5APQA

Sequence ienkad inserted between gcn4 adaptors - structure a6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
61
structure length
61
Chain Sequence
QLEDKVEELLSKVYHLENEVARLKKLIENKADMKQLEDKVEELLSKVYHLENEVARLKKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 26
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apqA00
3M9BA 3T97A 3NFQA 3M0AA 3V4WA 4AYCA 5APQA 5AW7B 4M3LA 5APWA 3NXSA 3IR9A 2WWWA 3NTNA 2C9LY 3VYIA 4LC1A 2WT7A 5AVVB 4KHXA 2E43A 2W27A 5AW9B 3KQGA 1JNMA 2YO3A 1DH3A 5APYA 1OXZA 3M0DA 3TK1A 3V5BA 3L37A 2P67A 3KDPB 3O8ZA 1GK6A 5AVYB 4GT1A 3L36A 1HUCA 3HE5B 1GU4A 2WPSA 4B86A 1CI6B 4C46A 3VTPC 1MFZA 5CMZA 1S9KE 1G2CB 1FAVA 1CSBA 5AW1B 4GKGA 5AW4B 3A2AA 4I2LC 3VMXA 3NMDA 1HWTC 2P7JA 4HYTB 2C9NY 3HE4B 2E42A 1GU5A 1HBWA 2ZFCA 2R3CA 1J2JB 4AQRD 2H7HA 2Z5HA 2JJLA 3HTKA 1A02J 1KQLA 1CZQA 3TNUA 5AVXB 4DZOA 5APUA 4RESB 2KP8A 2N9BA 3A7OA 4I6MC 3VMZA 3A3YB 1GK4A 1CI6A 3L35A 2Q5UA 2BASA 3M91A 5APXA 5AW8B 3VN0A 2P2UA 1H88A 5AW0B 2W6AA 4JYBA 1HJBA 5AVTB 3V4QA 1NWQA 1S9KD 1H8AA 2XU6A 3LIDA 1GTWA 4C7NA 4AUWA 2Q7CA 3OAKA 3M9HA 2Q3IA 2R32A 1H89A 3M06A 1X8YA 1MV8A 3MD0A 5AW5B 3P8MC 3TNUB 5AVRB 2IPPA 1A02F 1SP4A 2R5DA 4JYCA 5AVSB 1FOSE 1NAFA 3I5CA 1YYCA 1FOSF 3P32A 3B8EB 5AW3B 1MUUA 5AVWB 3TYYA 3VMYA 1T2KC 1OWAA 2VRSA 5AW2B 3P7KA 3SWFA 3HE4A 2WPQA 3LIEA 1IO4A 5APVA 1T2KD 1SLQA 2QM8A 2XZRA 5AVUB 1JUNA 5APSA 2XV5A 4XE5B 2WT7B 2Z5IA 4C7NB 5AVZB 3HE5A 2R5BA 1GD2E 1GZLA 2WPRA 2QM7A 2WTYA 3MGNA 3A5TA 5AW6B 5APTA 4EOTA 3UIAA 2YO2A 2ZXEB 5AVQB 2YNYA
chains in the Genus database with same CATH superfamily
2KS1B 3M9BA 2IDBA 3T97A 5CCHD 1VQNP 2QJYB 2BCCJ 3ITKA 2NZ2A 2RMZA 1LTJB 1SQVK 1USDA 3JSVC 2E5YA 1HGVA 5AW7B 1GL2B 2KB7P 1SQVE 5GTIE 4WY4C 4O9BA 1N73A 2FXOA 3HUSA 2HYNA 2C9LY 2UWJE 3VYIA 1N2DC 3L74G 2K1AA 3MUDA 2J5UA 5GTIH 1Q86Q 1IFPA 3AE1C 2E43A 3H1HD 4RKUJ 2W27A 1BE3E 1VQ7P 3TF5A 4U3FJ 2W6BA 2JWDA 2JKVA 1M56D 3BCCD 3L71J 3L70D 1FZCC 3JCUH 1JM0A 1LTJA 2OGUA 2WITA 4LGDE 4W80A 4PV1D 1S4XA 3M0DA 2QEXP 1YQ4C 2J59M 1G1JA 5KLIC 1BE3G 2P67A 3AEEC 2RN0A 2G3AA 1BGYE 2K9JA 3VP9A 3V2RA 2O01N 1S72P 1HGZA 4YPCA 1KTMA 1KZUB 3SSUA 2WPSA 1G1IA 2YMYA 3D6ZA 1KB9I 1ZLLA 3H1JD 1OFCX 2P1JA 1VQ9P 2O01H 5CMZA 3CXHE 2R44A 3H1LG 1VDFA 1G2CB 2IZ0A 3GHGC 4R4LA 4ASWA 5B5EE 4PJ0E 2OYIC 4GKGA 1AQTA 1L0ND 1NYHA 1OW8A 2OARA 4I2LC 3TGUD 2FYUG 3NMDA 5E79E 2SPZA 4YXWH 5CJ4A 2P7JA 3CI9A 2IBZD 5TISE 3BASA 4EIJA 1GU5A 1M90Q 1FZGA 3H1KG 3F89A 4Y99C 3RL0B 3Q5SA 2XNXA 4H0LD 2B88A 3VMAA 4AQRD 2Z5HA 3AEBC 1PFIA 1A02J 1YIJP 3L75E 1IJDB 1KORA 3CCLP 3CL3D 1T8ZA 2V7QJ 3CMEP 3CCRP 1KFNA 2E74D 1LTTC 1SVFA 1SQQD 3W68A 4K3AA 2A45H 1BSNA 2GUVA 3L35A 1KB9H 2E74B 1JY3P 2Q5UA 3QH9A 3VP8A 1N73B 5AW8B 3H1KD 1WMKA 3I55P 4WVZA 1S1CX 3AE4C 1L0LG 2E76D 1EQ7A 1JY2N 2YXRB 3MP7B 3O6QA 3V4QA 4EI2A 2OYHA 2KSEA 4PV1B 4OGQD 1LWUB 1H8AA 2NPSD 2W90A 2IBZE 3LIDA 2FFDB 1GD2E 2YKOA 3EFGA 1L0NJ 3TGUJ 3FXEA 1NTMJ 1H89A 3CX5H 2JO1A 3HD7A 2YKQA 4GODA 5CCGA 3E1RA 3RK2D 1KB9D 1LTAC 1NTZD 5GTHE 1A02F 1MFTA 3RK2B 1FJKA 5AVSB 2NRGA 3I5CA 3P8CD 4PD4D 3L73G 1JB0J 1FOSF 3OW2O 2QIWA 1J1DB 1PGJA 3WUVA 1SQPE 3G9RA 2OTJP 3VMYA 2L91A 1GL2C 2B9BA 3U59A 3RK3B 2W6JH 1E5WA 2KZIA 1M57D 4LLHA 1NJIQ 2QJYC 2DW3A 1QGKB 1JEKA 2IBZI 1T2KD 3L73D 1IO4A 1M8OB 1NGMB 2B89A 1GL2D 1KYOI 2OYOA 3BRTB 1EDKA 2QM8A 1NTZG 1LT9A 1UIXA 3MIWA 2KXPB 1LWUC 3OA7A 2D2CB 5KKZB 1OW7A 3HE5A 2HLOA 2M5AB 1LTSC 3H1HE 1RE4C 5KAIE 1SQBG 2FY8A 1KD1Q 3IN6A 1OVVA 1KILC 5AW6B 1M1JB 3CC4P 3B4SA 3N4XA 5CCHC 4IL6X 2LXBA 3EFFK 1AV1A 2JJLA 1KV4A 4BRYB 4ZKUA 5DJUB 1URQC 3PHLA 3RL0D 2FYZA 3M0AA 3V4WA 4EYYQ 1BDCA 1N86A 3C1LA 1PPJD 2A06D 5APWA 2O1JA 3NXSA 2QJPC 3NTNA 4R4MA 3AE6C 4N78D 3L72D 4MN4C 5TJHA 1KN7A 3FXDA 3HTKB 4LC1A 1NO4A 2JP3A 2KLVA 5KJ7C 2WT7A 4L73A 5AW9B 2IZ1A 1NH4A 1S3JA 5CBOA 3G71P 1Q90D 1OX3A 1RE3A 2HG5D 2YO3A 1NU1K 5APYA 1OXZA 2LXCB 2ZXXA 4PD4I 1X9VA 5CCHA 2E76B 3H1JJ 1YJNP 2BEZF 2L5GB 3KDPB 3L37A 1MKMA 3V2NA 3H25A 1Z56A 2YIUC 2W83C 5AVYB 4XFJA 5KAIH 3BATA 3JC22 3L36A 4NPFX 2WMMA 1VQ4P 1SQBJ 3KZIE 4N78E 3HE5B 5GTHH 3GF7A 3BCCE 4ASVA 4N6JA 4B86A 3U1AA 1CI6B 4C46A 4U3FE 1LT9B 1PPJE 2A06E 1MFZA 1DIPA 4L74A 1RQUA 5K5GB 1N7SC 2WSCH 1KYOD 1URQB 2HODA 3Q1MA 1ZRTE 4I7ZB 4WY4A 1VQLP 1CSBA 2ZVNB 1VQOP 4WBAA 5CHXA 1SQQG 3B5NC 1EZVI 3H1KE 3WMM0 2Q3EA 1M1JC 2QVAA 4OVNF 1QEXA 1NKNA 2A45I 4W7ZA 5KTBA 2OYHB 3CCQP 3AE5C 4Y28J 3ZDMA 4HH2A 1SQQE 3PP5A 1AQ5A 2R3CA 1J2JB 1KYOH 2NPSB 5KLVE 3L73J 3EWKA 3L70G 3HTKA 1YTZT 1DD4A 3OJAB 5H2FE 3D70A 4WY4B 1E79H 1G2CA 2E74C 2I8DA 4RESB 2D2CD 3CCEP 2KP8A 3U1CA 3ABVC 2RKLA 2N9BA 2N1TC 1ZOYC 1L0NG 3HD7D 3TGUG 2YMKA 1M1KQ 2FYUD 5M1BA 1Y47A 1HTLC 2CPBA 3RK3C 2BASA 1RF1A 3GF3A 3M91A 1AVOA 5APXA 3R4YA 1IZNB 1LTBC 1IC2A 1JY3O 1LTGC 2AXTE 2ZT9D 3MZWB 1PP9J 1FZEA 1K05A 1SFCC 2KNCA 2P2UA 5L8RJ 1H88A 1RY3A 2NPSC 3RK3D 3AEGC 1FBMA 3TSIA 4RJTA 1N7LA 1PP9G 2KLUA 5AVTB 2ZJSE 2KIKA 1KB9E 1LP1B 4WWIA 5KLVD 2QA4P 1S9KD 1NWQA 1ZMEC 4PJ0H 3CWBD 2M5AA 4NPDA 1HBWA 1GTWA 3CXHI 3B5NB 2IX7C 3IAOA 2R32A 3AE8C 1SQQK 1JCDA 1URQA 1X8YA 1MV8A 1JY3N 2AEJA 2FXPA 2HODB 3MD0A 4UB8E 3P8MC 3PJSK 3TNUB 2B87B 5KAFH 3RL0g 3H1LE 2FBWC 5BVZA 4RO0A 1BGYD 2IFMA 1LWUA 5C39A 2ZT9B 1QVGO 1FOSE 3L70J 1GW3A 2WSSH 1RE4A 4PD4H 2GM4A 2XKMA 1SFCB 1BDDA 3B8EB 3RGUA 3Q5RA 3H1KJ 4IFMA 1MUUA 3B71A 2C0XA 4IOIH 1R5SA 4OH8B 4QMAA 1OWAA 2VRSA 3TYYA 3P7KA 5E79H 4ZKPA 3CMAP 2WSCJ 2WPQA 5CJ0A 1Y8AA 4KT0J 3I56P 1SQQJ 3LIEA 2WPVB 1AVYA 3RK3E 4BWNA 4L76A 1K73Q 1VQKP 2Z4EA 1SLQA 1LTIC 1D7MA 1EZVD 5KLVK 1FZFA 4H13B 1OVRA 4UB6H 1FZCB 3N7NA 3AE3C 2AEMA 4YXDC 2XV5A 4XE5B 2WT7B 1JY2P 1GDTA 2FFDA 5AVZB 1KILD 1AA0A 2P58A 2O3JA 5H2FH 2WTYA 1BCCE 3G3ZA 3H32B 1SQXE 2H88C 2O1KA 3GLMA 3KZIH 5KJ7A 2WZ7A 4EDFA 3L72E 4ZNCA 4EOTA 1L0NE 1URQD 3UIAA 1NTME 1EDIA 3TGUE 1VQPP 2H89C 2Q1KA 2ZXEB 3H1JG 3HRNA 1AJYA 3CCJP 2KS1A 4I7ZC 3S1KA 3GHGB 1BCCD 4AYCA 1WRGA 2LR2A 1XTGB 3IR9A 2WWWA 2KI7B 3CX5D 2WSFH 4XA4A 2BCCE 3L74J 1EZVE 2N1TD 1L2PA 5AVVB 4KHXA 2YIUB 1LP1A 4IFFA 1VF5D 1L4AC 3KQGA 1JNMA 2CK3H 1SQXK 1IFMA 1JO5A 1RF1C 2BCCG 1R8EA 1NAYA 4HB1A 2WSFJ 4OWFA 3L74D 4A7PA 1L0LE 2Y0DA 1YJWP 1FDOA 5BU8B 3C8VA 2E75D 2FYNC 1NOHA 1S2EA 1M1JA 1WT6A 3O8ZA 3V2QA 4BXLA 1SQBD 3H1HJ 1OMIA 3H1LD 2PRRA 4GT1A 2BCCD 1H0TB 1HUCA 1P84D 3CX5E 1S5LX 2IYPA 2JWAA 4GIFA 2KZJA 1RF1B 3AE7C 3VTPC 3GW6A 3E1IA 3IF4A 1SQXG 2P10A 5B5EH 2I1KA 1NTZJ 3RK2C 1L0NK 1VQ5P 2NPSA 1VQ6P 1ZXGA 1S9KE 1BCCJ 2RH0A 2C0WA 5AW4B 3VMXA 3A2AA 2E75B 1EDLA 3F5HA 3H1IG 1H0TA 1SQXD 3Q2YA 1HWTC 4HYTB 3PTZA 2C9NY 3HE4B 1HF9A 1LJ2A 1ZP0C 2E42A 1KILE 1ZN5A 2FYUE 4GDOA 1HVVA 5CBNA 4D6TE 2H7HA 1QL1A 1JMBA 2H8PD 1LGHB 1KQLA 2I1JA 2KUBA 2Y0CA 3HD7C 3RBZA 3TNUA 5AVXB 4DOJA 3LW5H 2ZYGA 2A45G 2Q9IA 2M3BA 3WU2H 1NTMG 2IFNA 1ZW0A 1N7SB 3A7OA 3Q3DA 1CI6A 1SFCD 3B5NA 1N7SD 3AEAC 1IFDA 2WVRA 5B66H 3A0BH 3G6EP 1ZR2A 2OTLP 3BCCJ 2Y9YA 3L71D 1GL2A 1L0LJ 2ZVOB 4NPEA 2KSJA 3L73E 3JCUE 4GOFA 4H0LB 4JYBA 2KK7A 3KPEA 5AW0B 4D6TG 1KFMA 3H6PA 4Y99B 2WQYC 1NHLA 1ZRTD 3RL0C 1T2KC 1CW5A 1RF0C 1M7LA 3E7KA 3KHUA 2XU6A 3CCUP 1N7SA 4C7NA 1KQGB 4AUWA 3OAKA 2K88A 2Q3IA 2FYUK 3FX0A 3P8CE 3M06A 1NTKJ 2HR3A 4PD4E 3CWBE 3GMAA 5AW5B 3CCVP 1T3UA 1U7MA 2M8RA 2M0BA 3WUUA 1K9MQ 1PV3A 2IPPA 2H43A 1SQPG 1SP4A 2R5DA 2J58A 2K3RA 1P84I 3CXHD 4JYCA 1KILA 4HKZH 2HPCB 4UB8H 3CC7P 3P32A 1U7JA 3CLQA 4I1LA 4OGQC 3G4SP 4DJGA 5AVWB 1N73C 4C7RA 2QJPB 1FDMA 3SWFA 2ZT9C 1J1EC 3HE4A 3CCMP 3Q5PA 1X0TA 5TISH 2FYUJ 1IFNA 4JF7A 1QLED 4WY4D 1FC2C 1K04A 1X22A 2O01J 2BEQD 2V7QH 3PLNA 2QSIA 4TLFA 2B87A 1SFCA 3B5ND 3H1LJ 2XZRA 3L4FA 3VOPA 5AVUB 1JUNA 3CC2P 1PP9E 1DX7A 5APSA 3CXHH 4W7YA 1SQBK 2LKMA 3FWNA 1Y9BA 1SQVJ 1IK9A 1T6AA 2Q6QA 3H1ID 5KAFE 1GZLA 1BGYJ 4YTPC 1HJBA 2HFED 2K9YA 1FE6A 1VF5B 3HUSB 4H0LC 3FWLA 3IFMA 5APTA 1S5LH 4N3YB 1KMIZ 5CCGC 3AEDC 2K9JB 1PL5A 3LW5J 1Q2NA 1BE3J 2PFXA 1KC8Q 1SQVD 2OYIB 1LTJC 2KOGA 1X79B 1P84H 1KYOE 3L75G 1S5LE 1JMMA 1NKZB 3NFQA 2OYIA 1XTCC 1DEBA 3L71G 4M3LA 2QRXA 5APQA 3S9OA 1LNQA 1IK7A 4U3FG 3TDKA 2ZAEB 2IYOA 3A0HE 3HD7B 1PP9D 1BSHA 4UB6E 1NTKE 1J1DC 3AECC 4H13D 4H44D 2HPCA 1VF5C 1L0LK 3FGAD 1JCCA 2AEFA 2YXQB 3PRJA 3O6QB 1EZVG 3CX5I 3H1JE 4H44C 2ZYDA 1EC5A 2POHA 3GHGA 2E75C 1P84E 1FZAA 1KQFB 3L75J 3WUTA 1PZQA 1SQPD 3TK1A 2N9YB 1U57A 2QE7H 3V5BA 4JBZA 1SQBE 1NTKK 1YITP 2R3SA 1HJ0A 2V4HA 4PV1C 4JPZB 5BU5A 1GK6A 3L74E 2QG4A 1YI2P 3MHVA 5KJ7D 4KJMA 1GU4A 2QJKC 1BGYG 4OGQB 3L72J 4L75A 3C9IA 1LT1A 3GG2A 1SQVG 2E5TA 5CCGD 1VL2A 1BE3D 1RQVA 3R2PA 1QVFO 2N1TA 4IFDK 1NTMK 4DCKA 4K35A 1SQPK 2FYNB 2N1TB 2PP6A 3AE9C 1FAVA 3CD6P 4TT3H 1K8AQ 3CWBG 3M0DC 5AVQB 2JR8A 5AW1B 1YHQP 3BVHA 2GA1A 2W8ZA 2AXTH 3II6A 1W2BO 1RHZB 1DH3A 1JTHB 1L4AB 2AXCA 2WSEJ 3AE2C 3H1IE 3H32A 3HUSC 1JTHA 1L4AA 2ZFCA 4Z1MH 1EDJA 1FJPA 3MUDC 3SWKA 1Q81Q 1TU3F 2OYHC 3MTUE 1GMJA 2YKPA 1SQPJ 1Q82Q 1CZQA 3WU2E 2MJZA 1R5LA 3L75D 4DZOA 1OW6A 5APUA 5KLVJ 1FZCA 3S4RA 1NU1D 3EQ2A 1NTKG 2XNDH 2PGDA 4I6MC 4IL6H 1W5CE 1NU1J 1GK4A 1PIXA 3A3YB 3KXDA 4JQ0D 3SFEC 3VMZA 1Q7YQ 1J1EB 1LT9C 3D71A 1FU1A 2FKWB 2ZYAA 4U7JA 3VN0A 4WB4A 1PGQA 2KNCB 3K5BA 4D6TJ 1YTZI 2W6AA 1JY2O 1NTZE 1RH5B 3A0BE 3T97B 1OZHA 3BCCG 5B66E 1PGPA 1EXJA 2D2CC 5KKZC 1QL2A 5KLIB 5DJTB 2E76C 1USEA 2Q7CA 1JOCA 1NU1G 1YBKA 3M9HA 1FDIA 1NTZK 1PGOA 4H13C 3AEFC 2JDIH 2IBZG 1IFIA 4IL6E 3SFDC 3CCSP 1EXIA 5KLVG 2K37A 3D6YA 3V2PA 4ZMDA 3RBXA 1DEEG 1FS0E 2Y0EA 5AVRB 4CPGA 1ZR4A 3BRVB 2OQQA 2FFDC 1NAFA 1YYCA 4BRYA 3L71E 2G8YA 4U3FD 1ZV8A 1VQMP 2M3EA 2QJKB 1L0LD 1QX8A 2KYVA 3KYQA 5EFWB 4HJGH 5AW3B 1UIIA 4DT0A 2Y9ZA 1YQ3C 5AW2B 1NVOA 3L70E 1YJ9P 1T3JA 3H1IJ 2XDJA 1DD3A 5APVA 1N8RQ 3CWBJ 3W67A 1AFOA 3V6IA 1BCCG 3SWYA 2PAJA 1VPCA 3QWOC 1RE3C 1VQ8P 1OVUA 1OIPA 3A0HH 4H44B 1KILB 1SQXJ 1W2EA 2OTKE 4D6TD 2Z5IA 1IFJA 4C7NB 1GW4A 2JEEA 2MKVA 2R5BA 2WPRA 1MZ9A 1NU1E 3L72G 2WSEH 2QM7A 4GOEA 3MGNA 3USSA 3A5TA 3CPWO 2ITAA 1HH0A 1PPJG 2A06G 3PH0A 1RF0A 2CPSA 3H1HG 1NTKD 2FXMA 1FZBA 1NTMD 2YO2A 3M9QA 1KQSO 1SS1A 2GUSA 2YNYA 1L4AD
chains in the Genus database with same CATH topology
3M9BA 5CCHD 3T97A 5AW7B 1LTJB 1SQVK 1HGVA 1GL2B 2KB7P 4WY4C 4O9BA 1N73A 3HUSA 2HYNA 2C9LY 3VYIA 1N2DC 3MUDA 2E43A 2W27A 2W6BA 1DH3A 1FZCC 1LTJA 2WITA 4LGDE 4W80A 3M0DA 2J59M 1G1JA 2P67A 3VP9A 3V2RA 1HGZA 1KZUB 2WPSA 1G1IA 2YMYA 1ZLLA 2P1JA 2O01H 5CMZA 1VDFA 1G2CB 3GHGC 2OYIC 4GKGA 4I2LC 2OARA 3NMDA 5CJ4A 2P7JA 3CI9A 4EIJA 3BASA 1FZGA 1GU5A 4Y99C 3RL0B 2XNXA 4AQRD 2Z5HA 1PFIA 1A02J 1IJDB 3CL3D 1T8ZA 1KFNA 1LTTC 1SVFA 2A45H 2GUVA 3L35A 2Q5UA 1JY3P 3VP8A 1N73B 5AW8B 1EQ7A 1JY2N 3V4QA 2OYHA 1H8AA 1LWUB 2NPSD 3LIDA 2FFDB 2YKOA 3EFGA 1H89A 3HD7A 2YKQA 3RK2D 1LTAC 1A02F 3RK2B 1FJKA 5AVSB 3I5CA 3P8CD 1FOSF 1J1DB 3VMYA 1GL2C 3U59A 3RK3B 1E5WA 4LLHA 1IO4A 1T2KD 1GL2D 3BRTB 2QM8A 1LT9A 3MIWA 1LWUC 3OA7A 3HE5A 2HLOA 1LTSC 1RE4C 1KILC 5AW6B 1M1JB 3N4XA 5CCHC 2JJLA 4ZKUA 3RL0D 1URQC 2FYZA 3M0AA 3V4WA 1N86A 5APWA 2O1JA 3NXSA 3NTNA 4N78D 3HTKB 4LC1A 1NO4A 2KLVA 5KJ7C 2WT7A 5AW9B 1NH4A 1RE3A 2HG5D 2YO3A 1NU1K 5APYA 1OXZA 1X9VA 5CCHA 3L37A 2L5GB 3KDPB 3V2NA 1Z56A 5AVYB 3BATA 3L36A 4N78E 3HE5B 4B86A 4N6JA 3U1AA 1CI6B 4C46A 1LT9B 1MFZA 1N7SC 2WSCH 1URQB 2HODA 4WY4A 1CSBA 4WBAA 5CHXA 3B5NC 3WMM0 1M1JC 1NKNA 2A45I 4W7ZA 2OYHB 4HH2A 1AQ5A 3PP5A 2R3CA 1J2JB 2NPSB 3HTKA 1YTZT 3OJAB 4WY4B 1G2CA 4RESB 2KP8A 3U1CA 3HD7D 2N9BA 2N1TC 1HTLC 2CPBA 3RK3C 2BASA 1RF1A 3M91A 5APXA 1LTBC 1IC2A 1JY3O 1LTGC 1SFCC 1FZEA 2P2UA 1H88A 1RY3A 2NPSC 3RK3D 3TSIA 1FBMA 1N7LA 5AVTB 1NWQA 1S9KD 1GTWA 3B5NB 2IX7C 2R32A 1SQQK 1JCDA 1URQA 3MD0A 1X8YA 1MV8A 1JY3N 2HODB 5CCGA 2FFDC 3P8MC 3TNUB 2IFMA 1LWUA 1FOSE 1GW3A 1RE4A 2GM4A 2XKMA 1SFCB 3B8EB 4IFMA 1MUUA 4OH8B 2C0XA 3TYYA 4ZKPA 1T2KC 1OWAA 2VRSA 3P7KA 2WPQA 5CJ0A 3LIEA 2Z4EA 1SLQA 1LTIC 5KLVK 1FZCB 3N7NA 2XV5A 4XE5B 2WT7B 1JY2P 1GDTA 2FFDA 5AVZB 1KILD 2WTYA 3G3ZA 3H32B 5KJ7A 2O1KA 2WZ7A 4EOTA 1URQD 3UIAA 3HRNA 2ZXEB 3GHGB 4AYCA 1WRGA 1XTGB 3IR9A 2WWWA 2WSFH 4XA4A 2N1TD 5AVVB 4KHXA 4IFFA 3KQGA 1L4AC 1JNMA 1SQXK 1IFMA 1JO5A 5BU8B 1NOHA 3O8ZA 1M1JA 1WT6A 3V2QA 4GT1A 1HUCA 4GIFA 1RF1B 3VTPC 3E1IA 2I1KA 3RK2C 1L0NK 2NPSA 1S9KE 2C0WA 5AW4B 3VMXA 3A2AA 1HWTC 4HYTB 2C9NY 3HE4B 2E42A 1ZN5A 1HVVA 2H7HA 1QL1A 2H8PD 1LGHB 1KQLA 2I1JA 3HD7C 4DOJA 3TNUA 5AVXB 3LW5H 2A45G 2Q9IA 2M3BA 2IFNA 3A7OA 1N7SB 1CI6A 1SFCD 3B5NA 1N7SD 1IFDA 1ZR2A 1GL2A 5BVZA 2KSJA 5AW0B 5KTBA 4JYBA 1HJBA 3KPEA 1KFMA 3H6PA 4Y99B 3RL0C 1NHLA 1CW5A 1RF0C 1M7LA 2XU6A 4AUWA 1N7SA 4C7NA 3OAKA 2Q3IA 2FYUK 3P8CE 3M06A 5AW5B 1T3UA 2M8RA 2IPPA 2H43A 1SP4A 2R5DA 2J58A 4JYCA 2HPCB 1KILA 3P32A 3CLQA 4I1LA 5AVWB 1N73C 4C7RA 1FDMA 3SWFA 1J1EC 3HE4A 1IFNA 4JF7A 4WY4D 1SFCA 3B5ND 3L4FA 2XZRA 3VOPA 5AVUB 1JUNA 1DX7A 5APSA 4W7YA 1SQBK 2LKMA 1IK9A 1GD2E 1GZLA 2HFED 3HUSB 3IFMA 5APTA 4N3YB 5CCGC 2OYIB 2KOGA 1LTJC 1X79B 3NFQA 1JMMA 1NKZB 2OYIA 1XTCC 1DEBA 5APQA 4M3LA 3HD7B 2HPCA 1J1DC 1L0LK 1JCCA 1FZFA 2POHA 3GHGA 1FZAA 3TK1A 3V5BA 1NTKK 5BU5A 1GK6A 5KJ7D 1GU4A 3C9IA 5CCGD 4IFDK 3R2PA 2N1TA 1NTMK 1SQPK 2PP6A 2N1TB 1FAVA 5AW1B 3M0DC 5AVQB 3BVHA 3II6A 1JTHB 1L4AB 3HUSC 1HBWA 3H32A 1JTHA 1L4AA 2ZFCA 1FJPA 2OYHC 3MTUE 2YKPA 1CZQA 2MJZA 4DZOA 5APUA 1FZCA 3EQ2A 4I6MC 3VMZA 3A3YB 1GK4A 1J1EB 1LT9C 1FU1A 2FKWB 3VN0A 4WB4A 1YTZI 2W6AA 1JY2O 1QL2A 2Q7CA 1JOCA 3M9HA 1NTZK 1IFIA 3V2PA 5AVRB 1ZR4A 3BRVB 1NAFA 1YYCA 1ZV8A 1RF1C 5AW3B 2KYVA 3KYQA 5AW2B 1T3JA 2XDJA 5APVA 1AFOA 3SWYA 2PAJA 1VPCA 1RE3C 1KILB 1W2EA 2Z5IA 1IFJA 4C7NB 1GW4A 2R5BA 2JEEA 2WPRA 1MZ9A 2WSEH 2QM7A 3MGNA 3A5TA 1HH0A 1RF0A 2CPSA 2FXMA 1FZBA 2YO2A 3M9QA 2GUSA 2YNYA 1L4AD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  3T97 A;  3NFQ A;  3M0A A;  3V4W A;  4AYC A;  5APQ A;  5AW7 B;  4M3L A;  5APW A;  3NXS A;  3IR9 A;  2WWW A;  3NTN A;  2C9L Y;  3VYI A;  4LC1 A;  2WT7 A;  5AVV B;  4KHX A;  2E43 A;  2W27 A;  5AW9 B;  3KQG A;  1JNM A;  2YO3 A;  1DH3 A;  5APY A;  1OXZ A;  3M0D A;  3TK1 A;  3V5B A;  3L37 A;  2P67 A;  3KDP B;  3O8Z A;  1GK6 A;  5AVY B;  4GT1 A;  3L36 A;  1HUC A;  3HE5 B;  1GU4 A;  2WPS A;  4B86 A;  1CI6 B;  4C46 A;  3VTP C;  1MFZ A;  5CMZ A;  1S9K E;  1G2C B;  1FAV A;  1CSB A;  5AW1 B;  4GKG A;  5AW4 B;  3A2A A;  4I2L C;  3VMX A;  3NMD A;  1HWT C;  2P7J A;  4HYT B;  2C9N Y;  3HE4 B;  2E42 A;  1GU5 A;  1HBW A;  2ZFC A;  2R3C A;  1J2J B;  4AQR D;  2H7H A;  2Z5H A;  2JJL A;  3HTK A;  1A02 J;  1KQL A;  1CZQ A;  3TNU A;  5AVX B;  4DZO A;  5APU A;  4RES B;  2KP8 A;  2N9B A;  3A7O A;  4I6M C;  3VMZ A;  3A3Y B;  1GK4 A;  1CI6 A;  3L35 A;  2Q5U A;  2BAS A;  3M91 A;  5APX A;  5AW8 B;  3VN0 A;  2P2U A;  1H88 A;  5AW0 B;  2W6A A;  4JYB A;  1HJB A;  5AVT B;  3V4Q A;  1NWQ A;  1S9K D;  1H8A A;  2XU6 A;  3LID A;  1GTW A;  4C7N A;  4AUW A;  2Q7C A;  3OAK A;  3M9H A;  2Q3I A;  2R32 A;  1H89 A;  3M06 A;  1X8Y A;  1MV8 A;  3MD0 A;  5AW5 B;  3P8M C;  3TNU B;  5AVR B;  2IPP A;  1A02 F;  1SP4 A;  2R5D A;  4JYC A;  5AVS B;  1FOS E;  1NAF A;  3I5C A;  1YYC A;  1FOS F;  3P32 A;  3B8E B;  5AW3 B;  1MUU A;  5AVW B;  3TYY A;  3VMY A;  1T2K C;  1OWA A;  2VRS A;  5AW2 B;  3P7K A;  3SWF A;  3HE4 A;  2WPQ A;  3LIE A;  1IO4 A;  5APV A;  1T2K D;  1SLQ A;  2QM8 A;  2XZR A;  5AVU B;  1JUN A;  5APS A;  2XV5 A;  4XE5 B;  2WT7 B;  2Z5I A;  4C7N B;  5AVZ B;  3HE5 A;  2R5B A;  1GD2 E;  1GZL A;  2WPR A;  2QM7 A;  2WTY A;  3MGN A;  3A5T A;  5AW6 B;  5APT A;  4EOT A;  3UIA A;  2YO2 A;  2ZXE B;  5AVQ B;  2YNY A; 
#chains in the Genus database with same CATH topology
 2KS1 B;  3M9B A;  2IDB A;  3T97 A;  5CCH D;  1VQN P;  2QJY B;  2BCC J;  3ITK A;  2NZ2 A;  2RMZ A;  1LTJ B;  1SQV K;  1USD A;  3JSV C;  2E5Y A;  1HGV A;  5AW7 B;  1GL2 B;  2KB7 P;  1SQV E;  5GTI E;  4WY4 C;  4O9B A;  1N73 A;  2FXO A;  3HUS A;  2HYN A;  2C9L Y;  2UWJ E;  3VYI A;  1N2D C;  3L74 G;  2K1A A;  3MUD A;  2J5U A;  5GTI H;  1Q86 Q;  1IFP A;  3AE1 C;  2E43 A;  3H1H D;  4RKU J;  2W27 A;  1BE3 E;  1VQ7 P;  3TF5 A;  4U3F J;  2W6B A;  2JWD A;  2JKV A;  1M56 D;  3BCC D;  3L71 J;  3L70 D;  1FZC C;  3JCU H;  1JM0 A;  1LTJ A;  2OGU A;  2WIT A;  4LGD E;  4W80 A;  4PV1 D;  1S4X A;  3M0D A;  2QEX P;  1YQ4 C;  2J59 M;  1G1J A;  5KLI C;  1BE3 G;  2P67 A;  3AEE C;  2RN0 A;  2G3A A;  1BGY E;  2K9J A;  3VP9 A;  3V2R A;  2O01 N;  1S72 P;  1HGZ A;  4YPC A;  1KTM A;  1KZU B;  3SSU A;  2WPS A;  1G1I A;  2YMY A;  3D6Z A;  1KB9 I;  1ZLL A;  3H1J D;  1OFC X;  2P1J A;  1VQ9 P;  2O01 H;  5CMZ A;  3CXH E;  2R44 A;  3H1L G;  1VDF A;  1G2C B;  2IZ0 A;  3GHG C;  4R4L A;  4ASW A;  5B5E E;  4PJ0 E;  2OYI C;  4GKG A;  1AQT A;  1L0N D;  1NYH A;  1OW8 A;  2OAR A;  4I2L C;  3TGU D;  2FYU G;  3NMD A;  5E79 E;  2SPZ A;  4YXW H;  5CJ4 A;  2P7J A;  3CI9 A;  2IBZ D;  5TIS E;  3BAS A;  4EIJ A;  1GU5 A;  1M90 Q;  1FZG A;  3H1K G;  3F89 A;  4Y99 C;  3RL0 B;  3Q5S A;  2XNX A;  4H0L D;  2B88 A;  3VMA A;  4AQR D;  2Z5H A;  3AEB C;  1PFI A;  1A02 J;  1YIJ P;  3L75 E;  1IJD B;  1KOR A;  3CCL P;  3CL3 D;  1T8Z A;  2V7Q J;  3CME P;  3CCR P;  1KFN A;  2E74 D;  1LTT C;  1SVF A;  1SQQ D;  3W68 A;  4K3A A;  2A45 H;  1BSN A;  2GUV A;  3L35 A;  1KB9 H;  2E74 B;  1JY3 P;  2Q5U A;  3QH9 A;  3VP8 A;  1N73 B;  5AW8 B;  3H1K D;  1WMK A;  3I55 P;  4WVZ A;  1S1C X;  3AE4 C;  1L0L G;  2E76 D;  1EQ7 A;  1JY2 N;  2YXR B;  3MP7 B;  3O6Q A;  3V4Q A;  4EI2 A;  2OYH A;  2KSE A;  4PV1 B;  4OGQ D;  1LWU B;  1H8A A;  2NPS D;  2W90 A;  2IBZ E;  3LID A;  2FFD B;  1GD2 E;  2YKO A;  3EFG A;  1L0N J;  3TGU J;  3FXE A;  1NTM J;  1H89 A;  3CX5 H;  2JO1 A;  3HD7 A;  2YKQ A;  4GOD A;  5CCG A;  3E1R A;  3RK2 D;  1KB9 D;  1LTA C;  1NTZ D;  5GTH E;  1A02 F;  1MFT A;  3RK2 B;  1FJK A;  5AVS B;  2NRG A;  3I5C A;  3P8C D;  4PD4 D;  3L73 G;  1JB0 J;  1FOS F;  3OW2 O;  2QIW A;  1J1D B;  1PGJ A;  3WUV A;  1SQP E;  3G9R A;  2OTJ P;  3VMY A;  2L91 A;  1GL2 C;  2B9B A;  3U59 A;  3RK3 B;  2W6J H;  1E5W A;  2KZI A;  1M57 D;  4LLH A;  1NJI Q;  2QJY C;  2DW3 A;  1QGK B;  1JEK A;  2IBZ I;  1T2K D;  3L73 D;  1IO4 A;  1M8O B;  1NGM B;  2B89 A;  1GL2 D;  1KYO I;  2OYO A;  3BRT B;  1EDK A;  2QM8 A;  1NTZ G;  1LT9 A;  1UIX A;  3MIW A;  2KXP B;  1LWU C;  3OA7 A;  2D2C B;  5KKZ B;  1OW7 A;  3HE5 A;  2HLO A;  2M5A B;  1LTS C;  3H1H E;  1RE4 C;  5KAI E;  1SQB G;  2FY8 A;  1KD1 Q;  3IN6 A;  1OVV A;  1KIL C;  5AW6 B;  1M1J B;  3CC4 P;  3B4S A;  3N4X A;  5CCH C;  4IL6 X;  2LXB A;  3EFF K;  1AV1 A;  2JJL A;  1KV4 A;  4BRY B;  4ZKU A;  5DJU B;  1URQ C;  3PHL A;  3RL0 D;  2FYZ A;  3M0A A;  3V4W A;  4EYY Q;  1BDC A;  1N86 A;  3C1L A;  1PPJ D;  2A06 D;  5APW A;  2O1J A;  3NXS A;  2QJP C;  3NTN A;  4R4M A;  3AE6 C;  4N78 D;  3L72 D;  4MN4 C;  5TJH A;  1KN7 A;  3FXD A;  3HTK B;  4LC1 A;  1NO4 A;  2JP3 A;  2KLV A;  5KJ7 C;  2WT7 A;  4L73 A;  5AW9 B;  2IZ1 A;  1NH4 A;  1S3J A;  5CBO A;  3G71 P;  1Q90 D;  1OX3 A;  1RE3 A;  2HG5 D;  2YO3 A;  1NU1 K;  5APY A;  1OXZ A;  2LXC B;  2ZXX A;  4PD4 I;  1X9V A;  5CCH A;  2E76 B;  3H1J J;  1YJN P;  2BEZ F;  2L5G B;  3KDP B;  3L37 A;  1MKM A;  3V2N A;  3H25 A;  1Z56 A;  2YIU C;  2W83 C;  5AVY B;  4XFJ A;  5KAI H;  3BAT A;  3JC2 2;  3L36 A;  4NPF X;  2WMM A;  1VQ4 P;  1SQB J;  3KZI E;  4N78 E;  3HE5 B;  5GTH H;  3GF7 A;  3BCC E;  4ASV A;  4N6J A;  4B86 A;  3U1A A;  1CI6 B;  4C46 A;  4U3F E;  1LT9 B;  1PPJ E;  2A06 E;  1MFZ A;  1DIP A;  4L74 A;  1RQU A;  5K5G B;  1N7S C;  2WSC H;  1KYO D;  1URQ B;  2HOD A;  3Q1M A;  1ZRT E;  4I7Z B;  4WY4 A;  1VQL P;  1CSB A;  2ZVN B;  1VQO P;  4WBA A;  5CHX A;  1SQQ G;  3B5N C;  1EZV I;  3H1K E;  3WMM 0;  2Q3E A;  1M1J C;  2QVA A;  4OVN F;  1QEX A;  1NKN A;  2A45 I;  4W7Z A;  5KTB A;  2OYH B;  3CCQ P;  3AE5 C;  4Y28 J;  3ZDM A;  4HH2 A;  1SQQ E;  3PP5 A;  1AQ5 A;  2R3C A;  1J2J B;  1KYO H;  2NPS B;  5KLV E;  3L73 J;  3EWK A;  3L70 G;  3HTK A;  1YTZ T;  1DD4 A;  3OJA B;  5H2F E;  3D70 A;  4WY4 B;  1E79 H;  1G2C A;  2E74 C;  2I8D A;  4RES B;  2D2C D;  3CCE P;  2KP8 A;  3U1C A;  3ABV C;  2RKL A;  2N9B A;  2N1T C;  1ZOY C;  1L0N G;  3HD7 D;  3TGU G;  2YMK A;  1M1K Q;  2FYU D;  5M1B A;  1Y47 A;  1HTL C;  2CPB A;  3RK3 C;  2BAS A;  1RF1 A;  3GF3 A;  3M91 A;  1AVO A;  5APX A;  3R4Y A;  1IZN B;  1LTB C;  1IC2 A;  1JY3 O;  1LTG C;  2AXT E;  2ZT9 D;  3MZW B;  1PP9 J;  1FZE A;  1K05 A;  1SFC C;  2KNC A;  2P2U A;  5L8R J;  1H88 A;  1RY3 A;  2NPS C;  3RK3 D;  3AEG C;  1FBM A;  3TSI A;  4RJT A;  1N7L A;  1PP9 G;  2KLU A;  5AVT B;  2ZJS E;  2KIK A;  1KB9 E;  1LP1 B;  4WWI A;  5KLV D;  2QA4 P;  1S9K D;  1NWQ A;  1ZME C;  4PJ0 H;  3CWB D;  2M5A A;  4NPD A;  1HBW A;  1GTW A;  3CXH I;  3B5N B;  2IX7 C;  3IAO A;  2R32 A;  3AE8 C;  1SQQ K;  1JCD A;  1URQ A;  1X8Y A;  1MV8 A;  1JY3 N;  2AEJ A;  2FXP A;  2HOD B;  3MD0 A;  4UB8 E;  3P8M C;  3PJS K;  3TNU B;  2B87 B;  5KAF H;  3RL0 g;  3H1L E;  2FBW C;  5BVZ A;  4RO0 A;  1BGY D;  2IFM A;  1LWU A;  5C39 A;  2ZT9 B;  1QVG O;  1FOS E;  3L70 J;  1GW3 A;  2WSS H;  1RE4 A;  4PD4 H;  2GM4 A;  2XKM A;  1SFC B;  1BDD A;  3B8E B;  3RGU A;  3Q5R A;  3H1K J;  4IFM A;  1MUU A;  3B71 A;  2C0X A;  4IOI H;  1R5S A;  4OH8 B;  4QMA A;  1OWA A;  2VRS A;  3TYY A;  3P7K A;  5E79 H;  4ZKP A;  3CMA P;  2WSC J;  2WPQ A;  5CJ0 A;  1Y8A A;  4KT0 J;  3I56 P;  1SQQ J;  3LIE A;  2WPV B;  1AVY A;  3RK3 E;  4BWN A;  4L76 A;  1K73 Q;  1VQK P;  2Z4E A;  1SLQ A;  1LTI C;  1D7M A;  1EZV D;  5KLV K;  1FZF A;  4H13 B;  1OVR A;  4UB6 H;  1FZC B;  3N7N A;  3AE3 C;  2AEM A;  4YXD C;  2XV5 A;  4XE5 B;  2WT7 B;  1JY2 P;  1GDT A;  2FFD A;  5AVZ B;  1KIL D;  1AA0 A;  2P58 A;  2O3J A;  5H2F H;  2WTY A;  1BCC E;  3G3Z A;  3H32 B;  1SQX E;  2H88 C;  2O1K A;  3GLM A;  3KZI H;  5KJ7 A;  2WZ7 A;  4EDF A;  3L72 E;  4ZNC A;  4EOT A;  1L0N E;  1URQ D;  3UIA A;  1NTM E;  1EDI A;  3TGU E;  1VQP P;  2H89 C;  2Q1K A;  2ZXE B;  3H1J G;  3HRN A;  1AJY A;  3CCJ P;  2KS1 A;  4I7Z C;  3S1K A;  3GHG B;  1BCC D;  4AYC A;  1WRG A;  2LR2 A;  1XTG B;  3IR9 A;  2WWW A;  2KI7 B;  3CX5 D;  2WSF H;  4XA4 A;  2BCC E;  3L74 J;  1EZV E;  2N1T D;  1L2P A;  5AVV B;  4KHX A;  2YIU B;  1LP1 A;  4IFF A;  1VF5 D;  1L4A C;  3KQG A;  1JNM A;  2CK3 H;  1SQX K;  1IFM A;  1JO5 A;  1RF1 C;  2BCC G;  1R8E A;  1NAY A;  4HB1 A;  2WSF J;  4OWF A;  3L74 D;  4A7P A;  1L0L E;  2Y0D A;  1YJW P;  1FDO A;  5BU8 B;  3C8V A;  2E75 D;  2FYN C;  1NOH A;  1S2E A;  1M1J A;  1WT6 A;  3O8Z A;  3V2Q A;  4BXL A;  1SQB D;  3H1H J;  1OMI A;  3H1L D;  2PRR A;  4GT1 A;  2BCC D;  1H0T B;  1HUC A;  1P84 D;  3CX5 E;  1S5L X;  2IYP A;  2JWA A;  4GIF A;  2KZJ A;  1RF1 B;  3AE7 C;  3VTP C;  3GW6 A;  3E1I A;  3IF4 A;  1SQX G;  2P10 A;  5B5E H;  2I1K A;  1NTZ J;  3RK2 C;  1L0N K;  1VQ5 P;  2NPS A;  1VQ6 P;  1ZXG A;  1S9K E;  1BCC J;  2RH0 A;  2C0W A;  5AW4 B;  3VMX A;  3A2A A;  2E75 B;  1EDL A;  3F5H A;  3H1I G;  1H0T A;  1SQX D;  3Q2Y A;  1HWT C;  4HYT B;  3PTZ A;  2C9N Y;  3HE4 B;  1HF9 A;  1LJ2 A;  1ZP0 C;  2E42 A;  1KIL E;  1ZN5 A;  2FYU E;  4GDO A;  1HVV A;  5CBN A;  4D6T E;  2H7H A;  1QL1 A;  1JMB A;  2H8P D;  1LGH B;  1KQL A;  2I1J A;  2KUB A;  2Y0C A;  3HD7 C;  3RBZ A;  3TNU A;  5AVX B;  4DOJ A;  3LW5 H;  2ZYG A;  2A45 G;  2Q9I A;  2M3B A;  3WU2 H;  1NTM G;  2IFN A;  1ZW0 A;  1N7S B;  3A7O A;  3Q3D A;  1CI6 A;  1SFC D;  3B5N A;  1N7S D;  3AEA C;  1IFD A;  2WVR A;  5B66 H;  3A0B H;  3G6E P;  1ZR2 A;  2OTL P;  3BCC J;  2Y9Y A;  3L71 D;  1GL2 A;  1L0L J;  2ZVO B;  4NPE A;  2KSJ A;  3L73 E;  3JCU E;  4GOF A;  4H0L B;  4JYB A;  2KK7 A;  3KPE A;  5AW0 B;  4D6T G;  1KFM A;  3H6P A;  4Y99 B;  2WQY C;  1NHL A;  1ZRT D;  3RL0 C;  1T2K C;  1CW5 A;  1RF0 C;  1M7L A;  3E7K A;  3KHU A;  2XU6 A;  3CCU P;  1N7S A;  4C7N A;  1KQG B;  4AUW A;  3OAK A;  2K88 A;  2Q3I A;  2FYU K;  3FX0 A;  3P8C E;  3M06 A;  1NTK J;  2HR3 A;  4PD4 E;  3CWB E;  3GMA A;  5AW5 B;  3CCV P;  1T3U A;  1U7M A;  2M8R A;  2M0B A;  3WUU A;  1K9M Q;  1PV3 A;  2IPP A;  2H43 A;  1SQP G;  1SP4 A;  2R5D A;  2J58 A;  2K3R A;  1P84 I;  3CXH D;  4JYC A;  1KIL A;  4HKZ H;  2HPC B;  4UB8 H;  3CC7 P;  3P32 A;  1U7J A;  3CLQ A;  4I1L A;  4OGQ C;  3G4S P;  4DJG A;  5AVW B;  1N73 C;  4C7R A;  2QJP B;  1FDM A;  3SWF A;  2ZT9 C;  1J1E C;  3HE4 A;  3CCM P;  3Q5P A;  1X0T A;  5TIS H;  2FYU J;  1IFN A;  4JF7 A;  1QLE D;  4WY4 D;  1FC2 C;  1K04 A;  1X22 A;  2O01 J;  2BEQ D;  2V7Q H;  3PLN A;  2QSI A;  4TLF A;  2B87 A;  1SFC A;  3B5N D;  3H1L J;  2XZR A;  3L4F A;  3VOP A;  5AVU B;  1JUN A;  3CC2 P;  1PP9 E;  1DX7 A;  5APS A;  3CXH H;  4W7Y A;  1SQB K;  2LKM A;  3FWN A;  1Y9B A;  1SQV J;  1IK9 A;  1T6A A;  2Q6Q A;  3H1I D;  5KAF E;  1GZL A;  1BGY J;  4YTP C;  1HJB A;  2HFE D;  2K9Y A;  1FE6 A;  1VF5 B;  3HUS B;  4H0L C;  3FWL A;  3IFM A;  5APT A;  1S5L H;  4N3Y B;  1KMI Z;  5CCG C;  3AED C;  2K9J B;  1PL5 A;  3LW5 J;  1Q2N A;  1BE3 J;  2PFX A;  1KC8 Q;  1SQV D;  2OYI B;  1LTJ C;  2KOG A;  1X79 B;  1P84 H;  1KYO E;  3L75 G;  1S5L E;  1JMM A;  1NKZ B;  3NFQ A;  2OYI A;  1XTC C;  1DEB A;  3L71 G;  4M3L A;  2QRX A;  5APQ A;  3S9O A;  1LNQ A;  1IK7 A;  4U3F G;  3TDK A;  2ZAE B;  2IYO A;  3A0H E;  3HD7 B;  1PP9 D;  1BSH A;  4UB6 E;  1NTK E;  1J1D C;  3AEC C;  4H13 D;  4H44 D;  2HPC A;  1VF5 C;  1L0L K;  3FGA D;  1JCC A;  2AEF A;  2YXQ B;  3PRJ A;  3O6Q B;  1EZV G;  3CX5 I;  3H1J E;  4H44 C;  2ZYD A;  1EC5 A;  2POH A;  3GHG A;  2E75 C;  1P84 E;  1FZA A;  1KQF B;  3L75 J;  3WUT A;  1PZQ A;  1SQP D;  3TK1 A;  2N9Y B;  1U57 A;  2QE7 H;  3V5B A;  4JBZ A;  1SQB E;  1NTK K;  1YIT P;  2R3S A;  1HJ0 A;  2V4H A;  4PV1 C;  4JPZ B;  5BU5 A;  1GK6 A;  3L74 E;  2QG4 A;  1YI2 P;  3MHV A;  5KJ7 D;  4KJM A;  1GU4 A;  2QJK C;  1BGY G;  4OGQ B;  3L72 J;  4L75 A;  3C9I A;  1LT1 A;  3GG2 A;  1SQV G;  2E5T A;  5CCG D;  1VL2 A;  1BE3 D;  1RQV A;  3R2P A;  1QVF O;  2N1T A;  4IFD K;  1NTM K;  4DCK A;  4K35 A;  1SQP K;  2FYN B;  2N1T B;  2PP6 A;  3AE9 C;  1FAV A;  3CD6 P;  4TT3 H;  1K8A Q;  3CWB G;  3M0D C;  5AVQ B;  2JR8 A;  5AW1 B;  1YHQ P;  3BVH A;  2GA1 A;  2W8Z A;  2AXT H;  3II6 A;  1W2B O;  1RHZ B;  1DH3 A;  1JTH B;  1L4A B;  2AXC A;  2WSE J;  3AE2 C;  3H1I E;  3H32 A;  3HUS C;  1JTH A;  1L4A A;  2ZFC A;  4Z1M H;  1EDJ A;  1FJP A;  3MUD C;  3SWK A;  1Q81 Q;  1TU3 F;  2OYH C;  3MTU E;  1GMJ A;  2YKP A;  1SQP J;  1Q82 Q;  1CZQ A;  3WU2 E;  2MJZ A;  1R5L A;  3L75 D;  4DZO A;  1OW6 A;  5APU A;  5KLV J;  1FZC A;  3S4R A;  1NU1 D;  3EQ2 A;  1NTK G;  2XND H;  2PGD A;  4I6M C;  4IL6 H;  1W5C E;  1NU1 J;  1GK4 A;  1PIX A;  3A3Y B;  3KXD A;  4JQ0 D;  3SFE C;  3VMZ A;  1Q7Y Q;  1J1E B;  1LT9 C;  3D71 A;  1FU1 A;  2FKW B;  2ZYA A;  4U7J A;  3VN0 A;  4WB4 A;  1PGQ A;  2KNC B;  3K5B A;  4D6T J;  1YTZ I;  2W6A A;  1JY2 O;  1NTZ E;  1RH5 B;  3A0B E;  3T97 B;  1OZH A;  3BCC G;  5B66 E;  1PGP A;  1EXJ A;  2D2C C;  5KKZ C;  1QL2 A;  5KLI B;  5DJT B;  2E76 C;  1USE A;  2Q7C A;  1JOC A;  1NU1 G;  1YBK A;  3M9H A;  1FDI A;  1NTZ K;  1PGO A;  4H13 C;  3AEF C;  2JDI H;  2IBZ G;  1IFI A;  4IL6 E;  3SFD C;  3CCS P;  1EXI A;  5KLV G;  2K37 A;  3D6Y A;  3V2P A;  4ZMD A;  3RBX A;  1DEE G;  1FS0 E;  2Y0E A;  5AVR B;  4CPG A;  1ZR4 A;  3BRV B;  2OQQ A;  2FFD C;  1NAF A;  1YYC A;  4BRY A;  3L71 E;  2G8Y A;  4U3F D;  1ZV8 A;  1VQM P;  2M3E A;  2QJK B;  1L0L D;  1QX8 A;  2KYV A;  3KYQ A;  5EFW B;  4HJG H;  5AW3 B;  1UII A;  4DT0 A;  2Y9Z A;  1YQ3 C;  5AW2 B;  1NVO A;  3L70 E;  1YJ9 P;  1T3J A;  3H1I J;  2XDJ A;  1DD3 A;  5APV A;  1N8R Q;  3CWB J;  3W67 A;  1AFO A;  3V6I A;  1BCC G;  3SWY A;  2PAJ A;  1VPC A;  3QWO C;  1RE3 C;  1VQ8 P;  1OVU A;  1OIP A;  3A0H H;  4H44 B;  1KIL B;  1SQX J;  1W2E A;  2OTK E;  4D6T D;  2Z5I A;  1IFJ A;  4C7N B;  1GW4 A;  2JEE A;  2MKV A;  2R5B A;  2WPR A;  1MZ9 A;  1NU1 E;  3L72 G;  2WSE H;  2QM7 A;  4GOE A;  3MGN A;  3USS A;  3A5T A;  3CPW O;  2ITA A;  1HH0 A;  1PPJ G;  2A06 G;  3PH0 A;  1RF0 A;  2CPS A;  3H1H G;  1NTK D;  2FXM A;  1FZB A;  1NTM D;  2YO2 A;  3M9Q A;  1KQS O;  1SS1 A;  2GUS A;  2YNY A;  1L4A D; 
#chains in the Genus database with same CATH homology
 3M9B A;  5CCH D;  3T97 A;  5AW7 B;  1LTJ B;  1SQV K;  1HGV A;  1GL2 B;  2KB7 P;  4WY4 C;  4O9B A;  1N73 A;  3HUS A;  2HYN A;  2C9L Y;  3VYI A;  1N2D C;  3MUD A;  2E43 A;  2W27 A;  2W6B A;  1DH3 A;  1FZC C;  1LTJ A;  2WIT A;  4LGD E;  4W80 A;  3M0D A;  2J59 M;  1G1J A;  2P67 A;  3VP9 A;  3V2R A;  1HGZ A;  1KZU B;  2WPS A;  1G1I A;  2YMY A;  1ZLL A;  2P1J A;  2O01 H;  5CMZ A;  1VDF A;  1G2C B;  3GHG C;  2OYI C;  4GKG A;  4I2L C;  2OAR A;  3NMD A;  5CJ4 A;  2P7J A;  3CI9 A;  4EIJ A;  3BAS A;  1FZG A;  1GU5 A;  4Y99 C;  3RL0 B;  2XNX A;  4AQR D;  2Z5H A;  1PFI A;  1A02 J;  1IJD B;  3CL3 D;  1T8Z A;  1KFN A;  1LTT C;  1SVF A;  2A45 H;  2GUV A;  3L35 A;  2Q5U A;  1JY3 P;  3VP8 A;  1N73 B;  5AW8 B;  1EQ7 A;  1JY2 N;  3V4Q A;  2OYH A;  1H8A A;  1LWU B;  2NPS D;  3LID A;  2FFD B;  2YKO A;  3EFG A;  1H89 A;  3HD7 A;  2YKQ A;  3RK2 D;  1LTA C;  1A02 F;  3RK2 B;  1FJK A;  5AVS B;  3I5C A;  3P8C D;  1FOS F;  1J1D B;  3VMY A;  1GL2 C;  3U59 A;  3RK3 B;  1E5W A;  4LLH A;  1IO4 A;  1T2K D;  1GL2 D;  3BRT B;  2QM8 A;  1LT9 A;  3MIW A;  1LWU C;  3OA7 A;  3HE5 A;  2HLO A;  1LTS C;  1RE4 C;  1KIL C;  5AW6 B;  1M1J B;  3N4X A;  5CCH C;  2JJL A;  4ZKU A;  3RL0 D;  1URQ C;  2FYZ A;  3M0A A;  3V4W A;  1N86 A;  5APW A;  2O1J A;  3NXS A;  3NTN A;  4N78 D;  3HTK B;  4LC1 A;  1NO4 A;  2KLV A;  5KJ7 C;  2WT7 A;  5AW9 B;  1NH4 A;  1RE3 A;  2HG5 D;  2YO3 A;  1NU1 K;  5APY A;  1OXZ A;  1X9V A;  5CCH A;  3L37 A;  2L5G B;  3KDP B;  3V2N A;  1Z56 A;  5AVY B;  3BAT A;  3L36 A;  4N78 E;  3HE5 B;  4B86 A;  4N6J A;  3U1A A;  1CI6 B;  4C46 A;  1LT9 B;  1MFZ A;  1N7S C;  2WSC H;  1URQ B;  2HOD A;  4WY4 A;  1CSB A;  4WBA A;  5CHX A;  3B5N C;  3WMM 0;  1M1J C;  1NKN A;  2A45 I;  4W7Z A;  2OYH B;  4HH2 A;  1AQ5 A;  3PP5 A;  2R3C A;  1J2J B;  2NPS B;  3HTK A;  1YTZ T;  3OJA B;  4WY4 B;  1G2C A;  4RES B;  2KP8 A;  3U1C A;  3HD7 D;  2N9B A;  2N1T C;  1HTL C;  2CPB A;  3RK3 C;  2BAS A;  1RF1 A;  3M91 A;  5APX A;  1LTB C;  1IC2 A;  1JY3 O;  1LTG C;  1SFC C;  1FZE A;  2P2U A;  1H88 A;  1RY3 A;  2NPS C;  3RK3 D;  3TSI A;  1FBM A;  1N7L A;  5AVT B;  1NWQ A;  1S9K D;  1GTW A;  3B5N B;  2IX7 C;  2R32 A;  1SQQ K;  1JCD A;  1URQ A;  3MD0 A;  1X8Y A;  1MV8 A;  1JY3 N;  2HOD B;  5CCG A;  2FFD C;  3P8M C;  3TNU B;  2IFM A;  1LWU A;  1FOS E;  1GW3 A;  1RE4 A;  2GM4 A;  2XKM A;  1SFC B;  3B8E B;  4IFM A;  1MUU A;  4OH8 B;  2C0X A;  3TYY A;  4ZKP A;  1T2K C;  1OWA A;  2VRS A;  3P7K A;  2WPQ A;  5CJ0 A;  3LIE A;  2Z4E A;  1SLQ A;  1LTI C;  5KLV K;  1FZC B;  3N7N A;  2XV5 A;  4XE5 B;  2WT7 B;  1JY2 P;  1GDT A;  2FFD A;  5AVZ B;  1KIL D;  2WTY A;  3G3Z A;  3H32 B;  5KJ7 A;  2O1K A;  2WZ7 A;  4EOT A;  1URQ D;  3UIA A;  3HRN A;  2ZXE B;  3GHG B;  4AYC A;  1WRG A;  1XTG B;  3IR9 A;  2WWW A;  2WSF H;  4XA4 A;  2N1T D;  5AVV B;  4KHX A;  4IFF A;  3KQG A;  1L4A C;  1JNM A;  1SQX K;  1IFM A;  1JO5 A;  5BU8 B;  1NOH A;  3O8Z A;  1M1J A;  1WT6 A;  3V2Q A;  4GT1 A;  1HUC A;  4GIF A;  1RF1 B;  3VTP C;  3E1I A;  2I1K A;  3RK2 C;  1L0N K;  2NPS A;  1S9K E;  2C0W A;  5AW4 B;  3VMX A;  3A2A A;  1HWT C;  4HYT B;  2C9N Y;  3HE4 B;  2E42 A;  1ZN5 A;  1HVV A;  2H7H A;  1QL1 A;  2H8P D;  1LGH B;  1KQL A;  2I1J A;  3HD7 C;  4DOJ A;  3TNU A;  5AVX B;  3LW5 H;  2A45 G;  2Q9I A;  2M3B A;  2IFN A;  3A7O A;  1N7S B;  1CI6 A;  1SFC D;  3B5N A;  1N7S D;  1IFD A;  1ZR2 A;  1GL2 A;  5BVZ A;  2KSJ A;  5AW0 B;  5KTB A;  4JYB A;  1HJB A;  3KPE A;  1KFM A;  3H6P A;  4Y99 B;  3RL0 C;  1NHL A;  1CW5 A;  1RF0 C;  1M7L A;  2XU6 A;  4AUW A;  1N7S A;  4C7N A;  3OAK A;  2Q3I A;  2FYU K;  3P8C E;  3M06 A;  5AW5 B;  1T3U A;  2M8R A;  2IPP A;  2H43 A;  1SP4 A;  2R5D A;  2J58 A;  4JYC A;  2HPC B;  1KIL A;  3P32 A;  3CLQ A;  4I1L A;  5AVW B;  1N73 C;  4C7R A;  1FDM A;  3SWF A;  1J1E C;  3HE4 A;  1IFN A;  4JF7 A;  4WY4 D;  1SFC A;  3B5N D;  3L4F A;  2XZR A;  3VOP A;  5AVU B;  1JUN A;  1DX7 A;  5APS A;  4W7Y A;  1SQB K;  2LKM A;  1IK9 A;  1GD2 E;  1GZL A;  2HFE D;  3HUS B;  3IFM A;  5APT A;  4N3Y B;  5CCG C;  2OYI B;  2KOG A;  1LTJ C;  1X79 B;  3NFQ A;  1JMM A;  1NKZ B;  2OYI A;  1XTC C;  1DEB A;  5APQ A;  4M3L A;  3HD7 B;  2HPC A;  1J1D C;  1L0L K;  1JCC A;  1FZF A;  2POH A;  3GHG A;  1FZA A;  3TK1 A;  3V5B A;  1NTK K;  5BU5 A;  1GK6 A;  5KJ7 D;  1GU4 A;  3C9I A;  5CCG D;  4IFD K;  3R2P A;  2N1T A;  1NTM K;  1SQP K;  2PP6 A;  2N1T B;  1FAV A;  5AW1 B;  3M0D C;  5AVQ B;  3BVH A;  3II6 A;  1JTH B;  1L4A B;  3HUS C;  1HBW A;  3H32 A;  1JTH A;  1L4A A;  2ZFC A;  1FJP A;  2OYH C;  3MTU E;  2YKP A;  1CZQ A;  2MJZ A;  4DZO A;  5APU A;  1FZC A;  3EQ2 A;  4I6M C;  3VMZ A;  3A3Y B;  1GK4 A;  1J1E B;  1LT9 C;  1FU1 A;  2FKW B;  3VN0 A;  4WB4 A;  1YTZ I;  2W6A A;  1JY2 O;  1QL2 A;  2Q7C A;  1JOC A;  3M9H A;  1NTZ K;  1IFI A;  3V2P A;  5AVR B;  1ZR4 A;  3BRV B;  1NAF A;  1YYC A;  1ZV8 A;  1RF1 C;  5AW3 B;  2KYV A;  3KYQ A;  5AW2 B;  1T3J A;  2XDJ A;  5APV A;  1AFO A;  3SWY A;  2PAJ A;  1VPC A;  1RE3 C;  1KIL B;  1W2E A;  2Z5I A;  1IFJ A;  4C7N B;  1GW4 A;  2R5B A;  2JEE A;  2WPR A;  1MZ9 A;  2WSE H;  2QM7 A;  3MGN A;  3A5T A;  1HH0 A;  1RF0 A;  2CPS A;  2FXM A;  1FZB A;  2YO2 A;  3M9Q A;  2GUS A;  2YNY A;  1L4A D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...