3B8EB

Crystal structure of the sodium-potassium pump
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
46
structure length
46
Chain Sequence
TGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of the sodium-potassium pump.
pubmed doi rcsb
total genus 14
structure length 46
sequence length 46
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b8eB00
1GD2E 1CI6A 1GTWA 1SLQA 4AUWA 2E43A 2W6AA 2P7JA 4GT1A 2BASA 3M0AA 3VYIA 2VRSA 2WT7B 5AW4B 1GU5A 2XZRA 4HYTB 2XV5A 5APWA 3HE5B 3A7OA 2QM8A 2Q3IA 3M0DA 3TK1A 4AQRD 4EOTA 1NWQA 1CSBA 2P67A 2YNYA 1CZQA 3P7KA 3V4WA 2WWWA 4C7NB 1HBWA 2E42A 1H8AA 5APSA 5AW0B 3A5TA 3HE4A 1SP4A 3M9BA 3MD0A 2WPRA 1FOSF 1KQLA 4I6MC 1NAFA 4RESB 3VMZA 2QM7A 1J2JB 3NMDA 2R32A 2WT7A 2YO2A 5AW6B 1G2CB 1JUNA 3HE5A 4LC1A 5APUA 1HJBA 2Q7CA 5AW2B 3OAKA 4DZOA 5APYA 1S9KD 3HTKA 1IO4A 5AW9B 2W27A 5AVQB 2Q5UA 3MGNA 4C7NA 3NFQA 3O8ZA 3LIEA 1GZLA 1DH3A 3VTPC 2P2UA 5AW1B 1H88A 2H7HA 3IR9A 3A2AA 4KHXA 3NXSA 1HUCA 3P32A 1GK4A 3KDPB 4GKGA 3SWFA 4I2LC 3M9HA 3NTNA 3UIAA 1MUUA 2ZXEB 4AYCA 5AW3B 3A3YB 2R5DA 1H89A 2C9NY 3L35A 2ZFCA 1S9KE 5AW5B 3I5CA 2WTYA 5APTA 1T2KC 3V5BA 5AVYB 2C9LY 5AVRB 1A02J 4XE5B 3TNUB 2XU6A 4M3LA 3V4QA 3L36A 3TYYA 2Z5HA 5CMZA 5AVTB 2R3CA 5AVXB 5AW8B 1FOSE 3VMXA 1GK6A 5AVUB 4C46A 2IPPA 1X8YA 2N9BA 2JJLA 1MFZA 3M06A 1T2KD 1OXZA 1CI6B 3B8EB 5AVVB 1JNMA 1HWTC 2R5BA 2WPQA 2KP8A 2YO3A 2WPSA 5AVWB 4JYCA 1A02F 2Z5IA 4JYBA 5AW7B 3VN0A 3L37A 4B86A 5AVSB 5AVZB 3T97A 3P8MC 5APQA 1MV8A 1FAVA 1YYCA 3LIDA 3TNUA 3KQGA 3M91A 3VMYA 5APXA 5APVA 1GU4A 1OWAA 3HE4B
chains in the Genus database with same CATH superfamily
1KB9E 2A06E 1R8EA 1LJ2A 2FY8A 2BCCD 4ZKPA 3CLQA 5APWA 2QJYB 1KQSO 1BGYJ 1CSBA 3L75D 3P7KA 3PJSK 4WY4B 1KB9H 4XA4A 5KAFE 1LTTC 2B88A 3E1IA 2OYIB 3AE8C 2AXCA 5AW2B 4Y99C 5KAFH 3PHLA 2V4HA 5AVQB 3MGNA 3O8ZA 3VTPC 2P2UA 3A0BH 3H1LE 1PIXA 2RH0A 2FFDA 1KORA 5KLVK 1KFMA 2R44A 4PJ0E 1FU1A 1RF1A 3M06A 4YXWH 2FFDC 1VL2A 1NTKD 3L71D 1HJ0A 1SQXK 4D6TG 2WQYC 4L75A 2N1TD 1FAVA 1YYCA 2P10A 1SQBD 1JO5A 1RF1C 2CPBA 2KSJA 4GOEA 1IZNB 1OWAA 3HE4B 2RMZA 3RGUA 1CI6A 2E43A 2IZ0A 2JEEA 1G1IA 1FJKA 3L4FA 2XV5A 1L0NK 4Y28J 1LWUB 4CPGA 1JTHB 3RL0D 2K37A 2LXCB 3Q3DA 1KQLA 1RH5B 4WBAA 3JSVC 1NTMJ 3VMZA 1BCCG 1LTAC 3IAOA 4HKZH 3HE5A 2ZYDA 1RE3A 2KS1B 1BE3D 1SQPJ 4C7NA 4PV1D 4TLFA 1LTJA 1JY2P 3CCLP 3IR9A 3GHGA 2Y0DA 1NOHA 3UIAA 2BCCE 5AW3B 1PFIA 2KOGA 1RE3C 3CWBG 1NU1E 3G9RA 3L75E 3GF7A 1L4AC 4N78D 3V4QA 3CXHD 1LP1B 1LTJC 1GDTA 4C46A 1KYOD 3GHGC 1ZXGA 3B5NB 2C0WA 5AVWB 3RK3B 5TJHA 1YJNP 1OVRA 4RO0A 1BDDA 3Q1MA 3V6IA 2M5AB 1GL2B 2K1AA 4ASWA 1Z56A 3BASA 3H1HE 2W6AA 1DIPA 2P7JA 3VYIA 1T3UA 1T3JA 2FBWC 1IFDA 1AFOA 2E74D 3Q5PA 1IK9A 1P84D 5DJUB 4BRYB 1L0LD 2H8PD 3BCCJ 1M57D 1ZR4A 3ABVC 2PRRA 1LTSC 1ZMEC 1NTKE 4LC1A 3L71E 2YKOA 2I8DA 1QL2A 1SQBK 3H1JG 5BU5A 2YIUC 1IFNA 3Q5SA 1PPJG 4KHXA 4JPZB 2M0BA 1K04A 1HTLC 1FDMA 1FBMA 2NPSB 2N9YB 5KLVG 4M3LA 1H0TA 2V7QH 1JCDA 2R3CA 4L74A 4EI2A 2O01J 2D2CD 1EXJA 5BU8B 2N1TC 2W6BA 3BRVB 5KAIE 3BRTB 3VN0A 1NKZB 1S2EA 2E76D 1BE3E 2KB7P 4D6TJ 1URQB 4OGQD 3KPEA 3H25A 1N7LA 3WU2E 1SQXG 5KAIH 1JMBA 3RL0C 3WU2H 2SPZA 3L73D 2Q3IA 2ZYGA 4BWNA 4N78E 5K5GB 1L0NG 2WSEJ 3AEDC 3CXHE 2H89C 3RK2C 1KYOE 1NAFA 1BCCJ 1FZGA 2WT7A 2J59M 4PV1C 1G2CB 3MZWB 1HJBA 2Q7CA 1Q90D 3CXHH 1S9KD 3HTKA 3L72G 1GW3A 1ZRTD 3L74D 4TT3H 2FKWB 1NVOA 1PL5A 1X79B 3AE5C 1VF5D 4WWIA 2QJKB 5GTHE 3CWBJ 5CJ0A 1J1DB 3V5BA 3H32A 3TGUG 2IDBA 2HR3A 1P84E 1YJWP 2JP3A 4U3FG 1SQQD 3HUSB 1RQUA 5GTHH 2IBZG 1KZUB 1KB9D 2R5BA 1KILB 1Y47A 3OJAB 1P84H 5GTIE 3TNUA 3Q2YA 4UB6H 1L2PA 2ITAA 1GD2E 5KKZC 4PD4H 4GT1A 4MN4C 5E79E 2M3EA 3AE4C 5GTIH 4HYTB 1SQVD 2HODA 3FGAD 4HH2A 2G3AA 1KD1Q 2OARA 2OYHB 5AW0B 2FYUE 2K9JB 1HGZA 3FXEA 5E79H 1KTMA 2AXTE 3H1LD 2WPVB 2W90A 2R32A 1WRGA 2YMYA 1VQOP 1EDJA 2P1JA 1DEBA 1YJ9P 1VQNP 2WSCJ 3CD6P 1VQ8P 1ZV8A 3CCJP 1NTZE 5APYA 1NAYA 2GUSA 2KUBA 2AXTH 3H1JJ 3TF5A 1PP9G 3PTZA 3AE9C 3AE6C 1VQ4P 1SQBG 2O01N 1GK4A 4GKGA 5B5EE 4H0LB 4A7PA 4WB4A 1AJYA 3HD7D 3L73E 2D2CC 5APTA 1K9MQ 3JCUE 1BCCE 5KLVJ 3L36A 3VP9A 5B5EH 5AW8B 1GK6A 2E76C 4EIJA 1OXZA 2YKPA 4UB8H 2FXPA 3JCUH 5AW7B 1IC2A 3H1IG 2XNXA 4H13D 3E1RA 3T97A 1NKNA 3WUUA 2OQQA 1ZRTE 3L74E 2ZVNB 5H2FE 1SQXJ 3C1LA 1DD3A 1IFIA 3M0AA 1G1JA 5AW4B 1N7SA 2QSIA 2MKVA 2XKMA 2XNDH 5H2FH 5CCHD 1LT1A 1Q81Q 2ZYAA 1HH0A 1L0NJ 2E42A 1YBKA 1SQQE 3M9BA 4OH8B 1FOSF 4RESB 1SFCB 1BGYD 4EYYQ 1EZVE 5APUA 1N7SC 1CW5A 4IOIH 1RF0A 4GDOA 4H44D 3CCUP 1HF9A 2IFMA 3L72J 2W27A 5AW9B 1NU1D 1X9VA 1VF5C 1M1KQ 1GZLA 4I7ZB 3BCCG 2E5TA 3AE1C 3N7NA 1VQKP 1ZW0A 2K88A 2Q1KA 2YMKA 3A0BE 1SQVE 3EWKA 2OTJP 3D6YA 3TGUJ 3EQ2A 1RF0C 2Z5HA 4U3FJ 3C8VA 1USDA 1HWTC 2ZJSE 3H1HD 4LLHA 1JY2O 4JYBA 5DJTB 4B86A 1J1EC 4Y99B 3F5HA 2WSFH 3P8CD 2JO1A 2BEQD 2HLOA 1MKMA 1QGKB 2GUVA 1M8OB 3CI9A 3FX0A 5CBNA 3F89A 1FDIA 1N73A 3B71A 2Y0EA 3CXHI 1KYOI 2A45H 2YNYA 3SWYA 1HBWA 3D71A 2Z4EA 3HD7A 5KLIC 2WPRA 1FZFA 3H1KG 2FFDB 1N73C 3QH9A 4R4LA 3GMAA 1NTMD 3AEBC 2M8RA 1Y8AA 1RF1B 1RQVA 1RHZB 1YIJP 2HYNA 1PP9J 3HD7C 1H88A 4K35A 1SQBJ 3G6EP 1Q82Q 3IF4A 1P84I 1JOCA 3CCRP 1ZR2A 2R5DA 2KNCA 1JEKA 1KQGB 1L4AA 3RK3E 1JB0J 3U1CA 4H13C 1CI6B 1BGYE 2KP8A 2FYNB 1XTCC 4JYCA 1QEXA 3KZIE 3H1IJ 2E75D 1NU1K 2KZJA 3MP7B 3CMEP 1RE4A 5L8RJ 1SLQA 3KZIH 2ZXXA 2IYOA 3CCQP 3HE5B 2BEZF 3L70G 1KQFB 3M0DA 4C7NB 3PRJA 1LTJB 3FWNA 2PGDA 5C39A 2UWJE 1RE4C 1JY3O 3ZDMA 2QE7H 3GHGB 4H44C 1VQLP 3VP8A 3G4SP 1LGHB 2R3SA 4DZOA 2A06G 3N4XA 1K73Q 3P8CE 1IO4A 3M0DC 4NPEA 2QA4P 1KMIZ 3NFQA 1S5LE 1FS0E 1FZEA 3H6PA 4IFDK 2OYOA 3SWFA 1S5LX 3KXDA 1NTKK 4NPFX 4PD4D 3A3YB 1S5LH 1SVFA 3SWKA 2ZT9B 5CCGD 5AVTB 5AVUB 3CL3D 3LW5J 2N1TA 2Z5IA 4O9BA 1IJDB 1NTME 2YIUB 1MFTA 1OFCX 2FYUD 3AEGC 1LTGC 2KK7A 4D6TD 1HVVA 2BASA 4W7YA 1SQPE 1GU5A 2QJPC 1XTGB 1PGQA 1QLED 3AECC 2L91A 2HFED 4AQRD 1NTZD 4W80A 1KFNA 1KB9I 2XDJA 2OTKE 1PGJA 4ZNCA 4DJGA 1W2BO 2QRXA 1EXIA 1OMIA 3NMDA 3H1KJ 3I56P 1VQ7P 2FXOA 4IL6E 1QX8A 1JM0A 2QEXP 1IFMA 3SSUA 1AQTA 3W67A 3OW2O 4IL6X 1BCCD 1N2DC 3EFGA 1H0TB 4JF7A 1KN7A 1DH3A 2LR2A 2IYPA 4IL6H 3NXSA 2L5GB 1AQ5A 3RL0B 3M9HA 3NTNA 2ZXEB 2JWAA 1W5CE 1JCCA 1AVOA 2KYVA 5AW5B 2C9LY 2ZVOB 5CJ4A 3HUSA 3RK2B 1M90Q 2H43A 1T2KD 3B8EB 2E75C 3CWBD 4WY4D 1VQMP 4PV1B 3CX5D 3RL0g 3A0HE 2DW3A 3BCCE 1ZOYC 3I55P 2BCCG 2HPCA 3S1KA 1FE6A 3WUTA 3MTUE 1LT9A 1L0LK 3HUSC 3A0HH 1NU1G 3L75G 2Q9IA 4UB6E 2WT7B 2Q6QA 3CCMP 1EZVD 2XZRA 4PD4E 4C7RA 2NZ2A 2K3RA 4HB1A 3L70J 1AV1A 1USEA 4EOTA 2P67A 3HTKB 1CZQA 3AEEC 1PGPA 2JDIH 1LT9C 1HGVA 2QM7A 2E74C 2YO2A 5AW6B 1JUNA 3FWLA 2O1JA 2CK3H 3H1HG 1SS1A 5M1BA 1ZP0C 3H32B 3CC2P 2Q5UA 1OVUA 3LIEA 3AE3C 1BSNA 2FYUK 3PP5A 3AE2C 5AW1B 3KHUA 2H88C 4D6TE 3V2RA 3G71P 2O01H 1MUUA 5CCGC 4DCKA 1H89A 3L35A 2WTYA 2B87B 1NTZK 4U7JA 2I1KA 1NTKG 1U57A 2IX7C 3TNUB 2POHA 3L71G 3BVHA 1FZCA 3AE7C 1QVGO 1YI2P 3CC7P 4GODA 1DD4A 4GIFA 3IFMA 5BVZA 2HODB 4UB8E 3CPWO 2WZ7A 5APQA 1M1JA 3M91A 3SFDC 3O6QA 1FC2C 1DX7A 4IFFA 2WITA 2P58A 1FZCC 2WSEH 1GTWA 2YKQA 3II6A 1VDFA 2CPSA 2YXQB 4OGQC 3R4YA 4JQ0D 1SQXD 1EDIA 2D2CB 1OIPA 1M1JC 1H8AA 1IFPA 1BE3G 2E76B 3CWBE 3CX5E 1L0ND 1VQPP 1IK7A 2KI7B 4WY4A 2AEFA 3B5ND 4L76A 2Y9ZA 1M56D 2M3BA 3RK3D 3Q5RA 5EFWB 1SQQK 3CX5H 3FXDA 3V2QA 3BATA 2OYIA 3L72D 1X0TA 2NRGA 1GL2D 3S9OA 2QJYC 1T2KC 3T97B 4WY4C 3TYYA 1VQ5P 4WVZA 2N9BA 4NPDA 1JNMA 3GG2A 2WPQA 2OYIC 3TGUD 3K5BA 1N7SB 1SQVK 4U3FD 5AVSB 3P8MC 3LIDA 2BCCJ 3VMYA 1OW6A 2IBZD 5APXA 1VF5B 3VOPA 1K8AQ 2QIWA 1NU1J 3L75J 2ZT9D 3IN6A 1L0LG 3H1JE 1PGOA 4OVNF 3E7KA 1PPJE 2WSCH 1Q86Q 3HE4A 1SP4A 3MD0A 1JY3N 2NPSD 3GLMA 3W68A 5KLVE 2KLUA 1J1EB 1ZLLA 3H1HJ 3OAKA 1KC8Q 1LWUA 1AA0A 4GOFA 1JTHA 3ITKA 1VQ6P 2H7HA 1URQD 2OTLP 3B4SA 1OW8A 4PJ0H 4AYCA 1QL1A 2FYUG 4OWFA 1X22A 1SQXE 2KS1A 1Q2NA 2JWDA 1PP9D 5AVYB 1LWUC 4XE5B 1NTKJ 2LXBA 1IFJA 3L71J 5KLIB 5CBOA 1NTZG 1GMJA 2IPPA 1X8YA 3RBZA 2KIKA 5B66E 2YO3A 2GM4A 1N73B 1A02F 1L0NE 1SQPD 5AVZB 2V7QJ 3JC22 3KQGA 1FJPA 1NGMB 1EDLA 2QG4A 5B66H 1LP1A 2YXRB 3L73G 4PD4I 3HD7B 5CCHA 3H1ID 1EC5A 4RJTA 3B5NA 2FYNC 3L72E 5KJ7D 3RK2D 4YPCA 4JBZA 3TK1A 1S72P 2M5AA 2Y9YA 3R2PA 4KJMA 1GL2A 1BE3J 4H13B 3RBXA 3L74G 5CCHC 3B5NC 3TGUE 1W2EA 2W8ZA 2IZ1A 3RK3C 2KNCB 4U3FE 4EDFA 1EDKA 2KZIA 5KTBA 2K9YA 2IBZE 3EFFK 1KILD 1L4AB 3WMM0 4N6JA 4BRYA 3D6ZA 2FXMA 1GL2C 3A2AA 2WVRA 1VPCA 1SQQG 1OX3A 1E5WA 3BCCD 1EZVG 5TISE 2G8YA 3VMXA 2RN0A 4ASVA 1U7JA 3HRNA 1D7MA 5AVVB 3V2PA 4H44B 2WPSA 4HJGH 3OA7A 3G3ZA 5TISH 1WMKA 2NPSA 2ZT9C 1SQVG 2W83C 2FYZA 2AEMA 3TDKA 4AUWA 2VRSA 1L0LJ 1Q7YQ 3H1LG 1PP9E 1URQA 4BXLA 2NPSC 4RKUJ 1SQBE 4H0LD 1NTMK 3V4WA 3CX5I 1OZHA 2KLVA 1UIXA 3PH0A 2W6JH 4I6MC 1YITP 3TSIA 2A45G 1SQPK 1ZN5A 1FDOA 3D70A 2KSEA 1URQC 1LTIC 3H1KD 1EZVI 1S1CX 2Q3EA 1OVVA 3KYQA 3AEAC 1GW4A 3H1IE 2N1TB 1G2CA 2QJPB 2FYUJ 3I5CA 5CHXA 1Y9BA 1R5SA 1PZQA 5AVRB 1YTZT 1JY3P 5CMZA 5KJ7A 3WUVA 5AVXB 4YTPC 1NTZJ 2IFNA 3SFEC 1MFZA 4DOJA 2O1KA 3S4RA 1NYHA 2B89A 1KV4A 1RY3A 2I1JA 2RKLA 1LTBC 4YXDC 1SFCD 1BDCA 1MV8A 3C9IA 2J5UA 1KILE 3MHVA 2PAJA 3L73J 5KJ7C 1N8RQ 2B9BA 1KILA 1VQ9P 2C0XA 4ZKUA 3A7OA 2QJKC 2A45I 1NWQA 1BGYG 1K05A 1T6AA 1J1DC 1KYOH 2WWWA 2MJZA 1N7SD 3A5TA 1NO4A 4QMAA 3CCVP 3L70D 1DEEG 2E75B 3L74J 1MZ9A 1PV3A 1KILC 1NJIQ 3AEFC 2WMMA 2OYHA 1L0LE 2K9JA 3GW6A 1YQ4C 1S4XA 3U1AA 1UIIA 1HUCA 2A06D 3KDPB 4I2LC 5CCGA 3LW5H 1SQQJ 2PFXA 3CC4P 2B87A 2C9NY 2O3JA 1A02J 1JMMA 2ZAEB 2HPCB 2OYHC 2GA1A 1FOSE 1E79H 1LT9B 5KKZB 3MUDA 2E74B 1U7MA 2OGUA 3CCEP 3H1JD 3L37A 1NH4A 1OW7A 1PPJD 3H1KE 1SQVJ 3V2NA 2WSSH 3CCSP 1T8ZA 1TU3F 3MUDC 4L73A 4H0LC 2E5YA 4XFJA 1FZAA 3CMAP 2WSFJ 1JY2N 1S3JA 5KLVD 4K3AA 1WT6A 2QM8A 3H1LJ 5APSA 3MIWA 4N3YB 1NTMG 1YHQP 1J2JB 2IBZI 2QVAA 3M9QA 4R4MA 1YQ3C 1M7LA 1BSHA 1SQPG 4KT0J 3GF3A 4IFMA 2HG5D 3USSA 1FZCB 1AVYA 1SFCA 3P32A 4DT0A 4OGQB 3U59A 3QWOC 4ZMDA 2ZFCA 1S9KE 1M1JB 2KXPB 2XU6A 1YTZI 1QVFO 3O6QB 1LNQA 2J58A 1NHLA 2LKMA 2JJLA 3L70E 1N86A 1FZBA 1EQ7A 1SFCC 4I1LA 1L4AD 2AEJA 4LGDE 2JKVA 3VMAA 2PP6A 4W7ZA 4Z1MH 2Y0CA 1R5LA 2JR8A 5APVA 3PLNA 1GU4A 4I7ZC
chains in the Genus database with same CATH topology
1GD2E 1LTGC 5CCHA 3B5NA 4GT1A 1HVVA 2BASA 4W7YA 4ZKPA 1GU5A 4HYTB 3CLQA 1XTGB 5APWA 5KJ7D 2HODA 3RK2D 4HH2A 2HFED 3TK1A 4AQRD 1CSBA 4W80A 1KFNA 2OARA 2XDJA 3P7KA 4WY4B 2OYHB 3R2PA 5AW0B 4XA4A 1GL2A 1HGZA 1LTTC 3E1IA 3NMDA 2OYIB 2R32A 5CCHC 1WRGA 2YMYA 3B5NC 2P1JA 1DEBA 1W2EA 3RK3C 1ZV8A 5AW2B 1IFMA 5APYA 4Y99C 5KTBA 2GUSA 5AVQB 3MGNA 1N2DC 3O8ZA 1KILD 1L4AB 3WMM0 3EFGA 4JF7A 4N6JA 1DH3A 3VTPC 2FXMA 2P2UA 1GL2C 3A2AA 3NXSA 1VPCA 2L5GB 1GK4A 2FFDA 4GKGA 1AQ5A 3RL0B 3M9HA 3NTNA 2ZXEB 5KLVK 4WB4A 1JCCA 1E5WA 2KYVA 1KFMA 3HD7D 5AW5B 5APTA 1FU1A 2C9LY 1RF1A 5CJ4A 3L36A 3VP9A 3HUSA 5AW8B 3VMXA 1GK6A 3RK2B 3M06A 2H43A 1T2KD 4EIJA 1OXZA 3HRNA 3B8EB 5AVVB 3V2PA 2YKPA 4WY4D 2WPSA 2FFDC 5AW7B 3OA7A 3G3ZA 1IC2A 1SQXK 2XNXA 2NPSA 3T97A 2N1TD 1NKNA 1FAVA 1YYCA 1JO5A 2HPCA 1RF1C 2CPBA 2KSJA 1OWAA 3MTUE 2FYZA 3HUSC 1LT9A 1L0LK 3HE4B 1CI6A 4AUWA 2E43A 1IFIA 2Q9IA 3M0AA 2VRSA 2JEEA 1G1IA 1G1JA 5AW4B 2WT7B 1FJKA 1N7SA 2XZRA 3L4FA 2XV5A 1L0NK 4C7RA 2XKMA 1URQA 4EOTA 1LWUB 5CCHD 2NPSC 2P67A 3HTKB 1JTHB 1CZQA 1NTMK 3RL0D 1HH0A 3V4WA 2E42A 3M9BA 2KLVA 4OH8B 1FOSF 1LT9C 1KQLA 4I6MC 4WBAA 1HGVA 4RESB 3VMZA 1SFCB 2QM7A 3TSIA 1LTAC 2YO2A 5AW6B 2A45G 1SQPK 1JUNA 3HE5A 1ZN5A 5APUA 2O1JA 1N7SC 1RE3A 1CW5A 1URQC 1LTIC 1RF0A 3H32B 2IFMA 5AW9B 2W27A 2Q5UA 4C7NA 3LIEA 1X9VA 1LTJA 1GZLA 2FYUK 3PP5A 3KYQA 5AW1B 1GW4A 1JY2P 3IR9A 3GHGA 3N7NA 1NOHA 2N1TB 3V2RA 2O01H 3UIAA 1MUUA 1G2CA 5CCGC 5AW3B 1H89A 1PFIA 2KOGA 3L35A 3I5CA 2WTYA 1NTZK 5CHXA 1RE3C 2I1KA 5AVRB 1YTZT 1JY3P 1RF0C 2IX7C 3EQ2A 3TNUB 2POHA 1L4AC 4N78D 3V4QA 2Z5HA 5CMZA 5KJ7A 5AVXB 1LTJC 3BVHA 1GDTA 1FZCA 2IFNA 4C46A 1MFZA 4DOJA 1HWTC 3GHGC 2O1KA 3B5NB 4LLHA 1JY2O 2C0WA 4GIFA 5AVWB 3IFMA 4JYBA 3RK3B 5BVZA 2HODB 4B86A 1J1EC 1RY3A 2I1JA 4Y99B 1LTBC 2WSFH 2WZ7A 1SFCD 3P8CD 1M1JA 1MV8A 3C9IA 5APQA 2HLOA 3M91A 2GUVA 1DX7A 4IFFA 2WITA 2PAJA 3CI9A 5KJ7C 1GL2B 1FZCC 1Z56A 2WSEH 3BASA 1GTWA 2YKQA 3II6A 1VDFA 2CPSA 2W6AA 2P7JA 1N73A 1KILA 3VYIA 1T3UA 2C0XA 4ZKUA 1T3JA 3A7OA 1IFDA 2A45I 1AFOA 1NWQA 2A45H 1J1DC 2YNYA 1IK9A 1M1JC 3SWYA 2WWWA 1HBWA 2MJZA 1H8AA 1N7SD 3A5TA 2Z4EA 1NO4A 2H8PD 3HD7A 2WPRA 1ZR4A 1FZFA 2FFDB 1MZ9A 1LTSC 1N73C 1KILC 4LC1A 2YKOA 1QL2A 4WY4A 3B5ND 1SQBK 2M8RA 2OYHA 1RF1B 5BU5A 1IFNA 2M3BA 3RK3D 2HYNA 1SQQK 3HD7C 1H88A 3U1AA 4KHXA 1HUCA 3V2QA 3BATA 2OYIA 3KDPB 4I2LC 5CCGA 3LW5H 1JOCA 1HTLC 1ZR2A 1FDMA 2R5DA 2C9NY 1GL2D 1FBMA 2NPSB 1T2KC 1A02J 1JMMA 1L4AA 4WY4C 4M3LA 3TYYA 2HPCB 2OYHC 1JCDA 2R3CA 1FOSE 1LT9B 3U1CA 2N9BA 3MUDA 1CI6B 1JNMA 5BU8B 2N1TC 2WPQA 2W6BA 2KP8A 2OYIC 3BRVB 1XTCC 4JYCA 3BRTB 1N7SB 1SQVK 3VN0A 1NKZB 3L37A 1NH4A 5AVSB 2KB7P 1URQB 3P8MC 3LIDA 1NU1K 3VMYA 3KPEA 5APXA 3VOPA 1N7LA 3V2NA 1RE4A 1T8ZA 1SLQA 3RL0C 1FZAA 1JY2N 3HE5B 1WT6A 2QM8A 2Q3IA 3M0DA 2WSCH 4N78E 4C7NB 5APSA 1LTJB 3MIWA 3HE4A 1SP4A 3MD0A 1RE4C 4N3YB 1JY3O 1JY3N 3RK2C 1NAFA 2NPSD 3GHGB 1FZGA 1J2JB 2WT7A 2J59M 3VP8A 1G2CB 3M9QA 1HJBA 1J1EB 2Q7CA 1LGHB 1ZLLA 3OAKA 4DZOA 1LWUA 1S9KD 3N4XA 3HTKA 3P8CE 1JTHA 1IO4A 3M0DC 1M7LA 1GW3A 3NFQA 2FKWB 4IFMA 1FZEA 2HG5D 3H6PA 1FZCB 4IFDK 2H7HA 1URQD 1SFCA 1X79B 3P32A 3SWFA 4AYCA 1QL1A 1NTKK 3U59A 3A3YB 2ZFCA 1SVFA 1S9KE 5CJ0A 1J1DB 5AVYB 1LWUC 3H32A 3V5BA 1M1JB 4XE5B 5CCGD 2XU6A 1YTZI 1IFJA 5AVTB 3HUSB 2J58A 1NHLA 2IPPA 2LKMA 1X8YA 3CL3D 5AVUB 2JJLA 1N86A 1FZBA 2N1TA 1KZUB 1EQ7A 1SFCC 2R5BA 2YO3A 4I1LA 1L4AD 2GM4A 1N73B 1KILB 1A02F 2Z5IA 3OJAB 4LGDE 4O9BA 2PP6A 5AVZB 4W7ZA 1IJDB 3TNUA 3KQGA 1FJPA 5APVA 1GU4A 3HD7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD2 E;  1CI6 A;  1GTW A;  1SLQ A;  4AUW A;  2E43 A;  2W6A A;  2P7J A;  4GT1 A;  2BAS A;  3M0A A;  3VYI A;  2VRS A;  2WT7 B;  5AW4 B;  1GU5 A;  2XZR A;  4HYT B;  2XV5 A;  5APW A;  3HE5 B;  3A7O A;  2QM8 A;  2Q3I A;  3M0D A;  3TK1 A;  4AQR D;  4EOT A;  1NWQ A;  1CSB A;  2P67 A;  2YNY A;  1CZQ A;  3P7K A;  3V4W A;  2WWW A;  4C7N B;  1HBW A;  2E42 A;  1H8A A;  5APS A;  5AW0 B;  3A5T A;  3HE4 A;  1SP4 A;  3M9B A;  3MD0 A;  2WPR A;  1FOS F;  1KQL A;  4I6M C;  1NAF A;  4RES B;  3VMZ A;  2QM7 A;  1J2J B;  3NMD A;  2R32 A;  2WT7 A;  2YO2 A;  5AW6 B;  1G2C B;  1JUN A;  3HE5 A;  4LC1 A;  5APU A;  1HJB A;  2Q7C A;  5AW2 B;  3OAK A;  4DZO A;  5APY A;  1S9K D;  3HTK A;  1IO4 A;  5AW9 B;  2W27 A;  5AVQ B;  2Q5U A;  3MGN A;  4C7N A;  3NFQ A;  3O8Z A;  3LIE A;  1GZL A;  1DH3 A;  3VTP C;  2P2U A;  5AW1 B;  1H88 A;  2H7H A;  3IR9 A;  3A2A A;  4KHX A;  3NXS A;  1HUC A;  3P32 A;  1GK4 A;  3KDP B;  4GKG A;  3SWF A;  4I2L C;  3M9H A;  3NTN A;  3UIA A;  1MUU A;  2ZXE B;  4AYC A;  5AW3 B;  3A3Y B;  2R5D A;  1H89 A;  2C9N Y;  3L35 A;  2ZFC A;  1S9K E;  5AW5 B;  3I5C A;  2WTY A;  5APT A;  1T2K C;  3V5B A;  5AVY B;  2C9L Y;  5AVR B;  1A02 J;  4XE5 B;  3TNU B;  2XU6 A;  4M3L A;  3V4Q A;  3L36 A;  3TYY A;  2Z5H A;  5CMZ A;  5AVT B;  2R3C A;  5AVX B;  5AW8 B;  1FOS E;  3VMX A;  1GK6 A;  5AVU B;  4C46 A;  2IPP A;  1X8Y A;  2N9B A;  2JJL A;  1MFZ A;  3M06 A;  1T2K D;  1OXZ A;  1CI6 B;  3B8E B;  5AVV B;  1JNM A;  1HWT C;  2R5B A;  2WPQ A;  2KP8 A;  2YO3 A;  2WPS A;  5AVW B;  4JYC A;  1A02 F;  2Z5I A;  4JYB A;  5AW7 B;  3VN0 A;  3L37 A;  4B86 A;  5AVS B;  5AVZ B;  3T97 A;  3P8M C;  5APQ A;  1MV8 A;  1FAV A;  1YYC A;  3LID A;  3TNU A;  3KQG A;  3M91 A;  3VMY A;  5APX A;  5APV A;  1GU4 A;  1OWA A;  3HE4 B; 
#chains in the Genus database with same CATH topology
 1KB9 E;  2A06 E;  1R8E A;  1LJ2 A;  2FY8 A;  2BCC D;  4ZKP A;  3CLQ A;  5APW A;  2QJY B;  1KQS O;  1BGY J;  1CSB A;  3L75 D;  3P7K A;  3PJS K;  4WY4 B;  1KB9 H;  4XA4 A;  5KAF E;  1LTT C;  2B88 A;  3E1I A;  2OYI B;  3AE8 C;  2AXC A;  5AW2 B;  4Y99 C;  5KAF H;  3PHL A;  2V4H A;  5AVQ B;  3MGN A;  3O8Z A;  3VTP C;  2P2U A;  3A0B H;  3H1L E;  1PIX A;  2RH0 A;  2FFD A;  1KOR A;  5KLV K;  1KFM A;  2R44 A;  4PJ0 E;  1FU1 A;  1RF1 A;  3M06 A;  4YXW H;  2FFD C;  1VL2 A;  1NTK D;  3L71 D;  1HJ0 A;  1SQX K;  4D6T G;  2WQY C;  4L75 A;  2N1T D;  1FAV A;  1YYC A;  2P10 A;  1SQB D;  1JO5 A;  1RF1 C;  2CPB A;  2KSJ A;  4GOE A;  1IZN B;  1OWA A;  3HE4 B;  2RMZ A;  3RGU A;  1CI6 A;  2E43 A;  2IZ0 A;  2JEE A;  1G1I A;  1FJK A;  3L4F A;  2XV5 A;  1L0N K;  4Y28 J;  1LWU B;  4CPG A;  1JTH B;  3RL0 D;  2K37 A;  2LXC B;  3Q3D A;  1KQL A;  1RH5 B;  4WBA A;  3JSV C;  1NTM J;  3VMZ A;  1BCC G;  1LTA C;  3IAO A;  4HKZ H;  3HE5 A;  2ZYD A;  1RE3 A;  2KS1 B;  1BE3 D;  1SQP J;  4C7N A;  4PV1 D;  4TLF A;  1LTJ A;  1JY2 P;  3CCL P;  3IR9 A;  3GHG A;  2Y0D A;  1NOH A;  3UIA A;  2BCC E;  5AW3 B;  1PFI A;  2KOG A;  1RE3 C;  3CWB G;  1NU1 E;  3G9R A;  3L75 E;  3GF7 A;  1L4A C;  4N78 D;  3V4Q A;  3CXH D;  1LP1 B;  1LTJ C;  1GDT A;  4C46 A;  1KYO D;  3GHG C;  1ZXG A;  3B5N B;  2C0W A;  5AVW B;  3RK3 B;  5TJH A;  1YJN P;  1OVR A;  4RO0 A;  1BDD A;  3Q1M A;  3V6I A;  2M5A B;  1GL2 B;  2K1A A;  4ASW A;  1Z56 A;  3BAS A;  3H1H E;  2W6A A;  1DIP A;  2P7J A;  3VYI A;  1T3U A;  1T3J A;  2FBW C;  1IFD A;  1AFO A;  2E74 D;  3Q5P A;  1IK9 A;  1P84 D;  5DJU B;  4BRY B;  1L0L D;  2H8P D;  3BCC J;  1M57 D;  1ZR4 A;  3ABV C;  2PRR A;  1LTS C;  1ZME C;  1NTK E;  4LC1 A;  3L71 E;  2YKO A;  2I8D A;  1QL2 A;  1SQB K;  3H1J G;  5BU5 A;  2YIU C;  1IFN A;  3Q5S A;  1PPJ G;  4KHX A;  4JPZ B;  2M0B A;  1K04 A;  1HTL C;  1FDM A;  1FBM A;  2NPS B;  2N9Y B;  5KLV G;  4M3L A;  1H0T A;  2V7Q H;  1JCD A;  2R3C A;  4L74 A;  4EI2 A;  2O01 J;  2D2C D;  1EXJ A;  5BU8 B;  2N1T C;  2W6B A;  3BRV B;  5KAI E;  3BRT B;  3VN0 A;  1NKZ B;  1S2E A;  2E76 D;  1BE3 E;  2KB7 P;  4D6T J;  1URQ B;  4OGQ D;  3KPE A;  3H25 A;  1N7L A;  3WU2 E;  1SQX G;  5KAI H;  1JMB A;  3RL0 C;  3WU2 H;  2SPZ A;  3L73 D;  2Q3I A;  2ZYG A;  4BWN A;  4N78 E;  5K5G B;  1L0N G;  2WSE J;  3AED C;  3CXH E;  2H89 C;  3RK2 C;  1KYO E;  1NAF A;  1BCC J;  1FZG A;  2WT7 A;  2J59 M;  4PV1 C;  1G2C B;  3MZW B;  1HJB A;  2Q7C A;  1Q90 D;  3CXH H;  1S9K D;  3HTK A;  3L72 G;  1GW3 A;  1ZRT D;  3L74 D;  4TT3 H;  2FKW B;  1NVO A;  1PL5 A;  1X79 B;  3AE5 C;  1VF5 D;  4WWI A;  2QJK B;  5GTH E;  3CWB J;  5CJ0 A;  1J1D B;  3V5B A;  3H32 A;  3TGU G;  2IDB A;  2HR3 A;  1P84 E;  1YJW P;  2JP3 A;  4U3F G;  1SQQ D;  3HUS B;  1RQU A;  5GTH H;  2IBZ G;  1KZU B;  1KB9 D;  2R5B A;  1KIL B;  1Y47 A;  3OJA B;  1P84 H;  5GTI E;  3TNU A;  3Q2Y A;  4UB6 H;  1L2P A;  2ITA A;  1GD2 E;  5KKZ C;  4PD4 H;  4GT1 A;  4MN4 C;  5E79 E;  2M3E A;  3AE4 C;  5GTI H;  4HYT B;  1SQV D;  2HOD A;  3FGA D;  4HH2 A;  2G3A A;  1KD1 Q;  2OAR A;  2OYH B;  5AW0 B;  2FYU E;  2K9J B;  1HGZ A;  3FXE A;  5E79 H;  1KTM A;  2AXT E;  3H1L D;  2WPV B;  2W90 A;  2R32 A;  1WRG A;  2YMY A;  1VQO P;  1EDJ A;  2P1J A;  1DEB A;  1YJ9 P;  1VQN P;  2WSC J;  3CD6 P;  1VQ8 P;  1ZV8 A;  3CCJ P;  1NTZ E;  5APY A;  1NAY A;  2GUS A;  2KUB A;  2AXT H;  3H1J J;  3TF5 A;  1PP9 G;  3PTZ A;  3AE9 C;  3AE6 C;  1VQ4 P;  1SQB G;  2O01 N;  1GK4 A;  4GKG A;  5B5E E;  4H0L B;  4A7P A;  4WB4 A;  1AJY A;  3HD7 D;  3L73 E;  2D2C C;  5APT A;  1K9M Q;  3JCU E;  1BCC E;  5KLV J;  3L36 A;  3VP9 A;  5B5E H;  5AW8 B;  1GK6 A;  2E76 C;  4EIJ A;  1OXZ A;  2YKP A;  4UB8 H;  2FXP A;  3JCU H;  5AW7 B;  1IC2 A;  3H1I G;  2XNX A;  4H13 D;  3E1R A;  3T97 A;  1NKN A;  3WUU A;  2OQQ A;  1ZRT E;  3L74 E;  2ZVN B;  5H2F E;  1SQX J;  3C1L A;  1DD3 A;  1IFI A;  3M0A A;  1G1J A;  5AW4 B;  1N7S A;  2QSI A;  2MKV A;  2XKM A;  2XND H;  5H2F H;  5CCH D;  1LT1 A;  1Q81 Q;  2ZYA A;  1HH0 A;  1L0N J;  2E42 A;  1YBK A;  1SQQ E;  3M9B A;  4OH8 B;  1FOS F;  4RES B;  1SFC B;  1BGY D;  4EYY Q;  1EZV E;  5APU A;  1N7S C;  1CW5 A;  4IOI H;  1RF0 A;  4GDO A;  4H44 D;  3CCU P;  1HF9 A;  2IFM A;  3L72 J;  2W27 A;  5AW9 B;  1NU1 D;  1X9V A;  1VF5 C;  1M1K Q;  1GZL A;  4I7Z B;  3BCC G;  2E5T A;  3AE1 C;  3N7N A;  1VQK P;  1ZW0 A;  2K88 A;  2Q1K A;  2YMK A;  3A0B E;  1SQV E;  3EWK A;  2OTJ P;  3D6Y A;  3TGU J;  3EQ2 A;  1RF0 C;  2Z5H A;  4U3F J;  3C8V A;  1USD A;  1HWT C;  2ZJS E;  3H1H D;  4LLH A;  1JY2 O;  4JYB A;  5DJT B;  4B86 A;  1J1E C;  4Y99 B;  3F5H A;  2WSF H;  3P8C D;  2JO1 A;  2BEQ D;  2HLO A;  1MKM A;  1QGK B;  2GUV A;  1M8O B;  3CI9 A;  3FX0 A;  5CBN A;  3F89 A;  1FDI A;  1N73 A;  3B71 A;  2Y0E A;  3CXH I;  1KYO I;  2A45 H;  2YNY A;  3SWY A;  1HBW A;  3D71 A;  2Z4E A;  3HD7 A;  5KLI C;  2WPR A;  1FZF A;  3H1K G;  2FFD B;  1N73 C;  3QH9 A;  4R4L A;  3GMA A;  1NTM D;  3AEB C;  2M8R A;  1Y8A A;  1RF1 B;  1RQV A;  1RHZ B;  1YIJ P;  2HYN A;  1PP9 J;  3HD7 C;  1H88 A;  4K35 A;  1SQB J;  3G6E P;  1Q82 Q;  3IF4 A;  1P84 I;  1JOC A;  3CCR P;  1ZR2 A;  2R5D A;  2KNC A;  1JEK A;  1KQG B;  1L4A A;  3RK3 E;  1JB0 J;  3U1C A;  4H13 C;  1CI6 B;  1BGY E;  2KP8 A;  2FYN B;  1XTC C;  4JYC A;  1QEX A;  3KZI E;  3H1I J;  2E75 D;  1NU1 K;  2KZJ A;  3MP7 B;  3CME P;  1RE4 A;  5L8R J;  1SLQ A;  3KZI H;  2ZXX A;  2IYO A;  3CCQ P;  3HE5 B;  2BEZ F;  3L70 G;  1KQF B;  3M0D A;  4C7N B;  3PRJ A;  1LTJ B;  3FWN A;  2PGD A;  5C39 A;  2UWJ E;  1RE4 C;  1JY3 O;  3ZDM A;  2QE7 H;  3GHG B;  4H44 C;  1VQL P;  3VP8 A;  3G4S P;  1LGH B;  2R3S A;  4DZO A;  2A06 G;  3N4X A;  1K73 Q;  3P8C E;  1IO4 A;  3M0D C;  4NPE A;  2QA4 P;  1KMI Z;  3NFQ A;  1S5L E;  1FS0 E;  1FZE A;  3H6P A;  4IFD K;  2OYO A;  3SWF A;  1S5L X;  3KXD A;  1NTK K;  4NPF X;  4PD4 D;  3A3Y B;  1S5L H;  1SVF A;  3SWK A;  2ZT9 B;  5CCG D;  5AVT B;  5AVU B;  3CL3 D;  3LW5 J;  2N1T A;  2Z5I A;  4O9B A;  1IJD B;  1NTM E;  2YIU B;  1MFT A;  1OFC X;  2FYU D;  3AEG C;  1LTG C;  2KK7 A;  4D6T D;  1HVV A;  2BAS A;  4W7Y A;  1SQP E;  1GU5 A;  2QJP C;  1XTG B;  1PGQ A;  1QLE D;  3AEC C;  2L91 A;  2HFE D;  4AQR D;  1NTZ D;  4W80 A;  1KFN A;  1KB9 I;  2XDJ A;  2OTK E;  1PGJ A;  4ZNC A;  4DJG A;  1W2B O;  2QRX A;  1EXI A;  1OMI A;  3NMD A;  3H1K J;  3I56 P;  1VQ7 P;  2FXO A;  4IL6 E;  1QX8 A;  1JM0 A;  2QEX P;  1IFM A;  3SSU A;  1AQT A;  3W67 A;  3OW2 O;  4IL6 X;  1BCC D;  1N2D C;  3EFG A;  1H0T B;  4JF7 A;  1KN7 A;  1DH3 A;  2LR2 A;  2IYP A;  4IL6 H;  3NXS A;  2L5G B;  1AQ5 A;  3RL0 B;  3M9H A;  3NTN A;  2ZXE B;  2JWA A;  1W5C E;  1JCC A;  1AVO A;  2KYV A;  5AW5 B;  2C9L Y;  2ZVO B;  5CJ4 A;  3HUS A;  3RK2 B;  1M90 Q;  2H43 A;  1T2K D;  3B8E B;  2E75 C;  3CWB D;  4WY4 D;  1VQM P;  4PV1 B;  3CX5 D;  3RL0 g;  3A0H E;  2DW3 A;  3BCC E;  1ZOY C;  3I55 P;  2BCC G;  2HPC A;  3S1K A;  1FE6 A;  3WUT A;  3MTU E;  1LT9 A;  1L0L K;  3HUS C;  3A0H H;  1NU1 G;  3L75 G;  2Q9I A;  4UB6 E;  2WT7 B;  2Q6Q A;  3CCM P;  1EZV D;  2XZR A;  4PD4 E;  4C7R A;  2NZ2 A;  2K3R A;  4HB1 A;  3L70 J;  1AV1 A;  1USE A;  4EOT A;  2P67 A;  3HTK B;  1CZQ A;  3AEE C;  1PGP A;  2JDI H;  1LT9 C;  1HGV A;  2QM7 A;  2E74 C;  2YO2 A;  5AW6 B;  1JUN A;  3FWL A;  2O1J A;  2CK3 H;  3H1H G;  1SS1 A;  5M1B A;  1ZP0 C;  3H32 B;  3CC2 P;  2Q5U A;  1OVU A;  3LIE A;  3AE3 C;  1BSN A;  2FYU K;  3PP5 A;  3AE2 C;  5AW1 B;  3KHU A;  2H88 C;  4D6T E;  3V2R A;  3G71 P;  2O01 H;  1MUU A;  5CCG C;  4DCK A;  1H89 A;  3L35 A;  2WTY A;  2B87 B;  1NTZ K;  4U7J A;  2I1K A;  1NTK G;  1U57 A;  2IX7 C;  3TNU B;  2POH A;  3L71 G;  3BVH A;  1FZC A;  3AE7 C;  1QVG O;  1YI2 P;  3CC7 P;  4GOD A;  1DD4 A;  4GIF A;  3IFM A;  5BVZ A;  2HOD B;  4UB8 E;  3CPW O;  2WZ7 A;  5APQ A;  1M1J A;  3M91 A;  3SFD C;  3O6Q A;  1FC2 C;  1DX7 A;  4IFF A;  2WIT A;  2P58 A;  1FZC C;  2WSE H;  1GTW A;  2YKQ A;  3II6 A;  1VDF A;  2CPS A;  2YXQ B;  4OGQ C;  3R4Y A;  4JQ0 D;  1SQX D;  1EDI A;  2D2C B;  1OIP A;  1M1J C;  1H8A A;  1IFP A;  1BE3 G;  2E76 B;  3CWB E;  3CX5 E;  1L0N D;  1VQP P;  1IK7 A;  2KI7 B;  4WY4 A;  2AEF A;  3B5N D;  4L76 A;  2Y9Z A;  1M56 D;  2M3B A;  3RK3 D;  3Q5R A;  5EFW B;  1SQQ K;  3CX5 H;  3FXD A;  3V2Q A;  3BAT A;  2OYI A;  3L72 D;  1X0T A;  2NRG A;  1GL2 D;  3S9O A;  2QJY C;  1T2K C;  3T97 B;  4WY4 C;  3TYY A;  1VQ5 P;  4WVZ A;  2N9B A;  4NPD A;  1JNM A;  3GG2 A;  2WPQ A;  2OYI C;  3TGU D;  3K5B A;  1N7S B;  1SQV K;  4U3F D;  5AVS B;  3P8M C;  3LID A;  2BCC J;  3VMY A;  1OW6 A;  2IBZ D;  5APX A;  1VF5 B;  3VOP A;  1K8A Q;  2QIW A;  1NU1 J;  3L75 J;  2ZT9 D;  3IN6 A;  1L0L G;  3H1J E;  1PGO A;  4OVN F;  3E7K A;  1PPJ E;  2WSC H;  1Q86 Q;  3HE4 A;  1SP4 A;  3MD0 A;  1JY3 N;  2NPS D;  3GLM A;  3W68 A;  5KLV E;  2KLU A;  1J1E B;  1ZLL A;  3H1H J;  3OAK A;  1KC8 Q;  1LWU A;  1AA0 A;  4GOF A;  1JTH A;  3ITK A;  1VQ6 P;  2H7H A;  1URQ D;  2OTL P;  3B4S A;  1OW8 A;  4PJ0 H;  4AYC A;  1QL1 A;  2FYU G;  4OWF A;  1X22 A;  1SQX E;  2KS1 A;  1Q2N A;  2JWD A;  1PP9 D;  5AVY B;  1LWU C;  4XE5 B;  1NTK J;  2LXB A;  1IFJ A;  3L71 J;  5KLI B;  5CBO A;  1NTZ G;  1GMJ A;  2IPP A;  1X8Y A;  3RBZ A;  2KIK A;  5B66 E;  2YO3 A;  2GM4 A;  1N73 B;  1A02 F;  1L0N E;  1SQP D;  5AVZ B;  2V7Q J;  3JC2 2;  3KQG A;  1FJP A;  1NGM B;  1EDL A;  2QG4 A;  5B66 H;  1LP1 A;  2YXR B;  3L73 G;  4PD4 I;  3HD7 B;  5CCH A;  3H1I D;  1EC5 A;  4RJT A;  3B5N A;  2FYN C;  3L72 E;  5KJ7 D;  3RK2 D;  4YPC A;  4JBZ A;  3TK1 A;  1S72 P;  2M5A A;  2Y9Y A;  3R2P A;  4KJM A;  1GL2 A;  1BE3 J;  4H13 B;  3RBX A;  3L74 G;  5CCH C;  3B5N C;  3TGU E;  1W2E A;  2W8Z A;  2IZ1 A;  3RK3 C;  2KNC B;  4U3F E;  4EDF A;  1EDK A;  2KZI A;  5KTB A;  2K9Y A;  2IBZ E;  3EFF K;  1KIL D;  1L4A B;  3WMM 0;  4N6J A;  4BRY A;  3D6Z A;  2FXM A;  1GL2 C;  3A2A A;  2WVR A;  1VPC A;  1SQQ G;  1OX3 A;  1E5W A;  3BCC D;  1EZV G;  5TIS E;  2G8Y A;  3VMX A;  2RN0 A;  4ASV A;  1U7J A;  3HRN A;  1D7M A;  5AVV B;  3V2P A;  4H44 B;  2WPS A;  4HJG H;  3OA7 A;  3G3Z A;  5TIS H;  1WMK A;  2NPS A;  2ZT9 C;  1SQV G;  2W83 C;  2FYZ A;  2AEM A;  3TDK A;  4AUW A;  2VRS A;  1L0L J;  1Q7Y Q;  3H1L G;  1PP9 E;  1URQ A;  4BXL A;  2NPS C;  4RKU J;  1SQB E;  4H0L D;  1NTM K;  3V4W A;  3CX5 I;  1OZH A;  2KLV A;  1UIX A;  3PH0 A;  2W6J H;  4I6M C;  1YIT P;  3TSI A;  2A45 G;  1SQP K;  1ZN5 A;  1FDO A;  3D70 A;  2KSE A;  1URQ C;  1LTI C;  3H1K D;  1EZV I;  1S1C X;  2Q3E A;  1OVV A;  3KYQ A;  3AEA C;  1GW4 A;  3H1I E;  2N1T B;  1G2C A;  2QJP B;  2FYU J;  3I5C A;  5CHX A;  1Y9B A;  1R5S A;  1PZQ A;  5AVR B;  1YTZ T;  1JY3 P;  5CMZ A;  5KJ7 A;  3WUV A;  5AVX B;  4YTP C;  1NTZ J;  2IFN A;  3SFE C;  1MFZ A;  4DOJ A;  2O1K A;  3S4R A;  1NYH A;  2B89 A;  1KV4 A;  1RY3 A;  2I1J A;  2RKL A;  1LTB C;  4YXD C;  1SFC D;  1BDC A;  1MV8 A;  3C9I A;  2J5U A;  1KIL E;  3MHV A;  2PAJ A;  3L73 J;  5KJ7 C;  1N8R Q;  2B9B A;  1KIL A;  1VQ9 P;  2C0X A;  4ZKU A;  3A7O A;  2QJK C;  2A45 I;  1NWQ A;  1BGY G;  1K05 A;  1T6A A;  1J1D C;  1KYO H;  2WWW A;  2MJZ A;  1N7S D;  3A5T A;  1NO4 A;  4QMA A;  3CCV P;  3L70 D;  1DEE G;  2E75 B;  3L74 J;  1MZ9 A;  1PV3 A;  1KIL C;  1NJI Q;  3AEF C;  2WMM A;  2OYH A;  1L0L E;  2K9J A;  3GW6 A;  1YQ4 C;  1S4X A;  3U1A A;  1UII A;  1HUC A;  2A06 D;  3KDP B;  4I2L C;  5CCG A;  3LW5 H;  1SQQ J;  2PFX A;  3CC4 P;  2B87 A;  2C9N Y;  2O3J A;  1A02 J;  1JMM A;  2ZAE B;  2HPC B;  2OYH C;  2GA1 A;  1FOS E;  1E79 H;  1LT9 B;  5KKZ B;  3MUD A;  2E74 B;  1U7M A;  2OGU A;  3CCE P;  3H1J D;  3L37 A;  1NH4 A;  1OW7 A;  1PPJ D;  3H1K E;  1SQV J;  3V2N A;  2WSS H;  3CCS P;  1T8Z A;  1TU3 F;  3MUD C;  4L73 A;  4H0L C;  2E5Y A;  4XFJ A;  1FZA A;  3CMA P;  2WSF J;  1JY2 N;  1S3J A;  5KLV D;  4K3A A;  1WT6 A;  2QM8 A;  3H1L J;  5APS A;  3MIW A;  4N3Y B;  1NTM G;  1YHQ P;  1J2J B;  2IBZ I;  2QVA A;  3M9Q A;  4R4M A;  1YQ3 C;  1M7L A;  1BSH A;  1SQP G;  4KT0 J;  3GF3 A;  4IFM A;  2HG5 D;  3USS A;  1FZC B;  1AVY A;  1SFC A;  3P32 A;  4DT0 A;  4OGQ B;  3U59 A;  3QWO C;  4ZMD A;  2ZFC A;  1S9K E;  1M1J B;  2KXP B;  2XU6 A;  1YTZ I;  1QVF O;  3O6Q B;  1LNQ A;  2J58 A;  1NHL A;  2LKM A;  2JJL A;  3L70 E;  1N86 A;  1FZB A;  1EQ7 A;  1SFC C;  4I1L A;  1L4A D;  2AEJ A;  4LGD E;  2JKV A;  3VMA A;  2PP6 A;  4W7Z A;  4Z1M H;  2Y0C A;  1R5L A;  2JR8 A;  5APV A;  3PLN A;  1GU4 A;  4I7Z C; 
#chains in the Genus database with same CATH homology
 1GD2 E;  1LTG C;  5CCH A;  3B5N A;  4GT1 A;  1HVV A;  2BAS A;  4W7Y A;  4ZKP A;  1GU5 A;  4HYT B;  3CLQ A;  1XTG B;  5APW A;  5KJ7 D;  2HOD A;  3RK2 D;  4HH2 A;  2HFE D;  3TK1 A;  4AQR D;  1CSB A;  4W80 A;  1KFN A;  2OAR A;  2XDJ A;  3P7K A;  4WY4 B;  2OYH B;  3R2P A;  5AW0 B;  4XA4 A;  1GL2 A;  1HGZ A;  1LTT C;  3E1I A;  3NMD A;  2OYI B;  2R32 A;  5CCH C;  1WRG A;  2YMY A;  3B5N C;  2P1J A;  1DEB A;  1W2E A;  3RK3 C;  1ZV8 A;  5AW2 B;  1IFM A;  5APY A;  4Y99 C;  5KTB A;  2GUS A;  5AVQ B;  3MGN A;  1N2D C;  3O8Z A;  1KIL D;  1L4A B;  3WMM 0;  3EFG A;  4JF7 A;  4N6J A;  1DH3 A;  3VTP C;  2FXM A;  2P2U A;  1GL2 C;  3A2A A;  3NXS A;  1VPC A;  2L5G B;  1GK4 A;  2FFD A;  4GKG A;  1AQ5 A;  3RL0 B;  3M9H A;  3NTN A;  2ZXE B;  5KLV K;  4WB4 A;  1JCC A;  1E5W A;  2KYV A;  1KFM A;  3HD7 D;  5AW5 B;  5APT A;  1FU1 A;  2C9L Y;  1RF1 A;  5CJ4 A;  3L36 A;  3VP9 A;  3HUS A;  5AW8 B;  3VMX A;  1GK6 A;  3RK2 B;  3M06 A;  2H43 A;  1T2K D;  4EIJ A;  1OXZ A;  3HRN A;  3B8E B;  5AVV B;  3V2P A;  2YKP A;  4WY4 D;  2WPS A;  2FFD C;  5AW7 B;  3OA7 A;  3G3Z A;  1IC2 A;  1SQX K;  2XNX A;  2NPS A;  3T97 A;  2N1T D;  1NKN A;  1FAV A;  1YYC A;  1JO5 A;  2HPC A;  1RF1 C;  2CPB A;  2KSJ A;  1OWA A;  3MTU E;  2FYZ A;  3HUS C;  1LT9 A;  1L0L K;  3HE4 B;  1CI6 A;  4AUW A;  2E43 A;  1IFI A;  2Q9I A;  3M0A A;  2VRS A;  2JEE A;  1G1I A;  1G1J A;  5AW4 B;  2WT7 B;  1FJK A;  1N7S A;  2XZR A;  3L4F A;  2XV5 A;  1L0N K;  4C7R A;  2XKM A;  1URQ A;  4EOT A;  1LWU B;  5CCH D;  2NPS C;  2P67 A;  3HTK B;  1JTH B;  1CZQ A;  1NTM K;  3RL0 D;  1HH0 A;  3V4W A;  2E42 A;  3M9B A;  2KLV A;  4OH8 B;  1FOS F;  1LT9 C;  1KQL A;  4I6M C;  4WBA A;  1HGV A;  4RES B;  3VMZ A;  1SFC B;  2QM7 A;  3TSI A;  1LTA C;  2YO2 A;  5AW6 B;  2A45 G;  1SQP K;  1JUN A;  3HE5 A;  1ZN5 A;  5APU A;  2O1J A;  1N7S C;  1RE3 A;  1CW5 A;  1URQ C;  1LTI C;  1RF0 A;  3H32 B;  2IFM A;  5AW9 B;  2W27 A;  2Q5U A;  4C7N A;  3LIE A;  1X9V A;  1LTJ A;  1GZL A;  2FYU K;  3PP5 A;  3KYQ A;  5AW1 B;  1GW4 A;  1JY2 P;  3IR9 A;  3GHG A;  3N7N A;  1NOH A;  2N1T B;  3V2R A;  2O01 H;  3UIA A;  1MUU A;  1G2C A;  5CCG C;  5AW3 B;  1H89 A;  1PFI A;  2KOG A;  3L35 A;  3I5C A;  2WTY A;  1NTZ K;  5CHX A;  1RE3 C;  2I1K A;  5AVR B;  1YTZ T;  1JY3 P;  1RF0 C;  2IX7 C;  3EQ2 A;  3TNU B;  2POH A;  1L4A C;  4N78 D;  3V4Q A;  2Z5H A;  5CMZ A;  5KJ7 A;  5AVX B;  1LTJ C;  3BVH A;  1GDT A;  1FZC A;  2IFN A;  4C46 A;  1MFZ A;  4DOJ A;  1HWT C;  3GHG C;  2O1K A;  3B5N B;  4LLH A;  1JY2 O;  2C0W A;  4GIF A;  5AVW B;  3IFM A;  4JYB A;  3RK3 B;  5BVZ A;  2HOD B;  4B86 A;  1J1E C;  1RY3 A;  2I1J A;  4Y99 B;  1LTB C;  2WSF H;  2WZ7 A;  1SFC D;  3P8C D;  1M1J A;  1MV8 A;  3C9I A;  5APQ A;  2HLO A;  3M91 A;  2GUV A;  1DX7 A;  4IFF A;  2WIT A;  2PAJ A;  3CI9 A;  5KJ7 C;  1GL2 B;  1FZC C;  1Z56 A;  2WSE H;  3BAS A;  1GTW A;  2YKQ A;  3II6 A;  1VDF A;  2CPS A;  2W6A A;  2P7J A;  1N73 A;  1KIL A;  3VYI A;  1T3U A;  2C0X A;  4ZKU A;  1T3J A;  3A7O A;  1IFD A;  2A45 I;  1AFO A;  1NWQ A;  2A45 H;  1J1D C;  2YNY A;  1IK9 A;  1M1J C;  3SWY A;  2WWW A;  1HBW A;  2MJZ A;  1H8A A;  1N7S D;  3A5T A;  2Z4E A;  1NO4 A;  2H8P D;  3HD7 A;  2WPR A;  1ZR4 A;  1FZF A;  2FFD B;  1MZ9 A;  1LTS C;  1N73 C;  1KIL C;  4LC1 A;  2YKO A;  1QL2 A;  4WY4 A;  3B5N D;  1SQB K;  2M8R A;  2OYH A;  1RF1 B;  5BU5 A;  1IFN A;  2M3B A;  3RK3 D;  2HYN A;  1SQQ K;  3HD7 C;  1H88 A;  3U1A A;  4KHX A;  1HUC A;  3V2Q A;  3BAT A;  2OYI A;  3KDP B;  4I2L C;  5CCG A;  3LW5 H;  1JOC A;  1HTL C;  1ZR2 A;  1FDM A;  2R5D A;  2C9N Y;  1GL2 D;  1FBM A;  2NPS B;  1T2K C;  1A02 J;  1JMM A;  1L4A A;  4WY4 C;  4M3L A;  3TYY A;  2HPC B;  2OYH C;  1JCD A;  2R3C A;  1FOS E;  1LT9 B;  3U1C A;  2N9B A;  3MUD A;  1CI6 B;  1JNM A;  5BU8 B;  2N1T C;  2WPQ A;  2W6B A;  2KP8 A;  2OYI C;  3BRV B;  1XTC C;  4JYC A;  3BRT B;  1N7S B;  1SQV K;  3VN0 A;  1NKZ B;  3L37 A;  1NH4 A;  5AVS B;  2KB7 P;  1URQ B;  3P8M C;  3LID A;  1NU1 K;  3VMY A;  3KPE A;  5APX A;  3VOP A;  1N7L A;  3V2N A;  1RE4 A;  1T8Z A;  1SLQ A;  3RL0 C;  1FZA A;  1JY2 N;  3HE5 B;  1WT6 A;  2QM8 A;  2Q3I A;  3M0D A;  2WSC H;  4N78 E;  4C7N B;  5APS A;  1LTJ B;  3MIW A;  3HE4 A;  1SP4 A;  3MD0 A;  1RE4 C;  4N3Y B;  1JY3 O;  1JY3 N;  3RK2 C;  1NAF A;  2NPS D;  3GHG B;  1FZG A;  1J2J B;  2WT7 A;  2J59 M;  3VP8 A;  1G2C B;  3M9Q A;  1HJB A;  1J1E B;  2Q7C A;  1LGH B;  1ZLL A;  3OAK A;  4DZO A;  1LWU A;  1S9K D;  3N4X A;  3HTK A;  3P8C E;  1JTH A;  1IO4 A;  3M0D C;  1M7L A;  1GW3 A;  3NFQ A;  2FKW B;  4IFM A;  1FZE A;  2HG5 D;  3H6P A;  1FZC B;  4IFD K;  2H7H A;  1URQ D;  1SFC A;  1X79 B;  3P32 A;  3SWF A;  4AYC A;  1QL1 A;  1NTK K;  3U59 A;  3A3Y B;  2ZFC A;  1SVF A;  1S9K E;  5CJ0 A;  1J1D B;  5AVY B;  1LWU C;  3H32 A;  3V5B A;  1M1J B;  4XE5 B;  5CCG D;  2XU6 A;  1YTZ I;  1IFJ A;  5AVT B;  3HUS B;  2J58 A;  1NHL A;  2IPP A;  2LKM A;  1X8Y A;  3CL3 D;  5AVU B;  2JJL A;  1N86 A;  1FZB A;  2N1T A;  1KZU B;  1EQ7 A;  1SFC C;  2R5B A;  2YO3 A;  4I1L A;  1L4A D;  2GM4 A;  1N73 B;  1KIL B;  1A02 F;  2Z5I A;  3OJA B;  4LGD E;  4O9B A;  2PP6 A;  5AVZ B;  4W7Z A;  1IJD B;  3TNU A;  3KQG A;  1FJP A;  5APV A;  1GU4 A;  3HD7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...