5KLVG

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 5klvG00
3L72G 1KYOH 1SQQG 1L0NG 3L75G 1BCCG 4U3FG 1BE3G 3CWBG 1KB9H 3TGUG 1NU1G 1P84H 2IBZG 3CX5H 2BCCG 3L74G 4PD4H 2A06G 3H1KG 3H1LG 3H1IG 1SQPG 2FYUG 3H1JG 1SQVG 1PPJG 3H1HG 3L70G 3L71G 3L73G 1EZVG 1L0LG 1BGYG 1SQBG 1PP9G 3CXHH 5KLVG 1NTZG 3BCCG 1NTMG 1NTKG 4D6TG 1SQXG
chains in the Genus database with same CATH superfamily
2LKMA 3II6A 1D7MA 3H1JJ 1EZVI 5AW6B 4H0LD 3AE3C 1OVRA 3H1ID 2HPCB 1RF0C 1G2CA 2HPCA 1L0NJ 3NMDA 3H1HG 1GW4A 1GD2E 2N1TB 2PP6A 2N1TA 1FDMA 3IFMA 4UB8E 2WSEH 3EWKA 4RESB 1GK4A 3H1KG 5APSA 2NZ2A 3IAOA 1EXIA 2LXCB 4D6TE 2KS1B 2KS1A 2G8YA 1NVOA 3WU2E 3CC2P 4PV1D 2L91A 1J2JB 5GTIE 2FYUJ 1NOHA 4DZOA 1S9KE 1J1EB 2V7QJ 3MHVA 4OWFA 4PJ0E 3H1LD 1SQPD 3H1IG 1W2BO 1QVGO 4H44D 4UB6E 1XTGB 2N9YB 1SQQD 2D2CB 1HVVA 1P84D 3CL3D 2IYPA 1AQTA 1KORA 1SFCA 3AE4C 3V5BA 1FDIA 3K5BA 1NTKD 2W6BA 4DT0A 3L36A 2OYOA 4JQ0D 3L74D 2WT7B 3V4QA 2WT7A 2A45I 2FKWB 2QM7A 4LLHA 1JUNA 1ZR4A 3NFQA 4JPZB 1VQ8P 1RF0A 2OTJP 2R44A 1DIPA 2XNDH 3VTPC 2ZYAA 1SQQG 2QJKB 1ZP0C 1J1DC 1PGPA 3I56P 1P84H 4HYTB 2Q3EA 1NAFA 2FFDC 5AW2B 2FYNB 1NTKG 2PFXA 2KP8A 5EFWB 1JY3N 1N8RQ 1YI2P 1FC2C 2KI7B 2PAJA 3HE5A 5CCGC 2JO1A 3R4YA 4ASWA 1KD1Q 1PP9D 3O8ZA 1X9VA 1H0TA 3L75G 2OQQA 1HJBA 1ZN5A 2AXCA 5CMZA 1VPCA 2OGUA 1KILE 1JTHA 3BRVB 4YPCA 4IFDK 1MZ9A 1YBKA 1VQ7P 1OXZA 2M5AB 2M5AA 2ZFCA 3L37A 1HJ0A 4PD4D 2Q6QA 1L0LE 1K73Q 2QVAA 4D6TJ 4DOJA 1L4AC 1YYCA 3RL0D 2P58A 1LTGC 1SQBK 1M56D 1IZNB 1PP9G 2KXPB 3O6QB 3AE6C 4IL6X 5KJ7D 1S4XA 4MN4C 4H0LC 1SQBJ 3RK2D 1J1DB 4AQRD 1JY2P 1R5LA 4XFJA 4GODA 4ZNCA 2J5UA 1KTMA 3TYYA 1LT1A 2FFDA 2P67A 4W7ZA 3IN6A 2C9LY 4PD4H 3P8MC 2JWAA 5APYA 3BCCE 1Y9BA 2BEQD 1WMKA 5CCGA 1S5LH 2OTKE 2PGDA 1CSBA 2OYHC 4PV1C 1R8EA 2KOGA 1NJIQ 2A45G 2A45H 4KT0J 1VQ6P 3MP7B 3F89A 2WSFJ 3L70D 3EFGA 4H44C 3G9RA 3AEDC 2IYOA 2FYZA 2WPQA 4GT1A 2WQYC 5APVA 1NO4A 4GOFA 2FXOA 2JEEA 3B8EB 2KIKA 3SSUA 2RN0A 1L4AB 1L4AA 1IK9A 5KAFE 1YJNP 1OWAA 4RO0A 4JYCA 3L73J 1A02F 1IO4A 2QJYC 2H8PD 3VMAA 1IFDA 2P1JA 2K3RA 1BE3E 3W68A 3SWKA 3M0DC 4WWIA 2Y9YA 2IBZE 4QMAA 2B88A 1RE4C 3GLMA 1LTBC 1NU1D 4TLFA 3BASA 3G4SP 2WSCH 2KNCB 4A7PA 1PL5A 2KNCA 1S1CX 1M90Q 3CX5I 3USSA 1L0LK 3B5ND 4Z1MH 2ZVOB 5APUA 3AEEC 2IPPA 2OYHA 1NKNA 2DW3A 4PV1B 1YTZT 1L0LJ 3H1HE 2YMYA 3CCQP 5B5EH 5AW7B 1Y8AA 1U57A 3CI9A 3L72E 1JEKA 1X22A 1KB9D 1UIIA 3FXEA 3A0HH 1AJYA 1YQ4C 3RK3D 1X0TA 3N4XA 3RBZA 2H89C 4LC1A 3KDPB 2NPSB 5AVXB 5BU5A 2ZXEB 3AE9C 3TGUG 3W67A 4BRYA 2QJYB 2M0BA 1LTSC 3M9HA 1RQVA 3RL0C 2KZIA 1LJ2A 4LGDE 2M8RA 1Q81Q 5AW0B 3HRNA 5B66E 1BCCD 2YO3A 2Q5UA 3M0DA 1KB9H 2IZ1A 3KPEA 5KJ7C 3CC4P 1FZCC 1RE4A 3RK2C 2FY8A 4WVZA 3P32A 3KZIE 2AEFA 3E1RA 1JY2O 5AW1B 1KQSO 1PPJD 2POHA 2OTLP 2HG5D 1NTMK 1KQLA 3Q5PA 1J1EC 1EQ7A 3CWBD 1FOSF 1Y47A 4AUWA 1HWTC 2BCCD 2V4HA 1NTMJ 1FZFA 1SQVK 3H1JD 1P84I 1SQVG 1AV1A 3AEGC 4H13B 3Q3DA 5KLVK 5CBOA 1FOSE 1N2DC 2YXQB 1PIXA 1PGOA 2WZ7A 3Q1MA 2ITAA 2JJLA 1JM0A 1YJWP 1BE3J 1PPJG 1U7MA 5AVQB 5CHXA 1K9MQ 3V4WA 1BGYG 2B89A 4DJGA 2W90A 1A02J 1NAYA 3LIEA 1L2PA 1JCDA 4IL6H 4RKUJ 3CWBG 4WB4A 1T3UA 2Q7CA 3CX5H 2BCCG 3VP9A 3GW6A 5DJUB 1EZVE 2E74B 2FYUD 1KC8Q 4W80A 4EIJA 3L75E 4K35A 3RL0B 2ZYGA 3PJSK 2QJKC 3AE1C 2IZ0A 2WMMA 3T97B 3T97A 2HR3A 3H1HJ 4M3LA 2PRRA 2Y0EA 1FZCB 3I5CA 1FZCA 5AVUB 3RK2B 1EDJA 4NPDA 2L5GB 2FBWC 3L72J 2FYNC 3LIDA 5AVRB 1NTZD 5KAIH 1DD3A 3KYQA 3M91A 3PP5A 2QIWA 3KHUA 2K37A 1SQBE 1YJ9P 3G3ZA 2KZJA 3B5NC 1TU3F 2ZYDA 3VN0A 4WY4B 3H1IJ 3PLNA 1KYOI 1JOCA 3V2QA 3QH9A 5AVYB 1FJKA 4PD4I 1JB0J 1VQ4P 1KQFB 3CXHD 4U3FE 2NPSD 1NTZG 2CPBA 1QX8A 3CC7P 1RE3C 1KMIZ 1RQUA 2I1KA 3H1LG 3WUUA 2OARA 3RK3C 1FJPA 1SQPG 4XE5B 3GMAA 3D6ZA 3JCUE 3HTKB 3SWYA 2K9YA 3HTKA 4JF7A 1SQXD 1SQQK 3TNUB 2O01H 4HB1A 3U1CA 2Z5HA 3MIWA 1ZLLA 2E43A 4HH2A 1M1JC 2WPSA 3JC22 3H25A 2XV5A 3CXHH 1NTKK 4N78E 3WMM0 5H2FE 4JYBA 3TK1A 3EFFK 3M0AA 3A0BH 1DEBA 3L74G 3WUVA 1GW3A 3L73E 1BDDA 4H13D 2KSJA 3TF5A 4ZMDA 3AECC 1G1IA 1Q90D 3VOPA 3B5NB 2E5YA 3B5NA 1SQXG 2N9BA 2R3SA 1Q2NA 3CCMP 1CZQA 2YIUC 1IFMA 2YKOA 1K8AQ 3CCLP 1W5CE 5AVWB 1S9KD 3L75J 1MKMA 1NKZB 2CPSA 1X79B 5BVZA 1X8YA 1K05A 1SVFA 1VQ5P 4C46A 1LTJC 1NWQA 1KYOD 4L74A 3SFEC 1RE3A 2E74D 1LNQA 1NYHA 2JKVA 4UB8H 1LWUB 4JBZA 5E79H 3RK3B 3HD7D 3O6QA 2Y0DA 1PGJA 1FDOA 3P8CE 2R5BA 1LP1B 1LP1A 3WU2H 5GTHH 3L71E 5GTIH 4L75A 1GMJA 5KTBA 3RBXA 4PJ0H 1QEXA 1W2EA 4K3AA 1M1JB 1M1JA 1KYOH 3HUSC 1EDLA 2E75D 2K88A 1FZAA 5AVSB 3I55P 1M57D 1M1KQ 5AW4B 1Q86Q 1Z56A 3AE8C 3AE2C 2Y9ZA 3AEBC 4U3FJ 1VQLP 1GL2D 1ZRTE 4WY4D 3TGUE 5APQA 3GHGC 3M9QA 2JWDA 3SFDC 1DEEG 2KUBA 3CCJP 1JY3P 3RL0g 1VF5B 2YIUB 1KB9I 1WRGA 1AA0A 2Z5IA 5APXA 2QE7H 2IFNA 2B9BA 4BWNA 5CBNA 1LTJB 4Y99C 5CJ4A 1LTJA 3MD0A 1LTTC 2JDIH 1ZV8A 2RMZA 2VRSA 3FXDA 1IC2A 1NTME 1VQ9P 1OFCX 1U7JA 2QSIA 1FU1A 2NPSC 1KILD 4R4LA 5CCHD 1HBWA 3G71P 2I8DA 3C8VA 1NHLA 1VQNP 2BASA 2LR2A 2KYVA 3B4SA 1SQVE 2RH0A 5TISE 2A06D 3A3YB 1AVYA 5KLVE 1YQ3C 1N7LA 1K04A 3L70G 1L0LD 5K5GB 2YKQA 1PV3A 4R4MA 1SP4A 3CCSP 4B86A 1CI6B 1CI6A 1LGHB 3Q2YA 3HUSB 1G1JA 3HUSA 1HUCA 1LT9B 1BGYE 1WT6A 3VMZA 4HKZH 1YHQP 3HE4B 3HE4A 2HYNA 3S1KA 3CX5E 1ZW0A 3E7KA 1E79H 1URQD 3GHGB 3GHGA 2E76D 3CCUP 1T2KD 2AXTH 2A06G 1EDKA 3UIAA 4H13C 1GK6A 2QRXA 3BCCD 1QL1A 3U59A 5DJTB 3R2PA 3H1KE 1NU1G 3L71J 3MGNA 4Y99B 1OW6A 1RF1B 3TDKA 1Q82Q 2NRGA 3Q5SA 1ZR2A 4EYYQ 2XDJA 2NPSA 1IFJA 4GDOA 3H1IE 5APWA 2E74C 4GKGA 3CMAP 4OVNF 3TGUJ 2M3BA 2Q3IA 1VQMP 3BCCG 1OW8A 3HD7C 1N7SD 1NH4A 4OH8B 1MUUA 1RH5B 4I7ZC 1R5SA 2QM8A 1OIPA 2C9NY 2ZVNB 2W8ZA 1QLED 3FGAD 2FXPA 1N86A 1IFPA 1QVFO 1BE3D 3H1LE 3NXSA 1VQPP 1VF5D 1GU5A 1SQPE 1PFIA 4KHXA 2E75C 2IBZD 3H6PA 4YTPC 1YTZI 1HGZA 5AW9B 1GL2C 2WPVB 1SQQE 4WY4C 3MTUE 2I1JA 1P84E 1L0ND 1BCCG 5AW8B 3VMYA 1SQVJ 3CXHI 2J59M 5KAFH 2HLOA 3A2AA 4KJMA 5KLVJ 1JY3O 2SPZA 2Q9IA 1NTKE 3H1HD 4O9BA 3N7NA 4NPFX 3L74E 2K1AA 3L72D 4ZKUA 3GG2A 1KV4A 3LW5H 3JSVC 1JCCA 1BGYJ 1YITP 4EOTA 3H1JG 2O1KA 3P7KA 3CWBJ 3AEFC 2W6JH 1KILC 2O01N 5CCHC 3BVHA 3SWFA 1L0NG 3HD7B 3HD7A 1BSNA 1S2EA 3CCEP 1MV8A 3F5HA 3G6EP 1G2CB 1FAVA 5KJ7A 1ZOYC 2O3JA 4I7ZB 2ZT9B 2WSEJ 4OGQB 2GUVA 1HGVA 2WVRA 3H1KJ 3L72G 2P10A 4EI2A 1EC5A 3OJAB 5E79E 1T8ZA 3B71A 1M7LA 2E75B 2FYUK 1OMIA 1PP9E 1FE6A 2FYUG 2V7QH 1MFTA 1GL2B 2Z4EA 1GL2A 2H88C 4WY4A 5GTHE 4AYCA 1URQC 3U1AA 2E76C 1BDCA 1T2KC 3CLQA 1DX7A 4I1LA 1DH3A 1KYOE 1OX3A 2P7JA 3IR9A 1NTZK 4PD4E 2WITA 1FS0E 3S9OA 2R5DA 4IFFA 1USEA 4GOEA 5B66H 1LWUC 3VYIA 1S5LE 1NTZJ 1SFCB 1SQPK 1H89A 3BATA 2KK7A 2YMKA 2GM4A 1AVOA 1H8AA 3KZIH 3H1LJ 2QEXP 2OYIC 1KILB 1SQPJ 2YKPA 1JO5A 1KILA 3TNUA 2W27A 5CCHA 3WUTA 1JY2N 1GU4A 2O01J 2XU6A 1SQQJ 3C1LA 2C0XA 3V2PA 1EZVD 2H43A 2Q1KA 3V6IA 3L75D 2JP3A 1H88A 3BRTB 4DCKA 4ZKPA 1N7SC 1NTKJ 2O1JA 2WWWA 3RGUA 5C39A 4XA4A 3L74J 1E5WA 1SQXK 4D6TD 1KN7A 1VF5C 1KZUB 3M06A 3FX0A 1URQB 3L70E 1URQA 3HE5B 4I6MC 2E76B 2KLVA 4C7NB 1M8OB 4C7NA 2LXBA 1SQXJ 4TT3H 1OVVA 1EZVG 4YXWH 2AEJA 1SQBD 3EQ2A 1H0TB 3D71A 1RHZB 3A7OA 2YNYA 1JTHB 1LWUA 2P2UA 3KXDA 1LTIC 1T6AA 1FZBA 1RY3A 1PGQA 1VDFA 2AXTE 5KLIC 4D6TG 3D70A 2A06E 4I2LC 4U3FD 3OA7A 3V2RA 5B5EE 5CJ0A 2OYIB 2OYIA 1PP9J 1HTLC 1T3JA 2C0WA 2KLUA 2G3AA 3OW2O 2ZT9D 4OGQD 1GDTA 1GTWA 1FBMA 2N1TD 1SQBG 5AVZB 4CPGA 1NU1E 2H7HA 1VL2A 2KB7P 3A0HE 4UB6H 2BEZF 3CMEP 1IK7A 1LT9C 4YXDC 3KQGA 1QL2A 1N7SB 3E1IA 1N7SA 1YIJP 2CK3H 1XTCC 2K9JB 2K9JA 3IF4A 1LTAC 3H32B 3H32A 5KKZC 2FFDB 2XZRA 2YO2A 3NTNA 4HJGH 4U3FG 5AW3B 4N78D 4NPEA 4RJTA 1KFNA 2W83C 1EDIA 3L73D 2HFED 1KB9E 1IFIA 2D2CD 2HODB 2HODA 3ZDMA 3JCUH 3CD6P 2WSFH 3QWOC 1RF1C 3RK3E 1BSHA 2GA1A 1SFCD 4IOIH 1JMBA 4IFMA 2IDBA 3MZWB 2Y0CA 2UWJE 4L76A 3VMXA 2MKVA 1FZEA 4L73A 1UIXA 5KLIB 3Q5RA 1PZQA 2IFMA 3L35A 2R3CA 2WPRA 5H2FH 3V2NA 2W6AA 1KFMA 5AVTB 3ITKA 3PRJA 3CCVP 5APTA 1BCCE 3CPWO 2YXRB 3L73G 2QJPC 1HF9A 1OW7A 2R32A 3FWLA 1JMMA 3L70J 1AQ5A 2XKMA 3P8CD 1PPJE 4H0LB 1USDA 1LT9A 3GF7A 2IBZI 2MJZA 5AW5B 3L71D 4IL6E 2M3EA 2WSCJ 3CWBE 2RKLA 3D6YA 1ZXGA 1IJDB 2BCCE 5KKZB 1VQOP 1EXJA 3H1JE 2QA4P 2E5TA 4EDFA 3AE5C 4C7RA 1MFZA 1L0NE 2AEMA 1L0LG 1S72P 2J58A 1ZRTD 2OYHB 3GF3A 3TGUD 1S3JA 1NU1K 1CW5A 3A5TA 1RF1A 3VP8A 3TSIA 5KAIE 3L71G 2QG4A 1NU1J 4H44B 1SLQA 2IX7C 3PH0A 2FYUE 1NGMB 1N73C 2XNXA 2WTYA 4ASVA 3S4RA 1ZMEC 3MUDC 2E42A 1NTMD 4Y28J 5TJHA 1OVUA 2QJPB 2FXMA 4N6JA 2ZXXA 4BRYB 1OZHA 3BCCJ 1VQKP 1AFOA 2ZJSE 2ZT9C 4OGQC 1FZGA 1NTZE 1SQVD 5M1BA 2N1TC 5KLVD 2B87B 2B87A 1IFNA 1SS1A 2JR8A 3AEAC 4WBAA 4GIFA 3OAKA 3PTZA 1Q7YQ 2WSSH 5BU8B 5CCGD 4W7YA 1BGYD 1NTMG 4BXLA 5L8RJ 4U7JA 4N3YB 3CX5D 1DD4A 3CXHE 3L4FA 1BCCJ 3AE7C 1S5LX 5TISH 3M9BA 5KLVG 3A0BE 2D2CC 3C9IA 1BE3G 3CCRP 2KSEA 1SFCC 2IBZG 1HH0A 1N73B 3H1KD 1JNMA 1N73A 1QGKB 1GZLA 3ABVC 1L4AD 1SQXE 3LW5J 2GUSA 3FWNA 2ZAEB 5AVVB 3PHLA 2BCCJ 1KQGB 3MUDA 1L0NK
chains in the Genus database with same CATH topology
3L72G 1KYOH 1SQQG 1L0NG 3L75G 1BCCG 4U3FG 1BE3G 3CWBG 1KB9H 3TGUG 1NU1G 1P84H 2IBZG 3CX5H 2BCCG 3L74G 4PD4H 2A06G 3H1KG 3H1LG 3H1IG 1SQPG 2FYUG 3H1JG 1SQVG 1PPJG 3H1HG 3L70G 3L71G 3L73G 1EZVG 1L0LG 1BGYG 1SQBG 1PP9G 3CXHH 5KLVG 1NTZG 3BCCG 1NTMG 1NTKG 4D6TG 1SQXG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 G;  1KYO H;  1SQQ G;  1L0N G;  3L75 G;  1BCC G;  4U3F G;  1BE3 G;  3CWB G;  1KB9 H;  3TGU G;  1NU1 G;  1P84 H;  2IBZ G;  3CX5 H;  2BCC G;  3L74 G;  4PD4 H;  2A06 G;  3H1K G;  3H1L G;  3H1I G;  1SQP G;  2FYU G;  3H1J G;  1SQV G;  1PPJ G;  3H1H G;  3L70 G;  3L71 G;  3L73 G;  1EZV G;  1L0L G;  1BGY G;  1SQB G;  1PP9 G;  3CXH H;  5KLV G;  1NTZ G;  3BCC G;  1NTM G;  1NTK G;  4D6T G;  1SQX G; 
#chains in the Genus database with same CATH topology
 2LKM A;  3II6 A;  1D7M A;  3H1J J;  1EZV I;  5AW6 B;  4H0L D;  3AE3 C;  1OVR A;  3H1I D;  2HPC B;  1RF0 C;  1G2C A;  2HPC A;  1L0N J;  3NMD A;  3H1H G;  1GW4 A;  1GD2 E;  2N1T B;  2PP6 A;  2N1T A;  1FDM A;  3IFM A;  4UB8 E;  2WSE H;  3EWK A;  4RES B;  1GK4 A;  3H1K G;  5APS A;  2NZ2 A;  3IAO A;  1EXI A;  2LXC B;  4D6T E;  2KS1 B;  2KS1 A;  2G8Y A;  1NVO A;  3WU2 E;  3CC2 P;  4PV1 D;  2L91 A;  1J2J B;  5GTI E;  2FYU J;  1NOH A;  4DZO A;  1S9K E;  1J1E B;  2V7Q J;  3MHV A;  4OWF A;  4PJ0 E;  3H1L D;  1SQP D;  3H1I G;  1W2B O;  1QVG O;  4H44 D;  4UB6 E;  1XTG B;  2N9Y B;  1SQQ D;  2D2C B;  1HVV A;  1P84 D;  3CL3 D;  2IYP A;  1AQT A;  1KOR A;  1SFC A;  3AE4 C;  3V5B A;  1FDI A;  3K5B A;  1NTK D;  2W6B A;  4DT0 A;  3L36 A;  2OYO A;  4JQ0 D;  3L74 D;  2WT7 B;  3V4Q A;  2WT7 A;  2A45 I;  2FKW B;  2QM7 A;  4LLH A;  1JUN A;  1ZR4 A;  3NFQ A;  4JPZ B;  1VQ8 P;  1RF0 A;  2OTJ P;  2R44 A;  1DIP A;  2XND H;  3VTP C;  2ZYA A;  1SQQ G;  2QJK B;  1ZP0 C;  1J1D C;  1PGP A;  3I56 P;  1P84 H;  4HYT B;  2Q3E A;  1NAF A;  2FFD C;  5AW2 B;  2FYN B;  1NTK G;  2PFX A;  2KP8 A;  5EFW B;  1JY3 N;  1N8R Q;  1YI2 P;  1FC2 C;  2KI7 B;  2PAJ A;  3HE5 A;  5CCG C;  2JO1 A;  3R4Y A;  4ASW A;  1KD1 Q;  1PP9 D;  3O8Z A;  1X9V A;  1H0T A;  3L75 G;  2OQQ A;  1HJB A;  1ZN5 A;  2AXC A;  5CMZ A;  1VPC A;  2OGU A;  1KIL E;  1JTH A;  3BRV B;  4YPC A;  4IFD K;  1MZ9 A;  1YBK A;  1VQ7 P;  1OXZ A;  2M5A B;  2M5A A;  2ZFC A;  3L37 A;  1HJ0 A;  4PD4 D;  2Q6Q A;  1L0L E;  1K73 Q;  2QVA A;  4D6T J;  4DOJ A;  1L4A C;  1YYC A;  3RL0 D;  2P58 A;  1LTG C;  1SQB K;  1M56 D;  1IZN B;  1PP9 G;  2KXP B;  3O6Q B;  3AE6 C;  4IL6 X;  5KJ7 D;  1S4X A;  4MN4 C;  4H0L C;  1SQB J;  3RK2 D;  1J1D B;  4AQR D;  1JY2 P;  1R5L A;  4XFJ A;  4GOD A;  4ZNC A;  2J5U A;  1KTM A;  3TYY A;  1LT1 A;  2FFD A;  2P67 A;  4W7Z A;  3IN6 A;  2C9L Y;  4PD4 H;  3P8M C;  2JWA A;  5APY A;  3BCC E;  1Y9B A;  2BEQ D;  1WMK A;  5CCG A;  1S5L H;  2OTK E;  2PGD A;  1CSB A;  2OYH C;  4PV1 C;  1R8E A;  2KOG A;  1NJI Q;  2A45 G;  2A45 H;  4KT0 J;  1VQ6 P;  3MP7 B;  3F89 A;  2WSF J;  3L70 D;  3EFG A;  4H44 C;  3G9R A;  3AED C;  2IYO A;  2FYZ A;  2WPQ A;  4GT1 A;  2WQY C;  5APV A;  1NO4 A;  4GOF A;  2FXO A;  2JEE A;  3B8E B;  2KIK A;  3SSU A;  2RN0 A;  1L4A B;  1L4A A;  1IK9 A;  5KAF E;  1YJN P;  1OWA A;  4RO0 A;  4JYC A;  3L73 J;  1A02 F;  1IO4 A;  2QJY C;  2H8P D;  3VMA A;  1IFD A;  2P1J A;  2K3R A;  1BE3 E;  3W68 A;  3SWK A;  3M0D C;  4WWI A;  2Y9Y A;  2IBZ E;  4QMA A;  2B88 A;  1RE4 C;  3GLM A;  1LTB C;  1NU1 D;  4TLF A;  3BAS A;  3G4S P;  2WSC H;  2KNC B;  4A7P A;  1PL5 A;  2KNC A;  1S1C X;  1M90 Q;  3CX5 I;  3USS A;  1L0L K;  3B5N D;  4Z1M H;  2ZVO B;  5APU A;  3AEE C;  2IPP A;  2OYH A;  1NKN A;  2DW3 A;  4PV1 B;  1YTZ T;  1L0L J;  3H1H E;  2YMY A;  3CCQ P;  5B5E H;  5AW7 B;  1Y8A A;  1U57 A;  3CI9 A;  3L72 E;  1JEK A;  1X22 A;  1KB9 D;  1UII A;  3FXE A;  3A0H H;  1AJY A;  1YQ4 C;  3RK3 D;  1X0T A;  3N4X A;  3RBZ A;  2H89 C;  4LC1 A;  3KDP B;  2NPS B;  5AVX B;  5BU5 A;  2ZXE B;  3AE9 C;  3TGU G;  3W67 A;  4BRY A;  2QJY B;  2M0B A;  1LTS C;  3M9H A;  1RQV A;  3RL0 C;  2KZI A;  1LJ2 A;  4LGD E;  2M8R A;  1Q81 Q;  5AW0 B;  3HRN A;  5B66 E;  1BCC D;  2YO3 A;  2Q5U A;  3M0D A;  1KB9 H;  2IZ1 A;  3KPE A;  5KJ7 C;  3CC4 P;  1FZC C;  1RE4 A;  3RK2 C;  2FY8 A;  4WVZ A;  3P32 A;  3KZI E;  2AEF A;  3E1R A;  1JY2 O;  5AW1 B;  1KQS O;  1PPJ D;  2POH A;  2OTL P;  2HG5 D;  1NTM K;  1KQL A;  3Q5P A;  1J1E C;  1EQ7 A;  3CWB D;  1FOS F;  1Y47 A;  4AUW A;  1HWT C;  2BCC D;  2V4H A;  1NTM J;  1FZF A;  1SQV K;  3H1J D;  1P84 I;  1SQV G;  1AV1 A;  3AEG C;  4H13 B;  3Q3D A;  5KLV K;  5CBO A;  1FOS E;  1N2D C;  2YXQ B;  1PIX A;  1PGO A;  2WZ7 A;  3Q1M A;  2ITA A;  2JJL A;  1JM0 A;  1YJW P;  1BE3 J;  1PPJ G;  1U7M A;  5AVQ B;  5CHX A;  1K9M Q;  3V4W A;  1BGY G;  2B89 A;  4DJG A;  2W90 A;  1A02 J;  1NAY A;  3LIE A;  1L2P A;  1JCD A;  4IL6 H;  4RKU J;  3CWB G;  4WB4 A;  1T3U A;  2Q7C A;  3CX5 H;  2BCC G;  3VP9 A;  3GW6 A;  5DJU B;  1EZV E;  2E74 B;  2FYU D;  1KC8 Q;  4W80 A;  4EIJ A;  3L75 E;  4K35 A;  3RL0 B;  2ZYG A;  3PJS K;  2QJK C;  3AE1 C;  2IZ0 A;  2WMM A;  3T97 B;  3T97 A;  2HR3 A;  3H1H J;  4M3L A;  2PRR A;  2Y0E A;  1FZC B;  3I5C A;  1FZC A;  5AVU B;  3RK2 B;  1EDJ A;  4NPD A;  2L5G B;  2FBW C;  3L72 J;  2FYN C;  3LID A;  5AVR B;  1NTZ D;  5KAI H;  1DD3 A;  3KYQ A;  3M91 A;  3PP5 A;  2QIW A;  3KHU A;  2K37 A;  1SQB E;  1YJ9 P;  3G3Z A;  2KZJ A;  3B5N C;  1TU3 F;  2ZYD A;  3VN0 A;  4WY4 B;  3H1I J;  3PLN A;  1KYO I;  1JOC A;  3V2Q A;  3QH9 A;  5AVY B;  1FJK A;  4PD4 I;  1JB0 J;  1VQ4 P;  1KQF B;  3CXH D;  4U3F E;  2NPS D;  1NTZ G;  2CPB A;  1QX8 A;  3CC7 P;  1RE3 C;  1KMI Z;  1RQU A;  2I1K A;  3H1L G;  3WUU A;  2OAR A;  3RK3 C;  1FJP A;  1SQP G;  4XE5 B;  3GMA A;  3D6Z A;  3JCU E;  3HTK B;  3SWY A;  2K9Y A;  3HTK A;  4JF7 A;  1SQX D;  1SQQ K;  3TNU B;  2O01 H;  4HB1 A;  3U1C A;  2Z5H A;  3MIW A;  1ZLL A;  2E43 A;  4HH2 A;  1M1J C;  2WPS A;  3JC2 2;  3H25 A;  2XV5 A;  3CXH H;  1NTK K;  4N78 E;  3WMM 0;  5H2F E;  4JYB A;  3TK1 A;  3EFF K;  3M0A A;  3A0B H;  1DEB A;  3L74 G;  3WUV A;  1GW3 A;  3L73 E;  1BDD A;  4H13 D;  2KSJ A;  3TF5 A;  4ZMD A;  3AEC C;  1G1I A;  1Q90 D;  3VOP A;  3B5N B;  2E5Y A;  3B5N A;  1SQX G;  2N9B A;  2R3S A;  1Q2N A;  3CCM P;  1CZQ A;  2YIU C;  1IFM A;  2YKO A;  1K8A Q;  3CCL P;  1W5C E;  5AVW B;  1S9K D;  3L75 J;  1MKM A;  1NKZ B;  2CPS A;  1X79 B;  5BVZ A;  1X8Y A;  1K05 A;  1SVF A;  1VQ5 P;  4C46 A;  1LTJ C;  1NWQ A;  1KYO D;  4L74 A;  3SFE C;  1RE3 A;  2E74 D;  1LNQ A;  1NYH A;  2JKV A;  4UB8 H;  1LWU B;  4JBZ A;  5E79 H;  3RK3 B;  3HD7 D;  3O6Q A;  2Y0D A;  1PGJ A;  1FDO A;  3P8C E;  2R5B A;  1LP1 B;  1LP1 A;  3WU2 H;  5GTH H;  3L71 E;  5GTI H;  4L75 A;  1GMJ A;  5KTB A;  3RBX A;  4PJ0 H;  1QEX A;  1W2E A;  4K3A A;  1M1J B;  1M1J A;  1KYO H;  3HUS C;  1EDL A;  2E75 D;  2K88 A;  1FZA A;  5AVS B;  3I55 P;  1M57 D;  1M1K Q;  5AW4 B;  1Q86 Q;  1Z56 A;  3AE8 C;  3AE2 C;  2Y9Z A;  3AEB C;  4U3F J;  1VQL P;  1GL2 D;  1ZRT E;  4WY4 D;  3TGU E;  5APQ A;  3GHG C;  3M9Q A;  2JWD A;  3SFD C;  1DEE G;  2KUB A;  3CCJ P;  1JY3 P;  3RL0 g;  1VF5 B;  2YIU B;  1KB9 I;  1WRG A;  1AA0 A;  2Z5I A;  5APX A;  2QE7 H;  2IFN A;  2B9B A;  4BWN A;  5CBN A;  1LTJ B;  4Y99 C;  5CJ4 A;  1LTJ A;  3MD0 A;  1LTT C;  2JDI H;  1ZV8 A;  2RMZ A;  2VRS A;  3FXD A;  1IC2 A;  1NTM E;  1VQ9 P;  1OFC X;  1U7J A;  2QSI A;  1FU1 A;  2NPS C;  1KIL D;  4R4L A;  5CCH D;  1HBW A;  3G71 P;  2I8D A;  3C8V A;  1NHL A;  1VQN P;  2BAS A;  2LR2 A;  2KYV A;  3B4S A;  1SQV E;  2RH0 A;  5TIS E;  2A06 D;  3A3Y B;  1AVY A;  5KLV E;  1YQ3 C;  1N7L A;  1K04 A;  3L70 G;  1L0L D;  5K5G B;  2YKQ A;  1PV3 A;  4R4M A;  1SP4 A;  3CCS P;  4B86 A;  1CI6 B;  1CI6 A;  1LGH B;  3Q2Y A;  3HUS B;  1G1J A;  3HUS A;  1HUC A;  1LT9 B;  1BGY E;  1WT6 A;  3VMZ A;  4HKZ H;  1YHQ P;  3HE4 B;  3HE4 A;  2HYN A;  3S1K A;  3CX5 E;  1ZW0 A;  3E7K A;  1E79 H;  1URQ D;  3GHG B;  3GHG A;  2E76 D;  3CCU P;  1T2K D;  2AXT H;  2A06 G;  1EDK A;  3UIA A;  4H13 C;  1GK6 A;  2QRX A;  3BCC D;  1QL1 A;  3U59 A;  5DJT B;  3R2P A;  3H1K E;  1NU1 G;  3L71 J;  3MGN A;  4Y99 B;  1OW6 A;  1RF1 B;  3TDK A;  1Q82 Q;  2NRG A;  3Q5S A;  1ZR2 A;  4EYY Q;  2XDJ A;  2NPS A;  1IFJ A;  4GDO A;  3H1I E;  5APW A;  2E74 C;  4GKG A;  3CMA P;  4OVN F;  3TGU J;  2M3B A;  2Q3I A;  1VQM P;  3BCC G;  1OW8 A;  3HD7 C;  1N7S D;  1NH4 A;  4OH8 B;  1MUU A;  1RH5 B;  4I7Z C;  1R5S A;  2QM8 A;  1OIP A;  2C9N Y;  2ZVN B;  2W8Z A;  1QLE D;  3FGA D;  2FXP A;  1N86 A;  1IFP A;  1QVF O;  1BE3 D;  3H1L E;  3NXS A;  1VQP P;  1VF5 D;  1GU5 A;  1SQP E;  1PFI A;  4KHX A;  2E75 C;  2IBZ D;  3H6P A;  4YTP C;  1YTZ I;  1HGZ A;  5AW9 B;  1GL2 C;  2WPV B;  1SQQ E;  4WY4 C;  3MTU E;  2I1J A;  1P84 E;  1L0N D;  1BCC G;  5AW8 B;  3VMY A;  1SQV J;  3CXH I;  2J59 M;  5KAF H;  2HLO A;  3A2A A;  4KJM A;  5KLV J;  1JY3 O;  2SPZ A;  2Q9I A;  1NTK E;  3H1H D;  4O9B A;  3N7N A;  4NPF X;  3L74 E;  2K1A A;  3L72 D;  4ZKU A;  3GG2 A;  1KV4 A;  3LW5 H;  3JSV C;  1JCC A;  1BGY J;  1YIT P;  4EOT A;  3H1J G;  2O1K A;  3P7K A;  3CWB J;  3AEF C;  2W6J H;  1KIL C;  2O01 N;  5CCH C;  3BVH A;  3SWF A;  1L0N G;  3HD7 B;  3HD7 A;  1BSN A;  1S2E A;  3CCE P;  1MV8 A;  3F5H A;  3G6E P;  1G2C B;  1FAV A;  5KJ7 A;  1ZOY C;  2O3J A;  4I7Z B;  2ZT9 B;  2WSE J;  4OGQ B;  2GUV A;  1HGV A;  2WVR A;  3H1K J;  3L72 G;  2P10 A;  4EI2 A;  1EC5 A;  3OJA B;  5E79 E;  1T8Z A;  3B71 A;  1M7L A;  2E75 B;  2FYU K;  1OMI A;  1PP9 E;  1FE6 A;  2FYU G;  2V7Q H;  1MFT A;  1GL2 B;  2Z4E A;  1GL2 A;  2H88 C;  4WY4 A;  5GTH E;  4AYC A;  1URQ C;  3U1A A;  2E76 C;  1BDC A;  1T2K C;  3CLQ A;  1DX7 A;  4I1L A;  1DH3 A;  1KYO E;  1OX3 A;  2P7J A;  3IR9 A;  1NTZ K;  4PD4 E;  2WIT A;  1FS0 E;  3S9O A;  2R5D A;  4IFF A;  1USE A;  4GOE A;  5B66 H;  1LWU C;  3VYI A;  1S5L E;  1NTZ J;  1SFC B;  1SQP K;  1H89 A;  3BAT A;  2KK7 A;  2YMK A;  2GM4 A;  1AVO A;  1H8A A;  3KZI H;  3H1L J;  2QEX P;  2OYI C;  1KIL B;  1SQP J;  2YKP A;  1JO5 A;  1KIL A;  3TNU A;  2W27 A;  5CCH A;  3WUT A;  1JY2 N;  1GU4 A;  2O01 J;  2XU6 A;  1SQQ J;  3C1L A;  2C0X A;  3V2P A;  1EZV D;  2H43 A;  2Q1K A;  3V6I A;  3L75 D;  2JP3 A;  1H88 A;  3BRT B;  4DCK A;  4ZKP A;  1N7S C;  1NTK J;  2O1J A;  2WWW A;  3RGU A;  5C39 A;  4XA4 A;  3L74 J;  1E5W A;  1SQX K;  4D6T D;  1KN7 A;  1VF5 C;  1KZU B;  3M06 A;  3FX0 A;  1URQ B;  3L70 E;  1URQ A;  3HE5 B;  4I6M C;  2E76 B;  2KLV A;  4C7N B;  1M8O B;  4C7N A;  2LXB A;  1SQX J;  4TT3 H;  1OVV A;  1EZV G;  4YXW H;  2AEJ A;  1SQB D;  3EQ2 A;  1H0T B;  3D71 A;  1RHZ B;  3A7O A;  2YNY A;  1JTH B;  1LWU A;  2P2U A;  3KXD A;  1LTI C;  1T6A A;  1FZB A;  1RY3 A;  1PGQ A;  1VDF A;  2AXT E;  5KLI C;  4D6T G;  3D70 A;  2A06 E;  4I2L C;  4U3F D;  3OA7 A;  3V2R A;  5B5E E;  5CJ0 A;  2OYI B;  2OYI A;  1PP9 J;  1HTL C;  1T3J A;  2C0W A;  2KLU A;  2G3A A;  3OW2 O;  2ZT9 D;  4OGQ D;  1GDT A;  1GTW A;  1FBM A;  2N1T D;  1SQB G;  5AVZ B;  4CPG A;  1NU1 E;  2H7H A;  1VL2 A;  2KB7 P;  3A0H E;  4UB6 H;  2BEZ F;  3CME P;  1IK7 A;  1LT9 C;  4YXD C;  3KQG A;  1QL2 A;  1N7S B;  3E1I A;  1N7S A;  1YIJ P;  2CK3 H;  1XTC C;  2K9J B;  2K9J A;  3IF4 A;  1LTA C;  3H32 B;  3H32 A;  5KKZ C;  2FFD B;  2XZR A;  2YO2 A;  3NTN A;  4HJG H;  4U3F G;  5AW3 B;  4N78 D;  4NPE A;  4RJT A;  1KFN A;  2W83 C;  1EDI A;  3L73 D;  2HFE D;  1KB9 E;  1IFI A;  2D2C D;  2HOD B;  2HOD A;  3ZDM A;  3JCU H;  3CD6 P;  2WSF H;  3QWO C;  1RF1 C;  3RK3 E;  1BSH A;  2GA1 A;  1SFC D;  4IOI H;  1JMB A;  4IFM A;  2IDB A;  3MZW B;  2Y0C A;  2UWJ E;  4L76 A;  3VMX A;  2MKV A;  1FZE A;  4L73 A;  1UIX A;  5KLI B;  3Q5R A;  1PZQ A;  2IFM A;  3L35 A;  2R3C A;  2WPR A;  5H2F H;  3V2N A;  2W6A A;  1KFM A;  5AVT B;  3ITK A;  3PRJ A;  3CCV P;  5APT A;  1BCC E;  3CPW O;  2YXR B;  3L73 G;  2QJP C;  1HF9 A;  1OW7 A;  2R32 A;  3FWL A;  1JMM A;  3L70 J;  1AQ5 A;  2XKM A;  3P8C D;  1PPJ E;  4H0L B;  1USD A;  1LT9 A;  3GF7 A;  2IBZ I;  2MJZ A;  5AW5 B;  3L71 D;  4IL6 E;  2M3E A;  2WSC J;  3CWB E;  2RKL A;  3D6Y A;  1ZXG A;  1IJD B;  2BCC E;  5KKZ B;  1VQO P;  1EXJ A;  3H1J E;  2QA4 P;  2E5T A;  4EDF A;  3AE5 C;  4C7R A;  1MFZ A;  1L0N E;  2AEM A;  1L0L G;  1S72 P;  2J58 A;  1ZRT D;  2OYH B;  3GF3 A;  3TGU D;  1S3J A;  1NU1 K;  1CW5 A;  3A5T A;  1RF1 A;  3VP8 A;  3TSI A;  5KAI E;  3L71 G;  2QG4 A;  1NU1 J;  4H44 B;  1SLQ A;  2IX7 C;  3PH0 A;  2FYU E;  1NGM B;  1N73 C;  2XNX A;  2WTY A;  4ASV A;  3S4R A;  1ZME C;  3MUD C;  2E42 A;  1NTM D;  4Y28 J;  5TJH A;  1OVU A;  2QJP B;  2FXM A;  4N6J A;  2ZXX A;  4BRY B;  1OZH A;  3BCC J;  1VQK P;  1AFO A;  2ZJS E;  2ZT9 C;  4OGQ C;  1FZG A;  1NTZ E;  1SQV D;  5M1B A;  2N1T C;  5KLV D;  2B87 B;  2B87 A;  1IFN A;  1SS1 A;  2JR8 A;  3AEA C;  4WBA A;  4GIF A;  3OAK A;  3PTZ A;  1Q7Y Q;  2WSS H;  5BU8 B;  5CCG D;  4W7Y A;  1BGY D;  1NTM G;  4BXL A;  5L8R J;  4U7J A;  4N3Y B;  3CX5 D;  1DD4 A;  3CXH E;  3L4F A;  1BCC J;  3AE7 C;  1S5L X;  5TIS H;  3M9B A;  5KLV G;  3A0B E;  2D2C C;  3C9I A;  1BE3 G;  3CCR P;  2KSE A;  1SFC C;  2IBZ G;  1HH0 A;  1N73 B;  3H1K D;  1JNM A;  1N73 A;  1QGK B;  1GZL A;  3ABV C;  1L4A D;  1SQX E;  3LW5 J;  2GUS A;  3FWN A;  2ZAE B;  5AVV B;  3PHL A;  2BCC J;  1KQG B;  3MUD A;  1L0N K; 
#chains in the Genus database with same CATH homology
 3L72 G;  1KYO H;  1SQQ G;  1L0N G;  3L75 G;  1BCC G;  4U3F G;  1BE3 G;  3CWB G;  1KB9 H;  3TGU G;  1NU1 G;  1P84 H;  2IBZ G;  3CX5 H;  2BCC G;  3L74 G;  4PD4 H;  2A06 G;  3H1K G;  3H1L G;  3H1I G;  1SQP G;  2FYU G;  3H1J G;  1SQV G;  1PPJ G;  3H1H G;  3L70 G;  3L71 G;  3L73 G;  1EZV G;  1L0L G;  1BGY G;  1SQB G;  1PP9 G;  3CXH H;  5KLV G;  1NTZ G;  3BCC G;  1NTM G;  1NTK G;  4D6T G;  1SQX G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...