5APQA

Sequence ienkad inserted between gcn4 adaptors - structure a6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
61
structure length
61
Chain Sequence
QLEDKVEELLSKVYHLENEVARLKKLIENKADMKQLEDKVEELLSKVYHLENEVARLKKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apqA00
4JYCA 4C46A 1GK4A 5APTA 1FOSE 3VMZA 3NTNA 3P32A 2R5DA 4AYCA 1H8AA 2XV5A 4GKGA 4I2LC 3LIEA 5APUA 1CI6A 2Q7CA 3V5BA 5AW9B 5APWA 3B8EB 2YO3A 2XU6A 1DH3A 3L35A 3VMYA 1OXZA 5AVXB 3TYYA 2WT7B 1S9KD 2QM8A 2E43A 1J2JB 3VN0A 2JJLA 1SP4A 3A7OA 3P7KA 2BASA 2ZXEB 5AVWB 4AUWA 3UIAA 4GT1A 3LIDA 1HUCA 2WPSA 3L37A 5AW6B 4RESB 1GU4A 3VMXA 2R3CA 3HE5B 3A2AA 3M0DA 5APXA 5AW8B 5AVUB 4AQRD 2Q5UA 1GD2E 4M3LA 3TK1A 2W27A 2WPRA 1HWTC 1X8YA 3O8ZA 3TNUB 5AVSB 3HE4A 4I6MC 3I5CA 2P67A 5AW1B 2ZFCA 3VTPC 1H89A 2C9LY 2YO2A 5AVVB 2E42A 1T2KC 4C7NA 5AW0B 3A3YB 4DZOA 2R32A 1FOSF 3L36A 5AW2B 2H7HA 2Q3IA 5APSA 2WTYA 1GK6A 1MV8A 4JYBA 3VYIA 3M9HA 3V4WA 1GZLA 3T97A 3V4QA 5AVZB 2W6AA 1H88A 4XE5B 1CZQA 4B86A 3A5TA 1HBWA 1CI6B 2Z5HA 1SLQA 3P8MC 3IR9A 3M0AA 2WT7A 5APVA 3OAKA 2P7JA 2IPPA 2WWWA 3HTKA 4HYTB 5APQA 1GU5A 3MD0A 2VRSA 4KHXA 1A02F 4C7NB 5AW4B 1S9KE 1JUNA 2QM7A 3KQGA 1CSBA 5AVRB 1FAVA 2P2UA 5AVTB 3M06A 2WPQA 5APYA 5CMZA 3NMDA 2N9BA 3M91A 1T2KD 3HE5A 2XZRA 4EOTA 3KDPB 5AVQB 5AW5B 1HJBA 5AW7B 1MUUA 2C9NY 3TNUA 1IO4A 1NWQA 2KP8A 5AVYB 2YNYA 4LC1A 1YYCA 5AW3B 3HE4B 1G2CB 1OWAA 1NAFA 1GTWA 1A02J 3NFQA 1KQLA 3MGNA 3M9BA 1MFZA 3SWFA 2R5BA 1JNMA 3NXSA 2Z5IA
chains in the Genus database with same CATH superfamily
5KJ7A 4IL6H 5KLIC 2R5DA 1GMJA 2W90A 2ZVOB 4PD4E 2GUSA 5CBOA 3AE6C 5M1BA 1S9KD 1NTKG 1NTMK 4H13C 1N86A 3H1HE 1SP4A 1SQVJ 3MHVA 2ZXEB 3CCUP 3E1IA 4U3FE 3RK2C 5CHXA 1SFCC 3S1KA 3L75J 1OFCX 3B71A 3O8ZA 2E74B 1DEBA 1JM0A 3G4SP 3VTPC 3RK3D 2ZYAA 2E42A 4L75A 2YKQA 1W5CE 4YPCA 1QLED 3WUTA 4CPGA 3H32B 2YKOA 3H1HJ 3L74G 1LT9C 1QL1A 1OVUA 1FZEA 3BRTB 1EDKA 4U3FJ 2B88A 1S9KE 3A0BH 2QM7A 2AEMA 3L4FA 5CMZA 3NMDA 1SQPG 1HJBA 1N2DC 4A7PA 4ZKUA 1EC5A 1YYCA 4I1LA 3SWFA 3G6EP 3H1LG 2K9YA 3RK3E 1JO5A 1M57D 2JKVA 2W83C 1N8RQ 3V5BA 3H1KG 2J5UA 1L4AA 2D2CC 2E75D 5AVXB 2P1JA 1QEXA 1P84D 1HGZA 1YITP 2JJLA 5KLVK 1SQPJ 1Q2NA 3CCVP 3B5NC 1Q90D 4H0LC 1USEA 2A06G 1SQQG 2P67A 3S4RA 4H44B 5AW0B 3PHLA 2WVRA 2QG4A 5B5EE 3S9OA 2O3JA 1H88A 5CCGA 3KPEA 1JMBA 4RJTA 3A5TA 2PAJA 1NKZB 3A0BE 4KJMA 2LXCB 2G8YA 1LTBC 3CWBG 4RO0A 1FC2C 2E5YA 3GHGC 2IFNA 5AW4B 4NPEA 1KYOH 5CJ4A 1FAVA 1P84E 1LTAC 4IFFA 3M91A 1M1JB 2FY8A 2O01N 3JCUH 2KSJA 3IAOA 3JSVC 5E79H 3GF7A 1DIPA 2KZIA 2H89C 3G71P 3CXHH 2IBZG 1NTZK 1MFZA 1AVOA 3AE1C 4JYCA 5APTA 3MP7B 1EZVI 5KJ7D 3VMAA 4I2LC 2FBWC 1VQNP 2NPSB 3LW5H 3AECC 1VF5D 3V2PA 5BU8B 3L72D 1JY2O 1HJ0A 3CXHD 3BVHA 1L2PA 2QJKB 3PTZA 2SPZA 3B4SA 1HGVA 4JQ0D 1FDIA 4HH2A 2IYPA 2ITAA 4IL6X 1QVGO 2OQQA 3A3YB 4DZOA 5BVZA 1JY2P 1GK6A 2R3SA 5EFWB 2Y0CA 2FYZA 4XA4A 1PGPA 2WZ7A 1FZCC 2YXRB 1L0LK 1LWUA 3MUDC 1EXIA 1RQUA 4ASWA 3JCUE 3Q1MA 2K1AA 3L72E 5E79E 2RN0A 3CXHE 1VQ6P 2I1KA 2E74D 1VL2A 1JY3O 1N73B 1SQBK 1WT6A 5DJUB 3M0DC 4C46A 2KUBA 4R4MA 1FS0E 5APUA 1J1EC 3RBZA 2WSFH 1L4AD 1CW5A 1W2EA 2FYUG 2M3EA 1KILB 3L71D 3VMXA 2A45I 3ABVC 3FXEA 3H1JD 2KZJA 2FYNC 2OYIC 2KXPB 3U1AA 4TT3H 3TGUG 3Q2YA 1FZGA 3LW5J 2KNCA 1KZUB 2AXTH 2WTYA 5CBNA 4QMAA 4ZMDA 3HD7B 4Z1MH 2CPSA 5CCGD 2Z5HA 3H1IG 1JMMA 2Y9ZA 3W67A 2N9YB 1NTMG 2K88A 1FJKA 1BE3D 4H13B 1VQKP 3GMAA 5KAIE 1WMKA 2XZRA 3AE2C 3RK2B 1PV3A 3L71E 1EZVD 2YIUB 1NHLA 3H1JE 1U7MA 4H44D 1Q86Q 2M3BA 1X22A 2MKVA 3VP9A 1FOSE 3HD7A 3P32A 1Y9BA 1ZR2A 4BWNA 2JDIH 1YTZT 1SQXD 3L35A 1OXZA 2FFDC 1J2JB 2K3RA 1OW6A 1XTGB 2B9BA 1LT9B 5AVWB 1PL5A 1L0ND 4NPFX 1BE3E 2KYVA 3L71J 1Y47A 2AXTE 2HPCA 2IDBA 3KYQA 3H1JJ 1LTIC 4UB8H 4N78D 2WSFJ 2ZFCA 1HH0A 3PJSK 2H43A 1URQB 1EZVE 2Q3IA 1LTJC 3VYIA 1GZLA 1JY2N 5AVZB 1P84I 3HUSA 1N7SC 2CK3H 5TISH 2E76B 3L75D 1GL2B 3M0AA 2NPSD 1S2EA 3SSUA 2D2CB 2VRSA 1SQXE 3CLQA 3CMAP 1BE3J 5KLVG 5AVRB 1Q81Q 1KTMA 2ZT9C 3E1RA 3HRNA 1L0NE 4IFDK 1NTKD 1L0NG 2KIKA 2QVAA 3KHUA 1IO4A 2BEQD 1NH4A 4H0LB 1URQA 2KB7P 4N78E 1RY3A 2JR8A 1RF0A 4U7JA 4IOIH 5B66H 1GL2A 3II6A 4ZNCA 1SQXJ 3CCJP 3L75E 2KLUA 2UWJE 4D6TG 4Y99C 2BASA 1H0TB 1L0NJ 4N3YB 2V7QH 3CCEP 3GHGB 4ASVA 1JY3N 3L74D 4HKZH 4WB4A 1AQTA 2GA1A 4GDOA 1NTKE 1PP9G 5AVSB 1T3JA 2FXPA 1SQPD 1ZMEC 1KN7A 3L73G 1YHQP 1S5LH 2H8PD 1RQVA 4NPDA 2KSEA 4D6TJ 1K73Q 1VQ9P 3CXHI 2FKWB 2HLOA 3H1LD 3AE3C 1JCDA 1Q82Q 1E79H 1RE3A 3KZIE 3A0HH 2CPBA 2OYHA 5DJTB 3KQGA 3H1KD 3GLMA 2E75C 1KILD 1YQ4C 1NTKJ 2HG5D 5AW7B 1VQ5P 3L74E 2M5AB 2XKMA 3SWYA 3WU2H 2QA4P 1A02J 3NFQA 5B66E 1NU1D 3HUSC 2ZYGA 1IFPA 2XDJA 1ZOYC 1SQPE 3NTNA 3H25A 3HD7D 4AYCA 2A06D 1SQQD 1NOHA 1S4XA 1NKNA 2O01H 4IL6E 1FZCB 2NZ2A 3P7KA 1RE4A 2HODB 3H1LE 3WUVA 1YQ3C 5CCHA 1GU4A 2KOGA 3CWBD 1BGYG 3A2AA 3AEDC 3H1KE 3L74J 3H32A 2RMZA 2W27A 1KILE 1HWTC 2Y0DA 2M5AA 3Q5PA 1M90Q 3I5CA 4OH8B 4WVZA 2HYNA 1ZXGA 2Q1KA 3CC4P 2R32A 1FE6A 4JYBA 1SQBG 3V4WA 1OVRA 1EQ7A 1NU1E 1LNQA 1NU1G 3A0HE 3EFGA 2IBZD 1J1EB 1KFNA 1SQQE 2A06E 2WWWA 4BXLA 3H1LJ 5TJHA 5KJ7C 1IJDB 2HODA 1U57A 1JUNA 4PJ0H 4YTPC 1FBMA 3H1KJ 3WU2E 2N9BA 1HF9A 4Y28J 5AW5B 1VF5C 3MIWA 3CWBE 1SVFA 3WMM0 3SWKA 1S1CX 2Q9IA 5AW3B 2FYNB 2WSCH 2OYIB 1NU1J 1URQD 3C1LA 1SQVK 2Y9YA 2XV5A 1E5WA 3V2QA 2E76D 1SQQJ 1GL2D 3I56P 2OTKE 1VQ4P 4O9BA 2AEFA 2QM8A 3FX0A 2D2CD 5BU5A 2IBZE 4OWFA 4BRYB 1HUCA 2Q6QA 3N7NA 1AVYA 1KYOD 3CWBJ 2ZYDA 3EFFK 4M3LA 1KMIZ 1X8YA 4H0LD 2W8ZA 1Y8AA 3TDKA 3L70G 2ZXXA 2OARA 2E74C 1M1JA 3FXDA 1CZQA 2HFED 4PJ0E 4OGQC 2WITA 1A02F 4C7NB 4GIFA 4WBAA 4WY4B 2P58A 2C0WA 3BCCG 1L4AC 4GOFA 4EOTA 1IC2A 3TF5A 3Q3DA 1EDLA 1KYOE 4JF7A 1LJ2A 1LTTC 2NPSA 2KP8A 2FYUD 1PGJA 1BCCG 4I7ZB 4C7RA 3JC22 3M9BA 3FWLA 3QWOC 2Z5IA 4W7YA 1SQPK 3GG2A 1LP1B 4HB1A 1XTCC 4OVNF 1Q7YQ 1OIPA 1G1IA 3LIEA 1ZR4A 1BDCA 3AEFC 2Q7CA 5APWA 3TGUD 2KLVA 2YO3A 5C39A 2WT7B 1N7SB 3AE8C 1U7JA 3VN0A 3D70A 4WY4A 4AUWA 3UIAA 2Z4EA 2H88C 3BASA 5CCGC 1QVFO 2WSCJ 2WPSA 2K37A 1UIXA 2BCCG 3H1ID 5CCHD 1LTGC 3O6QB 2WPVB 4AQRD 2ZT9B 3PRJA 3TK1A 1NTMD 3P8CD 2P10A 3TNUB 1GDTA 4R4LA 4HJGH 2C9LY 1RF1B 2FYUE 1JY3P 1KD1Q 2L5GB 4PV1B 2QJPB 1KORA 1IFIA 2N1TB 3P8MC 3CCMP 3IR9A 4H44C 2WT7A 1RHZB 1K05A 3TGUE 3RGUA 2BCCJ 2W6BA 1N73A 2R44A 3M06A 3F89A 2M0BA 3MTUE 2AEJA 3H1IE 1R5SA 5KLIB 1KB9H 3TNUA 1QGKB 5AVYB 1NYHA 2FYUJ 1NTME 3P8CE 1RF1A 1NAYA 3VMZA 1KILA 1OW8A 2N1TA 2IX7C 2B89A 3RL0C 3TGUJ 1SFCB 2Y0EA 2XU6A 4JBZA 2KK7A 1ZLLA 3L37A 3H1IJ 2NPSC 1LWUC 1IZNB 1NTMJ 2RH0A 2WSEH 2IZ0A 5KLVD 4GOEA 2YMYA 1NVOA 5AW1B 2QJKC 3N4XA 2PP6A 2XNXA 3E7KA 3EQ2A 3CCSP 3CCLP 1VQMP 1M56D 2B87B 1HBWA 1SFCA 1M8OB 3MZWB 1X0TA 3D6ZA 3OAKA 4DT0A 2P7JA 1GU5A 1YJWP 1GW4A 2MJZA 1PPJG 2P2UA 4W7ZA 1KV4A 1T2KD 3KDPB 2JWAA 3BATA 3R4YA 5GTIH 4D6TD 1K8AQ 5KKZC 1HTLC 3HE4B 3K5BA 4PD4H 1FDMA 1LT9A 5KLVE 1JNMA 2ZVNB 2IBZI 1QX8A 2QJYC 2B87A 2IYOA 1PP9D 1IFNA 1FDOA 3VP8A 3CCQP 2M8RA 4GODA 5K5GB 1ZRTD 1PFIA 1NTZD 3B5NB 2I8DA 3L73D 3AEEC 2RKLA 4WY4D 3D6YA 1NGMB 1N7LA 1S3JA 1MKMA 1LGHB 3HE5B 1S72P 2K9JB 3RK3C 5KLVJ 3HE4A 1VF5B 4D6TE 2YO2A 4XFJA 1FZBA 2H7HA 4EYYQ 5AW2B 1OX3A 3ITKA 1MV8A 1SQVG 4UB8E 2OYOA 4N6JA 1PZQA 2LXBA 3WUUA 2I1JA 1PP9E 1N7SD 1T3UA 1KYOI 2JO1A 2WSEJ 1ZRTE 2WSSH 3HD7C 5TISE 2FXMA 5GTIE 1NTZE 2GM4A 3L73E 1NTZG 3BRVB 3HE5A 1OZHA 2J59M 1SS1A 2ZT9D 1L0LD 2K9JA 2YKPA 1MFTA 1VQLP 1K04A 2YNYA 3RL0g 1G2CB 3H1HG 1BGYD 3CX5H 1JCCA 2QSIA 1H0TA 4PV1D 1KQGB 3GHGA 4U3FG 1PP9J 2N1TD 2YIUC 3B8EB 4EIJA 3OA7A 3AEGC 3GW6A 3HTKB 1SQBD 1NTZJ 1VPCA 3L73J 1FJPA 4OGQB 3CX5D 2PRRA 2A45G 2HR3A 1L4AB 1ZW0A 5B5EH 1G2CA 1L0LE 3PLNA 1H89A 1L0LG 2JEEA 1FOSF 5APSA 4H13D 2AXCA 1G1JA 1BGYE 3CI9A 3AE7C 4XE5B 1X79B 1CI6B 1AFOA 3RK2D 1WRGA 1SLQA 1SFCD 1P84H 1KFMA 3GF3A 3Q5SA 2OTJP 1URQC 3HTKA 2IPPA 1S5LE 3MD0A 4KHXA 3CMEP 1RF0C 3CD6P 1IFJA 1SQBE 2E76C 1W2BO 1GL2C 2O1JA 3V2RA 3CX5E 3FGAD 2V7QJ 2LKMA 1L0LJ 1MUUA 1FZCA 1SQXK 1OWAA 1OVVA 4YXWH 1BGYJ 4LGDE 1YIJP 2QEXP 3MUDA 3PH0A 1ZN5A 2GUVA 1H8AA 1L0NK 1CI6A 1J1DC 1VQ7P 1K9MQ 1DH3A 3IFMA 3CC2P 1Z56A 1JEKA 2O1KA 2E43A 2IZ1A 1SQBJ 3A7OA 3RBXA 3L70D 2R3CA 3M0DA 1T8ZA 5AW8B 2Q5UA 1EDIA 1GD2E 2WPRA 1YI2P 1RE3C 1DD4A 2OYHC 1VQOP 3BCCD 5KAFH 3M9HA 2V4HA 1USDA 1KB9I 3G3ZA 4B86A 1BCCD 1PIXA 4DJGA 1GW3A 1NTKK 3H6PA 3RL0B 3B5ND 2ZAEB 5APQA 1ZV8A 2OYIA 2O01J 2J58A 1CSBA 2FXOA 2XNDH 3L70E 1JTHB 2PGDA 1PGOA 2C9NY 1RE4C 3SFEC 1NWQA 2L91A 1LWUB 2BCCD 1JB0J 5CCHC 2R5BA 2FFDB 4BRYA 3BCCE 4GKGA 3C8VA 4W80A 2NRGA 3VMYA 4K3AA 1BCCE 2QE7H 4DCKA 3L70J 2W6JH 3U59A 3CL3D 1LTSC 1S5LX 3LIDA 1DD3A 1JTHA 1OW7A 3M9QA 4K35A 1YJ9P 1LTJB 5AVUB 3EWKA 5KAFE 5GTHH 1R8EA 4JPZB 3BCCJ 5KKZB 4C7NA 2FFDA 2BCCE 3L72G 3AE4C 3CCRP 3F5HA 1BCCJ 3CPWO 1IK9A 2BEZF 2QJYB 3R2PA 4LLHA 4PD4I 5APVA 5KAIH 4L74A 5KTBA 1VDFA 4OGQD 2KNCB 5CJ0A 1NU1K 1LP1A 2WPQA 1YTZI 4MN4C 3USSA 2YMKA 1LTJA 3AEBC 3Q5RA 4TLFA 4EDFA 1SQQK 1N7SA 3RK3B 1KQLA 2WMMA 2Q3EA 3L72J 4KT0J 2LR2A 1YBKA 3NXSA 1GK4A 3AEAC 4Y99B 3T97B 4UB6H 3O6QA 4WWIA 2JP3A 1YJNP 3TYYA 3V6IA 1OMIA 5H2FH 4L76A 2DW3A 4RKUJ 5GTHE 1M1JC 2JWDA 3G9RA 3IF4A 3U1CA 1PPJD 1JOCA 1KB9D 1T2KC 3OW2O 2OGUA 1M7LA 1T6AA 1IFMA 3T97A 2W6AA 1DEEG 1D7MA 1VQPP 2G3AA 2HPCB 1BSHA 2POHA 2E75B 3TSIA 3CX5I 3L71G 3ZDMA 2OTLP 3H1JG 1R5LA 4L73A 3HUSB 2E5TA 3FWNA 1AQ5A 1TU3F 4WY4C 3V2NA 4LC1A 4UB6E 1IK7A 2KS1B 1PPJE 1NJIQ 4I6MC 1KB9E 2KI7B 4IFMA 5H2FE 1PGQA 1BE3G 3OJAB 1IFDA 3KXDA 1MZ9A 1QL2A 5AW9B 4DOJA 4I7ZC 1FU1A 2PFXA 3RL0D 1SQVD 1UIIA 1NO4A 3VOPA 1M1KQ 1LT1A 3PP5A 1EZVG 2IFMA 4ZKPA 4GT1A 5AW6B 4RESB 2WQYC 1FZAA 5APXA 2QRXA 1KC8Q 3IN6A 4YXDC 1N73C 1KQSO 2KS1A 5AVVB 1SQXG 1EDJA 3L36A 1BDDA 4PD4D 2YXQB 3V4QA 1HVVA 3KZIH 3H1HD 5L8RJ 1AA0A 1RF1C 2A45H 1J1DB 1EXJA 3W68A 4HYTB 4PV1C 2QJPC 4U3FD 4EI2A 1AJYA 3C9IA 2FYUK 1BSNA 1KILC 3D71A 1X9VA 2N1TC 1AV1A 5AVTB 1SQVE 3SFDC 5APYA 3CC7P 3QH9A 2ZJSE 1KQFB 5AVQB 2QIWA 1ZP0C 1RH5B 3AE9C 1FZFA 3I55P 3B5NA 1NAFA 3L75G 3AE5C 1GTWA 1VQ8P 1DX7A 2C0XA 3MGNA 2OYHB
chains in the Genus database with same CATH topology
5KJ7A 3VP9A 1FOSE 3HD7A 1XTCC 1ZN5A 2GUVA 2R5DA 3P32A 1H8AA 1L0NK 1ZR2A 1G1IA 3LIEA 1ZR4A 1CI6A 2Q7CA 1J1DC 5APWA 2GUSA 2KLVA 2YO3A 1YTZT 1DH3A 3IFMA 3L35A 1Z56A 2O1KA 1OXZA 2WT7B 1N7SB 1S9KD 2FFDC 1NTMK 2E43A 1J2JB 1N86A 3VN0A 1SP4A 3A7OA 1XTGB 4WY4A 1LT9B 2ZXEB 5AVWB 4AUWA 3UIAA 2Z4EA 3BASA 3E1IA 5CCGC 2WPSA 3RK2C 5CHXA 1SFCC 5CCHD 1LTGC 2KYVA 2R3CA 3M0DA 1T8ZA 5AW8B 4AQRD 2Q5UA 1GD2E 3TK1A 2HPCA 2WPRA 3KYQA 3P8CD 3O8ZA 1LTIC 3TNUB 1GDTA 1DEBA 1RE3C 4N78D 2OYHC 2ZFCA 3VTPC 2C9LY 3RK3D 1HH0A 2E42A 1RF1B 2H43A 1URQB 2Q3IA 1LTJC 1JY3P 2YKQA 3VYIA 2L5GB 3M9HA 1GZLA 1JY2N 1IFIA 5AVZB 3G3ZA 3HUSA 2N1TB 1N7SC 3H32B 4B86A 2YKOA 1GL2B 3P8MC 3IR9A 1GW3A 3M0AA 2WT7A 1NTKK 3H6PA 2NPSD 1LT9C 3RL0B 3B5ND 1QL1A 5APQA 1FZEA 2VRSA 3BRTB 1ZV8A 2OYIA 1S9KE 2W6BA 3CLQA 1N73A 2QM7A 2J58A 1CSBA 5AVRB 3L4FA 3M06A 5CMZA 3NMDA 1JTHB 3HRNA 4IFDK 3MTUE 1HJBA 1N2DC 4ZKUA 2C9NY 3TNUA 1RE4C 1IO4A 1NWQA 5AVYB 1LWUB 1NH4A 1YYCA 4I1LA 3P8CE 1RF1A 5CCHC 1URQA 3SWFA 2R5BA 2KB7P 4N78E 2FFDB 1RY3A 3VMZA 1JO5A 1RF0A 1KILA 4GKGA 2N1TA 2IX7C 1GL2A 3II6A 3V5BA 4W80A 3RL0C 1L4AA 1SFCB 2XU6A 3VMYA 5AVXB 2P1JA 1HGZA 2JJLA 1ZLLA 5KLVK 4Y99C 3U59A 2BASA 3CL3D 1LTSC 4N3YB 3LIDA 3L37A 1JTHA 3GHGB 3M9QA 1JY3N 2NPSC 4WB4A 1LTJB 5AVUB 3B5NC 1LWUC 2WSEH 5AVSB 2YMYA 1T3JA 2P67A 5AW1B 4C7NA 5AW0B 2FFDA 3N4XA 2PP6A 2XNXA 2H8PD 3EQ2A 1H88A 5CCGA 3KPEA 3A5TA 1HBWA 2PAJA 1NKZB 1SFCA 1IK9A 3R2PA 1LTBC 4LLHA 5APVA 2FKWB 3OAKA 2HLOA 2P7JA 1JCDA 1GU5A 5KTBA 1GW4A 2MJZA 3GHGC 1VDFA 1RE3A 2IFNA 5CJ0A 5AW4B 2CPBA 2OYHA 5CJ4A 3KQGA 1FAVA 2P2UA 4W7ZA 1NU1K 2WPQA 1LTAC 1YTZI 4IFFA 3M91A 1T2KD 1KILD 3KDPB 1LTJA 1M1JB 2HG5D 3BATA 5AW7B 2KSJA 1SQQK 1N7SA 1HTLC 2XKMA 3SWYA 3HE4B 1A02J 3NFQA 3RK3B 1KQLA 1FDMA 1LT9A 1NTZK 1MFZA 1JNMA 3HUSC 3NXSA 4JYCA 2XDJA 1GK4A 5APTA 5KJ7D 3NTNA 3HD7D 4Y99B 4AYCA 4I2LC 1IFNA 3VP8A 1NOHA 2M8RA 1NKNA 3TYYA 2O01H 2NPSB 3LW5H 1PFIA 1FZCB 3B5NB 5BU8B 3V2PA 3P7KA 1RE4A 1JY2O 2HODB 4WY4D 1M1JC 3BVHA 1N7LA 5CCHA 1GU4A 2KOGA 1LGHB 3HE5B 3A2AA 1HGVA 3H32A 2W27A 4HH2A 1HWTC 3U1CA 3RK3C 1JOCA 3HE4A 3I5CA 4OH8B 2HYNA 2YO2A 1T2KC 1FZBA 3A3YB 4DZOA 2R32A 5BVZA 1JY2P 5AW2B 2H7HA 1GK6A 1MV8A 4JYBA 3V4WA 1M7LA 1EQ7A 1IFMA 3T97A 4N6JA 2W6AA 2FYZA 4XA4A 1FZCC 2WZ7A 2HPCB 3EFGA 2POHA 2I1JA 3TSIA 1N7SD 1J1EB 1L0LK 1KFNA 2WWWA 1LWUA 1T3UA 5KJ7C 3HD7C 1IJDB 2HODA 1JUNA 2FXMA 2GM4A 1FBMA 2N9BA 3BRVB 3HE5A 2J59M 3HUSB 5AW5B 3MIWA 1SVFA 2I1KA 2YKPA 3WMM0 1AQ5A 2Q9IA 4WY4C 2YNYA 3V2NA 4LC1A 5AW3B 1G2CB 2WSCH 1JY3O 2OYIB 1JCCA 1N73B 1URQD 1SQBK 4I6MC 1SQVK 1WT6A 3M0DC 4C46A 3GHGA 2XV5A 4IFMA 5APUA 1E5WA 2N1TD 1IFDA 3OJAB 1J1EC 3V2QA 1MZ9A 1QL2A 5AW9B 4DOJA 3B8EB 1GL2D 4EIJA 2WSFH 1L4AD 3OA7A 1CW5A 1FU1A 4O9BA 1W2EA 2QM8A 3RL0D 3HTKB 5BU5A 1VPCA 1FJPA 1NO4A 3VOPA 3PP5A 2IFMA 4ZKPA 4GT1A 1HUCA 5AW6B 4RESB 2A45G 3N7NA 1KILB 1FZAA 3VMXA 2A45I 5APXA 4M3LA 1L4AB 1X8YA 2OYIC 1N73C 1G2CA 3U1AA 1H89A 5AVVB 1FZGA 2JEEA 1KZUB 1FOSF 3L36A 5APSA 2WTYA 1G1JA 3HD7B 3CI9A 3V4QA 1HVVA 2CPSA 2OARA 4XE5B 1M1JA 5CCGD 1CZQA 1X79B 1CI6B 1AFOA 3RK2D 2HFED 1WRGA 1SLQA 2Z5HA 1SFCD 1KFMA 1JMMA 1RF1C 2A45H 1J1DB 1URQC 3HTKA 2IPPA 4HYTB 2WITA 3MD0A 4KHXA 1A02F 3C9IA 2FYUK 4C7NB 1FJKA 1RF0C 4GIFA 1KILC 4WBAA 4WY4B 1X9VA 1IFJA 2N1TC 5AVTB 1GL2C 5APYA 2C0WA 1L4AC 2XZRA 4EOTA 2O1JA 3V2RA 5AVQB 1IC2A 3RK2B 2LKMA 1MUUA 4JF7A 1FZFA 1LTTC 2NPSA 2KP8A 1FZCA 1NHLA 3B5NA 1SQXK 1OWAA 1NAFA 1GTWA 1DX7A 4C7RA 2C0XA 3MGNA 3M9BA 4LGDE 2M3BA 2OYHB 3MUDA 2Z5IA 4W7YA 1SQPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYC A;  4C46 A;  1GK4 A;  5APT A;  1FOS E;  3VMZ A;  3NTN A;  3P32 A;  2R5D A;  4AYC A;  1H8A A;  2XV5 A;  4GKG A;  4I2L C;  3LIE A;  5APU A;  1CI6 A;  2Q7C A;  3V5B A;  5AW9 B;  5APW A;  3B8E B;  2YO3 A;  2XU6 A;  1DH3 A;  3L35 A;  3VMY A;  1OXZ A;  5AVX B;  3TYY A;  2WT7 B;  1S9K D;  2QM8 A;  2E43 A;  1J2J B;  3VN0 A;  2JJL A;  1SP4 A;  3A7O A;  3P7K A;  2BAS A;  2ZXE B;  5AVW B;  4AUW A;  3UIA A;  4GT1 A;  3LID A;  1HUC A;  2WPS A;  3L37 A;  5AW6 B;  4RES B;  1GU4 A;  3VMX A;  2R3C A;  3HE5 B;  3A2A A;  3M0D A;  5APX A;  5AW8 B;  5AVU B;  4AQR D;  2Q5U A;  1GD2 E;  4M3L A;  3TK1 A;  2W27 A;  2WPR A;  1HWT C;  1X8Y A;  3O8Z A;  3TNU B;  5AVS B;  3HE4 A;  4I6M C;  3I5C A;  2P67 A;  5AW1 B;  2ZFC A;  3VTP C;  1H89 A;  2C9L Y;  2YO2 A;  5AVV B;  2E42 A;  1T2K C;  4C7N A;  5AW0 B;  3A3Y B;  4DZO A;  2R32 A;  1FOS F;  3L36 A;  5AW2 B;  2H7H A;  2Q3I A;  5APS A;  2WTY A;  1GK6 A;  1MV8 A;  4JYB A;  3VYI A;  3M9H A;  3V4W A;  1GZL A;  3T97 A;  3V4Q A;  5AVZ B;  2W6A A;  1H88 A;  4XE5 B;  1CZQ A;  4B86 A;  3A5T A;  1HBW A;  1CI6 B;  2Z5H A;  1SLQ A;  3P8M C;  3IR9 A;  3M0A A;  2WT7 A;  5APV A;  3OAK A;  2P7J A;  2IPP A;  2WWW A;  3HTK A;  4HYT B;  5APQ A;  1GU5 A;  3MD0 A;  2VRS A;  4KHX A;  1A02 F;  4C7N B;  5AW4 B;  1S9K E;  1JUN A;  2QM7 A;  3KQG A;  1CSB A;  5AVR B;  1FAV A;  2P2U A;  5AVT B;  3M06 A;  2WPQ A;  5APY A;  5CMZ A;  3NMD A;  2N9B A;  3M91 A;  1T2K D;  3HE5 A;  2XZR A;  4EOT A;  3KDP B;  5AVQ B;  5AW5 B;  1HJB A;  5AW7 B;  1MUU A;  2C9N Y;  3TNU A;  1IO4 A;  1NWQ A;  2KP8 A;  5AVY B;  2YNY A;  4LC1 A;  1YYC A;  5AW3 B;  3HE4 B;  1G2C B;  1OWA A;  1NAF A;  1GTW A;  1A02 J;  3NFQ A;  1KQL A;  3MGN A;  3M9B A;  1MFZ A;  3SWF A;  2R5B A;  1JNM A;  3NXS A;  2Z5I A; 
#chains in the Genus database with same CATH topology
 5KJ7 A;  4IL6 H;  5KLI C;  2R5D A;  1GMJ A;  2W90 A;  2ZVO B;  4PD4 E;  2GUS A;  5CBO A;  3AE6 C;  5M1B A;  1S9K D;  1NTK G;  1NTM K;  4H13 C;  1N86 A;  3H1H E;  1SP4 A;  1SQV J;  3MHV A;  2ZXE B;  3CCU P;  3E1I A;  4U3F E;  3RK2 C;  5CHX A;  1SFC C;  3S1K A;  3L75 J;  1OFC X;  3B71 A;  3O8Z A;  2E74 B;  1DEB A;  1JM0 A;  3G4S P;  3VTP C;  3RK3 D;  2ZYA A;  2E42 A;  4L75 A;  2YKQ A;  1W5C E;  4YPC A;  1QLE D;  3WUT A;  4CPG A;  3H32 B;  2YKO A;  3H1H J;  3L74 G;  1LT9 C;  1QL1 A;  1OVU A;  1FZE A;  3BRT B;  1EDK A;  4U3F J;  2B88 A;  1S9K E;  3A0B H;  2QM7 A;  2AEM A;  3L4F A;  5CMZ A;  3NMD A;  1SQP G;  1HJB A;  1N2D C;  4A7P A;  4ZKU A;  1EC5 A;  1YYC A;  4I1L A;  3SWF A;  3G6E P;  3H1L G;  2K9Y A;  3RK3 E;  1JO5 A;  1M57 D;  2JKV A;  2W83 C;  1N8R Q;  3V5B A;  3H1K G;  2J5U A;  1L4A A;  2D2C C;  2E75 D;  5AVX B;  2P1J A;  1QEX A;  1P84 D;  1HGZ A;  1YIT P;  2JJL A;  5KLV K;  1SQP J;  1Q2N A;  3CCV P;  3B5N C;  1Q90 D;  4H0L C;  1USE A;  2A06 G;  1SQQ G;  2P67 A;  3S4R A;  4H44 B;  5AW0 B;  3PHL A;  2WVR A;  2QG4 A;  5B5E E;  3S9O A;  2O3J A;  1H88 A;  5CCG A;  3KPE A;  1JMB A;  4RJT A;  3A5T A;  2PAJ A;  1NKZ B;  3A0B E;  4KJM A;  2LXC B;  2G8Y A;  1LTB C;  3CWB G;  4RO0 A;  1FC2 C;  2E5Y A;  3GHG C;  2IFN A;  5AW4 B;  4NPE A;  1KYO H;  5CJ4 A;  1FAV A;  1P84 E;  1LTA C;  4IFF A;  3M91 A;  1M1J B;  2FY8 A;  2O01 N;  3JCU H;  2KSJ A;  3IAO A;  3JSV C;  5E79 H;  3GF7 A;  1DIP A;  2KZI A;  2H89 C;  3G71 P;  3CXH H;  2IBZ G;  1NTZ K;  1MFZ A;  1AVO A;  3AE1 C;  4JYC A;  5APT A;  3MP7 B;  1EZV I;  5KJ7 D;  3VMA A;  4I2L C;  2FBW C;  1VQN P;  2NPS B;  3LW5 H;  3AEC C;  1VF5 D;  3V2P A;  5BU8 B;  3L72 D;  1JY2 O;  1HJ0 A;  3CXH D;  3BVH A;  1L2P A;  2QJK B;  3PTZ A;  2SPZ A;  3B4S A;  1HGV A;  4JQ0 D;  1FDI A;  4HH2 A;  2IYP A;  2ITA A;  4IL6 X;  1QVG O;  2OQQ A;  3A3Y B;  4DZO A;  5BVZ A;  1JY2 P;  1GK6 A;  2R3S A;  5EFW B;  2Y0C A;  2FYZ A;  4XA4 A;  1PGP A;  2WZ7 A;  1FZC C;  2YXR B;  1L0L K;  1LWU A;  3MUD C;  1EXI A;  1RQU A;  4ASW A;  3JCU E;  3Q1M A;  2K1A A;  3L72 E;  5E79 E;  2RN0 A;  3CXH E;  1VQ6 P;  2I1K A;  2E74 D;  1VL2 A;  1JY3 O;  1N73 B;  1SQB K;  1WT6 A;  5DJU B;  3M0D C;  4C46 A;  2KUB A;  4R4M A;  1FS0 E;  5APU A;  1J1E C;  3RBZ A;  2WSF H;  1L4A D;  1CW5 A;  1W2E A;  2FYU G;  2M3E A;  1KIL B;  3L71 D;  3VMX A;  2A45 I;  3ABV C;  3FXE A;  3H1J D;  2KZJ A;  2FYN C;  2OYI C;  2KXP B;  3U1A A;  4TT3 H;  3TGU G;  3Q2Y A;  1FZG A;  3LW5 J;  2KNC A;  1KZU B;  2AXT H;  2WTY A;  5CBN A;  4QMA A;  4ZMD A;  3HD7 B;  4Z1M H;  2CPS A;  5CCG D;  2Z5H A;  3H1I G;  1JMM A;  2Y9Z A;  3W67 A;  2N9Y B;  1NTM G;  2K88 A;  1FJK A;  1BE3 D;  4H13 B;  1VQK P;  3GMA A;  5KAI E;  1WMK A;  2XZR A;  3AE2 C;  3RK2 B;  1PV3 A;  3L71 E;  1EZV D;  2YIU B;  1NHL A;  3H1J E;  1U7M A;  4H44 D;  1Q86 Q;  2M3B A;  1X22 A;  2MKV A;  3VP9 A;  1FOS E;  3HD7 A;  3P32 A;  1Y9B A;  1ZR2 A;  4BWN A;  2JDI H;  1YTZ T;  1SQX D;  3L35 A;  1OXZ A;  2FFD C;  1J2J B;  2K3R A;  1OW6 A;  1XTG B;  2B9B A;  1LT9 B;  5AVW B;  1PL5 A;  1L0N D;  4NPF X;  1BE3 E;  2KYV A;  3L71 J;  1Y47 A;  2AXT E;  2HPC A;  2IDB A;  3KYQ A;  3H1J J;  1LTI C;  4UB8 H;  4N78 D;  2WSF J;  2ZFC A;  1HH0 A;  3PJS K;  2H43 A;  1URQ B;  1EZV E;  2Q3I A;  1LTJ C;  3VYI A;  1GZL A;  1JY2 N;  5AVZ B;  1P84 I;  3HUS A;  1N7S C;  2CK3 H;  5TIS H;  2E76 B;  3L75 D;  1GL2 B;  3M0A A;  2NPS D;  1S2E A;  3SSU A;  2D2C B;  2VRS A;  1SQX E;  3CLQ A;  3CMA P;  1BE3 J;  5KLV G;  5AVR B;  1Q81 Q;  1KTM A;  2ZT9 C;  3E1R A;  3HRN A;  1L0N E;  4IFD K;  1NTK D;  1L0N G;  2KIK A;  2QVA A;  3KHU A;  1IO4 A;  2BEQ D;  1NH4 A;  4H0L B;  1URQ A;  2KB7 P;  4N78 E;  1RY3 A;  2JR8 A;  1RF0 A;  4U7J A;  4IOI H;  5B66 H;  1GL2 A;  3II6 A;  4ZNC A;  1SQX J;  3CCJ P;  3L75 E;  2KLU A;  2UWJ E;  4D6T G;  4Y99 C;  2BAS A;  1H0T B;  1L0N J;  4N3Y B;  2V7Q H;  3CCE P;  3GHG B;  4ASV A;  1JY3 N;  3L74 D;  4HKZ H;  4WB4 A;  1AQT A;  2GA1 A;  4GDO A;  1NTK E;  1PP9 G;  5AVS B;  1T3J A;  2FXP A;  1SQP D;  1ZME C;  1KN7 A;  3L73 G;  1YHQ P;  1S5L H;  2H8P D;  1RQV A;  4NPD A;  2KSE A;  4D6T J;  1K73 Q;  1VQ9 P;  3CXH I;  2FKW B;  2HLO A;  3H1L D;  3AE3 C;  1JCD A;  1Q82 Q;  1E79 H;  1RE3 A;  3KZI E;  3A0H H;  2CPB A;  2OYH A;  5DJT B;  3KQG A;  3H1K D;  3GLM A;  2E75 C;  1KIL D;  1YQ4 C;  1NTK J;  2HG5 D;  5AW7 B;  1VQ5 P;  3L74 E;  2M5A B;  2XKM A;  3SWY A;  3WU2 H;  2QA4 P;  1A02 J;  3NFQ A;  5B66 E;  1NU1 D;  3HUS C;  2ZYG A;  1IFP A;  2XDJ A;  1ZOY C;  1SQP E;  3NTN A;  3H25 A;  3HD7 D;  4AYC A;  2A06 D;  1SQQ D;  1NOH A;  1S4X A;  1NKN A;  2O01 H;  4IL6 E;  1FZC B;  2NZ2 A;  3P7K A;  1RE4 A;  2HOD B;  3H1L E;  3WUV A;  1YQ3 C;  5CCH A;  1GU4 A;  2KOG A;  3CWB D;  1BGY G;  3A2A A;  3AED C;  3H1K E;  3L74 J;  3H32 A;  2RMZ A;  2W27 A;  1KIL E;  1HWT C;  2Y0D A;  2M5A A;  3Q5P A;  1M90 Q;  3I5C A;  4OH8 B;  4WVZ A;  2HYN A;  1ZXG A;  2Q1K A;  3CC4 P;  2R32 A;  1FE6 A;  4JYB A;  1SQB G;  3V4W A;  1OVR A;  1EQ7 A;  1NU1 E;  1LNQ A;  1NU1 G;  3A0H E;  3EFG A;  2IBZ D;  1J1E B;  1KFN A;  1SQQ E;  2A06 E;  2WWW A;  4BXL A;  3H1L J;  5TJH A;  5KJ7 C;  1IJD B;  2HOD A;  1U57 A;  1JUN A;  4PJ0 H;  4YTP C;  1FBM A;  3H1K J;  3WU2 E;  2N9B A;  1HF9 A;  4Y28 J;  5AW5 B;  1VF5 C;  3MIW A;  3CWB E;  1SVF A;  3WMM 0;  3SWK A;  1S1C X;  2Q9I A;  5AW3 B;  2FYN B;  2WSC H;  2OYI B;  1NU1 J;  1URQ D;  3C1L A;  1SQV K;  2Y9Y A;  2XV5 A;  1E5W A;  3V2Q A;  2E76 D;  1SQQ J;  1GL2 D;  3I56 P;  2OTK E;  1VQ4 P;  4O9B A;  2AEF A;  2QM8 A;  3FX0 A;  2D2C D;  5BU5 A;  2IBZ E;  4OWF A;  4BRY B;  1HUC A;  2Q6Q A;  3N7N A;  1AVY A;  1KYO D;  3CWB J;  2ZYD A;  3EFF K;  4M3L A;  1KMI Z;  1X8Y A;  4H0L D;  2W8Z A;  1Y8A A;  3TDK A;  3L70 G;  2ZXX A;  2OAR A;  2E74 C;  1M1J A;  3FXD A;  1CZQ A;  2HFE D;  4PJ0 E;  4OGQ C;  2WIT A;  1A02 F;  4C7N B;  4GIF A;  4WBA A;  4WY4 B;  2P58 A;  2C0W A;  3BCC G;  1L4A C;  4GOF A;  4EOT A;  1IC2 A;  3TF5 A;  3Q3D A;  1EDL A;  1KYO E;  4JF7 A;  1LJ2 A;  1LTT C;  2NPS A;  2KP8 A;  2FYU D;  1PGJ A;  1BCC G;  4I7Z B;  4C7R A;  3JC2 2;  3M9B A;  3FWL A;  3QWO C;  2Z5I A;  4W7Y A;  1SQP K;  3GG2 A;  1LP1 B;  4HB1 A;  1XTC C;  4OVN F;  1Q7Y Q;  1OIP A;  1G1I A;  3LIE A;  1ZR4 A;  1BDC A;  3AEF C;  2Q7C A;  5APW A;  3TGU D;  2KLV A;  2YO3 A;  5C39 A;  2WT7 B;  1N7S B;  3AE8 C;  1U7J A;  3VN0 A;  3D70 A;  4WY4 A;  4AUW A;  3UIA A;  2Z4E A;  2H88 C;  3BAS A;  5CCG C;  1QVF O;  2WSC J;  2WPS A;  2K37 A;  1UIX A;  2BCC G;  3H1I D;  5CCH D;  1LTG C;  3O6Q B;  2WPV B;  4AQR D;  2ZT9 B;  3PRJ A;  3TK1 A;  1NTM D;  3P8C D;  2P10 A;  3TNU B;  1GDT A;  4R4L A;  4HJG H;  2C9L Y;  1RF1 B;  2FYU E;  1JY3 P;  1KD1 Q;  2L5G B;  4PV1 B;  2QJP B;  1KOR A;  1IFI A;  2N1T B;  3P8M C;  3CCM P;  3IR9 A;  4H44 C;  2WT7 A;  1RHZ B;  1K05 A;  3TGU E;  3RGU A;  2BCC J;  2W6B A;  1N73 A;  2R44 A;  3M06 A;  3F89 A;  2M0B A;  3MTU E;  2AEJ A;  3H1I E;  1R5S A;  5KLI B;  1KB9 H;  3TNU A;  1QGK B;  5AVY B;  1NYH A;  2FYU J;  1NTM E;  3P8C E;  1RF1 A;  1NAY A;  3VMZ A;  1KIL A;  1OW8 A;  2N1T A;  2IX7 C;  2B89 A;  3RL0 C;  3TGU J;  1SFC B;  2Y0E A;  2XU6 A;  4JBZ A;  2KK7 A;  1ZLL A;  3L37 A;  3H1I J;  2NPS C;  1LWU C;  1IZN B;  1NTM J;  2RH0 A;  2WSE H;  2IZ0 A;  5KLV D;  4GOE A;  2YMY A;  1NVO A;  5AW1 B;  2QJK C;  3N4X A;  2PP6 A;  2XNX A;  3E7K A;  3EQ2 A;  3CCS P;  3CCL P;  1VQM P;  1M56 D;  2B87 B;  1HBW A;  1SFC A;  1M8O B;  3MZW B;  1X0T A;  3D6Z A;  3OAK A;  4DT0 A;  2P7J A;  1GU5 A;  1YJW P;  1GW4 A;  2MJZ A;  1PPJ G;  2P2U A;  4W7Z A;  1KV4 A;  1T2K D;  3KDP B;  2JWA A;  3BAT A;  3R4Y A;  5GTI H;  4D6T D;  1K8A Q;  5KKZ C;  1HTL C;  3HE4 B;  3K5B A;  4PD4 H;  1FDM A;  1LT9 A;  5KLV E;  1JNM A;  2ZVN B;  2IBZ I;  1QX8 A;  2QJY C;  2B87 A;  2IYO A;  1PP9 D;  1IFN A;  1FDO A;  3VP8 A;  3CCQ P;  2M8R A;  4GOD A;  5K5G B;  1ZRT D;  1PFI A;  1NTZ D;  3B5N B;  2I8D A;  3L73 D;  3AEE C;  2RKL A;  4WY4 D;  3D6Y A;  1NGM B;  1N7L A;  1S3J A;  1MKM A;  1LGH B;  3HE5 B;  1S72 P;  2K9J B;  3RK3 C;  5KLV J;  3HE4 A;  1VF5 B;  4D6T E;  2YO2 A;  4XFJ A;  1FZB A;  2H7H A;  4EYY Q;  5AW2 B;  1OX3 A;  3ITK A;  1MV8 A;  1SQV G;  4UB8 E;  2OYO A;  4N6J A;  1PZQ A;  2LXB A;  3WUU A;  2I1J A;  1PP9 E;  1N7S D;  1T3U A;  1KYO I;  2JO1 A;  2WSE J;  1ZRT E;  2WSS H;  3HD7 C;  5TIS E;  2FXM A;  5GTI E;  1NTZ E;  2GM4 A;  3L73 E;  1NTZ G;  3BRV B;  3HE5 A;  1OZH A;  2J59 M;  1SS1 A;  2ZT9 D;  1L0L D;  2K9J A;  2YKP A;  1MFT A;  1VQL P;  1K04 A;  2YNY A;  3RL0 g;  1G2C B;  3H1H G;  1BGY D;  3CX5 H;  1JCC A;  2QSI A;  1H0T A;  4PV1 D;  1KQG B;  3GHG A;  4U3F G;  1PP9 J;  2N1T D;  2YIU C;  3B8E B;  4EIJ A;  3OA7 A;  3AEG C;  3GW6 A;  3HTK B;  1SQB D;  1NTZ J;  1VPC A;  3L73 J;  1FJP A;  4OGQ B;  3CX5 D;  2PRR A;  2A45 G;  2HR3 A;  1L4A B;  1ZW0 A;  5B5E H;  1G2C A;  1L0L E;  3PLN A;  1H89 A;  1L0L G;  2JEE A;  1FOS F;  5APS A;  4H13 D;  2AXC A;  1G1J A;  1BGY E;  3CI9 A;  3AE7 C;  4XE5 B;  1X79 B;  1CI6 B;  1AFO A;  3RK2 D;  1WRG A;  1SLQ A;  1SFC D;  1P84 H;  1KFM A;  3GF3 A;  3Q5S A;  2OTJ P;  1URQ C;  3HTK A;  2IPP A;  1S5L E;  3MD0 A;  4KHX A;  3CME P;  1RF0 C;  3CD6 P;  1IFJ A;  1SQB E;  2E76 C;  1W2B O;  1GL2 C;  2O1J A;  3V2R A;  3CX5 E;  3FGA D;  2V7Q J;  2LKM A;  1L0L J;  1MUU A;  1FZC A;  1SQX K;  1OWA A;  1OVV A;  4YXW H;  1BGY J;  4LGD E;  1YIJ P;  2QEX P;  3MUD A;  3PH0 A;  1ZN5 A;  2GUV A;  1H8A A;  1L0N K;  1CI6 A;  1J1D C;  1VQ7 P;  1K9M Q;  1DH3 A;  3IFM A;  3CC2 P;  1Z56 A;  1JEK A;  2O1K A;  2E43 A;  2IZ1 A;  1SQB J;  3A7O A;  3RBX A;  3L70 D;  2R3C A;  3M0D A;  1T8Z A;  5AW8 B;  2Q5U A;  1EDI A;  1GD2 E;  2WPR A;  1YI2 P;  1RE3 C;  1DD4 A;  2OYH C;  1VQO P;  3BCC D;  5KAF H;  3M9H A;  2V4H A;  1USD A;  1KB9 I;  3G3Z A;  4B86 A;  1BCC D;  1PIX A;  4DJG A;  1GW3 A;  1NTK K;  3H6P A;  3RL0 B;  3B5N D;  2ZAE B;  5APQ A;  1ZV8 A;  2OYI A;  2O01 J;  2J58 A;  1CSB A;  2FXO A;  2XND H;  3L70 E;  1JTH B;  2PGD A;  1PGO A;  2C9N Y;  1RE4 C;  3SFE C;  1NWQ A;  2L91 A;  1LWU B;  2BCC D;  1JB0 J;  5CCH C;  2R5B A;  2FFD B;  4BRY A;  3BCC E;  4GKG A;  3C8V A;  4W80 A;  2NRG A;  3VMY A;  4K3A A;  1BCC E;  2QE7 H;  4DCK A;  3L70 J;  2W6J H;  3U59 A;  3CL3 D;  1LTS C;  1S5L X;  3LID A;  1DD3 A;  1JTH A;  1OW7 A;  3M9Q A;  4K35 A;  1YJ9 P;  1LTJ B;  5AVU B;  3EWK A;  5KAF E;  5GTH H;  1R8E A;  4JPZ B;  3BCC J;  5KKZ B;  4C7N A;  2FFD A;  2BCC E;  3L72 G;  3AE4 C;  3CCR P;  3F5H A;  1BCC J;  3CPW O;  1IK9 A;  2BEZ F;  2QJY B;  3R2P A;  4LLH A;  4PD4 I;  5APV A;  5KAI H;  4L74 A;  5KTB A;  1VDF A;  4OGQ D;  2KNC B;  5CJ0 A;  1NU1 K;  1LP1 A;  2WPQ A;  1YTZ I;  4MN4 C;  3USS A;  2YMK A;  1LTJ A;  3AEB C;  3Q5R A;  4TLF A;  4EDF A;  1SQQ K;  1N7S A;  3RK3 B;  1KQL A;  2WMM A;  2Q3E A;  3L72 J;  4KT0 J;  2LR2 A;  1YBK A;  3NXS A;  1GK4 A;  3AEA C;  4Y99 B;  3T97 B;  4UB6 H;  3O6Q A;  4WWI A;  2JP3 A;  1YJN P;  3TYY A;  3V6I A;  1OMI A;  5H2F H;  4L76 A;  2DW3 A;  4RKU J;  5GTH E;  1M1J C;  2JWD A;  3G9R A;  3IF4 A;  3U1C A;  1PPJ D;  1JOC A;  1KB9 D;  1T2K C;  3OW2 O;  2OGU A;  1M7L A;  1T6A A;  1IFM A;  3T97 A;  2W6A A;  1DEE G;  1D7M A;  1VQP P;  2G3A A;  2HPC B;  1BSH A;  2POH A;  2E75 B;  3TSI A;  3CX5 I;  3L71 G;  3ZDM A;  2OTL P;  3H1J G;  1R5L A;  4L73 A;  3HUS B;  2E5T A;  3FWN A;  1AQ5 A;  1TU3 F;  4WY4 C;  3V2N A;  4LC1 A;  4UB6 E;  1IK7 A;  2KS1 B;  1PPJ E;  1NJI Q;  4I6M C;  1KB9 E;  2KI7 B;  4IFM A;  5H2F E;  1PGQ A;  1BE3 G;  3OJA B;  1IFD A;  3KXD A;  1MZ9 A;  1QL2 A;  5AW9 B;  4DOJ A;  4I7Z C;  1FU1 A;  2PFX A;  3RL0 D;  1SQV D;  1UII A;  1NO4 A;  3VOP A;  1M1K Q;  1LT1 A;  3PP5 A;  1EZV G;  2IFM A;  4ZKP A;  4GT1 A;  5AW6 B;  4RES B;  2WQY C;  1FZA A;  5APX A;  2QRX A;  1KC8 Q;  3IN6 A;  4YXD C;  1N73 C;  1KQS O;  2KS1 A;  5AVV B;  1SQX G;  1EDJ A;  3L36 A;  1BDD A;  4PD4 D;  2YXQ B;  3V4Q A;  1HVV A;  3KZI H;  3H1H D;  5L8R J;  1AA0 A;  1RF1 C;  2A45 H;  1J1D B;  1EXJ A;  3W68 A;  4HYT B;  4PV1 C;  2QJP C;  4U3F D;  4EI2 A;  1AJY A;  3C9I A;  2FYU K;  1BSN A;  1KIL C;  3D71 A;  1X9V A;  2N1T C;  1AV1 A;  5AVT B;  1SQV E;  3SFD C;  5APY A;  3CC7 P;  3QH9 A;  2ZJS E;  1KQF B;  5AVQ B;  2QIW A;  1ZP0 C;  1RH5 B;  3AE9 C;  1FZF A;  3I55 P;  3B5N A;  1NAF A;  3L75 G;  3AE5 C;  1GTW A;  1VQ8 P;  1DX7 A;  2C0X A;  3MGN A;  2OYH B; 
#chains in the Genus database with same CATH homology
 5KJ7 A;  3VP9 A;  1FOS E;  3HD7 A;  1XTC C;  1ZN5 A;  2GUV A;  2R5D A;  3P32 A;  1H8A A;  1L0N K;  1ZR2 A;  1G1I A;  3LIE A;  1ZR4 A;  1CI6 A;  2Q7C A;  1J1D C;  5APW A;  2GUS A;  2KLV A;  2YO3 A;  1YTZ T;  1DH3 A;  3IFM A;  3L35 A;  1Z56 A;  2O1K A;  1OXZ A;  2WT7 B;  1N7S B;  1S9K D;  2FFD C;  1NTM K;  2E43 A;  1J2J B;  1N86 A;  3VN0 A;  1SP4 A;  3A7O A;  1XTG B;  4WY4 A;  1LT9 B;  2ZXE B;  5AVW B;  4AUW A;  3UIA A;  2Z4E A;  3BAS A;  3E1I A;  5CCG C;  2WPS A;  3RK2 C;  5CHX A;  1SFC C;  5CCH D;  1LTG C;  2KYV A;  2R3C A;  3M0D A;  1T8Z A;  5AW8 B;  4AQR D;  2Q5U A;  1GD2 E;  3TK1 A;  2HPC A;  2WPR A;  3KYQ A;  3P8C D;  3O8Z A;  1LTI C;  3TNU B;  1GDT A;  1DEB A;  1RE3 C;  4N78 D;  2OYH C;  2ZFC A;  3VTP C;  2C9L Y;  3RK3 D;  1HH0 A;  2E42 A;  1RF1 B;  2H43 A;  1URQ B;  2Q3I A;  1LTJ C;  1JY3 P;  2YKQ A;  3VYI A;  2L5G B;  3M9H A;  1GZL A;  1JY2 N;  1IFI A;  5AVZ B;  3G3Z A;  3HUS A;  2N1T B;  1N7S C;  3H32 B;  4B86 A;  2YKO A;  1GL2 B;  3P8M C;  3IR9 A;  1GW3 A;  3M0A A;  2WT7 A;  1NTK K;  3H6P A;  2NPS D;  1LT9 C;  3RL0 B;  3B5N D;  1QL1 A;  5APQ A;  1FZE A;  2VRS A;  3BRT B;  1ZV8 A;  2OYI A;  1S9K E;  2W6B A;  3CLQ A;  1N73 A;  2QM7 A;  2J58 A;  1CSB A;  5AVR B;  3L4F A;  3M06 A;  5CMZ A;  3NMD A;  1JTH B;  3HRN A;  4IFD K;  3MTU E;  1HJB A;  1N2D C;  4ZKU A;  2C9N Y;  3TNU A;  1RE4 C;  1IO4 A;  1NWQ A;  5AVY B;  1LWU B;  1NH4 A;  1YYC A;  4I1L A;  3P8C E;  1RF1 A;  5CCH C;  1URQ A;  3SWF A;  2R5B A;  2KB7 P;  4N78 E;  2FFD B;  1RY3 A;  3VMZ A;  1JO5 A;  1RF0 A;  1KIL A;  4GKG A;  2N1T A;  2IX7 C;  1GL2 A;  3II6 A;  3V5B A;  4W80 A;  3RL0 C;  1L4A A;  1SFC B;  2XU6 A;  3VMY A;  5AVX B;  2P1J A;  1HGZ A;  2JJL A;  1ZLL A;  5KLV K;  4Y99 C;  3U59 A;  2BAS A;  3CL3 D;  1LTS C;  4N3Y B;  3LID A;  3L37 A;  1JTH A;  3GHG B;  3M9Q A;  1JY3 N;  2NPS C;  4WB4 A;  1LTJ B;  5AVU B;  3B5N C;  1LWU C;  2WSE H;  5AVS B;  2YMY A;  1T3J A;  2P67 A;  5AW1 B;  4C7N A;  5AW0 B;  2FFD A;  3N4X A;  2PP6 A;  2XNX A;  2H8P D;  3EQ2 A;  1H88 A;  5CCG A;  3KPE A;  3A5T A;  1HBW A;  2PAJ A;  1NKZ B;  1SFC A;  1IK9 A;  3R2P A;  1LTB C;  4LLH A;  5APV A;  2FKW B;  3OAK A;  2HLO A;  2P7J A;  1JCD A;  1GU5 A;  5KTB A;  1GW4 A;  2MJZ A;  3GHG C;  1VDF A;  1RE3 A;  2IFN A;  5CJ0 A;  5AW4 B;  2CPB A;  2OYH A;  5CJ4 A;  3KQG A;  1FAV A;  2P2U A;  4W7Z A;  1NU1 K;  2WPQ A;  1LTA C;  1YTZ I;  4IFF A;  3M91 A;  1T2K D;  1KIL D;  3KDP B;  1LTJ A;  1M1J B;  2HG5 D;  3BAT A;  5AW7 B;  2KSJ A;  1SQQ K;  1N7S A;  1HTL C;  2XKM A;  3SWY A;  3HE4 B;  1A02 J;  3NFQ A;  3RK3 B;  1KQL A;  1FDM A;  1LT9 A;  1NTZ K;  1MFZ A;  1JNM A;  3HUS C;  3NXS A;  4JYC A;  2XDJ A;  1GK4 A;  5APT A;  5KJ7 D;  3NTN A;  3HD7 D;  4Y99 B;  4AYC A;  4I2L C;  1IFN A;  3VP8 A;  1NOH A;  2M8R A;  1NKN A;  3TYY A;  2O01 H;  2NPS B;  3LW5 H;  1PFI A;  1FZC B;  3B5N B;  5BU8 B;  3V2P A;  3P7K A;  1RE4 A;  1JY2 O;  2HOD B;  4WY4 D;  1M1J C;  3BVH A;  1N7L A;  5CCH A;  1GU4 A;  2KOG A;  1LGH B;  3HE5 B;  3A2A A;  1HGV A;  3H32 A;  2W27 A;  4HH2 A;  1HWT C;  3U1C A;  3RK3 C;  1JOC A;  3HE4 A;  3I5C A;  4OH8 B;  2HYN A;  2YO2 A;  1T2K C;  1FZB A;  3A3Y B;  4DZO A;  2R32 A;  5BVZ A;  1JY2 P;  5AW2 B;  2H7H A;  1GK6 A;  1MV8 A;  4JYB A;  3V4W A;  1M7L A;  1EQ7 A;  1IFM A;  3T97 A;  4N6J A;  2W6A A;  2FYZ A;  4XA4 A;  1FZC C;  2WZ7 A;  2HPC B;  3EFG A;  2POH A;  2I1J A;  3TSI A;  1N7S D;  1J1E B;  1L0L K;  1KFN A;  2WWW A;  1LWU A;  1T3U A;  5KJ7 C;  3HD7 C;  1IJD B;  2HOD A;  1JUN A;  2FXM A;  2GM4 A;  1FBM A;  2N9B A;  3BRV B;  3HE5 A;  2J59 M;  3HUS B;  5AW5 B;  3MIW A;  1SVF A;  2I1K A;  2YKP A;  3WMM 0;  1AQ5 A;  2Q9I A;  4WY4 C;  2YNY A;  3V2N A;  4LC1 A;  5AW3 B;  1G2C B;  2WSC H;  1JY3 O;  2OYI B;  1JCC A;  1N73 B;  1URQ D;  1SQB K;  4I6M C;  1SQV K;  1WT6 A;  3M0D C;  4C46 A;  3GHG A;  2XV5 A;  4IFM A;  5APU A;  1E5W A;  2N1T D;  1IFD A;  3OJA B;  1J1E C;  3V2Q A;  1MZ9 A;  1QL2 A;  5AW9 B;  4DOJ A;  3B8E B;  1GL2 D;  4EIJ A;  2WSF H;  1L4A D;  3OA7 A;  1CW5 A;  1FU1 A;  4O9B A;  1W2E A;  2QM8 A;  3RL0 D;  3HTK B;  5BU5 A;  1VPC A;  1FJP A;  1NO4 A;  3VOP A;  3PP5 A;  2IFM A;  4ZKP A;  4GT1 A;  1HUC A;  5AW6 B;  4RES B;  2A45 G;  3N7N A;  1KIL B;  1FZA A;  3VMX A;  2A45 I;  5APX A;  4M3L A;  1L4A B;  1X8Y A;  2OYI C;  1N73 C;  1G2C A;  3U1A A;  1H89 A;  5AVV B;  1FZG A;  2JEE A;  1KZU B;  1FOS F;  3L36 A;  5APS A;  2WTY A;  1G1J A;  3HD7 B;  3CI9 A;  3V4Q A;  1HVV A;  2CPS A;  2OAR A;  4XE5 B;  1M1J A;  5CCG D;  1CZQ A;  1X79 B;  1CI6 B;  1AFO A;  3RK2 D;  2HFE D;  1WRG A;  1SLQ A;  2Z5H A;  1SFC D;  1KFM A;  1JMM A;  1RF1 C;  2A45 H;  1J1D B;  1URQ C;  3HTK A;  2IPP A;  4HYT B;  2WIT A;  3MD0 A;  4KHX A;  1A02 F;  3C9I A;  2FYU K;  4C7N B;  1FJK A;  1RF0 C;  4GIF A;  1KIL C;  4WBA A;  4WY4 B;  1X9V A;  1IFJ A;  2N1T C;  5AVT B;  1GL2 C;  5APY A;  2C0W A;  1L4A C;  2XZR A;  4EOT A;  2O1J A;  3V2R A;  5AVQ B;  1IC2 A;  3RK2 B;  2LKM A;  1MUU A;  4JF7 A;  1FZF A;  1LTT C;  2NPS A;  2KP8 A;  1FZC A;  1NHL A;  3B5N A;  1SQX K;  1OWA A;  1NAF A;  1GTW A;  1DX7 A;  4C7R A;  2C0X A;  3MGN A;  3M9B A;  4LGD E;  2M3B A;  2OYH B;  3MUD A;  2Z5I A;  4W7Y A;  1SQP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...