A;  4U0V A;  2KYV A;  3H3U A;  3QOP A;  1AVY A;  3K70 C;  2HG5 D;  1UZC A;  4HF1 A;  3CXH E;  1LTJ A;  1EXI A;  4DQ2 A;  1JI8 A;  2HVQ A;  2ZVO B;  3RK3 D;  3CCY A;  1ZKG A;  5F04 A;  1X22 A;  3OIP A;  1XC5 A;  2MGQ A;  1RI7 A;  4GRI A;  1JTH B;  3B73 A;  2ZFW A;  3HDD A;  4ANJ A;  1SQV J;  3GVA A;  2FYU D;  3A2A A;  1JHF A;  2BW3 B;  4XLN F;  5HNH A;  3EUA A;  4GGG A;  4L9J A;  1U7M A;  2BHZ A;  3C9I A;  4HH2 A;  2A06 D;  2KP8 A;  3VYU B;  4OVN F;  3QP5 A;  3TF5 A;  1JKP C;  1L0L J;  2YKQ A;  3QPS A;  2G8Y A;  2ZXE B;  3ZQL A;  5TJH A;  2XUB A;  3R2P A;  3LW5 J;  4WXH A;  1WSU A;  4UVA A;  4CA0 A;  4I76 A;  5LHG A;  1OX3 A;  2OYO A;  1G3W A;  2VBX A;  2KIQ A;  3HRU A;  1GL2 B;  2N1T D;  3Q0U A;  4NC6 A;  1H8A A;  2YMY A;  1ETW A;  1XPX A;  2RV8 A;  5FLV A;  1E17 A;  3TGN A;  1N7S D;  1SLQ A;  1T8Z A;  4DOJ A;  4L18 B;  2WTY A;  3KLN A;  2NPS D;  4DOZ A;  3N97 A;  4H13 D;  4B1R A;  4BDZ A;  1A02 F;  1CF7 A;  4BQN A;  1GMJ A;  2OC6 A;  4L9T A;  2CW0 F;  2W90 A;  2VB6 A;  5KLV G;  1PGQ A;  3HHH A;  3R61 A;  1JY3 N;  5FRN A;  4PJN A;  3F23 A;  2LTP A;  3MVP A;  4MFD A;  3JRA A;  1LTB C;  3QAH A;  2L5G B;  3RK3 C;  4GKG A;  3GF7 A;  3NQO A;  1MNE A;  1E3O C;  2WSC H;  1MKM A;  3BOQ A;  3L7W A;  4D9J A;  3A1Y A;  2KS1 A;  3E1R A;  4XFJ A;  2FQ4 A;  4C9Y A;  3CJT B;  3SYT A;  4FX4 A;  1AJY A;  1FOX A;  1GD2 E;  2WSC J;  2XAS A;  4I1L A;  2OYH C;  2DN0 A;  3HG9 A;  1ZEL A;  4JOM A;  1KMI Z;  5TIS C;  1OJL A;  2JDI H;  2GWR A;  1P84 H;  1X3U A;  1UAA A;  1BBY A;  1Y8Q B;  2JKV A;  3B6A A;  4UHT A;  2I10 A;  4XBF A;  3HE5 B;  5F1R A;  2BXY A;  2EZH A;  5HOD A;  3CX5 D;  2B88 A;  5EZH A;  4ON0 A;  2DT7 B;  3T0Y A;  2CQN A;  1KYW A;  2QSH X;  4QIW N;  5CVR A;  3G4S I;  2N1T C;  2OCC H;  3RZO J;  2O6G E;  3FXE A;  1IN5 A;  1UB9 A;  4YEL A;  1JO5 A;  4XRS G;  1S6L A;  1N7S C;  2WAD A;  2QJK B;  5KK1 A;  1LFB A;  2HVS A;  2DK8 A;  1GW4 A;  4PSX A;  1LVA A;  1G8X A;  3H1I J;  2Z3Y A;  1TQI A;  4L0Z B;  2NPS C;  4H0L B;  4H13 C;  1V55 H;  5ICG A;  4UV9 A;  1OW6 A;  4Y3O A;  3CMA P;  4I6M C;  4M71 A;  4ZDL A;  3ZQF A;  2A45 G;  4HYT B;  5D5U B;  3QYF A;  3I4M J;  3IN6 A;  5CVJ A;  1DP7 P;  1QHH D;  5BQT A;  1TT5 B;  2KZG A;  5BNG A;  2K37 A;  2STW A;  1X8Y A;  3HD7 B;  3RZD J;  3P8C D;  2V9K A;  4C2T A;  2FX0 A;  2Y69 H;  2VLA A;  3W2V A;  2DCE A;  2KSE A;  3KP4 A;  1WMK A;  3ROU A;  5CBN A;  3Q0V A;  5FGM A;  2DOF A;  4F92 B;  4U87 A;  1UHM A;  3ASO H;  3MKW B;  4S05 A;  1SQB D;  3SWF A;  3H1L G;  1K6Y A;  2JZY A;  3H9J A;  4MGR A;  2AXT H;  1QLE D;  3V2R A;  1D0Y A;  1GL2 D;  1Q90 D;  4G7H F;  4M3D A;  3JRE A;  1U0J A;  3H1K J;  3T97 B;  1S5L H;  2FQ3 A;  1BW5 A;  3TED A;  3CMA I;  1LE8 A;  1QVT A;  2XPV A;  2FXP A;  5E1W A;  3HM5 A;  3CJQ B;  3FK6 A;  2L9S A;  3WGH A;  2BCC J;  3CXH D;  1WJE A;  3FDY A;  1S7E A;  2B87 B;  2FXM A;  4HBL A;  3CDI A;  5JLX A;  2R5B A;  1HBW A;  2LRE A;  2ZNZ A;  1WJA A;  2GZW A;  4B44 A;  5E79 H;  5DD4 A;  3VMY A;  3VMX A;  5LD2 C;  1YBK A;  1Y8A A;  1TQM A;  1SFC A;  2EZL A;  4DJA A;  1XTA A;  2JA7 J;  3M0D A;  3V5B A;  3MUD C;  4E6K G;  1Y56 A;  2H89 C;  2ZXW H;  3NRV A;  3M06 A;  5DJU B;  4IX7 A;  3L72 G;  1FEX A;  3MWM A;  2DLL A;  4FE4 A;  1EC5 A;  2OD5 A;  1PP9 J;  3VB2 A;  1H0T A;  3BJO A;  1K4T A;  4IHY A;  1YHQ I;  2P1J A;  2WSF H;  4U7J A;  1RF1 A;  2OPT A;  3IAM 2;  4A3J J;  4OIQ F;  1DU6 A;  3W2A A;  2MAB A;  3WTT C;  1XMX A;  4H4K C;  1YO5 C;  1SMY F;  2QJY B;  2BZT A;  3RYR A;  3EUH A;  1W36 D;  1GL2 C;  2WSF J;  2X1D A;  5APQ A;  2O1J A;  1MJB A;  2F4I A;  1QGP A;  3GTO J;  5CCH D;  5AVT B;  2R7O A;  4I0B A;  5EEG A;  4H0L D;  5AW5 B;  4BBR J;  3AG4 H;  1MFZ A;  1R49 A;  1PIX A;  1RH5 B;  2FEZ A;  3S1R J;  1XN7 A;  5D8L B;  3C2G A;  1IFM A;  3ESW B;  3HPG A;  5M5W J;  2WPV B;  1WPK A;  1VQ8 P;  4XN0 A;  3SEZ A;  2XAU A;  3OOU A;  3H1I G;  2QGU A;  1RHZ B;  3HD7 D;  2MSY A;  3CCL I;  3WTV C;  5E3M A;  4LG0 B;  1E3H A;  1RUN A;  2L4A A;  1GUU A;  3GHG C;  2R4G A;  4I02 A;  3S16 J;  1FX7 A;  1K73 Q;  3D71 A;  3S1Q J;  1LVK A;  4LOC A;  2VON A;  2ZJQ F;  3CCU I;  1EQ7 A;  1ZXG A;  1T0F A;  1FC2 C;  3WE2 A;  3KDP B;  4LIV A;  2L3D A;  2Y0S N;  5IY5 H;  2LKM A;  3CQZ J;  2V79 A;  3DPU A;  3SFZ A;  3J81 K;  2O03 A;  1PFI A;  4IHX A;  5CKT A;  3IH4 A;  4UB8 C;  5FO5 A;  4B09 A;  4BL0 B;  2PX9 A;  3W6K B;  4L5I A;  1W36 C;  2O61 A;  1TC3 C;  2DYS H;  2RGV A;  2KXP B;  2W6B A;  3LAJ A;  2D5V A;  2WAQ A;  5HLH A;  1NTM E;  2WSE H;  2R7X A;  5CCH C;  4R8H A;  4DZP A;  2QJK C;  1MW7 A;  4XOR A;  2R44 A;  2VQL A;  1WRG A;  3ULQ B;  2XRN A;  4ZH4 F;  2WSE J;  1KIL A;  2Y48 A;  2H8W A;  1VQ8 I;  4H0L C;  4GDO A;  4PK4 A;  2Y31 A;  2V6C A;  4UUS A;  5KAI E;  3I4P A;  4L0Y B;  2P4W A;  2ZJS E;  1V4R A;  4U3F G;  2Y75 A;  3GBG A;  4G6D A;  5EGO A;  3U9G A;  2KDZ A;  2Z33 A;  1D7M A;  5ICE A;  2DT5 A;  1MUU A;  4M9Z A;  5KAF E;  4XLH A;  1G1J A;  3HD7 C;  3V2Q A;  3ZXS A;  4LLL A;  1XTG B;  2EIM H;  3LFU A;  3C2H A;  1HKS A;  1R7J A;  2JSC A;  2DA3 A;  2KP6 A;  3LWF A;  4V2F A;  2ESN A;  3IR9 A;  2QA4 P;  3V2N A;  3GXO A;  2ACJ A;  3PSF A;  1OWA A;  1XTC C;  3KEQ A;  1ERD A;  1KYO E;  1LDD A;  3KEO A;  4I2O A;  1NTZ E;  2BBY A;  5F6F A;  4ZKU A;  2Q3I A;  3I0T A;  4BQA A;  1FOS E;  3HE4 B;  4DT0 A;  4EEF G;  1Z67 A;  2L7Z A;  1ZTR A;  2CUE A;  2IPQ X;  5GPA A;  1HJB A;  3O8Z A;  5AON A;  2KK7 A;  1ZG1 A;  5C4J J;  5H2F E;  2R5Z B;  2O5R A;  4MQV A;  3A5T A;  2JTV A;  2K88 A;  3CMM A;  1FZP B;  4G6T B;  3IL2 A;  4V2G A;  3ELK A;  2VE9 A;  1Q7Y Q;  4BY7 J;  1WH7 A;  4HG2 A;  1WHU A;  4BH9 A;  1KC8 Q;  1LDJ A;  2XV5 A;  2ZCW A;  3ECH A;  1P7I A;  4C3I J;  5H6R A;  3D0S A;  1TW3 A;  4HX7 A;  2XGD A;  1R1V A;  1Y9B A;  1ZGJ A;  1B59 A;  1AKH B;  1BSN A;  2IZ1 A;  3F8B A;  4KIG A;  2WPQ A;  2EV5 A;  2F48 A;  2XPU A;  1S72 P;  2KZJ A;  2K1A A;  3WTZ A;  1SFE A;  3L74 D;  3CF5 F;  2XKO A;  4D6T E;  1U78 A;  1JJ6 C;  1LB2 A;  2O3F A;  2G0E A;  4U0Y A;  1MJA A;  2VBW A;  3TGU D;  4L73 A;  1IXS B;  1P6R A;  1HGV A;  2CPB A;  2JUG A;  2IXS A;  2QJY C;  2ZYD A;  4HV6 A;  3LID A;  5AW3 B;  2KHM A;  2ZSI B;  3PRJ A;  3TOB A;  4AM3 A;  2KKO A;  2FRH A;  3OS2 A;  1RZ4 A;  2D1V A;  2KRC A;  2BV6 A;  4ZYD A;  5DJT B;  3GTQ J;  2GBY A;  3H1H J;  3DP7 A;  2QBY B;  4WY4 A;  3TSI A;  3QYB A;  4BE1 A;  1SVF A;  4C7N A;  1B6A A;  3OIQ A;  4LK0 F;  1P84 E;  3I71 A;  3CWB J;  1ZRF A;  1TWF J;  4BNC A;  2YSR A;  3BCC E;  3FM5 A;  2LBF A;  3ZMD A;  3F0C A;  1VTN C;  2VJI A;  2KIU A;  3IKT A;  2R0Q C;  2W24 A;  3QPH A;  1FU1 A;  5CCG D;  2LG4 A;  4S04 A;  2HKX A;  1ZN5 A;  5EG0 B;  2M45 A;  3QQA A;  1KZU B;  1CI6 A;  3JR9 A;  1FC3 A;  2LR2 A;  2L7F P;  3CP2 A;  3CCR P;  4E7J A;  1QEX A;  3K4L A;  5KLI B;  4BWN A;  2BY2 A;  1KTM A;  3ZOB A;  1T38 A;  2UZK A;  2QJP B;  2X6X A;  4RB3 C;  5CYV A;  5HS9 A;  1B9N A;  1S2E A;  2H88 C;  1GVJ A;  3DF8 A;  1NTM D;  4PV1 B;  1VQ6 I;  1EH8 A;  3JC2 2;  3FBI B;  2E5N A;  4F91 B;  3NAR A;  2DMP A;  1GDT A;  2R7T A;  5E17 F;  2CO5 A;  5ERI A;  3RKY A;  1BCC E;  4GOD A;  4II3 A;  1IV6 A;  1VQ5 I;  4B3X A;  4A3C J;  1FT9 A;  2WSS H;  3JTH A;  2W57 A;  4NC7 A;  1KN7 A;  4MEY F;  1Z21 A;  2VBZ A;  1FZA A;  2IGO A;  1EXJ A;  4GT1 A;  1KB9 H;  3DU5 A;  1V5G A;  1O7F A;  3COA C;  2PJR A;  2KLV A;  3GCM A;  3K7A J;  1BC8 C;  3I4N J;  2AXT E;  2LY9 A;  4A0Y A;  1R22 A;  2VJ4 A;  3LQQ A;  2I1K A;  3W68 A;  3M7G A;  2CG4 A;  4Y17 A;  2G3A A;  2R5D A;  3MHV A;  5CCG C;  4C30 A;  3GTG J;  1NU1 K;  2OU2 A;  2PMZ N;  1NU1 G;  1I1G A;  2MLG A;  3AE6 C;  4A7P A;  5EDN A;  1KYO D;  1NTZ D;  4RAY A;  4IKF A;  2E1O A;  2QYO A;  2EPF A;  4EOT A;  5E79 E;  1MMS A;  1GVD A;  2ID3 A;  4JX5 A;  3L73 D;  3L75 D;  4FET A;  4ETS A;  2LNB A;  3NTN A;  2GUV A;  3QOD A;  5CVU A;  3SFI A;  2M87 A;  1HKQ A;  3VYR B;  4AUX A;  2YU9 J;  1EZV I;  1YQ3 C;  2K4B A;  1YJW P;  3DWL E;  3ZQG A;  2HDW A;  3PSI A;  2KLO A;  4CIC A;  2GXA A;  2PP6 A;  3B5N B;  4OAY A;  3K4J A;  1ORK A;  5KAI C;  2L54 A;  1WI3 A;  3ISP A;  2E34 A;  2O0Y A;  4AYB A;  2IZ0 A;  2VPR A;  4BGD A;  3LSH A;  2ZJ2 A;  3TW7 A;  1YQ4 C;  2QEX P;  5JVT A;  1OZH A;  2IGN A;  3L71 G;  4HEA 2;  4E7H A;  5APX A;  2VQC A;  4ABZ A;  1T33 A;  1E79 H;  1MBH A;  2EIJ H;  1SFK A;  1NHL A;  3I56 I;  4L76 A;  5E8I A;  2M0M A;  2VL8 A;  2ECB A;  1O3S A;  2P10 A;  1FWZ A;  5DYM A;  4RGS A;  2MC3 A;  2VE8 A;  1FOY A;  3S8P A;  2QVA A;  4BXF A;  3CWB G;  3ZQI A;  4AQR D;  4P9F A;  4EGZ A;  4D6T D;  2PN6 A;  2N8G A;  5KJ7 D;  3RPU A;  2OAR A;  2O8X A;  3AFH A;  5F08 A;  5AW4 B;  3DTE A;  2P6S A;  2HFE D;  3D70 A;  1S9H A;  4AC0 A;  2KSJ A;  2P5K A;  4M3L A;  5D6E A;  3U1C A;  4PV1 D;  3LL7 A;  3BTC A;  3I64 A;  5H2F C;  1R8E A;  2WT7 B;  2HDC A;  3HRS A;  3HTS B;  2L5Q A;  2NVU B;  2M3A A;  1OYY A;  3S32 A;  4IO9 F;  4MTD A;  4C3H J;  5E3O A;  2JA5 J;  2EFN A;  4PGG A;  4E7K A;  3BCC D;  3GF3 A;  3O6Q A;  1T56 A;  4WCG A;  4M6X A;  4RGX A;  3ZQ7 A;  3F22 A;  5CMZ A;  5F0C A;  1W0T A;  4BUP A;  3LA2 A;  1FJK A;  2XKM A;  4FHT A;  1OXZ A;  1VDF A;  2AEM A;  2LKS A;  2LVS A;  5BVZ A;  2IBD A;  1LT1 A;  4Z2Y A;  1LJ2 A;  1KZH A;  1GU4 A;  2HPC B;  2NNY A;  1ULY A;  2EA4 A;  3OW2 O;  1HOM A;  4JX4 A;  3F89 A;  1DUX C;  2FYU K;  2M30 A;  3FBN B;  1OYI A;  1DGR M;  2OUM A;  3V4G A;  4ZZD A;  5B66 C;  2FYU G;  1OIS A;  5KLI C;  4CPG A;  5J1R A;  4BDY A;  1SQB J;  5KJ7 C;  4C7R A;  2OYH A;  4I7Z B;  2PMH A;  2QJP C;  2FXA A;  3C1D A;  1SD5 A;  3E0J B;  2YKO A;  2KDO A;  2UXX A;  2XPW A;  3R0A A;  2CRG A;  2HR3 A;  4M73 A;  2B63 J;  1R58 A;  3K4N A;  2FML A;  4LG3 A;  3RTR A;  1NTK J;  4PV1 C;  3HOY J;  3TNU A;  1BL0 A;  2B7E A;  4LLH A;  2QVO A;  1EKE A;  1JOC A;  3BRO A;  1YI2 P;  5APU A;  4CSW A;  1N7S A;  4RB1 A;  3AG3 H;  3B5N D;  1SD7 A;  3GTP J;  2EIN H;  3E7K A;  2COM A;  2ZME A;  4EAT A;  3EET A;  2HTS A;  1JUM A;  2JWD A;  1OCZ H;  1FOS F;  1L4A A;  2NXN B;  5IPA A;  1R5L A;  2OTJ P;  2Q2E A;  2A6T A;  1EJ9 A;  1YIJ I;  2JN6 A;  3OOP A;  2JO1 A;  4L74 A;  2N9B A;  1PGP A;  1IRZ A;  3SSU A;  3BJ6 A;  1HCR A;  3F8N A;  1KA8 A;  3NMD A;  1Y0U A;  3P7K A;  2XC7 A;  2WPS A;  3DCF A;  1JCC A;  1ZAR A;  2XND H;  2ZYA A;  1UII A;  3BRV B;  3PUF A;  3OSF A;  1NVO A;  1ZG3 A;  3E6B A;  3OV8 A;  5LEJ A;  3H1J E;  2HVR A;  3SHF A;  3OYD A;  3AE3 C;  1U6G A;  2W48 A;  1ZR4 A;  3BY6 A;  3RDI A;  4LB5 A;  5C39 A;  3RQI A;  4X1E A;  4HDV A;  2F4O B;  2NVX J;  1FAV A;  3HEF A;  4W7Y A;  2HPM A;  4Q4Z F;  1WWX A;  3MIW A;  1G4D A;  1RE4 C;  4W1U A;  3C1L A;  3CCM I;  1L0N K;  1BE3 E;  3L2V A;  3B5N C;  4QMA A;  2A5Y B;  1L0N G;  1QVU A;  1T95 A;  1QZE A;  2DJN A;  2DFH A;  2NS8 A;  2XAQ A;  1YJ9 I;  2I1J A;  3KPE A;  4K3A A;  2MLK A;  4XLF A;  3TYY A;  1H88 A;  2OTJ I;  1I27 A;  2AXT C;  1YTZ I;  2A3S A;  4IPA A;  2K9Q A;  5B5E C;  5JFR A;  1XGO A;  3H5R A;  3M1C A;  4F7Z A;  1B8I B;  2R7U A;  1FDM A;  1VQM P;  2OA4 A;  3ZMV A;  3SFD C;  3E1S A;  1U7J A;  2E5Y A;  2HZT A;  1BA5 A;  2VXZ A;  3HTK B;  4BEH B;  5K5R A;  2CU7 A;  3B6C A;  1B1B A;  1K6O A;  1YIT I;  2AXL A;  2E76 B;  2CWE A;  4CGZ A;  3BPX A;  5BS6 A;  1G2H A;  3T8T A;  1JY2 O;  5J4V A;  4YXD C;  2M3B A;  2XNX A;  5FKL A;  4UVC A;  3ZMT A;  2H1K A;  4AWX B;  5CQG A;  1S1C X;  3DU6 A;  5DCM A;  1SQP K;  2EV6 A;  5L3D A;  1SQB K;  4MFE A;  2HOD B;  1W1W E;  3A7O A;  1SQB G;  2QM7 A;  3K4M A;  1N8R Q;  1W5S A;  1SQQ D;  1GT0 C;  3KYD B;  3BR1 A;  5J8F A;  1NK2 P;  4HF0 A;  3DEE A;  3Q1M A;  4L9V A;  4R4L A;  4ZMD A;  2O01 J;  5CPR B;  1N2D C;  4FT8 A;  1Y47 A;  2WAE A;  1R1T A;  2PRR A;  2YS9 A;  5D6F A;  4BAY A;  1YX5 A;  2IA0 A;  1BGY E;  3N05 A;  4HW0 A;  2OZ6 A;  4ZYA A;  1IXC A;  2K9J A;  4XRF A;  2DA2 A;  3BRT B;  3GHG A;  2Y2Z A;  2Y9Z A;  4HNV A;  1VQK I;  4GIF A;  3MEX A;  3P9C A;  1OFC X;  4M9S A;  4DW6 A;  1PP7 U;  1EH6 A;  3TDK A;  1LP1 B;  2O8K A;  1JMM A;  1OVV A;  1RQU A;  2J5U A;  2F4M B;  1ETY A;  2W4S A;  4I99 C;  3H32 A;  1KB9 E;  3SDB A;  1K83 J;  3K2A A;  4EJU A;  2IS1 A;  2WTE A;  3WMM 0;  4Y33 A;  1GU5 A;  5DM6 F;  3HB9 A;  4IFD K;  5EYR A;  1QZZ A;  2DFE A;  3IP4 B;  3MMY B;  5FFX A;  3BAT A;  3NAU A;  3GMA A;  3H1C A;  2MD5 A;  3GZ6 A;  2DPU A;  1JGS A;  4HRI A;  2B9S A;  2EK5 A;  2D2W A;  1DH3 A;  3L70 E;  2RRE A;  3V6I A;  1HTL C;  5FKN A;  1PZQ A;  3RPQ A;  1WGX A;  2R92 J;  1WCM J;  1YRN B;  3GTK J;  1RF0 C;  1LDK B;  2IEK A;  2EBI A;  4BS9 A;  5LGN A;  1QPI A;  1X4P A;  2DFI A;  3KCC A;  1X3Z B;  2OYI B;  4Y99 B;  5CVV A;  1OR7 A;  2XU6 A;  1OCO H;  2MD0 A;  1W7P A;  4IOA F;  2KJC A;  2K27 A;  3L74 J;  2X4H A;  4HX4 A;  1CGP A;  3FXJ A;  2BY0 A;  1TWG J;  2C6Y A;  3A03 A;  3H1J D;  1G2C A;  3A0H H;  3UR3 C;  2E76 D;  5AW6 B;  1UCR A;  2M4K A;  2BAS A;  3SZT A;  3TGU J;  2UXN A;  1I3Q J;  3R4K A;  1MGT A;  2FE3 A;  1M7L A;  3U2R A;  3ZN1 A;  2K85 A;  1L0N D;  5GTI E;  2DTZ A;  2VKH A;  3Q9V A;  4ASN A;  4CCK A;  1X0T A;  1NTC A;  3HOX J;  5DUI A;  3IWF A;  1MDM A;  4BXX J;  1BE3 D;  1BN5 A;  2P2U A;  4A5M A;  1HDP A;  1ZOY C;  2B89 A;  2JWA A;  2RMZ A;  3HUS A;  1N73 C;  2EFP A;  2L9R A;  1A5J A;  3L4F A;  2IBZ I;  4UY8 I;  4I01 A;  5F0H A;  4NUB A;  1CQT A;  4WVZ A;  1U57 A;  4OIN F;  3JCU H;  2VQH A;  1LWU B;  3E1I A;  1R6R A;  3MTU E;  1WKM A;  4A6D A;  5KCM A;  3V8J A;  3WU1 B;  3SXY A;  3FWE A;  1F4K A;  2RNG A;  1SAX A;  1IO4 A;  3OYE A;  3I3L A;  3FM3 A;  3IHU A;  3ZMU A;  5IYC J;  2ZJR F;  1JKR C;  4BKX A;  2VKE A;  4HA8 A;  3FIW A;  1L2P A;  5ILU A;  1T08 B;  1G6N A;  2MH2 A;  2R7R A;  3OYH A;  4RLQ A;  4Y4R A;  2E76 C;  2Z99 A;  4JYC A;  3LOC A;  3BCA A;  1H9G A;  5IP7 J;  4TV7 A;  4P96 A;  1IZN B;  1S9K E;  1OYW A;  1Z1D A;  3Q9S A;  3M91 A;  1ON2 A;  3DXJ F;  1PL5 A;  3J80 Z;  4MO7 A;  5M1B A;  2CV1 A;  1IFD A;  4RS8 A;  1UG0 A;  1Z6T A;  3F21 A;  4PJ0 E;  1KD1 Q;  1UST A;  1L0O C;  5EEA A;  1SEU A;  1SP4 A;  3H1L J;  5TGT A;  1A35 A;  2M34 A;  1NYH A;  3LW5 H;  4OMY A;  4KIB A;  1K9M Q;  2V6E A;  5ED4 A;  1YQA A;  3GEZ A;  4FCY A;  1PUF B;  2FFD B;  5BOX A;  5LGU A;  2LP0 A;  2V4H A;  3IAO A;  3PM1 A;  1BGY D;  3C7J A;  4XR6 A;  1C0W A;  1ZR2 A;  1PUE E;  4JPZ B;  1RIO H;  3TP3 A;  3DLL F;  3BPV A;  2EZI A;  1IZ1 A;  1XCV A;  2VKD A;  3DKW A;  4GCV A;  1URQ B;  4LG0 A;  3ERE D;  2Z5I A;  3WU2 E;  3G4S P;  4CUG A;  3T1B A;  3V8L A;  2ZVN B;  1WT6 A;  3L73 J;  1M1K Q;  3L75 J;  2JK3 A;  5APV A;  4D0P A;  3OL4 A;  1Z7L A;  2HFH A;  4A12 A;  3A0B E;  1JGG A;  1RNL A;  1WJF A;  3L72 J;  3AEB C;  3AE5 C;  4CDG A;  5DTD A;  3L74 G;  4M3G A;  4I0A A;  1KFM A;  2W8Z A;  1XX5 A;  2CJJ A;  2QKL B;  1IFN A;  1ZYR F;  4LK1 F;  2Z9O A;  2IS4 A;  1TW2 A;  4UNO A;  3MQ0 A;  4CCN A;  1ZRC A;  3TGU G;  3EYY A;  2DMQ A;  5LGT A;  4CYD A;  4OWR B;  2R7D A;  4QPQ A;  3AE4 C;  3PNT A;  3KZI H;  2KNC A;  3PL8 A;  2WWY A;  1NWQ A;  2BXZ A;  2R3S A;  5ILS A;  3RSN A;  2VUM J;  1X79 B;  3ZQQ A;  1JTY A;  3IKV A;  4CCJ A;  3E6D A;  2GUS A;  4RAG A;  3LSJ A;  1BW6 A;  4C46 A;  2V9V A;  3OMY A;  4KT6 A;  4XRS A;  1EZV E;  3IF4 A;  2EFQ A;  3EQL F;  2OYI C;  2X48 A;  2EH3 A;  2YU3 A;  2Q8K A;  2DQR A;  2PMU A;  2XDV A;  4A6E A;  3MAJ A;  5LHI A;  2XRL A;  4XRM A;  4HQE A;  4RM2 A;  2H6C A;  3S3N A;  1IJD B;  2CUF A;  4I09 A;  3CCQ P;  2HQA A;  4EI2 A;  2A5W A;  1KU3 A;  2CSO A;  3G71 I;  4X6A J;  1IXR C;  1SQX E;  3JRI A;  4Y13 A;  2XAG A;  1IK7 A;  1SVO A;  1PPJ E;  3PIO F;  2LOO A;  3BWG A;  5K7H A;  3GYH X;  1Z9C A;  3KP2 A;  3LFK A;  5E1Z B;  1N77 A;  1IC8 A;  3GW6 A;  1H89 A;  1HWT C;  2ZAE B;  2W82 A;  3ASN H;  3OS1 A;  5IYD J;  1DEE G;  1R1U A;  3CL3 D;  1R5S A;  2JA2 A;  3K1M A;  4RES B;  2RH0 A;  1NTM K;  1SS1 A;  1TWA J;  1NTM G;  3F3X A;  2QM8 A;  2Y9Y A;  1MD0 A;  1P4W A;  3JRD A;  3VMA A;  1LT9 A;  4I7H A;  2E1M B;  2GAU A;  4G8X A;  2OF7 A;  5JVG F;  4RB0 A;  4W97 A;  1M1J B;  1SQP D;  4IJA A;  2DPD A;  1LWU C;  1HGZ A;  4CO8 A;  2GQQ A;  2EA2 A;  2W1O A;  1YHQ P;  3F8M A;  3IC7 A;  5GAH J;  3CCQ I;  5J47 A;  1Q82 Q;  1AFO A;  2FJ1 A;  2O7O A;  2GIV A;  3KIO A;  3VN0 A;  4U3F J;  1UG2 A;  4OIR F;  4PD4 H;  2LH9 A;  1URQ D;  3F8C A;  1JUP A;  2R7V A;  4XOP A;  1D1A A;  2HOE A;  2NOJ B;  4EQQ A;  1GHC A;  2ADU A;  2DI3 A;  5DS9 A;  2DW3 A;  2FBH A;  2FSW A;  3FHN A;  5GTI C;  3CUQ A;  4AD9 A;  1NTZ K;  1NTZ G;  1X1D A;  2P7V B;  1VF5 B;  5GTH C;  2EIL H;  2NS7 A;  4E70 A;  2DO7 A;  4I2L C;  4UB6 E;  2ZSH B;  1DD4 A;  4IL6 H;  2FBI A;  5E3L A;  1XMA A;  5D8K B;  3L73 G;  3OYL A;  3L75 G;  1BJA A;  3A2K A;  4X0G A;  3RK2 B;  3CCL P;  3JSV C;  1JXS A;  4XSZ F;  1I3A A;  5L3G A;  4ZZL A;  1QA6 A;  2G7U A;  3WUU A;  4K35 A;  2BOL A;  2X6W A;  3IAS 2;  2FFD C;  1BR2 A;  3CCU P;  1AA7 A;  1ZGW A;  1T2K D;  4RAZ A;  4HOB A;  3RJP A;  3K2Z A;  1GXQ A;  2MJZ A;  4ESB A;  2QM3 A;  5IP6 A;  1MBJ A;  3CD6 I;  1A04 A;  3Q3S A;  1RET A;  2X9D A;  1VL2 A;  2C0X A;  3BZ6 A;  2DW4 A;  2MG4 A;  2HQN A;  4WWC A;  2E36 A;  1URQ C;  1AQ5 A;  1DD3 A;  5F1J A;  1ZME C;  1TNS A;  4ZYH A;  2K9L A;  3EPZ A;  2FKW B;  2K3P A;  3PO2 J;  5KLV E;  4AUW A;  2V4J C;  4D6T G;  1EA3 A;  2XSD C;  4NQW A;  1LTJ B;  4A3K J;  1W2E A;  2C9N Y;  4PJ0 C;  3W67 A;  1VZ0 A;  4HB1 A;  4F55 A;  2R5Y A;  2W00 A;  3MKY B;  3TP0 A;  4KNY A;  2FOW A;  2XAH A;  3GTL J;  1SD6 A;  3WGG A;  2BHY A;  3GFL A;  2FXO A;  2V1X A;  3KFW X;  3H35 A;  3MN2 A;  3WE3 A;  3GFM A;  3A0H E;  5AW1 B;  3KE2 A;  1EZV D;  3S93 A;  3FXQ A;  1T2K C;  3GLX A;  4KUM A;  2XVC A;  4E7I A;  2P0W A;  2WVR A;  3SDG A;  1YTZ T;  3QWL A;  4RA2 A;  3WU2 C;  3DTK A;  3BCC G;  4KHX A;  2VC1 A;  4IEJ A;  2MW8 A;  4YTP C;  2YPR A;  3WTU C;  2K9Y A;  2XKP A;  4CCO A;  3U1A A;  5GP9 A;  3HOV J;  1K78 A;  1SQX D;  3FX0 A;  2FF4 A;  1XDS A;  1J5Y A;  3A0B C;  5EF6 A;  1CF7 B;  1JKO C;  2YKP A;  4HDU A;  3ZR8 X;  1VF5 D;  4XL9 A;  1YYC A;  3GZN B;  2EWN A;  2VJ5 A;  3OYK A;  9ANT A;  1KB9 I;  3TK1 A;  2W7N A;  2HQR A;  3QH9 A;  1JB0 J;  1B72 A;  1F43 A;  3RK2 D;  1SQQ J;  2KS1 B;  3FXO A;  3PJR A;  1KU9 A;  2E71 A;  2XF6 A;  3USS A;  2IJL A;  3IRQ A;  4XKB A;  1BCC G;  1RPW A;  5J1U A;  4RMN A;  5AW2 B;  5DUK A;  2E1M C;  3NXS A;  2R93 J;  1M1J C;  5AVW B;  3QU6 A;  3M4O J;  1XSV A;  5HOO A;  3VOD A;  1SQV E;  3BR5 A;  3FHZ A;  5FD6 A;  3K10 A;  4BXU A;  1UJ8 A;  3NEU A;  3MZY A;  4EMS A;  4RO0 A;  3FKI J;  2GIZ A;  1KQL A;  4E4H A;  5AVZ B;  3V2P A;  3ZN0 A;  2M0C A;  3SQN A;  1L0L E;  3SEQ A;  5DDG A;  2KI7 B;  3RL0 B;  2XSJ C;  4FIS A;  5FLM J;  1T3U A;  2IDB A;  4M3B A;  3VOP A;  3GTJ J;  5CVI A;  2Q7C A;  1Q1V A;  1NU1 J;  3GO5 A;  2ZKZ A;  4RGU A;  1DEB A;  1FYM A;  3EYI A;  3S3O A;  1VF5 C;  2DU9 A;  3WUT A;  3Q5S A;  2HOA A;  2L01 A;  1M1E B;  2L0K A;  1EDK A;  2K86 A;  3NWT A;  4Q48 A;  3L2C A;  3V7R A;  4Y28 J;  3RK2 C;  4OOI A;  2IT0 A;  2DA7 A;  1RE3 A;  5F27 A;  1YS7 A;  3QP6 A;  2B0L A;  1FZC A;  1IFJ A;  2Q3E A;  3ZMZ A;  3MKZ A;  3CDH A;  2HOT A;  4ZNC A;  1A36 A;  2YNY A;  1VND A;  3DEW A;  2CW8 A;  2IA2 A;  3J7A Y;  1IRX A;  4N4N B;  2M5A A;  2MBF A;  2PLY A;  1LTA C;  3WOD F;  2NZ2 A;  3AAF A;  3L71 J;  2M5W A;  2O3J A;  1VQ6 P;  2M0B A;  1YW7 A;  1LE8 B;  3KP6 A;  4LGD E;  1Q86 Q;  3BVH A;  3KZI E;  2VT2 A;  3HBL A;  4II2 A;  3PIP F;  1OMI A;  3J81 Z;  1PYV A;  3AE7 C;  3GFJ A;  1XS9 A;  1VQ5 P;  4UB6 C;  2H27 A;  2M2E A;  2FD5 A;  3FX3 A;  3B02 A;  3L2W A;  3MCZ A;  5FLX K;  1LTJ C;  3JSP A;  3HOT A;  4Y15 A;  3ZCO A;  1SFC B;  2E42 A;  3PFI A;  1ZN2 A;  1Z91 A;  1ZV8 A;  3DPL C;  4MNU A;  2OGU A;  3H1I E;  2O1K A;  3PH0 A;  3G1O A;  4M3E A;  2TCT A;  1O3T A;  3F5H A;  2FNA A;  2BEQ D;  1JKQ C;  3ABK H;  3ZPL A;  1YW9 A;  5APY A;  3KYL A;  4L9N A;  1QX8 A;  2M8R A;  4IF4 A;  5LRS A;  2DK5 A;  2TDX A;  2WB1 N;  4IOC F;  1HJ0 A;  2WY8 Q;  4KFC A;  4NHJ A;  3S2H J;  3EQ2 A;  1SQQ K;  3Q5P A;  1H0T B;  1BI3 A;  1HBX G;  1SQQ G;  2VOP A;  1RF1 B;  3HOS A;  1HLV A;  1X4O A;  5HS8 A;  4A3M J;  2XF5 A;  5CLS A;  1GK4 A;  2GOX B;  4F52 A;  1KQG B;  1VFC A;  1H8A C;  1IDZ A;  4V19 K;  1Z3X A;  3DKY A;  2IBZ E;  3CLQ A;  1U5T A;  4KJZ A;  4IRG A;  4GXO A;  1W0U A;  1CZQ A;  3RL0 D;  3CC4 P;  1YIO A;  2A61 A;  3G6E I;  2JEE A;  2KZI A;  3H0D A;  4XE5 B;  5K7Z A;  2V7Q J;  3QOE A;  4LIT A;  2W83 C;  5AVQ B;  4ZDO A;  5AVU B;  2L7K A;  3ITK A;  5E18 F;  2HYJ A;  2Y0S A;  1JCD A;  1D1B A;  1FDO A;  1KIL E;  1Q1H A;  3H1K E;  2X85 A;  2FYU J;  5TIS H;  5J3L A;  1PGO A;  2BCC E;  5APT A;  1EF4 A;  1S5L E;  5GAD J;  3LA3 A;  3I56 P;  2A05 A;  2RN7 A;  3K1N A;  3A0H C;  2CFX A;  3FZV A;  4U0W A;  1V54 H;  3HUG A;  2AEF A;  1N73 A;  2ID6 A;  1Q2N A;  4N9H A;  4R79 A;  1SQV D;  2IRF G;  1ZG5 A;  1AQT A;  3J7Y J;  1TBX A;  1DPU A;  2H1L A;  3ECO A;  3IH3 A;  4CYC A;  1D5Y A;  1GTW A;  1I6H J;  1JY3 O;  4H44 B;  2P5L C;  1KU2 A;  4IL6 E;  3HYI A;  4HKZ H;  3CC4 I;  3S17 J;  1S7A A;  5L3B A;  1PP9 E;  4KA4 A;  2WZ7 A;  3K9T A;  4BRY A;  1WJB A;  2NOG A;  2K3R A;  3R4Y A;  3R60 A;  3HC7 A;  3TMO A;  4LC1 A;  2ISY A;  4QLC U;  5BMZ A;  3RL0 C;  4XLA A;  3SZG A;  2IGM A;  1P4X A;  4FTH A;  2KIM A;  2K40 A;  2HYF A;  3GFI A;  1KIL B;  1KFN A;  2BY3 A;  3U1D A;  3FF5 A;  2R7Q A;  4UUS B;  5JLW A;  1TL8 A;  1A6I A;  5C4X J;  3VEP A;  1N86 A;  3H1J G;  1Z6R A;  5KAF C;  3VYI A;  5EGO B;  1ETX A;  2G9W A;  1SFC D;  2HXI A;  2ZXH A;  2W85 A;  4ZC3 A;  2QWW A;  4ZTF A;  3BG6 A;  5L8R J;  2NS0 A;  2KL4 A;  4IZZ A;  2HOD A;  3CX5 H;  3OR1 C;  1U8R A;  2YUS A;  2QUF A;  3D6Y A;  4DIQ A;  3QYE A;  1BE3 G;  5FLX Z;  3ABV C;  4BBS J;  4ZDP A;  3H3V K;  1FP1 D;  1GK6 A;  4Y99 C;  1S29 A;  4W7Z A;  4DYC A;  1L0N J;  2HI3 A;  3CDL A;  1ZLL A;  3W6J B;  4WB4 A;  5KVR A;  3D5S C;  2UV1 A;  1D0X A;  3F72 A;  3CCJ I;  3D5L A;  4G94 A;  1Z0X A;  2L91 A;  2JA6 J;  2ZC2 A;  5AW9 B;  3M9Q A;  3I59 A;  2PFB A;  1O3Q A;  1P84 D;  4OGQ B;  4BHP A;  2DMN A;  1ZRD A;  2E75 B;  4UUT A;  4Y7N J;  4RJT A;  2XAJ A;  2NNN A;  2JRT A;  2CGP A;  2R7Z J;  1F1Z A;  3WGI A;  3F6V A;  1JMB A;  1QO0 D;  3H0G J;  3A4C A;  1SFC C;  2IGK A;  1NHA A;  1TNT A;  2CW7 A;  2HKO A;  2L02 A;  4P5O A;  1K04 A;  1VPC A;  1D3Y A;  2WIT A;  3M0D C;  1X2N A;  2ELJ A;  5K7F A;  3ABM H;  3HRT A;  3FKJ A;  2DXI A;  2KZV A;  2NYX A;  2DA1 A;  2UUZ A;  2VXD A;  3OWT A;  1M56 D;  1YIJ P;  1OCR H;  1YX3 A;  2DOA A;  3M8E A;  3HKZ N;  4PGH A;  4EDF A;  3OYI A;  1SQP J;  3W3C A;  4OIO F;  3CJR B;  2AO9 A;  3BG3 A;  5CJ9 A;  1ENH A;  2BVL A;  3S15 J;  3WUV A;  2FUG 2;  3R6S A;  1VQO I;  2LFB A;  4BYY A;  3BTL A;  1APL C;  1RF1 C;  2IP2 A;  1IRF A;  2COB A;  1MND A;  4EGY A;  4H44 D;  4JF7 A;  4A69 C;  3WTX C;  2IBZ D;  2KIK A;  1BCC D;  3EUH C;  1GXP A;  2N1T A;  2X1E A;  1KQ9 A;  1RY3 A;  1BGY G;  1YLF A;  4IHS A;  1WRJ A;  5D5V B;  5ILV A;  2VOO A;  3TL4 X;  2NPS A;  4WY4 B;  2LY2 A;  3H1K D;  3CCM P;  1KIL D;  1OCC H;  4C7N B;  3PQJ A;  1FBS A;  1DU0 A;  4YG2 F;  4K2E A;  3TO9 A;  1YJ9 P;  3AED C;  3WHB A;  1AVO A;  1I6X A;  5D4R A;  2BCC D;  5M3M J;  1HKT A;  2F5F A;  2VC0 A;  2RAE A;  4DYQ A;  1MMN A;  4IQ4 A;  2ECC A;  2LBF B;  5M5X J;  2E7X A;  1AA0 A;  1WJD A;  1PVE A;  3EUK L;  2ME6 A;  3MD0 A;  2XAF A;  2QZ8 A;  3Q0W A;  4AID A;  4Z6Y A;  1YYV A;  4BXL A;  1CI6 B;  4UB8 H;  1J1E B;  5L3F A;  2BYV E;  1EV7 A;  1JUS A;  1HW2 A;  5IT9 K;  3RIR A;  5AW0 B;  2OQQ A;  4FX0 A;  3RL0 g;  2IS6 A;  1T0F C;  1D5V A;  2E35 A;  4G9Y A;  3E5Q A;  1FZE A;  1NH4 A;  2HLO A;  2R3C A;  2Z5H A;  1YIT P;  3LSR A;  4N3Y B;  3C8V A;  1PP9 D;  4H44 C;  3G1L A;  3OAK A;  4YPC A;  2JJ7 A;  1MBG A;  5KNL A;  4LMY A;  4IRI A;  1IV8 A;  1VQP I;  5AIQ A;  1UFM A;  4MQ9 F;  4KMU X;  1IRG A;  1OQY A;  4OGQ D;  2E75 D;  5D5W B;  3JAM K;  2E43 A;  2VKV A;  1KIL C;  3VYT B;  5H20 A;  3ZRG A;  1KOR A;  1LTT C;  1U3E M;  3VTP C;  2DDB A;  2A6E F;  3DFG A;  2A45 I;  4BY1 J;  1S5L C;  2PJR B;  1XDU A;  3L09 A;  1I50 J;  3GME A;  4LLG F;  3LQR A;  1WZ2 A;  2VOD A;  4WXD A;  3H1H E;  2IS2 A;  2DJI A;  4JK1 X;  1JTH A;  1BI1 A;  1DQU A;  3ML6 A;  1K05 A;  1O3R A;  1X3W B;  3MUD A;  1M8O B;  1NO4 A;  2BW3 A;  4N4O B;  2QIW A;  3CWB E;  5E79 C;  2YXR B;  2Z1D A;  1MV8 A;  4FQG A;  3B4S A;  4HLY A;  2F5C A;  2IFM A;  3H6P A;  1GW3 A;  1RUO A;  3AL0 B;  1YG2 A;  3V4W A;  1VQK P;  2OTL I;  4A3F J;  1SAU A;  3FMQ A;  1E2X A;  3H92 A;  4JBZ A;  2JR8 A;  4PZJ A;  4B86 A;  2QQ8 A;  1Q81 Q;  5ICC A;  1BOB A;  1USD A;  3GF2 A;  4KN4 X;  1SQP G;  1UEL B;  1GL2 A;  3E6M A;  1R5I D;  1ITY A;  1NG6 A;  1ZRT E;  3PNY A;  2D1H A;  2O01 H;  1FTZ A;  4OGQ C;  4ZJZ A;  1S8N A;  2E75 C;  3BDD A;  4WY4 D;  2ELK A;  2NRA C;  1CW5 A;  5J6X A;  2BY1 A;  5J8C A;  3II6 A;  4M72 A;  3K5B A;  3M3Y J;  4UUV A;  1NGM B;  1J9I A;  3HSR A;  3VDX A;  1D0Z A;  1R00 A;  4PJL A;  3ZQH A;  4D7N A;  2P5V A;  2IAI A;  4CCM A;  5K5G B;  3KXD A;  2Z5U A;  3OYA A;  3MFK A;  2NVQ J;  1BR4 A;  2MKV A;  2LMD A;  4BE0 A;  2X6Y A;  3P8M C;  2Z4E A;  4A3L J;  5HNF A;  3K6G A;  4MHG A;  1X1P A;  3OYB A;  3J7A O;  2Q1K A;  3BTI A;  3HSE A;  4HF2 A;  1KV4 A;  1NJI Q;  1S7O A;  2LK2 A;  3QRF F;  4I7Z C;  3LIE A;  2ZFC A;  2A06 E;  1VQN I;  4EM0 B;  3HE5 A;  2MC4 A;  5FKM A;  5TIS E;  1JTX A;  1TT0 A;  4ITV A;  1A6Q A;  2AHQ A;  4YFX F;  4WK8 F;  2QQ9 A;  2Y30 A;  1QNT A;  3DV8 A;  1SFO J;  1MSE C;  2JJL A;  3AE8 C;  3A01 B;  4GOF A;  2CMP A;  3B8E B;  2GA1 A;  5CCH A;  2Z16 A;  5FJ8 J;  4G7O F;  3CCS P;  2A6H F;  2RQQ A;  2PG4 A;  1RES A;  3TO6 A;  1FOK A;  3CCE P;  3CTA A;  2K7L A;  3AE2 C;  4WY4 C;  3G1M A;  2O9L A;  2M8G X;  2QF7 A;  1HH0 A;  4EV0 A;  1S5L X;  3PTZ A;  3O6Q B;  1MJ9 A;  1KU7 A;  5HLT A;  3HGG A;  3Q5F A;  3L00 A;  5FD5 A;  4EM1 A;  2CQ7 A;  4B47 A;  4LJZ F;  5IP9 J;  5DD8 A;  3TQN A;  2X1C A;  2CUZ A;  2XZR A;  1ODD A;  5J40 A;  3HD7 A;  4WF2 A;  3E97 A;  4A3B J;  1NAY A;  4XKC A;  2ZXX A;  1FOW A;  1J1E C;  2LF7 A;  5HDK A;  1FYK A;  2XGX A;  3BG5 A;  4HJG H;  4NBQ A;  3G9R A;  1R4N B;  3DTI A;  4E7Z A;  2LKX A;  1NG7 A;  2XRO A;  2D2C B;  2IVM A;  3HL2 A;  1J0R A;  5TJJ A;  3PQK A;  1FBQ A;  1EZV G;  1FZF A;  3TNU B;  3TO7 A;  3CCS I;  3CCE I;  3OJA B;  3LSG A;  2H7H A;  3ZP5 A;  3EWK A;  2CH0 A;  1MBE A;  2RVC A;  4CHU A;  3T97 A;  1JEK A;  3M1E A;  2AS5 F;  3FK7 A;  2STT A;  1FMV A;  1YW8 A;  2L9V A;  1TP4 A;  1QL2 A;  2B87 A;  2A68 F;  2PAJ A;  3AG2 H;  4H13 B;  3K4B A;  1DGW Y;  2ZME B;  3OR2 C;  1SQX K;  2A45 H;  5A2Q K;  1SQX G;  3H1H D;  3WHC A;  3BR6 A;  2QCO A;  4DYR A;  1L4A B;  4OH8 B;  4GDF A;  5E3N A;  2Q2E B;  1RQV A;  3DLA A;  1FBU A;  4W80 A;  2L2O A;  4EJT A;  2DMT A;  2OQG A;  4PD4 I;  4FAS D;  3LAP A;  3X2Q H;  5M5Y J;  4XNF A;  1QU3 A;  1SAN A;  3GW2 A;  3RPU D;  4J19 A;  3AL0 C;  1JM0 A;  3F8F A;  4EVI A;  1NTM J;  1P4A A;  3ABL H;  1J09 A;  4IHW A;  2Y0D A;  3RCO A;  4DCK A;  1Z05 A;  4TT3 H;  5AIP A;  3VOE A;  4M9X A;  1M90 Q;  1FZB A;  1D8J A;  1ZRT D;  1STZ A;  5L3C A;  4BAC A;  4KMF A;  5KKZ B;  3WTW C;  5JI6 A;  3L1P A;  1SQB E;  2LD5 A;  4NPD A;  2LKP A;  3DPT A;  3IV5 A;  3Q2Y A;  4CCL A;  1SD4 A;  2J5O A;  3DBH B;  1USE A;  4D5C A;  1FJP A;  1E5W A;  1NTK E;  3FWL A;  3ZGK A;  2OQR A;  5LRR A;  1VQ7 P;  2JMW A;  3BG9 A;  3BZC A;  1KYO H;  2IPP A;  2P7J A;  5IOY A;  1MNM C;  1IFP A;  3U59 A;  1PV3 A;  1FMW A;  1XGM A;  1TLH B;  1O57 A;  2LF8 A;  1NTZ J;  1GZL A;  1OVR A;  4PJM A;  4YFK F;  3JSO A;  3I58 A;  2BE5 F;  1FNN A;  4E7S A;  4NPF X;  4EIJ A;  1QGK B;  3I55 P;  2LR8 A;  2R7W A;  2JP3 A;  5H2F H;  1MBK A;  1OPC A;  1KB9 D;  4DJG A;  4XM3 A;  1MSF C;  1WQ2 A;  1X1C A;  2OAZ A;  1LPQ A;  1P2F A;  3G71 P;  5J4Y A;  1J59 A;  3LMM A;  4JQF A;  1UHS A;  1B9M A;  2HGC A;  3FXR A;  5HDG A;  2D2C D;  1MFT A;  4IOI H;  2ESH A;  2QEN A;  4BJ6 C;  1LTI C;  2ME0 A;  4AVZ A;  1SFU A;  5DCM B;  5H6Q A;  1IUF A;  3MZH A;  2YO2 A;  3U1K A;  3CME P;  2QLZ A;  3OL3 A;  3L70 D;  5HLG A;  1BC7 C;  4UB8 E;  1VQ7 I;  2E19 A;  1MMD A;  3ZDM A;  3TKY A;  2JT1 A;  2ZT9 B;  2YMK A;  1IF1 A;  1ZGA A;  5KLV K;  5FKO A;  2P6T A;  4KIS A;  1FPQ A;  3VP9 A;  3OY9 A;  2FBW C;  1E3P A;  2ITA A;  5B66 H;  1L4A D;  2JA8 J;  4XK4 A;  4PDK A;  2OJE D;  1WVR A;  3I55 I;  3W6V A;  4B48 A;  4DGW B;  4D6T J;  2WAQ N;  5CCG A;  2ZB9 A;  3G73 A;  2K9J B;  5ICF A;  4HX8 A;  1KQ8 A;  4YEJ A;  2FNP A;  2DYR H;  1HDD C;  2N9Y B;  3GHG B;  4BHC A;  5A2Q Z;  3JRC A;  4ZTJ A;  3GLM A;  3CCV P;  1JNM A;  4Q47 A;  4HSR A;  5M3F J;  4KIC A;  2WAF A;  1IUY A;  3MP7 B;  1LFP A;  3H32 B;  3CJN A;  3O3K A;  3WG7 H;  3CME I;  1NH3 A;  2OCE A;  3S1N J;  1QHG A;  1FLI A;  1MZ9 A;  1OW8 A;  2D2C C;  3BR3 A;  1QQI A;  3HE4 A;  4I98 B;  1BIA A;  2DQL A;  4XON A;  3K4C A;  3MZ8 A;  2CV0 A;  2UWM A;  2W6A A;  1AOY A;  1X19 A;  1FBM A;  1XMK A;  2DA6 A;  2OV7 A;  1JY2 P;  5KTB A;  1SMT A;  2CQK A;  2R5Z A;  3BCC J;  3QPL A;  4HV5 A;  1ETQ A;  4C3J J;  3OYJ A;  5BU5 A;  3QU3 A;  1IG7 A;  3CC2 P;  1DDN A;  2LC2 A;  4ASW A;  2ZME C;  1FSH A;  2NVY J;  5J1Y A;  5AVR B;  2AXC A;  3PFY A;  4PCQ A;  3RBZ A;  2DA4 A;  3GG2 A;  2J5P A;  5LLQ A;  2VBY A;  1WI9 A;  1L4A C;  1IW7 F;  2LXC B;  1W4M A;  3HRN A;  4P9U A;  4G7Z F;  1TU3 F;  1MMA A;  1W7P B;  3CCV I;  1AKH A;  4M3F A;  2E74 B;  3RKQ A;  3CI9 A;  2K02 A;  2HOS A;  3CD6 P;  3E3V A;  2CQQ A;  3C3W A;  4JBA A;  4ASV A;  3NFQ A;  2E60 A;  1G2C B;  1S9K D;  1G3S A;  2FBK A;  1QVG O;  1O7L A;  1PJR A;  5AVV B;  3CPW O;  1R5H A;  3EFF K;  2L7M P;  2OBP A;  1BCC J;  3IH2 A;  1SQV K;  4G12 A;  3PNV A;  1SQV G;  1YFH A;  4IVN A;  3DKX A;  3GZ5 A;  2AEJ A;  4DZJ A;  2G7H A;  1HF9 A;  2XGE A;  5KKZ C; 
#chains in the Genus database with same CATH homology
 2UWJ E;  4B43 A;  3K70 D;  3L2W A;  3W2W A;  2V1N A;  3H5N A;  4CSW A;  3OYF A;  3HOT A;  3ZCO A;  3KEY A;  5FRM A;  3LSK A;  3PH0 A;  3MZW B;  3DPL C;  4XKW A;  4EAT A;  4KIT B;  1X1A A;  2JWD A;  2DT6 A;  4XLC A;  3KYL A;  5JHF A;  2Z2S B;  2HU9 A;  2WY8 Q;  2A6T A;  3MD2 A;  3TBI A;  1H0T B;  4RLF A;  1Y6I A;  3HOS A;  3K4K A;  2VIX A;  4D1Q A;  1X4O A;  2XC7 A;  2XF5 A;  3H5A A;  2GOX B;  4F52 A;  1NVO A;  4XQF A;  1D1C A;  2HVR A;  1Z3X A;  3DKY A;  3OYD A;  4KJZ A;  3OYG A;  2KZI A;  3H0D A;  5C39 A;  3QOE A;  4LIT A;  3K70 C;  4ZDO A;  2L7K A;  2HPM A;  2ZXI A;  2Y0S A;  3VWB A;  1D1B A;  2X85 A;  3L2V A;  1JI8 A;  2HVQ A;  1T95 A;  1YE9 A;  4XMY A;  4XLF A;  4K3A A;  3S1K A;  3OIP A;  4LIU A;  4GRI A;  4ANJ A;  2BW3 B;  5HNH A;  3EUA A;  3H5R A;  3M1C A;  4PJJ A;  3AKZ A;  2R7U A;  1U7M A;  1Q2N A;  3VYU B;  4R79 A;  3ONQ A;  3E1S A;  1U7J A;  2QRX A;  3FXD A;  1N75 A;  2VXZ A;  3H9Q A;  4BEH B;  2V26 A;  3LSI A;  4CA0 A;  4RM3 A;  4HKZ H;  1HA8 A;  3RGU A;  1BDD A;  1WJB A;  2K3R A;  1P9Q C;  3TMO A;  3HC7 A;  1EDJ A;  3L2U A;  4XLA A;  4XKV A;  2IGM A;  3SZG A;  5CQG A;  4DOZ A;  4BDZ A;  3DU6 A;  4BQN A;  3LSM A;  2OC6 A;  2R7Q A;  2GOM A;  2VB6 A;  2MFZ A;  3K4M A;  5FRN A;  4PJN A;  4YRV A;  3L2Q A;  5KHD A;  2ZXH A;  4ZC3 A;  4ZTF A;  1MNE A;  3BG6 A;  4D9J A;  3DEE A;  3A1Y A;  2KL4 A;  2WA0 A;  4C9Y A;  4IZZ A;  3SYT A;  3OR1 C;  4ZMD A;  5CPR B;  1Y47 A;  4DIQ A;  2WAE A;  3QYE A;  3VSL A;  3HG9 A;  1YX5 A;  1ZEL A;  1OR7 C;  4JOM A;  4ZDP A;  3VSK A;  3N05 A;  4OAZ A;  4ZYA A;  1G59 A;  1UAA A;  3CES A;  3D5S C;  2LY1 A;  2B88 A;  2UV1 A;  1D0X A;  2DT7 B;  3D5L A;  5FRO A;  3FXE A;  2JVG A;  3M8J A;  1LP1 B;  4YEL A;  1OVV A;  3CZ6 A;  2W4S A;  1Z3Y A;  2K9M A;  2WAD A;  3SDB A;  2M7B A;  2HVS A;  4PSX A;  1G8X A;  2IS1 A;  4Y33 A;  4KJM A;  4Y3O A;  3IP4 B;  3MMY B;  3H9G A;  4ZDL A;  2M4G A;  1TZL A;  1JMB A;  3QYF A;  3A4C A;  4HRI A;  2IGK A;  2CW7 A;  3V42 A;  4P5O A;  1QHH D;  2JSP A;  2RRE A;  1V5E A;  2ELJ A;  3FKJ A;  3OS0 A;  2DXI A;  4PFP A;  2KZV A;  2UUZ A;  2V9K A;  2VXD A;  3OWT A;  4XN3 A;  3F9K A;  4C2T A;  1LDK B;  1YX3 A;  2DOA A;  4BS9 A;  2VLA A;  1X4P A;  3W2V A;  2DCE A;  3OYI A;  3W3C A;  1S3J A;  3NWS A;  3CJR B;  2CFO A;  5CBN A;  4P1W A;  2BVL A;  4F92 B;  1X1B A;  2FUG 2;  2MD0 A;  4U87 A;  3MKW B;  1MND A;  3D5R C;  2KIK A;  1K6Y A;  3H9J A;  4F3Q A;  3EUH C;  3UR3 C;  1D0Y A;  2M4K A;  2X1E A;  1U0J A;  2L9N A;  3CJQ B;  3TL4 X;  2L9S A;  3VYS B;  2VKH A;  2LY2 A;  1WJE A;  3FDY A;  4CCK A;  1X0T A;  2B87 B;  2LRE A;  1WJA A;  4B44 A;  2B89 A;  4BJ5 C;  5LD2 C;  3OYM A;  1MMN A;  4IQ4 A;  2LBF B;  4NUB A;  4DJA A;  1WJD A;  3EUK L;  5EFW B;  4E6K G;  1OLT A;  1Y56 A;  2VQH A;  4BXL A;  2Q1Z B;  1R6R A;  5DJU B;  4IX7 A;  5KCM A;  2RNG A;  2IS6 A;  1T0F C;  3I3L A;  3OYE A;  1EC5 A;  1H0T A;  3IAM 2;  3W2A A;  2MAB A;  2ZFU A;  1GLN A;  4H4K C;  2F6C A;  2R7R A;  3OYH A;  4RLQ A;  4J00 A;  4Y4R A;  5KNL A;  1W36 D;  3BCA A;  2VQG A;  2X1D A;  2F4I A;  2KRH A;  4NQW B;  2R7O A;  1N78 A;  2JVH A;  2CV1 A;  4NPE A;  1UG0 A;  3VYT B;  3ZRG A;  4DBR A;  1MMG A;  3C2G A;  2P58 A;  2CUJ A;  3HPG A;  5TGT A;  4XN0 A;  2PJR B;  3SEZ A;  2XAU A;  3OOU A;  2V6E A;  2IS2 A;  2DJI A;  1DQU A;  2R7S A;  2BW3 A;  3CF2 A;  2R4G A;  2KMU A;  4N4O B;  2Z1D A;  4XR6 A;  1LVK A;  1ZXG A;  1FC2 C;  3AL0 B;  4LIV A;  2VKD A;  1SAU A;  4BEH A;  4JBZ A;  3DPU A;  4CUG A;  1BOB A;  5CKT A;  4BL0 B;  2VPL A;  1UEL B;  1W36 C;  3OL4 A;  1Z7L A;  5HVQ C;  2WAQ A;  2LYC A;  1WJF A;  1NG6 A;  2R7X A;  3PNY A;  1MW7 A;  3BCB A;  4XOR A;  2R44 A;  1BDC A;  4CH7 A;  2QKL B;  2VQL A;  4AU7 A;  4ZJZ A;  1WJC A;  2IS4 A;  4PK4 A;  4CCN A;  3GBG A;  4QPO A;  1D0Z A;  4OWR B;  4PJL A;  4QPQ A;  3VDX A;  3PNT A;  5CBO A;  3PL8 A;  3RSN A;  4CCM A;  5K5G B;  3ZQQ A;  4XLH A;  4CCJ A;  3OYA A;  3ZXS A;  1BR4 A;  1WFX A;  3LFU A;  3C2H A;  1KON A;  2KP6 A;  2X6Y A;  4BE0 A;  2V7F A;  3OMY A;  4KT6 A;  5HNF A;  3K6G A;  3OYB A;  4EYY Q;  2Q1K A;  3PSF A;  2HZD A;  2XDV A;  3S3N A;  1ERD A;  3HPH A;  4RM2 A;  4XOT A;  2I8D A;  2HQA A;  2MC4 A;  2A5W A;  1TT0 A;  3CP8 A;  4ITV A;  2HNH A;  4GOF A;  2VJJ A;  2CMP A;  1LP1 A;  1LKX A;  2LOO A;  2Z16 A;  1N77 A;  2O5R A;  2RQQ A;  2ZAE B;  2W82 A;  3CMM A;  3OS1 A;  4G6T B;  1DEE G;  5LFA A;  2JA2 A;  4BQQ A;  4CZC A;  1SS1 A;  5HLT A;  1DP3 A;  4HG2 A;  4NC8 A;  4B47 A;  3RQ4 A;  2X1C A;  2CUZ A;  2CS3 A;  2E1M B;  4XKC A;  2M5A B;  2W1O A;  2KZJ A;  4HJG H;  2WY7 Q;  3DTI A;  2LH9 A;  4E7Z A;  1NG7 A;  4BJT A;  2R7V A;  4XOP A;  3HL2 A;  1D1A A;  4PUS A;  2NOJ B;  4HNT A;  4WWI A;  2JUG A;  2IXS A;  2WB1 A;  4J01 A;  3BG7 A;  2KHM A;  2ZSI B;  3LSG A;  3FHN A;  2CH0 A;  4HPQ A;  1X1D A;  3OS2 A;  2KRC A;  5DJT B;  1FMV A;  2ZSH B;  2CV2 A;  2QKM B;  2B87 A;  3QYB A;  3OYL A;  4BE1 A;  3K4B A;  1DGW Y;  3OIQ A;  3OR2 C;  4X0G A;  3A2K A;  4IQJ A;  2LBF A;  2Q2E B;  2VJI A;  3DLA A;  4K35 A;  2BOL A;  2X6W A;  3HXL A;  3IAS 2;  1BR2 A;  2L2O A;  2LG4 A;  1AA7 A;  4HNU A;  4FAS D;  4GOE A;  2LR2 A;  2LRD A;  3CP2 A;  3G2B A;  4XNF A;  4E7J A;  1QU3 A;  3K4L A;  3OYN A;  1EDL A;  3RPU D;  3L2R A;  3AL0 C;  1JM0 A;  1EDI A;  1J09 A;  2LXB A;  2X6X A;  4MLO A;  2AQE A;  2PMZ A;  3RCO A;  2KPM A;  2K9L A;  3BC8 A;  3EPZ A;  3U21 A;  2VAS A;  2K3P A;  2BVM A;  3FBI B;  4BAC A;  2E5N A;  4F91 B;  2V4J C;  4NPD A;  3DPT A;  1EA3 A;  2R7T A;  2MYS A;  4GOD A;  4CCL A;  4II3 A;  1VZ0 A;  4B3X A;  4HB1 A;  4F55 A;  2W00 A;  3ZGK A;  1WJ5 A;  4NC7 A;  3MKY B;  1Z21 A;  2IGO A;  3DU5 A;  3H35 A;  1V5G A;  3HUG B;  2PJR A;  3S3M A;  1FMW A;  2VJ4 A;  1OVR A;  4PJM A;  3MHV A;  4NPF X;  4C30 A;  2HPI A;  3S93 A;  4E7S A;  1E0E A;  4E7I A;  2P0W A;  4BQO A;  2R7W A;  4MN4 C;  4BU2 A;  2AQF A;  2KUB A;  3DTK A;  4XM3 A;  4IKF A;  1X1C A;  4CCO A;  3LMM A;  4FET A;  4JQF A;  2WBM A;  2E5Z A;  4IOI H;  1MFT A;  3QOD A;  4BJ6 C;  4AVZ A;  4BE2 A;  3DQV C;  3VYR B;  3QWO C;  3OL3 A;  4PFO A;  3ZR8 X;  3DWL E;  4XL9 A;  2HDW A;  4F93 B;  3PSI A;  2KLO A;  1MMD A;  3PUB A;  2VJ5 A;  3BLY A;  3OYK A;  3ZDM A;  4E7L A;  4OAY A;  3K4J A;  4XLE A;  2W7N A;  4AYB A;  4BGD A;  3LSH A;  2KS1 B;  4KIS A;  3OY9 A;  3PJR A;  2IGN A;  4HEA 2;  2XF6 A;  4E7H A;  2VQC A;  4XKB A;  1SFK A;  2X51 A;  4RMN A;  2M0M A;  2VL8 A;  4B48 A;  4DGW B;  2E1M C;  5HOO A;  2QVA A;  3S8P A;  4YEJ A;  4BXF A;  4HST A;  3K10 A;  4ZTJ A;  4HSR A;  3KX2 A;  2WAF A;  4E4H A;  1LFP A;  3AFH A;  1OVU A;  3SEQ A;  3DTE A;  2WMM A;  1QHG A;  2KI7 B;  1V5F A;  1S9H A;  2XSJ C;  4PSW A;  4XON A;  3HKZ A;  2M7A A;  3K4C A;  3LL7 A;  2CV0 A;  2UWM A;  2SPZ A;  1X19 A;  3S3O A;  2OV7 A;  2OTK E;  5CQE A;  2L5Q A;  2M3A A;  3S32 A;  1EDK A;  3NWT A;  3OYJ A;  3UNG C;  3OYC A;  4ASW A;  2LC2 A;  4E7K A;  1BR1 A;  4C2U A;  2XF7 A;  2KQR A;  3PFY A;  2RKL A;  4BUP A;  3IUO A;  4U7B A;  2LXC B;  3MKZ A;  1LT1 A;  2K5C A;  4ZNC A;  1MMA A;  2CW8 A;  1ZW0 A;  3J7A Y;  1IRX A;  4N4N B;  2M5A A;  2F5V A;  4NNJ A;  4ASV A;  3I9V 2;  3FBN B;  2E60 A;  1DGR M;  2OUM A;  4CPG A;  1PJR A;  4BDY A;  2M0B A;  3PNV A;  3E0J B;  3DKX A;  2KDO A;  4II2 A;  2HR3 A;  3RTR A;  3K4N A;  4LG3 A;  1PYV A;  4DBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...