5APQA

Sequence ienkad inserted between gcn4 adaptors - structure a6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
61
structure length
61
Chain Sequence
QLEDKVEELLSKVYHLENEVARLKKLIENKADMKQLEDKVEELLSKVYHLENEVARLKKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 26
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apqA00
1T2KC 3KDPB 2P7JA 1H88A 4I6MC 1DH3A 2BASA 3M9BA 1MUUA 4XE5B 3VN0A 3V4WA 5CMZA 3VMXA 2WWWA 1GU4A 3MD0A 3OAKA 1NWQA 3M9HA 1JUNA 2H7HA 3L35A 4GKGA 5APVA 3L36A 3V5BA 4C7NB 5AVRB 1G2CB 3A7OA 5AW0B 5APWA 2C9NY 4KHXA 1X8YA 3HE4B 5AW2B 1A02F 5AW8B 4LC1A 2ZXEB 5AW7B 2Q5UA 2YNYA 1H89A 2E42A 1HWTC 2N9BA 3A3YB 3TYYA 3VMYA 3NXSA 1GZLA 3P32A 2C9LY 4C7NA 3M06A 2R5DA 2R32A 2W27A 2WPQA 4I2LC 5APUA 5AW5B 5AW3B 3HE4A 1HUCA 2Z5HA 1GD2E 3KQGA 3SWFA 1IO4A 3M91A 2YO3A 3TK1A 2Q3IA 3VTPC 3IR9A 1MFZA 4B86A 1S9KE 1SLQA 3O8ZA 3NTNA 1CI6B 3MGNA 2R3CA 2W6AA 5AW1B 3A2AA 2WT7B 2QM7A 3P7KA 4EOTA 1GK6A 2P2UA 4HYTB 2R5BA 5AVXB 1J2JB 2Q7CA 1YYCA 1S9KD 2XV5A 3P8MC 2WTYA 2VRSA 5APSA 3TNUA 1A02J 2E43A 3M0AA 4AYCA 2P67A 3NFQA 2JJLA 3UIAA 3A5TA 1CSBA 1CI6A 3VYIA 5APQA 3HE5B 4AQRD 5AW9B 3I5CA 4JYBA 2WT7A 3M0DA 1GU5A 2ZFCA 4C46A 1HBWA 1JNMA 5AVZB 2XZRA 1SP4A 2YO2A 3HTKA 5AVVB 3T97A 3TNUB 2WPSA 3B8EB 4M3LA 1OXZA 2KP8A 1OWAA 5APTA 1HJBA 4DZOA 1H8AA 5APXA 5AVYB 3HE5A 2Z5IA 1KQLA 1GK4A 4JYCA 2WPRA 1CZQA 1FAVA 4AUWA 5AVTB 1FOSF 5AVSB 4RESB 1FOSE 5APYA 5AW6B 3LIDA 5AVUB 5AVQB 1T2KD 2IPPA 3L37A 2XU6A 3VMZA 3V4QA 3NMDA 2QM8A 1GTWA 3LIEA 1MV8A 5AVWB 1NAFA 4GT1A 5AW4B
chains in the Genus database with same CATH superfamily
2WSEJ 3H1IJ 3KDPB 3H32A 2KYVA 2P7JA 1ZR2A 1JMMA 2K9JA 2OQQA 1RY3A 1SQPK 1LTJA 2E74D 2G8YA 3RL0B 3F5HA 1EXJA 3A0HE 1X9VA 1ZOYC 5AVRB 3II6A 1VF5B 2QJPC 3G4SP 1K05A 4U3FD 1IFIA 1IFDA 3BVHA 3L70D 1GD2E 4JF7A 3W68A 1IO4A 2FYUJ 4BWNA 5EFWB 3ZDMA 3GG2A 2W90A 4KT0J 3P8MC 1EDIA 2GUSA 2QJPB 4OGQD 4JYBA 3PJSK 1N7LA 1U7MA 1YQ3C 1Q2NA 2E5TA 3CCJP 1OX3A 2FBWC 1SQXG 1NTZJ 1RF1C 1KB9D 1IJDB 2KB7P 3VMZA 1VPCA 2QM8A 3Q2YA 4W7YA 1NAFA 2ZVNB 2W6JH 3A0BE 1LT9A 1NJIQ 3BCCE 1EZVG 1USDA 1N73B 1PIXA 5KKZB 1H0TB 1BSNA 1L0NG 1NTMG 2OTKE 3RBZA 3VMXA 1LT9B 1L0LD 1OVRA 2I1JA 4JQ0D 3B5NA 3H25A 1Q7YQ 3L36A 4C7NB 4PD4D 3A7OA 1M7LA 1YHQP 1S5LH 3CCQP 2C0WA 2ZXEB 2YNYA 3EFFK 2BCCE 2FFDA 2N9BA 1SQXK 4L74A 3HD7A 1HGVA 2NPSB 1LTIC 2HODB 3D71A 2CPSA 2HPCA 3AE8C 2FFDB 1GW3A 3Q3DA 2I8DA 1J1EC 2PAJA 1KFMA 4GOFA 3KPEA 3O6QA 1GL2C 3U1CA 3HTKB 1YITP 1M1JC 1L0NK 1NOHA 3LW5J 3TNUA 1S5LE 4AYCA 1SQBJ 1RHZB 3O6QB 2JP3A 1Y8AA 1L4AA 2QA4P 3TNUB 4I1LA 1OXZA 3U1AA 1RE3A 2FXOA 1K73Q 4GIFA 4Y28J 3QH9A 3H1HJ 1KQLA 1KB9I 1J1EB 3OA7A 2K3RA 2N1TD 3WU2E 4NPFX 3AE5C 3TGUJ 1URQB 4DCKA 1KILE 2OYOA 5L8RJ 2G3AA 2YMKA 3BASA 3CWBE 3CCVP 3RK3D 1SQQD 1UIXA 1BE3G 1RQUA 5CMZA 1USEA 2OTJP 2V4HA 3L74G 3L71G 4PD4I 2SPZA 1NYHA 1G2CB 2UWJE 5AW0B 1KILA 4U3FJ 5KJ7A 1H89A 3VMYA 3L70J 3CMEP 3CMAP 2E74C 5KAIH 1U57A 1S9KE 4IOIH 3NTNA 2R3CA 1TU3F 1FBMA 2P2UA 3PTZA 2RMZA 2ZFCA 2OYHA 1FDOA 3L72G 1BGYE 2QIWA 2E75B 1FS0E 5AVYB 5KAIE 2A45G 3V6IA 1K8AQ 1VDFA 1FZAA 3P8CD 1M90Q 2HYNA 2JEEA 2MKVA 4DOJA 1WMKA 3S1KA 5KLVG 1ZW0A 5CCGA 1MKMA 1HJ0A 4OGQC 2Y0CA 1RF0A 2FYZA 1L0LJ 1M1KQ 4O9BA 5GTIH 2QJKC 3M0DC 3S9OA 4EIJA 1ZXGA 1IZNB 2A06G 4GKGA 3H1KE 2C9NY 1SQXE 1X8YA 3L73G 2YKPA 4ASVA 5B5EH 4PJ0H 2R5DA 2P58A 3CXHH 1LGHB 2FXPA 4OGQB 4ZKUA 1EQ7A 1JMBA 1EZVE 5KLVK 1BSHA 1L0NE 4PV1D 4WB4A 2QJKB 4WBAA 1AA0A 4BRYB 2IDBA 4BXLA 4WVZA 1AVOA 1S3JA 1FDIA 1PP9G 2QJYC 3HRNA 1SQVG 1VL2A 3M9QA 3VP8A 3GHGC 4PJ0E 1VQPP 1HBWA 4UB8H 3CCRP 1KORA 3TSIA 1PPJG 2FYUG 3CXHE 3AEGC 1OWAA 3G9RA 5KLIB 3AEAC 5AVTB 3WUUA 1R5SA 3FXEA 3TDKA 5DJUB 1SS1A 2M5AA 5AVWB 5E79H 3V2QA 4WY4A 4UB8E 5C39A 2M5AB 1MUUA 1SQQJ 3GHGB 3GF3A 5CCHA 3VN0A 3PH0A 2O01N 1NTZG 3BCCD 4H0LB 1N86A 1YTZI 1SQVK 2KLVA 2BEQD 1QX8A 3QWOC 5TJHA 1N8RQ 2KS1A 2E76B 1G1IA 3G3ZA 5E79E 1LTGC 1IK9A 1OIPA 3NXSA 2CK3H 3MTUE 1N7SD 3HE4A 2BCCD 4N3YB 4K35A 3H1JG 3GMAA 3TK1A 2Q1KA 3RK3C 4HKZH 4TT3H 2ZYAA 1FJKA 2AEJA 3WUVA 1BE3E 3AECC 1L4AD 4EOTA 3L74E 5AVXB 1J2JB 2WSCH 2LXBA 1HGZA 1KC8Q 2N1TB 3VYIA 1ZRTE 3TF5A 1R8EA 5KTBA 2ZJSE 1UIIA 3AEEC 1JEKA 3G6EP 1AV1A 2N9YB 1ZMEC 3CPWO 2Z5IA 3RK3B 1VQKP 3KZIE 4H44B 1JCCA 3MZWB 1MV8A 3B71A 1LWUC 1NVOA 5CJ4A 2KNCA 3V2PA 1KILD 2B9BA 1JTHB 1EDLA 2M8RA 3CWBD 2O01J 3L72E 3L75E 1Z56A 3MP7B 2ZVOB 1OW6A 1LTJC 2Q5UA 3VP9A 2WPQA 2J5UA 1BCCE 5KLVE 3CCUP 1LWUB 2PGDA 2Q3IA 4N6JA 3JSVC 2QVAA 4YXWH 2IZ1A 5AW1B 2QM7A 3AEDC 1GK6A 3RK2D 1S9KD 2WTYA 3AEBC 3L70G 3M0AA 5APQA 3L73E 5AW9B 3I5CA 3PLNA 3U59A 2WSSH 4IL6X 1HVVA 2WPSA 2KP8A 1RE4C 1PGOA 1JY3O 2MJZA 3EWKA 1BGYD 2KIKA 4PV1C 1LP1B 2HR3A 3A0BH 2I1KA 1K9MQ 1T2KC 2BASA 4GOEA 1G1JA 1PP9E 4ASWA 1ZP0C 3BCCJ 1SQVE 1AQ5A 3RBXA 3W67A 4QMAA 1LJ2A 1PPJE 1NU1G 1NWQA 3M9HA 5APVA 1N73A 1H0TA 4KHXA 1KQFB 4PV1B 4JPZB 4LC1A 1YJWP 1HWTC 3H1KD 1L0LG 3IN6A 1OVVA 1SQXD 4C7NA 4DT0A 2R32A 1OW8A 3CX5H 2BCCJ 1RF1A 1FZBA 3N4XA 2KZJA 1FZCC 2HLOA 1JY2O 1PZQA 1RF1B 2NPSA 4A7PA 3CI9A 2HODA 2K37A 1EZVD 3H1LJ 3Q1MA 4C7RA 2R5BA 3PRJA 5CBNA 3AE6C 1KV4A 1L0ND 2E43A 3Q5SA 3UIAA 1NU1K 1IK7A 3CX5E 3HTKA 1BDCA 1N7SC 2Z4EA 3VOPA 2IZ0A 3ABVC 3WU2H 1L0LK 2IYOA 3CXHD 3H1JE 2IBZG 1NTMK 2K88A 3N7NA 4RESB 3FWNA 4ZMDA 5CCHD 1L4AC 1NTKG 1KQGB 1DD4A 2KK7A 2LR2A 1ZLLA 1WRGA 4L76A 1GL2A 3CC4P 1JO5A 1URQA 3V4WA 3IAOA 3CWBJ 4EYYQ 2WWWA 1DX7A 1M56D 1N7SB 3MD0A 3H6PA 4Y99C 1GL2B 3L35A 2WQYC 3V5BA 1M1JB 1SQPE 2FY8A 1KZUB 1SFCD 3SFDC 4YPCA 5AW7B 4I7ZC 1SQQG 3IF4A 2E5YA 2B87B 2FXMA 3M06A 1G2CA 3FGAD 3JCUH 1ZR4A 3MHVA 1NTKK 3EFGA 4ZKPA 3VTPC 3IR9A 3AE4C 3BATA 1KILC 2KLUA 1OZHA 1SLQA 1EZVI 3P7KA 4Y99B 5BU8B 1NAYA 2D2CD 1S2EA 1BE3D 2P67A 1PGQA 4I7ZB 3L74D 2QE7H 1FU1A 1P84H 1JM0A 3CLQA 3JCUE 1SP4A 2YO2A 1ZRTD 2P10A 2GUVA 4DZOA 3CXHI 1SQQK 1GK4A 2WPRA 2YXQB 2B89A 1KYOH 1BGYJ 1FOSF 3BRVB 3LIDA 2OYHC 2NZ2A 1JY3N 3RK2C 4NPEA 3L4FA 4YTPC 3Q5PA 1P84E 1BDDA 3M9BA 4XE5B 2O1KA 3RL0D 2E74B 3D70A 4D6TG 3PP5A 1KYOE 5B66H 4HH2A 3H1KJ 1RF0C 3L72D 2GA1A 2M3EA 3L75D 1SQXJ 3HUSC 2H88C 1JOCA 1QLED 5APUA 5AW3B 1PGJA 2M3BA 2ZT9C 1BCCD 5KLVD 3SWKA 5B66E 2PFXA 3H1IG 2WT7B 1QGKB 2KZIA 2H43A 1L0NJ 1NU1E 1JCDA 1A02J 1JY2N 1EXIA 3HE5B 3M0DA 4BRYA 5H2FH 2NRGA 4K3AA 1E79H 3L73D 5K5GB 1NTME 3JC22 1PFIA 5AW6B 5AVQB 1T2KD 2ITAA 1VQ4P 3PHLA 1YJNP 1DEBA 3CL3D 3E7KA 2O1JA 5H2FE 2H89C 1QVFO 1GMJA 1PP9D 3IFMA 1SQVD 2ZXXA 4CPGA 3GHGA 1FDMA 1PPJD 3B5ND 2IBZE 4WWIA 5CCHC 2QJYB 4UB6H 1EC5A 2OYIC 2KOGA 1GZLA 2C9LY 3AE1C 1NTKE 2V7QH 2IYPA 1EDKA 2KUBA 1X22A 3HD7D 3SWFA 2O3JA 3B4SA 1MFZA 2FYUK 2OTLP 2JWDA 3GLMA 1NH4A 1CI6B 3CC2P 4HYTB 1BE3J 2VRSA 2Y9YA 1X0TA 1SFCC 3L74J 4UB6E 1CSBA 4LLHA 4C46A 2OGUA 2XZRA 2OYIB 2WSFH 2ZAEB 2ZYDA 1OMIA 1HTLC 5APTA 1HJBA 2K9YA 5APXA 2N1TA 3CX5D 3KZIH 3H1LG 1NGMB 4JYCA 3G71P 4W80A 4AUWA 3L71E 1FOSE 1NTZK 5BVZA 1YI2P 2IPPA 3V4QA 3NMDA 4RO0A 3MUDA 3H1JD 1T8ZA 3AE9C 2D2CC 2WSCJ 1NO4A 4I6MC 3F89A 1YTZT 3GF7A 4KJMA 3CC7P 1SQBG 1JUNA 2A45H 2H7HA 3KHUA 1IFPA 2DW3A 1Q82Q 3L72J 5TISH 1JTHA 1VQ5P 1XTCC 3L75J 5AW8B 3H1HG 1SQPD 2D2CB 5KJ7D 4I2LC 2XNDH 1Q86Q 3TGUG 1BCCJ 5KLVJ 3RL0C 4D6TE 1LWUA 5TISE 1YYCA 2WSEH 3AE7C 1VF5C 1LTBC 4IL6E 2CPBA 2WITA 3VMAA 1SQBK 1QVGO 1GU5A 3SFEC 2RH0A 5AVVB 3T97A 3L73J 3C1LA 2JDIH 3CX5I 2E75D 2GM4A 4U3FG 4RJTA 5M1BA 3WUTA 3T97B 5AVSB 2A06E 3H32B 5GTHH 3D6YA 2K9JB 4RKUJ 2KSJA 2WVRA 1LTJB 3H1IE 3LIEA 1AQTA 5AW4B 2KXPB 1JB0J 2Y9ZA 1LTTC 1LP1A 5CCGD 1BGYG 1PP9J 1P84D 1SQVJ 4XFJA 5GTHE 2B88A 4LGDE 5APWA 1VQ8P 1VQ6P 1KYOD 1RE4A 2E42A 2ZT9D 4IFDK 2YIUC 2IFNA 1VQLP 2R3SA 2JKVA 2W27A 2FYUE 1N73C 5KKZC 2J58A 1T6AA 1FJPA 2YKQA 1LT9C 2W83C 1LTSC 4OVNF 3USSA 2W6AA 3H1KG 4N78E 1VQ7P 3Q5RA 1M8OB 1YQ4C 5CBOA 1LNQA 1SVFA 5APSA 2QEXP 1KN7A 3B5NC 4H13D 1ZN5A 3NFQA 2FYNC 3A5TA 4AQRD 1NU1D 2Q3EA 1R5LA 2YIUB 2NPSC 1AFOA 5CHXA 2KSEA 3B8EB 1OFCX 5BU5A 3FXDA 1NTZE 2FFDC 1IFMA 3HD7C 1FAVA 2XKMA 5APYA 1NTMD 3H1JJ 1AJYA 4HB1A 1T3UA 4EDFA 4Z1MH 1LTAC 1FZCA 3B5NB 1H88A 4ZNCA 2FYNB 2LXCB 3ITKA 3EQ2A 3V2RA 2P1JA 4WY4D 4H0LD 1P84I 1FZCB 1YBKA 1GU4A 2JWAA 2RN0A 3LW5H 3HD7B 1DIPA 1QEXA 3H1LE 1KYOI 1RE3C 2E76D 2XNXA 2POHA 2HPCB 1A02F 2Y0EA 1N7SA 3CCLP 1URQC 1SQPJ 1M57D 3FX0A 2LKMA 4W7ZA 1GDTA 1M1JA 2IBZD 4JBZA 1HUCA 1U7JA 3V2NA 3KQGA 1ZV8A 2OARA 1NTKD 1WT6A 4IFMA 4HJGH 2YXRB 2B87A 2FKWB 3O8ZA 3SSUA 3KXDA 3KYQA 1L4AB 1SQBE 4OH8B 3E1RA 4R4MA 2JJLA 1IFNA 2YMYA 1RQVA 5AVZB 4NPDA 1S5LX 1MZ9A 3H1HE 4M3LA 1T3JA 1YJ9P 5KJ7C 4MN4C 1H8AA 2WZ7A 1VQMP 2WMMA 2W6BA 1NKZB 3TGUE 1S72P 3AE2C 4H44D 4L75A 1FE6A 3L37A 2XU6A 1LT1A 3L71D 3SWYA 1JY3P 2C0XA 4L73A 4GT1A 3D6ZA 1FZGA 2AXTH 1DH3A 2AEFA 1HF9A 5DJTB 1KILB 4XA4A 1N2DC 2E75C 1KMIZ 1K04A 3GW6A 4U3FE 1FZFA 1Q81Q 3L70E 2IBZI 2WPVB 2HFED 2AXTE 1W2BO 2K1AA 2BEZF 3WMM0 1OW7A 5KAFH 1KB9H 3M91A 1KFNA 2Q9IA 5CCGC 2QSIA 1VF5D 1VQNP 3L75G 2OYHB 2RKLA 1QL1A 2H8PD 3RK2B 1KTMA 1PV3A 1JY2P 1OVUA 4D6TD 1NU1J 2WT7A 1PL5A 1BCCG 1JNMA 2JR8A 1W2EA 5KAFE 1KB9E 4PD4H 4U7JA 1J1DC 3HE5A 1CZQA 1NTMJ 1GW4A 3HUSA 5AVUB 1IFJA 2PP6A 3MIWA 1GTWA 2A06D 3HUSB 3R2PA 3I56P 1L0LE 4H13C 3H1ID 1IC2A 1X79B 2PRRA 2AXCA 2ZT9B 4PD4E 1DEEG 3BRTB 1HH0A 3OAKA 1J1DB 5KLIC 1Q90D 2QG4A 5GTIE 2AEMA 3I55P 3K5BA 5AW2B 2ZYGA 2W8ZA 3A3YB 3CCMP 3TYYA 3P32A 1W5CE 5B5EE 2Y0DA 5AW5B 4H13B 2Z5HA 1E5WA 1NTKJ 2YO3A 1KD1Q 1XTGB 1VQ9P 4WY4C 4H0LC 4B86A 3CCSP 1Y9BA 2FYUD 3MGNA 3A2AA 2A45I 1Y47A 2IFMA 2XV5A 3BCCG 3FWLA 2NPSD 1FZEA 2E76C 4N78D 2XDJA 1CI6A 1FC2C 3S4RA 2R44A 3AE3C 2V7QJ 2YKOA 3C9IA 3R4YA 4WY4B 2L91A 2OYIA 1NTZD 1S1CX 4TLFA 1MFTA 2BCCG 1VQOP 2L5GB 3L71J 1PGPA 4DJGA 3RK3E 4GODA 1SQQE 2N1TC 4EI2A 2J59M 2M0BA 3RGUA 2KS1B 1NHLA 2WSFJ 1GL2D 1SFCA 3MUDC 4YXDC 1DD3A 1URQD 1S4XA 4IFFA 4OWFA 3HE4B 5CJ0A 3CCEP 4H44C 1SFCB 3H1LD 1CW5A 4GDOA 3CD6P 1RH5B 1L2PA 1QL2A 3OJAB 2HG5D 3E1IA 3C8VA 2JO1A 1AVYA 4IL6H 3AEFC 1SQPG 2Q7CA 2QRXA 4D6TJ 2KI7B 3CWBG 1NKNA 1EDJA 1SQBD 1YIJP 2O01H 3OW2O 3P8CE 2Q6QA 3H1HD 3A0HH 4R4LA 1D7MA 1KQSO 2KNCB 3RL0g 3TGUD 2IX7C
chains in the Genus database with same CATH topology
3B5NB 3KDPB 3H32A 2KYVA 3L4FA 2P7JA 1H88A 1ZR2A 1JMMA 1RY3A 3EQ2A 1SQPK 3M9BA 1MUUA 3V2RA 3GHGB 4XE5B 2O1KA 2P1JA 5CCHA 1LTJA 3VN0A 3RL0D 4WY4D 1FZCB 3RL0B 3PP5A 1GU4A 1N86A 1YTZI 1SQVK 2KLVA 1X9VA 3LW5H 3HD7B 5AVRB 4HH2A 3II6A 1RE3C 2XNXA 2POHA 2HPCB 1A02F 1RF0C 1G1IA 1N7SA 3G3ZA 1LTGC 1URQC 1IK9A 2LKMA 3HUSC 3NXSA 1IFIA 4W7ZA 1IFDA 1GDTA 3MTUE 1M1JA 3BVHA 1N7SD 1JOCA 5APUA 5AW3B 3HE4A 1HUCA 3V2NA 1GD2E 3KQGA 4N3YB 1ZV8A 2M3BA 4JF7A 1IO4A 2OARA 3TK1A 3RK3C 1WT6A 4IFMA 1FJKA 2FKWB 3O8ZA 2WT7B 1L4AD 4EOTA 2H43A 3KYQA 1L4AB 5AVXB 1J2JB 4OH8B 3P8MC 2WSCH 1JCDA 1A02J 1JY2N 1HGZA 2GUSA 2JJLA 1IFNA 2YMYA 2N1TB 3VYIA 3HE5B 4JYBA 3M0DA 1N7LA 5KTBA 5AVZB 1MZ9A 4M3LA 1T3JA 5KJ7C 1H8AA 2WZ7A 1PFIA 2Z5IA 2W6BA 3RK3B 1NKZB 5AW6B 1RF1C 5AVQB 1T2KD 1IJDB 2KB7P 3L37A 2XU6A 3VMZA 1VPCA 2QM8A 1JCCA 4W7YA 3SWYA 1MV8A 1JY3P 1NAFA 2C0XA 1DEBA 3CL3D 4GT1A 1LT9A 2O1JA 1FZGA 1DH3A 1LWUC 5CJ4A 1N73B 3V2PA 1KILD 1JTHB 3VMXA 1LT9B 2I1JA 1KILB 4XA4A 2M8RA 3B5NA 1N2DC 3IFMA 3L36A 3GHGA 4C7NB 1FZFA 3A7OA 1FDMA 1Z56A 3B5ND 1M7LA 2C0WA 5CCHC 1LTJC 2ZXEB 2Q5UA 2YNYA 2FFDA 2N9BA 3VP9A 1SQXK 2OYIC 2KOGA 3HD7A 1GZLA 1HGVA 2HFED 2C9LY 2NPSB 2WPQA 1LTIC 2HODB 3WMM0 2CPSA 2HPCA 1LWUB 3HD7D 3SWFA 2FFDB 3M91A 1GW3A 2Q3IA 1KFNA 4N6JA 2Q9IA 1J1EC 1MFZA 2FYUK 5CCGC 2PAJA 1KFMA 1NH4A 1CI6B 5AW1B 2QM7A 3KPEA 1GL2C 2OYHB 3U1CA 1QL1A 1GK6A 3HTKB 1M1JC 4HYTB 3RK2D 1L0NK 1S9KD 1NOHA 2H8PD 2WTYA 3RK2B 2VRSA 3TNUA 1JY2P 3M0AA 4AYCA 1SFCC 1CSBA 5APQA 5AW9B 3I5CA 3U59A 2WT7A 4LLHA 4C46A 1JNMA 2XZRA 2OYIB 1L4AA 3TNUB 1HVVA 2WSFH 4I1LA 2WPSA 1W2EA 1OXZA 3U1AA 2KP8A 1RE4C 1RE3A 1HTLC 5APTA 1HJBA 4GIFA 1J1DC 5APXA 2N1TA 1JY3O 3HE5A 1KQLA 2MJZA 4JYCA 1CZQA 4W80A 4AUWA 1J1EB 1GW4A 3OA7A 1FOSE 1NTZK 3HUSA 5BVZA 5AVUB 1IFJA 2IPPA 2N1TD 2PP6A 3V4QA 3MIWA 3NMDA 3MUDA 1URQB 1GTWA 1T8ZA 2I1KA 3HUSB 3R2PA 1T2KC 1NO4A 3BASA 4I6MC 2BASA 1IC2A 1G1JA 1X79B 1AQ5A 3RK3D 1YTZT 5CMZA 3BRTB 1HH0A 3OAKA 1J1DB 1NWQA 3M9HA 2A45H 1JUNA 2H7HA 5APVA 1N73A 1G2CB 5AW0B 4KHXA 1JTHA 1XTCC 1KILA 5AW2B 5AW8B 4LC1A 5KJ7A 1H89A 1HWTC 3A3YB 3TYYA 3VMYA 3P32A 4C7NA 2R32A 5KJ7D 1FZBA 1RF1A 4I2LC 5AW5B 2Z5HA 1E5WA 3N4XA 2YO3A 1FZCC 2HLOA 1XTGB 3RL0C 4WY4C 4B86A 1JY2O 1S9KE 1RF1B 2NPSA 3NTNA 3MGNA 2R3CA 3CI9A 3A2AA 2HODA 1LWUA 1FBMA 2P2UA 2R5BA 4C7RA 2A45I 1YYCA 2IFMA 2XV5A 2WSEH 2NPSD 1FZEA 1LTBC 2E43A 2CPBA 4N78D 2WITA 3UIAA 1SQBK 2XDJA 1CI6A 1NU1K 1GU5A 2ZFCA 2OYHA 3HTKA 5AVVB 3T97A 1N7SC 2Z4EA 2GM4A 2YKOA 3C9IA 5AVYB 3VOPA 1L0LK 2A45G 4WY4B 5AVSB 1NTMK 3N7NA 4RESB 2OYIA 3H32B 1VDFA 1FZAA 3P8CD 5CCHD 2L5GB 2KSJA 2HYNA 2JEEA 1LTJB 1L4AC 3LIEA 4DOJA 5AW4B 5CCGA 1LTTC 1ZLLA 2N1TC 1WRGA 1GL2A 1RF0A 2FYZA 1JO5A 1URQA 3V4WA 5CCGD 2J59M 4O9BA 2WWWA 1NHLA 1DX7A 1N7SB 1GL2D 1SFCA 3M0DC 3MD0A 3H6PA 4EIJA 4Y99C 1GL2B 1URQD 3L35A 4GKGA 3V5BA 1M1JB 4LGDE 4IFFA 5APWA 2C9NY 1KZUB 1SFCD 1X8YA 3HE4B 5CJ0A 1SFCB 2YKPA 1RE4A 5AW7B 2E42A 4IFDK 2IFNA 2FXMA 2R5DA 1G2CA 3M06A 1CW5A 2W27A 1ZR4A 1LGHB 4ZKUA 1N73C 1QL2A 1NTKK 1EQ7A 2J58A 3EFGA 1FJPA 2YKQA 4ZKPA 3VTPC 3IR9A 3BATA 3OJAB 5KLVK 1LT9C 1KILC 1SLQA 2HG5D 1LTSC 3E1IA 4WB4A 2W6AA 4N78E 4WBAA 3P7KA 4Y99B 2Q7CA 5BU8B 1SVFA 5APSA 2P67A 3B5NC 1NKNA 1ZN5A 3NFQA 3A5TA 3HRNA 4AQRD 3M9QA 3VP8A 3GHGC 1FU1A 1HBWA 3CLQA 3TSIA 1SP4A 2YO2A 2NPSC 1AFOA 5CHXA 3B8EB 5BU5A 2O01H 1OWAA 3P8CE 2GUVA 1FZCA 4DZOA 2FFDC 1SQQK 1IFMA 3HD7C 1GK4A 2WPRA 1FAVA 2XKMA 5AVTB 1FOSF 3BRVB 5APYA 3LIDA 2OYHC 1T3UA 1JY3N 5AVWB 3V2QA 2IX7C 3RK2C 1LTAC 4WY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K C;  3KDP B;  2P7J A;  1H88 A;  4I6M C;  1DH3 A;  2BAS A;  3M9B A;  1MUU A;  4XE5 B;  3VN0 A;  3V4W A;  5CMZ A;  3VMX A;  2WWW A;  1GU4 A;  3MD0 A;  3OAK A;  1NWQ A;  3M9H A;  1JUN A;  2H7H A;  3L35 A;  4GKG A;  5APV A;  3L36 A;  3V5B A;  4C7N B;  5AVR B;  1G2C B;  3A7O A;  5AW0 B;  5APW A;  2C9N Y;  4KHX A;  1X8Y A;  3HE4 B;  5AW2 B;  1A02 F;  5AW8 B;  4LC1 A;  2ZXE B;  5AW7 B;  2Q5U A;  2YNY A;  1H89 A;  2E42 A;  1HWT C;  2N9B A;  3A3Y B;  3TYY A;  3VMY A;  3NXS A;  1GZL A;  3P32 A;  2C9L Y;  4C7N A;  3M06 A;  2R5D A;  2R32 A;  2W27 A;  2WPQ A;  4I2L C;  5APU A;  5AW5 B;  5AW3 B;  3HE4 A;  1HUC A;  2Z5H A;  1GD2 E;  3KQG A;  3SWF A;  1IO4 A;  3M91 A;  2YO3 A;  3TK1 A;  2Q3I A;  3VTP C;  3IR9 A;  1MFZ A;  4B86 A;  1S9K E;  1SLQ A;  3O8Z A;  3NTN A;  1CI6 B;  3MGN A;  2R3C A;  2W6A A;  5AW1 B;  3A2A A;  2WT7 B;  2QM7 A;  3P7K A;  4EOT A;  1GK6 A;  2P2U A;  4HYT B;  2R5B A;  5AVX B;  1J2J B;  2Q7C A;  1YYC A;  1S9K D;  2XV5 A;  3P8M C;  2WTY A;  2VRS A;  5APS A;  3TNU A;  1A02 J;  2E43 A;  3M0A A;  4AYC A;  2P67 A;  3NFQ A;  2JJL A;  3UIA A;  3A5T A;  1CSB A;  1CI6 A;  3VYI A;  5APQ A;  3HE5 B;  4AQR D;  5AW9 B;  3I5C A;  4JYB A;  2WT7 A;  3M0D A;  1GU5 A;  2ZFC A;  4C46 A;  1HBW A;  1JNM A;  5AVZ B;  2XZR A;  1SP4 A;  2YO2 A;  3HTK A;  5AVV B;  3T97 A;  3TNU B;  2WPS A;  3B8E B;  4M3L A;  1OXZ A;  2KP8 A;  1OWA A;  5APT A;  1HJB A;  4DZO A;  1H8A A;  5APX A;  5AVY B;  3HE5 A;  2Z5I A;  1KQL A;  1GK4 A;  4JYC A;  2WPR A;  1CZQ A;  1FAV A;  4AUW A;  5AVT B;  1FOS F;  5AVS B;  4RES B;  1FOS E;  5APY A;  5AW6 B;  3LID A;  5AVU B;  5AVQ B;  1T2K D;  2IPP A;  3L37 A;  2XU6 A;  3VMZ A;  3V4Q A;  3NMD A;  2QM8 A;  1GTW A;  3LIE A;  1MV8 A;  5AVW B;  1NAF A;  4GT1 A;  5AW4 B; 
#chains in the Genus database with same CATH topology
 2WSE J;  3H1I J;  3KDP B;  3H32 A;  2KYV A;  2P7J A;  1ZR2 A;  1JMM A;  2K9J A;  2OQQ A;  1RY3 A;  1SQP K;  1LTJ A;  2E74 D;  2G8Y A;  3RL0 B;  3F5H A;  1EXJ A;  3A0H E;  1X9V A;  1ZOY C;  5AVR B;  3II6 A;  1VF5 B;  2QJP C;  3G4S P;  1K05 A;  4U3F D;  1IFI A;  1IFD A;  3BVH A;  3L70 D;  1GD2 E;  4JF7 A;  3W68 A;  1IO4 A;  2FYU J;  4BWN A;  5EFW B;  3ZDM A;  3GG2 A;  2W90 A;  4KT0 J;  3P8M C;  1EDI A;  2GUS A;  2QJP B;  4OGQ D;  4JYB A;  3PJS K;  1N7L A;  1U7M A;  1YQ3 C;  1Q2N A;  2E5T A;  3CCJ P;  1OX3 A;  2FBW C;  1SQX G;  1NTZ J;  1RF1 C;  1KB9 D;  1IJD B;  2KB7 P;  3VMZ A;  1VPC A;  2QM8 A;  3Q2Y A;  4W7Y A;  1NAF A;  2ZVN B;  2W6J H;  3A0B E;  1LT9 A;  1NJI Q;  3BCC E;  1EZV G;  1USD A;  1N73 B;  1PIX A;  5KKZ B;  1H0T B;  1BSN A;  1L0N G;  1NTM G;  2OTK E;  3RBZ A;  3VMX A;  1LT9 B;  1L0L D;  1OVR A;  2I1J A;  4JQ0 D;  3B5N A;  3H25 A;  1Q7Y Q;  3L36 A;  4C7N B;  4PD4 D;  3A7O A;  1M7L A;  1YHQ P;  1S5L H;  3CCQ P;  2C0W A;  2ZXE B;  2YNY A;  3EFF K;  2BCC E;  2FFD A;  2N9B A;  1SQX K;  4L74 A;  3HD7 A;  1HGV A;  2NPS B;  1LTI C;  2HOD B;  3D71 A;  2CPS A;  2HPC A;  3AE8 C;  2FFD B;  1GW3 A;  3Q3D A;  2I8D A;  1J1E C;  2PAJ A;  1KFM A;  4GOF A;  3KPE A;  3O6Q A;  1GL2 C;  3U1C A;  3HTK B;  1YIT P;  1M1J C;  1L0N K;  1NOH A;  3LW5 J;  3TNU A;  1S5L E;  4AYC A;  1SQB J;  1RHZ B;  3O6Q B;  2JP3 A;  1Y8A A;  1L4A A;  2QA4 P;  3TNU B;  4I1L A;  1OXZ A;  3U1A A;  1RE3 A;  2FXO A;  1K73 Q;  4GIF A;  4Y28 J;  3QH9 A;  3H1H J;  1KQL A;  1KB9 I;  1J1E B;  3OA7 A;  2K3R A;  2N1T D;  3WU2 E;  4NPF X;  3AE5 C;  3TGU J;  1URQ B;  4DCK A;  1KIL E;  2OYO A;  5L8R J;  2G3A A;  2YMK A;  3BAS A;  3CWB E;  3CCV P;  3RK3 D;  1SQQ D;  1UIX A;  1BE3 G;  1RQU A;  5CMZ A;  1USE A;  2OTJ P;  2V4H A;  3L74 G;  3L71 G;  4PD4 I;  2SPZ A;  1NYH A;  1G2C B;  2UWJ E;  5AW0 B;  1KIL A;  4U3F J;  5KJ7 A;  1H89 A;  3VMY A;  3L70 J;  3CME P;  3CMA P;  2E74 C;  5KAI H;  1U57 A;  1S9K E;  4IOI H;  3NTN A;  2R3C A;  1TU3 F;  1FBM A;  2P2U A;  3PTZ A;  2RMZ A;  2ZFC A;  2OYH A;  1FDO A;  3L72 G;  1BGY E;  2QIW A;  2E75 B;  1FS0 E;  5AVY B;  5KAI E;  2A45 G;  3V6I A;  1K8A Q;  1VDF A;  1FZA A;  3P8C D;  1M90 Q;  2HYN A;  2JEE A;  2MKV A;  4DOJ A;  1WMK A;  3S1K A;  5KLV G;  1ZW0 A;  5CCG A;  1MKM A;  1HJ0 A;  4OGQ C;  2Y0C A;  1RF0 A;  2FYZ A;  1L0L J;  1M1K Q;  4O9B A;  5GTI H;  2QJK C;  3M0D C;  3S9O A;  4EIJ A;  1ZXG A;  1IZN B;  2A06 G;  4GKG A;  3H1K E;  2C9N Y;  1SQX E;  1X8Y A;  3L73 G;  2YKP A;  4ASV A;  5B5E H;  4PJ0 H;  2R5D A;  2P58 A;  3CXH H;  1LGH B;  2FXP A;  4OGQ B;  4ZKU A;  1EQ7 A;  1JMB A;  1EZV E;  5KLV K;  1BSH A;  1L0N E;  4PV1 D;  4WB4 A;  2QJK B;  4WBA A;  1AA0 A;  4BRY B;  2IDB A;  4BXL A;  4WVZ A;  1AVO A;  1S3J A;  1FDI A;  1PP9 G;  2QJY C;  3HRN A;  1SQV G;  1VL2 A;  3M9Q A;  3VP8 A;  3GHG C;  4PJ0 E;  1VQP P;  1HBW A;  4UB8 H;  3CCR P;  1KOR A;  3TSI A;  1PPJ G;  2FYU G;  3CXH E;  3AEG C;  1OWA A;  3G9R A;  5KLI B;  3AEA C;  5AVT B;  3WUU A;  1R5S A;  3FXE A;  3TDK A;  5DJU B;  1SS1 A;  2M5A A;  5AVW B;  5E79 H;  3V2Q A;  4WY4 A;  4UB8 E;  5C39 A;  2M5A B;  1MUU A;  1SQQ J;  3GHG B;  3GF3 A;  5CCH A;  3VN0 A;  3PH0 A;  2O01 N;  1NTZ G;  3BCC D;  4H0L B;  1N86 A;  1YTZ I;  1SQV K;  2KLV A;  2BEQ D;  1QX8 A;  3QWO C;  5TJH A;  1N8R Q;  2KS1 A;  2E76 B;  1G1I A;  3G3Z A;  5E79 E;  1LTG C;  1IK9 A;  1OIP A;  3NXS A;  2CK3 H;  3MTU E;  1N7S D;  3HE4 A;  2BCC D;  4N3Y B;  4K35 A;  3H1J G;  3GMA A;  3TK1 A;  2Q1K A;  3RK3 C;  4HKZ H;  4TT3 H;  2ZYA A;  1FJK A;  2AEJ A;  3WUV A;  1BE3 E;  3AEC C;  1L4A D;  4EOT A;  3L74 E;  5AVX B;  1J2J B;  2WSC H;  2LXB A;  1HGZ A;  1KC8 Q;  2N1T B;  3VYI A;  1ZRT E;  3TF5 A;  1R8E A;  5KTB A;  2ZJS E;  1UII A;  3AEE C;  1JEK A;  3G6E P;  1AV1 A;  2N9Y B;  1ZME C;  3CPW O;  2Z5I A;  3RK3 B;  1VQK P;  3KZI E;  4H44 B;  1JCC A;  3MZW B;  1MV8 A;  3B71 A;  1LWU C;  1NVO A;  5CJ4 A;  2KNC A;  3V2P A;  1KIL D;  2B9B A;  1JTH B;  1EDL A;  2M8R A;  3CWB D;  2O01 J;  3L72 E;  3L75 E;  1Z56 A;  3MP7 B;  2ZVO B;  1OW6 A;  1LTJ C;  2Q5U A;  3VP9 A;  2WPQ A;  2J5U A;  1BCC E;  5KLV E;  3CCU P;  1LWU B;  2PGD A;  2Q3I A;  4N6J A;  3JSV C;  2QVA A;  4YXW H;  2IZ1 A;  5AW1 B;  2QM7 A;  3AED C;  1GK6 A;  3RK2 D;  1S9K D;  2WTY A;  3AEB C;  3L70 G;  3M0A A;  5APQ A;  3L73 E;  5AW9 B;  3I5C A;  3PLN A;  3U59 A;  2WSS H;  4IL6 X;  1HVV A;  2WPS A;  2KP8 A;  1RE4 C;  1PGO A;  1JY3 O;  2MJZ A;  3EWK A;  1BGY D;  2KIK A;  4PV1 C;  1LP1 B;  2HR3 A;  3A0B H;  2I1K A;  1K9M Q;  1T2K C;  2BAS A;  4GOE A;  1G1J A;  1PP9 E;  4ASW A;  1ZP0 C;  3BCC J;  1SQV E;  1AQ5 A;  3RBX A;  3W67 A;  4QMA A;  1LJ2 A;  1PPJ E;  1NU1 G;  1NWQ A;  3M9H A;  5APV A;  1N73 A;  1H0T A;  4KHX A;  1KQF B;  4PV1 B;  4JPZ B;  4LC1 A;  1YJW P;  1HWT C;  3H1K D;  1L0L G;  3IN6 A;  1OVV A;  1SQX D;  4C7N A;  4DT0 A;  2R32 A;  1OW8 A;  3CX5 H;  2BCC J;  1RF1 A;  1FZB A;  3N4X A;  2KZJ A;  1FZC C;  2HLO A;  1JY2 O;  1PZQ A;  1RF1 B;  2NPS A;  4A7P A;  3CI9 A;  2HOD A;  2K37 A;  1EZV D;  3H1L J;  3Q1M A;  4C7R A;  2R5B A;  3PRJ A;  5CBN A;  3AE6 C;  1KV4 A;  1L0N D;  2E43 A;  3Q5S A;  3UIA A;  1NU1 K;  1IK7 A;  3CX5 E;  3HTK A;  1BDC A;  1N7S C;  2Z4E A;  3VOP A;  2IZ0 A;  3ABV C;  3WU2 H;  1L0L K;  2IYO A;  3CXH D;  3H1J E;  2IBZ G;  1NTM K;  2K88 A;  3N7N A;  4RES B;  3FWN A;  4ZMD A;  5CCH D;  1L4A C;  1NTK G;  1KQG B;  1DD4 A;  2KK7 A;  2LR2 A;  1ZLL A;  1WRG A;  4L76 A;  1GL2 A;  3CC4 P;  1JO5 A;  1URQ A;  3V4W A;  3IAO A;  3CWB J;  4EYY Q;  2WWW A;  1DX7 A;  1M56 D;  1N7S B;  3MD0 A;  3H6P A;  4Y99 C;  1GL2 B;  3L35 A;  2WQY C;  3V5B A;  1M1J B;  1SQP E;  2FY8 A;  1KZU B;  1SFC D;  3SFD C;  4YPC A;  5AW7 B;  4I7Z C;  1SQQ G;  3IF4 A;  2E5Y A;  2B87 B;  2FXM A;  3M06 A;  1G2C A;  3FGA D;  3JCU H;  1ZR4 A;  3MHV A;  1NTK K;  3EFG A;  4ZKP A;  3VTP C;  3IR9 A;  3AE4 C;  3BAT A;  1KIL C;  2KLU A;  1OZH A;  1SLQ A;  1EZV I;  3P7K A;  4Y99 B;  5BU8 B;  1NAY A;  2D2C D;  1S2E A;  1BE3 D;  2P67 A;  1PGQ A;  4I7Z B;  3L74 D;  2QE7 H;  1FU1 A;  1P84 H;  1JM0 A;  3CLQ A;  3JCU E;  1SP4 A;  2YO2 A;  1ZRT D;  2P10 A;  2GUV A;  4DZO A;  3CXH I;  1SQQ K;  1GK4 A;  2WPR A;  2YXQ B;  2B89 A;  1KYO H;  1BGY J;  1FOS F;  3BRV B;  3LID A;  2OYH C;  2NZ2 A;  1JY3 N;  3RK2 C;  4NPE A;  3L4F A;  4YTP C;  3Q5P A;  1P84 E;  1BDD A;  3M9B A;  4XE5 B;  2O1K A;  3RL0 D;  2E74 B;  3D70 A;  4D6T G;  3PP5 A;  1KYO E;  5B66 H;  4HH2 A;  3H1K J;  1RF0 C;  3L72 D;  2GA1 A;  2M3E A;  3L75 D;  1SQX J;  3HUS C;  2H88 C;  1JOC A;  1QLE D;  5APU A;  5AW3 B;  1PGJ A;  2M3B A;  2ZT9 C;  1BCC D;  5KLV D;  3SWK A;  5B66 E;  2PFX A;  3H1I G;  2WT7 B;  1QGK B;  2KZI A;  2H43 A;  1L0N J;  1NU1 E;  1JCD A;  1A02 J;  1JY2 N;  1EXI A;  3HE5 B;  3M0D A;  4BRY A;  5H2F H;  2NRG A;  4K3A A;  1E79 H;  3L73 D;  5K5G B;  1NTM E;  3JC2 2;  1PFI A;  5AW6 B;  5AVQ B;  1T2K D;  2ITA A;  1VQ4 P;  3PHL A;  1YJN P;  1DEB A;  3CL3 D;  3E7K A;  2O1J A;  5H2F E;  2H89 C;  1QVF O;  1GMJ A;  1PP9 D;  3IFM A;  1SQV D;  2ZXX A;  4CPG A;  3GHG A;  1FDM A;  1PPJ D;  3B5N D;  2IBZ E;  4WWI A;  5CCH C;  2QJY B;  4UB6 H;  1EC5 A;  2OYI C;  2KOG A;  1GZL A;  2C9L Y;  3AE1 C;  1NTK E;  2V7Q H;  2IYP A;  1EDK A;  2KUB A;  1X22 A;  3HD7 D;  3SWF A;  2O3J A;  3B4S A;  1MFZ A;  2FYU K;  2OTL P;  2JWD A;  3GLM A;  1NH4 A;  1CI6 B;  3CC2 P;  4HYT B;  1BE3 J;  2VRS A;  2Y9Y A;  1X0T A;  1SFC C;  3L74 J;  4UB6 E;  1CSB A;  4LLH A;  4C46 A;  2OGU A;  2XZR A;  2OYI B;  2WSF H;  2ZAE B;  2ZYD A;  1OMI A;  1HTL C;  5APT A;  1HJB A;  2K9Y A;  5APX A;  2N1T A;  3CX5 D;  3KZI H;  3H1L G;  1NGM B;  4JYC A;  3G71 P;  4W80 A;  4AUW A;  3L71 E;  1FOS E;  1NTZ K;  5BVZ A;  1YI2 P;  2IPP A;  3V4Q A;  3NMD A;  4RO0 A;  3MUD A;  3H1J D;  1T8Z A;  3AE9 C;  2D2C C;  2WSC J;  1NO4 A;  4I6M C;  3F89 A;  1YTZ T;  3GF7 A;  4KJM A;  3CC7 P;  1SQB G;  1JUN A;  2A45 H;  2H7H A;  3KHU A;  1IFP A;  2DW3 A;  1Q82 Q;  3L72 J;  5TIS H;  1JTH A;  1VQ5 P;  1XTC C;  3L75 J;  5AW8 B;  3H1H G;  1SQP D;  2D2C B;  5KJ7 D;  4I2L C;  2XND H;  1Q86 Q;  3TGU G;  1BCC J;  5KLV J;  3RL0 C;  4D6T E;  1LWU A;  5TIS E;  1YYC A;  2WSE H;  3AE7 C;  1VF5 C;  1LTB C;  4IL6 E;  2CPB A;  2WIT A;  3VMA A;  1SQB K;  1QVG O;  1GU5 A;  3SFE C;  2RH0 A;  5AVV B;  3T97 A;  3L73 J;  3C1L A;  2JDI H;  3CX5 I;  2E75 D;  2GM4 A;  4U3F G;  4RJT A;  5M1B A;  3WUT A;  3T97 B;  5AVS B;  2A06 E;  3H32 B;  5GTH H;  3D6Y A;  2K9J B;  4RKU J;  2KSJ A;  2WVR A;  1LTJ B;  3H1I E;  3LIE A;  1AQT A;  5AW4 B;  2KXP B;  1JB0 J;  2Y9Z A;  1LTT C;  1LP1 A;  5CCG D;  1BGY G;  1PP9 J;  1P84 D;  1SQV J;  4XFJ A;  5GTH E;  2B88 A;  4LGD E;  5APW A;  1VQ8 P;  1VQ6 P;  1KYO D;  1RE4 A;  2E42 A;  2ZT9 D;  4IFD K;  2YIU C;  2IFN A;  1VQL P;  2R3S A;  2JKV A;  2W27 A;  2FYU E;  1N73 C;  5KKZ C;  2J58 A;  1T6A A;  1FJP A;  2YKQ A;  1LT9 C;  2W83 C;  1LTS C;  4OVN F;  3USS A;  2W6A A;  3H1K G;  4N78 E;  1VQ7 P;  3Q5R A;  1M8O B;  1YQ4 C;  5CBO A;  1LNQ A;  1SVF A;  5APS A;  2QEX P;  1KN7 A;  3B5N C;  4H13 D;  1ZN5 A;  3NFQ A;  2FYN C;  3A5T A;  4AQR D;  1NU1 D;  2Q3E A;  1R5L A;  2YIU B;  2NPS C;  1AFO A;  5CHX A;  2KSE A;  3B8E B;  1OFC X;  5BU5 A;  3FXD A;  1NTZ E;  2FFD C;  1IFM A;  3HD7 C;  1FAV A;  2XKM A;  5APY A;  1NTM D;  3H1J J;  1AJY A;  4HB1 A;  1T3U A;  4EDF A;  4Z1M H;  1LTA C;  1FZC A;  3B5N B;  1H88 A;  4ZNC A;  2FYN B;  2LXC B;  3ITK A;  3EQ2 A;  3V2R A;  2P1J A;  4WY4 D;  4H0L D;  1P84 I;  1FZC B;  1YBK A;  1GU4 A;  2JWA A;  2RN0 A;  3LW5 H;  3HD7 B;  1DIP A;  1QEX A;  3H1L E;  1KYO I;  1RE3 C;  2E76 D;  2XNX A;  2POH A;  2HPC B;  1A02 F;  2Y0E A;  1N7S A;  3CCL P;  1URQ C;  1SQP J;  1M57 D;  3FX0 A;  2LKM A;  4W7Z A;  1GDT A;  1M1J A;  2IBZ D;  4JBZ A;  1HUC A;  1U7J A;  3V2N A;  3KQG A;  1ZV8 A;  2OAR A;  1NTK D;  1WT6 A;  4IFM A;  4HJG H;  2YXR B;  2B87 A;  2FKW B;  3O8Z A;  3SSU A;  3KXD A;  3KYQ A;  1L4A B;  1SQB E;  4OH8 B;  3E1R A;  4R4M A;  2JJL A;  1IFN A;  2YMY A;  1RQV A;  5AVZ B;  4NPD A;  1S5L X;  1MZ9 A;  3H1H E;  4M3L A;  1T3J A;  1YJ9 P;  5KJ7 C;  4MN4 C;  1H8A A;  2WZ7 A;  1VQM P;  2WMM A;  2W6B A;  1NKZ B;  3TGU E;  1S72 P;  3AE2 C;  4H44 D;  4L75 A;  1FE6 A;  3L37 A;  2XU6 A;  1LT1 A;  3L71 D;  3SWY A;  1JY3 P;  2C0X A;  4L73 A;  4GT1 A;  3D6Z A;  1FZG A;  2AXT H;  1DH3 A;  2AEF A;  1HF9 A;  5DJT B;  1KIL B;  4XA4 A;  1N2D C;  2E75 C;  1KMI Z;  1K04 A;  3GW6 A;  4U3F E;  1FZF A;  1Q81 Q;  3L70 E;  2IBZ I;  2WPV B;  2HFE D;  2AXT E;  1W2B O;  2K1A A;  2BEZ F;  3WMM 0;  1OW7 A;  5KAF H;  1KB9 H;  3M91 A;  1KFN A;  2Q9I A;  5CCG C;  2QSI A;  1VF5 D;  1VQN P;  3L75 G;  2OYH B;  2RKL A;  1QL1 A;  2H8P D;  3RK2 B;  1KTM A;  1PV3 A;  1JY2 P;  1OVU A;  4D6T D;  1NU1 J;  2WT7 A;  1PL5 A;  1BCC G;  1JNM A;  2JR8 A;  1W2E A;  5KAF E;  1KB9 E;  4PD4 H;  4U7J A;  1J1D C;  3HE5 A;  1CZQ A;  1NTM J;  1GW4 A;  3HUS A;  5AVU B;  1IFJ A;  2PP6 A;  3MIW A;  1GTW A;  2A06 D;  3HUS B;  3R2P A;  3I56 P;  1L0L E;  4H13 C;  3H1I D;  1IC2 A;  1X79 B;  2PRR A;  2AXC A;  2ZT9 B;  4PD4 E;  1DEE G;  3BRT B;  1HH0 A;  3OAK A;  1J1D B;  5KLI C;  1Q90 D;  2QG4 A;  5GTI E;  2AEM A;  3I55 P;  3K5B A;  5AW2 B;  2ZYG A;  2W8Z A;  3A3Y B;  3CCM P;  3TYY A;  3P32 A;  1W5C E;  5B5E E;  2Y0D A;  5AW5 B;  4H13 B;  2Z5H A;  1E5W A;  1NTK J;  2YO3 A;  1KD1 Q;  1XTG B;  1VQ9 P;  4WY4 C;  4H0L C;  4B86 A;  3CCS P;  1Y9B A;  2FYU D;  3MGN A;  3A2A A;  2A45 I;  1Y47 A;  2IFM A;  2XV5 A;  3BCC G;  3FWL A;  2NPS D;  1FZE A;  2E76 C;  4N78 D;  2XDJ A;  1CI6 A;  1FC2 C;  3S4R A;  2R44 A;  3AE3 C;  2V7Q J;  2YKO A;  3C9I A;  3R4Y A;  4WY4 B;  2L91 A;  2OYI A;  1NTZ D;  1S1C X;  4TLF A;  1MFT A;  2BCC G;  1VQO P;  2L5G B;  3L71 J;  1PGP A;  4DJG A;  3RK3 E;  4GOD A;  1SQQ E;  2N1T C;  4EI2 A;  2J59 M;  2M0B A;  3RGU A;  2KS1 B;  1NHL A;  2WSF J;  1GL2 D;  1SFC A;  3MUD C;  4YXD C;  1DD3 A;  1URQ D;  1S4X A;  4IFF A;  4OWF A;  3HE4 B;  5CJ0 A;  3CCE P;  4H44 C;  1SFC B;  3H1L D;  1CW5 A;  4GDO A;  3CD6 P;  1RH5 B;  1L2P A;  1QL2 A;  3OJA B;  2HG5 D;  3E1I A;  3C8V A;  2JO1 A;  1AVY A;  4IL6 H;  3AEF C;  1SQP G;  2Q7C A;  2QRX A;  4D6T J;  2KI7 B;  3CWB G;  1NKN A;  1EDJ A;  1SQB D;  1YIJ P;  2O01 H;  3OW2 O;  3P8C E;  2Q6Q A;  3H1H D;  3A0H H;  4R4L A;  1D7M A;  1KQS O;  2KNC B;  3RL0 g;  3TGU D;  2IX7 C; 
#chains in the Genus database with same CATH homology
 3B5N B;  3KDP B;  3H32 A;  2KYV A;  3L4F A;  2P7J A;  1H88 A;  1ZR2 A;  1JMM A;  1RY3 A;  3EQ2 A;  1SQP K;  3M9B A;  1MUU A;  3V2R A;  3GHG B;  4XE5 B;  2O1K A;  2P1J A;  5CCH A;  1LTJ A;  3VN0 A;  3RL0 D;  4WY4 D;  1FZC B;  3RL0 B;  3PP5 A;  1GU4 A;  1N86 A;  1YTZ I;  1SQV K;  2KLV A;  1X9V A;  3LW5 H;  3HD7 B;  5AVR B;  4HH2 A;  3II6 A;  1RE3 C;  2XNX A;  2POH A;  2HPC B;  1A02 F;  1RF0 C;  1G1I A;  1N7S A;  3G3Z A;  1LTG C;  1URQ C;  1IK9 A;  2LKM A;  3HUS C;  3NXS A;  1IFI A;  4W7Z A;  1IFD A;  1GDT A;  3MTU E;  1M1J A;  3BVH A;  1N7S D;  1JOC A;  5APU A;  5AW3 B;  3HE4 A;  1HUC A;  3V2N A;  1GD2 E;  3KQG A;  4N3Y B;  1ZV8 A;  2M3B A;  4JF7 A;  1IO4 A;  2OAR A;  3TK1 A;  3RK3 C;  1WT6 A;  4IFM A;  1FJK A;  2FKW B;  3O8Z A;  2WT7 B;  1L4A D;  4EOT A;  2H43 A;  3KYQ A;  1L4A B;  5AVX B;  1J2J B;  4OH8 B;  3P8M C;  2WSC H;  1JCD A;  1A02 J;  1JY2 N;  1HGZ A;  2GUS A;  2JJL A;  1IFN A;  2YMY A;  2N1T B;  3VYI A;  3HE5 B;  4JYB A;  3M0D A;  1N7L A;  5KTB A;  5AVZ B;  1MZ9 A;  4M3L A;  1T3J A;  5KJ7 C;  1H8A A;  2WZ7 A;  1PFI A;  2Z5I A;  2W6B A;  3RK3 B;  1NKZ B;  5AW6 B;  1RF1 C;  5AVQ B;  1T2K D;  1IJD B;  2KB7 P;  3L37 A;  2XU6 A;  3VMZ A;  1VPC A;  2QM8 A;  1JCC A;  4W7Y A;  3SWY A;  1MV8 A;  1JY3 P;  1NAF A;  2C0X A;  1DEB A;  3CL3 D;  4GT1 A;  1LT9 A;  2O1J A;  1FZG A;  1DH3 A;  1LWU C;  5CJ4 A;  1N73 B;  3V2P A;  1KIL D;  1JTH B;  3VMX A;  1LT9 B;  2I1J A;  1KIL B;  4XA4 A;  2M8R A;  3B5N A;  1N2D C;  3IFM A;  3L36 A;  3GHG A;  4C7N B;  1FZF A;  3A7O A;  1FDM A;  1Z56 A;  3B5N D;  1M7L A;  2C0W A;  5CCH C;  1LTJ C;  2ZXE B;  2Q5U A;  2YNY A;  2FFD A;  2N9B A;  3VP9 A;  1SQX K;  2OYI C;  2KOG A;  3HD7 A;  1GZL A;  1HGV A;  2HFE D;  2C9L Y;  2NPS B;  2WPQ A;  1LTI C;  2HOD B;  3WMM 0;  2CPS A;  2HPC A;  1LWU B;  3HD7 D;  3SWF A;  2FFD B;  3M91 A;  1GW3 A;  2Q3I A;  1KFN A;  4N6J A;  2Q9I A;  1J1E C;  1MFZ A;  2FYU K;  5CCG C;  2PAJ A;  1KFM A;  1NH4 A;  1CI6 B;  5AW1 B;  2QM7 A;  3KPE A;  1GL2 C;  2OYH B;  3U1C A;  1QL1 A;  1GK6 A;  3HTK B;  1M1J C;  4HYT B;  3RK2 D;  1L0N K;  1S9K D;  1NOH A;  2H8P D;  2WTY A;  3RK2 B;  2VRS A;  3TNU A;  1JY2 P;  3M0A A;  4AYC A;  1SFC C;  1CSB A;  5APQ A;  5AW9 B;  3I5C A;  3U59 A;  2WT7 A;  4LLH A;  4C46 A;  1JNM A;  2XZR A;  2OYI B;  1L4A A;  3TNU B;  1HVV A;  2WSF H;  4I1L A;  2WPS A;  1W2E A;  1OXZ A;  3U1A A;  2KP8 A;  1RE4 C;  1RE3 A;  1HTL C;  5APT A;  1HJB A;  4GIF A;  1J1D C;  5APX A;  2N1T A;  1JY3 O;  3HE5 A;  1KQL A;  2MJZ A;  4JYC A;  1CZQ A;  4W80 A;  4AUW A;  1J1E B;  1GW4 A;  3OA7 A;  1FOS E;  1NTZ K;  3HUS A;  5BVZ A;  5AVU B;  1IFJ A;  2IPP A;  2N1T D;  2PP6 A;  3V4Q A;  3MIW A;  3NMD A;  3MUD A;  1URQ B;  1GTW A;  1T8Z A;  2I1K A;  3HUS B;  3R2P A;  1T2K C;  1NO4 A;  3BAS A;  4I6M C;  2BAS A;  1IC2 A;  1G1J A;  1X79 B;  1AQ5 A;  3RK3 D;  1YTZ T;  5CMZ A;  3BRT B;  1HH0 A;  3OAK A;  1J1D B;  1NWQ A;  3M9H A;  2A45 H;  1JUN A;  2H7H A;  5APV A;  1N73 A;  1G2C B;  5AW0 B;  4KHX A;  1JTH A;  1XTC C;  1KIL A;  5AW2 B;  5AW8 B;  4LC1 A;  5KJ7 A;  1H89 A;  1HWT C;  3A3Y B;  3TYY A;  3VMY A;  3P32 A;  4C7N A;  2R32 A;  5KJ7 D;  1FZB A;  1RF1 A;  4I2L C;  5AW5 B;  2Z5H A;  1E5W A;  3N4X A;  2YO3 A;  1FZC C;  2HLO A;  1XTG B;  3RL0 C;  4WY4 C;  4B86 A;  1JY2 O;  1S9K E;  1RF1 B;  2NPS A;  3NTN A;  3MGN A;  2R3C A;  3CI9 A;  3A2A A;  2HOD A;  1LWU A;  1FBM A;  2P2U A;  2R5B A;  4C7R A;  2A45 I;  1YYC A;  2IFM A;  2XV5 A;  2WSE H;  2NPS D;  1FZE A;  1LTB C;  2E43 A;  2CPB A;  4N78 D;  2WIT A;  3UIA A;  1SQB K;  2XDJ A;  1CI6 A;  1NU1 K;  1GU5 A;  2ZFC A;  2OYH A;  3HTK A;  5AVV B;  3T97 A;  1N7S C;  2Z4E A;  2GM4 A;  2YKO A;  3C9I A;  5AVY B;  3VOP A;  1L0L K;  2A45 G;  4WY4 B;  5AVS B;  1NTM K;  3N7N A;  4RES B;  2OYI A;  3H32 B;  1VDF A;  1FZA A;  3P8C D;  5CCH D;  2L5G B;  2KSJ A;  2HYN A;  2JEE A;  1LTJ B;  1L4A C;  3LIE A;  4DOJ A;  5AW4 B;  5CCG A;  1LTT C;  1ZLL A;  2N1T C;  1WRG A;  1GL2 A;  1RF0 A;  2FYZ A;  1JO5 A;  1URQ A;  3V4W A;  5CCG D;  2J59 M;  4O9B A;  2WWW A;  1NHL A;  1DX7 A;  1N7S B;  1GL2 D;  1SFC A;  3M0D C;  3MD0 A;  3H6P A;  4EIJ A;  4Y99 C;  1GL2 B;  1URQ D;  3L35 A;  4GKG A;  3V5B A;  1M1J B;  4LGD E;  4IFF A;  5APW A;  2C9N Y;  1KZU B;  1SFC D;  1X8Y A;  3HE4 B;  5CJ0 A;  1SFC B;  2YKP A;  1RE4 A;  5AW7 B;  2E42 A;  4IFD K;  2IFN A;  2FXM A;  2R5D A;  1G2C A;  3M06 A;  1CW5 A;  2W27 A;  1ZR4 A;  1LGH B;  4ZKU A;  1N73 C;  1QL2 A;  1NTK K;  1EQ7 A;  2J58 A;  3EFG A;  1FJP A;  2YKQ A;  4ZKP A;  3VTP C;  3IR9 A;  3BAT A;  3OJA B;  5KLV K;  1LT9 C;  1KIL C;  1SLQ A;  2HG5 D;  1LTS C;  3E1I A;  4WB4 A;  2W6A A;  4N78 E;  4WBA A;  3P7K A;  4Y99 B;  2Q7C A;  5BU8 B;  1SVF A;  5APS A;  2P67 A;  3B5N C;  1NKN A;  1ZN5 A;  3NFQ A;  3A5T A;  3HRN A;  4AQR D;  3M9Q A;  3VP8 A;  3GHG C;  1FU1 A;  1HBW A;  3CLQ A;  3TSI A;  1SP4 A;  2YO2 A;  2NPS C;  1AFO A;  5CHX A;  3B8E B;  5BU5 A;  2O01 H;  1OWA A;  3P8C E;  2GUV A;  1FZC A;  4DZO A;  2FFD C;  1SQQ K;  1IFM A;  3HD7 C;  1GK4 A;  2WPR A;  1FAV A;  2XKM A;  5AVT B;  1FOS F;  3BRV B;  5APY A;  3LID A;  2OYH C;  1T3U A;  1JY3 N;  5AVW B;  3V2Q A;  2IX7 C;  3RK2 C;  1LTA C;  4WY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...