5KLVG

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 5klvG00
3H1LG 1L0LG 3CXHH 1L0NG 1BCCG 1KYOH 1BGYG 3H1IG 3L72G 1SQXG 3L75G 5KLVG 3H1HG 1KB9H 1BE3G 2IBZG 3H1KG 1SQBG 1EZVG 2FYUG 3L70G 3L71G 3L73G 4U3FG 1PPJG 3CWBG 1P84H 4PD4H 1PP9G 1SQQG 3CX5H 1NTKG 3H1JG 1NU1G 2A06G 3L74G 1NTZG 2BCCG 3BCCG 3TGUG 4D6TG 1NTMG 1SQPG 1SQVG
chains in the Genus database with same CATH superfamily
1N7SC 1USEA 2RN0A 2AEJA 4EOTA 1KFNA 4JF7A 1H8AA 2E74D 5AW1B 5EFWB 3AE2C 1VF5B 1Y8AA 3V4QA 3CCRP 2R5DA 3MZWB 5CJ4A 1L0NG 1YJWP 3O6QA 1AJYA 4Z1MH 1QLED 4TT3H 4GT1A 1PP9G 1L0LD 2Y9ZA 1NTKG 4IFMA 3CCEP 1BCCD 2IBZI 4OGQB 3CCUP 1GDTA 3P32A 5CBOA 4R4LA 2YMYA 1NJIQ 1A02J 4XA4A 2BASA 1JTHB 3SSUA 1YQ3C 2XNXA 1EZVI 1PZQA 1KC8Q 1KB9D 2OTJP 2C0XA 3E1RA 2FYNC 1AA0A 1ZMEC 1URQC 4LGDE 1OVUA 4YPCA 3AEDC 3H1LD 2QJKC 5TJHA 1X22A 3CXHI 1NKNA 4IL6E 1NTMG 2ZXXA 5KLVD 1PL5A 2VRSA 2YO2A 4IFDK 1OVVA 1U7MA 3FXDA 1SQBJ 2E42A 1BE3J 1ZOYC 1AVOA 1IFNA 2LR2A 3GW6A 2H88C 2E76D 1JOCA 1OX3A 3H25A 1L0LE 3CXHH 1BCCE 2HG5D 5AW4B 1N7SD 4OH8B 4IL6X 1LTAC 5B5EH 1R8EA 2C9LY 3L73J 1RF0A 1OIPA 4JYCA 4ASVA 3V2QA 5KAFE 2SPZA 5CCGC 3V5BA 2KXPB 2WT7A 3FXEA 1NTZJ 3USSA 1SQPJ 1DD4A 2NPSC 3AE3C 5KLIB 1SQBG 3G3ZA 5GTHE 1VQLP 1KB9E 4EDFA 3CMEP 1T3JA 3VMXA 1LWUA 2KNCA 3LIEA 1ZLLA 3H1LE 4WY4C 2B89A 1NKZB 5KLVE 3I55P 3H1KE 1VPCA 3L73G 4W7ZA 4JYBA 5AVRB 1NTZG 2ZAEB 1DX7A 3CD6P 1KYOD 2ZT9C 3M9QA 2Q9IA 4Y99B 3RK3C 1M56D 3L71D 3HE4A 1LTGC 2E75C 5KAIE 2HYNA 3CWBG 1URQD 3AE6C 3MGNA 1AQTA 2CPSA 1RE4A 1LP1A 3N7NA 2QSIA 2D2CC 3O8ZA 5AW3B 3UIAA 3B71A 3P8CE 2E5TA 4JQ0D 2IFNA 3U1AA 1OMIA 3BVHA 1EDKA 1YTZT 2KS1A 2YKQA 1FS0E 5TISE 5DJTB 3VTPC 1NU1K 1R5SA 3HRNA 2BCCD 4C7NB 4AQRD 3RL0g 3B5NA 2R32A 3IR9A 2C0WA 1JNMA 5CCGD 2QM7A 1D7MA 2M3BA 2ZJSE 1KYOE 4UB6H 1Y47A 3Q5RA 4JBZA 2ZVOB 3CX5D 3FWNA 2MKVA 2A06G 3GG2A 3IN6A 3WMM0 5AVWB 5GTIE 4WY4D 2YMKA 1FOSE 3H1IJ 3HD7B 1DD3A 2FBWC 4D6TD 3Q3DA 3W68A 4IOIH 1AV1A 1AQ5A 1N2DC 1GL2A 3AEAC 1OW8A 1KQLA 2KZIA 3P8MC 3G71P 2ZT9D 4PV1D 5M1BA 2W6JH 2L91A 1JY3O 2E75D 2PP6A 1QL1A 1KILB 1KTMA 1IJDB 1K04A 1S2EA 2O3JA 3GF7A 3AEGC 2FYUD 2D2CD 3A7OA 4XE5B 3PP5A 3PHLA 3E7KA 5KTBA 5BVZA 1JUNA 5AVSB 2XU6A 1PGQA 3BASA 1W2BO 1VQMP 1M90Q 1ZN5A 3H1JJ 2ITAA 1OZHA 1NVOA 5APUA 1SQVJ 2HODA 3VP9A 1SQXE 2W6BA 1SQQD 3MIWA 2JP3A 1VQOP 3H1HJ 3MUDA 3L71G 1NU1D 2UWJE 3NFQA 4K3AA 3RK2C 3KXDA 4D6TE 4L76A 1J2JB 1RE3A 1GU5A 1LWUC 1G2CB 3CCJP 2PRRA 1S1CX 2E74C 5AW5B 4DT0A 1KQFB 2LKMA 2QIWA 3B8EB 2M5AB 3M0AA 3D70A 5APXA 1M57D 1J1DB 4U3FD 2M3EA 1EZVE 2FYUE 2CK3H 2B87B 2FXMA 1L0LK 3TYYA 3L37A 1H88A 5AVQB 1FOSF 2BCCG 3BCCE 2K37A 2FFDB 4EI2A 1RE4C 4YTPC 5AW7B 4QMAA 3C9IA 2E5YA 3L70G 3KDPB 1SQQE 3AE9C 2N9BA 4HH2A 2JR8A 3GMAA 1L4AA 2K9JA 2HLOA 3ABVC 3L72E 1NHLA 4PJ0H 3L75J 4PD4I 3VOPA 2K9YA 3CC7P 1M1KQ 1OXZA 1NOHA 4NPDA 1R5LA 2N1TA 5KLVK 2IYPA 1FAVA 3TK1A 1BSHA 1SVFA 3GHGB 2HPCA 3QWOC 2R3CA 1JY2N 2E76B 4N3YB 1PFIA 1L0NJ 1OVRA 1IK9A 4HYTB 3T97B 2ZFCA 1N7SB 1N86A 2YNYA 4O9BA 1VDFA 2IFMA 3RK2D 3S1KA 1PP9J 1AFOA 1NTKJ 1K9MQ 2ZYGA 2QVAA 1IFPA 1BE3D 4TLFA 3L75G 1HTLC 1P84I 5AW9B 1EXJA 3LW5H 2L5GB 3V2NA 3L74G 5CMZA 5BU5A 1E79H 3L36A 3R2PA 3BRTB 3B4SA 1KQSO 1FBMA 1JY3P 3FX0A 1NYHA 3MP7B 1E5WA 2Y0DA 3CCSP 4EYYQ 1SQPD 4C46A 1P84H 3VMAA 3KZIH 4YXWH 1NU1G 1DH3A 4C7RA 3HE5A 1MFTA 2KOGA 1NTMJ 5H2FE 3S9OA 1BGYJ 3SFEC 3CCVP 1M1JA 2WTYA 3M91A 3CX5H 1CI6A 2KP8A 2FYNB 1FJKA 1URQB 2IZ1A 2YKOA 3P7KA 2QJKB 1GK4A 2M0BA 1SQBE 4WVZA 1BE3E 1FZCA 2Z5IA 5BU8B 4U3FG 1RQVA 1KFMA 3HUSA 3M9BA 2ZYAA 4UB6E 3MUDC 3TGUG 2K3RA 2QJYC 3MTUE 2OYHA 3H1KD 1BGYG 3B5ND 1PPJD 2GM4A 1RE3C 4BRYB 2YXRB 3L73E 4KHXA 1MUUA 1HVVA 4EIJA 3KPEA 1SQPE 1J1EC 1QL2A 2XNDH 2KSJA 1QVGO 1H0TB 4GOFA 3AEBC 5AVZB 3VP8A 1FC2C 4H0LC 1KMIZ 2NPSB 2HR3A 2KIKA 3P8CD 3G9RA 2IX7C 4H13C 1GL2D 1Z56A 1N8RQ 5AVXB 4L73A 3A0HE 1ZV8A 4WY4B 1PIXA 2QEXP 1U7JA 1FDOA 2KSEA 2WSSH 1S4XA 1A02F 3CWBJ 1SQXK 2ZXEB 3CCQP 2H7HA 3SWFA 3R4YA 2OGUA 3AE1C 1VQ5P 5CCHA 1L0LJ 2OYIA 1BCCJ 1RF1A 2G8YA 1L4AC 1HGZA 4Y28J 1PPJE 5B66H 1LTJA 2ZT9B 1EDJA 3RK3B 3IF4A 1VQ6P 3I5CA 1MV8A 3CPWO 2E75B 2JO1A 3II6A 5E79H 1HWTC 1SFCA 2N1TC 3RL0D 1G1IA 4PV1C 1MFZA 3A0BH 2D2CB 4ZNCA 2P10A 4OGQD 2M8RA 4IFFA 1IC2A 1QGKB 1JO5A 2O01N 2FYUK 2OTKE 1YTZI 1L0LG 1BCCG 3FGAD 4I7ZC 3H1LJ 1YJ9P 3EWKA 4LLHA 2YIUC 4LC1A 2YKPA 3CL3D 1BSNA 2WMMA 1WT6A 1S5LH 2C9NY 3CI9A 2B87A 1VQ9P 2J58A 1CZQA 3C8VA 3L4FA 4K35A 1GU4A 2FFDA 1IFMA 5KJ7A 1SQQK 1QVFO 4M3LA 1KZUB 1N73A 3PH0A 2WPQA 2KB7P 1EDLA 3I56P 4H0LD 1PV3A 1FZBA 4OVNF 2QM8A 2WPSA 3H1HD 3H1LG 3OA7A 4BWNA 3AE8C 3QH9A 3H1IE 1IFIA 2W90A 5DJUB 2PGDA 5KLVG 3H1KG 4H13D 1X79B 4PJ0E 4YXDC 2GUSA 3HTKA 1Y9BA 1M1JC 1SQXD 1PGJA 1HBWA 1LT9A 2W6AA 2P67A 2I8DA 2XZRA 3TNUA 3WU2E 1L4AD 3M0DA 5AW8B 3T97A 2KK7A 1FZCC 3HUSC 4W7YA 1VQ8P 4PD4E 2IBZD 2OYOA 4WBAA 3A5TA 2N1TD 3NXSA 2JWAA 1YHQP 2P58A 2Q3EA 2HFED 3L71J 3Q5PA 3VN0A 3H1JE 1SQVE 2WWWA 1KB9I 1EZVD 2RKLA 1NH4A 1CSBA 3H1HE 3EQ2A 2Q5UA 2V4HA 5KAFH 4GKGA 3BCCD 2XV5A 3JCUH 2IDBA 2WT7B 1EQ7A 3V2RA 1VQ7P 3LW5J 2JJLA 3CXHD 1RF0C 3RK2B 2OQQA 1KB9H 1LWUB 2P1JA 1Q2NA 1EC5A 2KNCB 3TF5A 1YITP 3WUVA 2WPVB 1L0ND 2E74B 1JY2O 4XFJA 1JTHA 3L72D 2QG4A 2BCCJ 2AXTH 2WSFH 1PP9D 2IBZE 5AVUB 1NTKD 2WITA 1T3UA 5CCHC 2OYIC 1RF1C 2O1JA 2QE7H 1Q82Q 3L70J 2KUBA 1K8AQ 2BEZF 1LTJC 1EXIA 1VL2A 2Q3IA 3HE4B 5KAIH 2E43A 5APSA 2W8ZA 4KJMA 2A45G 4I1LA 1SFCC 2Q7CA 3JC22 1SQPK 4KT0J 1FZEA 2IPPA 1LP1B 2WSEJ 2FXPA 2H43A 1JB0J 3L75E 2I1KA 3KHUA 1H89A 2XDJA 3CXHE 1USDA 4CPGA 1LTIC 4RO0A 2KS1B 5B5EE 1W5CE 1PGPA 1KYOI 2YO3A 5TISH 2POHA 2NPSA 1L2PA 1L0NE 2GUVA 1ZR4A 1N7LA 4RJTA 1OFCX 1RQUA 1SQXG 2Y0EA 2WVRA 3V4WA 2BEQD 4B86A 2KZJA 1SP4A 3B5NB 5KJ7C 2FYUJ 4I2LC 1N73C 1PP9E 1NTKE 3PRJA 4D6TG 1LT1A 5AW2B 3L74J 4OWFA 3B5NC 3U59A 1KYOH 4AYCA 1NWQA 1WRGA 1FZFA 1NAYA 3D6YA 3MHVA 1FDIA 1LTBC 1Q90D 2A45I 5GTIH 1SQQJ 1YBKA 1NU1J 3AECC 1SQBD 2K88A 3W67A 1XTCC 1TU3F 1IFJA 2NRGA 4NPEA 1LT9C 2FYUG 2FKWB 2KLVA 4ASWA 5CCHD 3CCMP 1HUCA 2FY8A 3M0DC 1DIPA 1WMKA 3BCCG 5L8RJ 2W27A 1NTME 5KKZC 2QJPC 4H44C 2A45H 1BGYE 4GOEA 3L73D 1GL2C 3TSIA 4RKUJ 2RH0A 2G3AA 3CX5I 2I1JA 1NTZD 1SFCD 1SQQG 4U3FJ 2KLUA 1S5LE 3CC4P 3D6ZA 1LGHB 3VMZA 4ZKPA 1OWAA 3TGUJ 2JEEA 1VF5C 5APQA 2H89C 2N9YB 2B88A 2LXCB 3IFMA 3L72G 3CWBD 5APYA 1GW4A 3F5HA 1X0TA 3RL0B 1S3JA 4HKZH 1GK6A 1KILE 1JM0A 1QEXA 5AVVB 5APWA 5K5GB 2MJZA 4C7NA 2O1KA 3D71A 2HODB 1HGVA 1YYCA 3RL0C 4W80A 1S5LX 3CC2P 1AVYA 2WSEH 4HB1A 4N78E 3KYQA 3ZDMA 3TDKA 1JMMA 2QJYB 4OGQC 3Q5SA 2AXCA 1FE6A 1JY2P 2R3SA 5KJ7D 3H32B 2H8PD 3K5BA 1XTGB 1T8ZA 2WSCH 2Q1KA 4MN4C 5AW6B 1J1EB 4A7PA 2V7QH 3HD7A 1IK7A 1NTZE 2WQYC 1VQ4P 3S4RA 4H0LB 1FZAA 1UIIA 4U7JA 1YIJP 1W2EA 2A06D 2OARA 1LTSC 1SQVK 3CWBE 4GODA 4H13B 1YQ4C 1FZGA 1KILA 5CJ0A 2ZVNB 1RHZB 2RMZA 3GF3A 1KORA 4H44D 1JEKA 3A3YB 1M7LA 3AEFC 1FDMA 3E1IA 3EFGA 4DJGA 1IFDA 1L4AB 3M9HA 2K9JB 3WUTA 3JCUE 2Q6QA 1KV4A 3RBZA 1DEEG 2GA1A 1ZR2A 4R4MA 5APVA 1VF5D 3CCLP 2XKMA 1BE3G 2N1TB 4AUWA 1X9VA 3NMDA 3H6PA 4PV1B 2HPCB 3JSVC 2PFXA 5KLIC 3H1ID 1ZW0A 3G4SP 1Q81Q 3Q1MA 1DEBA 1LNQA 1G2CA 4UB8H 2AXTE 1ZP0C 4I7ZB 2YIUB 3Q2YA 2A06E 1VQPP 1QX8A 3F89A 2B9BA 2M5AA 5APTA 1SQPG 2NZ2A 2ZYDA 1FJPA 5KLVJ 1T2KC 2JDIH 3N4XA 1KD1Q 1MKMA 3H1KJ 5AW0B 1NO4A 1JMBA 2OTLP 4PD4D 4Y99C 2CPBA 2WSFJ 2FXOA 4I6MC 4GDOA 3MD0A 2O01J 3O6QB 3PTZA 5C39A 5CBNA 1KQGB 2R5BA 3A2AA 1SLQA 3H1JD 1HH0A 3HE5B 1L0NK 1SQVD 2AEMA 5H2FH 2DW3A 4WWIA 4L74A 3BATA 1NTKK 1M1JB 2IYOA 1GD2E 4DCKA 1GW3A 1JCCA 1CI6B 1PPJG 3V6IA 1FU1A 3SWYA 1P84D 4BXLA 1ZXGA 2LXBA 2P7JA 2AEFA 3L70D 1U57A 3GHGA 1FZCB 3HUSB 2FYZA 2NPSD 3L71E 4IL6H 2K1AA 3V2PA 1X8YA 1N7SA 2J5UA 5AVTB 2Z5HA 2OYHB 4GIFA 2QA4P 1T6AA 2OYHC 1NTMK 3RBXA 1Q7YQ 2Y0CA 3HD7C 1SS1A 3PJSK 3PLNA 3RK3D 1JCDA 1T2KD 4WB4A 2BCCE 1ZRTD 1LJ2A 3L75D 1LTTC 1BDDA 3AEEC 1P84E 1UIXA 3BRVB 3KZIE 3CMAP 1Q86Q 3KQGA 1KILC 3H1IG 3OJAB 3A0HH 5GTHH 4DZOA 3L70E 3L74D 1CW5A 3LIDA 1SQBK 2OYIB 3CX5E 1RF1B 2QRXA 1IO4A 3VMYA 1URQA 1OW6A 1NGMB 4N6JA 1HF9A 1LTJB 3IAOA 3EFFK 2O01H 1S9KD 3SWKA 1SFCB 3H32A 1PGOA 1NAFA 2YXQB 4DOJA 1YJNP 3OW2O 1VQKP 1NTZK 1SQXJ 3AE7C 1OW7A 3RK3E 4BRYA 3H1JG 2IZ0A 1YI2P 3U1CA 3OAKA 1MZ9A 1SQVG 4NPFX 4D6TJ 5AVYB 1ZRTE 2Y9YA 1EDIA 3H1HG 1G1JA 2JWDA 3SFDC 2R44A 1H0TA 3TGUD 5CCGA 1NTMD 1HJBA 2PAJA 1J1DC 2WSCJ 1BGYD 1JY3N 3L74E 1K05A 1IZNB 4HJGH 1S72P 4RESB 3WUUA 3C1LA 3HD7D 3AE5C 1HJ0A 2V7QJ 1N73B 2JKVA 2FFDC 3ITKA 2WPRA 4WY4A 1NU1E 3L35A 1M8OB 1S9KE 3BCCJ 1GMJA 1K73Q 2KYVA 1KILD 4ZKUA 2P2UA 2IBZG 4JPZB 1GTWA 1VQNP 3RGUA 3HTKB 1BDCA 1RY3A 2W83C 2Z4EA 5CHXA 5B66E 1RH5B 1LT9B 3NTNA 4N78D 1KN7A 3AE4C 3CLQA 4ZMDA 5E79E 3TNUB 3M06A 3WU2H 4L75A 2KI7B 3FWLA 5KKZB 2QJPB 1EZVG 3L72J 4H44B 4U3FE 3GHGC 2WZ7A 3A0BE 4UB8E 1GL2B 4PD4H 2E76C 2J59M 3TGUE 1GZLA 3GLMA 3G6EP 3VYIA
chains in the Genus database with same CATH topology
3H1LG 1L0LG 3CXHH 1L0NG 1BCCG 1KYOH 1BGYG 3H1IG 3L72G 1SQXG 3L75G 5KLVG 3H1HG 1KB9H 1BE3G 2IBZG 3H1KG 1SQBG 1EZVG 2FYUG 3L70G 3L71G 3L73G 4U3FG 1PPJG 3CWBG 1P84H 4PD4H 1PP9G 1SQQG 3CX5H 1NTKG 3H1JG 1NU1G 2A06G 3L74G 1NTZG 2BCCG 3BCCG 3TGUG 4D6TG 1NTMG 1SQPG 1SQVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L G;  1L0L G;  3CXH H;  1L0N G;  1BCC G;  1KYO H;  1BGY G;  3H1I G;  3L72 G;  1SQX G;  3L75 G;  5KLV G;  3H1H G;  1KB9 H;  1BE3 G;  2IBZ G;  3H1K G;  1SQB G;  1EZV G;  2FYU G;  3L70 G;  3L71 G;  3L73 G;  4U3F G;  1PPJ G;  3CWB G;  1P84 H;  4PD4 H;  1PP9 G;  1SQQ G;  3CX5 H;  1NTK G;  3H1J G;  1NU1 G;  2A06 G;  3L74 G;  1NTZ G;  2BCC G;  3BCC G;  3TGU G;  4D6T G;  1NTM G;  1SQP G;  1SQV G; 
#chains in the Genus database with same CATH topology
 1N7S C;  1USE A;  2RN0 A;  2AEJ A;  4EOT A;  1KFN A;  4JF7 A;  1H8A A;  2E74 D;  5AW1 B;  5EFW B;  3AE2 C;  1VF5 B;  1Y8A A;  3V4Q A;  3CCR P;  2R5D A;  3MZW B;  5CJ4 A;  1L0N G;  1YJW P;  3O6Q A;  1AJY A;  4Z1M H;  1QLE D;  4TT3 H;  4GT1 A;  1PP9 G;  1L0L D;  2Y9Z A;  1NTK G;  4IFM A;  3CCE P;  1BCC D;  2IBZ I;  4OGQ B;  3CCU P;  1GDT A;  3P32 A;  5CBO A;  4R4L A;  2YMY A;  1NJI Q;  1A02 J;  4XA4 A;  2BAS A;  1JTH B;  3SSU A;  1YQ3 C;  2XNX A;  1EZV I;  1PZQ A;  1KC8 Q;  1KB9 D;  2OTJ P;  2C0X A;  3E1R A;  2FYN C;  1AA0 A;  1ZME C;  1URQ C;  4LGD E;  1OVU A;  4YPC A;  3AED C;  3H1L D;  2QJK C;  5TJH A;  1X22 A;  3CXH I;  1NKN A;  4IL6 E;  1NTM G;  2ZXX A;  5KLV D;  1PL5 A;  2VRS A;  2YO2 A;  4IFD K;  1OVV A;  1U7M A;  3FXD A;  1SQB J;  2E42 A;  1BE3 J;  1ZOY C;  1AVO A;  1IFN A;  2LR2 A;  3GW6 A;  2H88 C;  2E76 D;  1JOC A;  1OX3 A;  3H25 A;  1L0L E;  3CXH H;  1BCC E;  2HG5 D;  5AW4 B;  1N7S D;  4OH8 B;  4IL6 X;  1LTA C;  5B5E H;  1R8E A;  2C9L Y;  3L73 J;  1RF0 A;  1OIP A;  4JYC A;  4ASV A;  3V2Q A;  5KAF E;  2SPZ A;  5CCG C;  3V5B A;  2KXP B;  2WT7 A;  3FXE A;  1NTZ J;  3USS A;  1SQP J;  1DD4 A;  2NPS C;  3AE3 C;  5KLI B;  1SQB G;  3G3Z A;  5GTH E;  1VQL P;  1KB9 E;  4EDF A;  3CME P;  1T3J A;  3VMX A;  1LWU A;  2KNC A;  3LIE A;  1ZLL A;  3H1L E;  4WY4 C;  2B89 A;  1NKZ B;  5KLV E;  3I55 P;  3H1K E;  1VPC A;  3L73 G;  4W7Z A;  4JYB A;  5AVR B;  1NTZ G;  2ZAE B;  1DX7 A;  3CD6 P;  1KYO D;  2ZT9 C;  3M9Q A;  2Q9I A;  4Y99 B;  3RK3 C;  1M56 D;  3L71 D;  3HE4 A;  1LTG C;  2E75 C;  5KAI E;  2HYN A;  3CWB G;  1URQ D;  3AE6 C;  3MGN A;  1AQT A;  2CPS A;  1RE4 A;  1LP1 A;  3N7N A;  2QSI A;  2D2C C;  3O8Z A;  5AW3 B;  3UIA A;  3B71 A;  3P8C E;  2E5T A;  4JQ0 D;  2IFN A;  3U1A A;  1OMI A;  3BVH A;  1EDK A;  1YTZ T;  2KS1 A;  2YKQ A;  1FS0 E;  5TIS E;  5DJT B;  3VTP C;  1NU1 K;  1R5S A;  3HRN A;  2BCC D;  4C7N B;  4AQR D;  3RL0 g;  3B5N A;  2R32 A;  3IR9 A;  2C0W A;  1JNM A;  5CCG D;  2QM7 A;  1D7M A;  2M3B A;  2ZJS E;  1KYO E;  4UB6 H;  1Y47 A;  3Q5R A;  4JBZ A;  2ZVO B;  3CX5 D;  3FWN A;  2MKV A;  2A06 G;  3GG2 A;  3IN6 A;  3WMM 0;  5AVW B;  5GTI E;  4WY4 D;  2YMK A;  1FOS E;  3H1I J;  3HD7 B;  1DD3 A;  2FBW C;  4D6T D;  3Q3D A;  3W68 A;  4IOI H;  1AV1 A;  1AQ5 A;  1N2D C;  1GL2 A;  3AEA C;  1OW8 A;  1KQL A;  2KZI A;  3P8M C;  3G71 P;  2ZT9 D;  4PV1 D;  5M1B A;  2W6J H;  2L91 A;  1JY3 O;  2E75 D;  2PP6 A;  1QL1 A;  1KIL B;  1KTM A;  1IJD B;  1K04 A;  1S2E A;  2O3J A;  3GF7 A;  3AEG C;  2FYU D;  2D2C D;  3A7O A;  4XE5 B;  3PP5 A;  3PHL A;  3E7K A;  5KTB A;  5BVZ A;  1JUN A;  5AVS B;  2XU6 A;  1PGQ A;  3BAS A;  1W2B O;  1VQM P;  1M90 Q;  1ZN5 A;  3H1J J;  2ITA A;  1OZH A;  1NVO A;  5APU A;  1SQV J;  2HOD A;  3VP9 A;  1SQX E;  2W6B A;  1SQQ D;  3MIW A;  2JP3 A;  1VQO P;  3H1H J;  3MUD A;  3L71 G;  1NU1 D;  2UWJ E;  3NFQ A;  4K3A A;  3RK2 C;  3KXD A;  4D6T E;  4L76 A;  1J2J B;  1RE3 A;  1GU5 A;  1LWU C;  1G2C B;  3CCJ P;  2PRR A;  1S1C X;  2E74 C;  5AW5 B;  4DT0 A;  1KQF B;  2LKM A;  2QIW A;  3B8E B;  2M5A B;  3M0A A;  3D70 A;  5APX A;  1M57 D;  1J1D B;  4U3F D;  2M3E A;  1EZV E;  2FYU E;  2CK3 H;  2B87 B;  2FXM A;  1L0L K;  3TYY A;  3L37 A;  1H88 A;  5AVQ B;  1FOS F;  2BCC G;  3BCC E;  2K37 A;  2FFD B;  4EI2 A;  1RE4 C;  4YTP C;  5AW7 B;  4QMA A;  3C9I A;  2E5Y A;  3L70 G;  3KDP B;  1SQQ E;  3AE9 C;  2N9B A;  4HH2 A;  2JR8 A;  3GMA A;  1L4A A;  2K9J A;  2HLO A;  3ABV C;  3L72 E;  1NHL A;  4PJ0 H;  3L75 J;  4PD4 I;  3VOP A;  2K9Y A;  3CC7 P;  1M1K Q;  1OXZ A;  1NOH A;  4NPD A;  1R5L A;  2N1T A;  5KLV K;  2IYP A;  1FAV A;  3TK1 A;  1BSH A;  1SVF A;  3GHG B;  2HPC A;  3QWO C;  2R3C A;  1JY2 N;  2E76 B;  4N3Y B;  1PFI A;  1L0N J;  1OVR A;  1IK9 A;  4HYT B;  3T97 B;  2ZFC A;  1N7S B;  1N86 A;  2YNY A;  4O9B A;  1VDF A;  2IFM A;  3RK2 D;  3S1K A;  1PP9 J;  1AFO A;  1NTK J;  1K9M Q;  2ZYG A;  2QVA A;  1IFP A;  1BE3 D;  4TLF A;  3L75 G;  1HTL C;  1P84 I;  5AW9 B;  1EXJ A;  3LW5 H;  2L5G B;  3V2N A;  3L74 G;  5CMZ A;  5BU5 A;  1E79 H;  3L36 A;  3R2P A;  3BRT B;  3B4S A;  1KQS O;  1FBM A;  1JY3 P;  3FX0 A;  1NYH A;  3MP7 B;  1E5W A;  2Y0D A;  3CCS P;  4EYY Q;  1SQP D;  4C46 A;  1P84 H;  3VMA A;  3KZI H;  4YXW H;  1NU1 G;  1DH3 A;  4C7R A;  3HE5 A;  1MFT A;  2KOG A;  1NTM J;  5H2F E;  3S9O A;  1BGY J;  3SFE C;  3CCV P;  1M1J A;  2WTY A;  3M91 A;  3CX5 H;  1CI6 A;  2KP8 A;  2FYN B;  1FJK A;  1URQ B;  2IZ1 A;  2YKO A;  3P7K A;  2QJK B;  1GK4 A;  2M0B A;  1SQB E;  4WVZ A;  1BE3 E;  1FZC A;  2Z5I A;  5BU8 B;  4U3F G;  1RQV A;  1KFM A;  3HUS A;  3M9B A;  2ZYA A;  4UB6 E;  3MUD C;  3TGU G;  2K3R A;  2QJY C;  3MTU E;  2OYH A;  3H1K D;  1BGY G;  3B5N D;  1PPJ D;  2GM4 A;  1RE3 C;  4BRY B;  2YXR B;  3L73 E;  4KHX A;  1MUU A;  1HVV A;  4EIJ A;  3KPE A;  1SQP E;  1J1E C;  1QL2 A;  2XND H;  2KSJ A;  1QVG O;  1H0T B;  4GOF A;  3AEB C;  5AVZ B;  3VP8 A;  1FC2 C;  4H0L C;  1KMI Z;  2NPS B;  2HR3 A;  2KIK A;  3P8C D;  3G9R A;  2IX7 C;  4H13 C;  1GL2 D;  1Z56 A;  1N8R Q;  5AVX B;  4L73 A;  3A0H E;  1ZV8 A;  4WY4 B;  1PIX A;  2QEX P;  1U7J A;  1FDO A;  2KSE A;  2WSS H;  1S4X A;  1A02 F;  3CWB J;  1SQX K;  2ZXE B;  3CCQ P;  2H7H A;  3SWF A;  3R4Y A;  2OGU A;  3AE1 C;  1VQ5 P;  5CCH A;  1L0L J;  2OYI A;  1BCC J;  1RF1 A;  2G8Y A;  1L4A C;  1HGZ A;  4Y28 J;  1PPJ E;  5B66 H;  1LTJ A;  2ZT9 B;  1EDJ A;  3RK3 B;  3IF4 A;  1VQ6 P;  3I5C A;  1MV8 A;  3CPW O;  2E75 B;  2JO1 A;  3II6 A;  5E79 H;  1HWT C;  1SFC A;  2N1T C;  3RL0 D;  1G1I A;  4PV1 C;  1MFZ A;  3A0B H;  2D2C B;  4ZNC A;  2P10 A;  4OGQ D;  2M8R A;  4IFF A;  1IC2 A;  1QGK B;  1JO5 A;  2O01 N;  2FYU K;  2OTK E;  1YTZ I;  1L0L G;  1BCC G;  3FGA D;  4I7Z C;  3H1L J;  1YJ9 P;  3EWK A;  4LLH A;  2YIU C;  4LC1 A;  2YKP A;  3CL3 D;  1BSN A;  2WMM A;  1WT6 A;  1S5L H;  2C9N Y;  3CI9 A;  2B87 A;  1VQ9 P;  2J58 A;  1CZQ A;  3C8V A;  3L4F A;  4K35 A;  1GU4 A;  2FFD A;  1IFM A;  5KJ7 A;  1SQQ K;  1QVF O;  4M3L A;  1KZU B;  1N73 A;  3PH0 A;  2WPQ A;  2KB7 P;  1EDL A;  3I56 P;  4H0L D;  1PV3 A;  1FZB A;  4OVN F;  2QM8 A;  2WPS A;  3H1H D;  3H1L G;  3OA7 A;  4BWN A;  3AE8 C;  3QH9 A;  3H1I E;  1IFI A;  2W90 A;  5DJU B;  2PGD A;  5KLV G;  3H1K G;  4H13 D;  1X79 B;  4PJ0 E;  4YXD C;  2GUS A;  3HTK A;  1Y9B A;  1M1J C;  1SQX D;  1PGJ A;  1HBW A;  1LT9 A;  2W6A A;  2P67 A;  2I8D A;  2XZR A;  3TNU A;  3WU2 E;  1L4A D;  3M0D A;  5AW8 B;  3T97 A;  2KK7 A;  1FZC C;  3HUS C;  4W7Y A;  1VQ8 P;  4PD4 E;  2IBZ D;  2OYO A;  4WBA A;  3A5T A;  2N1T D;  3NXS A;  2JWA A;  1YHQ P;  2P58 A;  2Q3E A;  2HFE D;  3L71 J;  3Q5P A;  3VN0 A;  3H1J E;  1SQV E;  2WWW A;  1KB9 I;  1EZV D;  2RKL A;  1NH4 A;  1CSB A;  3H1H E;  3EQ2 A;  2Q5U A;  2V4H A;  5KAF H;  4GKG A;  3BCC D;  2XV5 A;  3JCU H;  2IDB A;  2WT7 B;  1EQ7 A;  3V2R A;  1VQ7 P;  3LW5 J;  2JJL A;  3CXH D;  1RF0 C;  3RK2 B;  2OQQ A;  1KB9 H;  1LWU B;  2P1J A;  1Q2N A;  1EC5 A;  2KNC B;  3TF5 A;  1YIT P;  3WUV A;  2WPV B;  1L0N D;  2E74 B;  1JY2 O;  4XFJ A;  1JTH A;  3L72 D;  2QG4 A;  2BCC J;  2AXT H;  2WSF H;  1PP9 D;  2IBZ E;  5AVU B;  1NTK D;  2WIT A;  1T3U A;  5CCH C;  2OYI C;  1RF1 C;  2O1J A;  2QE7 H;  1Q82 Q;  3L70 J;  2KUB A;  1K8A Q;  2BEZ F;  1LTJ C;  1EXI A;  1VL2 A;  2Q3I A;  3HE4 B;  5KAI H;  2E43 A;  5APS A;  2W8Z A;  4KJM A;  2A45 G;  4I1L A;  1SFC C;  2Q7C A;  3JC2 2;  1SQP K;  4KT0 J;  1FZE A;  2IPP A;  1LP1 B;  2WSE J;  2FXP A;  2H43 A;  1JB0 J;  3L75 E;  2I1K A;  3KHU A;  1H89 A;  2XDJ A;  3CXH E;  1USD A;  4CPG A;  1LTI C;  4RO0 A;  2KS1 B;  5B5E E;  1W5C E;  1PGP A;  1KYO I;  2YO3 A;  5TIS H;  2POH A;  2NPS A;  1L2P A;  1L0N E;  2GUV A;  1ZR4 A;  1N7L A;  4RJT A;  1OFC X;  1RQU A;  1SQX G;  2Y0E A;  2WVR A;  3V4W A;  2BEQ D;  4B86 A;  2KZJ A;  1SP4 A;  3B5N B;  5KJ7 C;  2FYU J;  4I2L C;  1N73 C;  1PP9 E;  1NTK E;  3PRJ A;  4D6T G;  1LT1 A;  5AW2 B;  3L74 J;  4OWF A;  3B5N C;  3U59 A;  1KYO H;  4AYC A;  1NWQ A;  1WRG A;  1FZF A;  1NAY A;  3D6Y A;  3MHV A;  1FDI A;  1LTB C;  1Q90 D;  2A45 I;  5GTI H;  1SQQ J;  1YBK A;  1NU1 J;  3AEC C;  1SQB D;  2K88 A;  3W67 A;  1XTC C;  1TU3 F;  1IFJ A;  2NRG A;  4NPE A;  1LT9 C;  2FYU G;  2FKW B;  2KLV A;  4ASW A;  5CCH D;  3CCM P;  1HUC A;  2FY8 A;  3M0D C;  1DIP A;  1WMK A;  3BCC G;  5L8R J;  2W27 A;  1NTM E;  5KKZ C;  2QJP C;  4H44 C;  2A45 H;  1BGY E;  4GOE A;  3L73 D;  1GL2 C;  3TSI A;  4RKU J;  2RH0 A;  2G3A A;  3CX5 I;  2I1J A;  1NTZ D;  1SFC D;  1SQQ G;  4U3F J;  2KLU A;  1S5L E;  3CC4 P;  3D6Z A;  1LGH B;  3VMZ A;  4ZKP A;  1OWA A;  3TGU J;  2JEE A;  1VF5 C;  5APQ A;  2H89 C;  2N9Y B;  2B88 A;  2LXC B;  3IFM A;  3L72 G;  3CWB D;  5APY A;  1GW4 A;  3F5H A;  1X0T A;  3RL0 B;  1S3J A;  4HKZ H;  1GK6 A;  1KIL E;  1JM0 A;  1QEX A;  5AVV B;  5APW A;  5K5G B;  2MJZ A;  4C7N A;  2O1K A;  3D71 A;  2HOD B;  1HGV A;  1YYC A;  3RL0 C;  4W80 A;  1S5L X;  3CC2 P;  1AVY A;  2WSE H;  4HB1 A;  4N78 E;  3KYQ A;  3ZDM A;  3TDK A;  1JMM A;  2QJY B;  4OGQ C;  3Q5S A;  2AXC A;  1FE6 A;  1JY2 P;  2R3S A;  5KJ7 D;  3H32 B;  2H8P D;  3K5B A;  1XTG B;  1T8Z A;  2WSC H;  2Q1K A;  4MN4 C;  5AW6 B;  1J1E B;  4A7P A;  2V7Q H;  3HD7 A;  1IK7 A;  1NTZ E;  2WQY C;  1VQ4 P;  3S4R A;  4H0L B;  1FZA A;  1UII A;  4U7J A;  1YIJ P;  1W2E A;  2A06 D;  2OAR A;  1LTS C;  1SQV K;  3CWB E;  4GOD A;  4H13 B;  1YQ4 C;  1FZG A;  1KIL A;  5CJ0 A;  2ZVN B;  1RHZ B;  2RMZ A;  3GF3 A;  1KOR A;  4H44 D;  1JEK A;  3A3Y B;  1M7L A;  3AEF C;  1FDM A;  3E1I A;  3EFG A;  4DJG A;  1IFD A;  1L4A B;  3M9H A;  2K9J B;  3WUT A;  3JCU E;  2Q6Q A;  1KV4 A;  3RBZ A;  1DEE G;  2GA1 A;  1ZR2 A;  4R4M A;  5APV A;  1VF5 D;  3CCL P;  2XKM A;  1BE3 G;  2N1T B;  4AUW A;  1X9V A;  3NMD A;  3H6P A;  4PV1 B;  2HPC B;  3JSV C;  2PFX A;  5KLI C;  3H1I D;  1ZW0 A;  3G4S P;  1Q81 Q;  3Q1M A;  1DEB A;  1LNQ A;  1G2C A;  4UB8 H;  2AXT E;  1ZP0 C;  4I7Z B;  2YIU B;  3Q2Y A;  2A06 E;  1VQP P;  1QX8 A;  3F89 A;  2B9B A;  2M5A A;  5APT A;  1SQP G;  2NZ2 A;  2ZYD A;  1FJP A;  5KLV J;  1T2K C;  2JDI H;  3N4X A;  1KD1 Q;  1MKM A;  3H1K J;  5AW0 B;  1NO4 A;  1JMB A;  2OTL P;  4PD4 D;  4Y99 C;  2CPB A;  2WSF J;  2FXO A;  4I6M C;  4GDO A;  3MD0 A;  2O01 J;  3O6Q B;  3PTZ A;  5C39 A;  5CBN A;  1KQG B;  2R5B A;  3A2A A;  1SLQ A;  3H1J D;  1HH0 A;  3HE5 B;  1L0N K;  1SQV D;  2AEM A;  5H2F H;  2DW3 A;  4WWI A;  4L74 A;  3BAT A;  1NTK K;  1M1J B;  2IYO A;  1GD2 E;  4DCK A;  1GW3 A;  1JCC A;  1CI6 B;  1PPJ G;  3V6I A;  1FU1 A;  3SWY A;  1P84 D;  4BXL A;  1ZXG A;  2LXB A;  2P7J A;  2AEF A;  3L70 D;  1U57 A;  3GHG A;  1FZC B;  3HUS B;  2FYZ A;  2NPS D;  3L71 E;  4IL6 H;  2K1A A;  3V2P A;  1X8Y A;  1N7S A;  2J5U A;  5AVT B;  2Z5H A;  2OYH B;  4GIF A;  2QA4 P;  1T6A A;  2OYH C;  1NTM K;  3RBX A;  1Q7Y Q;  2Y0C A;  3HD7 C;  1SS1 A;  3PJS K;  3PLN A;  3RK3 D;  1JCD A;  1T2K D;  4WB4 A;  2BCC E;  1ZRT D;  1LJ2 A;  3L75 D;  1LTT C;  1BDD A;  3AEE C;  1P84 E;  1UIX A;  3BRV B;  3KZI E;  3CMA P;  1Q86 Q;  3KQG A;  1KIL C;  3H1I G;  3OJA B;  3A0H H;  5GTH H;  4DZO A;  3L70 E;  3L74 D;  1CW5 A;  3LID A;  1SQB K;  2OYI B;  3CX5 E;  1RF1 B;  2QRX A;  1IO4 A;  3VMY A;  1URQ A;  1OW6 A;  1NGM B;  4N6J A;  1HF9 A;  1LTJ B;  3IAO A;  3EFF K;  2O01 H;  1S9K D;  3SWK A;  1SFC B;  3H32 A;  1PGO A;  1NAF A;  2YXQ B;  4DOJ A;  1YJN P;  3OW2 O;  1VQK P;  1NTZ K;  1SQX J;  3AE7 C;  1OW7 A;  3RK3 E;  4BRY A;  3H1J G;  2IZ0 A;  1YI2 P;  3U1C A;  3OAK A;  1MZ9 A;  1SQV G;  4NPF X;  4D6T J;  5AVY B;  1ZRT E;  2Y9Y A;  1EDI A;  3H1H G;  1G1J A;  2JWD A;  3SFD C;  2R44 A;  1H0T A;  3TGU D;  5CCG A;  1NTM D;  1HJB A;  2PAJ A;  1J1D C;  2WSC J;  1BGY D;  1JY3 N;  3L74 E;  1K05 A;  1IZN B;  4HJG H;  1S72 P;  4RES B;  3WUU A;  3C1L A;  3HD7 D;  3AE5 C;  1HJ0 A;  2V7Q J;  1N73 B;  2JKV A;  2FFD C;  3ITK A;  2WPR A;  4WY4 A;  1NU1 E;  3L35 A;  1M8O B;  1S9K E;  3BCC J;  1GMJ A;  1K73 Q;  2KYV A;  1KIL D;  4ZKU A;  2P2U A;  2IBZ G;  4JPZ B;  1GTW A;  1VQN P;  3RGU A;  3HTK B;  1BDC A;  1RY3 A;  2W83 C;  2Z4E A;  5CHX A;  5B66 E;  1RH5 B;  1LT9 B;  3NTN A;  4N78 D;  1KN7 A;  3AE4 C;  3CLQ A;  4ZMD A;  5E79 E;  3TNU B;  3M06 A;  3WU2 H;  4L75 A;  2KI7 B;  3FWL A;  5KKZ B;  2QJP B;  1EZV G;  3L72 J;  4H44 B;  4U3F E;  3GHG C;  2WZ7 A;  3A0B E;  4UB8 E;  1GL2 B;  4PD4 H;  2E76 C;  2J59 M;  3TGU E;  1GZL A;  3GLM A;  3G6E P;  3VYI A; 
#chains in the Genus database with same CATH homology
 3H1L G;  1L0L G;  3CXH H;  1L0N G;  1BCC G;  1KYO H;  1BGY G;  3H1I G;  3L72 G;  1SQX G;  3L75 G;  5KLV G;  3H1H G;  1KB9 H;  1BE3 G;  2IBZ G;  3H1K G;  1SQB G;  1EZV G;  2FYU G;  3L70 G;  3L71 G;  3L73 G;  4U3F G;  1PPJ G;  3CWB G;  1P84 H;  4PD4 H;  1PP9 G;  1SQQ G;  3CX5 H;  1NTK G;  3H1J G;  1NU1 G;  2A06 G;  3L74 G;  1NTZ G;  2BCC G;  3BCC G;  3TGU G;  4D6T G;  1NTM G;  1SQP G;  1SQV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...