5KLVG

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
molecule tags Oxidoreductase
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 5klvG00
2A06G 1EZVG 2BCCG 3L70G 1KYOH 3L72G 3L71G 3CXHH 3H1HG 2FYUG 3L73G 2IBZG 1PPJG 3H1KG 1BCCG 1SQPG 3CX5H 1SQXG 1SQQG 3CWBG 3L75G 3BCCG 1NU1G 3H1JG 4D6TG 1L0NG 1SQBG 4U3FG 3TGUG 3H1IG 1BGYG 1NTMG 1L0LG 1NTZG 4PD4H 1SQVG 5KLVG 1NTKG 1PP9G 1KB9H 1BE3G 3L74G 3H1LG 1P84H
chains in the Genus database with same CATH superfamily
1SQVD 1LWUC 2WSEJ 2HLOA 4TT3H 1GU5A 3E1RA 2E42A 1URQB 2I1KA 1NH4A 3VYIA 3JC22 3MUDC 4IL6X 2HPCB 1ZMEC 5KKZB 3B4SA 2Q1KA 2FFDB 2WSCH 3L35A 1SQPG 2IX7C 4U3FE 1EXIA 1KTMA 1XTGB 4DCKA 2KSEA 3H25A 1CSBA 2ZT9C 3L73E 3P8CD 4RO0A 3RK3B 3CPWO 2KI7B 3H1KE 2I8DA 4D6TG 1RF1B 1PFIA 1IJDB 2HFED 2W6BA 1G1IA 3E1IA 3HE5B 1ZV8A 1S5LE 2A45I 1PGOA 2BCCD 5KLVE 1E79H 1FZCC 1EDKA 1VQ8P 3L74D 3L75E 1L2PA 1LTSC 1MFTA 1DD3A 3RBXA 3V2QA 5KJ7C 5GTHE 3RK3D 1NOHA 3CXHD 2R3SA 1JTHA 3SFEC 1SQPK 4HKZH 1KZUB 1VQMP 1SFCC 1T2KD 2POHA 2N1TD 3P8MC 4GOFA 1GZLA 3KXDA 1KQGB 4OGQD 3AEDC 3L71G 3OJAB 2KIKA 3V2NA 3KZIH 1YITP 3MZWB 2M3BA 3FXDA 4DJGA 1FU1A 3D6ZA 1U7MA 1L4AB 2ZYGA 2XKMA 3AE2C 1N8RQ 1OW7A 3Q5RA 2FYNB 3TSIA 3HTKB 3TF5A 1AVOA 3H1IG 1SQXE 3Q1MA 1SFCB 1FOSE 1L0LG 2RMZA 3N4XA 1LT1A 3P7KA 5APTA 3NTNA 3TDKA 3TK1A 3IFMA 2FYUK 3AECC 3C8VA 5KLVD 3MUDA 2BCCE 3CMAP 1GTWA 1LTBC 1NU1K 1KB9H 2IYPA 2LXBA 1NTMD 3FXEA 3H1HE 4WY4C 1L0LE 4H0LD 2K9JB 1L0NK 3A7OA 1SQPD 1KILC 1LNQA 2E43A 1VF5C 3I5CA 1FDOA 4H44C 2KOGA 5DJTB 1JM0A 1HJ0A 3CWBJ 4OWFA 5AVUB 1BE3E 1GL2C 3CC7P 4AUWA 1T8ZA 4XFJA 4JQ0D 2M8RA 1NTMK 2IPPA 4WB4A 1M8OB 1LGHB 2WSFJ 5AW8B 2GUVA 3U59A 3L71J 2P10A 1DEEG 3L75G 5AVYB 3H1KD 4H13B 2AXCA 1GMJA 1KFNA 3LIDA 1KYOI 2QJKB 4JYCA 5H2FE 3BVHA 3FX0A 1J1DC 1X0TA 2JO1A 2NRGA 2WPVB 2ZVNB 3GHGC 1Y47A 4BRYB 1KILE 1SLQA 2K37A 2AEMA 1KB9I 4CPGA 5GTIH 2Z5HA 1NTKG 1JEKA 1GL2D 2W6AA 3L72E 1LTIC 1W2EA 3L74G 2VRSA 1VF5D 3G9RA 3BASA 3HUSA 4GKGA 1Z56A 3GG2A 4H44D 1MKMA 1SQVE 3HD7C 2K1AA 4H0LC 2N1TB 3RL0C 1JOCA 3L72J 4Z1MH 5BVZA 3H1HD 1N73C 1IO4A 2JEEA 3CX5I 2HODB 2WQYC 1IK7A 1CI6B 3L73G 2A06D 3QH9A 4I2LC 2QA4P 2YIUC 1AJYA 1RH5B 3TGUE 4N78D 1PV3A 1QL1A 1S3JA 1NAFA 3SWYA 2A45G 5AW6B 5AVTB 3EQ2A 3H1HJ 2UWJE 3UIAA 3I56P 3L73D 1G2CB 1QEXA 3M9QA 1LT9A 3CXHI 1FC2C 1NKZB 2OGUA 3HD7B 3SWKA 3L71D 2WSFH 2OQQA 2V4HA 3B5NB 2Q9IA 1GK6A 3W67A 1RQVA 2KS1A 1OX3A 2ZT9D 3N7NA 3O8ZA 2IFNA 5H2FH 1H0TA 2Q3EA 2J59M 2L91A 3CX5E 2RH0A 3A0HH 2FFDA 1LT9B 5AVXB 3HD7D 2J5UA 1BE3G 2K9YA 3AEGC 4OVNF 4LC1A 3P32A 5AVRB 3U1AA 4L73A 2WSSH 2A06G 1AVYA 4C7NA 1L0LJ 3RBZA 5KJ7A 1XTCC 1T2KC 2W6JH 1LWUA 2KLUA 2NPSD 1FE6A 5EFWB 2OYHB 2M0BA 3AE5C 1YHQP 1NWQA 2Q7CA 2W27A 4GOEA 2C9LY 1R5LA 3CCRP 2Y0CA 4H13C 1L0NE 2ZAEB 1N7SD 2KLVA 1KQLA 1SQXG 2E74D 1SP4A 1FZBA 1RF0A 2FYUD 4ZKPA 5KLVK 5TISH 1KYOD 5KAIH 2YKQA 3GHGB 1FZAA 3MIWA 1LTJC 3CCUP 2XDJA 3CCVP 2E5TA 3R2PA 2KNCA 3RGUA 3S1KA 1JMBA 4ZMDA 5B66H 1GU4A 3SSUA 5AW3B 3MP7B 2H43A 1J2JB 2E75C 1HTLC 1YTZT 2OTLP 3H1JE 1BCCD 4WVZA 1K04A 1SQVG 2V7QH 3HUSC 2YKPA 4PV1B 5KLVJ 1H89A 2H88C 2K3RA 1PIXA 1N86A 3KDPB 3CCEP 1RHZB 2RN0A 1K8AQ 2NPSC 1QX8A 3H1LG 3JCUH 4ASVA 2KSJA 2P1JA 4UB8H 2XU6A 3L70G 4IFMA 5CCHC 1HJBA 4LGDE 1BE3J 1EZVI 2N9BA 2QE7H 3IAOA 4QMAA 3HE4A 4U3FJ 3WMM0 3CCMP 3A5TA 3D6YA 1CI6A 3CLQA 3CC2P 2HODA 1SQVK 5APUA 2BEZF 3VTPC 2P67A 5CBNA 1NJIQ 1JY3O 3FWNA 1FZFA 3R4YA 4D6TD 4AYCA 1EZVD 1LTAC 1ZP0C 3F5HA 3LIEA 3HE4B 1YJ9P 3JSVC 1X79B 4NPDA 1SQQD 1DEBA 2B88A 1LT9C 1NU1E 1GDTA 1VDFA 4K35A 2OYIC 2Q5UA 5GTHH 1L4AD 1MV8A 1RE3A 3L72D 1HF9A 1G1JA 2R32A 3B8EB 4IFDK 3RL0D 2O01N 3GMAA 2W90A 1BSHA 1S5LH 4I1LA 1VPCA 1YQ4C 2O01H 3GLMA 2KP8A 3RK3C 1TU3F 1AQTA 2KZIA 3O6QA 3K5BA 2QEXP 1Q2NA 1NKNA 2KZJA 2W83C 2WPSA 4Y28J 3A3YB 1Q81Q 2XV5A 3V2PA 1KC8Q 3RK2D 1BGYJ 1JB0J 3V2RA 3WU2E 2KUBA 5L8RJ 4I7ZB 2BASA 1BDCA 3MTUE 4C7RA 1RF1C 2QJYC 4A7PA 3L70D 3AE6C 5AW1B 2XZRA 3I55P 3ZDMA 2ZYAA 1LTTC 2E5YA 3H1JD 1LWUB 2AEFA 1EZVE 1SQQK 2NPSB 2WVRA 3EWKA 4L76A 2WT7B 2Y9ZA 2OARA 1EXJA 1SVFA 2YXQB 1U7JA 2MKVA 1MUUA 1JY3N 1KMIZ 5B5EE 3W68A 2M3EA 5CCHD 2R5BA 3Q5SA 3A2AA 2K9JA 2FBWC 2QJKC 1N7LA 2OTKE 2QM7A 2QSIA 3ABVC 4HH2A 2O1KA 2NPSA 3AEEC 2WPQA 3MGNA 2Z5IA 3Q3DA 4W7ZA 4JBZA 4UB6H 3L37A 1KD1Q 1NGMB 1OW8A 3L75J 3H1LJ 2WITA 2ZT9B 4R4LA 3TYYA 3U1CA 1Y8AA 3QWOC 2FYZA 1GL2B 1NTMJ 2AXTH 5AVSB 3E7KA 1VQ4P 1Q86Q 1NTZD 1VF5B 2B89A 4H44B 1KQSO 1S72P 4N6JA 4U3FG 5AVWB 1NYHA 3TGUG 3CX5D 2JJLA 1BGYG 1NHLA 1SQBJ 2N1TC 3CWBE 3RK2B 1N73B 4NPFX 3G71P 4IL6E 3M0AA 2QJPC 3BCCJ 4NPEA 1NU1J 3NXSA 1JY2O 1PZQA 2YMKA 4UB6E 1PP9J 1WMKA 1L0LD 3JCUE 2WTYA 3CCQP 3H1ID 1Y9BA 3FGAD 1L0ND 3VOPA 1KYOH 3AE9C 2HG5D 3AEAC 3BCCE 3H32B 1EC5A 2Y0DA 3SFDC 2KNCB 4WWIA 1N73A 1M90Q 3GF7A 2WPRA 5K5GB 1LTJA 5AW7B 3RL0g 3CCLP 3VMYA 1H0TB 2IBZI 4EIJA 1A02J 2E76D 1VQNP 4PD4E 3EFFK 1VQOP 1Q7YQ 1FZCB 3H1JJ 2N9YB 3M0DA 1X22A 1G2CA 1ZRTD 2FKWB 1GW3A 2KB7P 2HR3A 2PFXA 1LTJB 3AEBC 2WMMA 3B71A 1PGPA 1KILD 2QG4A 3L70J 3A0HE 2E76B 2WWWA 1S4XA 2WZ7A 4RESB 4ASWA 3G6EP 1T3JA 1X9VA 3KQGA 4YTPC 1HWTC 4KT0J 4M3LA 2Z4EA 4TLFA 3CCSP 4C46A 2JWAA 1AQ5A 4GT1A 2BCCG 1NTZJ 1OW6A 2Q6QA 3WUUA 4XA4A 1NVOA 5KAFH 1KB9E 3H1KG 4D6TJ 1ZLLA 4EYYQ 2GM4A 1JO5A 3BRVB 2ZFCA 3M9BA 3AE7C 1BGYE 3CWBG 3Q5PA 3USSA 2RKLA 3RK2C 5APVA 2FYNC 1FDIA 4Y99C 2PRRA 5E79H 3GW6A 1OXZA 1WT6A 1L0NJ 5AW4B 2E74B 4GODA 4PJ0E 1T6AA 4U7JA 1RQUA 4WBAA 5APQA 1JY3P 3B5NA 1RY3A 4DT0A 3O6QB 1PGJA 4KJMA 5AVQB 2L5GB 1OZHA 3AE8C 3IN6A 1LP1B 5APYA 2O1JA 1JTHB 2GA1A 1GW4A 1NTKE 4PD4I 1SQBD 1P84I 2W8ZA 1NTZK 1OMIA 3KYQA 4IOIH 1LTGC 2P2UA 1JCCA 2ZYDA 5B66E 1USEA 2R3CA 2SPZA 2KYVA 3IR9A 3PJSK 3CL3D 3WUVA 3PRJA 1E5WA 1HVVA 2Y0EA 1P84D 1SQPJ 2IYOA 3H32A 4JPZB 1M1KQ 1PP9D 5CMZA 1FBMA 5APSA 2GUSA 1VQ6P 1HGZA 1KYOE 1OIPA 2R5DA 4PD4D 5APWA 1VQKP 2FXPA 1OFCX 2QVAA 2M5AB 1SQQE 1U57A 1J1EB 1M1JA 2D2CB 3PHLA 1L4AC 3SWFA 1KV4A 2IDBA 4MN4C 4GIFA 3CD6P 4WY4D 1MFZA 3L70E 3M06A 1FOSF 4IL6H 1KQFB 4EOTA 5CJ4A 2JP3A 1URQD 3FWLA 3VMAA 1M7LA 1HH0A 3ITKA 1LJ2A 3OAKA 1WRGA 1OVVA 3RL0B 1EQ7A 4KHXA 1ZR4A 2JDIH 1W2BO 1FJPA 2IBZG 2V7QJ 1VQLP 2YIUB 3CX5H 1NTKD 5AW9B 5CHXA 3V6IA 1S5LX 2FY8A 1FS0E 1BGYD 2O3JA 4GDOA 4PJ0H 1DD4A 2E75B 3BCCG 3H6PA 1NU1G 1OVUA 4ZKUA 1IFNA 2OYIB 3CMEP 2E74C 1BCCE 1KILB 5KAFE 3D70A 1FDMA 1PP9E 4N3YB 5BU8B 1FAVA 4H13D 5CCGC 3L74J 1ZXGA 3L74E 2IZ0A 4I7ZC 4PD4H 1HBWA 1NU1D 1JNMA 5B5EH 2OYHA 3PTZA 2E75D 2XNXA 3H1IE 3L36A 5TISE 1S9KD 3PLNA 2QJPB 1SQBK 2OTJP 2IBZD 2QJYB 3PP5A 4LLHA 1ZR2A 2G8YA 3AE3C 2I1JA 1IK9A 2CPBA 2MJZA 5KJ7D 1H8AA 2QRXA 3V4QA 3H1HG 4O9BA 3S9OA 3H1LE 1RE4A 1PPJG 1YBKA 5AW0B 3T97A 1P84E 4B86A 1K9MQ 2JKVA 1FZCA 4DZOA 2ITAA 1AV1A 2YO2A 2YKOA 3GF3A 1HUCA 3AE4C 3A0BH 1JY2N 5CJ0A 3CC4P 1HGVA 1ZOYC 1NTKK 1OVRA 1ZRTE 1FZEA 4OGQC 1NTZE 1YQ3C 1J1EC 2C0WA 2LXCB 4L74A 1NO4A 1KFMA 1PGQA 3VMXA 3WUTA 4N78E 4BRYA 1SQBG 3OW2O 1YI2P 3MD0A 3OA7A 1EDLA 3CWBD 2JR8A 2C9NY 4WY4B 3TGUJ 2Y9YA 1NTZG 4BXLA 1N7SB 5C39A 4OGQB 2D2CD 3B5ND 4PV1C 1RF1A 3C9IA 1PP9G 3VP8A 1GD2E 3H1KJ 3HE5A 3CCJP 5M1BA 2R44A 1IFMA 5CCHA 3BATA 2WSEH 1QGKB 3M0DC 5AVVB 3M91A 1D7MA 2CPSA 3M9HA 1SQPE 2LKMA 3RK3E 3CXHE 3V4WA 4C7NB 2AEJA 3D71A 1AFOA 1OWAA 4AQRD 2P58A 3L72G 3VMZA 1S9KE 1DH3A 1J1DB 3CXHH 1DX7A 1X8YA 4ZNCA 1QVGO 1EDIA 5APXA 1FJKA 1QVFO 3CI9A 2H8PD 4JF7A 1KN7A 1SQQJ 1SQQG 1SQXD 2G3AA 1CZQA 3G3ZA 1W5CE 4YXWH 2YNYA 1N7SC 1PPJE 3AE1C 3H1JG 3KZIE 4HJGH 4XE5B 1LP1A 1IZNB 3S4RA 1VQ7P 1RF0C 1IFIA 5KLIC 4RJTA 2OYIA 1R5SA 1EDJA 4W80A 2ZXXA 5TJHA 1KILA 1M56D 2AXTE 2PP6A 4UB8E 1NTKJ 1BDDA 1YIJP 1H88A 1A02F 3TNUA 1SQXK 1L4AA 1PL5A 2DW3A 3WU2H 1S1CX 4WY4A 3GHGA 4K3AA 4BWNA 5GTIE 3Q2YA 2FYUJ 2N1TA 1UIIA 1ZN5A 1N2DC 1AA0A 1P84H 1JCDA 2IBZE 3H1IJ 1URQA 5AW5B 1EZVG 4OH8B 1IFJA 5KTBA 1VQ9P 3AEFC 4I6MC 1L0LK 1URQC 2B87B 4RKUJ 3LW5H 4Y99B 1T3UA 2BCCJ 4YPCA 1KB9D 2YMYA 5KAIE 3BCCD 3VP9A 1IC2A 2A06E 1BSNA 1BCCJ 2C0XA 1BCCG 1YTZI 1USDA 2YXRB 1SQBE 2XNDH 3IF4A 4EI2A 1KORA 5CCGA 3TNUB 5CCGD 1SQXJ 1BE3D 1ZW0A 1Q90D 2ZVOB 5KKZC 2P7JA 4HYTB 4DOJA 2K88A 3P8CE 4H0LB 2HYNA 1FZGA 5AVZB 1L0NG 2OYOA 2IZ1A 2ZJSE 3PH0A 3NMDA 1NTMG 3HRNA 3L75D 4IFFA 3A0BE 4JYBA 1YYCA 4D6TE 1IFDA 1SQVJ 2JWDA 2KXPB 5KLVG 1VQ5P 2YO3A 2PGDA 2PAJA 3L4FA 1UIXA 2H7HA 1CW5A 2KK7A 3HTKA 1JUNA 3HD7A 2A45H 1MZ9A 3EFGA 2J58A 1SS1A 1RE3C 2ZXEB 2HPCA 2H89C 2WSCJ 1QLED 3LW5J 4HB1A 5E79E 2CK3H 2KS1B 1RE4C 3TGUD 1VL2A 2FYUG 5DJUB 2B9BA 1M57D 1IFPA 2O01J 2B87A 3H1LD 2IFMA 3MHVA 1M1JC 3II6A 1QL2A 2E76C 2QIWA 2LR2A 3HUSB 2FXOA 4L75A 4YXDC 1N7SA 3L71E 3BRTB 2WT7A 1R8EA 4W7YA 2FYUE 1PPJD 5CBOA 4EDFA 3B5NC 1GK4A 4PV1D 1K05A 2FFDC 1YJWP 3L73J 1SFCA 1NAYA 3VN0A 2OYHC 1SFCD 5BU5A 5KLIB 3KPEA 3F89A 5AW2B 1YJNP 3KHUA 2FXMA 2M5AA 1VQPP 2NZ2A 3NFQA 2BEQD 1S2EA 2QM8A 1JMMA 1GL2A 1M1JB 4R4MA 4U3FD 1K73Q 1DIPA 2Q3IA 3T97B 3G4SP 2D2CC 3C1LA 1NTME 1JY2P 1Q82Q 3V5BA
chains in the Genus database with same CATH topology
2A06G 1EZVG 2BCCG 3L70G 1KYOH 3L72G 3L71G 3CXHH 3H1HG 2FYUG 3L73G 2IBZG 1PPJG 3H1KG 1BCCG 1SQPG 3CX5H 1SQXG 1SQQG 3CWBG 3L75G 3BCCG 1NU1G 3H1JG 4D6TG 1L0NG 1SQBG 4U3FG 3TGUG 3H1IG 1BGYG 1NTMG 1L0LG 1NTZG 4PD4H 1SQVG 5KLVG 1NTKG 1PP9G 1KB9H 1BE3G 3L74G 3H1LG 1P84H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  1EZV G;  2BCC G;  3L70 G;  1KYO H;  3L72 G;  3L71 G;  3CXH H;  3H1H G;  2FYU G;  3L73 G;  2IBZ G;  1PPJ G;  3H1K G;  1BCC G;  1SQP G;  3CX5 H;  1SQX G;  1SQQ G;  3CWB G;  3L75 G;  3BCC G;  1NU1 G;  3H1J G;  4D6T G;  1L0N G;  1SQB G;  4U3F G;  3TGU G;  3H1I G;  1BGY G;  1NTM G;  1L0L G;  1NTZ G;  4PD4 H;  1SQV G;  5KLV G;  1NTK G;  1PP9 G;  1KB9 H;  1BE3 G;  3L74 G;  3H1L G;  1P84 H; 
#chains in the Genus database with same CATH topology
 1SQV D;  1LWU C;  2WSE J;  2HLO A;  4TT3 H;  1GU5 A;  3E1R A;  2E42 A;  1URQ B;  2I1K A;  1NH4 A;  3VYI A;  3JC2 2;  3MUD C;  4IL6 X;  2HPC B;  1ZME C;  5KKZ B;  3B4S A;  2Q1K A;  2FFD B;  2WSC H;  3L35 A;  1SQP G;  2IX7 C;  4U3F E;  1EXI A;  1KTM A;  1XTG B;  4DCK A;  2KSE A;  3H25 A;  1CSB A;  2ZT9 C;  3L73 E;  3P8C D;  4RO0 A;  3RK3 B;  3CPW O;  2KI7 B;  3H1K E;  2I8D A;  4D6T G;  1RF1 B;  1PFI A;  1IJD B;  2HFE D;  2W6B A;  1G1I A;  3E1I A;  3HE5 B;  1ZV8 A;  1S5L E;  2A45 I;  1PGO A;  2BCC D;  5KLV E;  1E79 H;  1FZC C;  1EDK A;  1VQ8 P;  3L74 D;  3L75 E;  1L2P A;  1LTS C;  1MFT A;  1DD3 A;  3RBX A;  3V2Q A;  5KJ7 C;  5GTH E;  3RK3 D;  1NOH A;  3CXH D;  2R3S A;  1JTH A;  3SFE C;  1SQP K;  4HKZ H;  1KZU B;  1VQM P;  1SFC C;  1T2K D;  2POH A;  2N1T D;  3P8M C;  4GOF A;  1GZL A;  3KXD A;  1KQG B;  4OGQ D;  3AED C;  3L71 G;  3OJA B;  2KIK A;  3V2N A;  3KZI H;  1YIT P;  3MZW B;  2M3B A;  3FXD A;  4DJG A;  1FU1 A;  3D6Z A;  1U7M A;  1L4A B;  2ZYG A;  2XKM A;  3AE2 C;  1N8R Q;  1OW7 A;  3Q5R A;  2FYN B;  3TSI A;  3HTK B;  3TF5 A;  1AVO A;  3H1I G;  1SQX E;  3Q1M A;  1SFC B;  1FOS E;  1L0L G;  2RMZ A;  3N4X A;  1LT1 A;  3P7K A;  5APT A;  3NTN A;  3TDK A;  3TK1 A;  3IFM A;  2FYU K;  3AEC C;  3C8V A;  5KLV D;  3MUD A;  2BCC E;  3CMA P;  1GTW A;  1LTB C;  1NU1 K;  1KB9 H;  2IYP A;  2LXB A;  1NTM D;  3FXE A;  3H1H E;  4WY4 C;  1L0L E;  4H0L D;  2K9J B;  1L0N K;  3A7O A;  1SQP D;  1KIL C;  1LNQ A;  2E43 A;  1VF5 C;  3I5C A;  1FDO A;  4H44 C;  2KOG A;  5DJT B;  1JM0 A;  1HJ0 A;  3CWB J;  4OWF A;  5AVU B;  1BE3 E;  1GL2 C;  3CC7 P;  4AUW A;  1T8Z A;  4XFJ A;  4JQ0 D;  2M8R A;  1NTM K;  2IPP A;  4WB4 A;  1M8O B;  1LGH B;  2WSF J;  5AW8 B;  2GUV A;  3U59 A;  3L71 J;  2P10 A;  1DEE G;  3L75 G;  5AVY B;  3H1K D;  4H13 B;  2AXC A;  1GMJ A;  1KFN A;  3LID A;  1KYO I;  2QJK B;  4JYC A;  5H2F E;  3BVH A;  3FX0 A;  1J1D C;  1X0T A;  2JO1 A;  2NRG A;  2WPV B;  2ZVN B;  3GHG C;  1Y47 A;  4BRY B;  1KIL E;  1SLQ A;  2K37 A;  2AEM A;  1KB9 I;  4CPG A;  5GTI H;  2Z5H A;  1NTK G;  1JEK A;  1GL2 D;  2W6A A;  3L72 E;  1LTI C;  1W2E A;  3L74 G;  2VRS A;  1VF5 D;  3G9R A;  3BAS A;  3HUS A;  4GKG A;  1Z56 A;  3GG2 A;  4H44 D;  1MKM A;  1SQV E;  3HD7 C;  2K1A A;  4H0L C;  2N1T B;  3RL0 C;  1JOC A;  3L72 J;  4Z1M H;  5BVZ A;  3H1H D;  1N73 C;  1IO4 A;  2JEE A;  3CX5 I;  2HOD B;  2WQY C;  1IK7 A;  1CI6 B;  3L73 G;  2A06 D;  3QH9 A;  4I2L C;  2QA4 P;  2YIU C;  1AJY A;  1RH5 B;  3TGU E;  4N78 D;  1PV3 A;  1QL1 A;  1S3J A;  1NAF A;  3SWY A;  2A45 G;  5AW6 B;  5AVT B;  3EQ2 A;  3H1H J;  2UWJ E;  3UIA A;  3I56 P;  3L73 D;  1G2C B;  1QEX A;  3M9Q A;  1LT9 A;  3CXH I;  1FC2 C;  1NKZ B;  2OGU A;  3HD7 B;  3SWK A;  3L71 D;  2WSF H;  2OQQ A;  2V4H A;  3B5N B;  2Q9I A;  1GK6 A;  3W67 A;  1RQV A;  2KS1 A;  1OX3 A;  2ZT9 D;  3N7N A;  3O8Z A;  2IFN A;  5H2F H;  1H0T A;  2Q3E A;  2J59 M;  2L91 A;  3CX5 E;  2RH0 A;  3A0H H;  2FFD A;  1LT9 B;  5AVX B;  3HD7 D;  2J5U A;  1BE3 G;  2K9Y A;  3AEG C;  4OVN F;  4LC1 A;  3P32 A;  5AVR B;  3U1A A;  4L73 A;  2WSS H;  2A06 G;  1AVY A;  4C7N A;  1L0L J;  3RBZ A;  5KJ7 A;  1XTC C;  1T2K C;  2W6J H;  1LWU A;  2KLU A;  2NPS D;  1FE6 A;  5EFW B;  2OYH B;  2M0B A;  3AE5 C;  1YHQ P;  1NWQ A;  2Q7C A;  2W27 A;  4GOE A;  2C9L Y;  1R5L A;  3CCR P;  2Y0C A;  4H13 C;  1L0N E;  2ZAE B;  1N7S D;  2KLV A;  1KQL A;  1SQX G;  2E74 D;  1SP4 A;  1FZB A;  1RF0 A;  2FYU D;  4ZKP A;  5KLV K;  5TIS H;  1KYO D;  5KAI H;  2YKQ A;  3GHG B;  1FZA A;  3MIW A;  1LTJ C;  3CCU P;  2XDJ A;  3CCV P;  2E5T A;  3R2P A;  2KNC A;  3RGU A;  3S1K A;  1JMB A;  4ZMD A;  5B66 H;  1GU4 A;  3SSU A;  5AW3 B;  3MP7 B;  2H43 A;  1J2J B;  2E75 C;  1HTL C;  1YTZ T;  2OTL P;  3H1J E;  1BCC D;  4WVZ A;  1K04 A;  1SQV G;  2V7Q H;  3HUS C;  2YKP A;  4PV1 B;  5KLV J;  1H89 A;  2H88 C;  2K3R A;  1PIX A;  1N86 A;  3KDP B;  3CCE P;  1RHZ B;  2RN0 A;  1K8A Q;  2NPS C;  1QX8 A;  3H1L G;  3JCU H;  4ASV A;  2KSJ A;  2P1J A;  4UB8 H;  2XU6 A;  3L70 G;  4IFM A;  5CCH C;  1HJB A;  4LGD E;  1BE3 J;  1EZV I;  2N9B A;  2QE7 H;  3IAO A;  4QMA A;  3HE4 A;  4U3F J;  3WMM 0;  3CCM P;  3A5T A;  3D6Y A;  1CI6 A;  3CLQ A;  3CC2 P;  2HOD A;  1SQV K;  5APU A;  2BEZ F;  3VTP C;  2P67 A;  5CBN A;  1NJI Q;  1JY3 O;  3FWN A;  1FZF A;  3R4Y A;  4D6T D;  4AYC A;  1EZV D;  1LTA C;  1ZP0 C;  3F5H A;  3LIE A;  3HE4 B;  1YJ9 P;  3JSV C;  1X79 B;  4NPD A;  1SQQ D;  1DEB A;  2B88 A;  1LT9 C;  1NU1 E;  1GDT A;  1VDF A;  4K35 A;  2OYI C;  2Q5U A;  5GTH H;  1L4A D;  1MV8 A;  1RE3 A;  3L72 D;  1HF9 A;  1G1J A;  2R32 A;  3B8E B;  4IFD K;  3RL0 D;  2O01 N;  3GMA A;  2W90 A;  1BSH A;  1S5L H;  4I1L A;  1VPC A;  1YQ4 C;  2O01 H;  3GLM A;  2KP8 A;  3RK3 C;  1TU3 F;  1AQT A;  2KZI A;  3O6Q A;  3K5B A;  2QEX P;  1Q2N A;  1NKN A;  2KZJ A;  2W83 C;  2WPS A;  4Y28 J;  3A3Y B;  1Q81 Q;  2XV5 A;  3V2P A;  1KC8 Q;  3RK2 D;  1BGY J;  1JB0 J;  3V2R A;  3WU2 E;  2KUB A;  5L8R J;  4I7Z B;  2BAS A;  1BDC A;  3MTU E;  4C7R A;  1RF1 C;  2QJY C;  4A7P A;  3L70 D;  3AE6 C;  5AW1 B;  2XZR A;  3I55 P;  3ZDM A;  2ZYA A;  1LTT C;  2E5Y A;  3H1J D;  1LWU B;  2AEF A;  1EZV E;  1SQQ K;  2NPS B;  2WVR A;  3EWK A;  4L76 A;  2WT7 B;  2Y9Z A;  2OAR A;  1EXJ A;  1SVF A;  2YXQ B;  1U7J A;  2MKV A;  1MUU A;  1JY3 N;  1KMI Z;  5B5E E;  3W68 A;  2M3E A;  5CCH D;  2R5B A;  3Q5S A;  3A2A A;  2K9J A;  2FBW C;  2QJK C;  1N7L A;  2OTK E;  2QM7 A;  2QSI A;  3ABV C;  4HH2 A;  2O1K A;  2NPS A;  3AEE C;  2WPQ A;  3MGN A;  2Z5I A;  3Q3D A;  4W7Z A;  4JBZ A;  4UB6 H;  3L37 A;  1KD1 Q;  1NGM B;  1OW8 A;  3L75 J;  3H1L J;  2WIT A;  2ZT9 B;  4R4L A;  3TYY A;  3U1C A;  1Y8A A;  3QWO C;  2FYZ A;  1GL2 B;  1NTM J;  2AXT H;  5AVS B;  3E7K A;  1VQ4 P;  1Q86 Q;  1NTZ D;  1VF5 B;  2B89 A;  4H44 B;  1KQS O;  1S72 P;  4N6J A;  4U3F G;  5AVW B;  1NYH A;  3TGU G;  3CX5 D;  2JJL A;  1BGY G;  1NHL A;  1SQB J;  2N1T C;  3CWB E;  3RK2 B;  1N73 B;  4NPF X;  3G71 P;  4IL6 E;  3M0A A;  2QJP C;  3BCC J;  4NPE A;  1NU1 J;  3NXS A;  1JY2 O;  1PZQ A;  2YMK A;  4UB6 E;  1PP9 J;  1WMK A;  1L0L D;  3JCU E;  2WTY A;  3CCQ P;  3H1I D;  1Y9B A;  3FGA D;  1L0N D;  3VOP A;  1KYO H;  3AE9 C;  2HG5 D;  3AEA C;  3BCC E;  3H32 B;  1EC5 A;  2Y0D A;  3SFD C;  2KNC B;  4WWI A;  1N73 A;  1M90 Q;  3GF7 A;  2WPR A;  5K5G B;  1LTJ A;  5AW7 B;  3RL0 g;  3CCL P;  3VMY A;  1H0T B;  2IBZ I;  4EIJ A;  1A02 J;  2E76 D;  1VQN P;  4PD4 E;  3EFF K;  1VQO P;  1Q7Y Q;  1FZC B;  3H1J J;  2N9Y B;  3M0D A;  1X22 A;  1G2C A;  1ZRT D;  2FKW B;  1GW3 A;  2KB7 P;  2HR3 A;  2PFX A;  1LTJ B;  3AEB C;  2WMM A;  3B71 A;  1PGP A;  1KIL D;  2QG4 A;  3L70 J;  3A0H E;  2E76 B;  2WWW A;  1S4X A;  2WZ7 A;  4RES B;  4ASW A;  3G6E P;  1T3J A;  1X9V A;  3KQG A;  4YTP C;  1HWT C;  4KT0 J;  4M3L A;  2Z4E A;  4TLF A;  3CCS P;  4C46 A;  2JWA A;  1AQ5 A;  4GT1 A;  2BCC G;  1NTZ J;  1OW6 A;  2Q6Q A;  3WUU A;  4XA4 A;  1NVO A;  5KAF H;  1KB9 E;  3H1K G;  4D6T J;  1ZLL A;  4EYY Q;  2GM4 A;  1JO5 A;  3BRV B;  2ZFC A;  3M9B A;  3AE7 C;  1BGY E;  3CWB G;  3Q5P A;  3USS A;  2RKL A;  3RK2 C;  5APV A;  2FYN C;  1FDI A;  4Y99 C;  2PRR A;  5E79 H;  3GW6 A;  1OXZ A;  1WT6 A;  1L0N J;  5AW4 B;  2E74 B;  4GOD A;  4PJ0 E;  1T6A A;  4U7J A;  1RQU A;  4WBA A;  5APQ A;  1JY3 P;  3B5N A;  1RY3 A;  4DT0 A;  3O6Q B;  1PGJ A;  4KJM A;  5AVQ B;  2L5G B;  1OZH A;  3AE8 C;  3IN6 A;  1LP1 B;  5APY A;  2O1J A;  1JTH B;  2GA1 A;  1GW4 A;  1NTK E;  4PD4 I;  1SQB D;  1P84 I;  2W8Z A;  1NTZ K;  1OMI A;  3KYQ A;  4IOI H;  1LTG C;  2P2U A;  1JCC A;  2ZYD A;  5B66 E;  1USE A;  2R3C A;  2SPZ A;  2KYV A;  3IR9 A;  3PJS K;  3CL3 D;  3WUV A;  3PRJ A;  1E5W A;  1HVV A;  2Y0E A;  1P84 D;  1SQP J;  2IYO A;  3H32 A;  4JPZ B;  1M1K Q;  1PP9 D;  5CMZ A;  1FBM A;  5APS A;  2GUS A;  1VQ6 P;  1HGZ A;  1KYO E;  1OIP A;  2R5D A;  4PD4 D;  5APW A;  1VQK P;  2FXP A;  1OFC X;  2QVA A;  2M5A B;  1SQQ E;  1U57 A;  1J1E B;  1M1J A;  2D2C B;  3PHL A;  1L4A C;  3SWF A;  1KV4 A;  2IDB A;  4MN4 C;  4GIF A;  3CD6 P;  4WY4 D;  1MFZ A;  3L70 E;  3M06 A;  1FOS F;  4IL6 H;  1KQF B;  4EOT A;  5CJ4 A;  2JP3 A;  1URQ D;  3FWL A;  3VMA A;  1M7L A;  1HH0 A;  3ITK A;  1LJ2 A;  3OAK A;  1WRG A;  1OVV A;  3RL0 B;  1EQ7 A;  4KHX A;  1ZR4 A;  2JDI H;  1W2B O;  1FJP A;  2IBZ G;  2V7Q J;  1VQL P;  2YIU B;  3CX5 H;  1NTK D;  5AW9 B;  5CHX A;  3V6I A;  1S5L X;  2FY8 A;  1FS0 E;  1BGY D;  2O3J A;  4GDO A;  4PJ0 H;  1DD4 A;  2E75 B;  3BCC G;  3H6P A;  1NU1 G;  1OVU A;  4ZKU A;  1IFN A;  2OYI B;  3CME P;  2E74 C;  1BCC E;  1KIL B;  5KAF E;  3D70 A;  1FDM A;  1PP9 E;  4N3Y B;  5BU8 B;  1FAV A;  4H13 D;  5CCG C;  3L74 J;  1ZXG A;  3L74 E;  2IZ0 A;  4I7Z C;  4PD4 H;  1HBW A;  1NU1 D;  1JNM A;  5B5E H;  2OYH A;  3PTZ A;  2E75 D;  2XNX A;  3H1I E;  3L36 A;  5TIS E;  1S9K D;  3PLN A;  2QJP B;  1SQB K;  2OTJ P;  2IBZ D;  2QJY B;  3PP5 A;  4LLH A;  1ZR2 A;  2G8Y A;  3AE3 C;  2I1J A;  1IK9 A;  2CPB A;  2MJZ A;  5KJ7 D;  1H8A A;  2QRX A;  3V4Q A;  3H1H G;  4O9B A;  3S9O A;  3H1L E;  1RE4 A;  1PPJ G;  1YBK A;  5AW0 B;  3T97 A;  1P84 E;  4B86 A;  1K9M Q;  2JKV A;  1FZC A;  4DZO A;  2ITA A;  1AV1 A;  2YO2 A;  2YKO A;  3GF3 A;  1HUC A;  3AE4 C;  3A0B H;  1JY2 N;  5CJ0 A;  3CC4 P;  1HGV A;  1ZOY C;  1NTK K;  1OVR A;  1ZRT E;  1FZE A;  4OGQ C;  1NTZ E;  1YQ3 C;  1J1E C;  2C0W A;  2LXC B;  4L74 A;  1NO4 A;  1KFM A;  1PGQ A;  3VMX A;  3WUT A;  4N78 E;  4BRY A;  1SQB G;  3OW2 O;  1YI2 P;  3MD0 A;  3OA7 A;  1EDL A;  3CWB D;  2JR8 A;  2C9N Y;  4WY4 B;  3TGU J;  2Y9Y A;  1NTZ G;  4BXL A;  1N7S B;  5C39 A;  4OGQ B;  2D2C D;  3B5N D;  4PV1 C;  1RF1 A;  3C9I A;  1PP9 G;  3VP8 A;  1GD2 E;  3H1K J;  3HE5 A;  3CCJ P;  5M1B A;  2R44 A;  1IFM A;  5CCH A;  3BAT A;  2WSE H;  1QGK B;  3M0D C;  5AVV B;  3M91 A;  1D7M A;  2CPS A;  3M9H A;  1SQP E;  2LKM A;  3RK3 E;  3CXH E;  3V4W A;  4C7N B;  2AEJ A;  3D71 A;  1AFO A;  1OWA A;  4AQR D;  2P58 A;  3L72 G;  3VMZ A;  1S9K E;  1DH3 A;  1J1D B;  3CXH H;  1DX7 A;  1X8Y A;  4ZNC A;  1QVG O;  1EDI A;  5APX A;  1FJK A;  1QVF O;  3CI9 A;  2H8P D;  4JF7 A;  1KN7 A;  1SQQ J;  1SQQ G;  1SQX D;  2G3A A;  1CZQ A;  3G3Z A;  1W5C E;  4YXW H;  2YNY A;  1N7S C;  1PPJ E;  3AE1 C;  3H1J G;  3KZI E;  4HJG H;  4XE5 B;  1LP1 A;  1IZN B;  3S4R A;  1VQ7 P;  1RF0 C;  1IFI A;  5KLI C;  4RJT A;  2OYI A;  1R5S A;  1EDJ A;  4W80 A;  2ZXX A;  5TJH A;  1KIL A;  1M56 D;  2AXT E;  2PP6 A;  4UB8 E;  1NTK J;  1BDD A;  1YIJ P;  1H88 A;  1A02 F;  3TNU A;  1SQX K;  1L4A A;  1PL5 A;  2DW3 A;  3WU2 H;  1S1C X;  4WY4 A;  3GHG A;  4K3A A;  4BWN A;  5GTI E;  3Q2Y A;  2FYU J;  2N1T A;  1UII A;  1ZN5 A;  1N2D C;  1AA0 A;  1P84 H;  1JCD A;  2IBZ E;  3H1I J;  1URQ A;  5AW5 B;  1EZV G;  4OH8 B;  1IFJ A;  5KTB A;  1VQ9 P;  3AEF C;  4I6M C;  1L0L K;  1URQ C;  2B87 B;  4RKU J;  3LW5 H;  4Y99 B;  1T3U A;  2BCC J;  4YPC A;  1KB9 D;  2YMY A;  5KAI E;  3BCC D;  3VP9 A;  1IC2 A;  2A06 E;  1BSN A;  1BCC J;  2C0X A;  1BCC G;  1YTZ I;  1USD A;  2YXR B;  1SQB E;  2XND H;  3IF4 A;  4EI2 A;  1KOR A;  5CCG A;  3TNU B;  5CCG D;  1SQX J;  1BE3 D;  1ZW0 A;  1Q90 D;  2ZVO B;  5KKZ C;  2P7J A;  4HYT B;  4DOJ A;  2K88 A;  3P8C E;  4H0L B;  2HYN A;  1FZG A;  5AVZ B;  1L0N G;  2OYO A;  2IZ1 A;  2ZJS E;  3PH0 A;  3NMD A;  1NTM G;  3HRN A;  3L75 D;  4IFF A;  3A0B E;  4JYB A;  1YYC A;  4D6T E;  1IFD A;  1SQV J;  2JWD A;  2KXP B;  5KLV G;  1VQ5 P;  2YO3 A;  2PGD A;  2PAJ A;  3L4F A;  1UIX A;  2H7H A;  1CW5 A;  2KK7 A;  3HTK A;  1JUN A;  3HD7 A;  2A45 H;  1MZ9 A;  3EFG A;  2J58 A;  1SS1 A;  1RE3 C;  2ZXE B;  2HPC A;  2H89 C;  2WSC J;  1QLE D;  3LW5 J;  4HB1 A;  5E79 E;  2CK3 H;  2KS1 B;  1RE4 C;  3TGU D;  1VL2 A;  2FYU G;  5DJU B;  2B9B A;  1M57 D;  1IFP A;  2O01 J;  2B87 A;  3H1L D;  2IFM A;  3MHV A;  1M1J C;  3II6 A;  1QL2 A;  2E76 C;  2QIW A;  2LR2 A;  3HUS B;  2FXO A;  4L75 A;  4YXD C;  1N7S A;  3L71 E;  3BRT B;  2WT7 A;  1R8E A;  4W7Y A;  2FYU E;  1PPJ D;  5CBO A;  4EDF A;  3B5N C;  1GK4 A;  4PV1 D;  1K05 A;  2FFD C;  1YJW P;  3L73 J;  1SFC A;  1NAY A;  3VN0 A;  2OYH C;  1SFC D;  5BU5 A;  5KLI B;  3KPE A;  3F89 A;  5AW2 B;  1YJN P;  3KHU A;  2FXM A;  2M5A A;  1VQP P;  2NZ2 A;  3NFQ A;  2BEQ D;  1S2E A;  2QM8 A;  1JMM A;  1GL2 A;  1M1J B;  4R4M A;  4U3F D;  1K73 Q;  1DIP A;  2Q3I A;  3T97 B;  3G4S P;  2D2C C;  3C1L A;  1NTM E;  1JY2 P;  1Q82 Q;  3V5B A; 
#chains in the Genus database with same CATH homology
 2A06 G;  1EZV G;  2BCC G;  3L70 G;  1KYO H;  3L72 G;  3L71 G;  3CXH H;  3H1H G;  2FYU G;  3L73 G;  2IBZ G;  1PPJ G;  3H1K G;  1BCC G;  1SQP G;  3CX5 H;  1SQX G;  1SQQ G;  3CWB G;  3L75 G;  3BCC G;  1NU1 G;  3H1J G;  4D6T G;  1L0N G;  1SQB G;  4U3F G;  3TGU G;  3H1I G;  1BGY G;  1NTM G;  1L0L G;  1NTZ G;  4PD4 H;  1SQV G;  5KLV G;  1NTK G;  1PP9 G;  1KB9 H;  1BE3 G;  3L74 G;  3H1L G;  1P84 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...