1CZQA

Crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/inhibitor
molecule keywords FUSION PROTEIN BETWEEN THE HYDROPHOBIC POCKET OF HIV GP41 AN
publication title Inhibiting HIV-1 entry: discovery of D-peptide inhibitors that target the gp41 coiled-coil pocket.
pubmed doi rcsb
source organism Saccharomyces cerevisiae, human immunodeficiency virus
total genus 21
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1999-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1czqA00
2YNYA 2R5BA 5AW1B 3MD0A 1J2JB 4RESB 5APQA 1HBWA 1H89A 4JYBA 2WT7B 5APWA 2WPSA 2YO2A 3NMDA 5AVWB 1CSBA 3L37A 3LIEA 5AVXB 3OAKA 3TYYA 2E42A 1MUUA 3B8EB 5AW4B 3TK1A 3HE4A 3VN0A 1NAFA 2ZFCA 2KP8A 1OWAA 5AW8B 3NTNA 2QM7A 4LC1A 1H88A 3HE4B 2N9BA 3M0DA 2IPPA 4I2LC 2XU6A 4KHXA 5AW7B 2QM8A 2W27A 1GU5A 1GZLA 1CI6A 1SP4A 4HYTB 3LIDA 3V4QA 2WPRA 5AVSB 1MV8A 2P7JA 5AVRB 3I5CA 4DZOA 1CI6B 5AW3B 4C7NA 5AVTB 3VMXA 1NWQA 3M9HA 1FOSE 1HJBA 3HTKA 5AVZB 5AW0B 2Q7CA 2P2UA 2WPQA 3VMYA 4AQRD 1GD2E 4C7NB 1T2KC 5AW5B 3P7KA 1MFZA 2E43A 3NFQA 1JUNA 2W6AA 2BASA 3T97A 2H7HA 5AVVB 2P67A 4GT1A 3VTPC 2Z5HA 1CZQA 1YYCA 3L35A 3NXSA 2C9NY 3L36A 3KQGA 4JYCA 1IO4A 5AVQB 1A02J 5APXA 4C46A 3A3YB 3A7OA 5AW6B 2C9LY 3M9BA 5APYA 1DH3A 4I6MC 1OXZA 1GK6A 5APVA 4GKGA 3V4WA 3O8ZA 1GU4A 1T2KD 2YO3A 5CMZA 3M91A 4EOTA 1HWTC 1FOSF 1JNMA 3M06A 1FAVA 2Q5UA 3P8MC 3UIAA 2R3CA 2R32A 2ZXEB 5AW9B 1GK4A 3MGNA 4B86A 4XE5B 2XV5A 3IR9A 1S9KE 2VRSA 3HE5A 3P32A 4M3LA 3TNUA 1HUCA 3A2AA 3VMZA 1SLQA 3KDPB 3VYIA 3HE5B 1X8YA 3TNUB 4AYCA 3SWFA 2WTYA 1A02F 2Q3IA 1GTWA 2XZRA 1G2CB 5AW2B 3A5TA 5AVUB 5APUA 2JJLA 5AVYB 3M0AA 5APTA 1H8AA 4AUWA 2Z5IA 2R5DA 5APSA 1KQLA 2WWWA 3V5BA 1S9KD 2WT7A
chains in the Genus database with same CATH superfamily
3WU2E 1L4AD 2E75B 2N1TD 2E74D 3NMDA 4PJ0E 1KB9I 1CSBA 1VQ4P 3TK1A 4H44B 1IK7A 4MN4C 1VPCA 1RQUA 4LC1A 2HODA 3BASA 1RF1B 3L72G 1YJWP 1SQPG 1MKMA 2P7JA 3CX5I 1M1JB 1NO4A 1SQVJ 1NTZD 4C7NB 2QJYB 1MFZA 1EDJA 1PZQA 4WY4B 1L0ND 3PH0A 3HUSC 4Y28J 2NPSA 2ITAA 5TJHA 4C46A 2IZ0A 1DH3A 4GOEA 5GTIH 3O8ZA 3FGAD 4U7JA 3M91A 1OZHA 3RGUA 1YBKA 1PGOA 3CD6P 1SQBE 2VRSA 4IL6E 1NTMD 3H1IG 2IYOA 2ZYGA 2E76D 1HJ0A 1NTME 4PD4D 1JCDA 3V2PA 3L71E 3AE6C 1FZGA 1GTWA 3JCUE 4PD4E 5APUA 3L73D 1HTLC 2ZXXA 1H8AA 2ZVNB 3L73E 3V5BA 1E79H 1YQ4C 2YNYA 2AEMA 5AW1B 2WT7B 2L91A 2XDJA 4Y99C 2OTJP 4UB8H 2KIKA 2FY8A 3GF7A 5L8RJ 2N9BA 4L73A 1VQPP 4GDOA 2IPPA 4I2LC 1SQXE 5AW7B 3BVHA 4NPDA 2XKMA 1OX3A 3CCQP 4U3FJ 1KB9D 3D6ZA 1QVFO 3KHUA 1X79B 1DIPA 3H1JJ 1KB9E 1GD2E 5AW5B 1VQNP 1BDCA 4H44C 2FFDB 3BCCJ 3S4RA 3KQGA 4JYCA 1BE3D 4HB1A 1SQPK 1BE3E 1Q86Q 1GU4A 3MUDA 1SQVD 2B87B 1L0NG 3CX5E 5M1BA 2YXQB 3B5NA 1Q81Q 4XE5B 1S9KE 3HE5A 2QJYC 3SWYA 4WY4C 4OGQB 1SLQA 1FZAA 3L4FA 3H1KE 1LTJC 1URQA 2OYHA 1A02F 5AW2B 1SQBG 2WZ7A 2GM4A 5APSA 2R3SA 1NTMG 5KLVD 1K8AQ 3L71G 1ZRTD 5APQA 1VQ7P 2QVAA 5B5EH 1ZRTE 1R5SA 1SFCA 3L73G 3CC2P 3AE9C 2H43A 1L0LD 1VQ6P 1PFIA 4BRYA 3AE4C 4N3YB 1MV8A 2QG4A 5GTIE 3H25A 2FYUE 4EYYQ 4PV1D 1FOSE 1SQXG 3AEAC 2DW3A 3KZIH 5GTHH 3NFQA 2C9NY 1VF5B 3CC4P 2NPSB 1BCCJ 3MTUE 4CPGA 3PP5A 4YTPC 5H2FH 1BE3G 2HLOA 3H32A 1JY2P 2FFDC 1VDFA 4UB8E 4DJGA 1PL5A 4W80A 5KJ7C 1WMKA 4H13D 1NTZK 3CLQA 5CJ0A 4UB6E 2JJLA 1L0NK 2IX7C 3Q5SA 3H1KG 1HGVA 2IFMA 4JYBA 3L72J 2JR8A 2D2CB 3FX0A 3CL3D 3L74E 3L75J 1S5LH 1SQPJ 2Y9ZA 4H0LD 1NOHA 2FXMA 4YXDC 2HPCA 1FZCB 2RMZA 3B71A 2FXPA 1NTMK 1W2EA 5CCGC 3V2NA 3VP9A 2WQYC 2WSFH 1QEXA 1JY2O 1Y9BA 1SQQD 3HD7A 4OWFA 3F5HA 2QJKB 1LT9A 1U7MA 4I7ZC 3QWOC 2Z4EA 1VQ9P 4YXWH 2LXCB 4HKZH 2LXBA 1K05A 2HR3A 5AVQB 2B88A 3G3ZA 3H1IJ 5APYA 2GUVA 4K35A 4EOTA 1N2DC 1FOSF 2IFNA 3C8VA 3MGNA 5B5EE 1AVYA 3HTKB 1D7MA 3B5NB 2WMMA 2FBWC 3HE5B 1VF5C 3ITKA 4YPCA 1OIPA 1PP9D 2XZRA 2NPSC 2V4HA 1PP9E 3TSIA 2OYHB 1URQB 1P84H 1KQLA 1YITP 1FDMA 1IK9A 2ZT9B 2FYZA 2OGUA 4NPFX 1SFCB 3KZIE 5GTHE 4BWNA 1X9VA 3VOPA 2LKMA 3NTNA 4RJTA 3L74G 2HFED 4BRYB 2E75D 1SP4A 1Q82Q 1KQSO 2XNXA 1P84I 3FXDA 1LNQA 3I5CA 5H2FE 4H44D 2C0XA 5KLVK 4AQRD 3HUSB 1AQ5A 2QA4P 1FDIA 1Q2NA 2A45H 1L0NJ 2BEZF 4L76A 3VP8A 2WSEH 2QJPC 5BVZA 1A02J 5APXA 1OW8A 1SQQG 1L0LK 1OXZA 4D6TE 3CC7P 1SS1A 1T2KD 5CBOA 1FBMA 2ZJSE 1T6AA 3GMAA 1EDIA 4WY4D 2R32A 2QJKC 4IFDK 1WRGA 3CMAP 1NTMJ 3L71J 3VMZA 1S5LE 1VQLP 3H32B 5DJTB 2WTYA 3CCVP 2YKQA 3L73J 5APTA 1N7LA 3RK3E 2R5BA 1NAYA 1NVOA 3MD0A 1J2JB 3CCEP 1LTBC 1K9MQ 3MUDC 3G6EP 2YIUC 3PHLA 1PP9G 1LP1A 5CCGA 3M9QA 1Q7YQ 1PV3A 3SFDC 2OYHC 1URQC 2HPCB 2QM8A 1VL2A 2QEXP 2M5AA 2Y0CA 5AW3B 3CWBE 2ZT9C 1YJ9P 2H8PD 1SFCC 2Q9IA 1JUNA 2W6AA 3CCMP 4ZMDA 1BE3J 4IL6X 1P84D 1DEEG 2O01H 1P84E 2YO3A 3L70E 3M06A 3TGUE 1HH0A 1Y8AA 3GF3A 1OVRA 3FWNA 3IR9A 2OARA 4D6TG 3WMM0 3TNUA 1RE3A 5KJ7D 1LTJB 1SQQK 4HH2A 2OYOA 4AYCA 2KOGA 2Q6QA 3RK3B 3V2RA 1SQBD 2M8RA 5KKZB 2G3AA 2KS1A 5KLVJ 1LTAC 4OGQD 5APWA 3L71D 3OAKA 1FE6A 2PAJA 2WSSH 1L0LJ 1OWAA 2WSCH 2P1JA 3RBZA 3M0DA 1LT1A 2KZIA 2XU6A 4ASWA 3AEGC 2QIWA 1G1JA 1VQMP 2H89C 1QGKB 3M9HA 1QX8A 1BGYE 5AW0B 2WPQA 3VMYA 4UB6H 3A0HH 1K73Q 1PGPA 2QE7H 1SQXD 1JOCA 3T97A 3CWBG 1IFDA 2XNDH 2W6BA 1NGMB 1NKZB 3A3YB 3A7OA 5C39A 1M57D 2KNCA 4O9BA 1AFOA 3IFMA 1JNMA 1AJYA 1S1CX 4JPZB 3P32A 3HD7C 1VF5D 3ABVC 1KYOH 1LT9C 3GLMA 2NPSD 3TGUG 2Q3IA 2JEEA 1VQKP 4L74A 3CX5D 3SFEC 1L2PA 3OJAB 1FZBA 2Z5IA 1S9KD 2CPSA 1J1DB 3H1KD 3EQ2A 2ZAEB 3H1LD 2JO1A 1NH4A 2IBZI 3H1LE 4IFFA 2SPZA 1M1KQ 1LP1B 1KYOI 3VMAA 2K9YA 1H88A 3RK3C 5CCHA 1J1EB 5KKZC 1GU5A 2K1AA 2D2CD 3MP7B 1LWUA 4ZKUA 4DZOA 1N73A 3H1HD 3CMEP 1SQQJ 1NWQA 4I7ZB 1R5LA 2M5AB 3H1HE 1KILC 5B66H 1AQTA 3FWLA 2M0BA 1CZQA 2HODB 1BGYG 2FYUD 1H0TA 4K3AA 3CXHH 1MZ9A 3AECC 4RO0A 1NJIQ 1FC2C 3TNUB 3E1IA 1PP9J 3E1RA 3A0BH 1KC8Q 4AUWA 2YKOA 1E5WA 3W67A 1PGQA 2AEFA 3B5ND 1ZR4A 2K88A 2KS1B 2QSIA 3CXHI 1ZR2A 2AXTH 3AE3C 2ZYDA 1N8RQ 1JB0J 4U3FE 2FKWB 3TF5A 3A0HE 2O1JA 1AV1A 1URQD 3CCLP 2CK3H 2RH0A 3S9OA 3BCCE 3H1LG 4GIFA 2W27A 3L74D 1GZLA 4HYTB 1EDLA 3MHVA 3V4QA 1R8EA 4W7ZA 1S72P 1M7LA 1NYHA 2ZT9D 1J1DC 3G4SP 1ZMEC 1SQBK 1YHQP 1SFCD 2IBZE 1KN7A 2Q3EA 3P7KA 2QJPB 1KYOD 3VTPC 1KYOE 3L36A 3AE8C 3Q3DA 1GL2A 3H1HG 3T97B 4RKUJ 1J1EC 3MZWB 2JDIH 3V4WA 1ZLLA 4GOFA 1KFNA 2O3JA 1QL1A 2R3CA 2ZXEB 1GK4A 1QLED 2XV5A 2YMYA 2FYUG 1N7SA 1Y47A 3VYIA 3GG2A 1IC2A 4ZKPA 2K37A 1S2EA 2RN0A 1SQXK 1RF1A 3FXEA 4EI2A 2CPBA 1NHLA 1UIIA 2WSFJ 2YIUB 1FU1A 3LIEA 3HE4A 4TLFA 1AA0A 1DX7A 5B66E 1RE3C 2A06E 4KHXA 2ZYAA 4U3FG 1HF9A 4LLHA 1T3UA 3RL0B 3CWBJ 3CCJP 5AVSB 3CCRP 4WVZA 1KILA 3CXHD 1M8OB 1BCCE 5AVTB 1LWUB 3CXHE 2KSEA 3LW5H 1CW5A 3BCCG 1N73B 3AEEC 2K9JA 1RE4C 4GT1A 3Q5PA 3GHGA 2IBZG 1RH5B 2BEQD 1OW7A 3A0BE 1S5LX 3M0DC 3TGUJ 1HWTC 1H0TB 2RKLA 1NU1D 1FDOA 2WITA 3P8MC 3UIAA 1L4AA 1VQOP 1NU1E 2N1TA 1GW3A 4L75A 2O01N 2AXTE 1G2CA 4D6TD 1X8YA 1T3JA 3OW2O 1LGHB 2JP3A 3L75E 5AVUB 3D70A 1SQPE 3PJSK 4Z1MH 1W5CE 1SQBJ 2HYNA 4WWIA 2FYUK 2V7QH 5KLIC 2E5YA 1S3JA 1X22A 5CHXA 2YO2A 3AE5C 2HG5D 2POHA 2A45I 2GA1A 4IOIH 1NTKD 3R2PA 3P8CE 3RK3D 1NTKE 2J58A 1LJ2A 2FXOA 2H88C 2P10A 1KQFB 1JMBA 1FZEA 2J5UA 2M3EA 3G9RA 1IJDB 3K5BA 2P2UA 5BU8B 3C9IA 1KILE 1SQXJ 2WPVB 1LTIC 2Z5HA 3L35A 1ZV8A 1BCCG 1IO4A 2R44A 2P58A 4JQ0D 2OTLP 3CWBD 2LR2A 2C9LY 3M9BA 4TT3H 1GL2B 3RL0C 1N86A 5CCHC 3CPWO 5CMZA 1USDA 1LWUC 3HD7B 2N9YB 1N73C 2KI7B 1LT9B 2W6JH 4WBAA 1G1IA 3JSVC 2NRGA 1DEBA 1N7SB 3N4XA 2Y0DA 3SWFA 1NU1G 3L70D 2WVRA 3A5TA 4JBZA 3TGUD 1KFMA 2MJZA 1EZVI 1YIJP 1EC5A 5CBNA 3Q2YA 2R5DA 4H0LC 1BDDA 1PPJD 3CI9A 1H89A 1PPJE 3BATA 3L75G 4N78D 3Q1MA 2BCCD 3H1KJ 3H1LJ 4N78E 2BCCE 5AVWB 3L37A 3TYYA 2PGDA 2ZFCA 4ASVA 5E79H 2QM7A 3IF4A 3HRNA 1PGJA 3AE2C 3HE4B 1NTZE 1S4XA 5CJ4A 1L0NE 2O01J 3AEDC 1DD4A 1CI6A 3LIDA 1DD3A 3GW6A 5AVRB 1NTKG 1RE4A 2GUSA 3H1HJ 3RK2B 5KAFH 5AVZB 3BRVB 1KILB 1AVOA 5CCGD 2W83C 3NXSA 4R4MA 4NPEA 2K9JB 2FYUJ 2QRXA 1BGYD 3GHGB 3U59A 1OW6A 1RF0A 3OA7A 1L4AB 2I1JA 2N1TB 1BSNA 2E74B 1USEA 4XFJA 1FZCA 2WSCJ 2PFXA 4EIJA 2KLUA 1G2CB 5AVYB 2PRRA 3I56P 4QMAA 1KMIZ 1YTZT 1KD1Q 1GL2C 2IZ1A 1Z56A 2UWJE 3PRJA 3RBXA 1U7JA 4C7RA 3L70G 2E75C 1NU1K 3W68A 1Q90D 1N7SC 1JCCA 2MKVA 2KP8A 1PPJG 1EZVD 5AW8B 4DT0A 2K3RA 1EZVE 2BCCG 3EFFK 3L74J 1VQ5P 1RF1C 4ZNCA 1HGZA 4BXLA 3E7KA 3KPEA 2B9BA 1NTZG 3AEFC 3VMXA 1LTTC 3HTKA 3C1LA 1M1JC 1T2KC 1EDKA 1SQVE 1TU3F 2P67A 2IDBA 2OYIA 1QVGO 2E76B 1M56D 3U1AA 3V2QA 2A45G 3H6PA 1NTKK 5AW6B 1M90Q 2OTKE 4A7PA 1EXJA 2Y0EA 2W90A 3WUUA 3ZDMA 1JTHA 1MFTA 4IFMA 3RK2C 2Q5UA 3RL0g 2KB7P 5AW9B 4HJGH 3S1KA 5KLVE 2YXRB 1IFMA 1KQGB 4I1LA 2KYVA 4XA4A 2L5GB 5E79E 2KK7A 3M0AA 3GHGC 1L0LE 2WWWA 1YI2P 2PP6A 3AE7C 1YQ3C 1JY3P 4RESB 1ZXGA 3I55P 1PIXA 2WPSA 2IYPA 3G71P 1L4AC 3HUSA 5KAFE 1ZOYC 3WUVA 5DJUB 3B8EB 2N1TC 2E74C 3VN0A 1YTZI 1RHZB 2KUBA 3CCSP 4OVNF 1ZP0C 4U3FD 1CI6B 4OH8B 1EZVG 3R4YA 3H1JD 2JWDA 2JKVA 2OQQA 3H1JE 2KLVA 5KAIH 3O6QA 1XTGB 3PLNA 2E43A 3BCCD 5AVVB 1IFPA 2JWAA 1JEKA 1IFNA 4KJMA 3AE1C 3RL0D 5CCHD 1JY3O 1SQVG 1NKNA 2FYNB 2IBZD 2O1KA 4GKGA 3U1CA 1NU1J 4B86A 1OFCX 3F89A 4W7YA 4JF7A 1HVVA 5TISH 2B89A 4D6TJ 5K5GB 4OGQC 5EFWB 2E76C 1GDTA 4DCKA 5KLVG 3EWKA 1ZW0A 2KNCB 5KLIB 2AEJA 1HBWA 1ZN5A 1BSHA 1GMJA 1L0LG 1FJKA 4R4LA 1MUUA 4PV1B 5AW4B 1OMIA 1NTKJ 3N7NA 1U57A 1SQQE 5BU5A 2YKPA 3JC22 3SWKA 3WUTA 3QH9A 3WU2H 1M1JA 2WPRA 2I8DA 1UIXA 3USSA 4C7NA 2KSJA 4PJ0H 4WY4A 2Q7CA 1RY3A 1QL2A 3IAOA 3Q5RA 2A06D 1KV4A 1YJNP 1LTJA 2J59M 1YYCA 3AEBC 1RQVA 2AXCA 1W2BO 1EQ7A 4LGDE 2OYIB 1BCCD 3H1JG 1JMMA 4H13B 1X0TA 3V6IA 1VQ8P 1FJPA 3B4SA 1FAVA 3II6A 1JTHB 1FZFA 3BRTB 2G8YA 1KTMA 4M3LA 3KXDA 1HUCA 3EFGA 3KDPB 3IN6A 1SQVK 1GW4A 1JM0A 1GL2D 3L70J 1JO5A 4KT0J 4H0LB 2M3BA 4WB4A 3TDKA 2FYNC 2WT7A 3HD7D 3D71A 4GODA 1LTGC 2BCCJ 1K04A 3L72D 1IFJA 3LW5J 3SSUA 4IL6H 2W8ZA 1N7SD 3L72E 3L75D 5AVXB 2D2CC 2E42A 1KZUB 1SQPD 1RF0C 5KAIE 1NAFA 1NTZJ 3JCUH 4PD4H 2C0WA 1T8ZA 1FZCC 2E5TA 3D6YA 2NZ2A 1LTSC 1IFIA 1XTCC 3MIWA 3P8CD 2FFDA 2YMKA 1HJBA 2WSEJ 1FS0E 1IZNB 1JY3N 4PV1C 4EDFA 5KJ7A 2BASA 2H7HA 5TISE 2KZJA 3O6QB 3PTZA 2Q1KA 4PD4I 3H1ID 2B87A 1KORA 4I6MC 1GK6A 5APVA 3RK2D 1BGYJ 3CCUP 3H1IE 2A06G 2V7QJ 4DOJA 1KILD 2Y9YA 1KB9H 2KXPB 4Y99B 1EXIA 3A2AA 2ZVOB 3B5NC 1WT6A 1OVVA 1SVFA 2I1KA 2OYIC 5KTBA 1JY2N 4H13C 1OVUA 4N6JA 3KYQA 3CX5H
chains in the Genus database with same CATH topology
3B5ND 1FDMA 1L4AD 1IK9A 1ZR4A 2N1TD 4C7RA 3NMDA 1ZR2A 1CSBA 1NU1K 2FYZA 2FKWB 3TK1A 1SFCB 1N7SC 1JCCA 2KP8A 2O1JA 1X9VA 3VOPA 2LKMA 5AW8B 3NTNA 1URQD 1VPCA 4LC1A 2HODA 3BASA 2HFED 1RF1B 4GIFA 2W27A 1GZLA 1SP4A 4HYTB 1RF1C 3V4QA 2XNXA 1HGZA 4W7ZA 3KPEA 1M7LA 2P7JA 3I5CA 1J1DC 3VMXA 1M1JB 1NO4A 1SQBK 1LTTC 3HTKA 1SFCD 2C0XA 5KLVK 4AQRD 3HUSB 1M1JC 1AQ5A 4C7NB 1T2KC 3P7KA 1MFZA 4WY4B 2A45H 3HUSC 3VP8A 2WSEH 2P67A 3VTPC 2NPSA 2OYIA 3L36A 5BVZA 1GL2A 1A02J 3U1AA 5APXA 3V2QA 4C46A 1J1EC 2A45G 3H6PA 1NTKK 5AW6B 1L0LK 1DH3A 1OXZA 3V4WA 1ZLLA 3O8ZA 1T2KD 3M91A 1JTHA 1FBMA 4IFMA 3RK2C 1KFNA 2Q5UA 1QL1A 2R3CA 2KB7P 2R32A 2ZXEB 4WY4D 5AW9B 1GK4A 2XV5A 4IFDK 2VRSA 1WRGA 2YMYA 1N7SA 1IFMA 3VMZA 3VYIA 1IC2A 4ZKPA 3H32B 4I1LA 1JCDA 3V2PA 2KYVA 4XA4A 2WTYA 1FZGA 1GTWA 2L5GB 2YKQA 5APUA 1SQXK 1RF1A 3M0AA 5APTA 1N7LA 1HTLC 2CPBA 1NHLA 1H8AA 3GHGC 2WWWA 3V5BA 2PP6A 2YNYA 2R5BA 5AW1B 3MD0A 1J2JB 1FU1A 1JY3P 1LTBC 4RESB 2WT7B 2WPSA 2XDJA 4Y99C 1L4AC 3HUSA 3LIEA 5CCGA 3B8EB 2N1TC 3HE4A 3M9QA 3VN0A 1DX7A 1RE3C 1YTZI 2N9BA 2OYHC 1URQC 2IPPA 4I2LC 2HPCB 4KHXA 5AW7B 2QM8A 4LLHA 3BVHA 1T3UA 3RL0B 2XKMA 5AVSB 1KILA 1CI6B 5AW3B 4OH8B 5AVTB 1X79B 1LWUB 1CW5A 3LW5H 1N73B 1GD2E 5AW5B 2KLVA 2H8PD 1XTGB 2E43A 2FFDB 1SFCC 2Q9IA 1JUNA 1RE4C 2W6AA 5AVVB 4GT1A 3KQGA 1IFNA 4JYCA 1SQPK 3GHGA 3RL0D 5CCHD 1JY3O 1NKNA 2O01H 4GKGA 2O1KA 3M0DC 1GU4A 2YO3A 3MUDA 1HWTC 3M06A 3U1CA 2WITA 3B5NA 1HH0A 3P8MC 1L4AA 3UIAA 4B86A 2N1TA 1GW3A 4XE5B 3IR9A 1S9KE 2OARA 3HE5A 4W7YA 3SWYA 3WMM0 4WY4C 3TNUA 1RE3A 5KJ7D 4JF7A 1SLQA 1G2CA 1HVVA 1LTJB 1FZAA 1SQQK 3L4FA 4HH2A 1X8YA 1T3JA 1LGHB 4AYCA 1LTJC 1URQA 2KOGA 2OYHA 1A02F 1GDTA 5AW2B 5AVUB 2WZ7A 3RK3B 2GM4A 5APSA 3V2RA 2M8RA 2HYNA 1LTAC 2FYUK 5APQA 1HBWA 1ZN5A 5APWA 5CHXA 2YO2A 1SFCA 2HG5D 1FJKA 3OAKA 2POHA 1MUUA 2A45I 2PAJA 5AW4B 2H43A 3N7NA 3R2PA 3P8CE 5BU5A 1OWAA 3RK3D 2YKPA 1PFIA 2WSCH 2P1JA 2J58A 3M0DA 2XU6A 1G1JA 1M1JA 2WPRA 4N3YB 1MV8A 1FZEA 4C7NA 1IJDB 2KSJA 3M9HA 4WY4A 1FOSE 5AW0B 2Q7CA 1RY3A 2P2UA 2WPQA 3VMYA 5BU8B 1QL2A 3C9IA 3NFQA 1LTJA 1JOCA 3T97A 1LTIC 2J59M 2Z5HA 2C9NY 1YYCA 3L35A 1ZV8A 1IO4A 1IFDA 1EQ7A 4LGDE 2W6BA 1NKZB 2NPSB 3A3YB 3A7OA 2OYIB 3MTUE 2C9LY 3M9BA 1JMMA 1GL2B 4O9BA 3RL0C 1N86A 5CCHC 1AFOA 3PP5A 5CMZA 1FJPA 3IFMA 1JNMA 1FAVA 3II6A 1LWUC 3HD7B 1JTHB 1N73C 1FZFA 3BRTB 3P32A 2HLOA 3H32A 1LT9B 1JY2P 3HD7C 2FFDC 4M3LA 1HUCA 1VDFA 4WBAA 3EFGA 3KDPB 1LT9C 2NPSD 1G1IA 1SQVK 1DEBA 1GW4A 1N7SB 3N4XA 4W80A 5KJ7C 3SWFA 1GL2D 1NTZK 3CLQA 2Q3IA 2JEEA 1JO5A 5CJ0A 3A5TA 2JJLA 1KFMA 1L0NK 2M3BA 2MJZA 3OJAB 4WB4A 1FZBA 2R5DA 2Z5IA 2IX7C 1S9KD 2WT7A 3HD7D 3CI9A 1HGVA 2IFMA 1H89A 4JYBA 2CPSA 3BATA 1LTGC 1J1DB 4N78D 1IFJA 3EQ2A 3CL3D 4N78E 1NH4A 5AVWB 1N7SD 3L37A 5AVXB 3TYYA 2E42A 1KZUB 4IFFA 1RF0C 1NOHA 1NAFA 2ZFCA 2FXMA 2HPCA 1FZCB 2QM7A 3HRNA 2C0WA 1T8ZA 1NTMK 1W2EA 1H88A 3HE4B 5CCGC 1FZCC 5CJ4A 3RK3C 5CCHA 3V2NA 3VP9A 1J1EB 1LTSC 1GU5A 1CI6A 3LIDA 1LWUA 1IFIA 2WSFH 1JY2O 5AVRB 4ZKUA 1XTCC 4DZOA 1N73A 1RE4A 2GUSA 3MIWA 3RK2B 3HD7A 3P8CD 1NWQA 2FFDA 1HJBA 5AVZB 3BRVB 1KILB 5CCGD 1LT9A 1JY3N 2Z4EA 1KILC 5KJ7A 2BASA 2H7HA 3NXSA 1CZQA 5AVQB 2HODB 3G3ZA 5APYA 4I6MC 1GK6A 5APVA 3RK2D 2GUVA 3GHGB 3U59A 4EOTA 1N2DC 4DOJA 1KILD 1FOSF 2IFNA 1MZ9A 3MGNA 3HTKB 4Y99B 1RF0A 3B5NB 3OA7A 1L4AB 2I1JA 3A2AA 2N1TB 3B5NC 1WT6A 3HE5B 1FZCA 3TNUB 3E1IA 4EIJA 1SVFA 2XZRA 1G2CB 2I1KA 2NPSC 2OYIC 5KTBA 5AVYB 1YTZT 1GL2C 1JY2N 3TSIA 2OYHB 1URQB 4AUWA 2YKOA 1KQLA 1E5WA 4N6JA 3KYQA 1Z56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNY A;  2R5B A;  5AW1 B;  3MD0 A;  1J2J B;  4RES B;  5APQ A;  1HBW A;  1H89 A;  4JYB A;  2WT7 B;  5APW A;  2WPS A;  2YO2 A;  3NMD A;  5AVW B;  1CSB A;  3L37 A;  3LIE A;  5AVX B;  3OAK A;  3TYY A;  2E42 A;  1MUU A;  3B8E B;  5AW4 B;  3TK1 A;  3HE4 A;  3VN0 A;  1NAF A;  2ZFC A;  2KP8 A;  1OWA A;  5AW8 B;  3NTN A;  2QM7 A;  4LC1 A;  1H88 A;  3HE4 B;  2N9B A;  3M0D A;  2IPP A;  4I2L C;  2XU6 A;  4KHX A;  5AW7 B;  2QM8 A;  2W27 A;  1GU5 A;  1GZL A;  1CI6 A;  1SP4 A;  4HYT B;  3LID A;  3V4Q A;  2WPR A;  5AVS B;  1MV8 A;  2P7J A;  5AVR B;  3I5C A;  4DZO A;  1CI6 B;  5AW3 B;  4C7N A;  5AVT B;  3VMX A;  1NWQ A;  3M9H A;  1FOS E;  1HJB A;  3HTK A;  5AVZ B;  5AW0 B;  2Q7C A;  2P2U A;  2WPQ A;  3VMY A;  4AQR D;  1GD2 E;  4C7N B;  1T2K C;  5AW5 B;  3P7K A;  1MFZ A;  2E43 A;  3NFQ A;  1JUN A;  2W6A A;  2BAS A;  3T97 A;  2H7H A;  5AVV B;  2P67 A;  4GT1 A;  3VTP C;  2Z5H A;  1CZQ A;  1YYC A;  3L35 A;  3NXS A;  2C9N Y;  3L36 A;  3KQG A;  4JYC A;  1IO4 A;  5AVQ B;  1A02 J;  5APX A;  4C46 A;  3A3Y B;  3A7O A;  5AW6 B;  2C9L Y;  3M9B A;  5APY A;  1DH3 A;  4I6M C;  1OXZ A;  1GK6 A;  5APV A;  4GKG A;  3V4W A;  3O8Z A;  1GU4 A;  1T2K D;  2YO3 A;  5CMZ A;  3M91 A;  4EOT A;  1HWT C;  1FOS F;  1JNM A;  3M06 A;  1FAV A;  2Q5U A;  3P8M C;  3UIA A;  2R3C A;  2R32 A;  2ZXE B;  5AW9 B;  1GK4 A;  3MGN A;  4B86 A;  4XE5 B;  2XV5 A;  3IR9 A;  1S9K E;  2VRS A;  3HE5 A;  3P32 A;  4M3L A;  3TNU A;  1HUC A;  3A2A A;  3VMZ A;  1SLQ A;  3KDP B;  3VYI A;  3HE5 B;  1X8Y A;  3TNU B;  4AYC A;  3SWF A;  2WTY A;  1A02 F;  2Q3I A;  1GTW A;  2XZR A;  1G2C B;  5AW2 B;  3A5T A;  5AVU B;  5APU A;  2JJL A;  5AVY B;  3M0A A;  5APT A;  1H8A A;  4AUW A;  2Z5I A;  2R5D A;  5APS A;  1KQL A;  2WWW A;  3V5B A;  1S9K D;  2WT7 A; 
#chains in the Genus database with same CATH topology
 3WU2 E;  1L4A D;  2E75 B;  2N1T D;  2E74 D;  3NMD A;  4PJ0 E;  1KB9 I;  1CSB A;  1VQ4 P;  3TK1 A;  4H44 B;  1IK7 A;  4MN4 C;  1VPC A;  1RQU A;  4LC1 A;  2HOD A;  3BAS A;  1RF1 B;  3L72 G;  1YJW P;  1SQP G;  1MKM A;  2P7J A;  3CX5 I;  1M1J B;  1NO4 A;  1SQV J;  1NTZ D;  4C7N B;  2QJY B;  1MFZ A;  1EDJ A;  1PZQ A;  4WY4 B;  1L0N D;  3PH0 A;  3HUS C;  4Y28 J;  2NPS A;  2ITA A;  5TJH A;  4C46 A;  2IZ0 A;  1DH3 A;  4GOE A;  5GTI H;  3O8Z A;  3FGA D;  4U7J A;  3M91 A;  1OZH A;  3RGU A;  1YBK A;  1PGO A;  3CD6 P;  1SQB E;  2VRS A;  4IL6 E;  1NTM D;  3H1I G;  2IYO A;  2ZYG A;  2E76 D;  1HJ0 A;  1NTM E;  4PD4 D;  1JCD A;  3V2P A;  3L71 E;  3AE6 C;  1FZG A;  1GTW A;  3JCU E;  4PD4 E;  5APU A;  3L73 D;  1HTL C;  2ZXX A;  1H8A A;  2ZVN B;  3L73 E;  3V5B A;  1E79 H;  1YQ4 C;  2YNY A;  2AEM A;  5AW1 B;  2WT7 B;  2L91 A;  2XDJ A;  4Y99 C;  2OTJ P;  4UB8 H;  2KIK A;  2FY8 A;  3GF7 A;  5L8R J;  2N9B A;  4L73 A;  1VQP P;  4GDO A;  2IPP A;  4I2L C;  1SQX E;  5AW7 B;  3BVH A;  4NPD A;  2XKM A;  1OX3 A;  3CCQ P;  4U3F J;  1KB9 D;  3D6Z A;  1QVF O;  3KHU A;  1X79 B;  1DIP A;  3H1J J;  1KB9 E;  1GD2 E;  5AW5 B;  1VQN P;  1BDC A;  4H44 C;  2FFD B;  3BCC J;  3S4R A;  3KQG A;  4JYC A;  1BE3 D;  4HB1 A;  1SQP K;  1BE3 E;  1Q86 Q;  1GU4 A;  3MUD A;  1SQV D;  2B87 B;  1L0N G;  3CX5 E;  5M1B A;  2YXQ B;  3B5N A;  1Q81 Q;  4XE5 B;  1S9K E;  3HE5 A;  2QJY C;  3SWY A;  4WY4 C;  4OGQ B;  1SLQ A;  1FZA A;  3L4F A;  3H1K E;  1LTJ C;  1URQ A;  2OYH A;  1A02 F;  5AW2 B;  1SQB G;  2WZ7 A;  2GM4 A;  5APS A;  2R3S A;  1NTM G;  5KLV D;  1K8A Q;  3L71 G;  1ZRT D;  5APQ A;  1VQ7 P;  2QVA A;  5B5E H;  1ZRT E;  1R5S A;  1SFC A;  3L73 G;  3CC2 P;  3AE9 C;  2H43 A;  1L0L D;  1VQ6 P;  1PFI A;  4BRY A;  3AE4 C;  4N3Y B;  1MV8 A;  2QG4 A;  5GTI E;  3H25 A;  2FYU E;  4EYY Q;  4PV1 D;  1FOS E;  1SQX G;  3AEA C;  2DW3 A;  3KZI H;  5GTH H;  3NFQ A;  2C9N Y;  1VF5 B;  3CC4 P;  2NPS B;  1BCC J;  3MTU E;  4CPG A;  3PP5 A;  4YTP C;  5H2F H;  1BE3 G;  2HLO A;  3H32 A;  1JY2 P;  2FFD C;  1VDF A;  4UB8 E;  4DJG A;  1PL5 A;  4W80 A;  5KJ7 C;  1WMK A;  4H13 D;  1NTZ K;  3CLQ A;  5CJ0 A;  4UB6 E;  2JJL A;  1L0N K;  2IX7 C;  3Q5S A;  3H1K G;  1HGV A;  2IFM A;  4JYB A;  3L72 J;  2JR8 A;  2D2C B;  3FX0 A;  3CL3 D;  3L74 E;  3L75 J;  1S5L H;  1SQP J;  2Y9Z A;  4H0L D;  1NOH A;  2FXM A;  4YXD C;  2HPC A;  1FZC B;  2RMZ A;  3B71 A;  2FXP A;  1NTM K;  1W2E A;  5CCG C;  3V2N A;  3VP9 A;  2WQY C;  2WSF H;  1QEX A;  1JY2 O;  1Y9B A;  1SQQ D;  3HD7 A;  4OWF A;  3F5H A;  2QJK B;  1LT9 A;  1U7M A;  4I7Z C;  3QWO C;  2Z4E A;  1VQ9 P;  4YXW H;  2LXC B;  4HKZ H;  2LXB A;  1K05 A;  2HR3 A;  5AVQ B;  2B88 A;  3G3Z A;  3H1I J;  5APY A;  2GUV A;  4K35 A;  4EOT A;  1N2D C;  1FOS F;  2IFN A;  3C8V A;  3MGN A;  5B5E E;  1AVY A;  3HTK B;  1D7M A;  3B5N B;  2WMM A;  2FBW C;  3HE5 B;  1VF5 C;  3ITK A;  4YPC A;  1OIP A;  1PP9 D;  2XZR A;  2NPS C;  2V4H A;  1PP9 E;  3TSI A;  2OYH B;  1URQ B;  1P84 H;  1KQL A;  1YIT P;  1FDM A;  1IK9 A;  2ZT9 B;  2FYZ A;  2OGU A;  4NPF X;  1SFC B;  3KZI E;  5GTH E;  4BWN A;  1X9V A;  3VOP A;  2LKM A;  3NTN A;  4RJT A;  3L74 G;  2HFE D;  4BRY B;  2E75 D;  1SP4 A;  1Q82 Q;  1KQS O;  2XNX A;  1P84 I;  3FXD A;  1LNQ A;  3I5C A;  5H2F E;  4H44 D;  2C0X A;  5KLV K;  4AQR D;  3HUS B;  1AQ5 A;  2QA4 P;  1FDI A;  1Q2N A;  2A45 H;  1L0N J;  2BEZ F;  4L76 A;  3VP8 A;  2WSE H;  2QJP C;  5BVZ A;  1A02 J;  5APX A;  1OW8 A;  1SQQ G;  1L0L K;  1OXZ A;  4D6T E;  3CC7 P;  1SS1 A;  1T2K D;  5CBO A;  1FBM A;  2ZJS E;  1T6A A;  3GMA A;  1EDI A;  4WY4 D;  2R32 A;  2QJK C;  4IFD K;  1WRG A;  3CMA P;  1NTM J;  3L71 J;  3VMZ A;  1S5L E;  1VQL P;  3H32 B;  5DJT B;  2WTY A;  3CCV P;  2YKQ A;  3L73 J;  5APT A;  1N7L A;  3RK3 E;  2R5B A;  1NAY A;  1NVO A;  3MD0 A;  1J2J B;  3CCE P;  1LTB C;  1K9M Q;  3MUD C;  3G6E P;  2YIU C;  3PHL A;  1PP9 G;  1LP1 A;  5CCG A;  3M9Q A;  1Q7Y Q;  1PV3 A;  3SFD C;  2OYH C;  1URQ C;  2HPC B;  2QM8 A;  1VL2 A;  2QEX P;  2M5A A;  2Y0C A;  5AW3 B;  3CWB E;  2ZT9 C;  1YJ9 P;  2H8P D;  1SFC C;  2Q9I A;  1JUN A;  2W6A A;  3CCM P;  4ZMD A;  1BE3 J;  4IL6 X;  1P84 D;  1DEE G;  2O01 H;  1P84 E;  2YO3 A;  3L70 E;  3M06 A;  3TGU E;  1HH0 A;  1Y8A A;  3GF3 A;  1OVR A;  3FWN A;  3IR9 A;  2OAR A;  4D6T G;  3WMM 0;  3TNU A;  1RE3 A;  5KJ7 D;  1LTJ B;  1SQQ K;  4HH2 A;  2OYO A;  4AYC A;  2KOG A;  2Q6Q A;  3RK3 B;  3V2R A;  1SQB D;  2M8R A;  5KKZ B;  2G3A A;  2KS1 A;  5KLV J;  1LTA C;  4OGQ D;  5APW A;  3L71 D;  3OAK A;  1FE6 A;  2PAJ A;  2WSS H;  1L0L J;  1OWA A;  2WSC H;  2P1J A;  3RBZ A;  3M0D A;  1LT1 A;  2KZI A;  2XU6 A;  4ASW A;  3AEG C;  2QIW A;  1G1J A;  1VQM P;  2H89 C;  1QGK B;  3M9H A;  1QX8 A;  1BGY E;  5AW0 B;  2WPQ A;  3VMY A;  4UB6 H;  3A0H H;  1K73 Q;  1PGP A;  2QE7 H;  1SQX D;  1JOC A;  3T97 A;  3CWB G;  1IFD A;  2XND H;  2W6B A;  1NGM B;  1NKZ B;  3A3Y B;  3A7O A;  5C39 A;  1M57 D;  2KNC A;  4O9B A;  1AFO A;  3IFM A;  1JNM A;  1AJY A;  1S1C X;  4JPZ B;  3P32 A;  3HD7 C;  1VF5 D;  3ABV C;  1KYO H;  1LT9 C;  3GLM A;  2NPS D;  3TGU G;  2Q3I A;  2JEE A;  1VQK P;  4L74 A;  3CX5 D;  3SFE C;  1L2P A;  3OJA B;  1FZB A;  2Z5I A;  1S9K D;  2CPS A;  1J1D B;  3H1K D;  3EQ2 A;  2ZAE B;  3H1L D;  2JO1 A;  1NH4 A;  2IBZ I;  3H1L E;  4IFF A;  2SPZ A;  1M1K Q;  1LP1 B;  1KYO I;  3VMA A;  2K9Y A;  1H88 A;  3RK3 C;  5CCH A;  1J1E B;  5KKZ C;  1GU5 A;  2K1A A;  2D2C D;  3MP7 B;  1LWU A;  4ZKU A;  4DZO A;  1N73 A;  3H1H D;  3CME P;  1SQQ J;  1NWQ A;  4I7Z B;  1R5L A;  2M5A B;  3H1H E;  1KIL C;  5B66 H;  1AQT A;  3FWL A;  2M0B A;  1CZQ A;  2HOD B;  1BGY G;  2FYU D;  1H0T A;  4K3A A;  3CXH H;  1MZ9 A;  3AEC C;  4RO0 A;  1NJI Q;  1FC2 C;  3TNU B;  3E1I A;  1PP9 J;  3E1R A;  3A0B H;  1KC8 Q;  4AUW A;  2YKO A;  1E5W A;  3W67 A;  1PGQ A;  2AEF A;  3B5N D;  1ZR4 A;  2K88 A;  2KS1 B;  2QSI A;  3CXH I;  1ZR2 A;  2AXT H;  3AE3 C;  2ZYD A;  1N8R Q;  1JB0 J;  4U3F E;  2FKW B;  3TF5 A;  3A0H E;  2O1J A;  1AV1 A;  1URQ D;  3CCL P;  2CK3 H;  2RH0 A;  3S9O A;  3BCC E;  3H1L G;  4GIF A;  2W27 A;  3L74 D;  1GZL A;  4HYT B;  1EDL A;  3MHV A;  3V4Q A;  1R8E A;  4W7Z A;  1S72 P;  1M7L A;  1NYH A;  2ZT9 D;  1J1D C;  3G4S P;  1ZME C;  1SQB K;  1YHQ P;  1SFC D;  2IBZ E;  1KN7 A;  2Q3E A;  3P7K A;  2QJP B;  1KYO D;  3VTP C;  1KYO E;  3L36 A;  3AE8 C;  3Q3D A;  1GL2 A;  3H1H G;  3T97 B;  4RKU J;  1J1E C;  3MZW B;  2JDI H;  3V4W A;  1ZLL A;  4GOF A;  1KFN A;  2O3J A;  1QL1 A;  2R3C A;  2ZXE B;  1GK4 A;  1QLE D;  2XV5 A;  2YMY A;  2FYU G;  1N7S A;  1Y47 A;  3VYI A;  3GG2 A;  1IC2 A;  4ZKP A;  2K37 A;  1S2E A;  2RN0 A;  1SQX K;  1RF1 A;  3FXE A;  4EI2 A;  2CPB A;  1NHL A;  1UII A;  2WSF J;  2YIU B;  1FU1 A;  3LIE A;  3HE4 A;  4TLF A;  1AA0 A;  1DX7 A;  5B66 E;  1RE3 C;  2A06 E;  4KHX A;  2ZYA A;  4U3F G;  1HF9 A;  4LLH A;  1T3U A;  3RL0 B;  3CWB J;  3CCJ P;  5AVS B;  3CCR P;  4WVZ A;  1KIL A;  3CXH D;  1M8O B;  1BCC E;  5AVT B;  1LWU B;  3CXH E;  2KSE A;  3LW5 H;  1CW5 A;  3BCC G;  1N73 B;  3AEE C;  2K9J A;  1RE4 C;  4GT1 A;  3Q5P A;  3GHG A;  2IBZ G;  1RH5 B;  2BEQ D;  1OW7 A;  3A0B E;  1S5L X;  3M0D C;  3TGU J;  1HWT C;  1H0T B;  2RKL A;  1NU1 D;  1FDO A;  2WIT A;  3P8M C;  3UIA A;  1L4A A;  1VQO P;  1NU1 E;  2N1T A;  1GW3 A;  4L75 A;  2O01 N;  2AXT E;  1G2C A;  4D6T D;  1X8Y A;  1T3J A;  3OW2 O;  1LGH B;  2JP3 A;  3L75 E;  5AVU B;  3D70 A;  1SQP E;  3PJS K;  4Z1M H;  1W5C E;  1SQB J;  2HYN A;  4WWI A;  2FYU K;  2V7Q H;  5KLI C;  2E5Y A;  1S3J A;  1X22 A;  5CHX A;  2YO2 A;  3AE5 C;  2HG5 D;  2POH A;  2A45 I;  2GA1 A;  4IOI H;  1NTK D;  3R2P A;  3P8C E;  3RK3 D;  1NTK E;  2J58 A;  1LJ2 A;  2FXO A;  2H88 C;  2P10 A;  1KQF B;  1JMB A;  1FZE A;  2J5U A;  2M3E A;  3G9R A;  1IJD B;  3K5B A;  2P2U A;  5BU8 B;  3C9I A;  1KIL E;  1SQX J;  2WPV B;  1LTI C;  2Z5H A;  3L35 A;  1ZV8 A;  1BCC G;  1IO4 A;  2R44 A;  2P58 A;  4JQ0 D;  2OTL P;  3CWB D;  2LR2 A;  2C9L Y;  3M9B A;  4TT3 H;  1GL2 B;  3RL0 C;  1N86 A;  5CCH C;  3CPW O;  5CMZ A;  1USD A;  1LWU C;  3HD7 B;  2N9Y B;  1N73 C;  2KI7 B;  1LT9 B;  2W6J H;  4WBA A;  1G1I A;  3JSV C;  2NRG A;  1DEB A;  1N7S B;  3N4X A;  2Y0D A;  3SWF A;  1NU1 G;  3L70 D;  2WVR A;  3A5T A;  4JBZ A;  3TGU D;  1KFM A;  2MJZ A;  1EZV I;  1YIJ P;  1EC5 A;  5CBN A;  3Q2Y A;  2R5D A;  4H0L C;  1BDD A;  1PPJ D;  3CI9 A;  1H89 A;  1PPJ E;  3BAT A;  3L75 G;  4N78 D;  3Q1M A;  2BCC D;  3H1K J;  3H1L J;  4N78 E;  2BCC E;  5AVW B;  3L37 A;  3TYY A;  2PGD A;  2ZFC A;  4ASV A;  5E79 H;  2QM7 A;  3IF4 A;  3HRN A;  1PGJ A;  3AE2 C;  3HE4 B;  1NTZ E;  1S4X A;  5CJ4 A;  1L0N E;  2O01 J;  3AED C;  1DD4 A;  1CI6 A;  3LID A;  1DD3 A;  3GW6 A;  5AVR B;  1NTK G;  1RE4 A;  2GUS A;  3H1H J;  3RK2 B;  5KAF H;  5AVZ B;  3BRV B;  1KIL B;  1AVO A;  5CCG D;  2W83 C;  3NXS A;  4R4M A;  4NPE A;  2K9J B;  2FYU J;  2QRX A;  1BGY D;  3GHG B;  3U59 A;  1OW6 A;  1RF0 A;  3OA7 A;  1L4A B;  2I1J A;  2N1T B;  1BSN A;  2E74 B;  1USE A;  4XFJ A;  1FZC A;  2WSC J;  2PFX A;  4EIJ A;  2KLU A;  1G2C B;  5AVY B;  2PRR A;  3I56 P;  4QMA A;  1KMI Z;  1YTZ T;  1KD1 Q;  1GL2 C;  2IZ1 A;  1Z56 A;  2UWJ E;  3PRJ A;  3RBX A;  1U7J A;  4C7R A;  3L70 G;  2E75 C;  1NU1 K;  3W68 A;  1Q90 D;  1N7S C;  1JCC A;  2MKV A;  2KP8 A;  1PPJ G;  1EZV D;  5AW8 B;  4DT0 A;  2K3R A;  1EZV E;  2BCC G;  3EFF K;  3L74 J;  1VQ5 P;  1RF1 C;  4ZNC A;  1HGZ A;  4BXL A;  3E7K A;  3KPE A;  2B9B A;  1NTZ G;  3AEF C;  3VMX A;  1LTT C;  3HTK A;  3C1L A;  1M1J C;  1T2K C;  1EDK A;  1SQV E;  1TU3 F;  2P67 A;  2IDB A;  2OYI A;  1QVG O;  2E76 B;  1M56 D;  3U1A A;  3V2Q A;  2A45 G;  3H6P A;  1NTK K;  5AW6 B;  1M90 Q;  2OTK E;  4A7P A;  1EXJ A;  2Y0E A;  2W90 A;  3WUU A;  3ZDM A;  1JTH A;  1MFT A;  4IFM A;  3RK2 C;  2Q5U A;  3RL0 g;  2KB7 P;  5AW9 B;  4HJG H;  3S1K A;  5KLV E;  2YXR B;  1IFM A;  1KQG B;  4I1L A;  2KYV A;  4XA4 A;  2L5G B;  5E79 E;  2KK7 A;  3M0A A;  3GHG C;  1L0L E;  2WWW A;  1YI2 P;  2PP6 A;  3AE7 C;  1YQ3 C;  1JY3 P;  4RES B;  1ZXG A;  3I55 P;  1PIX A;  2WPS A;  2IYP A;  3G71 P;  1L4A C;  3HUS A;  5KAF E;  1ZOY C;  3WUV A;  5DJU B;  3B8E B;  2N1T C;  2E74 C;  3VN0 A;  1YTZ I;  1RHZ B;  2KUB A;  3CCS P;  4OVN F;  1ZP0 C;  4U3F D;  1CI6 B;  4OH8 B;  1EZV G;  3R4Y A;  3H1J D;  2JWD A;  2JKV A;  2OQQ A;  3H1J E;  2KLV A;  5KAI H;  3O6Q A;  1XTG B;  3PLN A;  2E43 A;  3BCC D;  5AVV B;  1IFP A;  2JWA A;  1JEK A;  1IFN A;  4KJM A;  3AE1 C;  3RL0 D;  5CCH D;  1JY3 O;  1SQV G;  1NKN A;  2FYN B;  2IBZ D;  2O1K A;  4GKG A;  3U1C A;  1NU1 J;  4B86 A;  1OFC X;  3F89 A;  4W7Y A;  4JF7 A;  1HVV A;  5TIS H;  2B89 A;  4D6T J;  5K5G B;  4OGQ C;  5EFW B;  2E76 C;  1GDT A;  4DCK A;  5KLV G;  3EWK A;  1ZW0 A;  2KNC B;  5KLI B;  2AEJ A;  1HBW A;  1ZN5 A;  1BSH A;  1GMJ A;  1L0L G;  1FJK A;  4R4L A;  1MUU A;  4PV1 B;  5AW4 B;  1OMI A;  1NTK J;  3N7N A;  1U57 A;  1SQQ E;  5BU5 A;  2YKP A;  3JC2 2;  3SWK A;  3WUT A;  3QH9 A;  3WU2 H;  1M1J A;  2WPR A;  2I8D A;  1UIX A;  3USS A;  4C7N A;  2KSJ A;  4PJ0 H;  4WY4 A;  2Q7C A;  1RY3 A;  1QL2 A;  3IAO A;  3Q5R A;  2A06 D;  1KV4 A;  1YJN P;  1LTJ A;  2J59 M;  1YYC A;  3AEB C;  1RQV A;  2AXC A;  1W2B O;  1EQ7 A;  4LGD E;  2OYI B;  1BCC D;  3H1J G;  1JMM A;  4H13 B;  1X0T A;  3V6I A;  1VQ8 P;  1FJP A;  3B4S A;  1FAV A;  3II6 A;  1JTH B;  1FZF A;  3BRT B;  2G8Y A;  1KTM A;  4M3L A;  3KXD A;  1HUC A;  3EFG A;  3KDP B;  3IN6 A;  1SQV K;  1GW4 A;  1JM0 A;  1GL2 D;  3L70 J;  1JO5 A;  4KT0 J;  4H0L B;  2M3B A;  4WB4 A;  3TDK A;  2FYN C;  2WT7 A;  3HD7 D;  3D71 A;  4GOD A;  1LTG C;  2BCC J;  1K04 A;  3L72 D;  1IFJ A;  3LW5 J;  3SSU A;  4IL6 H;  2W8Z A;  1N7S D;  3L72 E;  3L75 D;  5AVX B;  2D2C C;  2E42 A;  1KZU B;  1SQP D;  1RF0 C;  5KAI E;  1NAF A;  1NTZ J;  3JCU H;  4PD4 H;  2C0W A;  1T8Z A;  1FZC C;  2E5T A;  3D6Y A;  2NZ2 A;  1LTS C;  1IFI A;  1XTC C;  3MIW A;  3P8C D;  2FFD A;  2YMK A;  1HJB A;  2WSE J;  1FS0 E;  1IZN B;  1JY3 N;  4PV1 C;  4EDF A;  5KJ7 A;  2BAS A;  2H7H A;  5TIS E;  2KZJ A;  3O6Q B;  3PTZ A;  2Q1K A;  4PD4 I;  3H1I D;  2B87 A;  1KOR A;  4I6M C;  1GK6 A;  5APV A;  3RK2 D;  1BGY J;  3CCU P;  3H1I E;  2A06 G;  2V7Q J;  4DOJ A;  1KIL D;  2Y9Y A;  1KB9 H;  2KXP B;  4Y99 B;  1EXI A;  3A2A A;  2ZVO B;  3B5N C;  1WT6 A;  1OVV A;  1SVF A;  2I1K A;  2OYI C;  5KTB A;  1JY2 N;  4H13 C;  1OVU A;  4N6J A;  3KYQ A;  3CX5 H; 
#chains in the Genus database with same CATH homology
 3B5N D;  1FDM A;  1L4A D;  1IK9 A;  1ZR4 A;  2N1T D;  4C7R A;  3NMD A;  1ZR2 A;  1CSB A;  1NU1 K;  2FYZ A;  2FKW B;  3TK1 A;  1SFC B;  1N7S C;  1JCC A;  2KP8 A;  2O1J A;  1X9V A;  3VOP A;  2LKM A;  5AW8 B;  3NTN A;  1URQ D;  1VPC A;  4LC1 A;  2HOD A;  3BAS A;  2HFE D;  1RF1 B;  4GIF A;  2W27 A;  1GZL A;  1SP4 A;  4HYT B;  1RF1 C;  3V4Q A;  2XNX A;  1HGZ A;  4W7Z A;  3KPE A;  1M7L A;  2P7J A;  3I5C A;  1J1D C;  3VMX A;  1M1J B;  1NO4 A;  1SQB K;  1LTT C;  3HTK A;  1SFC D;  2C0X A;  5KLV K;  4AQR D;  3HUS B;  1M1J C;  1AQ5 A;  4C7N B;  1T2K C;  3P7K A;  1MFZ A;  4WY4 B;  2A45 H;  3HUS C;  3VP8 A;  2WSE H;  2P67 A;  3VTP C;  2NPS A;  2OYI A;  3L36 A;  5BVZ A;  1GL2 A;  1A02 J;  3U1A A;  5APX A;  3V2Q A;  4C46 A;  1J1E C;  2A45 G;  3H6P A;  1NTK K;  5AW6 B;  1L0L K;  1DH3 A;  1OXZ A;  3V4W A;  1ZLL A;  3O8Z A;  1T2K D;  3M91 A;  1JTH A;  1FBM A;  4IFM A;  3RK2 C;  1KFN A;  2Q5U A;  1QL1 A;  2R3C A;  2KB7 P;  2R32 A;  2ZXE B;  4WY4 D;  5AW9 B;  1GK4 A;  2XV5 A;  4IFD K;  2VRS A;  1WRG A;  2YMY A;  1N7S A;  1IFM A;  3VMZ A;  3VYI A;  1IC2 A;  4ZKP A;  3H32 B;  4I1L A;  1JCD A;  3V2P A;  2KYV A;  4XA4 A;  2WTY A;  1FZG A;  1GTW A;  2L5G B;  2YKQ A;  5APU A;  1SQX K;  1RF1 A;  3M0A A;  5APT A;  1N7L A;  1HTL C;  2CPB A;  1NHL A;  1H8A A;  3GHG C;  2WWW A;  3V5B A;  2PP6 A;  2YNY A;  2R5B A;  5AW1 B;  3MD0 A;  1J2J B;  1FU1 A;  1JY3 P;  1LTB C;  4RES B;  2WT7 B;  2WPS A;  2XDJ A;  4Y99 C;  1L4A C;  3HUS A;  3LIE A;  5CCG A;  3B8E B;  2N1T C;  3HE4 A;  3M9Q A;  3VN0 A;  1DX7 A;  1RE3 C;  1YTZ I;  2N9B A;  2OYH C;  1URQ C;  2IPP A;  4I2L C;  2HPC B;  4KHX A;  5AW7 B;  2QM8 A;  4LLH A;  3BVH A;  1T3U A;  3RL0 B;  2XKM A;  5AVS B;  1KIL A;  1CI6 B;  5AW3 B;  4OH8 B;  5AVT B;  1X79 B;  1LWU B;  1CW5 A;  3LW5 H;  1N73 B;  1GD2 E;  5AW5 B;  2KLV A;  2H8P D;  1XTG B;  2E43 A;  2FFD B;  1SFC C;  2Q9I A;  1JUN A;  1RE4 C;  2W6A A;  5AVV B;  4GT1 A;  3KQG A;  1IFN A;  4JYC A;  1SQP K;  3GHG A;  3RL0 D;  5CCH D;  1JY3 O;  1NKN A;  2O01 H;  4GKG A;  2O1K A;  3M0D C;  1GU4 A;  2YO3 A;  3MUD A;  1HWT C;  3M06 A;  3U1C A;  2WIT A;  3B5N A;  1HH0 A;  3P8M C;  1L4A A;  3UIA A;  4B86 A;  2N1T A;  1GW3 A;  4XE5 B;  3IR9 A;  1S9K E;  2OAR A;  3HE5 A;  4W7Y A;  3SWY A;  3WMM 0;  4WY4 C;  3TNU A;  1RE3 A;  5KJ7 D;  4JF7 A;  1SLQ A;  1G2C A;  1HVV A;  1LTJ B;  1FZA A;  1SQQ K;  3L4F A;  4HH2 A;  1X8Y A;  1T3J A;  1LGH B;  4AYC A;  1LTJ C;  1URQ A;  2KOG A;  2OYH A;  1A02 F;  1GDT A;  5AW2 B;  5AVU B;  2WZ7 A;  3RK3 B;  2GM4 A;  5APS A;  3V2R A;  2M8R A;  2HYN A;  1LTA C;  2FYU K;  5APQ A;  1HBW A;  1ZN5 A;  5APW A;  5CHX A;  2YO2 A;  1SFC A;  2HG5 D;  1FJK A;  3OAK A;  2POH A;  1MUU A;  2A45 I;  2PAJ A;  5AW4 B;  2H43 A;  3N7N A;  3R2P A;  3P8C E;  5BU5 A;  1OWA A;  3RK3 D;  2YKP A;  1PFI A;  2WSC H;  2P1J A;  2J58 A;  3M0D A;  2XU6 A;  1G1J A;  1M1J A;  2WPR A;  4N3Y B;  1MV8 A;  1FZE A;  4C7N A;  1IJD B;  2KSJ A;  3M9H A;  4WY4 A;  1FOS E;  5AW0 B;  2Q7C A;  1RY3 A;  2P2U A;  2WPQ A;  3VMY A;  5BU8 B;  1QL2 A;  3C9I A;  3NFQ A;  1LTJ A;  1JOC A;  3T97 A;  1LTI C;  2J59 M;  2Z5H A;  2C9N Y;  1YYC A;  3L35 A;  1ZV8 A;  1IO4 A;  1IFD A;  1EQ7 A;  4LGD E;  2W6B A;  1NKZ B;  2NPS B;  3A3Y B;  3A7O A;  2OYI B;  3MTU E;  2C9L Y;  3M9B A;  1JMM A;  1GL2 B;  4O9B A;  3RL0 C;  1N86 A;  5CCH C;  1AFO A;  3PP5 A;  5CMZ A;  1FJP A;  3IFM A;  1JNM A;  1FAV A;  3II6 A;  1LWU C;  3HD7 B;  1JTH B;  1N73 C;  1FZF A;  3BRT B;  3P32 A;  2HLO A;  3H32 A;  1LT9 B;  1JY2 P;  3HD7 C;  2FFD C;  4M3L A;  1HUC A;  1VDF A;  4WBA A;  3EFG A;  3KDP B;  1LT9 C;  2NPS D;  1G1I A;  1SQV K;  1DEB A;  1GW4 A;  1N7S B;  3N4X A;  4W80 A;  5KJ7 C;  3SWF A;  1GL2 D;  1NTZ K;  3CLQ A;  2Q3I A;  2JEE A;  1JO5 A;  5CJ0 A;  3A5T A;  2JJL A;  1KFM A;  1L0N K;  2M3B A;  2MJZ A;  3OJA B;  4WB4 A;  1FZB A;  2R5D A;  2Z5I A;  2IX7 C;  1S9K D;  2WT7 A;  3HD7 D;  3CI9 A;  1HGV A;  2IFM A;  1H89 A;  4JYB A;  2CPS A;  3BAT A;  1LTG C;  1J1D B;  4N78 D;  1IFJ A;  3EQ2 A;  3CL3 D;  4N78 E;  1NH4 A;  5AVW B;  1N7S D;  3L37 A;  5AVX B;  3TYY A;  2E42 A;  1KZU B;  4IFF A;  1RF0 C;  1NOH A;  1NAF A;  2ZFC A;  2FXM A;  2HPC A;  1FZC B;  2QM7 A;  3HRN A;  2C0W A;  1T8Z A;  1NTM K;  1W2E A;  1H88 A;  3HE4 B;  5CCG C;  1FZC C;  5CJ4 A;  3RK3 C;  5CCH A;  3V2N A;  3VP9 A;  1J1E B;  1LTS C;  1GU5 A;  1CI6 A;  3LID A;  1LWU A;  1IFI A;  2WSF H;  1JY2 O;  5AVR B;  4ZKU A;  1XTC C;  4DZO A;  1N73 A;  1RE4 A;  2GUS A;  3MIW A;  3RK2 B;  3HD7 A;  3P8C D;  1NWQ A;  2FFD A;  1HJB A;  5AVZ B;  3BRV B;  1KIL B;  5CCG D;  1LT9 A;  1JY3 N;  2Z4E A;  1KIL C;  5KJ7 A;  2BAS A;  2H7H A;  3NXS A;  1CZQ A;  5AVQ B;  2HOD B;  3G3Z A;  5APY A;  4I6M C;  1GK6 A;  5APV A;  3RK2 D;  2GUV A;  3GHG B;  3U59 A;  4EOT A;  1N2D C;  4DOJ A;  1KIL D;  1FOS F;  2IFN A;  1MZ9 A;  3MGN A;  3HTK B;  4Y99 B;  1RF0 A;  3B5N B;  3OA7 A;  1L4A B;  2I1J A;  3A2A A;  2N1T B;  3B5N C;  1WT6 A;  3HE5 B;  1FZC A;  3TNU B;  3E1I A;  4EIJ A;  1SVF A;  2XZR A;  1G2C B;  2I1K A;  2NPS C;  2OYI C;  5KTB A;  5AVY B;  1YTZ T;  1GL2 C;  1JY2 N;  3TSI A;  2OYH B;  1URQ B;  4AUW A;  2YKO A;  1KQL A;  1E5W A;  4N6J A;  3KYQ A;  1Z56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...