1NTZJ

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1ntzJ00
3BCCJ 3L74J 3H1IJ 1BGYJ 4D6TJ 1SQPJ 5KLVJ 1PP9J 1KB9I 1NTZJ 1SQXJ 2FYUJ 3L70J 1EZVI 1KYOI 1NTMJ 1SQBJ 2IBZI 3CX5I 3CXHI 3H1JJ 4U3FJ 1L0NJ 4PD4I 3H1HJ 1BCCJ 3L71J 1SQVJ 1BE3J 1NU1J 3L72J 1P84I 3CWBJ 2BCCJ 3H1LJ 1SQQJ 3H1KJ 3L73J 3TGUJ 3L75J 1L0LJ 1NTKJ
chains in the Genus database with same CATH superfamily
1IO4A 2O1KA 2WT7B 2Q5UA 2LKMA 1NTKE 1RH5B 2WTYA 3R2PA 3I5CA 2FY8A 4ASWA 4D6TE 2FYUK 1BGYG 1HWTC 4PD4I 1LTTC 4IL6H 1FU1A 2OYOA 1SQVG 2Z5HA 1WT6A 4NPFX 1HUCA 1LT1A 1NHLA 1VQOP 3L75D 1OMIA 3CX5I 3IR9A 1KZUB 3QWOC 2JDIH 1RE4C 3H1HG 2KNCA 2NZ2A 2W6AA 3A0BH 1VQNP 2WSFH 1NWQA 1OW8A 2BCCG 2C0XA 1VL2A 3FX0A 2W27A 4KHXA 4K35A 3L36A 3AE8C 3AEDC 5CBNA 4C7RA 2N1TA 1DD3A 2IBZG 1CSBA 4MN4C 5KLVE 1N73C 4I1LA 1JO5A 2K9YA 2W8ZA 1AVYA 4JYBA 2KLUA 3TSIA 4C46A 1L0LJ 2XNDH 4LGDE 4OH8B 4I7ZC 3TGUE 1SQPK 4H0LB 2QJYC 3P8MC 3L4FA 1YIJP 2N9YB 1IZNB 3WU2H 1KV4A 4RESB 1KTMA 1VDFA 1SQVK 3TK1A 4GOFA 4UB8H 1Q82Q 1QL2A 3MZWB 4EYYQ 4Z1MH 1ZMEC 1CW5A 2P10A 1T2KD 3VTPC 3HE4A 2FFDB 1USDA 1S72P 1EDLA 3UIAA 3ITKA 3G3ZA 1GMJA 5AW0B 2FFDC 2E75D 3Q5RA 3L75G 1EDKA 5E79E 1U7JA 3RK3B 1KYOH 1VF5D 1QGKB 1GZLA 3PH0A 5GTIH 2H89C 4YTPC 2IFNA 3RK3C 5CCHA 2ZYGA 1FS0E 3CWBE 4I6MC 3TNUB 1PIXA 3HRNA 3GHGB 1SQXK 1K04A 1PV3A 3GHGC 2HPCA 5CJ0A 2B88A 3WUUA 2Z4EA 3OJAB 4TT3H 4KJMA 1YQ3C 2YNYA 3FXDA 3GG2A 3AEFC 2POHA 1RF1A 3L70J 2YMKA 3RK2D 5DJUB 3EFFK 1S5LE 1S5LX 1JUNA 2R32A 1H8AA 3CL3D 2HFED 3Q2YA 1GDTA 1QEXA 3KZIE 1KMIZ 1HJ0A 1NH4A 2KYVA 2N1TC 2NPSD 2PAJA 2OGUA 1NYHA 1RQUA 2E42A 3JCUH 3H1JD 3AEEC 4L75A 3C9IA 3H25A 2MKVA 2KOGA 3S4RA 2Q7CA 2L5GB 4PD4E 1NU1D 4YXWH 1MV8A 3T97B 3C8VA 2KS1A 1SQBJ 1SFCA 2MJZA 1SQQJ 1GK6A 1BCCE 1FZGA 1KQGB 1QVGO 3FGAD 2IPPA 3MUDA 3F5HA 1JY3N 3HD7D 3I55P 1HTLC 5H2FH 1L4AB 2HODB 1OZHA 1L4AC 2QRXA 3C1LA 1A02F 3MTUE 1KILD 3GW6A 5KAIE 5KLIC 4OVNF 1EXJA 4L73A 2E76C 4PJ0H 3AE6C 1PP9D 3G71P 2NRGA 4W7ZA 1T6AA 3BRVB 1YHQP 3IAOA 2Y9ZA 1KC8Q 4AUWA 5AVYB 2QJPB 2I1KA 4L74A 4JF7A 3BCCE 4N6JA 2FXPA 2IBZI 3P8CE 4BWNA 2HR3A 1FDOA 2QJPC 4O9BA 2OARA 1YYCA 2ZT9B 3CC7P 1LP1A 1BE3D 1N8RQ 2IFMA 2ZT9C 3CMEP 3H1JG 4H13B 4R4LA 1RF1C 2IDBA 4HB1A 5BVZA 2JWAA 2CPSA 1AJYA 1H0TA 5CHXA 3B8EB 1L0NG 1NTKJ 2JR8A 1LWUA 1NU1G 4D6TJ 1GW4A 3MD0A 5APWA 2GUVA 3A7OA 3A2AA 3H32A 4YPCA 2K3RA 2G3AA 3D71A 3O8ZA 5B66H 3RBZA 1LT9B 2FYNB 3PJSK 1RE3A 1FZEA 1L0LK 2WPRA 1YTZT 3BATA 1M1JA 1JB0J 3H1KD 4B86A 5AVQB 1SQPD 2B89A 4WVZA 2OYHA 2FYUE 1JY2O 2J59M 3PP5A 3MP7B 3RK3E 3H1LE 3HUSB 1SQQE 4LLHA 1YI2P 3MUDC 3L73D 1CI6B 1S3JA 2V4HA 1ZRTD 5L8RJ 2OYIB 2AEJA 1XTGB 1PP9G 3LIEA 1G2CA 5K5GB 4N3YB 2I1JA 2K88A 3HE5A 4RO0A 3V2PA 2L91A 2NPSA 4U3FD 3GMAA 3AECC 1Q90D 5KLVJ 1NTZJ 2RH0A 1QVFO 1KORA 1K05A 1NTKD 3E7KA 2P58A 2E5TA 1W2BO 3LW5J 1X8YA 3K5BA 3AEBC 1M8OB 3AEGC 1NU1K 2GA1A 3TGUJ 3L72E 3FWLA 4WBAA 3O6QB 2WQYC 1BE3G 3KDPB 5CCHD 5AVWB 4UB6H 2FXOA 3HTKB 2YXRB 1S2EA 2P1JA 3BASA 1SQXD 4HYTB 4GIFA 2Q3IA 3WUVA 2O1JA 3HD7A 4QMAA 3M0DA 2QEXP 1ZW0A 2H43A 2E43A 1T2KC 4PV1B 1BGYE 1GU5A 3II6A 1X22A 2XKMA 1NAYA 1KILA 3CXHH 2E75C 2E74D 2AXTE 1U57A 1SQVE 1AV1A 1VQ8P 1BDDA 5AW6B 4C7NB 2YKPA 1SVFA 1VQ4P 1LWUC 4WY4A 3M0AA 3H1KG 1JTHA 2BEQD 1VF5C 3L74G 1SQPG 3MIWA 1JCCA 2WMMA 1M1KQ 1M56D 1LTIC 3CWBJ 1NTMD 3H1HE 1URQD 2IZ0A 2BCCE 2K37A 1RE3C 3G4SP 1K73Q 3L73G 1M1JC 2R5BA 4A7PA 3USSA 2W90A 1LTJA 3WMM0 1JMMA 3D70A 2WSCJ 1SQBK 1KD1Q 3NXSA 4H44D 5KKZB 3VOPA 2J5UA 1KB9D 4U3FG 5AVVB 2K9JB 2IBZE 5KKZC 1SFCD 1YJ9P 3L71G 2WVRA 3RK2C 3CCSP 3TDKA 1P84E 5BU8B 1FOSE 5EFWB 5CMZA 1DH3A 2IYPA 2J58A 1HBWA 2QIWA 1FBMA 3CI9A 2KP8A 2NPSC 1KFNA 1N73B 3MHVA 1KYOD 3NMDA 4XFJA 2XU6A 2Q3EA 2Q9IA 5TISE 2RKLA 3OAKA 3Q5SA 1NTZE 2QJKC 3OW2O 2V7QJ 2O01N 1SQXG 2O3JA 4BRYA 4I7ZB 1KQFB 4N78D 2QJYB 1YITP 3CWBD 3FXEA 1R5SA 4OWFA 5KJ7D 4TLFA 1OW6A 3H1IG 3LW5H 2VRSA 1BCCJ 1AQTA 5AW1B 5GTHE 2JP3A 2QM7A 1HGZA 3OA7A 2WWWA 1M90Q 3HD7C 1OX3A 3M0DC 3L75E 3CCEP 2C9LY 2C0WA 4BXLA 1FJPA 3VN0A 1WMKA 1KB9H 1DEEG 2XZRA 3S1KA 1KILC 5DJTB 4YXDC 1NTMG 1GK4A 2H88C 1OFCX 1NTKK 3KHUA 1FZAA 4IFFA 5KTBA 1OWAA 3B5NA 1FZFA 4EDFA 2YMYA 2HLOA 3SWKA 4IFDK 2HG5D 3AE1C 1WRGA 3V4QA 5KAFH 5E79H 3BCCJ 1IFNA 1AA0A 1HVVA 3V4WA 1DIPA 1L0LD 4EOTA 3P32A 1FE6A 1FDIA 2QVAA 2QA4P 1PPJD 2KNCB 1AVOA 2H8PD 2P7JA 4JPZB 1S1CX 3GF3A 2M5AA 2ZYAA 4KT0J 2PP6A 1JOCA 2WSCH 3AE2C 1T3UA 3VP9A 2IX7C 4CPGA 2N1TB 3V5BA 1JY3P 3A0HE 1K8AQ 2RN0A 5CCGA 1N7SA 1S5LH 1M57D 1Z56A 1IFMA 3V6IA 2KK7A 3CPWO 2KI7B 1NTMK 1URQA 1NO4A 1UIXA 1LNQA 2XDJA 3V2QA 1AFOA 1DD4A 4WB4A 4WWIA 2YIUB 2FYUJ 3SWFA 1X79B 2QE7H 3P8CD 4EIJA 3CLQA 1HH0A 1L2PA 4PD4H 2YIUC 3H1LJ 1NKZB 2M3EA 1JY3O 1VQMP 3LIDA 4K3AA 3CX5E 2YKQA 3SWYA 1VPCA 2A06D 2D2CD 1KFMA 3KXDA 3EQ2A 3F89A 4I2LC 2R5DA 3HE4B 3SSUA 3M9QA 2AEMA 3CXHI 3IN6A 2WPSA 3L70D 4H0LD 5KLIB 1J2JB 2Q1KA 4M3LA 2E76B 5APTA 1EDIA 2ZVOB 3VMYA 3A5TA 1FZCA 5AW5B 1L0LG 3BRTB 1W5CE 5APVA 4JQ0D 1GL2A 4WY4D 1PPJG 2PGDA 5KAIH 3L72J 1RF0A 5CCHC 5KJ7A 3H1JE 2W83C 2HPCB 1MFTA 1QX8A 2A45H 1L0NE 2Y0DA 1SQBD 2OQQA 4JBZA 1NU1E 3EWKA 4ASVA 3CCJP 1RF1B 1BGYJ 3H1LD 1SQQD 4GOEA 4JYCA 2GUSA 1FDMA 2E74C 3V2NA 3GF7A 1LTGC 1SQVJ 3IF4A 1JY2P 3M06A 2B87A 5AW3B 3WUTA 2ZFCA 1M7LA 3TYYA 4ZMDA 1MUUA 2CPBA 1J1EC 3H1HJ 3N7NA 1URQC 4XA4A 2KSEA 2BCCJ 1KILE 3U1CA 1YJWP 3L72D 2A06G 1EZVD 5AVSB 1GTWA 2KS1B 4RJTA 1OIPA 4H44C 2WT7A 1SFCB 1PP9E 3KPEA 1S9KE 1ZOYC 3L70G 1SFCC 3V2RA 3RL0g 4GODA 2WSFJ 1KB9I 3Q1MA 3CXHD 2YKOA 1Y47A 4DZOA 1MFZA 1ZLLA 1R8EA 2WITA 1DX7A 1BE3E 1LGHB 3H1IJ 5AW2B 5TJHA 1IFPA 1FZCC 2YO3A 2QM8A 1KYOI 3A3YB 1FZBA 1X0TA 2PFXA 4D6TD 3E1RA 1DEBA 4W7YA 2ITAA 3B5ND 1SQBG 3H1HD 1RF0C 3GLMA 1OXZA 2BCCD 5B5EE 1ZV8A 1CZQA 4Y99C 1X9VA 2WSEJ 2WSSH 1LP1B 3L75J 5CJ4A 1YQ4C 2JKVA 3H1KE 2N9BA 3L74E 3VYIA 1SQPE 1PL5A 2E75B 1VQ7P 1P84D 4OGQD 1H0TB 1PGPA 3RGUA 2AEFA 1LWUB 1NAFA 1YBKA 1XTCC 3FWNA 1SLQA 1VF5B 1G1JA 1EZVG 3H32B 1ZRTE 1PGQA 1FC2C 5CCGD 2BEZF 2KIKA 1N7SD 2AXTH 2Q6QA 2FXMA 5KLVD 1NTZD 5AW8B 4L76A 4U3FE 2W6JH 5CBOA 2FFDA 3L71E 3RL0D 1M1JB 4AQRD 4H13D 1QL1A 4IL6E 4IL6X 2B9BA 3JSVC 2OYHB 3TGUD 1JEKA 4ZKUA 3CMAP 2JEEA 2Y9YA 1K9MQ 1KN7A 1YJNP 2OYHC 2K1AA 1UIIA 3RK2B 3M91A 1SQQK 3P7KA 3L35A 5C39A 5APXA 1LJ2A 1GD2E 2IZ1A 1G2CB 3A0BE 1NTKG 3TNUA 3HE5B 4D6TG 3GHGA 2FBWC 2W6BA 1SQXE 4GT1A 2NPSB 4R4MA 1P84H 5AVTB 3CCVP 2YO2A 1GW3A 2M3BA 2QJKB 4U7JA 3H1IE 1EQ7A 3CCMP 2I8DA 1W2EA 1GL2D 2YXQB 3B4SA 1OW7A 2H7HA 5TISH 2ZXEB 1MKMA 3D6YA 1TU3F 1FJKA 2A45I 2D2CB 2O01J 4AYCA 5APYA 1NTME 3HD7B 1VQ6P 1VQPP 2D2CC 2FYZA 3PHLA 3WU2E 1ZR4A 2UWJE 5GTHH 3CCQP 2KSJA 3AE7C 4UB8E 1KILB 2KB7P 4GKGA 3T97A 5KLVG 2WSEH 4GDOA 4H0LC 1ZR2A 1NTZG 1Y8AA 3RBXA 1KB9E 3E1IA 3CCRP 2PRRA 3SFDC 4WY4B 2WPVB 1NVOA 1IC2A 1JTHB 4Y28J 5APSA 1OVUA 3TGUG 1OVRA 4WY4C 1PGJA 1SS1A 1E5WA 1L4AA 2ZVNB 2HODA 2KZIA 4PV1D 2R3CA 1KYOE 3H1JJ 1H89A 2OTLP 1LTJB 1J1DB 5GTIE 2KXPB 4PD4D 2BASA 5AW4B 5KAFE 1PFIA 1LTJC 3CCLP 1J1DC 1L0NJ 4N78E 1NU1J 3R4YA 2OTKE 2WPQA 3H6PA 1BCCD 3CX5D 3W67A 3L37A 1T3JA 3Q3DA 3AE3C 5APUA 1GU4A 3EFGA 1USEA 5AVZB 1T8ZA 1S4XA 3CWBG 4DT0A 5KLVK 1QLED 1NTZK 4HH2A 1N7LA 1MZ9A 4BRYB 3I56P 3A0HH 3U1AA 4DOJA 3KZIH 3IFMA 3JCUE 1IFDA 1PP9J 3AE9C 1Q86Q 1A02J 5AVXB 2WZ7A 1Q7YQ 1EZVI 3BCCD 2AXCA 2V7QH 1N2DC 3ABVC 2C9NY 1L0ND 1Y9BA 1LT9A 1L0LE 2LXCB 1IFIA 2O01H 2Y0CA 2P67A 1PPJE 2ZYDA 2OTJP 1BDCA 3BVHA 3CX5H 1BE3J 3QH9A 5H2FE 4IFMA 1AQ5A 3B5NB 2ZJSE 3CD6P 1Q81Q 1HGVA 4NPEA 3HUSA 2R44A 1CI6A 3B5NC 2OYIA 2IYOA 3KYQA 4PJ0E 5AW9B 1BCCG 2Z5IA 2LXBA 5M1BA 3JC22 1LTAC 1VQ5P 1RY3A 1HJBA 3PLNA 2SPZA 1S9KD 1JCDA 2FYUD 2M5AB 1N86A 1FAVA 1PGOA 3H1KJ 3ZDMA 4OGQB 1NJIQ 1LTSC 3L74J 3M9BA 1SQPJ 3RK3D 3VMXA 2E74B 5AVRB 3O6QA 4OGQC 3PRJA 4HJGH 3W68A 3MGNA 3HTKA 1EDJA 1P84I 1N7SB 3L73J 2DW3A 3D6ZA 2A06E 5CCGC 2A45G 1J1EB 2JJLA 4HKZH 3G6EP 1N7SC 3RL0B 1URQB 1D7MA 1EC5A 2QSIA 1BSNA 3BCCG 4U3FJ 4EI2A 3L70E 3L71J 3RL0C 1ZP0C 1ZXGA 4H13C 2M0BA 3B71A 3CC2P 2KUBA 4H44B 1IK7A 1R5LA 5B66E 1IFJA 2QG4A 4C7NA 2N1TD 3CC4P 1KQSO 3Q5PA 3VP8A 4DJGA 1H88A 4NPDA 1NKNA 1JM0A 3U59A 4IOIH 2JWDA 5AVUB 2E5YA 5BU5A 5AW7B 1VQLP 1LT9C 1U7MA 2FYNC 1SQXJ 2KLVA 3SFEC 3L74D 1BGYD 1SQBE 2FKWB 2Y0EA 4RKUJ 3AE4C 1RE4A 1IK9A 1EXIA 4LC1A 1G1IA 4XE5B 1FZCB 2RMZA 1JY2N 1NOHA 1SQVD 2ZAEB 3S9OA 2K9JA 1GL2B 2ZXXA 3TF5A 3HUSC 3NTNA 1KQLA 3G9RA 1RHZB 1OVVA 1GL2C 2FYUG 2OYIC 1SP4A 3L71D 1YTZI 1L4AD 3AEAC 3H1LG 4Y99B 2XV5A 1JMBA 1SQQG 2R3SA 1N73A 3NFQA 5KJ7C 2P2UA 1NTMJ 1BSHA 3VMZA 1VQ9P 2M8RA 2E76D 1L0NK 3PTZA 2XNXA 4W80A 1LTBC 4UB6E 1ZN5A 5B5EH 1E79H 1FOSF 1EZVE 2IBZD 2CK3H 3N4XA 4ZKPA 2LR2A 3KQGA 3M9HA 2G8YA 4ZNCA 2B87B 1JNMA 1PZQA 3AE5C 3CCUP 1NGMB 3CXHE 1IJDB 3L72G 1Q2NA 3L73E 1VQKP 1HF9A 4DCKA 3VMAA 1RQVA 3H1ID 2HYNA 2GM4A 2ZT9D 2KZJA 5APQA 4PV1C 2JO1A
chains in the Genus database with same CATH topology
3BCCJ 3L74J 3H1IJ 1BGYJ 4D6TJ 1SQPJ 5KLVJ 1PP9J 1KB9I 1NTZJ 1SQXJ 2FYUJ 3L70J 1EZVI 1KYOI 1NTMJ 1SQBJ 2IBZI 3CX5I 3CXHI 3H1JJ 4U3FJ 1L0NJ 4PD4I 3H1HJ 1BCCJ 3L71J 1SQVJ 1BE3J 1NU1J 3L72J 1P84I 3CWBJ 2BCCJ 3H1LJ 1SQQJ 3H1KJ 3L73J 3TGUJ 3L75J 1L0LJ 1NTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC J;  3L74 J;  3H1I J;  1BGY J;  4D6T J;  1SQP J;  5KLV J;  1PP9 J;  1KB9 I;  1NTZ J;  1SQX J;  2FYU J;  3L70 J;  1EZV I;  1KYO I;  1NTM J;  1SQB J;  2IBZ I;  3CX5 I;  3CXH I;  3H1J J;  4U3F J;  1L0N J;  4PD4 I;  3H1H J;  1BCC J;  3L71 J;  1SQV J;  1BE3 J;  1NU1 J;  3L72 J;  1P84 I;  3CWB J;  2BCC J;  3H1L J;  1SQQ J;  3H1K J;  3L73 J;  3TGU J;  3L75 J;  1L0L J;  1NTK J; 
#chains in the Genus database with same CATH topology
 1IO4 A;  2O1K A;  2WT7 B;  2Q5U A;  2LKM A;  1NTK E;  1RH5 B;  2WTY A;  3R2P A;  3I5C A;  2FY8 A;  4ASW A;  4D6T E;  2FYU K;  1BGY G;  1HWT C;  4PD4 I;  1LTT C;  4IL6 H;  1FU1 A;  2OYO A;  1SQV G;  2Z5H A;  1WT6 A;  4NPF X;  1HUC A;  1LT1 A;  1NHL A;  1VQO P;  3L75 D;  1OMI A;  3CX5 I;  3IR9 A;  1KZU B;  3QWO C;  2JDI H;  1RE4 C;  3H1H G;  2KNC A;  2NZ2 A;  2W6A A;  3A0B H;  1VQN P;  2WSF H;  1NWQ A;  1OW8 A;  2BCC G;  2C0X A;  1VL2 A;  3FX0 A;  2W27 A;  4KHX A;  4K35 A;  3L36 A;  3AE8 C;  3AED C;  5CBN A;  4C7R A;  2N1T A;  1DD3 A;  2IBZ G;  1CSB A;  4MN4 C;  5KLV E;  1N73 C;  4I1L A;  1JO5 A;  2K9Y A;  2W8Z A;  1AVY A;  4JYB A;  2KLU A;  3TSI A;  4C46 A;  1L0L J;  2XND H;  4LGD E;  4OH8 B;  4I7Z C;  3TGU E;  1SQP K;  4H0L B;  2QJY C;  3P8M C;  3L4F A;  1YIJ P;  2N9Y B;  1IZN B;  3WU2 H;  1KV4 A;  4RES B;  1KTM A;  1VDF A;  1SQV K;  3TK1 A;  4GOF A;  4UB8 H;  1Q82 Q;  1QL2 A;  3MZW B;  4EYY Q;  4Z1M H;  1ZME C;  1CW5 A;  2P10 A;  1T2K D;  3VTP C;  3HE4 A;  2FFD B;  1USD A;  1S72 P;  1EDL A;  3UIA A;  3ITK A;  3G3Z A;  1GMJ A;  5AW0 B;  2FFD C;  2E75 D;  3Q5R A;  3L75 G;  1EDK A;  5E79 E;  1U7J A;  3RK3 B;  1KYO H;  1VF5 D;  1QGK B;  1GZL A;  3PH0 A;  5GTI H;  2H89 C;  4YTP C;  2IFN A;  3RK3 C;  5CCH A;  2ZYG A;  1FS0 E;  3CWB E;  4I6M C;  3TNU B;  1PIX A;  3HRN A;  3GHG B;  1SQX K;  1K04 A;  1PV3 A;  3GHG C;  2HPC A;  5CJ0 A;  2B88 A;  3WUU A;  2Z4E A;  3OJA B;  4TT3 H;  4KJM A;  1YQ3 C;  2YNY A;  3FXD A;  3GG2 A;  3AEF C;  2POH A;  1RF1 A;  3L70 J;  2YMK A;  3RK2 D;  5DJU B;  3EFF K;  1S5L E;  1S5L X;  1JUN A;  2R32 A;  1H8A A;  3CL3 D;  2HFE D;  3Q2Y A;  1GDT A;  1QEX A;  3KZI E;  1KMI Z;  1HJ0 A;  1NH4 A;  2KYV A;  2N1T C;  2NPS D;  2PAJ A;  2OGU A;  1NYH A;  1RQU A;  2E42 A;  3JCU H;  3H1J D;  3AEE C;  4L75 A;  3C9I A;  3H25 A;  2MKV A;  2KOG A;  3S4R A;  2Q7C A;  2L5G B;  4PD4 E;  1NU1 D;  4YXW H;  1MV8 A;  3T97 B;  3C8V A;  2KS1 A;  1SQB J;  1SFC A;  2MJZ A;  1SQQ J;  1GK6 A;  1BCC E;  1FZG A;  1KQG B;  1QVG O;  3FGA D;  2IPP A;  3MUD A;  3F5H A;  1JY3 N;  3HD7 D;  3I55 P;  1HTL C;  5H2F H;  1L4A B;  2HOD B;  1OZH A;  1L4A C;  2QRX A;  3C1L A;  1A02 F;  3MTU E;  1KIL D;  3GW6 A;  5KAI E;  5KLI C;  4OVN F;  1EXJ A;  4L73 A;  2E76 C;  4PJ0 H;  3AE6 C;  1PP9 D;  3G71 P;  2NRG A;  4W7Z A;  1T6A A;  3BRV B;  1YHQ P;  3IAO A;  2Y9Z A;  1KC8 Q;  4AUW A;  5AVY B;  2QJP B;  2I1K A;  4L74 A;  4JF7 A;  3BCC E;  4N6J A;  2FXP A;  2IBZ I;  3P8C E;  4BWN A;  2HR3 A;  1FDO A;  2QJP C;  4O9B A;  2OAR A;  1YYC A;  2ZT9 B;  3CC7 P;  1LP1 A;  1BE3 D;  1N8R Q;  2IFM A;  2ZT9 C;  3CME P;  3H1J G;  4H13 B;  4R4L A;  1RF1 C;  2IDB A;  4HB1 A;  5BVZ A;  2JWA A;  2CPS A;  1AJY A;  1H0T A;  5CHX A;  3B8E B;  1L0N G;  1NTK J;  2JR8 A;  1LWU A;  1NU1 G;  4D6T J;  1GW4 A;  3MD0 A;  5APW A;  2GUV A;  3A7O A;  3A2A A;  3H32 A;  4YPC A;  2K3R A;  2G3A A;  3D71 A;  3O8Z A;  5B66 H;  3RBZ A;  1LT9 B;  2FYN B;  3PJS K;  1RE3 A;  1FZE A;  1L0L K;  2WPR A;  1YTZ T;  3BAT A;  1M1J A;  1JB0 J;  3H1K D;  4B86 A;  5AVQ B;  1SQP D;  2B89 A;  4WVZ A;  2OYH A;  2FYU E;  1JY2 O;  2J59 M;  3PP5 A;  3MP7 B;  3RK3 E;  3H1L E;  3HUS B;  1SQQ E;  4LLH A;  1YI2 P;  3MUD C;  3L73 D;  1CI6 B;  1S3J A;  2V4H A;  1ZRT D;  5L8R J;  2OYI B;  2AEJ A;  1XTG B;  1PP9 G;  3LIE A;  1G2C A;  5K5G B;  4N3Y B;  2I1J A;  2K88 A;  3HE5 A;  4RO0 A;  3V2P A;  2L91 A;  2NPS A;  4U3F D;  3GMA A;  3AEC C;  1Q90 D;  5KLV J;  1NTZ J;  2RH0 A;  1QVF O;  1KOR A;  1K05 A;  1NTK D;  3E7K A;  2P58 A;  2E5T A;  1W2B O;  3LW5 J;  1X8Y A;  3K5B A;  3AEB C;  1M8O B;  3AEG C;  1NU1 K;  2GA1 A;  3TGU J;  3L72 E;  3FWL A;  4WBA A;  3O6Q B;  2WQY C;  1BE3 G;  3KDP B;  5CCH D;  5AVW B;  4UB6 H;  2FXO A;  3HTK B;  2YXR B;  1S2E A;  2P1J A;  3BAS A;  1SQX D;  4HYT B;  4GIF A;  2Q3I A;  3WUV A;  2O1J A;  3HD7 A;  4QMA A;  3M0D A;  2QEX P;  1ZW0 A;  2H43 A;  2E43 A;  1T2K C;  4PV1 B;  1BGY E;  1GU5 A;  3II6 A;  1X22 A;  2XKM A;  1NAY A;  1KIL A;  3CXH H;  2E75 C;  2E74 D;  2AXT E;  1U57 A;  1SQV E;  1AV1 A;  1VQ8 P;  1BDD A;  5AW6 B;  4C7N B;  2YKP A;  1SVF A;  1VQ4 P;  1LWU C;  4WY4 A;  3M0A A;  3H1K G;  1JTH A;  2BEQ D;  1VF5 C;  3L74 G;  1SQP G;  3MIW A;  1JCC A;  2WMM A;  1M1K Q;  1M56 D;  1LTI C;  3CWB J;  1NTM D;  3H1H E;  1URQ D;  2IZ0 A;  2BCC E;  2K37 A;  1RE3 C;  3G4S P;  1K73 Q;  3L73 G;  1M1J C;  2R5B A;  4A7P A;  3USS A;  2W90 A;  1LTJ A;  3WMM 0;  1JMM A;  3D70 A;  2WSC J;  1SQB K;  1KD1 Q;  3NXS A;  4H44 D;  5KKZ B;  3VOP A;  2J5U A;  1KB9 D;  4U3F G;  5AVV B;  2K9J B;  2IBZ E;  5KKZ C;  1SFC D;  1YJ9 P;  3L71 G;  2WVR A;  3RK2 C;  3CCS P;  3TDK A;  1P84 E;  5BU8 B;  1FOS E;  5EFW B;  5CMZ A;  1DH3 A;  2IYP A;  2J58 A;  1HBW A;  2QIW A;  1FBM A;  3CI9 A;  2KP8 A;  2NPS C;  1KFN A;  1N73 B;  3MHV A;  1KYO D;  3NMD A;  4XFJ A;  2XU6 A;  2Q3E A;  2Q9I A;  5TIS E;  2RKL A;  3OAK A;  3Q5S A;  1NTZ E;  2QJK C;  3OW2 O;  2V7Q J;  2O01 N;  1SQX G;  2O3J A;  4BRY A;  4I7Z B;  1KQF B;  4N78 D;  2QJY B;  1YIT P;  3CWB D;  3FXE A;  1R5S A;  4OWF A;  5KJ7 D;  4TLF A;  1OW6 A;  3H1I G;  3LW5 H;  2VRS A;  1BCC J;  1AQT A;  5AW1 B;  5GTH E;  2JP3 A;  2QM7 A;  1HGZ A;  3OA7 A;  2WWW A;  1M90 Q;  3HD7 C;  1OX3 A;  3M0D C;  3L75 E;  3CCE P;  2C9L Y;  2C0W A;  4BXL A;  1FJP A;  3VN0 A;  1WMK A;  1KB9 H;  1DEE G;  2XZR A;  3S1K A;  1KIL C;  5DJT B;  4YXD C;  1NTM G;  1GK4 A;  2H88 C;  1OFC X;  1NTK K;  3KHU A;  1FZA A;  4IFF A;  5KTB A;  1OWA A;  3B5N A;  1FZF A;  4EDF A;  2YMY A;  2HLO A;  3SWK A;  4IFD K;  2HG5 D;  3AE1 C;  1WRG A;  3V4Q A;  5KAF H;  5E79 H;  3BCC J;  1IFN A;  1AA0 A;  1HVV A;  3V4W A;  1DIP A;  1L0L D;  4EOT A;  3P32 A;  1FE6 A;  1FDI A;  2QVA A;  2QA4 P;  1PPJ D;  2KNC B;  1AVO A;  2H8P D;  2P7J A;  4JPZ B;  1S1C X;  3GF3 A;  2M5A A;  2ZYA A;  4KT0 J;  2PP6 A;  1JOC A;  2WSC H;  3AE2 C;  1T3U A;  3VP9 A;  2IX7 C;  4CPG A;  2N1T B;  3V5B A;  1JY3 P;  3A0H E;  1K8A Q;  2RN0 A;  5CCG A;  1N7S A;  1S5L H;  1M57 D;  1Z56 A;  1IFM A;  3V6I A;  2KK7 A;  3CPW O;  2KI7 B;  1NTM K;  1URQ A;  1NO4 A;  1UIX A;  1LNQ A;  2XDJ A;  3V2Q A;  1AFO A;  1DD4 A;  4WB4 A;  4WWI A;  2YIU B;  2FYU J;  3SWF A;  1X79 B;  2QE7 H;  3P8C D;  4EIJ A;  3CLQ A;  1HH0 A;  1L2P A;  4PD4 H;  2YIU C;  3H1L J;  1NKZ B;  2M3E A;  1JY3 O;  1VQM P;  3LID A;  4K3A A;  3CX5 E;  2YKQ A;  3SWY A;  1VPC A;  2A06 D;  2D2C D;  1KFM A;  3KXD A;  3EQ2 A;  3F89 A;  4I2L C;  2R5D A;  3HE4 B;  3SSU A;  3M9Q A;  2AEM A;  3CXH I;  3IN6 A;  2WPS A;  3L70 D;  4H0L D;  5KLI B;  1J2J B;  2Q1K A;  4M3L A;  2E76 B;  5APT A;  1EDI A;  2ZVO B;  3VMY A;  3A5T A;  1FZC A;  5AW5 B;  1L0L G;  3BRT B;  1W5C E;  5APV A;  4JQ0 D;  1GL2 A;  4WY4 D;  1PPJ G;  2PGD A;  5KAI H;  3L72 J;  1RF0 A;  5CCH C;  5KJ7 A;  3H1J E;  2W83 C;  2HPC B;  1MFT A;  1QX8 A;  2A45 H;  1L0N E;  2Y0D A;  1SQB D;  2OQQ A;  4JBZ A;  1NU1 E;  3EWK A;  4ASV A;  3CCJ P;  1RF1 B;  1BGY J;  3H1L D;  1SQQ D;  4GOE A;  4JYC A;  2GUS A;  1FDM A;  2E74 C;  3V2N A;  3GF7 A;  1LTG C;  1SQV J;  3IF4 A;  1JY2 P;  3M06 A;  2B87 A;  5AW3 B;  3WUT A;  2ZFC A;  1M7L A;  3TYY A;  4ZMD A;  1MUU A;  2CPB A;  1J1E C;  3H1H J;  3N7N A;  1URQ C;  4XA4 A;  2KSE A;  2BCC J;  1KIL E;  3U1C A;  1YJW P;  3L72 D;  2A06 G;  1EZV D;  5AVS B;  1GTW A;  2KS1 B;  4RJT A;  1OIP A;  4H44 C;  2WT7 A;  1SFC B;  1PP9 E;  3KPE A;  1S9K E;  1ZOY C;  3L70 G;  1SFC C;  3V2R A;  3RL0 g;  4GOD A;  2WSF J;  1KB9 I;  3Q1M A;  3CXH D;  2YKO A;  1Y47 A;  4DZO A;  1MFZ A;  1ZLL A;  1R8E A;  2WIT A;  1DX7 A;  1BE3 E;  1LGH B;  3H1I J;  5AW2 B;  5TJH A;  1IFP A;  1FZC C;  2YO3 A;  2QM8 A;  1KYO I;  3A3Y B;  1FZB A;  1X0T A;  2PFX A;  4D6T D;  3E1R A;  1DEB A;  4W7Y A;  2ITA A;  3B5N D;  1SQB G;  3H1H D;  1RF0 C;  3GLM A;  1OXZ A;  2BCC D;  5B5E E;  1ZV8 A;  1CZQ A;  4Y99 C;  1X9V A;  2WSE J;  2WSS H;  1LP1 B;  3L75 J;  5CJ4 A;  1YQ4 C;  2JKV A;  3H1K E;  2N9B A;  3L74 E;  3VYI A;  1SQP E;  1PL5 A;  2E75 B;  1VQ7 P;  1P84 D;  4OGQ D;  1H0T B;  1PGP A;  3RGU A;  2AEF A;  1LWU B;  1NAF A;  1YBK A;  1XTC C;  3FWN A;  1SLQ A;  1VF5 B;  1G1J A;  1EZV G;  3H32 B;  1ZRT E;  1PGQ A;  1FC2 C;  5CCG D;  2BEZ F;  2KIK A;  1N7S D;  2AXT H;  2Q6Q A;  2FXM A;  5KLV D;  1NTZ D;  5AW8 B;  4L76 A;  4U3F E;  2W6J H;  5CBO A;  2FFD A;  3L71 E;  3RL0 D;  1M1J B;  4AQR D;  4H13 D;  1QL1 A;  4IL6 E;  4IL6 X;  2B9B A;  3JSV C;  2OYH B;  3TGU D;  1JEK A;  4ZKU A;  3CMA P;  2JEE A;  2Y9Y A;  1K9M Q;  1KN7 A;  1YJN P;  2OYH C;  2K1A A;  1UII A;  3RK2 B;  3M91 A;  1SQQ K;  3P7K A;  3L35 A;  5C39 A;  5APX A;  1LJ2 A;  1GD2 E;  2IZ1 A;  1G2C B;  3A0B E;  1NTK G;  3TNU A;  3HE5 B;  4D6T G;  3GHG A;  2FBW C;  2W6B A;  1SQX E;  4GT1 A;  2NPS B;  4R4M A;  1P84 H;  5AVT B;  3CCV P;  2YO2 A;  1GW3 A;  2M3B A;  2QJK B;  4U7J A;  3H1I E;  1EQ7 A;  3CCM P;  2I8D A;  1W2E A;  1GL2 D;  2YXQ B;  3B4S A;  1OW7 A;  2H7H A;  5TIS H;  2ZXE B;  1MKM A;  3D6Y A;  1TU3 F;  1FJK A;  2A45 I;  2D2C B;  2O01 J;  4AYC A;  5APY A;  1NTM E;  3HD7 B;  1VQ6 P;  1VQP P;  2D2C C;  2FYZ A;  3PHL A;  3WU2 E;  1ZR4 A;  2UWJ E;  5GTH H;  3CCQ P;  2KSJ A;  3AE7 C;  4UB8 E;  1KIL B;  2KB7 P;  4GKG A;  3T97 A;  5KLV G;  2WSE H;  4GDO A;  4H0L C;  1ZR2 A;  1NTZ G;  1Y8A A;  3RBX A;  1KB9 E;  3E1I A;  3CCR P;  2PRR A;  3SFD C;  4WY4 B;  2WPV B;  1NVO A;  1IC2 A;  1JTH B;  4Y28 J;  5APS A;  1OVU A;  3TGU G;  1OVR A;  4WY4 C;  1PGJ A;  1SS1 A;  1E5W A;  1L4A A;  2ZVN B;  2HOD A;  2KZI A;  4PV1 D;  2R3C A;  1KYO E;  3H1J J;  1H89 A;  2OTL P;  1LTJ B;  1J1D B;  5GTI E;  2KXP B;  4PD4 D;  2BAS A;  5AW4 B;  5KAF E;  1PFI A;  1LTJ C;  3CCL P;  1J1D C;  1L0N J;  4N78 E;  1NU1 J;  3R4Y A;  2OTK E;  2WPQ A;  3H6P A;  1BCC D;  3CX5 D;  3W67 A;  3L37 A;  1T3J A;  3Q3D A;  3AE3 C;  5APU A;  1GU4 A;  3EFG A;  1USE A;  5AVZ B;  1T8Z A;  1S4X A;  3CWB G;  4DT0 A;  5KLV K;  1QLE D;  1NTZ K;  4HH2 A;  1N7L A;  1MZ9 A;  4BRY B;  3I56 P;  3A0H H;  3U1A A;  4DOJ A;  3KZI H;  3IFM A;  3JCU E;  1IFD A;  1PP9 J;  3AE9 C;  1Q86 Q;  1A02 J;  5AVX B;  2WZ7 A;  1Q7Y Q;  1EZV I;  3BCC D;  2AXC A;  2V7Q H;  1N2D C;  3ABV C;  2C9N Y;  1L0N D;  1Y9B A;  1LT9 A;  1L0L E;  2LXC B;  1IFI A;  2O01 H;  2Y0C A;  2P67 A;  1PPJ E;  2ZYD A;  2OTJ P;  1BDC A;  3BVH A;  3CX5 H;  1BE3 J;  3QH9 A;  5H2F E;  4IFM A;  1AQ5 A;  3B5N B;  2ZJS E;  3CD6 P;  1Q81 Q;  1HGV A;  4NPE A;  3HUS A;  2R44 A;  1CI6 A;  3B5N C;  2OYI A;  2IYO A;  3KYQ A;  4PJ0 E;  5AW9 B;  1BCC G;  2Z5I A;  2LXB A;  5M1B A;  3JC2 2;  1LTA C;  1VQ5 P;  1RY3 A;  1HJB A;  3PLN A;  2SPZ A;  1S9K D;  1JCD A;  2FYU D;  2M5A B;  1N86 A;  1FAV A;  1PGO A;  3H1K J;  3ZDM A;  4OGQ B;  1NJI Q;  1LTS C;  3L74 J;  3M9B A;  1SQP J;  3RK3 D;  3VMX A;  2E74 B;  5AVR B;  3O6Q A;  4OGQ C;  3PRJ A;  4HJG H;  3W68 A;  3MGN A;  3HTK A;  1EDJ A;  1P84 I;  1N7S B;  3L73 J;  2DW3 A;  3D6Z A;  2A06 E;  5CCG C;  2A45 G;  1J1E B;  2JJL A;  4HKZ H;  3G6E P;  1N7S C;  3RL0 B;  1URQ B;  1D7M A;  1EC5 A;  2QSI A;  1BSN A;  3BCC G;  4U3F J;  4EI2 A;  3L70 E;  3L71 J;  3RL0 C;  1ZP0 C;  1ZXG A;  4H13 C;  2M0B A;  3B71 A;  3CC2 P;  2KUB A;  4H44 B;  1IK7 A;  1R5L A;  5B66 E;  1IFJ A;  2QG4 A;  4C7N A;  2N1T D;  3CC4 P;  1KQS O;  3Q5P A;  3VP8 A;  4DJG A;  1H88 A;  4NPD A;  1NKN A;  1JM0 A;  3U59 A;  4IOI H;  2JWD A;  5AVU B;  2E5Y A;  5BU5 A;  5AW7 B;  1VQL P;  1LT9 C;  1U7M A;  2FYN C;  1SQX J;  2KLV A;  3SFE C;  3L74 D;  1BGY D;  1SQB E;  2FKW B;  2Y0E A;  4RKU J;  3AE4 C;  1RE4 A;  1IK9 A;  1EXI A;  4LC1 A;  1G1I A;  4XE5 B;  1FZC B;  2RMZ A;  1JY2 N;  1NOH A;  1SQV D;  2ZAE B;  3S9O A;  2K9J A;  1GL2 B;  2ZXX A;  3TF5 A;  3HUS C;  3NTN A;  1KQL A;  3G9R A;  1RHZ B;  1OVV A;  1GL2 C;  2FYU G;  2OYI C;  1SP4 A;  3L71 D;  1YTZ I;  1L4A D;  3AEA C;  3H1L G;  4Y99 B;  2XV5 A;  1JMB A;  1SQQ G;  2R3S A;  1N73 A;  3NFQ A;  5KJ7 C;  2P2U A;  1NTM J;  1BSH A;  3VMZ A;  1VQ9 P;  2M8R A;  2E76 D;  1L0N K;  3PTZ A;  2XNX A;  4W80 A;  1LTB C;  4UB6 E;  1ZN5 A;  5B5E H;  1E79 H;  1FOS F;  1EZV E;  2IBZ D;  2CK3 H;  3N4X A;  4ZKP A;  2LR2 A;  3KQG A;  3M9H A;  2G8Y A;  4ZNC A;  2B87 B;  1JNM A;  1PZQ A;  3AE5 C;  3CCU P;  1NGM B;  3CXH E;  1IJD B;  3L72 G;  1Q2N A;  3L73 E;  1VQK P;  1HF9 A;  4DCK A;  3VMA A;  1RQV A;  3H1I D;  2HYN A;  2GM4 A;  2ZT9 D;  2KZJ A;  5APQ A;  4PV1 C;  2JO1 A; 
#chains in the Genus database with same CATH homology
 3BCC J;  3L74 J;  3H1I J;  1BGY J;  4D6T J;  1SQP J;  5KLV J;  1PP9 J;  1KB9 I;  1NTZ J;  1SQX J;  2FYU J;  3L70 J;  1EZV I;  1KYO I;  1NTM J;  1SQB J;  2IBZ I;  3CX5 I;  3CXH I;  3H1J J;  4U3F J;  1L0N J;  4PD4 I;  3H1H J;  1BCC J;  3L71 J;  1SQV J;  1BE3 J;  1NU1 J;  3L72 J;  1P84 I;  3CWB J;  2BCC J;  3H1L J;  1SQQ J;  3H1K J;  3L73 J;  3TGU J;  3L75 J;  1L0L J;  1NTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...