1NTZJ

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1ntzJ00
1NU1J 2FYUJ 3TGUJ 1KYOI 5KLVJ 1BCCJ 1KB9I 3L70J 1SQXJ 1SQVJ 3BCCJ 1L0NJ 2IBZI 1EZVI 1SQPJ 1L0LJ 1BE3J 3H1IJ 4U3FJ 1PP9J 1NTKJ 4PD4I 3CWBJ 3L72J 3CX5I 3H1KJ 1NTZJ 3L71J 1BGYJ 3CXHI 3H1HJ 3L73J 3L75J 1SQBJ 4D6TJ 1SQQJ 1P84I 3H1JJ 2BCCJ 1NTMJ 3L74J 3H1LJ
chains in the Genus database with same CATH superfamily
3H1ID 4H44D 3AE7C 1RY3A 5AW7B 3SWKA 4WB4A 1IZNB 2OGUA 2WWWA 3A7OA 1KC8Q 2OYIC 1VQ7P 3H32A 2M5AA 2VRSA 3CL3D 1YQ3C 1SQQK 3U1CA 3QH9A 2W90A 3O6QA 1DD4A 2IBZI 3LW5H 4GDOA 3U59A 2P67A 1IFNA 2AEJA 2KP8A 3HRNA 2R5BA 2AEMA 5CBOA 3AEGC 1EXIA 2FXPA 2YXQB 2Y9ZA 1HJBA 1HVVA 1FJPA 1LGHB 2N1TC 2E76B 1DX7A 3Q5SA 5APXA 1QL1A 4YXDC 4EI2A 2KI7B 3L75E 1X0TA 1R8EA 3H1LJ 4L75A 5KLVG 4UB8E 3BCCJ 2A06G 2R5DA 1VDFA 3EFFK 4R4LA 1D7MA 3RBZA 2KZJA 2W8ZA 1NTZE 3H1HJ 1EZVG 1EDLA 2WT7B 1Q86Q 1BCCJ 1KB9I 1N7SB 3B5NA 4YPCA 1IFPA 1U7JA 2WSEH 1GW4A 5KAFE 1PPJE 1E5WA 3V2QA 1AQ5A 2BCCD 2XV5A 2Y0DA 2QJPB 4B86A 4JQ0D 4H44B 3H25A 2WSFJ 1NKNA 3MGNA 1J1EB 3AE4C 1DEEG 3L75D 3FX0A 2Y0CA 1M1KQ 3H1KG 5CJ4A 2KS1A 1VPCA 2GUVA 4H13C 3C9IA 1KV4A 4BRYA 2G8YA 3M9BA 4AQRD 1USEA 3AE3C 3EQ2A 1L0NG 2M5AB 2JR8A 2QRXA 1L0LE 2OYHA 3H1IJ 1NTZD 1J1DC 1FJKA 3WUVA 1NGMB 3TSIA 1PGPA 3MD0A 1SQBE 2FYUK 1KMIZ 3V2RA 1Q90D 3PLNA 1CSBA 3Q5PA 1PPJD 2RKLA 4DCKA 3CCEP 2G3AA 1RF0A 3CXHH 5AVYB 1L4AC 3GW6A 1PGQA 1USDA 3H1JG 2E75D 4RKUJ 2LXCB 1T6AA 1SQVG 1BDDA 1VQKP 2Q7CA 1PP9G 3M9HA 2JP3A 5L8RJ 1LTJC 5B66H 2W83C 1L0LD 4I2LC 1MFTA 3VMZA 1LT9A 3E7KA 1GMJA 5AW0B 1SQBD 2MJZA 1IFMA 3KPEA 1OFCX 2KYVA 2E76C 4MN4C 4DOJA 2E43A 1N73B 1LTSC 5CHXA 2A06E 1IFDA 3USSA 3VOPA 2D2CC 2GUSA 3PH0A 1P84E 1NYHA 1QX8A 3BATA 1P84I 3P8CE 3CCRP 1FZCA 1N8RQ 3AEFC 3SSUA 1Q81Q 3ITKA 2R32A 3MUDA 2K1AA 3D6ZA 2C0WA 4U3FE 3JCUH 2WTYA 3K5BA 2V7QJ 2HLOA 2IZ0A 3V4WA 1SS1A 4L73A 1FDIA 3GG2A 3L75J 1NO4A 3MHVA 4JYCA 3GLMA 1NTMG 2QJPC 1DIPA 2OYHB 1HWTC 1RH5B 4H44C 2ZT9C 3VMAA 4WVZA 2XDJA 4AYCA 2IFMA 2R3CA 2JDIH 1LP1B 1LNQA 1IK7A 1CI6B 3MTUE 1LWUA 3GHGC 1NTZJ 2E75B 1NKZB 5KLVD 4OGQB 2LXBA 2A06D 2ZJSE 1ZW0A 4ZMDA 2A45I 3CCVP 4QMAA 2KNCA 1L0NE 1YJNP 3AEBC 1BE3E 3N4XA 4I7ZC 1EZVD 3P8CD 5KAIH 1FS0E 1U7MA 4EIJA 2K88A 1PV3A 3L73E 4D6TG 2NPSA 2AXTE 3OA7A 4U3FD 2HPCB 4IFDK 3NMDA 2K37A 5AVWB 5CJ0A 3A2AA 3ABVC 2KXPB 1FAVA 1LTIC 1Q7YQ 3G3ZA 2YXRB 2QE7H 2ZYAA 4KJMA 2NPSD 5M1BA 1NU1G 1ZR4A 1LT9B 3TK1A 1SQVE 3H1KD 3AE2C 1PP9E 3SWFA 4RESB 3Q5RA 1NTKE 3GF7A 3L72E 1VL2A 1SQBJ 1QEXA 3HD7D 5CCHD 2YKOA 2OTLP 1L0ND 2Q9IA 1L2PA 2P7JA 2BEZF 2O3JA 1FZAA 3U1AA 1PIXA 1YJWP 2L5GB 1L4AD 4KHXA 3PP5A 2KOGA 2RH0A 1FZCB 1LTBC 3GF3A 4PV1B 1JOCA 1LTAC 1KZUB 2K3RA 3HE4B 1SLQA 1N73C 2W27A 3OAKA 4YXWH 1SQXE 5APTA 3II6A 1QGKB 1G1JA 3HUSA 1OW7A 1AJYA 2AXCA 2ZFCA 4C7NA 5KKZB 1SQVD 1ZV8A 1RF1A 2QM7A 1PP9D 1NWQA 4PD4E 1NTKD 3G9RA 1K9MQ 5TISE 3L72D 1BDCA 2WSCH 1N86A 1OWAA 2KZIA 1AV1A 2E76D 2ZYDA 3VTPC 2KNCB 3L74G 2OYHC 4IL6H 1M56D 3G4SP 2DW3A 3WUTA 2O01J 2D2CD 2NPSB 1RE4C 1SQBK 3L35A 3CMAP 3CCMP 2NZ2A 1SQXD 2E75C 4XA4A 4OGQC 1SP4A 4DT0A 1J1DB 1SQPK 3EWKA 1H89A 2K9JA 4K3AA 4U3FJ 1HJ0A 2FYNB 2WITA 1LT1A 3HD7B 2QJYB 4LLHA 3VYIA 4UB6H 1AVOA 4PD4D 3G6EP 4IFFA 5AVXB 4D6TE 3W68A 4WY4A 1NJIQ 2H8PD 2ZT9D 4TT3H 1S1CX 1ZR2A 1URQD 5BU5A 1L4AB 1FZEA 2KSJA 2JWAA 3CCJP 3KDPB 5GTHH 1RE3A 4JPZB 3P8MC 2O1KA 1NVOA 1H0TA 1ZRTE 1L0NJ 5TJHA 1LT9C 1BE3J 3O8ZA 3CCUP 1LTJB 5BU8B 3L71G 3L73J 2HODA 3Q3DA 2BCCE 2QM8A 1MFZA 5AW3B 1IFJA 2JEEA 3HUSB 3HTKA 3AE9C 5APSA 2Z5HA 4D6TD 3IR9A 3TYYA 1JCDA 3TDKA 2JJLA 1JMBA 1SQQG 1YTZI 1T3UA 1FZCC 2PAJA 4PV1C 1SQVJ 1N2DC 3IF4A 2ZXXA 1NAFA 2D2CB 1NTKJ 3B71A 2HFED 2V7QH 3L72J 3JC22 2HG5D 3ZDMA 1ZRTD 5H2FE 1JB0J 3TGUG 5AVUB 5KKZC 2YMYA 1G2CA 2KK7A 1LWUC 1IO4A 1OVVA 1BGYE 2V4HA 1KB9H 1IC2A 2ZT9B 3PJSK 3NXSA 2M0BA 3L74E 2FYZA 1L0NK 1URQB 3RK3E 3B5ND 1SQXJ 3P32A 3V2PA 4A7PA 1JY2N 3GHGB 4CPGA 2FXMA 5CMZA 5KAFH 1OVRA 2YMKA 1BSHA 4Z1MH 2NPSC 1EQ7A 4HKZH 1SVFA 2QG4A 3CMEP 3A0HH 4O9BA 3H32B 4AUWA 4I7ZB 3R2PA 1PL5A 1GU5A 2QIWA 2I1KA 2FYNC 1RQUA 5CCHC 4ASWA 3HD7C 3O6QB 2QJYC 3BASA 1DEBA 3VP9A 1Z56A 1T8ZA 2H88C 2H89C 1NTKK 4I1LA 4GIFA 1MZ9A 2Q3EA 3CXHE 1BGYD 3M0AA 3A0BE 3L74D 2I8DA 5AW8B 3RK3D 1PZQA 2W6JH 5AVSB 1K8AQ 4OGQD 1ZN5A 2OTKE 1OIPA 2B9BA 3FWLA 2R3SA 2IFNA 4BWNA 2KLVA 1HBWA 3E1IA 1NHLA 3CLQA 1YITP 1VQ6P 3CC7P 4D6TJ 1CW5A 3C1LA 3I5CA 1SQXK 2FYUG 1H88A 4KT0J 1KQGB 2LR2A 4I6MC 1MKMA 2YO3A 1SFCA 4GODA 3AE5C 2OYIA 3HUSC 1NH4A 3BRVB 3H1HG 3B5NB 1RF1C 4N6JA 1SQQE 1G2CB 3CXHD 1W2EA 1BCCG 1AA0A 5KLVE 4L74A 2FBWC 1UIIA 1QLED 5E79E 1R5LA 5K5GB 3F5HA 3IN6A 5KJ7A 2HR3A 1LJ2A 3S1KA 1JM0A 3FWNA 1UIXA 5AW5B 1HH0A 2BCCJ 1EZVE 2M8RA 3A3YB 1AVYA 3TGUE 3WUUA 2FFDA 1FZGA 4RJTA 1EZVI 1S5LX 2FXOA 3V5BA 2KS1B 4YTPC 2N1TA 2WPSA 1X22A 1P84H 2Z5IA 4Y99C 1KYOE 2W6BA 2Y0EA 4BRYB 4GKGA 1R5SA 2Y9YA 3QWOC 1KYOI 4PV1D 3CX5E 3CI9A 4XE5B 4IOIH 1URQC 3D6YA 3RK3B 4DJGA 1SQQD 1VQ9P 3H1KE 2YIUC 1JY3P 3KHUA 2ZVOB 3FXEA 1OX3A 2C0XA 2RMZA 3Q2YA 1WRGA 2OQQA 5KAIE 3IFMA 5CCGA 1FZBA 3FGAD 3TGUD 1BGYJ 1RE3C 2A45H 4HYTB 1OXZA 5APWA 3L74J 4R4MA 1IJDB 5APUA 3KZIE 1VQ4P 4BXLA 1KYOD 2PRRA 3AE8C 3CCLP 3CX5D 2CPBA 3H1JE 2AXTH 2WZ7A 1VQ8P 2PGDA 3WU2E 1KILA 1L0LJ 2C9NY 2B87A 4K35A 5AVTB 2IBZG 4H0LC 1YTZT 1WMKA 4PJ0H 3M06A 2FYUE 3CC4P 2XNXA 2O01N 4EYYQ 1NTZK 5AVRB 2YKPA 1QVGO 1RQVA 1S4XA 2N9BA 3WMM0 3KQGA 1Y9BA 4HH2A 3FXDA 1VQOP 1FC2C 2ZAEB 1AQTA 3B4SA 3B5NC 3L70G 3D71A 4NPDA 4WWIA 1EXJA 3H1JD 2YO2A 2M3EA 2KLUA 2NRGA 4Y28J 3C8VA 5AVVB 2WSFH 1S5LE 1LWUB 1H8AA 2LKMA 2OARA 5KLIB 4PD4I 2H43A 5AW9B 2FYUD 4OWFA 3L36A 1SQQJ 1NTME 2SPZA 3UIAA 5KLVJ 3CD6P 1L0LK 2J58A 1JUNA 2O1JA 2Q3IA 2I1JA 2GM4A 3CWBG 3M0DA 3OW2O 1EDIA 3RK3C 1A02J 3LIDA 1KFNA 1FZFA 4ASVA 5GTIH 2WT7A 1FOSE 2ZXEB 1N7SA 1RF0C 1K04A 3TNUA 3I55P 4UB6E 3AE6C 1XTCC 4RO0A 1MUUA 4U7JA 1NAYA 5AVZB 3PHLA 1KILB 1JMMA 2XU6A 3LIEA 3RL0g 2Z4EA 3VMXA 5B5EH 2M3BA 3A5TA 2FKWB 2QJKB 2KUBA 1NTMD 3H1KJ 5GTHE 1QL2A 1T2KD 2OTJP 2PP6A 4WY4D 1Y8AA 1TU3F 1NU1E 2CK3H 4XFJA 3PRJA 1SFCC 1SQPG 3L37A 3IAOA 1A02F 4HJGH 5AW2B 1XTGB 2IBZE 1X9VA 3JSVC 5KLVK 4EDFA 2YNYA 3RL0C 3W67A 1U57A 5KJ7C 5DJTB 4C7NB 1RF1B 5APVA 2J5UA 2RN0A 3H1JJ 4W7ZA 4C46A 3AEDC 1GK6A 2FFDC 2YKQA 4ZKUA 3L70E 1S72P 3VMYA 1Y47A 3MUDC 1GL2A 1KFMA 1PP9J 2P58A 1KD1Q 2WPVB 1YIJP 1JCCA 3E1RA 1NU1D 2Q6QA 1VQ5P 4H0LD 2FYUJ 1N7LA 1KQFB 4UB8H 2P1JA 1GL2D 3CCQP 3F89A 2IBZD 3RK2D 4Y99B 3T97A 5KLIC 1JNMA 1KB9E 2BASA 5H2FH 2K9JB 2QA4P 1N73A 3TNUB 1HUCA 1FU1A 3KXDA 4U3FG 2WMMA 5CCGC 4HB1A 3CCSP 3CWBE 2YIUB 3RGUA 4WY4B 1MV8A 3L70D 1M57D 5AW4B 1K73Q 3A0HE 4WBAA 3NTNA 2WSCJ 1G1IA 3SFEC 1OW8A 1T3JA 2A45G 1HTLC 3AECC 3B8EB 1M1JA 3BVHA 1EDJA 3AEAC 4DZOA 1H0TB 1NTMJ 1VF5D 2Q1KA 1SQVK 3HE5A 1KILC 2H7HA 1BE3G 3RBXA 3SWYA 1KB9D 4JYBA 1KQLA 2HODB 1KORA 1LP1A 1RE4A 1YI2P 1WT6A 5CBNA 1DH3A 1JY3O 1CI6A 3L73G 3CXHI 2E5TA 4JF7A 2QJKC 3HTKB 3CWBD 2JO1A 1SQPE 3CPWO 1J2JB 1VQPP 3A0BH 5B66E 1ZMEC 4NPFX 1OZHA 2QVAA 1FBMA 1NOHA 4H0LB 4LC1A 3L71E 1YHQP 1KQSO 3I56P 2KB7P 3H1LG 1GL2B 2E74D 1CZQA 3BCCG 1K05A 3RK2B 1YBKA 1W5CE 1PGJA 2POHA 1NTKG 2HPCA 3OJAB 3L72G 2CPSA 3CC2P 1S3JA 5AW1B 3R4YA 2MKVA 1NU1J 2WVRA 3LW5J 1LTTC 4OVNF 1ZLLA 3T97B 1OVUA 1SFCD 4N78E 1JTHA 1JEKA 1HF9A 1FDMA 1GW3A 2BEQD 1NTMK 1FOSF 1SQPD 1M7LA 1SQXG 3MZWB 2AEFA 1Q2NA 3RL0D 3D70A 3JCUE 3L71D 5E79H 4JBZA 3M0DC 5KJ7D 2IX7C 1VF5B 2O01H 2IPPA 2GA1A 4L76A 3S9OA 2PFXA 3L70J 1N7SC 3HE4A 3H1IG 1M1JB 4IL6X 2P2UA 1S9KE 4ZNCA 2N1TD 1X8YA 4M3LA 4GOFA 3CX5I 1T2KC 5APYA 2FY8A 1KYOH 4WY4C 3HE5B 4GT1A 3NFQA 4N78D 3AE1C 5APQA 1ZOYC 3S4RA 3EFGA 1PFIA 3CX5H 3VN0A 2WSEJ 5DJUB 2P10A 1J1EC 2XZRA 1KILE 1GTWA 2K9YA 2E74B 1NU1K 3KYQA 3PTZA 1GD2E 1IK9A 2UWJE 1EC5A 1P84D 1KN7A 4IFMA 3H6PA 3VP8A 2IYPA 3BRTB 2OYOA 5CCGD 3CWBJ 5C39A 4W7YA 4LGDE 4C7RA 1DD3A 1SFCB 2E42A 1S9KD 2OYIB 1GDTA 3KZIH 4N3YB 1Q82Q 1AFOA 2WPRA 4GOEA 4PJ0E 1HGVA 3HD7A 4H13D 5CCHA 3V6IA 3H1LE 3RL0B 3M9QA 4EOTA 1JY2O 3N7NA 1JTHB 2L91A 3BCCE 1GL2C 1S2EA 3WU2H 1KILD 1ZP0C 2B88A 2QEXP 3MIWA 3RK2C 1GK4A 3MP7B 1L4AA 1VQMP 1W2BO 2ZVNB 3H1HE 4NPEA 2FFDB 1VQLP 2BCCG 1YYCA 1BE3D 2IYOA 3V4QA 1X79B 3AEEC 5AW6B 1FDOA 1BCCE 1IFIA 2B89A 2IZ1A 2N1TB 2QSIA 1SQPJ 3TF5A 3L73D 2XKMA 2WSSH 3P7KA 3L71J 1LTJA 2XNDH 3L75G 3GMAA 2W6AA 4ZKPA 5BVZA 1EDKA 2JKVA 4TLFA 1VQNP 1HGZA 2C9LY 4W80A 1E79H 3SFDC 1YQ4C 3H1LD 1NTZG 2IDBA 1JY3N 1QVFO 3BCCD 1VF5C 2E5YA 5KTBA 4PD4H 1S5LH 4IL6E 1YJ9P 1PGOA 5TISH 3H1IE 1FE6A 3H1HD 1PPJG 5AVQB 1M1JC 1BGYG 1ZXGA 1BCCD 1BSNA 2WPQA 3TGUJ 5GTIE 1OW6A 3M91A 3G71P 2KSEA 1JO5A 1OMIA 2ITAA 2R44A 4H13B 3Q1MA 5EFWB 2HYNA 2KIKA 1GU4A 2E74C 1RHZB 3L4FA 2B87B 1L0LG 2WQYC 5B5EE 1JY2P 1URQA 1M90Q 1N7SD 2JWDA 1KTMA 2N9YB 2ZYGA 1M8OB 3GHGA 3V2NA 1GZLA 2J59M 1LTGC 1SQBG 2Q5UA 4OH8B
chains in the Genus database with same CATH topology
1NU1J 2FYUJ 3TGUJ 1KYOI 5KLVJ 1BCCJ 1KB9I 3L70J 1SQXJ 1SQVJ 3BCCJ 1L0NJ 2IBZI 1EZVI 1SQPJ 1L0LJ 1BE3J 3H1IJ 4U3FJ 1PP9J 1NTKJ 4PD4I 3CWBJ 3L72J 3CX5I 3H1KJ 1NTZJ 3L71J 1BGYJ 3CXHI 3H1HJ 3L73J 3L75J 1SQBJ 4D6TJ 1SQQJ 1P84I 3H1JJ 2BCCJ 1NTMJ 3L74J 3H1LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 J;  2FYU J;  3TGU J;  1KYO I;  5KLV J;  1BCC J;  1KB9 I;  3L70 J;  1SQX J;  1SQV J;  3BCC J;  1L0N J;  2IBZ I;  1EZV I;  1SQP J;  1L0L J;  1BE3 J;  3H1I J;  4U3F J;  1PP9 J;  1NTK J;  4PD4 I;  3CWB J;  3L72 J;  3CX5 I;  3H1K J;  1NTZ J;  3L71 J;  1BGY J;  3CXH I;  3H1H J;  3L73 J;  3L75 J;  1SQB J;  4D6T J;  1SQQ J;  1P84 I;  3H1J J;  2BCC J;  1NTM J;  3L74 J;  3H1L J; 
#chains in the Genus database with same CATH topology
 3H1I D;  4H44 D;  3AE7 C;  1RY3 A;  5AW7 B;  3SWK A;  4WB4 A;  1IZN B;  2OGU A;  2WWW A;  3A7O A;  1KC8 Q;  2OYI C;  1VQ7 P;  3H32 A;  2M5A A;  2VRS A;  3CL3 D;  1YQ3 C;  1SQQ K;  3U1C A;  3QH9 A;  2W90 A;  3O6Q A;  1DD4 A;  2IBZ I;  3LW5 H;  4GDO A;  3U59 A;  2P67 A;  1IFN A;  2AEJ A;  2KP8 A;  3HRN A;  2R5B A;  2AEM A;  5CBO A;  3AEG C;  1EXI A;  2FXP A;  2YXQ B;  2Y9Z A;  1HJB A;  1HVV A;  1FJP A;  1LGH B;  2N1T C;  2E76 B;  1DX7 A;  3Q5S A;  5APX A;  1QL1 A;  4YXD C;  4EI2 A;  2KI7 B;  3L75 E;  1X0T A;  1R8E A;  3H1L J;  4L75 A;  5KLV G;  4UB8 E;  3BCC J;  2A06 G;  2R5D A;  1VDF A;  3EFF K;  4R4L A;  1D7M A;  3RBZ A;  2KZJ A;  2W8Z A;  1NTZ E;  3H1H J;  1EZV G;  1EDL A;  2WT7 B;  1Q86 Q;  1BCC J;  1KB9 I;  1N7S B;  3B5N A;  4YPC A;  1IFP A;  1U7J A;  2WSE H;  1GW4 A;  5KAF E;  1PPJ E;  1E5W A;  3V2Q A;  1AQ5 A;  2BCC D;  2XV5 A;  2Y0D A;  2QJP B;  4B86 A;  4JQ0 D;  4H44 B;  3H25 A;  2WSF J;  1NKN A;  3MGN A;  1J1E B;  3AE4 C;  1DEE G;  3L75 D;  3FX0 A;  2Y0C A;  1M1K Q;  3H1K G;  5CJ4 A;  2KS1 A;  1VPC A;  2GUV A;  4H13 C;  3C9I A;  1KV4 A;  4BRY A;  2G8Y A;  3M9B A;  4AQR D;  1USE A;  3AE3 C;  3EQ2 A;  1L0N G;  2M5A B;  2JR8 A;  2QRX A;  1L0L E;  2OYH A;  3H1I J;  1NTZ D;  1J1D C;  1FJK A;  3WUV A;  1NGM B;  3TSI A;  1PGP A;  3MD0 A;  1SQB E;  2FYU K;  1KMI Z;  3V2R A;  1Q90 D;  3PLN A;  1CSB A;  3Q5P A;  1PPJ D;  2RKL A;  4DCK A;  3CCE P;  2G3A A;  1RF0 A;  3CXH H;  5AVY B;  1L4A C;  3GW6 A;  1PGQ A;  1USD A;  3H1J G;  2E75 D;  4RKU J;  2LXC B;  1T6A A;  1SQV G;  1BDD A;  1VQK P;  2Q7C A;  1PP9 G;  3M9H A;  2JP3 A;  5L8R J;  1LTJ C;  5B66 H;  2W83 C;  1L0L D;  4I2L C;  1MFT A;  3VMZ A;  1LT9 A;  3E7K A;  1GMJ A;  5AW0 B;  1SQB D;  2MJZ A;  1IFM A;  3KPE A;  1OFC X;  2KYV A;  2E76 C;  4MN4 C;  4DOJ A;  2E43 A;  1N73 B;  1LTS C;  5CHX A;  2A06 E;  1IFD A;  3USS A;  3VOP A;  2D2C C;  2GUS A;  3PH0 A;  1P84 E;  1NYH A;  1QX8 A;  3BAT A;  1P84 I;  3P8C E;  3CCR P;  1FZC A;  1N8R Q;  3AEF C;  3SSU A;  1Q81 Q;  3ITK A;  2R32 A;  3MUD A;  2K1A A;  3D6Z A;  2C0W A;  4U3F E;  3JCU H;  2WTY A;  3K5B A;  2V7Q J;  2HLO A;  2IZ0 A;  3V4W A;  1SS1 A;  4L73 A;  1FDI A;  3GG2 A;  3L75 J;  1NO4 A;  3MHV A;  4JYC A;  3GLM A;  1NTM G;  2QJP C;  1DIP A;  2OYH B;  1HWT C;  1RH5 B;  4H44 C;  2ZT9 C;  3VMA A;  4WVZ A;  2XDJ A;  4AYC A;  2IFM A;  2R3C A;  2JDI H;  1LP1 B;  1LNQ A;  1IK7 A;  1CI6 B;  3MTU E;  1LWU A;  3GHG C;  1NTZ J;  2E75 B;  1NKZ B;  5KLV D;  4OGQ B;  2LXB A;  2A06 D;  2ZJS E;  1ZW0 A;  4ZMD A;  2A45 I;  3CCV P;  4QMA A;  2KNC A;  1L0N E;  1YJN P;  3AEB C;  1BE3 E;  3N4X A;  4I7Z C;  1EZV D;  3P8C D;  5KAI H;  1FS0 E;  1U7M A;  4EIJ A;  2K88 A;  1PV3 A;  3L73 E;  4D6T G;  2NPS A;  2AXT E;  3OA7 A;  4U3F D;  2HPC B;  4IFD K;  3NMD A;  2K37 A;  5AVW B;  5CJ0 A;  3A2A A;  3ABV C;  2KXP B;  1FAV A;  1LTI C;  1Q7Y Q;  3G3Z A;  2YXR B;  2QE7 H;  2ZYA A;  4KJM A;  2NPS D;  5M1B A;  1NU1 G;  1ZR4 A;  1LT9 B;  3TK1 A;  1SQV E;  3H1K D;  3AE2 C;  1PP9 E;  3SWF A;  4RES B;  3Q5R A;  1NTK E;  3GF7 A;  3L72 E;  1VL2 A;  1SQB J;  1QEX A;  3HD7 D;  5CCH D;  2YKO A;  2OTL P;  1L0N D;  2Q9I A;  1L2P A;  2P7J A;  2BEZ F;  2O3J A;  1FZA A;  3U1A A;  1PIX A;  1YJW P;  2L5G B;  1L4A D;  4KHX A;  3PP5 A;  2KOG A;  2RH0 A;  1FZC B;  1LTB C;  3GF3 A;  4PV1 B;  1JOC A;  1LTA C;  1KZU B;  2K3R A;  3HE4 B;  1SLQ A;  1N73 C;  2W27 A;  3OAK A;  4YXW H;  1SQX E;  5APT A;  3II6 A;  1QGK B;  1G1J A;  3HUS A;  1OW7 A;  1AJY A;  2AXC A;  2ZFC A;  4C7N A;  5KKZ B;  1SQV D;  1ZV8 A;  1RF1 A;  2QM7 A;  1PP9 D;  1NWQ A;  4PD4 E;  1NTK D;  3G9R A;  1K9M Q;  5TIS E;  3L72 D;  1BDC A;  2WSC H;  1N86 A;  1OWA A;  2KZI A;  1AV1 A;  2E76 D;  2ZYD A;  3VTP C;  2KNC B;  3L74 G;  2OYH C;  4IL6 H;  1M56 D;  3G4S P;  2DW3 A;  3WUT A;  2O01 J;  2D2C D;  2NPS B;  1RE4 C;  1SQB K;  3L35 A;  3CMA P;  3CCM P;  2NZ2 A;  1SQX D;  2E75 C;  4XA4 A;  4OGQ C;  1SP4 A;  4DT0 A;  1J1D B;  1SQP K;  3EWK A;  1H89 A;  2K9J A;  4K3A A;  4U3F J;  1HJ0 A;  2FYN B;  2WIT A;  1LT1 A;  3HD7 B;  2QJY B;  4LLH A;  3VYI A;  4UB6 H;  1AVO A;  4PD4 D;  3G6E P;  4IFF A;  5AVX B;  4D6T E;  3W68 A;  4WY4 A;  1NJI Q;  2H8P D;  2ZT9 D;  4TT3 H;  1S1C X;  1ZR2 A;  1URQ D;  5BU5 A;  1L4A B;  1FZE A;  2KSJ A;  2JWA A;  3CCJ P;  3KDP B;  5GTH H;  1RE3 A;  4JPZ B;  3P8M C;  2O1K A;  1NVO A;  1H0T A;  1ZRT E;  1L0N J;  5TJH A;  1LT9 C;  1BE3 J;  3O8Z A;  3CCU P;  1LTJ B;  5BU8 B;  3L71 G;  3L73 J;  2HOD A;  3Q3D A;  2BCC E;  2QM8 A;  1MFZ A;  5AW3 B;  1IFJ A;  2JEE A;  3HUS B;  3HTK A;  3AE9 C;  5APS A;  2Z5H A;  4D6T D;  3IR9 A;  3TYY A;  1JCD A;  3TDK A;  2JJL A;  1JMB A;  1SQQ G;  1YTZ I;  1T3U A;  1FZC C;  2PAJ A;  4PV1 C;  1SQV J;  1N2D C;  3IF4 A;  2ZXX A;  1NAF A;  2D2C B;  1NTK J;  3B71 A;  2HFE D;  2V7Q H;  3L72 J;  3JC2 2;  2HG5 D;  3ZDM A;  1ZRT D;  5H2F E;  1JB0 J;  3TGU G;  5AVU B;  5KKZ C;  2YMY A;  1G2C A;  2KK7 A;  1LWU C;  1IO4 A;  1OVV A;  1BGY E;  2V4H A;  1KB9 H;  1IC2 A;  2ZT9 B;  3PJS K;  3NXS A;  2M0B A;  3L74 E;  2FYZ A;  1L0N K;  1URQ B;  3RK3 E;  3B5N D;  1SQX J;  3P32 A;  3V2P A;  4A7P A;  1JY2 N;  3GHG B;  4CPG A;  2FXM A;  5CMZ A;  5KAF H;  1OVR A;  2YMK A;  1BSH A;  4Z1M H;  2NPS C;  1EQ7 A;  4HKZ H;  1SVF A;  2QG4 A;  3CME P;  3A0H H;  4O9B A;  3H32 B;  4AUW A;  4I7Z B;  3R2P A;  1PL5 A;  1GU5 A;  2QIW A;  2I1K A;  2FYN C;  1RQU A;  5CCH C;  4ASW A;  3HD7 C;  3O6Q B;  2QJY C;  3BAS A;  1DEB A;  3VP9 A;  1Z56 A;  1T8Z A;  2H88 C;  2H89 C;  1NTK K;  4I1L A;  4GIF A;  1MZ9 A;  2Q3E A;  3CXH E;  1BGY D;  3M0A A;  3A0B E;  3L74 D;  2I8D A;  5AW8 B;  3RK3 D;  1PZQ A;  2W6J H;  5AVS B;  1K8A Q;  4OGQ D;  1ZN5 A;  2OTK E;  1OIP A;  2B9B A;  3FWL A;  2R3S A;  2IFN A;  4BWN A;  2KLV A;  1HBW A;  3E1I A;  1NHL A;  3CLQ A;  1YIT P;  1VQ6 P;  3CC7 P;  4D6T J;  1CW5 A;  3C1L A;  3I5C A;  1SQX K;  2FYU G;  1H88 A;  4KT0 J;  1KQG B;  2LR2 A;  4I6M C;  1MKM A;  2YO3 A;  1SFC A;  4GOD A;  3AE5 C;  2OYI A;  3HUS C;  1NH4 A;  3BRV B;  3H1H G;  3B5N B;  1RF1 C;  4N6J A;  1SQQ E;  1G2C B;  3CXH D;  1W2E A;  1BCC G;  1AA0 A;  5KLV E;  4L74 A;  2FBW C;  1UII A;  1QLE D;  5E79 E;  1R5L A;  5K5G B;  3F5H A;  3IN6 A;  5KJ7 A;  2HR3 A;  1LJ2 A;  3S1K A;  1JM0 A;  3FWN A;  1UIX A;  5AW5 B;  1HH0 A;  2BCC J;  1EZV E;  2M8R A;  3A3Y B;  1AVY A;  3TGU E;  3WUU A;  2FFD A;  1FZG A;  4RJT A;  1EZV I;  1S5L X;  2FXO A;  3V5B A;  2KS1 B;  4YTP C;  2N1T A;  2WPS A;  1X22 A;  1P84 H;  2Z5I A;  4Y99 C;  1KYO E;  2W6B A;  2Y0E A;  4BRY B;  4GKG A;  1R5S A;  2Y9Y A;  3QWO C;  1KYO I;  4PV1 D;  3CX5 E;  3CI9 A;  4XE5 B;  4IOI H;  1URQ C;  3D6Y A;  3RK3 B;  4DJG A;  1SQQ D;  1VQ9 P;  3H1K E;  2YIU C;  1JY3 P;  3KHU A;  2ZVO B;  3FXE A;  1OX3 A;  2C0X A;  2RMZ A;  3Q2Y A;  1WRG A;  2OQQ A;  5KAI E;  3IFM A;  5CCG A;  1FZB A;  3FGA D;  3TGU D;  1BGY J;  1RE3 C;  2A45 H;  4HYT B;  1OXZ A;  5APW A;  3L74 J;  4R4M A;  1IJD B;  5APU A;  3KZI E;  1VQ4 P;  4BXL A;  1KYO D;  2PRR A;  3AE8 C;  3CCL P;  3CX5 D;  2CPB A;  3H1J E;  2AXT H;  2WZ7 A;  1VQ8 P;  2PGD A;  3WU2 E;  1KIL A;  1L0L J;  2C9N Y;  2B87 A;  4K35 A;  5AVT B;  2IBZ G;  4H0L C;  1YTZ T;  1WMK A;  4PJ0 H;  3M06 A;  2FYU E;  3CC4 P;  2XNX A;  2O01 N;  4EYY Q;  1NTZ K;  5AVR B;  2YKP A;  1QVG O;  1RQV A;  1S4X A;  2N9B A;  3WMM 0;  3KQG A;  1Y9B A;  4HH2 A;  3FXD A;  1VQO P;  1FC2 C;  2ZAE B;  1AQT A;  3B4S A;  3B5N C;  3L70 G;  3D71 A;  4NPD A;  4WWI A;  1EXJ A;  3H1J D;  2YO2 A;  2M3E A;  2KLU A;  2NRG A;  4Y28 J;  3C8V A;  5AVV B;  2WSF H;  1S5L E;  1LWU B;  1H8A A;  2LKM A;  2OAR A;  5KLI B;  4PD4 I;  2H43 A;  5AW9 B;  2FYU D;  4OWF A;  3L36 A;  1SQQ J;  1NTM E;  2SPZ A;  3UIA A;  5KLV J;  3CD6 P;  1L0L K;  2J58 A;  1JUN A;  2O1J A;  2Q3I A;  2I1J A;  2GM4 A;  3CWB G;  3M0D A;  3OW2 O;  1EDI A;  3RK3 C;  1A02 J;  3LID A;  1KFN A;  1FZF A;  4ASV A;  5GTI H;  2WT7 A;  1FOS E;  2ZXE B;  1N7S A;  1RF0 C;  1K04 A;  3TNU A;  3I55 P;  4UB6 E;  3AE6 C;  1XTC C;  4RO0 A;  1MUU A;  4U7J A;  1NAY A;  5AVZ B;  3PHL A;  1KIL B;  1JMM A;  2XU6 A;  3LIE A;  3RL0 g;  2Z4E A;  3VMX A;  5B5E H;  2M3B A;  3A5T A;  2FKW B;  2QJK B;  2KUB A;  1NTM D;  3H1K J;  5GTH E;  1QL2 A;  1T2K D;  2OTJ P;  2PP6 A;  4WY4 D;  1Y8A A;  1TU3 F;  1NU1 E;  2CK3 H;  4XFJ A;  3PRJ A;  1SFC C;  1SQP G;  3L37 A;  3IAO A;  1A02 F;  4HJG H;  5AW2 B;  1XTG B;  2IBZ E;  1X9V A;  3JSV C;  5KLV K;  4EDF A;  2YNY A;  3RL0 C;  3W67 A;  1U57 A;  5KJ7 C;  5DJT B;  4C7N B;  1RF1 B;  5APV A;  2J5U A;  2RN0 A;  3H1J J;  4W7Z A;  4C46 A;  3AED C;  1GK6 A;  2FFD C;  2YKQ A;  4ZKU A;  3L70 E;  1S72 P;  3VMY A;  1Y47 A;  3MUD C;  1GL2 A;  1KFM A;  1PP9 J;  2P58 A;  1KD1 Q;  2WPV B;  1YIJ P;  1JCC A;  3E1R A;  1NU1 D;  2Q6Q A;  1VQ5 P;  4H0L D;  2FYU J;  1N7L A;  1KQF B;  4UB8 H;  2P1J A;  1GL2 D;  3CCQ P;  3F89 A;  2IBZ D;  3RK2 D;  4Y99 B;  3T97 A;  5KLI C;  1JNM A;  1KB9 E;  2BAS A;  5H2F H;  2K9J B;  2QA4 P;  1N73 A;  3TNU B;  1HUC A;  1FU1 A;  3KXD A;  4U3F G;  2WMM A;  5CCG C;  4HB1 A;  3CCS P;  3CWB E;  2YIU B;  3RGU A;  4WY4 B;  1MV8 A;  3L70 D;  1M57 D;  5AW4 B;  1K73 Q;  3A0H E;  4WBA A;  3NTN A;  2WSC J;  1G1I A;  3SFE C;  1OW8 A;  1T3J A;  2A45 G;  1HTL C;  3AEC C;  3B8E B;  1M1J A;  3BVH A;  1EDJ A;  3AEA C;  4DZO A;  1H0T B;  1NTM J;  1VF5 D;  2Q1K A;  1SQV K;  3HE5 A;  1KIL C;  2H7H A;  1BE3 G;  3RBX A;  3SWY A;  1KB9 D;  4JYB A;  1KQL A;  2HOD B;  1KOR A;  1LP1 A;  1RE4 A;  1YI2 P;  1WT6 A;  5CBN A;  1DH3 A;  1JY3 O;  1CI6 A;  3L73 G;  3CXH I;  2E5T A;  4JF7 A;  2QJK C;  3HTK B;  3CWB D;  2JO1 A;  1SQP E;  3CPW O;  1J2J B;  1VQP P;  3A0B H;  5B66 E;  1ZME C;  4NPF X;  1OZH A;  2QVA A;  1FBM A;  1NOH A;  4H0L B;  4LC1 A;  3L71 E;  1YHQ P;  1KQS O;  3I56 P;  2KB7 P;  3H1L G;  1GL2 B;  2E74 D;  1CZQ A;  3BCC G;  1K05 A;  3RK2 B;  1YBK A;  1W5C E;  1PGJ A;  2POH A;  1NTK G;  2HPC A;  3OJA B;  3L72 G;  2CPS A;  3CC2 P;  1S3J A;  5AW1 B;  3R4Y A;  2MKV A;  1NU1 J;  2WVR A;  3LW5 J;  1LTT C;  4OVN F;  1ZLL A;  3T97 B;  1OVU A;  1SFC D;  4N78 E;  1JTH A;  1JEK A;  1HF9 A;  1FDM A;  1GW3 A;  2BEQ D;  1NTM K;  1FOS F;  1SQP D;  1M7L A;  1SQX G;  3MZW B;  2AEF A;  1Q2N A;  3RL0 D;  3D70 A;  3JCU E;  3L71 D;  5E79 H;  4JBZ A;  3M0D C;  5KJ7 D;  2IX7 C;  1VF5 B;  2O01 H;  2IPP A;  2GA1 A;  4L76 A;  3S9O A;  2PFX A;  3L70 J;  1N7S C;  3HE4 A;  3H1I G;  1M1J B;  4IL6 X;  2P2U A;  1S9K E;  4ZNC A;  2N1T D;  1X8Y A;  4M3L A;  4GOF A;  3CX5 I;  1T2K C;  5APY A;  2FY8 A;  1KYO H;  4WY4 C;  3HE5 B;  4GT1 A;  3NFQ A;  4N78 D;  3AE1 C;  5APQ A;  1ZOY C;  3S4R A;  3EFG A;  1PFI A;  3CX5 H;  3VN0 A;  2WSE J;  5DJU B;  2P10 A;  1J1E C;  2XZR A;  1KIL E;  1GTW A;  2K9Y A;  2E74 B;  1NU1 K;  3KYQ A;  3PTZ A;  1GD2 E;  1IK9 A;  2UWJ E;  1EC5 A;  1P84 D;  1KN7 A;  4IFM A;  3H6P A;  3VP8 A;  2IYP A;  3BRT B;  2OYO A;  5CCG D;  3CWB J;  5C39 A;  4W7Y A;  4LGD E;  4C7R A;  1DD3 A;  1SFC B;  2E42 A;  1S9K D;  2OYI B;  1GDT A;  3KZI H;  4N3Y B;  1Q82 Q;  1AFO A;  2WPR A;  4GOE A;  4PJ0 E;  1HGV A;  3HD7 A;  4H13 D;  5CCH A;  3V6I A;  3H1L E;  3RL0 B;  3M9Q A;  4EOT A;  1JY2 O;  3N7N A;  1JTH B;  2L91 A;  3BCC E;  1GL2 C;  1S2E A;  3WU2 H;  1KIL D;  1ZP0 C;  2B88 A;  2QEX P;  3MIW A;  3RK2 C;  1GK4 A;  3MP7 B;  1L4A A;  1VQM P;  1W2B O;  2ZVN B;  3H1H E;  4NPE A;  2FFD B;  1VQL P;  2BCC G;  1YYC A;  1BE3 D;  2IYO A;  3V4Q A;  1X79 B;  3AEE C;  5AW6 B;  1FDO A;  1BCC E;  1IFI A;  2B89 A;  2IZ1 A;  2N1T B;  2QSI A;  1SQP J;  3TF5 A;  3L73 D;  2XKM A;  2WSS H;  3P7K A;  3L71 J;  1LTJ A;  2XND H;  3L75 G;  3GMA A;  2W6A A;  4ZKP A;  5BVZ A;  1EDK A;  2JKV A;  4TLF A;  1VQN P;  1HGZ A;  2C9L Y;  4W80 A;  1E79 H;  3SFD C;  1YQ4 C;  3H1L D;  1NTZ G;  2IDB A;  1JY3 N;  1QVF O;  3BCC D;  1VF5 C;  2E5Y A;  5KTB A;  4PD4 H;  1S5L H;  4IL6 E;  1YJ9 P;  1PGO A;  5TIS H;  3H1I E;  1FE6 A;  3H1H D;  1PPJ G;  5AVQ B;  1M1J C;  1BGY G;  1ZXG A;  1BCC D;  1BSN A;  2WPQ A;  3TGU J;  5GTI E;  1OW6 A;  3M91 A;  3G71 P;  2KSE A;  1JO5 A;  1OMI A;  2ITA A;  2R44 A;  4H13 B;  3Q1M A;  5EFW B;  2HYN A;  2KIK A;  1GU4 A;  2E74 C;  1RHZ B;  3L4F A;  2B87 B;  1L0L G;  2WQY C;  5B5E E;  1JY2 P;  1URQ A;  1M90 Q;  1N7S D;  2JWD A;  1KTM A;  2N9Y B;  2ZYG A;  1M8O B;  3GHG A;  3V2N A;  1GZL A;  2J59 M;  1LTG C;  1SQB G;  2Q5U A;  4OH8 B; 
#chains in the Genus database with same CATH homology
 1NU1 J;  2FYU J;  3TGU J;  1KYO I;  5KLV J;  1BCC J;  1KB9 I;  3L70 J;  1SQX J;  1SQV J;  3BCC J;  1L0N J;  2IBZ I;  1EZV I;  1SQP J;  1L0L J;  1BE3 J;  3H1I J;  4U3F J;  1PP9 J;  1NTK J;  4PD4 I;  3CWB J;  3L72 J;  3CX5 I;  3H1K J;  1NTZ J;  3L71 J;  1BGY J;  3CXH I;  3H1H J;  3L73 J;  3L75 J;  1SQB J;  4D6T J;  1SQQ J;  1P84 I;  3H1J J;  2BCC J;  1NTM J;  3L74 J;  3H1L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...