5KLVG

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 5klvG00
1SQBG 3H1KG 1L0NG 3CX5H 3H1IG 1SQVG 4U3FG 1PPJG 1SQQG 2FYUG 3L70G 1SQXG 3BCCG 1NTMG 1PP9G 1BE3G 3H1HG 2BCCG 3L71G 3TGUG 3H1LG 2IBZG 1EZVG 1SQPG 3L72G 3L73G 3H1JG 3CXHH 1KB9H 1NTKG 1KYOH 3L75G 1BCCG 4D6TG 2A06G 1NTZG 3L74G 1L0LG 4PD4H 1NU1G 1BGYG 1P84H 5KLVG 3CWBG
chains in the Genus database with same CATH superfamily
2CPBA 2IBZI 4PV1C 2Y0EA 1AV1A 5BU5A 1MFZA 2OTLP 1H8AA 3H1HD 4DZOA 2PAJA 4C7NA 1KMIZ 3CPWO 1L0LE 1S9KE 3M0DA 1X0TA 2H89C 2O1JA 4U7JA 4PD4H 3BVHA 2XNDH 5GTHH 1SQQD 5KAFH 4BWNA 2N1TD 1LTAC 4UB8E 2HPCB 1P84D 4WY4D 1GU5A 1JOCA 1GZLA 2K9JB 1BE3G 1LJ2A 1IFNA 4XE5B 2YIUB 4K35A 1SFCC 1PP9J 1DD4A 1KYOH 2WSCJ 2YKPA 2A06G 3T97B 2KIKA 3PRJA 4OGQD 3IFMA 5GTIH 5C39A 4ZMDA 1N73C 2WSSH 4Z1MH 2OQQA 3L73J 2WTYA 3NFQA 3B5ND 1EDLA 4H13C 1BGYD 3H1IG 4H44D 5AW8B 1RQUA 2J59M 2OARA 5AW5B 2K9YA 2L91A 2CK3H 1NAFA 3BCCJ 2OYHC 1IFJA 4ASVA 3AEEC 1VQLP 2K88A 1M1KQ 2HODA 3NXSA 3L74J 2KNCA 3HTKB 3O6QA 2QIWA 2O01N 2OTJP 2PFXA 1G1JA 3VP9A 3HRNA 2NPSB 4PD4D 4TT3H 1U57A 5APYA 1LP1B 2ZT9B 1S2EA 2A45G 1FS0E 3OA7A 3L70G 2WSEJ 1LTSC 3L72E 5CCGC 1JY2N 3RL0B 1NYHA 2R5DA 1PZQA 1SQVK 1HVVA 5KLIC 3MZWB 1YJNP 4YTPC 2D2CD 3EFFK 1HTLC 3AECC 4OGQB 1BE3D 3WUVA 1ZMEC 1JTHA 2N9YB 2IDBA 1QGKB 1SQQK 3CD6P 1M7LA 2R5BA 1GL2A 2CPSA 2NZ2A 4D6TG 3BASA 2A06D 2I1JA 2Q5UA 2M5AA 4GOEA 4JYBA 1SFCA 2KYVA 1PIXA 5BU8B 2BCCG 1E79H 4WVZA 3TGUG 1GK6A 2ZVNB 3MD0A 3B4SA 1SQXK 2M0BA 3L75G 2Q3IA 3PJSK 3VTPC 1J2JB 1OZHA 1BDCA 3VOPA 4XA4A 3V4WA 1EQ7A 4OVNF 2FYNB 4PJ0H 2RH0A 1FZAA 2AXTH 1L4AD 4HB1A 4OWFA 2JP3A 1E5WA 4W7ZA 1OVRA 1GDTA 1PPJD 4ZKPA 2IYPA 1SQVJ 2IYOA 3H1HJ 1RF0C 2JWAA 4K3AA 3L71J 3H6PA 1MZ9A 5KAIE 1G2CA 3KPEA 3V5BA 1PP9E 4HJGH 3L70D 1IC2A 1NTMG 1SQQJ 4IOIH 2WMMA 3BRVB 5B66E 4EIJA 1TU3F 1EDJA 3Q1MA 3AEBC 1IFMA 1M1JC 3V2PA 1BCCG 3G9RA 1OXZA 1S3JA 1VPCA 4A7PA 3H1KG 2JKVA 3AE1C 2ZAEB 5AVWB 3L73E 1FDMA 2KSJA 1SQXJ 2HFED 3H1LD 3A0HE 5CCGD 3KYQA 4D6TD 2L5GB 3BCCE 3RBZA 4OH8B 5APSA 1HH0A 4U3FJ 2BEZF 2BCCD 2Z5IA 3G6EP 5CBOA 3TGUD 1L4AB 2Q9IA 3L74E 2E75D 1ZW0A 5AVSB 1T3UA 3L75D 2KXPB 4LGDE 2KK7A 1AVOA 4YPCA 4IL6E 5KJ7C 1RE3A 1BGYJ 2B9BA 4I7ZC 2YXQB 2XU6A 2E74D 3SWYA 2IBZG 2LXCB 5AVQB 4NPEA 3R4YA 2PP6A 1USEA 1KB9E 3N4XA 2HLOA 1EZVE 1EXIA 1KQLA 2V7QH 2KLVA 1DD3A 1LT9B 1USDA 2JDIH 3RL0g 1Q90D 4I1LA 3CWBG 1JY3O 5CJ0A 3N7NA 1NTMD 2XNXA 1QVGO 1OX3A 1L0NK 1W5CE 1XTGB 1H0TA 1CI6B 1VQOP 4JQ0D 1W2EA 1BCCD 1NTZG 3IF4A 1SQPK 1XTCC 2KZJA 2QM7A 2NPSC 3VN0A 3H1KD 1SQBD 3W68A 2ZT9C 3GF3A 1PGPA 5CHXA 2BEQD 3MIWA 1YQ3C 2PGDA 1BE3J 2LR2A 3NMDA 1MV8A 3P32A 2E75B 1M56D 3RL0C 3CCMP 3PTZA 3M9BA 2FYUG 5KLVD 3OW2O 4Y99B 5BVZA 1FZCB 4DT0A 2E74B 1ZRTE 1NH4A 2HPCA 2QJKC 3U59A 2OYIB 1YIJP 2GUVA 1KILD 1SQVE 4DOJA 4XFJA 1LWUB 2K9JA 4C7RA 3A0BH 1UIXA 4JYCA 2K37A 3L71E 3H25A 2YO3A 1G1IA 5AW6B 1VF5D 3CCRP 1FOSE 2IBZD 1DX7A 3D71A 4H0LD 4UB6E 3F5HA 1SQQE 1FZFA 1L0LG 3T97A 1KB9I 1EZVI 1IO4A 2KS1B 1N2DC 3W67A 1RF1B 1L0NJ 1P84E 3CX5I 1IFPA 3Q3DA 5B5EE 3M06A 3AE6C 3BRTB 5EFWB 1SQPJ 1Q7YQ 1VQMP 4N6JA 1SQXE 2WPSA 1FAVA 2QEXP 1S72P 2BASA 2FXPA 4L74A 1S5LE 2O3JA 3PHLA 2B87B 2HG5D 1VL2A 1SLQA 1RE4A 1IK7A 1NU1E 1OVUA 3AE7C 1IK9A 3KDPB 4U3FE 4KHXA 3CXHE 3HTKA 2IZ1A 2M3EA 1LTGC 3GHGB 3AEAC 3D70A 3PLNA 1EC5A 1ZLLA 3HE4B 2WVRA 2NPSA 2FFDB 3G4SP 3H1LJ 1NTMK 1LP1A 1DIPA 1FDOA 4RJTA 1KILB 2YO2A 4D6TJ 1BDDA 2KSEA 5CJ4A 5TISE 5H2FH 1ZV8A 3PH0A 2FYUD 4QMAA 4WBAA 1GL2C 1SQBK 2GA1A 3S9OA 2B88A 1NKZB 5CCHD 4H0LB 3SWKA 1T8ZA 4GIFA 3H1JJ 3H32B 1CW5A 3RK3D 1URQB 4PD4E 2K1AA 1JY2P 1Q86Q 2R3SA 1KORA 5GTHE 4C46A 2QJPC 5KLVK 1N7SD 5KAFE 2JEEA 1VQKP 3HD7B 1L0LD 1S9KD 1N86A 2Z5HA 3TYYA 3VP8A 1P84I 3S4RA 5CBNA 4I2LC 3KXDA 1J1DB 3L72G 1NOHA 2W83C 4ASWA 1VQ6P 3P7KA 2G3AA 3Q5SA 3JCUH 1KYOE 1QVFO 1BSNA 3PP5A 4DJGA 5E79H 1NTMJ 2N1TB 3Q5PA 2J5UA 1U7JA 1NWQA 1M90Q 1HBWA 5GTIE 2HYNA 4IFFA 2RMZA 3CXHI 4WY4B 3KQGA 5AW1B 1GU4A 2E76C 2W6BA 1SQBJ 2A45H 2YMKA 3O8ZA 3P8MC 4PV1D 1J1EB 3VYIA 4L73A 1PGQA 3RK3B 2QG4A 5KLVJ 2E43A 1N7SB 1FZBA 1VQ8P 3A7OA 2ZXEB 2QJYC 5APWA 1L0NE 3V2RA 3AE4C 1PPJE 3B5NB 1ZR2A 2ITAA 4PD4I 2WPRA 4H44B 2W8ZA 1SQPE 1R8EA 2C9NY 2W27A 5APUA 4WB4A 1RE3C 2JO1A 1AFOA 1SFCD 3II6A 1X22A 3GW6A 2V7QJ 3H1ID 1JUNA 1PP9G 4BXLA 1GW4A 3MP7B 1T2KC 5APQA 1L4AA 3L72D 3ZDMA 4TLFA 5AVRB 2UWJE 1PV3A 1KYOI 4EI2A 1HUCA 5B66H 3H1LE 1X9VA 2M8RA 4HKZH 1JNMA 2O1KA 3RK2C 3HUSB 4H13D 3L73G 2PRRA 1H88A 2KOGA 2P10A 2O01H 2YXRB 5KKZB 3MTUE 1QL1A 3TNUB 3BCCG 2D2CB 2R32A 3H1JE 1FU1A 2J58A 2JWDA 3TSIA 4PJ0E 1UIIA 2OTKE 1N8RQ 3C9IA 2AXTE 3L74G 5AVYB 1FE6A 3CCQP 1EXJA 1KQSO 3SFEC 1ZN5A 3G71P 1CI6A 4JBZA 1YQ4C 1GW3A 1YTZI 4NPFX 2FFDC 3R2PA 3VMZA 1FC2C 3U1AA 5M1BA 1PL5A 4AQRD 4O9BA 1AQ5A 1EZVG 5K5GB 1KN7A 1Q2NA 2WT7B 2GUSA 2YIUC 3P8CD 1NTME 2P7JA 3CX5H 1FJKA 2FKWB 5L8RJ 1FZCA 1LTJB 1N73B 2OYIA 1ZXGA 4H13B 4IFDK 1KFNA 1EDIA 1A02F 1SQBE 2IFNA 1NKNA 2KB7P 2FXMA 2OYHB 2NRGA 3E7KA 2IZ0A 5KLVE 4EDFA 1LNQA 3CCUP 1KD1Q 1EDKA 2KS1A 1RE4C 1VQ5P 1RF1A 1GK4A 4R4MA 3F89A 3BCCD 1KILE 2N9BA 4YXDC 1JM0A 2H88C 3QH9A 1JY2O 2WPVB 1LGHB 3AEGC 1KFMA 2OYOA 3L74D 3QWOC 2C9LY 4R4LA 1SQVG 1FZEA 3KHUA 1NHLA 2B87A 5AW0B 1T3JA 3VMAA 3L71G 1WT6A 2P67A 4M3LA 4GKGA 1RQVA 3GMAA 1W2BO 2E5TA 4AYCA 5KLIB 2FY8A 1JCCA 2YKQA 1X79B 5AVUB 3C1LA 3WU2E 4N78E 4MN4C 3MGNA 3V6IA 1JEKA 3GHGA 3SFDC 1Y8AA 3V2QA 3JSVC 3HE4A 2FYZA 3K5BA 1KB9D 2FFDA 1EZVD 5DJTB 1KILA 1NTKG 2Y0CA 3KZIE 4OGQC 1YYCA 3CX5D 2OGUA 5AW3B 2Z4EA 3H1HE 2RN0A 1SQXG 1QLED 4LLHA 1HJBA 3H1IJ 2FBWC 3B5NC 1HJ0A 4H44C 1VQ9P 3E1IA 1KZUB 3H32A 2E5YA 1NU1G 5TJHA 1URQA 4U3FG 3HE5B 1MFTA 1K8AQ 2P2UA 3M9QA 2QE7H 3FWLA 1WMKA 3LW5H 5APXA 2RKLA 3CCVP 5KJ7D 3HD7A 2FYNC 2WPQA 4I6MC 1YI2P 3NTNA 3CWBD 1HWTC 3A0BE 4UB8H 3L70J 1KV4A 2C0XA 3RK3E 1ZRTD 3HUSC 4HH2A 3IAOA 4GOFA 1NTZD 2XDJA 2Q7CA 3BATA 2DW3A 2IX7C 1SQVD 1KQFB 3I56P 1NVOA 5KKZC 1M1JB 1T6AA 2N1TA 3L71D 4L76A 1U7MA 1FOSF 2D2CC 1BGYE 4WY4A 3FXDA 1L2PA 3L4FA 1H89A 3CC2P 2AXCA 1IZNB 3IN6A 1S1CX 3CCLP 1VF5B 2ZYGA 5CCHA 2BCCJ 2NPSD 1OW7A 3TGUJ 3G3ZA 2G8YA 2ZT9D 1NTKD 3I5CA 3CLQA 4BRYB 3LIDA 1FDIA 1NAYA 3L75J 1JB0J 1K9MQ 1SVFA 3RL0D 1SQXD 2POHA 2MKVA 1N7SA 1WRGA 1JMBA 1YHQP 1Q82Q 3CMAP 3WUTA 5CMZA 2FXOA 1NJIQ 1JY3P 4I7ZB 1OWAA 2LKMA 3B5NA 1L4AC 1A02J 1NU1D 1Q81Q 3FXEA 1OIPA 4U3FD 4RO0A 2ZFCA 3CXHD 5H2FE 3GF7A 3L36A 2QVAA 1LTJC 1PGJA 2O01J 3A3YB 1BE3E 3EQ2A 3FWNA 2W90A 3M9HA 3V4QA 1VDFA 3FGAD 4EYYQ 1ZOYC 2A06E 4C7NB 2Y9YA 3UIAA 5AVTB 3U1CA 1LT9C 1BCCJ 3CCSP 1L0NG 1KC8Q 1PPJG 2WSFH 2V4HA 3H1KJ 3WUUA 3HUSA 2IPPA 4NPDA 1SQPG 1JY3N 3H1IE 2GM4A 1YJWP 3TNUA 2KI7B 3AEFC 3AE3C 2ZXXA 2ZVOB 3JCUE 1NTZK 1LT1A 2AEMA 3EWKA 5AW2B 1ZR4A 5E79E 2E75C 3B8EB 2Q3EA 3E1RA 3MHVA 2QJKB 4DCKA 2SPZA 2W6JH 3H1LG 1K04A 1KYOD 1K05A 2FYUK 4Y99C 4HYTB 1JO5A 2JJLA 1FZCC 2KP8A 2E74C 3L70E 1GL2D 3JC22 1Z56A 2OYIC 1M57D 1NTKK 1X8YA 4Y28J 4IL6X 2YNYA 2KLUA 2WITA 1LWUC 2ZYDA 5APTA 2JR8A 5KAIH 3Q5RA 3RBXA 3SWFA 3H1JG 4JPZB 2WT7A 1NGMB 3AE8C 4GT1A 2VRSA 3L37A 1JMMA 2R3CA 2QM8A 2WSCH 1JCDA 1GD2E 1LTJA 1Y9BA 2HODB 1N73A 2AEJA 2KNCB 3O6QB 3CWBJ 1L0LK 1NU1K 1IFIA 2XKMA 4D6TE 2Y9ZA 3TF5A 4PV1B 5KTBA 1RF1C 2Q1KA 2H8PD 2QA4P 4ZNCA 2OYHA 2BCCE 1ZP0C 2I1KA 4LC1A 3TGUE 1NTZJ 1L0ND 3USSA 2XZRA 3A0HH 1OVVA 3GLMA 4W80A 1LT9A 3L75E 1QEXA 3P8CE 1KQGB 1SQPD 5AW4B 1GTWA 1VQ4P 1PFIA 1VQPP 2E42A 3ABVC 2MJZA 2XV5A 1BSHA 1K73Q 3MUDC 4CPGA 1YITP 3CMEP 2FYUJ 2B89A 1IJDB 1JTHB 3GHGC 5CCGA 2KUBA 2E76D 4GDOA 4IL6H 4W7YA 1GL2B 1NTKJ 1HGVA 3OAKA 1SQBG 1RHZB 2M5AB 1SFCB 2WQYC 1KILC 2IFMA 1CZQA 2I8DA 1AA0A 1GMJA 2WSEH 4EOTA 2M3BA 3A5TA 3V2NA 3CC7P 2A45I 2Y0DA 1KB9H 3EFGA 3M0AA 1AQTA 4IFMA 3I55P 2H7HA 3CI9A 1VF5C 1MKMA 2QJPB 1YTZT 5KLVG 4GODA 3ITKA 4H0LC 1L0LJ 1NU1J 1N7LA 1R5SA 2YMYA 1S4XA 3LW5J 3RGUA 1PP9D 1BCCE 1D7MA 1DEEG 1QX8A 1M8OB 4AUWA 1URQC 4JF7A 3IR9A 2P58A 2WWWA 3H1JD 3H1KE 1OW8A 1LWUA 3VMXA 2ZJSE 3AEDC 3HD7C 1RH5B 3AE9C 3M91A 3L35A 3L73D 5AW7B 1VQ7P 1J1DC 1LTBC 1FBMA 1QL2A 3B71A 1T2KD 1G2CB 2AEFA 3AE2C 3HE5A 3D6ZA 1R5LA 3CX5E 1S5LX 2C0WA 1DEBA 3WU2H 1KTMA 4RKUJ 2WZ7A 2ZYAA 3Q2YA 1NO4A 2E76B 2QRXA 2N1TC 3C8VA 1HF9A 1RF0A 3RK2D 3VMYA 2Q6QA 3M0DC 2IBZE 1RY3A 3H1HG 1SS1A 4WY4C 3KZIH 2LXBA 1MUUA 1VQNP 3MUDA 4ZKUA 3SSUA 4L75A 4RESB 5APVA 3D6YA 2K3RA 2P1JA 1YBKA 3WMM0 5CCHC 1SQQG 1J1EC 1M1JA 3GG2A 2QJYB 4UB6H 3LIEA 1Y47A 1FJPA 3AE5C 3CCEP 1OFCX 4N3YB 3RK3C 1LTTC 3OJAB 2R44A 3CWBE 4B86A 1OW6A 1N7SC 1P84H 1OMIA 2HR3A 3A2AA 3TK1A 2W6AA 5B5EH 4YXWH 2KZIA 4WWIA 1FZGA 1NTZE 1SP4A 3CL3D 5AVZB 4BRYA 5AVXB 3L72J 1CSBA 2YKOA 1PGOA 5AW9B 1S5LH 1HGZA 1YJ9P 1AVYA 4KJMA 5KJ7A 3CCJP 1DH3A 3CXHH 1LTIC 2FYUE 1BGYG 2QSIA 2WSFJ 3RK2B 1AJYA 1URQD 5AVVB 3FX0A 1IFDA 4N78D 2H43A 1NTKE 3TDKA 3S1KA 3CC4P 3HD7D 1H0TB 5TISH 4KT0J 5DJUB
chains in the Genus database with same CATH topology
1SQBG 3H1KG 1L0NG 3CX5H 3H1IG 1SQVG 4U3FG 1PPJG 1SQQG 2FYUG 3L70G 1SQXG 3BCCG 1NTMG 1PP9G 1BE3G 3H1HG 2BCCG 3L71G 3TGUG 3H1LG 2IBZG 1EZVG 1SQPG 3L72G 3L73G 3H1JG 3CXHH 1KB9H 1NTKG 1KYOH 3L75G 1BCCG 4D6TG 2A06G 1NTZG 3L74G 1L0LG 4PD4H 1NU1G 1BGYG 1P84H 5KLVG 3CWBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB G;  3H1K G;  1L0N G;  3CX5 H;  3H1I G;  1SQV G;  4U3F G;  1PPJ G;  1SQQ G;  2FYU G;  3L70 G;  1SQX G;  3BCC G;  1NTM G;  1PP9 G;  1BE3 G;  3H1H G;  2BCC G;  3L71 G;  3TGU G;  3H1L G;  2IBZ G;  1EZV G;  1SQP G;  3L72 G;  3L73 G;  3H1J G;  3CXH H;  1KB9 H;  1NTK G;  1KYO H;  3L75 G;  1BCC G;  4D6T G;  2A06 G;  1NTZ G;  3L74 G;  1L0L G;  4PD4 H;  1NU1 G;  1BGY G;  1P84 H;  5KLV G;  3CWB G; 
#chains in the Genus database with same CATH topology
 2CPB A;  2IBZ I;  4PV1 C;  2Y0E A;  1AV1 A;  5BU5 A;  1MFZ A;  2OTL P;  1H8A A;  3H1H D;  4DZO A;  2PAJ A;  4C7N A;  1KMI Z;  3CPW O;  1L0L E;  1S9K E;  3M0D A;  1X0T A;  2H89 C;  2O1J A;  4U7J A;  4PD4 H;  3BVH A;  2XND H;  5GTH H;  1SQQ D;  5KAF H;  4BWN A;  2N1T D;  1LTA C;  4UB8 E;  2HPC B;  1P84 D;  4WY4 D;  1GU5 A;  1JOC A;  1GZL A;  2K9J B;  1BE3 G;  1LJ2 A;  1IFN A;  4XE5 B;  2YIU B;  4K35 A;  1SFC C;  1PP9 J;  1DD4 A;  1KYO H;  2WSC J;  2YKP A;  2A06 G;  3T97 B;  2KIK A;  3PRJ A;  4OGQ D;  3IFM A;  5GTI H;  5C39 A;  4ZMD A;  1N73 C;  2WSS H;  4Z1M H;  2OQQ A;  3L73 J;  2WTY A;  3NFQ A;  3B5N D;  1EDL A;  4H13 C;  1BGY D;  3H1I G;  4H44 D;  5AW8 B;  1RQU A;  2J59 M;  2OAR A;  5AW5 B;  2K9Y A;  2L91 A;  2CK3 H;  1NAF A;  3BCC J;  2OYH C;  1IFJ A;  4ASV A;  3AEE C;  1VQL P;  2K88 A;  1M1K Q;  2HOD A;  3NXS A;  3L74 J;  2KNC A;  3HTK B;  3O6Q A;  2QIW A;  2O01 N;  2OTJ P;  2PFX A;  1G1J A;  3VP9 A;  3HRN A;  2NPS B;  4PD4 D;  4TT3 H;  1U57 A;  5APY A;  1LP1 B;  2ZT9 B;  1S2E A;  2A45 G;  1FS0 E;  3OA7 A;  3L70 G;  2WSE J;  1LTS C;  3L72 E;  5CCG C;  1JY2 N;  3RL0 B;  1NYH A;  2R5D A;  1PZQ A;  1SQV K;  1HVV A;  5KLI C;  3MZW B;  1YJN P;  4YTP C;  2D2C D;  3EFF K;  1HTL C;  3AEC C;  4OGQ B;  1BE3 D;  3WUV A;  1ZME C;  1JTH A;  2N9Y B;  2IDB A;  1QGK B;  1SQQ K;  3CD6 P;  1M7L A;  2R5B A;  1GL2 A;  2CPS A;  2NZ2 A;  4D6T G;  3BAS A;  2A06 D;  2I1J A;  2Q5U A;  2M5A A;  4GOE A;  4JYB A;  1SFC A;  2KYV A;  1PIX A;  5BU8 B;  2BCC G;  1E79 H;  4WVZ A;  3TGU G;  1GK6 A;  2ZVN B;  3MD0 A;  3B4S A;  1SQX K;  2M0B A;  3L75 G;  2Q3I A;  3PJS K;  3VTP C;  1J2J B;  1OZH A;  1BDC A;  3VOP A;  4XA4 A;  3V4W A;  1EQ7 A;  4OVN F;  2FYN B;  4PJ0 H;  2RH0 A;  1FZA A;  2AXT H;  1L4A D;  4HB1 A;  4OWF A;  2JP3 A;  1E5W A;  4W7Z A;  1OVR A;  1GDT A;  1PPJ D;  4ZKP A;  2IYP A;  1SQV J;  2IYO A;  3H1H J;  1RF0 C;  2JWA A;  4K3A A;  3L71 J;  3H6P A;  1MZ9 A;  5KAI E;  1G2C A;  3KPE A;  3V5B A;  1PP9 E;  4HJG H;  3L70 D;  1IC2 A;  1NTM G;  1SQQ J;  4IOI H;  2WMM A;  3BRV B;  5B66 E;  4EIJ A;  1TU3 F;  1EDJ A;  3Q1M A;  3AEB C;  1IFM A;  1M1J C;  3V2P A;  1BCC G;  3G9R A;  1OXZ A;  1S3J A;  1VPC A;  4A7P A;  3H1K G;  2JKV A;  3AE1 C;  2ZAE B;  5AVW B;  3L73 E;  1FDM A;  2KSJ A;  1SQX J;  2HFE D;  3H1L D;  3A0H E;  5CCG D;  3KYQ A;  4D6T D;  2L5G B;  3BCC E;  3RBZ A;  4OH8 B;  5APS A;  1HH0 A;  4U3F J;  2BEZ F;  2BCC D;  2Z5I A;  3G6E P;  5CBO A;  3TGU D;  1L4A B;  2Q9I A;  3L74 E;  2E75 D;  1ZW0 A;  5AVS B;  1T3U A;  3L75 D;  2KXP B;  4LGD E;  2KK7 A;  1AVO A;  4YPC A;  4IL6 E;  5KJ7 C;  1RE3 A;  1BGY J;  2B9B A;  4I7Z C;  2YXQ B;  2XU6 A;  2E74 D;  3SWY A;  2IBZ G;  2LXC B;  5AVQ B;  4NPE A;  3R4Y A;  2PP6 A;  1USE A;  1KB9 E;  3N4X A;  2HLO A;  1EZV E;  1EXI A;  1KQL A;  2V7Q H;  2KLV A;  1DD3 A;  1LT9 B;  1USD A;  2JDI H;  3RL0 g;  1Q90 D;  4I1L A;  3CWB G;  1JY3 O;  5CJ0 A;  3N7N A;  1NTM D;  2XNX A;  1QVG O;  1OX3 A;  1L0N K;  1W5C E;  1XTG B;  1H0T A;  1CI6 B;  1VQO P;  4JQ0 D;  1W2E A;  1BCC D;  1NTZ G;  3IF4 A;  1SQP K;  1XTC C;  2KZJ A;  2QM7 A;  2NPS C;  3VN0 A;  3H1K D;  1SQB D;  3W68 A;  2ZT9 C;  3GF3 A;  1PGP A;  5CHX A;  2BEQ D;  3MIW A;  1YQ3 C;  2PGD A;  1BE3 J;  2LR2 A;  3NMD A;  1MV8 A;  3P32 A;  2E75 B;  1M56 D;  3RL0 C;  3CCM P;  3PTZ A;  3M9B A;  2FYU G;  5KLV D;  3OW2 O;  4Y99 B;  5BVZ A;  1FZC B;  4DT0 A;  2E74 B;  1ZRT E;  1NH4 A;  2HPC A;  2QJK C;  3U59 A;  2OYI B;  1YIJ P;  2GUV A;  1KIL D;  1SQV E;  4DOJ A;  4XFJ A;  1LWU B;  2K9J A;  4C7R A;  3A0B H;  1UIX A;  4JYC A;  2K37 A;  3L71 E;  3H25 A;  2YO3 A;  1G1I A;  5AW6 B;  1VF5 D;  3CCR P;  1FOS E;  2IBZ D;  1DX7 A;  3D71 A;  4H0L D;  4UB6 E;  3F5H A;  1SQQ E;  1FZF A;  1L0L G;  3T97 A;  1KB9 I;  1EZV I;  1IO4 A;  2KS1 B;  1N2D C;  3W67 A;  1RF1 B;  1L0N J;  1P84 E;  3CX5 I;  1IFP A;  3Q3D A;  5B5E E;  3M06 A;  3AE6 C;  3BRT B;  5EFW B;  1SQP J;  1Q7Y Q;  1VQM P;  4N6J A;  1SQX E;  2WPS A;  1FAV A;  2QEX P;  1S72 P;  2BAS A;  2FXP A;  4L74 A;  1S5L E;  2O3J A;  3PHL A;  2B87 B;  2HG5 D;  1VL2 A;  1SLQ A;  1RE4 A;  1IK7 A;  1NU1 E;  1OVU A;  3AE7 C;  1IK9 A;  3KDP B;  4U3F E;  4KHX A;  3CXH E;  3HTK A;  2IZ1 A;  2M3E A;  1LTG C;  3GHG B;  3AEA C;  3D70 A;  3PLN A;  1EC5 A;  1ZLL A;  3HE4 B;  2WVR A;  2NPS A;  2FFD B;  3G4S P;  3H1L J;  1NTM K;  1LP1 A;  1DIP A;  1FDO A;  4RJT A;  1KIL B;  2YO2 A;  4D6T J;  1BDD A;  2KSE A;  5CJ4 A;  5TIS E;  5H2F H;  1ZV8 A;  3PH0 A;  2FYU D;  4QMA A;  4WBA A;  1GL2 C;  1SQB K;  2GA1 A;  3S9O A;  2B88 A;  1NKZ B;  5CCH D;  4H0L B;  3SWK A;  1T8Z A;  4GIF A;  3H1J J;  3H32 B;  1CW5 A;  3RK3 D;  1URQ B;  4PD4 E;  2K1A A;  1JY2 P;  1Q86 Q;  2R3S A;  1KOR A;  5GTH E;  4C46 A;  2QJP C;  5KLV K;  1N7S D;  5KAF E;  2JEE A;  1VQK P;  3HD7 B;  1L0L D;  1S9K D;  1N86 A;  2Z5H A;  3TYY A;  3VP8 A;  1P84 I;  3S4R A;  5CBN A;  4I2L C;  3KXD A;  1J1D B;  3L72 G;  1NOH A;  2W83 C;  4ASW A;  1VQ6 P;  3P7K A;  2G3A A;  3Q5S A;  3JCU H;  1KYO E;  1QVF O;  1BSN A;  3PP5 A;  4DJG A;  5E79 H;  1NTM J;  2N1T B;  3Q5P A;  2J5U A;  1U7J A;  1NWQ A;  1M90 Q;  1HBW A;  5GTI E;  2HYN A;  4IFF A;  2RMZ A;  3CXH I;  4WY4 B;  3KQG A;  5AW1 B;  1GU4 A;  2E76 C;  2W6B A;  1SQB J;  2A45 H;  2YMK A;  3O8Z A;  3P8M C;  4PV1 D;  1J1E B;  3VYI A;  4L73 A;  1PGQ A;  3RK3 B;  2QG4 A;  5KLV J;  2E43 A;  1N7S B;  1FZB A;  1VQ8 P;  3A7O A;  2ZXE B;  2QJY C;  5APW A;  1L0N E;  3V2R A;  3AE4 C;  1PPJ E;  3B5N B;  1ZR2 A;  2ITA A;  4PD4 I;  2WPR A;  4H44 B;  2W8Z A;  1SQP E;  1R8E A;  2C9N Y;  2W27 A;  5APU A;  4WB4 A;  1RE3 C;  2JO1 A;  1AFO A;  1SFC D;  3II6 A;  1X22 A;  3GW6 A;  2V7Q J;  3H1I D;  1JUN A;  1PP9 G;  4BXL A;  1GW4 A;  3MP7 B;  1T2K C;  5APQ A;  1L4A A;  3L72 D;  3ZDM A;  4TLF A;  5AVR B;  2UWJ E;  1PV3 A;  1KYO I;  4EI2 A;  1HUC A;  5B66 H;  3H1L E;  1X9V A;  2M8R A;  4HKZ H;  1JNM A;  2O1K A;  3RK2 C;  3HUS B;  4H13 D;  3L73 G;  2PRR A;  1H88 A;  2KOG A;  2P10 A;  2O01 H;  2YXR B;  5KKZ B;  3MTU E;  1QL1 A;  3TNU B;  3BCC G;  2D2C B;  2R32 A;  3H1J E;  1FU1 A;  2J58 A;  2JWD A;  3TSI A;  4PJ0 E;  1UII A;  2OTK E;  1N8R Q;  3C9I A;  2AXT E;  3L74 G;  5AVY B;  1FE6 A;  3CCQ P;  1EXJ A;  1KQS O;  3SFE C;  1ZN5 A;  3G71 P;  1CI6 A;  4JBZ A;  1YQ4 C;  1GW3 A;  1YTZ I;  4NPF X;  2FFD C;  3R2P A;  3VMZ A;  1FC2 C;  3U1A A;  5M1B A;  1PL5 A;  4AQR D;  4O9B A;  1AQ5 A;  1EZV G;  5K5G B;  1KN7 A;  1Q2N A;  2WT7 B;  2GUS A;  2YIU C;  3P8C D;  1NTM E;  2P7J A;  3CX5 H;  1FJK A;  2FKW B;  5L8R J;  1FZC A;  1LTJ B;  1N73 B;  2OYI A;  1ZXG A;  4H13 B;  4IFD K;  1KFN A;  1EDI A;  1A02 F;  1SQB E;  2IFN A;  1NKN A;  2KB7 P;  2FXM A;  2OYH B;  2NRG A;  3E7K A;  2IZ0 A;  5KLV E;  4EDF A;  1LNQ A;  3CCU P;  1KD1 Q;  1EDK A;  2KS1 A;  1RE4 C;  1VQ5 P;  1RF1 A;  1GK4 A;  4R4M A;  3F89 A;  3BCC D;  1KIL E;  2N9B A;  4YXD C;  1JM0 A;  2H88 C;  3QH9 A;  1JY2 O;  2WPV B;  1LGH B;  3AEG C;  1KFM A;  2OYO A;  3L74 D;  3QWO C;  2C9L Y;  4R4L A;  1SQV G;  1FZE A;  3KHU A;  1NHL A;  2B87 A;  5AW0 B;  1T3J A;  3VMA A;  3L71 G;  1WT6 A;  2P67 A;  4M3L A;  4GKG A;  1RQV A;  3GMA A;  1W2B O;  2E5T A;  4AYC A;  5KLI B;  2FY8 A;  1JCC A;  2YKQ A;  1X79 B;  5AVU B;  3C1L A;  3WU2 E;  4N78 E;  4MN4 C;  3MGN A;  3V6I A;  1JEK A;  3GHG A;  3SFD C;  1Y8A A;  3V2Q A;  3JSV C;  3HE4 A;  2FYZ A;  3K5B A;  1KB9 D;  2FFD A;  1EZV D;  5DJT B;  1KIL A;  1NTK G;  2Y0C A;  3KZI E;  4OGQ C;  1YYC A;  3CX5 D;  2OGU A;  5AW3 B;  2Z4E A;  3H1H E;  2RN0 A;  1SQX G;  1QLE D;  4LLH A;  1HJB A;  3H1I J;  2FBW C;  3B5N C;  1HJ0 A;  4H44 C;  1VQ9 P;  3E1I A;  1KZU B;  3H32 A;  2E5Y A;  1NU1 G;  5TJH A;  1URQ A;  4U3F G;  3HE5 B;  1MFT A;  1K8A Q;  2P2U A;  3M9Q A;  2QE7 H;  3FWL A;  1WMK A;  3LW5 H;  5APX A;  2RKL A;  3CCV P;  5KJ7 D;  3HD7 A;  2FYN C;  2WPQ A;  4I6M C;  1YI2 P;  3NTN A;  3CWB D;  1HWT C;  3A0B E;  4UB8 H;  3L70 J;  1KV4 A;  2C0X A;  3RK3 E;  1ZRT D;  3HUS C;  4HH2 A;  3IAO A;  4GOF A;  1NTZ D;  2XDJ A;  2Q7C A;  3BAT A;  2DW3 A;  2IX7 C;  1SQV D;  1KQF B;  3I56 P;  1NVO A;  5KKZ C;  1M1J B;  1T6A A;  2N1T A;  3L71 D;  4L76 A;  1U7M A;  1FOS F;  2D2C C;  1BGY E;  4WY4 A;  3FXD A;  1L2P A;  3L4F A;  1H89 A;  3CC2 P;  2AXC A;  1IZN B;  3IN6 A;  1S1C X;  3CCL P;  1VF5 B;  2ZYG A;  5CCH A;  2BCC J;  2NPS D;  1OW7 A;  3TGU J;  3G3Z A;  2G8Y A;  2ZT9 D;  1NTK D;  3I5C A;  3CLQ A;  4BRY B;  3LID A;  1FDI A;  1NAY A;  3L75 J;  1JB0 J;  1K9M Q;  1SVF A;  3RL0 D;  1SQX D;  2POH A;  2MKV A;  1N7S A;  1WRG A;  1JMB A;  1YHQ P;  1Q82 Q;  3CMA P;  3WUT A;  5CMZ A;  2FXO A;  1NJI Q;  1JY3 P;  4I7Z B;  1OWA A;  2LKM A;  3B5N A;  1L4A C;  1A02 J;  1NU1 D;  1Q81 Q;  3FXE A;  1OIP A;  4U3F D;  4RO0 A;  2ZFC A;  3CXH D;  5H2F E;  3GF7 A;  3L36 A;  2QVA A;  1LTJ C;  1PGJ A;  2O01 J;  3A3Y B;  1BE3 E;  3EQ2 A;  3FWN A;  2W90 A;  3M9H A;  3V4Q A;  1VDF A;  3FGA D;  4EYY Q;  1ZOY C;  2A06 E;  4C7N B;  2Y9Y A;  3UIA A;  5AVT B;  3U1C A;  1LT9 C;  1BCC J;  3CCS P;  1L0N G;  1KC8 Q;  1PPJ G;  2WSF H;  2V4H A;  3H1K J;  3WUU A;  3HUS A;  2IPP A;  4NPD A;  1SQP G;  1JY3 N;  3H1I E;  2GM4 A;  1YJW P;  3TNU A;  2KI7 B;  3AEF C;  3AE3 C;  2ZXX A;  2ZVO B;  3JCU E;  1NTZ K;  1LT1 A;  2AEM A;  3EWK A;  5AW2 B;  1ZR4 A;  5E79 E;  2E75 C;  3B8E B;  2Q3E A;  3E1R A;  3MHV A;  2QJK B;  4DCK A;  2SPZ A;  2W6J H;  3H1L G;  1K04 A;  1KYO D;  1K05 A;  2FYU K;  4Y99 C;  4HYT B;  1JO5 A;  2JJL A;  1FZC C;  2KP8 A;  2E74 C;  3L70 E;  1GL2 D;  3JC2 2;  1Z56 A;  2OYI C;  1M57 D;  1NTK K;  1X8Y A;  4Y28 J;  4IL6 X;  2YNY A;  2KLU A;  2WIT A;  1LWU C;  2ZYD A;  5APT A;  2JR8 A;  5KAI H;  3Q5R A;  3RBX A;  3SWF A;  3H1J G;  4JPZ B;  2WT7 A;  1NGM B;  3AE8 C;  4GT1 A;  2VRS A;  3L37 A;  1JMM A;  2R3C A;  2QM8 A;  2WSC H;  1JCD A;  1GD2 E;  1LTJ A;  1Y9B A;  2HOD B;  1N73 A;  2AEJ A;  2KNC B;  3O6Q B;  3CWB J;  1L0L K;  1NU1 K;  1IFI A;  2XKM A;  4D6T E;  2Y9Z A;  3TF5 A;  4PV1 B;  5KTB A;  1RF1 C;  2Q1K A;  2H8P D;  2QA4 P;  4ZNC A;  2OYH A;  2BCC E;  1ZP0 C;  2I1K A;  4LC1 A;  3TGU E;  1NTZ J;  1L0N D;  3USS A;  2XZR A;  3A0H H;  1OVV A;  3GLM A;  4W80 A;  1LT9 A;  3L75 E;  1QEX A;  3P8C E;  1KQG B;  1SQP D;  5AW4 B;  1GTW A;  1VQ4 P;  1PFI A;  1VQP P;  2E42 A;  3ABV C;  2MJZ A;  2XV5 A;  1BSH A;  1K73 Q;  3MUD C;  4CPG A;  1YIT P;  3CME P;  2FYU J;  2B89 A;  1IJD B;  1JTH B;  3GHG C;  5CCG A;  2KUB A;  2E76 D;  4GDO A;  4IL6 H;  4W7Y A;  1GL2 B;  1NTK J;  1HGV A;  3OAK A;  1SQB G;  1RHZ B;  2M5A B;  1SFC B;  2WQY C;  1KIL C;  2IFM A;  1CZQ A;  2I8D A;  1AA0 A;  1GMJ A;  2WSE H;  4EOT A;  2M3B A;  3A5T A;  3V2N A;  3CC7 P;  2A45 I;  2Y0D A;  1KB9 H;  3EFG A;  3M0A A;  1AQT A;  4IFM A;  3I55 P;  2H7H A;  3CI9 A;  1VF5 C;  1MKM A;  2QJP B;  1YTZ T;  5KLV G;  4GOD A;  3ITK A;  4H0L C;  1L0L J;  1NU1 J;  1N7L A;  1R5S A;  2YMY A;  1S4X A;  3LW5 J;  3RGU A;  1PP9 D;  1BCC E;  1D7M A;  1DEE G;  1QX8 A;  1M8O B;  4AUW A;  1URQ C;  4JF7 A;  3IR9 A;  2P58 A;  2WWW A;  3H1J D;  3H1K E;  1OW8 A;  1LWU A;  3VMX A;  2ZJS E;  3AED C;  3HD7 C;  1RH5 B;  3AE9 C;  3M91 A;  3L35 A;  3L73 D;  5AW7 B;  1VQ7 P;  1J1D C;  1LTB C;  1FBM A;  1QL2 A;  3B71 A;  1T2K D;  1G2C B;  2AEF A;  3AE2 C;  3HE5 A;  3D6Z A;  1R5L A;  3CX5 E;  1S5L X;  2C0W A;  1DEB A;  3WU2 H;  1KTM A;  4RKU J;  2WZ7 A;  2ZYA A;  3Q2Y A;  1NO4 A;  2E76 B;  2QRX A;  2N1T C;  3C8V A;  1HF9 A;  1RF0 A;  3RK2 D;  3VMY A;  2Q6Q A;  3M0D C;  2IBZ E;  1RY3 A;  3H1H G;  1SS1 A;  4WY4 C;  3KZI H;  2LXB A;  1MUU A;  1VQN P;  3MUD A;  4ZKU A;  3SSU A;  4L75 A;  4RES B;  5APV A;  3D6Y A;  2K3R A;  2P1J A;  1YBK A;  3WMM 0;  5CCH C;  1SQQ G;  1J1E C;  1M1J A;  3GG2 A;  2QJY B;  4UB6 H;  3LIE A;  1Y47 A;  1FJP A;  3AE5 C;  3CCE P;  1OFC X;  4N3Y B;  3RK3 C;  1LTT C;  3OJA B;  2R44 A;  3CWB E;  4B86 A;  1OW6 A;  1N7S C;  1P84 H;  1OMI A;  2HR3 A;  3A2A A;  3TK1 A;  2W6A A;  5B5E H;  4YXW H;  2KZI A;  4WWI A;  1FZG A;  1NTZ E;  1SP4 A;  3CL3 D;  5AVZ B;  4BRY A;  5AVX B;  3L72 J;  1CSB A;  2YKO A;  1PGO A;  5AW9 B;  1S5L H;  1HGZ A;  1YJ9 P;  1AVY A;  4KJM A;  5KJ7 A;  3CCJ P;  1DH3 A;  3CXH H;  1LTI C;  2FYU E;  1BGY G;  2QSI A;  2WSF J;  3RK2 B;  1AJY A;  1URQ D;  5AVV B;  3FX0 A;  1IFD A;  4N78 D;  2H43 A;  1NTK E;  3TDK A;  3S1K A;  3CC4 P;  3HD7 D;  1H0T B;  5TIS H;  4KT0 J;  5DJU B; 
#chains in the Genus database with same CATH homology
 1SQB G;  3H1K G;  1L0N G;  3CX5 H;  3H1I G;  1SQV G;  4U3F G;  1PPJ G;  1SQQ G;  2FYU G;  3L70 G;  1SQX G;  3BCC G;  1NTM G;  1PP9 G;  1BE3 G;  3H1H G;  2BCC G;  3L71 G;  3TGU G;  3H1L G;  2IBZ G;  1EZV G;  1SQP G;  3L72 G;  3L73 G;  3H1J G;  3CXH H;  1KB9 H;  1NTK G;  1KYO H;  3L75 G;  1BCC G;  4D6T G;  2A06 G;  1NTZ G;  3L74 G;  1L0L G;  4PD4 H;  1NU1 G;  1BGY G;  1P84 H;  5KLV G;  3CWB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...