5KLVG

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 5klvG00
1KB9H 1SQXG 3TGUG 3L73G 3H1KG 1L0LG 3CX5H 3L74G 4PD4H 2BCCG 1NTMG 3L75G 1EZVG 3BCCG 2FYUG 3L71G 1P84H 3H1JG 3H1IG 1SQVG 3CWBG 1L0NG 1BCCG 1SQQG 2IBZG 1PPJG 1SQPG 4D6TG 1NTKG 3L72G 1BGYG 5KLVG 3H1HG 4U3FG 1NU1G 3L70G 1PP9G 3CXHH 1SQBG 1KYOH 1NTZG 2A06G 1BE3G 3H1LG
chains in the Genus database with same CATH superfamily
2ZJSE 1FU1A 2M5AA 1N73A 1R5LA 3B5NB 4KT0J 3P8CD 2YMKA 1L0LG 1FJKA 1MZ9A 4MN4C 1L0LD 2G8YA 1YTZI 4D6TD 1J1EB 4H44D 1K05A 5AW9B 4EYYQ 1KZUB 1NVOA 1S5LX 1Y47A 3CWBJ 4HH2A 3KDPB 4TT3H 2H7HA 1IK7A 2PP6A 2WSFJ 3AEAC 4YXWH 2IZ1A 3CWBG 5APSA 3T97B 4BXLA 2Q9IA 2C0WA 2FBWC 1SQVK 2WT7B 3GG2A 2IBZG 2YNYA 1NTKD 2HG5D 2FXPA 1KORA 3C1LA 3GW6A 3KPEA 1J1EC 4LLHA 1S9KE 3N4XA 3C8VA 1SQPK 5KAFE 2N1TB 2W90A 1NTKK 5GTHH 3Q2YA 3KZIH 2WSCJ 1GL2B 1LP1B 1AQTA 2V7QJ 1K73Q 1R5SA 2PFXA 2BEQD 4PJ0E 1M1JA 2O3JA 1CZQA 2AXCA 2AXTH 2OYOA 1RE3A 3M91A 1N7SD 4H0LC 5APTA 2QJKC 4OH8B 5TISE 3CL3D 1DX7A 5E79E 2FYNC 2O1JA 2YXQB 2JR8A 1AVYA 1L2PA 3BRTB 4BWNA 5GTIE 4EOTA 2OQQA 1RH5B 1JMMA 3FGAD 3U1CA 3CX5E 1YHQP 1M7LA 4OVNF 5AVYB 3L70D 4CPGA 2C9NY 3MUDC 2FYUD 1OVRA 2Y9ZA 1SQQG 3GF7A 2WSFH 4D6TE 1NTKE 2KOGA 2C0XA 2Q7CA 4YXDC 1OW6A 2HFED 1P84D 2IZ0A 2ZFCA 3H1KJ 2IFNA 4IFFA 3TGUJ 3OW2O 1FZEA 4PJ0H 1Q90D 1N7SB 2Q5UA 3W67A 5KLVG 1QVGO 1NTZD 2YKOA 2ZXXA 3A5TA 1ZR2A 4WWIA 2JDIH 4LC1A 2P7JA 3AE5C 3MIWA 3OAKA 1SQBJ 1VPCA 3FXEA 1NTZG 1VF5D 4I7ZC 1FZCC 1EXIA 4EDFA 4LGDE 1OZHA 3HUSB 1L4AC 1KYOE 1MV8A 4EIJA 1T2KC 3G9RA 3L74D 1YQ3C 2NPSC 3L74G 2PAJA 3TK1A 2ZYDA 1SQPJ 2Y0EA 4ASVA 1AVOA 1FZFA 3H1KE 2YKQA 5CCHA 1BCCE 1JY2P 1GTWA 1RE3C 2Y0CA 3GHGC 1FZAA 2D2CC 1LT9C 1DEEG 2E75C 2FYUE 3PP5A 2RMZA 5AW5B 3S1KA 3CWBE 1VQ7P 5CMZA 3L4FA 5AVUB 2KYVA 4GOEA 5KJ7D 4D6TG 2ZT9C 3AEGC 1SQQE 1PIXA 2K9YA 3AE2C 3L74J 2DW3A 4IL6E 3RK3E 5KJ7A 2FFDB 2R32A 2W6JH 4C7NA 3L70E 3P8CE 1IZNB 3RL0B 4B86A 1KQSO 4H13C 1DIPA 1NYHA 1NTZK 3E1IA 1SQBG 3SFDC 2WTYA 1N86A 3W68A 5AW2B 2AEJA 1VF5C 3AE9C 2QVAA 5KLVJ 2XNXA 4H44C 2FY8A 3PHLA 2IBZD 1ZP0C 3O8ZA 5AW0B 2H89C 4JBZA 1IK9A 2QRXA 3WUUA 4C46A 2M5AB 1OVVA 2NPSB 3OJAB 5KAIH 1YJWP 1FZCA 1N73B 1SQQJ 2YO2A 1BCCD 1SVFA 1YBKA 1KILD 2XDJA 3V2QA 1MFZA 3G6EP 2WSSH 1YJNP 1VQKP 2YKPA 2LKMA 3VMZA 4U7JA 1AFOA 3VTPC 1N8RQ 5APYA 5KLVD 1AQ5A 2JKVA 2UWJE 1NO4A 1PPJE 4UB8E 3I56P 4W7ZA 2B9BA 1ZR4A 4U3FE 2OYIC 1JEKA 3HTKA 2RH0A 3VOPA 3L70G 3SWYA 3Q1MA 3Q5SA 2W8ZA 1VF5B 1GL2D 1W2BO 1M90Q 2CPBA 1FS0E 1J2JB 2N1TA 1LP1A 1A02F 2OYHB 2ZT9D 2N1TD 4RKUJ 3CCMP 1X79B 3LIDA 1PGOA 3VP9A 3D6ZA 1YJ9P 2WPVB 4L74A 3B4SA 4HKZH 3LIEA 1SQXK 4N78D 3AEBC 1SQPD 2JWAA 3RL0C 3PH0A 4IFDK 2QM8A 1X22A 3H1JG 1M8OB 1KFMA 1KTMA 4PD4E 3H1JE 1LT9A 1AA0A 1WMKA 3TNUB 1KMIZ 1NWQA 1LGHB 1IFMA 1NU1K 1QGKB 1W2EA 3S9OA 1Q2NA 1ZN5A 2IBZE 2Z5HA 5APXA 3AEDC 1JTHB 2H8PD 1M57D 3H1KD 5L8RJ 3L35A 5AW3B 2B87B 2FKWB 1L0LJ 1FDOA 1NAFA 3B8EB 1HUCA 5KLVK 1GZLA 1FDIA 3AE3C 3A0BE 4AQRD 2Q1KA 3IF4A 2E43A 1G2CB 1H0TA 1JO5A 1M1JB 2WZ7A 3M0DC 1SQBD 3H1LD 1L0ND 2E76D 3TDKA 3FX0A 4ZMDA 5KKZC 1NHLA 3F89A 5AVSB 1Q82Q 2R3CA 4JYCA 1LT9B 1Y8AA 2HPCB 5GTHE 4W7YA 2P1JA 2QE7H 1KB9H 2M0BA 1QVFO 1KQLA 3HD7C 2WSEH 3WU2E 2OTJP 2W27A 1SQXD 3HE4A 4HYTB 1D7MA 5C39A 1SQQD 3VMXA 1KN7A 1BCCJ 1L0NK 3C9IA 3M9QA 1GK4A 1RF0C 3HUSC 4H13B 4PD4D 3T97A 5KTBA 3KQGA 1BDCA 1HBWA 1KD1Q 2QJYC 1QL2A 1PGQA 1VQOP 2AEMA 1G1JA 5KJ7C 3CCSP 4WVZA 1VQPP 1SQPE 3CMAP 2QJKB 1T3UA 3QWOC 2RN0A 4UB6E 4IL6X 3LW5J 1H8AA 3L72G 4XE5B 2B88A 1KFNA 2I1KA 1SQXJ 2E75B 3H32B 4JPZB 1OIPA 2J5UA 3UIAA 4UB8H 1YITP 1SQBE 2IDBA 1VDFA 3MUDA 1X9VA 2KZJA 2N1TC 3G3ZA 5M1BA 1Z56A 2HLOA 2IBZI 2XZRA 1NU1J 2SPZA 2ZVNB 4WY4B 3VYIA 3BCCD 3AE7C 5AVVB 1M1KQ 1NTME 3TGUD 1OVUA 4WY4A 2BCCG 5CCGD 2WVRA 1USDA 2VRSA 3E1RA 2FYUG 4XFJA 5B5EE 2POHA 1CI6B 1W5CE 2AXTE 1JM0A 3CX5D 3M06A 4NPFX 1KQFB 3WMM0 1LWUC 5APVA 4DZOA 2P58A 2N9YB 2K37A 5CJ0A 3GHGB 3JCUH 1VQ9P 3BCCJ 1FOSE 1SQBK 1CW5A 1MFTA 1PPJG 3CXHI 1P84I 2W6BA 2B89A 2KSEA 1G1IA 4K3AA 1BGYG 2KNCB 3CC2P 1DD4A 5B66H 1JY2N 4L76A 2E74B 2E76C 1VQMP 1GK6A 1LTJB 1NKZB 1LWUA 1TU3F 1PP9G 3A3YB 1AV1A 3B71A 3JC22 1URQB 4HJGH 2XV5A 4IL6H 1K04A 3ZDMA 4RESB 2O01H 1S9KD 1JY3P 1PP9E 2A06E 1X0TA 4U3FJ 3HD7D 3RL0D 1XTGB 4IFMA 3MTUE 1K8AQ 3L73G 5APWA 3CX5H 3II6A 3FWLA 3O6QB 4I6MC 1BSNA 4ASWA 5AVRB 3USSA 1FAVA 1VQLP 2GUSA 3WU2H 2GA1A 2O1KA 3IAOA 2NPSA 1L0NG 1VQNP 2NPSD 1L0NE 1P84E 1U7MA 2A45I 3CXHE 5CBOA 3CC4P 3D70A 4N6JA 3SWFA 3VN0A 4DT0A 2W6AA 3RK2C 3MGNA 3H1HG 1OMIA 5K5GB 1QL1A 2E42A 2D2CD 3H1LJ 5AW4B 1NH4A 3CMEP 1OW7A 2E76B 1KYOH 1KB9D 2P2UA 3KXDA 3M0AA 2K9JA 4I2LC 4OGQC 1RQVA 2LXBA 2ZYAA 3V2PA 2KB7P 2HODA 3L74E 4Y99B 3G71P 1SFCB 1X8YA 1GW4A 4WY4C 1YTZT 2V4HA 3ITKA 4PD4H 5APUA 3L73E 2M3EA 1NAYA 3L72D 3MD0A 3OA7A 3L75G 4O9BA 1GU5A 2FFDA 2YIUB 1KILA 1JY3N 3L71G 2Q3IA 1UIXA 2A06D 1IFPA 3H1IJ 1PFIA 3H1IG 1SQVD 1E79H 4BRYB 3P8MC 2QA4P 1QLED 3P7KA 4ZNCA 5AW7B 3QH9A 4QMAA 1G2CA 1Y9BA 1HF9A 2Q6QA 4C7RA 2BCCD 1M1JC 1NTKG 1ZXGA 2K1AA 3CLQA 4HB1A 2ITAA 3M9HA 3S4RA 1ZW0A 4GDOA 2JO1A 4GT1A 1PGPA 2HR3A 4Z1MH 3H1HE 4GODA 1VQ8P 1FJPA 2MJZA 2E5YA 4JQ0D 2QG4A 3P32A 1KQGB 2N9BA 4ZKUA 3MP7B 1NU1D 5B66E 5AVWB 3V5BA 4OGQB 3SSUA 2ZVOB 3HE4B 3EQ2A 3V2NA 1HGZA 4DJGA 1ZOYC 3BATA 3M9BA 2L5GB 4PV1C 3L36A 1YYCA 5CCGC 1BE3E 1BDDA 1N7SA 5BU8B 5TJHA 3N7NA 3L75E 3JCUE 2OARA 1E5WA 1NTMG 2KS1A 1OW8A 2WPRA 4WY4D 3V4QA 1L0NJ 2KIKA 1EC5A 3RBXA 2R5BA 3AE4C 3BRVB 1S1CX 2IFMA 4UB6H 5BU5A 1SQVG 2GUVA 3R2PA 2LXCB 3RK3B 5H2FH 3HE5A 1FBMA 1T6AA 1WRGA 1L4AA 5KLVE 1M56D 1VQ4P 1JY3O 1PPJD 1RF1C 1RHZB 1BE3J 1BGYE 4I1LA 1HWTC 3A0HE 1T8ZA 2K9JB 1VQ6P 1PP9J 1EDIA 4U3FD 1LTGC 2E74D 1SLQA 1ZMEC 2M3BA 3H6PA 4L73A 5AVQB 4EI2A 1S72P 2ZAEB 1BGYJ 5B5EH 3M0DA 3H1HD 1JCCA 1FZBA 1QX8A 2O01N 3MZWB 2Z4EA 3FXDA 2E5TA 1S4XA 3HD7B 3BCCG 4N78E 2G3AA 4DCKA 5CCHD 1Q86Q 1S5LH 1N2DC 1DEBA 1SS1A 3V4WA 2JJLA 4PV1D 2ZXEB 4XA4A 3TNUA 1HTLC 3H1JD 4YTPC 3CPWO 3A0BH 1GU4A 1GW3A 3A0HH 3H1IE 2BCCJ 3CCVP 4C7NB 3TF5A 2XU6A 1ZRTE 4KHXA 3IFMA 3D71A 4AUWA 1NU1G 1EDJA 2ZT9B 2FXMA 5KLIC 3WUVA 3CCUP 2BASA 3CC7P 2QEXP 3GF3A 3Q5RA 2M8RA 4A7PA 2PRRA 1LTTC 2D2CB 1BE3G 2L91A 1HH0A 1NTMD 1J1DC 3TGUE 5AVXB 1SQXE 3NXSA 2IYPA 3L72J 5CCGA 3Q5PA 1GMJA 1LT1A 2I1JA 3CCLP 1L0LE 3BVHA 2BCCE 2JWDA 1S2EA 1RF0A 3HUSA 2C9LY 1EQ7A 3RL0g 1P84H 1PZQA 1SQVJ 5TISH 1JUNA 3KYQA 3RGUA 2OGUA 3HRNA 2Q3EA 3PLNA 5BVZA 3CCEP 2QJYB 1KILB 2FYNB 1AJYA 1BCCG 3AE6C 1EDLA 2KNCA 2WQYC 3NFQA 1JOCA 1NTMJ 3E7KA 3U1AA 3HTKB 3AEFC 1A02J 4W80A 1SQQK 2LR2A 1LTIC 2YO3A 3F5HA 5DJUB 1N73C 1LJ2A 1VQ5P 4N3YB 1BE3D 1LNQA 2HODB 2Z5IA 3TYYA 2OYHA 1KYOD 2GM4A 3AE8C 3L37A 1NTZE 1FC2C 1YIJP 1CI6A 1VL2A 2A06G 4K35A 4TLFA 3GLMA 2QJPC 3CD6P 3CI9A 1BGYD 1L4AB 1Q7YQ 1BSHA 2QJPB 1EZVI 2WPQA 1NTKJ 5AVZB 1QEXA 1GDTA 4I7ZB 1S3JA 3EWKA 1KC8Q 3BCCE 2K3RA 3R4YA 4PV1B 3AEEC 2FYZA 2HYNA 4IOIH 3CCJP 1URQD 1FOSF 2I8DA 2OYIB 3H1JJ 2YXRB 1URQA 3L71J 5AVTB 5CJ4A 1GD2E 1IFJA 2V7QH 3H32A 2H88C 2E75D 1SFCC 3L75J 1HJBA 4NPDA 3RBZA 1KYOI 3VMAA 2J58A 2NRGA 2YMYA 1L4AD 4YPCA 2AEFA 3RK3D 1RQUA 2H43A 5EFWB 1IO4A 3H1ID 3K5BA 2Y0DA 2IYOA 1IFDA 3CXHH 3JSVC 1PP9D 2KLUA 1NGMB 2HPCA 1NOHA 1YI2P 2OYHC 2WWWA 3L70J 3WUTA 3H1LG 1RE4C 4H44B 5AW8B 3H1HJ 3RK2D 1J1DB 2JP3A 1JY2O 3VP8A 1EZVE 2YIUC 1K9MQ 1IJDB 2QSIA 2RKLA 3L73D 2B87A 3TSIA 1RY3A 3ABVC 4JYBA 4OGQD 2OTKE 4AYCA 1LTSC 2FXOA 5KLIB 4BRYA 1OWAA 1RE4A 1KILC 4H13D 2KS1B 2R3SA 3IN6A 2FFDC 1PGJA 3I55P 1DD3A 2KUBA 3NTNA 3H25A 1USEA 1SFCD 3CXHD 3L73J 2OTLP 1SFCA 2XKMA 3RK2B 3FWNA 1OX3A 1U57A 4U3FG 1T2KD 3EFGA 1KB9E 1MKMA 1URQC 5H2FE 2P10A 3V2RA 2XNDH 3PJSK 4NPEA 3NMDA 3MHVA 4GOFA 4RJTA 1NU1E 4R4LA 3VMYA 3CCQP 2QM7A 2WITA 1FE6A 1JMBA 3LW5H 1NKNA 2J59M 2WSCH 4Y99C 1JB0J 1EZVD 3D6YA 3KZIE 3B5NA 3AECC 2O01J 2KZIA 2ZYGA 3B5ND 2BEZF 5AW1B 4D6TJ 1EXJA 2WMMA 1IFIA 1EZVG 2A45H 1MUUA 1HJ0A 2KLVA 2KXPB 1SQVE 3CCRP 2KI7B 1KB9I 3G4SP 1KILE 1SP4A 2WPSA 4OWFA 3I5CA 3SWKA 2OYIA 3L71D 2IX7C 3L72E 2Y9YA 2FYUJ 4M3LA 1GL2C 1LTAC 3U59A 5GTIH 5KAFH 1SQPG 3HE5B 4KJMA 4RO0A 3RK3C 2MKVA 2P67A 1H89A 3IR9A 1FZGA 2KK7A 1EDKA 4WBAA 4L75A 1U7JA 4R4MA 3GMAA 1PV3A 5AW6B 2W83C 1NTZJ 1OFCX 4PD4I 2K88A 1GL2A 3KHUA 2R5DA 2R44A 1LTJA 3PRJA 5E79H 1LWUB 3PTZA 3A2AA 3BASA 4GKGA 1LTBC 3O6QA 2KSJA 3EFFK 1FZCB 1JNMA 1SQXG 3AE1C 1JCDA 3HD7A 4H0LB 1KV4A 3TGUG 1RF1B 5CHXA 3H1KG 1N7SC 1PL5A 1HVVA 1HGVA 1T3JA 2IPPA 4WB4A 3B5NC 2WT7A 1Q81Q 1FDMA 1NJIQ 2CPSA 1LTJC 1IC2A 1OXZA 2A45G 1YQ4C 5KAIE 3L71E 1N7LA 1ZLLA 3L75D 2NZ2A 1ZV8A 1XTCC 1NTMK 5DJTB 1UIIA 1WT6A 3V6IA 1S5LE 4DOJA 5CCHC 2KP8A 1IFNA 1ZRTD 2CK3H 2JEEA 3Q3DA 4ZKPA 1JTHA 3GHGA 4H0LD 1R8EA 1RF1A 4GIFA 5KKZB 3SFEC 4Y28J 5CBNA 3CWBD 3H1LE 3A7OA 2E74C 3CX5I 4JF7A 1H88A 1DH3A 1H0TB 2FYUK 2WSEJ 5APQA 2QIWA 1L0LK 2PGDA 1CSBA
chains in the Genus database with same CATH topology
1KB9H 1SQXG 3TGUG 3L73G 3H1KG 1L0LG 3CX5H 3L74G 4PD4H 2BCCG 1NTMG 3L75G 1EZVG 3BCCG 2FYUG 3L71G 1P84H 3H1JG 3H1IG 1SQVG 3CWBG 1L0NG 1BCCG 1SQQG 2IBZG 1PPJG 1SQPG 4D6TG 1NTKG 3L72G 1BGYG 5KLVG 3H1HG 4U3FG 1NU1G 3L70G 1PP9G 3CXHH 1SQBG 1KYOH 1NTZG 2A06G 1BE3G 3H1LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 H;  1SQX G;  3TGU G;  3L73 G;  3H1K G;  1L0L G;  3CX5 H;  3L74 G;  4PD4 H;  2BCC G;  1NTM G;  3L75 G;  1EZV G;  3BCC G;  2FYU G;  3L71 G;  1P84 H;  3H1J G;  3H1I G;  1SQV G;  3CWB G;  1L0N G;  1BCC G;  1SQQ G;  2IBZ G;  1PPJ G;  1SQP G;  4D6T G;  1NTK G;  3L72 G;  1BGY G;  5KLV G;  3H1H G;  4U3F G;  1NU1 G;  3L70 G;  1PP9 G;  3CXH H;  1SQB G;  1KYO H;  1NTZ G;  2A06 G;  1BE3 G;  3H1L G; 
#chains in the Genus database with same CATH topology
 2ZJS E;  1FU1 A;  2M5A A;  1N73 A;  1R5L A;  3B5N B;  4KT0 J;  3P8C D;  2YMK A;  1L0L G;  1FJK A;  1MZ9 A;  4MN4 C;  1L0L D;  2G8Y A;  1YTZ I;  4D6T D;  1J1E B;  4H44 D;  1K05 A;  5AW9 B;  4EYY Q;  1KZU B;  1NVO A;  1S5L X;  1Y47 A;  3CWB J;  4HH2 A;  3KDP B;  4TT3 H;  2H7H A;  1IK7 A;  2PP6 A;  2WSF J;  3AEA C;  4YXW H;  2IZ1 A;  3CWB G;  5APS A;  3T97 B;  4BXL A;  2Q9I A;  2C0W A;  2FBW C;  1SQV K;  2WT7 B;  3GG2 A;  2IBZ G;  2YNY A;  1NTK D;  2HG5 D;  2FXP A;  1KOR A;  3C1L A;  3GW6 A;  3KPE A;  1J1E C;  4LLH A;  1S9K E;  3N4X A;  3C8V A;  1SQP K;  5KAF E;  2N1T B;  2W90 A;  1NTK K;  5GTH H;  3Q2Y A;  3KZI H;  2WSC J;  1GL2 B;  1LP1 B;  1AQT A;  2V7Q J;  1K73 Q;  1R5S A;  2PFX A;  2BEQ D;  4PJ0 E;  1M1J A;  2O3J A;  1CZQ A;  2AXC A;  2AXT H;  2OYO A;  1RE3 A;  3M91 A;  1N7S D;  4H0L C;  5APT A;  2QJK C;  4OH8 B;  5TIS E;  3CL3 D;  1DX7 A;  5E79 E;  2FYN C;  2O1J A;  2YXQ B;  2JR8 A;  1AVY A;  1L2P A;  3BRT B;  4BWN A;  5GTI E;  4EOT A;  2OQQ A;  1RH5 B;  1JMM A;  3FGA D;  3U1C A;  3CX5 E;  1YHQ P;  1M7L A;  4OVN F;  5AVY B;  3L70 D;  4CPG A;  2C9N Y;  3MUD C;  2FYU D;  1OVR A;  2Y9Z A;  1SQQ G;  3GF7 A;  2WSF H;  4D6T E;  1NTK E;  2KOG A;  2C0X A;  2Q7C A;  4YXD C;  1OW6 A;  2HFE D;  1P84 D;  2IZ0 A;  2ZFC A;  3H1K J;  2IFN A;  4IFF A;  3TGU J;  3OW2 O;  1FZE A;  4PJ0 H;  1Q90 D;  1N7S B;  2Q5U A;  3W67 A;  5KLV G;  1QVG O;  1NTZ D;  2YKO A;  2ZXX A;  3A5T A;  1ZR2 A;  4WWI A;  2JDI H;  4LC1 A;  2P7J A;  3AE5 C;  3MIW A;  3OAK A;  1SQB J;  1VPC A;  3FXE A;  1NTZ G;  1VF5 D;  4I7Z C;  1FZC C;  1EXI A;  4EDF A;  4LGD E;  1OZH A;  3HUS B;  1L4A C;  1KYO E;  1MV8 A;  4EIJ A;  1T2K C;  3G9R A;  3L74 D;  1YQ3 C;  2NPS C;  3L74 G;  2PAJ A;  3TK1 A;  2ZYD A;  1SQP J;  2Y0E A;  4ASV A;  1AVO A;  1FZF A;  3H1K E;  2YKQ A;  5CCH A;  1BCC E;  1JY2 P;  1GTW A;  1RE3 C;  2Y0C A;  3GHG C;  1FZA A;  2D2C C;  1LT9 C;  1DEE G;  2E75 C;  2FYU E;  3PP5 A;  2RMZ A;  5AW5 B;  3S1K A;  3CWB E;  1VQ7 P;  5CMZ A;  3L4F A;  5AVU B;  2KYV A;  4GOE A;  5KJ7 D;  4D6T G;  2ZT9 C;  3AEG C;  1SQQ E;  1PIX A;  2K9Y A;  3AE2 C;  3L74 J;  2DW3 A;  4IL6 E;  3RK3 E;  5KJ7 A;  2FFD B;  2R32 A;  2W6J H;  4C7N A;  3L70 E;  3P8C E;  1IZN B;  3RL0 B;  4B86 A;  1KQS O;  4H13 C;  1DIP A;  1NYH A;  1NTZ K;  3E1I A;  1SQB G;  3SFD C;  2WTY A;  1N86 A;  3W68 A;  5AW2 B;  2AEJ A;  1VF5 C;  3AE9 C;  2QVA A;  5KLV J;  2XNX A;  4H44 C;  2FY8 A;  3PHL A;  2IBZ D;  1ZP0 C;  3O8Z A;  5AW0 B;  2H89 C;  4JBZ A;  1IK9 A;  2QRX A;  3WUU A;  4C46 A;  2M5A B;  1OVV A;  2NPS B;  3OJA B;  5KAI H;  1YJW P;  1FZC A;  1N73 B;  1SQQ J;  2YO2 A;  1BCC D;  1SVF A;  1YBK A;  1KIL D;  2XDJ A;  3V2Q A;  1MFZ A;  3G6E P;  2WSS H;  1YJN P;  1VQK P;  2YKP A;  2LKM A;  3VMZ A;  4U7J A;  1AFO A;  3VTP C;  1N8R Q;  5APY A;  5KLV D;  1AQ5 A;  2JKV A;  2UWJ E;  1NO4 A;  1PPJ E;  4UB8 E;  3I56 P;  4W7Z A;  2B9B A;  1ZR4 A;  4U3F E;  2OYI C;  1JEK A;  3HTK A;  2RH0 A;  3VOP A;  3L70 G;  3SWY A;  3Q1M A;  3Q5S A;  2W8Z A;  1VF5 B;  1GL2 D;  1W2B O;  1M90 Q;  2CPB A;  1FS0 E;  1J2J B;  2N1T A;  1LP1 A;  1A02 F;  2OYH B;  2ZT9 D;  2N1T D;  4RKU J;  3CCM P;  1X79 B;  3LID A;  1PGO A;  3VP9 A;  3D6Z A;  1YJ9 P;  2WPV B;  4L74 A;  3B4S A;  4HKZ H;  3LIE A;  1SQX K;  4N78 D;  3AEB C;  1SQP D;  2JWA A;  3RL0 C;  3PH0 A;  4IFD K;  2QM8 A;  1X22 A;  3H1J G;  1M8O B;  1KFM A;  1KTM A;  4PD4 E;  3H1J E;  1LT9 A;  1AA0 A;  1WMK A;  3TNU B;  1KMI Z;  1NWQ A;  1LGH B;  1IFM A;  1NU1 K;  1QGK B;  1W2E A;  3S9O A;  1Q2N A;  1ZN5 A;  2IBZ E;  2Z5H A;  5APX A;  3AED C;  1JTH B;  2H8P D;  1M57 D;  3H1K D;  5L8R J;  3L35 A;  5AW3 B;  2B87 B;  2FKW B;  1L0L J;  1FDO A;  1NAF A;  3B8E B;  1HUC A;  5KLV K;  1GZL A;  1FDI A;  3AE3 C;  3A0B E;  4AQR D;  2Q1K A;  3IF4 A;  2E43 A;  1G2C B;  1H0T A;  1JO5 A;  1M1J B;  2WZ7 A;  3M0D C;  1SQB D;  3H1L D;  1L0N D;  2E76 D;  3TDK A;  3FX0 A;  4ZMD A;  5KKZ C;  1NHL A;  3F89 A;  5AVS B;  1Q82 Q;  2R3C A;  4JYC A;  1LT9 B;  1Y8A A;  2HPC B;  5GTH E;  4W7Y A;  2P1J A;  2QE7 H;  1KB9 H;  2M0B A;  1QVF O;  1KQL A;  3HD7 C;  2WSE H;  3WU2 E;  2OTJ P;  2W27 A;  1SQX D;  3HE4 A;  4HYT B;  1D7M A;  5C39 A;  1SQQ D;  3VMX A;  1KN7 A;  1BCC J;  1L0N K;  3C9I A;  3M9Q A;  1GK4 A;  1RF0 C;  3HUS C;  4H13 B;  4PD4 D;  3T97 A;  5KTB A;  3KQG A;  1BDC A;  1HBW A;  1KD1 Q;  2QJY C;  1QL2 A;  1PGQ A;  1VQO P;  2AEM A;  1G1J A;  5KJ7 C;  3CCS P;  4WVZ A;  1VQP P;  1SQP E;  3CMA P;  2QJK B;  1T3U A;  3QWO C;  2RN0 A;  4UB6 E;  4IL6 X;  3LW5 J;  1H8A A;  3L72 G;  4XE5 B;  2B88 A;  1KFN A;  2I1K A;  1SQX J;  2E75 B;  3H32 B;  4JPZ B;  1OIP A;  2J5U A;  3UIA A;  4UB8 H;  1YIT P;  1SQB E;  2IDB A;  1VDF A;  3MUD A;  1X9V A;  2KZJ A;  2N1T C;  3G3Z A;  5M1B A;  1Z56 A;  2HLO A;  2IBZ I;  2XZR A;  1NU1 J;  2SPZ A;  2ZVN B;  4WY4 B;  3VYI A;  3BCC D;  3AE7 C;  5AVV B;  1M1K Q;  1NTM E;  3TGU D;  1OVU A;  4WY4 A;  2BCC G;  5CCG D;  2WVR A;  1USD A;  2VRS A;  3E1R A;  2FYU G;  4XFJ A;  5B5E E;  2POH A;  1CI6 B;  1W5C E;  2AXT E;  1JM0 A;  3CX5 D;  3M06 A;  4NPF X;  1KQF B;  3WMM 0;  1LWU C;  5APV A;  4DZO A;  2P58 A;  2N9Y B;  2K37 A;  5CJ0 A;  3GHG B;  3JCU H;  1VQ9 P;  3BCC J;  1FOS E;  1SQB K;  1CW5 A;  1MFT A;  1PPJ G;  3CXH I;  1P84 I;  2W6B A;  2B89 A;  2KSE A;  1G1I A;  4K3A A;  1BGY G;  2KNC B;  3CC2 P;  1DD4 A;  5B66 H;  1JY2 N;  4L76 A;  2E74 B;  2E76 C;  1VQM P;  1GK6 A;  1LTJ B;  1NKZ B;  1LWU A;  1TU3 F;  1PP9 G;  3A3Y B;  1AV1 A;  3B71 A;  3JC2 2;  1URQ B;  4HJG H;  2XV5 A;  4IL6 H;  1K04 A;  3ZDM A;  4RES B;  2O01 H;  1S9K D;  1JY3 P;  1PP9 E;  2A06 E;  1X0T A;  4U3F J;  3HD7 D;  3RL0 D;  1XTG B;  4IFM A;  3MTU E;  1K8A Q;  3L73 G;  5APW A;  3CX5 H;  3II6 A;  3FWL A;  3O6Q B;  4I6M C;  1BSN A;  4ASW A;  5AVR B;  3USS A;  1FAV A;  1VQL P;  2GUS A;  3WU2 H;  2GA1 A;  2O1K A;  3IAO A;  2NPS A;  1L0N G;  1VQN P;  2NPS D;  1L0N E;  1P84 E;  1U7M A;  2A45 I;  3CXH E;  5CBO A;  3CC4 P;  3D70 A;  4N6J A;  3SWF A;  3VN0 A;  4DT0 A;  2W6A A;  3RK2 C;  3MGN A;  3H1H G;  1OMI A;  5K5G B;  1QL1 A;  2E42 A;  2D2C D;  3H1L J;  5AW4 B;  1NH4 A;  3CME P;  1OW7 A;  2E76 B;  1KYO H;  1KB9 D;  2P2U A;  3KXD A;  3M0A A;  2K9J A;  4I2L C;  4OGQ C;  1RQV A;  2LXB A;  2ZYA A;  3V2P A;  2KB7 P;  2HOD A;  3L74 E;  4Y99 B;  3G71 P;  1SFC B;  1X8Y A;  1GW4 A;  4WY4 C;  1YTZ T;  2V4H A;  3ITK A;  4PD4 H;  5APU A;  3L73 E;  2M3E A;  1NAY A;  3L72 D;  3MD0 A;  3OA7 A;  3L75 G;  4O9B A;  1GU5 A;  2FFD A;  2YIU B;  1KIL A;  1JY3 N;  3L71 G;  2Q3I A;  1UIX A;  2A06 D;  1IFP A;  3H1I J;  1PFI A;  3H1I G;  1SQV D;  1E79 H;  4BRY B;  3P8M C;  2QA4 P;  1QLE D;  3P7K A;  4ZNC A;  5AW7 B;  3QH9 A;  4QMA A;  1G2C A;  1Y9B A;  1HF9 A;  2Q6Q A;  4C7R A;  2BCC D;  1M1J C;  1NTK G;  1ZXG A;  2K1A A;  3CLQ A;  4HB1 A;  2ITA A;  3M9H A;  3S4R A;  1ZW0 A;  4GDO A;  2JO1 A;  4GT1 A;  1PGP A;  2HR3 A;  4Z1M H;  3H1H E;  4GOD A;  1VQ8 P;  1FJP A;  2MJZ A;  2E5Y A;  4JQ0 D;  2QG4 A;  3P32 A;  1KQG B;  2N9B A;  4ZKU A;  3MP7 B;  1NU1 D;  5B66 E;  5AVW B;  3V5B A;  4OGQ B;  3SSU A;  2ZVO B;  3HE4 B;  3EQ2 A;  3V2N A;  1HGZ A;  4DJG A;  1ZOY C;  3BAT A;  3M9B A;  2L5G B;  4PV1 C;  3L36 A;  1YYC A;  5CCG C;  1BE3 E;  1BDD A;  1N7S A;  5BU8 B;  5TJH A;  3N7N A;  3L75 E;  3JCU E;  2OAR A;  1E5W A;  1NTM G;  2KS1 A;  1OW8 A;  2WPR A;  4WY4 D;  3V4Q A;  1L0N J;  2KIK A;  1EC5 A;  3RBX A;  2R5B A;  3AE4 C;  3BRV B;  1S1C X;  2IFM A;  4UB6 H;  5BU5 A;  1SQV G;  2GUV A;  3R2P A;  2LXC B;  3RK3 B;  5H2F H;  3HE5 A;  1FBM A;  1T6A A;  1WRG A;  1L4A A;  5KLV E;  1M56 D;  1VQ4 P;  1JY3 O;  1PPJ D;  1RF1 C;  1RHZ B;  1BE3 J;  1BGY E;  4I1L A;  1HWT C;  3A0H E;  1T8Z A;  2K9J B;  1VQ6 P;  1PP9 J;  1EDI A;  4U3F D;  1LTG C;  2E74 D;  1SLQ A;  1ZME C;  2M3B A;  3H6P A;  4L73 A;  5AVQ B;  4EI2 A;  1S72 P;  2ZAE B;  1BGY J;  5B5E H;  3M0D A;  3H1H D;  1JCC A;  1FZB A;  1QX8 A;  2O01 N;  3MZW B;  2Z4E A;  3FXD A;  2E5T A;  1S4X A;  3HD7 B;  3BCC G;  4N78 E;  2G3A A;  4DCK A;  5CCH D;  1Q86 Q;  1S5L H;  1N2D C;  1DEB A;  1SS1 A;  3V4W A;  2JJL A;  4PV1 D;  2ZXE B;  4XA4 A;  3TNU A;  1HTL C;  3H1J D;  4YTP C;  3CPW O;  3A0B H;  1GU4 A;  1GW3 A;  3A0H H;  3H1I E;  2BCC J;  3CCV P;  4C7N B;  3TF5 A;  2XU6 A;  1ZRT E;  4KHX A;  3IFM A;  3D71 A;  4AUW A;  1NU1 G;  1EDJ A;  2ZT9 B;  2FXM A;  5KLI C;  3WUV A;  3CCU P;  2BAS A;  3CC7 P;  2QEX P;  3GF3 A;  3Q5R A;  2M8R A;  4A7P A;  2PRR A;  1LTT C;  2D2C B;  1BE3 G;  2L91 A;  1HH0 A;  1NTM D;  1J1D C;  3TGU E;  5AVX B;  1SQX E;  3NXS A;  2IYP A;  3L72 J;  5CCG A;  3Q5P A;  1GMJ A;  1LT1 A;  2I1J A;  3CCL P;  1L0L E;  3BVH A;  2BCC E;  2JWD A;  1S2E A;  1RF0 A;  3HUS A;  2C9L Y;  1EQ7 A;  3RL0 g;  1P84 H;  1PZQ A;  1SQV J;  5TIS H;  1JUN A;  3KYQ A;  3RGU A;  2OGU A;  3HRN A;  2Q3E A;  3PLN A;  5BVZ A;  3CCE P;  2QJY B;  1KIL B;  2FYN B;  1AJY A;  1BCC G;  3AE6 C;  1EDL A;  2KNC A;  2WQY C;  3NFQ A;  1JOC A;  1NTM J;  3E7K A;  3U1A A;  3HTK B;  3AEF C;  1A02 J;  4W80 A;  1SQQ K;  2LR2 A;  1LTI C;  2YO3 A;  3F5H A;  5DJU B;  1N73 C;  1LJ2 A;  1VQ5 P;  4N3Y B;  1BE3 D;  1LNQ A;  2HOD B;  2Z5I A;  3TYY A;  2OYH A;  1KYO D;  2GM4 A;  3AE8 C;  3L37 A;  1NTZ E;  1FC2 C;  1YIJ P;  1CI6 A;  1VL2 A;  2A06 G;  4K35 A;  4TLF A;  3GLM A;  2QJP C;  3CD6 P;  3CI9 A;  1BGY D;  1L4A B;  1Q7Y Q;  1BSH A;  2QJP B;  1EZV I;  2WPQ A;  1NTK J;  5AVZ B;  1QEX A;  1GDT A;  4I7Z B;  1S3J A;  3EWK A;  1KC8 Q;  3BCC E;  2K3R A;  3R4Y A;  4PV1 B;  3AEE C;  2FYZ A;  2HYN A;  4IOI H;  3CCJ P;  1URQ D;  1FOS F;  2I8D A;  2OYI B;  3H1J J;  2YXR B;  1URQ A;  3L71 J;  5AVT B;  5CJ4 A;  1GD2 E;  1IFJ A;  2V7Q H;  3H32 A;  2H88 C;  2E75 D;  1SFC C;  3L75 J;  1HJB A;  4NPD A;  3RBZ A;  1KYO I;  3VMA A;  2J58 A;  2NRG A;  2YMY A;  1L4A D;  4YPC A;  2AEF A;  3RK3 D;  1RQU A;  2H43 A;  5EFW B;  1IO4 A;  3H1I D;  3K5B A;  2Y0D A;  2IYO A;  1IFD A;  3CXH H;  3JSV C;  1PP9 D;  2KLU A;  1NGM B;  2HPC A;  1NOH A;  1YI2 P;  2OYH C;  2WWW A;  3L70 J;  3WUT A;  3H1L G;  1RE4 C;  4H44 B;  5AW8 B;  3H1H J;  3RK2 D;  1J1D B;  2JP3 A;  1JY2 O;  3VP8 A;  1EZV E;  2YIU C;  1K9M Q;  1IJD B;  2QSI A;  2RKL A;  3L73 D;  2B87 A;  3TSI A;  1RY3 A;  3ABV C;  4JYB A;  4OGQ D;  2OTK E;  4AYC A;  1LTS C;  2FXO A;  5KLI B;  4BRY A;  1OWA A;  1RE4 A;  1KIL C;  4H13 D;  2KS1 B;  2R3S A;  3IN6 A;  2FFD C;  1PGJ A;  3I55 P;  1DD3 A;  2KUB A;  3NTN A;  3H25 A;  1USE A;  1SFC D;  3CXH D;  3L73 J;  2OTL P;  1SFC A;  2XKM A;  3RK2 B;  3FWN A;  1OX3 A;  1U57 A;  4U3F G;  1T2K D;  3EFG A;  1KB9 E;  1MKM A;  1URQ C;  5H2F E;  2P10 A;  3V2R A;  2XND H;  3PJS K;  4NPE A;  3NMD A;  3MHV A;  4GOF A;  4RJT A;  1NU1 E;  4R4L A;  3VMY A;  3CCQ P;  2QM7 A;  2WIT A;  1FE6 A;  1JMB A;  3LW5 H;  1NKN A;  2J59 M;  2WSC H;  4Y99 C;  1JB0 J;  1EZV D;  3D6Y A;  3KZI E;  3B5N A;  3AEC C;  2O01 J;  2KZI A;  2ZYG A;  3B5N D;  2BEZ F;  5AW1 B;  4D6T J;  1EXJ A;  2WMM A;  1IFI A;  1EZV G;  2A45 H;  1MUU A;  1HJ0 A;  2KLV A;  2KXP B;  1SQV E;  3CCR P;  2KI7 B;  1KB9 I;  3G4S P;  1KIL E;  1SP4 A;  2WPS A;  4OWF A;  3I5C A;  3SWK A;  2OYI A;  3L71 D;  2IX7 C;  3L72 E;  2Y9Y A;  2FYU J;  4M3L A;  1GL2 C;  1LTA C;  3U59 A;  5GTI H;  5KAF H;  1SQP G;  3HE5 B;  4KJM A;  4RO0 A;  3RK3 C;  2MKV A;  2P67 A;  1H89 A;  3IR9 A;  1FZG A;  2KK7 A;  1EDK A;  4WBA A;  4L75 A;  1U7J A;  4R4M A;  3GMA A;  1PV3 A;  5AW6 B;  2W83 C;  1NTZ J;  1OFC X;  4PD4 I;  2K88 A;  1GL2 A;  3KHU A;  2R5D A;  2R44 A;  1LTJ A;  3PRJ A;  5E79 H;  1LWU B;  3PTZ A;  3A2A A;  3BAS A;  4GKG A;  1LTB C;  3O6Q A;  2KSJ A;  3EFF K;  1FZC B;  1JNM A;  1SQX G;  3AE1 C;  1JCD A;  3HD7 A;  4H0L B;  1KV4 A;  3TGU G;  1RF1 B;  5CHX A;  3H1K G;  1N7S C;  1PL5 A;  1HVV A;  1HGV A;  1T3J A;  2IPP A;  4WB4 A;  3B5N C;  2WT7 A;  1Q81 Q;  1FDM A;  1NJI Q;  2CPS A;  1LTJ C;  1IC2 A;  1OXZ A;  2A45 G;  1YQ4 C;  5KAI E;  3L71 E;  1N7L A;  1ZLL A;  3L75 D;  2NZ2 A;  1ZV8 A;  1XTC C;  1NTM K;  5DJT B;  1UII A;  1WT6 A;  3V6I A;  1S5L E;  4DOJ A;  5CCH C;  2KP8 A;  1IFN A;  1ZRT D;  2CK3 H;  2JEE A;  3Q3D A;  4ZKP A;  1JTH A;  3GHG A;  4H0L D;  1R8E A;  1RF1 A;  4GIF A;  5KKZ B;  3SFE C;  4Y28 J;  5CBN A;  3CWB D;  3H1L E;  3A7O A;  2E74 C;  3CX5 I;  4JF7 A;  1H88 A;  1DH3 A;  1H0T B;  2FYU K;  2WSE J;  5APQ A;  2QIW A;  1L0L K;  2PGD A;  1CSB A; 
#chains in the Genus database with same CATH homology
 1KB9 H;  1SQX G;  3TGU G;  3L73 G;  3H1K G;  1L0L G;  3CX5 H;  3L74 G;  4PD4 H;  2BCC G;  1NTM G;  3L75 G;  1EZV G;  3BCC G;  2FYU G;  3L71 G;  1P84 H;  3H1J G;  3H1I G;  1SQV G;  3CWB G;  1L0N G;  1BCC G;  1SQQ G;  2IBZ G;  1PPJ G;  1SQP G;  4D6T G;  1NTK G;  3L72 G;  1BGY G;  5KLV G;  3H1H G;  4U3F G;  1NU1 G;  3L70 G;  1PP9 G;  3CXH H;  1SQB G;  1KYO H;  1NTZ G;  2A06 G;  1BE3 G;  3H1L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...