5APQA

Sequence ienkad inserted between gcn4 adaptors - structure a6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
61
structure length
61
Chain Sequence
QLEDKVEELLSKVYHLENEVARLKKLIENKADMKQLEDKVEELLSKVYHLENEVARLKKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 26
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apqA00
4C7NB 5APUA 3HE4B 3TYYA 3VTPC 4JYBA 1T2KD 1HWTC 2ZFCA 3SWFA 5AW0B 3P8MC 4KHXA 3HTKA 2XZRA 2KP8A 2C9NY 3A7OA 2R3CA 2W27A 2WPRA 3HE5B 5APTA 5AW1B 5AVYB 2JJLA 5AVWB 1HUCA 4I6MC 1G2CB 5APXA 4XE5B 5AW2B 3A5TA 1FOSF 1KQLA 3M9BA 3VMYA 1MFZA 3LIDA 5APVA 5AVXB 2R5BA 3V4WA 3TNUB 5AW9B 5AVVB 2P2UA 1H89A 2R32A 3M91A 2Q3IA 3KQGA 1HJBA 2H7HA 1CSBA 1JUNA 2XV5A 4EOTA 3TK1A 5AVUB 2W6AA 1CI6B 1GD2E 2P7JA 2ZXEB 3V5BA 2C9LY 2QM7A 2VRSA 2E42A 2Z5IA 5APQA 3LIEA 5AW8B 3L35A 3VYIA 1SLQA 3M9HA 3P7KA 4AYCA 1HBWA 5AW4B 3T97A 2WPSA 5AW5B 3M06A 1S9KE 2WPQA 1FOSE 5AW7B 3NTNA 1IO4A 5AVTB 2E43A 1CI6A 1CZQA 3VMXA 4B86A 1MUUA 3IR9A 3O8ZA 1NWQA 3VMZA 5AVSB 5AVRB 2Q7CA 2YO3A 1S9KD 5AVZB 1OXZA 4GKGA 1FAVA 3NMDA 3UIAA 2WT7B 2WWWA 4LC1A 2WT7A 2N9BA 3NXSA 1X8YA 2YO2A 1MV8A 2QM8A 1DH3A 2YNYA 4AUWA 2BASA 4JYCA 1H88A 3HE5A 3A3YB 1GZLA 3NFQA 1SP4A 3M0DA 3V4QA 4DZOA 5APYA 1YYCA 3MGNA 1A02J 1T2KC 3HE4A 3B8EB 3M0AA 4C7NA 4RESB 4AQRD 2XU6A 3MD0A 1GU5A 5CMZA 1GTWA 3OAKA 1JNMA 1OWAA 2Q5UA 2P67A 5AVQB 1J2JB 5APWA 3L37A 3P32A 2Z5HA 3A2AA 4C46A 5AW3B 1H8AA 5APSA 4HYTB 1GK4A 3VN0A 3KDPB 3I5CA 1NAFA 2IPPA 3L36A 2R5DA 1GU4A 4GT1A 3TNUA 2WTYA 4I2LC 4M3LA 1A02F 5AW6B 1GK6A
chains in the Genus database with same CATH superfamily
4WY4C 1JB0J 1BCCJ 1LTJB 5APUA 2J58A 3H32A 1LTGC 3HE4B 3C9IA 1T2KD 1HWTC 2E75B 2QEXP 1AJYA 1EXJA 2FFDC 3H1HE 1L0LE 2DW3A 3F5HA 1HJ0A 1KB9I 3KYQA 1NTZJ 3CXHI 3CWBJ 2CPSA 3K5BA 1HGVA 2FY8A 2R3CA 2HR3A 3A7OA 4K35A 2RH0A 5AVYB 2FYUD 3PLNA 4HB1A 1PGOA 1KQLA 5KJ7D 2K37A 1MFZA 4PV1C 1LJ2A 5KKZB 3VMAA 3MTUE 1VL2A 1KYOI 4NPFX 5AW9B 5CCGD 1L0LJ 1OW8A 4JBZA 1LTBC 4WY4B 1SQVJ 2YKQA 1U57A 2R32A 3M91A 1JUNA 2PP6A 2XV5A 1URQB 3KPEA 2H88C 3H25A 1J1DC 2BCCG 1ZXGA 1NVOA 1NTMD 1ZRTE 4DJGA 1AFOA 2WZ7A 3A0HH 4ASVA 3L70J 2IBZI 2P7JA 2BEQD 3QWOC 1MZ9A 3RL0B 4YXWH 2H8PD 1KC8Q 1FDMA 1NU1E 1TU3F 2E42A 3IAOA 2Z5IA 1Y9BA 5APQA 3M9QA 1N7LA 2E74C 4U3FD 1FJKA 4H0LB 1FZCC 2K9YA 3EQ2A 3CCJP 3M9HA 1YQ4C 3D6ZA 5B66H 5AW4B 3L73D 2WPSA 3E7KA 4OGQD 1AV1A 2YXQB 3O6QA 3V2PA 3BRTB 1KV4A 1L4AD 1S4XA 3M06A 1IFDA 2AEFA 2ZT9C 2KIKA 3FXEA 1SQBD 2W6BA 1VF5B 3BCCD 3HD7D 1OVUA 5AW7B 2I1JA 4ZMDA 2E43A 1DX7A 2KZIA 3CXHD 1CZQA 5GTIH 5H2FE 1VQ7P 1NWQA 3CCRP 2QRXA 5AVSB 3VMZA 1AQTA 1KD1Q 1H0TB 1IZNB 2FYUJ 4K3AA 2Q7CA 1KYOE 1RE4C 1KMIZ 1OXZA 1RF0C 1SVFA 4WWIA 3Q3DA 1VQ8P 1E5WA 5TJHA 1RE3A 1BCCE 4L74A 1IFPA 1T8ZA 1NTKJ 3NMDA 3UIAA 2HPCA 1N73B 3PTZA 3AEBC 5B5EH 1P84E 1HF9A 2YKPA 2N9BA 1N73A 2KS1B 1MV8A 2Y9YA 3HUSC 1OX3A 4PD4D 2H89C 4H13B 2B89A 2IBZG 1RF1B 1DEBA 2QJYC 3RK2B 3L71J 4A7PA 4DCKA 1W2BO 2A45H 2AXCA 1GL2C 1ZV8A 2QJKB 2YIUC 5L8RJ 1VQOP 2FFDB 3HE5A 3TGUJ 1SQVK 3A3YB 1GW3A 2A06E 1KFNA 1OW6A 1SP4A 1NHLA 2N1TB 2XNDH 1IK7A 2P1JA 3C1LA 3B5ND 4GIFA 4IFMA 5CJ0A 5APYA 1Q86Q 2O01H 4RO0A 1IFMA 1NU1K 3KXDA 3PP5A 3R4YA 3CX5D 2B88A 2K88A 3RL0g 2M0BA 3CX5I 4GODA 3GF7A 3AE9C 1R5SA 1JCDA 2YXRB 4GOFA 1NH4A 3G4SP 1JO5A 4EIJA 1IFIA 2C9NY 1L0NG 4D6TJ 1JY3O 2P67A 1LP1B 3CLQA 1W2EA 3V2NA 2RMZA 3P32A 3I56P 3RK2C 1OVVA 2IZ1A 2N1TC 2YIUB 4PD4I 1KILD 3A2AA 5AW3B 1JTHA 1LGHB 5APSA 4HYTB 3HUSB 1RF1C 3G3ZA 1GK4A 2M8RA 3G6EP 1Z56A 4U7JA 3CCUP 2KLVA 1KN7A 1OVRA 1FZBA 1ZP0C 1UIIA 1PGQA 2IFNA 3AE1C 1IO4A 5C39A 3AEEC 1ZLLA 1KB9E 2HYNA 1J1EB 4IL6E 2KXPB 1T3JA 4M3LA 1A02F 1NTKG 1YIJP 2NPSA 5EFWB 1BDDA 1R8EA 3FWNA 1AQ5A 1SQPD 1VQ5P 1OFCX 3TYYA 3VTPC 1NTKE 3A0BE 2NRGA 2UWJE 1HH0A 2ZFCA 3FWLA 5B66E 4KHXA 1KILC 1L0NJ 1SQXK 3HTKA 3JSVC 3PHLA 5AW6B 1SQPG 2MKVA 3G71P 2QE7H 1BE3D 1FZCA 3L74J 3I55P 1Y47A 2KP8A 1L2PA 2W27A 1SFCC 2GUVA 2LKMA 3MHVA 3AE6C 3L72E 2KNCA 4U3FE 2IFMA 3U1AA 5AW1B 5GTIE 3H1KG 4IOIH 3WUVA 3TGUE 4I6MC 1DEEG 1G2CB 2OQQA 2W8ZA 1U7MA 4XE5B 3RL0C 3CPWO 2HFED 2XKMA 2O1JA 4D6TD 3PRJA 4R4MA 5APVA 3WUTA 3V4WA 2LXCB 2O01J 4I7ZC 5AVVB 1G1IA 1L0NE 5CCHD 2YMKA 3MZWB 1L0ND 3KQGA 5TISE 2H7HA 2N1TD 4OGQB 4TLFA 3L71D 2C0XA 1J1EC 1FBMA 4BWNA 5AVUB 4D6TE 2W6AA 1EDIA 1CI6B 2PRRA 2QJPC 3Q5RA 2XNXA 1BDCA 3SFDC 1SQQD 1SQVG 4Y99B 2C9LY 2JP3A 3EFFK 2ZAEB 2VRSA 3H1HG 3RL0D 3L72D 2Y0EA 2A06G 3O6QB 5CBNA 4KT0J 1OMIA 4ZKUA 4JPZB 1BE3E 4LLHA 1SLQA 3P7KA 1N73C 1S5LX 1L0LD 3H1HD 3SWYA 1YI2P 3T97A 1HBWA 2OARA 4JF7A 4N6JA 4WY4A 1EDJA 1S9KE 1PIXA 1S72P 5GTHH 1USEA 1X79B 3MIWA 2LXBA 4OGQC 1CI6A 3VMXA 2IYPA 1FDOA 4B86A 1RH5B 1LTIC 3IR9A 3O8ZA 1BGYJ 2ZT9D 3L75J 1FZAA 1S5LH 1FZFA 1EZVG 1YTZI 4OH8B 1SQPK 3H1JJ 1DD4A 3KZIE 5DJTB 2YO3A 5AVZB 1WT6A 1N2DC 2GUSA 5KLVK 5CCGA 1S2EA 1PP9J 2KSJA 2O3JA 3AE2C 3B5NB 3KZIH 1Q82Q 4Z1MH 1PP9D 2E74B 2PGDA 4HKZH 2HG5D 3S4RA 3L70D 2WWWA 3HRNA 4PJ0E 4JQ0D 4D6TG 1JCCA 1X8YA 1FZGA 1FZCB 2QM8A 3L75G 5TISH 1DH3A 2OYIC 1QL1A 4JYCA 1ZR4A 1BGYE 3FGAD 1NTMJ 1H88A 2KUBA 5CCHC 5DJUB 4H44C 1GMJA 1ZOYC 3H6PA 1GZLA 2FYNC 2WSSH 2PFXA 3NFQA 3M0DA 3CC7P 1YBKA 3AE4C 5CCGC 1Q2NA 3MGNA 1PGJA 1A02J 3TSIA 3WU2E 1M90Q 1AA0A 1RY3A 3B8EB 3CMEP 1EDKA 3T97B 2PAJA 4RESB 2M5AB 3TDKA 1IJDB 3H1HJ 4PV1B 5KAIH 2AXTE 1GU5A 3CCLP 1NTZG 3CWBG 2L91A 3GMAA 2A06D 1GTWA 3CCEP 3MUDC 1NKNA 4WB4A 3L72J 3W68A 3AEFC 1SQBK 1XTGB 1BSNA 2H43A 3Q5PA 3V2RA 3RK3E 1PZQA 2CK3H 3CI9A 5CJ4A 3ZDMA 4TT3H 1JY3P 4MN4C 4C46A 1JY2N 2GM4A 2IYOA 3AEAC 4H0LC 5KLVG 2CPBA 1EDLA 3JCUE 2JR8A 4EYYQ 1K73Q 1BCCD 1L4AA 1SQXJ 4U3FG 1NAFA 1LTJC 2FYUK 2IPPA 1VQLP 1KYOD 1KB9H 2IZ0A 2R5DA 1SQPE 2QG4A 1LT9B 2Y0DA 3TNUA 2KSEA 3CXHH 2JKVA 2BEZF 3GG2A 3L73G 1T6AA 3N4XA 1FZEA 2Z4EA 1KB9D 3CXHE 3CL3D 1LTSC 4PV1D 1LTAC 3A0BH 3RBXA 1USDA 1QLED 1KQGB 2FYZA 1SQBE 1M57D 3L70G 1FC2C 2HODB 3IFMA 1IK9A 5E79E 2WSEJ 4C7NB 2M3EA 3L75D 3BVHA 1NKZB 2BCCJ 3SWFA 5AW0B 3P8MC 1QL2A 3L73E 3D71A 1N8RQ 4UB8H 2HLOA 1X0TA 1M1KQ 2HPCB 2XZRA 2WVRA 1KILE 3PJSK 4UB8E 4HJGH 3HD7A 1IC2A 1JMBA 2NZ2A 3HE5B 5APTA 2OYHA 1PV3A 4UB6H 1LWUA 1S5LE 1HUCA 2JJLA 1GL2D 2R3SA 2V7QH 2ZYDA 1JMMA 2KNCB 5APXA 5AW2B 3VP9A 3RBZA 1KORA 3A5TA 2D2CC 1NTME 3VMYA 2W83C 1R5LA 1NAYA 3LIDA 1JEKA 5KAFE 2E5TA 2R5BA 1S3JA 4XA4A 5AVXB 1YJNP 4RKUJ 1QGKB 3B5NA 1NTMG 3CX5E 1H89A 1PFIA 3OJAB 1LTJA 3VOPA 2Q3IA 1HJBA 1D7MA 1LNQA 1VF5C 4IFFA 3WMM0 2ZT9B 4YXDC 4EOTA 1VQ4P 2B9BA 1X9VA 3TK1A 4KJMA 3KHUA 3II6A 1EQ7A 3USSA 1GD2E 2QSIA 3AEGC 4L76A 1BGYD 2R44A 3V5BA 3E1IA 3V6IA 2OYIB 1KYOH 3AECC 3CCQP 1NTZK 4NPDA 2JWDA 4IFDK 5KLIB 4GDOA 5AW8B 1M1JC 5E79H 1SFCB 3L35A 3AE3C 1BGYG 3GW6A 1KILA 1SQBG 3L70E 4W80A 4NPEA 1ZN5A 1PP9E 3S9OA 4AYCA 3CCVP 1SQXG 1WMKA 2IBZE 5AW5B 1NTKK 2JO1A 3HD7C 1RQVA 1GL2A 3E1RA 1L4AC 4ZNCA 1FOSE 3SFEC 4ZKPA 1BE3J 5KLVJ 1QEXA 3JCUH 5AVTB 1JY2P 4CPGA 1SQPJ 4DOJA 2D2CD 1FJPA 1FS0E 1SQQJ 1ZMEC 3EWKA 1G2CA 1M56D 2WSEH 1HGZA 3GLMA 4YTPC 1S9KD 2QJKC 2YKOA 4ASWA 3RK2D 2W90A 4PJ0H 1RF1A 1IFNA 1KQSO 3IN6A 3P8CE 4H44B 4LC1A 2FYUG 3H1JE 2WT7A 2RKLA 2YO2A 3CMAP 2KZJA 2OGUA 3H1IG 1JY2O 4Y99C 1MFTA 3H32B 2BASA 1NU1D 2AEMA 3RGUA 2V4HA 2Y9ZA 1G1JA 2V7QJ 4EDFA 1DD3A 1BE3G 1SQQE 2C0WA 3GHGA 1VQ9P 3AE8C 3F89A 3ABVC 3H1ID 4Y28J 2G3AA 3FX0A 3L71E 5K5GB 4N3YB 1RE3C 1SQBJ 1IFJA 4UB6E 1KZUB 1Y8AA 2ZXXA 2WSCJ 1RHZB 3B71A 2AXTH 1GW4A 1L4AB 3G9RA 2HODA 2J59M 3H1KJ 1FDIA 3H1LE 3M0AA 2JDIH 2XU6A 3BASA 4AQRD 2QA4P 2A45I 3V2QA 1LT9C 1JTHB 5CMZA 1K04A 4IL6H 3S1KA 2RN0A 1VDFA 3N7NA 1T3UA 2FYUE 2Q5UA 3H1JG 4N78D 3U1CA 5AVQB 1JNMA 1J2JB 2XDJA 3TGUD 1GL2B 4L75A 4YPCA 5KAFH 1SQXD 2P10A 3OA7A 2FXOA 2WSCH 2ZYAA 3AEDC 5KTBA 1PPJG 2AEJA 3CCSP 3RK3C 1K8AQ 3CX5H 2MJZA 3H1JD 3BCCG 1KILB 4H13C 1M1JA 1OZHA 3P8CD 3H1KE 3TGUG 3WUUA 5CCHA 2E5YA 3U59A 4BRYA 1PPJD 1NTKD 1LWUC 1Q81Q 3H1IJ 1SQQK 1PGPA 5KAIE 5M1BA 2ZVOB 3BCCJ 4OVNF 4PD4H 3GHGB 2M5AA 2E76C 1GK6A 1LWUB 2QVAA 2W6JH 2FFDA 1KTMA 4EI2A 1PL5A 2FXPA 4I7ZB 4JYBA 4XFJA 3HD7B 3VP8A 2IBZD 2Q6QA 1AVYA 1NU1G 1EZVD 2P58A 1WRGA 1JY3N 3C8VA 2NPSD 1KQFB 2KLUA 2OTKE 4BXLA 1LTTC 2A45G 2WPRA 2BCCE 2KB7P 2WITA 3L73J 3PH0A 5AVWB 4H13D 5BU5A 4RJTA 5KLVE 1QVFO 1H0TA 1FOSF 2NPSB 1MKMA 3L74E 1EC5A 3M9BA 4U3FJ 2WMMA 1CW5A 3L4FA 1N86A 1LT9A 3TNUB 3CCMP 4O9BA 2P2UA 3AE5C 3L74G 1NTZE 3CWBE 3TF5A 5GTHE 3CD6P 1CSBA 1SQVD 1VQPP 1NU1J 2I1KA 2IDBA 3QH9A 4I1LA 3H1LG 5KJ7A 3B4SA 3L72G 2IX7C 5KKZC 1P84I 1SFCD 3L74D 1YTZT 1VF5D 1SS1A 1HVVA 2ZXEB 1XTCC 1NYHA 2QJYB 2QM7A 1L0LG 3A0HE 2Q9IA 2WQYC 3R2PA 1NGMB 3LIEA 4OWFA 3LW5J 4PD4E 3OW2O 1GDTA 4H44D 3SWKA 3W67A 3HUSA 1SQQG 1P84D 2Q1KA 3VYIA 4H0LD 1URQA 2QJPB 2FBWC 1OIPA 4W7YA 2E74D 3IF4A 4DT0A 3L75E 1YHQP 2E75C 2B87B 2E75D 1Q90D 2K1AA 2POHA 1ZW0A 1U7JA 2WPQA 3D6YA 1K05A 2ITAA 2KI7B 3MUDA 2Q3EA 3NTNA 1L0NK 1QVGO 2KK7A 2M3BA 2OYIA 2ZYGA 1JM0A 1MUUA 1URQD 1ZR2A 1K9MQ 2I8DA 3SSUA 5AVRB 2LR2A 2K9JB 3BCCE 2KYVA 3BATA 4WY4D 2JEEA 4WBAA 4GKGA 1PPJE 3FXDA 2NPSC 1FAVA 1NOHA 2KS1A 2FXMA 2OTLP 2G8YA 3CC2P 3H1KD 4WVZA 2WT7B 1AVOA 1N7SC 1N7SD 2WSFJ 1LT1A 1KFMA 3NXSA 5KLIC 3BRVB 1NO4A 1EZVI 2N9YB 1P84H 1SQXE 2YNYA 3JC22 1YJWP 3RK3D 4AUWA 2K3RA 4N78E 2OYHB 3Q1MA 1YQ3C 2OTJP 1OW7A 3GF3A 2ZVNB 5CHXA 1ZRTD 2GA1A 1VQKP 1URQC 4QMAA 3V4QA 4DZOA 1BSHA 3GHGC 3L71G 2WSFH 3HTKB 1QX8A 1SQVE 2E76B 2OYOA 3H1LD 3ITKA 4GOEA 3D70A 1NTZD 1YYCA 2B87A 3CWBD 4IL6X 2SPZA 1T2KC 2O1KA 3HE4A 3MP7B 4BRYB 4C7NA 5BU8B 2K9JA 3M0DC 3MD0A 1L0LK 2E76D 1YJ9P 2D2CB 1FE6A 1SFCA 4L73A 1NTMK 2J5UA 3H1IE 2FYNB 3OAKA 2FKWB 3EFGA 4R4LA 1NJIQ 1VQMP 1RQUA 5KLVD 1OWAA 1RE4A 3H1LJ 5CBOA 2WPVB 4C7RA 1LP1A 5APWA 4HH2A 2BCCD 2Y0CA 2O01N 3L37A 1BCCG 3LW5H 4LGDE 5BVZA 3Q2YA 3RK3B 2OYHC 2Z5HA 2ZJSE 1N7SA 3AE7C 1M1JB 3CC4P 1VPCA 1H8AA 1EZVE 2YMYA 1N7SB 4W7ZA 5H2FH 1E79H 1X22A 3VN0A 1Q7YQ 3KDPB 3I5CA 1EXIA 1VQNP 2QIWA 3WU2H 5B5EE 3Q5SA 1M8OB 3L36A 1GU4A 3B5NC 1HTLC 4GT1A 1VQ6P 1M7LA 2KOGA 4I2LC 2N1TA 2WTYA 1J1DB 1W5CE 1UIXA 1DIPA 5KJ7C 1YITP 1S1CX 2JWAA 2L5GB 1PP9G 1JOCA 1RF0A 1FU1A
chains in the Genus database with same CATH topology
4WY4C 1LTJB 5APUA 2J58A 3H32A 1LTGC 3HE4B 3C9IA 1T2KD 1HWTC 2FFDC 3KYQA 2CPSA 1HGVA 2R3CA 3A7OA 5AVYB 1KQLA 5KJ7D 1MFZA 3MTUE 5AW9B 5CCGD 1LTBC 4WY4B 2YKQA 2R32A 3M91A 1JUNA 2PP6A 2XV5A 1URQB 3KPEA 1J1DC 1AFOA 2WZ7A 2P7JA 1MZ9A 3RL0B 1FDMA 2H8PD 2E42A 2Z5IA 5APQA 3M9QA 1N7LA 1FJKA 1FZCC 3EQ2A 3M9HA 5AW4B 2WPSA 3V2PA 3BRTB 1L4AD 3M06A 1IFDA 3HD7D 2W6BA 5AW7B 2I1JA 2E43A 1DX7A 1CZQA 1NWQA 3VMZA 5AVSB 2Q7CA 1RE4C 1RF0C 1OXZA 1SVFA 1E5WA 1RE3A 1T8ZA 3NMDA 3UIAA 2HPCA 1N73B 1JOCA 2N9BA 1N73A 1MV8A 3HUSC 1RF1B 1DEBA 3RK2B 2A45H 1GL2C 1ZV8A 2FFDB 3HE5A 1SQVK 3A3YB 1GW3A 1KFNA 1SP4A 2N1TB 1NHLA 4GIFA 4IFMA 5CJ0A 2P1JA 3B5ND 5APYA 2O01H 1IFMA 1NU1K 3PP5A 1JCDA 1NH4A 1JO5A 4EIJA 1IFIA 1JY3O 2P67A 3CLQA 1W2EA 3V2NA 3P32A 3RK2C 1FU1A 1KILD 3A2AA 5AW3B 1JTHA 1LGHB 5APSA 4HYTB 3HUSB 1RF1C 3G3ZA 1GK4A 2M8RA 1Z56A 2KLVA 1FZBA 2IFNA 1ZLLA 2HYNA 4M3LA 1J1EB 1T3JA 1A02F 2NPSA 1AQ5A 3TYYA 3VTPC 1HH0A 2ZFCA 4KHXA 1KILC 3HTKA 1SQXK 1FZCA 2KP8A 2C9NY 2W27A 1SFCC 2GUVA 2LKMA 3U1AA 2IFMA 5AW1B 4I6MC 1G2CB 3RL0C 4XE5B 2HFED 2XKMA 2O1JA 5APVA 3V4WA 5CCHD 5AVVB 1G1IA 3KQGA 2H7HA 2N1TD 2C0XA 1J1EC 1FBMA 5AVUB 2W6AA 1CI6B 2XNXA 2C9LY 4Y99B 2VRSA 3RL0D 4ZKUA 4LLHA 1SLQA 3P7KA 1N73C 3SWYA 1HBWA 3T97A 2OARA 4JF7A 4N6JA 4WY4A 1S9KE 3MIWA 1X79B 1CI6A 3VMXA 4B86A 1LTIC 3IR9A 3O8ZA 1FZFA 1FZAA 1YTZI 4OH8B 1SQPK 2YO3A 5AVZB 1WT6A 1N2DC 2GUSA 5KLVK 5CCGA 2KSJA 3B5NB 2HG5D 5CJ4A 1FZCB 2WWWA 3HRNA 1FZGA 1JCCA 1X8YA 2QM8A 1DH3A 2OYIC 1QL1A 4JYCA 1ZR4A 1H88A 5CCHC 3H6PA 1GZLA 3NFQA 3M0DA 5CCGC 3MGNA 1A02J 3TSIA 1RY3A 3B8EB 2PAJA 4RESB 1IJDB 1GU5A 1GTWA 1NKNA 4WB4A 1SQBK 1XTGB 2H43A 3V2RA 3CI9A 1JY3P 4C46A 1JY2N 2GM4A 2CPBA 1L4AA 1NAFA 1LTJC 2FYUK 2IPPA 2R5DA 1LT9B 3TNUA 3N4XA 2Z4EA 1FZEA 3CL3D 1LTSC 1LTAC 2FYZA 4C7NB 2HODB 3IFMA 1IK9A 3BVHA 1NKZB 3SWFA 5AW0B 3P8MC 1QL2A 2HLOA 2HPCB 2XZRA 3HD7A 1IC2A 3HE5B 5APTA 2OYHA 1LWUA 2JJLA 1HUCA 1GL2D 3VP9A 1JMMA 5APXA 5AW2B 3A5TA 3VMYA 3LIDA 5AVXB 2R5BA 4XA4A 3B5NA 1H89A 1PFIA 3OJAB 1LTJA 3VOPA 2Q3IA 1HJBA 3WMM0 4IFFA 4EOTA 1X9VA 3TK1A 3II6A 1EQ7A 1GD2E 3V5BA 2OYIB 3E1IA 1NTZK 4IFDK 5AW8B 1M1JC 1SFCB 3L35A 1KILA 4W80A 4AYCA 1ZN5A 5AW5B 1NTKK 3HD7C 1GL2A 1L4AC 1FOSE 4ZKPA 5AVTB 1FJPA 1JY2P 4DOJA 1G2CA 2WSEH 1HGZA 1S9KD 2YKOA 3RK2D 1RF1A 1IFNA 3P8CE 4LC1A 2WT7A 2YO2A 4Y99C 1JY2O 3H32B 2BASA 1G1JA 2C0WA 3GHGA 1RE3C 1IFJA 1KZUB 1GW4A 1L4AB 3M0AA 2HODA 2J59M 4AQRD 2XU6A 3BASA 2A45I 3V2QA 1LT9C 1JTHB 5CMZA 1VDFA 3N7NA 1T3UA 2Q5UA 4N78D 3U1CA 1JNMA 5AVQB 1J2JB 2XDJA 1GL2B 3OA7A 2WSCH 5KTBA 3RK3C 2MJZA 5CCHA 1KILB 1M1JA 3P8CD 3U59A 1LWUC 1SQQK 3GHGB 2FFDA 1GK6A 1LWUB 4JYBA 3HD7B 3VP8A 1WRGA 1JY3N 2NPSD 1LTTC 2A45G 2WPRA 2WITA 2KB7P 5AVWB 5BU5A 1FOSF 2NPSB 3M9BA 1CW5A 3L4FA 1N86A 1LT9A 3TNUB 4O9BA 2P2UA 1CSBA 2I1KA 4I1LA 5KJ7A 2IX7C 1SFCD 1YTZT 1HVVA 2ZXEB 1XTCC 2QM7A 2Q9IA 3R2PA 3LIEA 1GDTA 3HUSA 3VYIA 1URQA 4W7YA 2WPQA 2POHA 3NTNA 3MUDA 2OYIA 1IO4A 1L0NK 2M3BA 1MUUA 1URQD 1ZR2A 5AVRB 2KYVA 3BATA 4WY4D 2JEEA 4WBAA 4GKGA 2NPSC 1FAVA 1NOHA 2FXMA 2WT7B 1N7SC 1N7SD 1KFMA 3NXSA 3BRVB 1NO4A 2YNYA 4AUWA 3RK3D 4N78E 2OYHB 5CHXA 1URQC 3V4QA 4DZOA 3GHGC 2WSFH 3HTKB 1YYCA 1T2KC 2O1KA 3HE4A 4C7NA 5BU8B 3M0DC 3MD0A 1L0LK 1SFCA 4N3YB 1NTMK 3OAKA 2FKWB 3EFGA 1OWAA 1RE4A 4C7RA 5APWA 4HH2A 5BVZA 3L37A 4LGDE 3LW5H 2OYHC 3RK3B 2Z5HA 1N7SA 1M1JB 1VPCA 1H8AA 2YMYA 1N7SB 4W7ZA 3VN0A 3KDPB 3I5CA 3L36A 1GU4A 3B5NC 1HTLC 4GT1A 1M7LA 2KOGA 4I2LC 2N1TA 2WTYA 1J1DB 5KJ7C 2L5GB 5AW6B 2YKPA 1RF0A 2N1TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7N B;  5APU A;  3HE4 B;  3TYY A;  3VTP C;  4JYB A;  1T2K D;  1HWT C;  2ZFC A;  3SWF A;  5AW0 B;  3P8M C;  4KHX A;  3HTK A;  2XZR A;  2KP8 A;  2C9N Y;  3A7O A;  2R3C A;  2W27 A;  2WPR A;  3HE5 B;  5APT A;  5AW1 B;  5AVY B;  2JJL A;  5AVW B;  1HUC A;  4I6M C;  1G2C B;  5APX A;  4XE5 B;  5AW2 B;  3A5T A;  1FOS F;  1KQL A;  3M9B A;  3VMY A;  1MFZ A;  3LID A;  5APV A;  5AVX B;  2R5B A;  3V4W A;  3TNU B;  5AW9 B;  5AVV B;  2P2U A;  1H89 A;  2R32 A;  3M91 A;  2Q3I A;  3KQG A;  1HJB A;  2H7H A;  1CSB A;  1JUN A;  2XV5 A;  4EOT A;  3TK1 A;  5AVU B;  2W6A A;  1CI6 B;  1GD2 E;  2P7J A;  2ZXE B;  3V5B A;  2C9L Y;  2QM7 A;  2VRS A;  2E42 A;  2Z5I A;  5APQ A;  3LIE A;  5AW8 B;  3L35 A;  3VYI A;  1SLQ A;  3M9H A;  3P7K A;  4AYC A;  1HBW A;  5AW4 B;  3T97 A;  2WPS A;  5AW5 B;  3M06 A;  1S9K E;  2WPQ A;  1FOS E;  5AW7 B;  3NTN A;  1IO4 A;  5AVT B;  2E43 A;  1CI6 A;  1CZQ A;  3VMX A;  4B86 A;  1MUU A;  3IR9 A;  3O8Z A;  1NWQ A;  3VMZ A;  5AVS B;  5AVR B;  2Q7C A;  2YO3 A;  1S9K D;  5AVZ B;  1OXZ A;  4GKG A;  1FAV A;  3NMD A;  3UIA A;  2WT7 B;  2WWW A;  4LC1 A;  2WT7 A;  2N9B A;  3NXS A;  1X8Y A;  2YO2 A;  1MV8 A;  2QM8 A;  1DH3 A;  2YNY A;  4AUW A;  2BAS A;  4JYC A;  1H88 A;  3HE5 A;  3A3Y B;  1GZL A;  3NFQ A;  1SP4 A;  3M0D A;  3V4Q A;  4DZO A;  5APY A;  1YYC A;  3MGN A;  1A02 J;  1T2K C;  3HE4 A;  3B8E B;  3M0A A;  4C7N A;  4RES B;  4AQR D;  2XU6 A;  3MD0 A;  1GU5 A;  5CMZ A;  1GTW A;  3OAK A;  1JNM A;  1OWA A;  2Q5U A;  2P67 A;  5AVQ B;  1J2J B;  5APW A;  3L37 A;  3P32 A;  2Z5H A;  3A2A A;  4C46 A;  5AW3 B;  1H8A A;  5APS A;  4HYT B;  1GK4 A;  3VN0 A;  3KDP B;  3I5C A;  1NAF A;  2IPP A;  3L36 A;  2R5D A;  1GU4 A;  4GT1 A;  3TNU A;  2WTY A;  4I2L C;  4M3L A;  1A02 F;  5AW6 B;  1GK6 A; 
#chains in the Genus database with same CATH topology
 4WY4 C;  1JB0 J;  1BCC J;  1LTJ B;  5APU A;  2J58 A;  3H32 A;  1LTG C;  3HE4 B;  3C9I A;  1T2K D;  1HWT C;  2E75 B;  2QEX P;  1AJY A;  1EXJ A;  2FFD C;  3H1H E;  1L0L E;  2DW3 A;  3F5H A;  1HJ0 A;  1KB9 I;  3KYQ A;  1NTZ J;  3CXH I;  3CWB J;  2CPS A;  3K5B A;  1HGV A;  2FY8 A;  2R3C A;  2HR3 A;  3A7O A;  4K35 A;  2RH0 A;  5AVY B;  2FYU D;  3PLN A;  4HB1 A;  1PGO A;  1KQL A;  5KJ7 D;  2K37 A;  1MFZ A;  4PV1 C;  1LJ2 A;  5KKZ B;  3VMA A;  3MTU E;  1VL2 A;  1KYO I;  4NPF X;  5AW9 B;  5CCG D;  1L0L J;  1OW8 A;  4JBZ A;  1LTB C;  4WY4 B;  1SQV J;  2YKQ A;  1U57 A;  2R32 A;  3M91 A;  1JUN A;  2PP6 A;  2XV5 A;  1URQ B;  3KPE A;  2H88 C;  3H25 A;  1J1D C;  2BCC G;  1ZXG A;  1NVO A;  1NTM D;  1ZRT E;  4DJG A;  1AFO A;  2WZ7 A;  3A0H H;  4ASV A;  3L70 J;  2IBZ I;  2P7J A;  2BEQ D;  3QWO C;  1MZ9 A;  3RL0 B;  4YXW H;  2H8P D;  1KC8 Q;  1FDM A;  1NU1 E;  1TU3 F;  2E42 A;  3IAO A;  2Z5I A;  1Y9B A;  5APQ A;  3M9Q A;  1N7L A;  2E74 C;  4U3F D;  1FJK A;  4H0L B;  1FZC C;  2K9Y A;  3EQ2 A;  3CCJ P;  3M9H A;  1YQ4 C;  3D6Z A;  5B66 H;  5AW4 B;  3L73 D;  2WPS A;  3E7K A;  4OGQ D;  1AV1 A;  2YXQ B;  3O6Q A;  3V2P A;  3BRT B;  1KV4 A;  1L4A D;  1S4X A;  3M06 A;  1IFD A;  2AEF A;  2ZT9 C;  2KIK A;  3FXE A;  1SQB D;  2W6B A;  1VF5 B;  3BCC D;  3HD7 D;  1OVU A;  5AW7 B;  2I1J A;  4ZMD A;  2E43 A;  1DX7 A;  2KZI A;  3CXH D;  1CZQ A;  5GTI H;  5H2F E;  1VQ7 P;  1NWQ A;  3CCR P;  2QRX A;  5AVS B;  3VMZ A;  1AQT A;  1KD1 Q;  1H0T B;  1IZN B;  2FYU J;  4K3A A;  2Q7C A;  1KYO E;  1RE4 C;  1KMI Z;  1OXZ A;  1RF0 C;  1SVF A;  4WWI A;  3Q3D A;  1VQ8 P;  1E5W A;  5TJH A;  1RE3 A;  1BCC E;  4L74 A;  1IFP A;  1T8Z A;  1NTK J;  3NMD A;  3UIA A;  2HPC A;  1N73 B;  3PTZ A;  3AEB C;  5B5E H;  1P84 E;  1HF9 A;  2YKP A;  2N9B A;  1N73 A;  2KS1 B;  1MV8 A;  2Y9Y A;  3HUS C;  1OX3 A;  4PD4 D;  2H89 C;  4H13 B;  2B89 A;  2IBZ G;  1RF1 B;  1DEB A;  2QJY C;  3RK2 B;  3L71 J;  4A7P A;  4DCK A;  1W2B O;  2A45 H;  2AXC A;  1GL2 C;  1ZV8 A;  2QJK B;  2YIU C;  5L8R J;  1VQO P;  2FFD B;  3HE5 A;  3TGU J;  1SQV K;  3A3Y B;  1GW3 A;  2A06 E;  1KFN A;  1OW6 A;  1SP4 A;  1NHL A;  2N1T B;  2XND H;  1IK7 A;  2P1J A;  3C1L A;  3B5N D;  4GIF A;  4IFM A;  5CJ0 A;  5APY A;  1Q86 Q;  2O01 H;  4RO0 A;  1IFM A;  1NU1 K;  3KXD A;  3PP5 A;  3R4Y A;  3CX5 D;  2B88 A;  2K88 A;  3RL0 g;  2M0B A;  3CX5 I;  4GOD A;  3GF7 A;  3AE9 C;  1R5S A;  1JCD A;  2YXR B;  4GOF A;  1NH4 A;  3G4S P;  1JO5 A;  4EIJ A;  1IFI A;  2C9N Y;  1L0N G;  4D6T J;  1JY3 O;  2P67 A;  1LP1 B;  3CLQ A;  1W2E A;  3V2N A;  2RMZ A;  3P32 A;  3I56 P;  3RK2 C;  1OVV A;  2IZ1 A;  2N1T C;  2YIU B;  4PD4 I;  1KIL D;  3A2A A;  5AW3 B;  1JTH A;  1LGH B;  5APS A;  4HYT B;  3HUS B;  1RF1 C;  3G3Z A;  1GK4 A;  2M8R A;  3G6E P;  1Z56 A;  4U7J A;  3CCU P;  2KLV A;  1KN7 A;  1OVR A;  1FZB A;  1ZP0 C;  1UII A;  1PGQ A;  2IFN A;  3AE1 C;  1IO4 A;  5C39 A;  3AEE C;  1ZLL A;  1KB9 E;  2HYN A;  1J1E B;  4IL6 E;  2KXP B;  1T3J A;  4M3L A;  1A02 F;  1NTK G;  1YIJ P;  2NPS A;  5EFW B;  1BDD A;  1R8E A;  3FWN A;  1AQ5 A;  1SQP D;  1VQ5 P;  1OFC X;  3TYY A;  3VTP C;  1NTK E;  3A0B E;  2NRG A;  2UWJ E;  1HH0 A;  2ZFC A;  3FWL A;  5B66 E;  4KHX A;  1KIL C;  1L0N J;  1SQX K;  3HTK A;  3JSV C;  3PHL A;  5AW6 B;  1SQP G;  2MKV A;  3G71 P;  2QE7 H;  1BE3 D;  1FZC A;  3L74 J;  3I55 P;  1Y47 A;  2KP8 A;  1L2P A;  2W27 A;  1SFC C;  2GUV A;  2LKM A;  3MHV A;  3AE6 C;  3L72 E;  2KNC A;  4U3F E;  2IFM A;  3U1A A;  5AW1 B;  5GTI E;  3H1K G;  4IOI H;  3WUV A;  3TGU E;  4I6M C;  1DEE G;  1G2C B;  2OQQ A;  2W8Z A;  1U7M A;  4XE5 B;  3RL0 C;  3CPW O;  2HFE D;  2XKM A;  2O1J A;  4D6T D;  3PRJ A;  4R4M A;  5APV A;  3WUT A;  3V4W A;  2LXC B;  2O01 J;  4I7Z C;  5AVV B;  1G1I A;  1L0N E;  5CCH D;  2YMK A;  3MZW B;  1L0N D;  3KQG A;  5TIS E;  2H7H A;  2N1T D;  4OGQ B;  4TLF A;  3L71 D;  2C0X A;  1J1E C;  1FBM A;  4BWN A;  5AVU B;  4D6T E;  2W6A A;  1EDI A;  1CI6 B;  2PRR A;  2QJP C;  3Q5R A;  2XNX A;  1BDC A;  3SFD C;  1SQQ D;  1SQV G;  4Y99 B;  2C9L Y;  2JP3 A;  3EFF K;  2ZAE B;  2VRS A;  3H1H G;  3RL0 D;  3L72 D;  2Y0E A;  2A06 G;  3O6Q B;  5CBN A;  4KT0 J;  1OMI A;  4ZKU A;  4JPZ B;  1BE3 E;  4LLH A;  1SLQ A;  3P7K A;  1N73 C;  1S5L X;  1L0L D;  3H1H D;  3SWY A;  1YI2 P;  3T97 A;  1HBW A;  2OAR A;  4JF7 A;  4N6J A;  4WY4 A;  1EDJ A;  1S9K E;  1PIX A;  1S72 P;  5GTH H;  1USE A;  1X79 B;  3MIW A;  2LXB A;  4OGQ C;  1CI6 A;  3VMX A;  2IYP A;  1FDO A;  4B86 A;  1RH5 B;  1LTI C;  3IR9 A;  3O8Z A;  1BGY J;  2ZT9 D;  3L75 J;  1FZA A;  1S5L H;  1FZF A;  1EZV G;  1YTZ I;  4OH8 B;  1SQP K;  3H1J J;  1DD4 A;  3KZI E;  5DJT B;  2YO3 A;  5AVZ B;  1WT6 A;  1N2D C;  2GUS A;  5KLV K;  5CCG A;  1S2E A;  1PP9 J;  2KSJ A;  2O3J A;  3AE2 C;  3B5N B;  3KZI H;  1Q82 Q;  4Z1M H;  1PP9 D;  2E74 B;  2PGD A;  4HKZ H;  2HG5 D;  3S4R A;  3L70 D;  2WWW A;  3HRN A;  4PJ0 E;  4JQ0 D;  4D6T G;  1JCC A;  1X8Y A;  1FZG A;  1FZC B;  2QM8 A;  3L75 G;  5TIS H;  1DH3 A;  2OYI C;  1QL1 A;  4JYC A;  1ZR4 A;  1BGY E;  3FGA D;  1NTM J;  1H88 A;  2KUB A;  5CCH C;  5DJU B;  4H44 C;  1GMJ A;  1ZOY C;  3H6P A;  1GZL A;  2FYN C;  2WSS H;  2PFX A;  3NFQ A;  3M0D A;  3CC7 P;  1YBK A;  3AE4 C;  5CCG C;  1Q2N A;  3MGN A;  1PGJ A;  1A02 J;  3TSI A;  3WU2 E;  1M90 Q;  1AA0 A;  1RY3 A;  3B8E B;  3CME P;  1EDK A;  3T97 B;  2PAJ A;  4RES B;  2M5A B;  3TDK A;  1IJD B;  3H1H J;  4PV1 B;  5KAI H;  2AXT E;  1GU5 A;  3CCL P;  1NTZ G;  3CWB G;  2L91 A;  3GMA A;  2A06 D;  1GTW A;  3CCE P;  3MUD C;  1NKN A;  4WB4 A;  3L72 J;  3W68 A;  3AEF C;  1SQB K;  1XTG B;  1BSN A;  2H43 A;  3Q5P A;  3V2R A;  3RK3 E;  1PZQ A;  2CK3 H;  3CI9 A;  5CJ4 A;  3ZDM A;  4TT3 H;  1JY3 P;  4MN4 C;  4C46 A;  1JY2 N;  2GM4 A;  2IYO A;  3AEA C;  4H0L C;  5KLV G;  2CPB A;  1EDL A;  3JCU E;  2JR8 A;  4EYY Q;  1K73 Q;  1BCC D;  1L4A A;  1SQX J;  4U3F G;  1NAF A;  1LTJ C;  2FYU K;  2IPP A;  1VQL P;  1KYO D;  1KB9 H;  2IZ0 A;  2R5D A;  1SQP E;  2QG4 A;  1LT9 B;  2Y0D A;  3TNU A;  2KSE A;  3CXH H;  2JKV A;  2BEZ F;  3GG2 A;  3L73 G;  1T6A A;  3N4X A;  1FZE A;  2Z4E A;  1KB9 D;  3CXH E;  3CL3 D;  1LTS C;  4PV1 D;  1LTA C;  3A0B H;  3RBX A;  1USD A;  1QLE D;  1KQG B;  2FYZ A;  1SQB E;  1M57 D;  3L70 G;  1FC2 C;  2HOD B;  3IFM A;  1IK9 A;  5E79 E;  2WSE J;  4C7N B;  2M3E A;  3L75 D;  3BVH A;  1NKZ B;  2BCC J;  3SWF A;  5AW0 B;  3P8M C;  1QL2 A;  3L73 E;  3D71 A;  1N8R Q;  4UB8 H;  2HLO A;  1X0T A;  1M1K Q;  2HPC B;  2XZR A;  2WVR A;  1KIL E;  3PJS K;  4UB8 E;  4HJG H;  3HD7 A;  1IC2 A;  1JMB A;  2NZ2 A;  3HE5 B;  5APT A;  2OYH A;  1PV3 A;  4UB6 H;  1LWU A;  1S5L E;  1HUC A;  2JJL A;  1GL2 D;  2R3S A;  2V7Q H;  2ZYD A;  1JMM A;  2KNC B;  5APX A;  5AW2 B;  3VP9 A;  3RBZ A;  1KOR A;  3A5T A;  2D2C C;  1NTM E;  3VMY A;  2W83 C;  1R5L A;  1NAY A;  3LID A;  1JEK A;  5KAF E;  2E5T A;  2R5B A;  1S3J A;  4XA4 A;  5AVX B;  1YJN P;  4RKU J;  1QGK B;  3B5N A;  1NTM G;  3CX5 E;  1H89 A;  1PFI A;  3OJA B;  1LTJ A;  3VOP A;  2Q3I A;  1HJB A;  1D7M A;  1LNQ A;  1VF5 C;  4IFF A;  3WMM 0;  2ZT9 B;  4YXD C;  4EOT A;  1VQ4 P;  2B9B A;  1X9V A;  3TK1 A;  4KJM A;  3KHU A;  3II6 A;  1EQ7 A;  3USS A;  1GD2 E;  2QSI A;  3AEG C;  4L76 A;  1BGY D;  2R44 A;  3V5B A;  3E1I A;  3V6I A;  2OYI B;  1KYO H;  3AEC C;  3CCQ P;  1NTZ K;  4NPD A;  2JWD A;  4IFD K;  5KLI B;  4GDO A;  5AW8 B;  1M1J C;  5E79 H;  1SFC B;  3L35 A;  3AE3 C;  1BGY G;  3GW6 A;  1KIL A;  1SQB G;  3L70 E;  4W80 A;  4NPE A;  1ZN5 A;  1PP9 E;  3S9O A;  4AYC A;  3CCV P;  1SQX G;  1WMK A;  2IBZ E;  5AW5 B;  1NTK K;  2JO1 A;  3HD7 C;  1RQV A;  1GL2 A;  3E1R A;  1L4A C;  4ZNC A;  1FOS E;  3SFE C;  4ZKP A;  1BE3 J;  5KLV J;  1QEX A;  3JCU H;  5AVT B;  1JY2 P;  4CPG A;  1SQP J;  4DOJ A;  2D2C D;  1FJP A;  1FS0 E;  1SQQ J;  1ZME C;  3EWK A;  1G2C A;  1M56 D;  2WSE H;  1HGZ A;  3GLM A;  4YTP C;  1S9K D;  2QJK C;  2YKO A;  4ASW A;  3RK2 D;  2W90 A;  4PJ0 H;  1RF1 A;  1IFN A;  1KQS O;  3IN6 A;  3P8C E;  4H44 B;  4LC1 A;  2FYU G;  3H1J E;  2WT7 A;  2RKL A;  2YO2 A;  3CMA P;  2KZJ A;  2OGU A;  3H1I G;  1JY2 O;  4Y99 C;  1MFT A;  3H32 B;  2BAS A;  1NU1 D;  2AEM A;  3RGU A;  2V4H A;  2Y9Z A;  1G1J A;  2V7Q J;  4EDF A;  1DD3 A;  1BE3 G;  1SQQ E;  2C0W A;  3GHG A;  1VQ9 P;  3AE8 C;  3F89 A;  3ABV C;  3H1I D;  4Y28 J;  2G3A A;  3FX0 A;  3L71 E;  5K5G B;  4N3Y B;  1RE3 C;  1SQB J;  1IFJ A;  4UB6 E;  1KZU B;  1Y8A A;  2ZXX A;  2WSC J;  1RHZ B;  3B71 A;  2AXT H;  1GW4 A;  1L4A B;  3G9R A;  2HOD A;  2J59 M;  3H1K J;  1FDI A;  3H1L E;  3M0A A;  2JDI H;  2XU6 A;  3BAS A;  4AQR D;  2QA4 P;  2A45 I;  3V2Q A;  1LT9 C;  1JTH B;  5CMZ A;  1K04 A;  4IL6 H;  3S1K A;  2RN0 A;  1VDF A;  3N7N A;  1T3U A;  2FYU E;  2Q5U A;  3H1J G;  4N78 D;  3U1C A;  5AVQ B;  1JNM A;  1J2J B;  2XDJ A;  3TGU D;  1GL2 B;  4L75 A;  4YPC A;  5KAF H;  1SQX D;  2P10 A;  3OA7 A;  2FXO A;  2WSC H;  2ZYA A;  3AED C;  5KTB A;  1PPJ G;  2AEJ A;  3CCS P;  3RK3 C;  1K8A Q;  3CX5 H;  2MJZ A;  3H1J D;  3BCC G;  1KIL B;  4H13 C;  1M1J A;  1OZH A;  3P8C D;  3H1K E;  3TGU G;  3WUU A;  5CCH A;  2E5Y A;  3U59 A;  4BRY A;  1PPJ D;  1NTK D;  1LWU C;  1Q81 Q;  3H1I J;  1SQQ K;  1PGP A;  5KAI E;  5M1B A;  2ZVO B;  3BCC J;  4OVN F;  4PD4 H;  3GHG B;  2M5A A;  2E76 C;  1GK6 A;  1LWU B;  2QVA A;  2W6J H;  2FFD A;  1KTM A;  4EI2 A;  1PL5 A;  2FXP A;  4I7Z B;  4JYB A;  4XFJ A;  3HD7 B;  3VP8 A;  2IBZ D;  2Q6Q A;  1AVY A;  1NU1 G;  1EZV D;  2P58 A;  1WRG A;  1JY3 N;  3C8V A;  2NPS D;  1KQF B;  2KLU A;  2OTK E;  4BXL A;  1LTT C;  2A45 G;  2WPR A;  2BCC E;  2KB7 P;  2WIT A;  3L73 J;  3PH0 A;  5AVW B;  4H13 D;  5BU5 A;  4RJT A;  5KLV E;  1QVF O;  1H0T A;  1FOS F;  2NPS B;  1MKM A;  3L74 E;  1EC5 A;  3M9B A;  4U3F J;  2WMM A;  1CW5 A;  3L4F A;  1N86 A;  1LT9 A;  3TNU B;  3CCM P;  4O9B A;  2P2U A;  3AE5 C;  3L74 G;  1NTZ E;  3CWB E;  3TF5 A;  5GTH E;  3CD6 P;  1CSB A;  1SQV D;  1VQP P;  1NU1 J;  2I1K A;  2IDB A;  3QH9 A;  4I1L A;  3H1L G;  5KJ7 A;  3B4S A;  3L72 G;  2IX7 C;  5KKZ C;  1P84 I;  1SFC D;  3L74 D;  1YTZ T;  1VF5 D;  1SS1 A;  1HVV A;  2ZXE B;  1XTC C;  1NYH A;  2QJY B;  2QM7 A;  1L0L G;  3A0H E;  2Q9I A;  2WQY C;  3R2P A;  1NGM B;  3LIE A;  4OWF A;  3LW5 J;  4PD4 E;  3OW2 O;  1GDT A;  4H44 D;  3SWK A;  3W67 A;  3HUS A;  1SQQ G;  1P84 D;  2Q1K A;  3VYI A;  4H0L D;  1URQ A;  2QJP B;  2FBW C;  1OIP A;  4W7Y A;  2E74 D;  3IF4 A;  4DT0 A;  3L75 E;  1YHQ P;  2E75 C;  2B87 B;  2E75 D;  1Q90 D;  2K1A A;  2POH A;  1ZW0 A;  1U7J A;  2WPQ A;  3D6Y A;  1K05 A;  2ITA A;  2KI7 B;  3MUD A;  2Q3E A;  3NTN A;  1L0N K;  1QVG O;  2KK7 A;  2M3B A;  2OYI A;  2ZYG A;  1JM0 A;  1MUU A;  1URQ D;  1ZR2 A;  1K9M Q;  2I8D A;  3SSU A;  5AVR B;  2LR2 A;  2K9J B;  3BCC E;  2KYV A;  3BAT A;  4WY4 D;  2JEE A;  4WBA A;  4GKG A;  1PPJ E;  3FXD A;  2NPS C;  1FAV A;  1NOH A;  2KS1 A;  2FXM A;  2OTL P;  2G8Y A;  3CC2 P;  3H1K D;  4WVZ A;  2WT7 B;  1AVO A;  1N7S C;  1N7S D;  2WSF J;  1LT1 A;  1KFM A;  3NXS A;  5KLI C;  3BRV B;  1NO4 A;  1EZV I;  2N9Y B;  1P84 H;  1SQX E;  2YNY A;  3JC2 2;  1YJW P;  3RK3 D;  4AUW A;  2K3R A;  4N78 E;  2OYH B;  3Q1M A;  1YQ3 C;  2OTJ P;  1OW7 A;  3GF3 A;  2ZVN B;  5CHX A;  1ZRT D;  2GA1 A;  1VQK P;  1URQ C;  4QMA A;  3V4Q A;  4DZO A;  1BSH A;  3GHG C;  3L71 G;  2WSF H;  3HTK B;  1QX8 A;  1SQV E;  2E76 B;  2OYO A;  3H1L D;  3ITK A;  4GOE A;  3D70 A;  1NTZ D;  1YYC A;  2B87 A;  3CWB D;  4IL6 X;  2SPZ A;  1T2K C;  2O1K A;  3HE4 A;  3MP7 B;  4BRY B;  4C7N A;  5BU8 B;  2K9J A;  3M0D C;  3MD0 A;  1L0L K;  2E76 D;  1YJ9 P;  2D2C B;  1FE6 A;  1SFC A;  4L73 A;  1NTM K;  2J5U A;  3H1I E;  2FYN B;  3OAK A;  2FKW B;  3EFG A;  4R4L A;  1NJI Q;  1VQM P;  1RQU A;  5KLV D;  1OWA A;  1RE4 A;  3H1L J;  5CBO A;  2WPV B;  4C7R A;  1LP1 A;  5APW A;  4HH2 A;  2BCC D;  2Y0C A;  2O01 N;  3L37 A;  1BCC G;  3LW5 H;  4LGD E;  5BVZ A;  3Q2Y A;  3RK3 B;  2OYH C;  2Z5H A;  2ZJS E;  1N7S A;  3AE7 C;  1M1J B;  3CC4 P;  1VPC A;  1H8A A;  1EZV E;  2YMY A;  1N7S B;  4W7Z A;  5H2F H;  1E79 H;  1X22 A;  3VN0 A;  1Q7Y Q;  3KDP B;  3I5C A;  1EXI A;  1VQN P;  2QIW A;  3WU2 H;  5B5E E;  3Q5S A;  1M8O B;  3L36 A;  1GU4 A;  3B5N C;  1HTL C;  4GT1 A;  1VQ6 P;  1M7L A;  2KOG A;  4I2L C;  2N1T A;  2WTY A;  1J1D B;  1W5C E;  1UIX A;  1DIP A;  5KJ7 C;  1YIT P;  1S1C X;  2JWA A;  2L5G B;  1PP9 G;  1JOC A;  1RF0 A;  1FU1 A; 
#chains in the Genus database with same CATH homology
 4WY4 C;  1LTJ B;  5APU A;  2J58 A;  3H32 A;  1LTG C;  3HE4 B;  3C9I A;  1T2K D;  1HWT C;  2FFD C;  3KYQ A;  2CPS A;  1HGV A;  2R3C A;  3A7O A;  5AVY B;  1KQL A;  5KJ7 D;  1MFZ A;  3MTU E;  5AW9 B;  5CCG D;  1LTB C;  4WY4 B;  2YKQ A;  2R32 A;  3M91 A;  1JUN A;  2PP6 A;  2XV5 A;  1URQ B;  3KPE A;  1J1D C;  1AFO A;  2WZ7 A;  2P7J A;  1MZ9 A;  3RL0 B;  1FDM A;  2H8P D;  2E42 A;  2Z5I A;  5APQ A;  3M9Q A;  1N7L A;  1FJK A;  1FZC C;  3EQ2 A;  3M9H A;  5AW4 B;  2WPS A;  3V2P A;  3BRT B;  1L4A D;  3M06 A;  1IFD A;  3HD7 D;  2W6B A;  5AW7 B;  2I1J A;  2E43 A;  1DX7 A;  1CZQ A;  1NWQ A;  3VMZ A;  5AVS B;  2Q7C A;  1RE4 C;  1RF0 C;  1OXZ A;  1SVF A;  1E5W A;  1RE3 A;  1T8Z A;  3NMD A;  3UIA A;  2HPC A;  1N73 B;  1JOC A;  2N9B A;  1N73 A;  1MV8 A;  3HUS C;  1RF1 B;  1DEB A;  3RK2 B;  2A45 H;  1GL2 C;  1ZV8 A;  2FFD B;  3HE5 A;  1SQV K;  3A3Y B;  1GW3 A;  1KFN A;  1SP4 A;  2N1T B;  1NHL A;  4GIF A;  4IFM A;  5CJ0 A;  2P1J A;  3B5N D;  5APY A;  2O01 H;  1IFM A;  1NU1 K;  3PP5 A;  1JCD A;  1NH4 A;  1JO5 A;  4EIJ A;  1IFI A;  1JY3 O;  2P67 A;  3CLQ A;  1W2E A;  3V2N A;  3P32 A;  3RK2 C;  1FU1 A;  1KIL D;  3A2A A;  5AW3 B;  1JTH A;  1LGH B;  5APS A;  4HYT B;  3HUS B;  1RF1 C;  3G3Z A;  1GK4 A;  2M8R A;  1Z56 A;  2KLV A;  1FZB A;  2IFN A;  1ZLL A;  2HYN A;  4M3L A;  1J1E B;  1T3J A;  1A02 F;  2NPS A;  1AQ5 A;  3TYY A;  3VTP C;  1HH0 A;  2ZFC A;  4KHX A;  1KIL C;  3HTK A;  1SQX K;  1FZC A;  2KP8 A;  2C9N Y;  2W27 A;  1SFC C;  2GUV A;  2LKM A;  3U1A A;  2IFM A;  5AW1 B;  4I6M C;  1G2C B;  3RL0 C;  4XE5 B;  2HFE D;  2XKM A;  2O1J A;  5APV A;  3V4W A;  5CCH D;  5AVV B;  1G1I A;  3KQG A;  2H7H A;  2N1T D;  2C0X A;  1J1E C;  1FBM A;  5AVU B;  2W6A A;  1CI6 B;  2XNX A;  2C9L Y;  4Y99 B;  2VRS A;  3RL0 D;  4ZKU A;  4LLH A;  1SLQ A;  3P7K A;  1N73 C;  3SWY A;  1HBW A;  3T97 A;  2OAR A;  4JF7 A;  4N6J A;  4WY4 A;  1S9K E;  3MIW A;  1X79 B;  1CI6 A;  3VMX A;  4B86 A;  1LTI C;  3IR9 A;  3O8Z A;  1FZF A;  1FZA A;  1YTZ I;  4OH8 B;  1SQP K;  2YO3 A;  5AVZ B;  1WT6 A;  1N2D C;  2GUS A;  5KLV K;  5CCG A;  2KSJ A;  3B5N B;  2HG5 D;  5CJ4 A;  1FZC B;  2WWW A;  3HRN A;  1FZG A;  1JCC A;  1X8Y A;  2QM8 A;  1DH3 A;  2OYI C;  1QL1 A;  4JYC A;  1ZR4 A;  1H88 A;  5CCH C;  3H6P A;  1GZL A;  3NFQ A;  3M0D A;  5CCG C;  3MGN A;  1A02 J;  3TSI A;  1RY3 A;  3B8E B;  2PAJ A;  4RES B;  1IJD B;  1GU5 A;  1GTW A;  1NKN A;  4WB4 A;  1SQB K;  1XTG B;  2H43 A;  3V2R A;  3CI9 A;  1JY3 P;  4C46 A;  1JY2 N;  2GM4 A;  2CPB A;  1L4A A;  1NAF A;  1LTJ C;  2FYU K;  2IPP A;  2R5D A;  1LT9 B;  3TNU A;  3N4X A;  2Z4E A;  1FZE A;  3CL3 D;  1LTS C;  1LTA C;  2FYZ A;  4C7N B;  2HOD B;  3IFM A;  1IK9 A;  3BVH A;  1NKZ B;  3SWF A;  5AW0 B;  3P8M C;  1QL2 A;  2HLO A;  2HPC B;  2XZR A;  3HD7 A;  1IC2 A;  3HE5 B;  5APT A;  2OYH A;  1LWU A;  2JJL A;  1HUC A;  1GL2 D;  3VP9 A;  1JMM A;  5APX A;  5AW2 B;  3A5T A;  3VMY A;  3LID A;  5AVX B;  2R5B A;  4XA4 A;  3B5N A;  1H89 A;  1PFI A;  3OJA B;  1LTJ A;  3VOP A;  2Q3I A;  1HJB A;  3WMM 0;  4IFF A;  4EOT A;  1X9V A;  3TK1 A;  3II6 A;  1EQ7 A;  1GD2 E;  3V5B A;  2OYI B;  3E1I A;  1NTZ K;  4IFD K;  5AW8 B;  1M1J C;  1SFC B;  3L35 A;  1KIL A;  4W80 A;  4AYC A;  1ZN5 A;  5AW5 B;  1NTK K;  3HD7 C;  1GL2 A;  1L4A C;  1FOS E;  4ZKP A;  5AVT B;  1FJP A;  1JY2 P;  4DOJ A;  1G2C A;  2WSE H;  1HGZ A;  1S9K D;  2YKO A;  3RK2 D;  1RF1 A;  1IFN A;  3P8C E;  4LC1 A;  2WT7 A;  2YO2 A;  4Y99 C;  1JY2 O;  3H32 B;  2BAS A;  1G1J A;  2C0W A;  3GHG A;  1RE3 C;  1IFJ A;  1KZU B;  1GW4 A;  1L4A B;  3M0A A;  2HOD A;  2J59 M;  4AQR D;  2XU6 A;  3BAS A;  2A45 I;  3V2Q A;  1LT9 C;  1JTH B;  5CMZ A;  1VDF A;  3N7N A;  1T3U A;  2Q5U A;  4N78 D;  3U1C A;  1JNM A;  5AVQ B;  1J2J B;  2XDJ A;  1GL2 B;  3OA7 A;  2WSC H;  5KTB A;  3RK3 C;  2MJZ A;  5CCH A;  1KIL B;  1M1J A;  3P8C D;  3U59 A;  1LWU C;  1SQQ K;  3GHG B;  2FFD A;  1GK6 A;  1LWU B;  4JYB A;  3HD7 B;  3VP8 A;  1WRG A;  1JY3 N;  2NPS D;  1LTT C;  2A45 G;  2WPR A;  2WIT A;  2KB7 P;  5AVW B;  5BU5 A;  1FOS F;  2NPS B;  3M9B A;  1CW5 A;  3L4F A;  1N86 A;  1LT9 A;  3TNU B;  4O9B A;  2P2U A;  1CSB A;  2I1K A;  4I1L A;  5KJ7 A;  2IX7 C;  1SFC D;  1YTZ T;  1HVV A;  2ZXE B;  1XTC C;  2QM7 A;  2Q9I A;  3R2P A;  3LIE A;  1GDT A;  3HUS A;  3VYI A;  1URQ A;  4W7Y A;  2WPQ A;  2POH A;  3NTN A;  3MUD A;  2OYI A;  1IO4 A;  1L0N K;  2M3B A;  1MUU A;  1URQ D;  1ZR2 A;  5AVR B;  2KYV A;  3BAT A;  4WY4 D;  2JEE A;  4WBA A;  4GKG A;  2NPS C;  1FAV A;  1NOH A;  2FXM A;  2WT7 B;  1N7S C;  1N7S D;  1KFM A;  3NXS A;  3BRV B;  1NO4 A;  2YNY A;  4AUW A;  3RK3 D;  4N78 E;  2OYH B;  5CHX A;  1URQ C;  3V4Q A;  4DZO A;  3GHG C;  2WSF H;  3HTK B;  1YYC A;  1T2K C;  2O1K A;  3HE4 A;  4C7N A;  5BU8 B;  3M0D C;  3MD0 A;  1L0L K;  1SFC A;  4N3Y B;  1NTM K;  3OAK A;  2FKW B;  3EFG A;  1OWA A;  1RE4 A;  4C7R A;  5APW A;  4HH2 A;  5BVZ A;  3L37 A;  4LGD E;  3LW5 H;  2OYH C;  3RK3 B;  2Z5H A;  1N7S A;  1M1J B;  1VPC A;  1H8A A;  2YMY A;  1N7S B;  4W7Z A;  3VN0 A;  3KDP B;  3I5C A;  3L36 A;  1GU4 A;  3B5N C;  1HTL C;  4GT1 A;  1M7L A;  2KOG A;  4I2L C;  2N1T A;  2WTY A;  1J1D B;  5KJ7 C;  2L5G B;  5AW6 B;  2YKP A;  1RF0 A;  2N1T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...