1NTZJ

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1ntzJ00
3L75J 3CX5I 1EZVI 5KLVJ 1NTMJ 1SQXJ 1BCCJ 1P84I 3H1KJ 1KB9I 1BGYJ 1L0LJ 3H1JJ 3TGUJ 1BE3J 2FYUJ 1SQPJ 1NTZJ 2BCCJ 1SQVJ 1NTKJ 1L0NJ 3L71J 1KYOI 3L72J 1PP9J 3L74J 1SQBJ 3CWBJ 2IBZI 3BCCJ 4PD4I 3H1HJ 4D6TJ 3L73J 1SQQJ 3L70J 3H1IJ 3H1LJ 4U3FJ 1NU1J 3CXHI
chains in the Genus database with same CATH superfamily
1X22A 1KC8Q 1BCCG 2KLVA 3O6QB 3L72E 5CCGC 1S4XA 4OVNF 4L73A 2H7HA 2A45H 2IBZE 1Q90D 2AEMA 2FFDA 3L70E 1SQQG 3CCJP 2OYHB 3L70J 3G9RA 4UB8E 2IFNA 4W7YA 4OGQB 4JQ0D 2XKMA 2GM4A 2WSFH 1G1JA 3GLMA 1YIJP 2PGDA 5APQA 3T97B 1EDJA 1SQBG 1HWTC 5KAFE 1GW3A 5B66E 5KAIE 1WMKA 1NU1G 3CXHE 3B5ND 1NTKK 3H1KG 4JBZA 1BSHA 3SWYA 5APUA 1U7MA 5AW9B 3CC2P 2Q5UA 2HG5D 2QJPB 1MV8A 1GDTA 1EXJA 3E1RA 1S72P 4HKZH 2SPZA 1S3JA 1LT9C 1M1JB 2XU6A 3AECC 1PP9D 2ZYDA 1TU3F 1E5WA 3OJAB 3V4WA 3F5HA 1LWUC 1M56D 3HD7A 1VQ7P 2W6JH 4Y99C 2WPRA 1SVFA 2K88A 2V7QJ 2Q6QA 4M3LA 1BE3D 1L2PA 1P84D 1KYOI 3Q5PA 2P2UA 2IZ1A 4OGQD 3EFFK 3L75E 4ZKUA 3H1ID 3L75J 1SQVE 3TSIA 1SQVJ 2KZIA 2NPSA 1L4AC 3B8EB 3CXHI 2HPCB 4IL6H 2N1TC 3FXEA 1JEKA 1KQLA 4WB4A 3CC4P 4DCKA 1LTGC 5APYA 3RGUA 4N78D 3QWOC 4A7PA 3AEFC 2KP8A 2OYIB 1KILB 1JO5A 4PV1C 1N7LA 3GHGB 3QH9A 5CMZA 3PHLA 1KV4A 1RH5B 1T3UA 1LTJA 2MJZA 1G2CB 3IN6A 4I1LA 3VOPA 1GW4A 2XZRA 3H1HD 3R4YA 3RL0B 1Q2NA 4JF7A 1KQFB 1FDMA 3VYIA 3SWKA 1PPJE 2YIUB 2IZ0A 1SQVK 4RKUJ 1S5LE 3CX5D 3W68A 3LW5H 1WT6A 1Y9BA 1KORA 2AXTH 3I55P 4PD4D 1PV3A 1LTAC 1USDA 1NVOA 2POHA 3AEEC 1YQ3C 1LTSC 3JC22 2WMMA 2FYNC 1PP9J 2JDIH 3HUSC 1RF1C 3PH0A 1S9KD 3BASA 2KB7P 2ZXEB 2M5AA 3A0BE 3CCLP 4K35A 1BE3J 5GTHE 1KILD 1YHQP 1T2KD 2KI7B 3H1IE 4DZOA 2L5GB 3H1IJ 1ZRTE 4JPZB 3V2NA 2R5DA 1H88A 3GW6A 4WWIA 2Z4EA 3RL0D 3B5NA 4EDFA 2HR3A 3AE8C 3MHVA 1SQQE 1JOCA 3BCCD 1JY3P 1VQOP 5KJ7D 2ZAEB 3L73G 5DJUB 4GOEA 3FXDA 3JCUH 1JB0J 5KLVD 1VPCA 4AUWA 1BGYD 1L0LD 4C7NB 5BVZA 1KTMA 1PGOA 1SQBE 4N78E 2QVAA 1SQBJ 1Z56A 3TDKA 2Q1KA 2QE7H 1YITP 4N6JA 3C8VA 1IJDB 2E76B 2OTLP 3O6QA 4Y28J 1DD3A 2WVRA 3WUTA 4R4MA 3LIDA 3H1HE 3L74D 3U1CA 4NPEA 3H1HJ 3AE9C 2UWJE 1N73B 2OYHA 1YTZI 4LLHA 1DD4A 1VQ4P 2I1JA 1EDIA 2JKVA 3CX5E 2IX7C 4GOFA 1JUNA 1P84I 3AE5C 3NTNA 5L8RJ 1SQPD 1QEXA 4NPFX 2Q3EA 3T97A 4NPDA 1YJNP 3P8MC 1RE3A 3CD6P 4PD4E 5AW6B 2A06D 4PJ0H 1SFCB 1FZBA 3Q3DA 1K73Q 1SQBK 1KB9H 2WT7B 3EFGA 3CCEP 2LXBA 3L72D 1S9KE 3RBXA 2IBZD 1IFIA 3IAOA 3L36A 1T3JA 2R3SA 4IFFA 1SQXG 1T6AA 1OVRA 1M1JA 5H2FH 1DEEG 3V4QA 4Z1MH 1FAVA 2E76D 1JY2N 5KLIC 5AVTB 3CPWO 1FZCC 1M1KQ 4TT3H 1CSBA 1NGMB 2E43A 4JYCA 1JM0A 1OXZA 1NOHA 1ZR2A 3BCCJ 3P7KA 3CC7P 2O01H 3MUDA 1KFNA 1ZN5A 5KLVE 2E75C 3CX5I 4WY4C 5KLVJ 1OX3A 1L0LE 2B87A 3HD7C 1BGYJ 1L0LJ 1SS1A 3H1JD 4H13D 1SFCD 2WWWA 1KMIZ 1T8ZA 3KYQA 2FXOA 1YJ9P 1YJWP 1AA0A 5E79E 2C9NY 4PD4I 1KFMA 2OYOA 2FBWC 2JO1A 1HH0A 2HPCA 3H1LG 1LT9B 1HVVA 2M3EA 1EC5A 1NTMD 1KQGB 3VTPC 1W2BO 4H44C 1NHLA 3L74E 1OW8A 3L74J 2W8ZA 1LWUB 1AFOA 1AJYA 2M3BA 3N7NA 5CCGD 1OVVA 4Y99B 2OYIA 1KILA 2B9BA 2H8PD 1ZV8A 5KKZC 1N86A 3CL3D 3GHGA 2WZ7A 1IZNB 4U3FG 1PGQA 1OIPA 2D2CC 2NPSC 5AVVB 1G2CA 2JR8A 5DJTB 2PAJA 1SQPJ 3SFDC 1J1EC 1FU1A 1L0ND 1SQVD 2WITA 3AE1C 5CJ4A 3CWBD 5KLVK 1L0LK 2P10A 1KD1Q 2HODB 3CCSP 1VQMP 1KZUB 4ASWA 5KJ7A 4ZKPA 1USEA 1X8YA 3RK2C 3M0DC 3L72J 1LTJC 1OZHA 1NAYA 3GF3A 1X0TA 5KTBA 2N1TB 3KHUA 1KN7A 2R3CA 1EZVD 5AW7B 1R5SA 3OA7A 2WSSH 2P1JA 2OTJP 3L71G 4PV1B 3L73E 3VMAA 1HTLC 2IFMA 2IPPA 3AE7C 3CMEP 1Y47A 1SQPK 4W7ZA 1J2JB 1K8AQ 5AW3B 1PPJD 1IFNA 2HLOA 2M8RA 3TGUG 2RN0A 2N9YB 2A45I 1N7SC 5AVUB 5CCHA 1FS0E 3S4RA 3RBZA 4IFMA 4BRYA 3TNUB 3H1JE 2FYUE 3H1JJ 2FYUJ 1NTZG 2BCCG 3A5TA 3TF5A 2JEEA 1KYOH 1HJ0A 1N8RQ 5AVYB 1H0TA 3WUVA 1RF0A 1RQUA 3H32B 3IR9A 3PTZA 1HBWA 1UIIA 1NTME 4KJMA 4D6TD 2FYNB 1NTMJ 1LNQA 1J1DC 1FOSE 1L4AD 4IL6E 4ZMDA 4DT0A 2Y0DA 1FBMA 3HUSB 2N1TD 3FX0A 1RF1B 2K1AA 1S2EA 3VP8A 2IBZI 1VDFA 4BXLA 1JCCA 2O1JA 1PL5A 3D71A 1RE4A 4R4LA 2KIKA 1LP1B 3C9IA 1MFZA 1ZRTD 4U7JA 3D70A 2E74C 4PV1D 1BCCD 1VQPP 5M1BA 2JWAA 3N4XA 5APSA 1L0NE 4L75A 1L0NJ 3CWBE 3ABVC 3CWBJ 1ZR4A 1ZOYC 1HUCA 2K9YA 2ZFCA 5AVZB 1JTHB 2RH0A 1SQQD 2QJKB 2FYUK 2ZXXA 4HH2A 3HE5B 1EDKA 3LW5J 2FY8A 2AXTE 1SQBD 1NTMK 1SFCA 2PFXA 2H89C 2W83C 1NU1D 2V7QH 2JJLA 1EZVE 2W27A 3PLNA 2OYHC 3H1KD 3RK3C 2QA4P 2KS1A 3FGAD 1JY3O 1KB9D 3A7OA 5AVSB 2KXPB 3NMDA 3CCQP 2CK3H 1NWQA 3F89A 4JYBA 1DX7A 1RE3C 1EXIA 1IC2A 5GTIH 1L0NK 3JSVC 5AVWB 3TYYA 4EIJA 2K9JA 3VMYA 3KQGA 3WU2H 1GZLA 4O9BA 1A02F 4GDOA 1S5LX 1SLQA 2RKLA 1UIXA 3VN0A 2QJYC 2KOGA 4MN4C 2QEXP 2YO2A 2Y0CA 3OW2O 1X9VA 2W90A 3A2AA 1S1CX 1DEBA 1ZXGA 4D6TE 1FZGA 2C0WA 4D6TJ 3E7KA 3JCUE 1XTGB 5BU5A 1HJBA 5TJHA 1CZQA 4BWNA 1NTKG 2JWDA 1BDDA 2G8YA 1LJ2A 2V4HA 3Q1MA 1IK7A 2R32A 4H0LC 1LT9A 1EZVI 1BCCE 4CPGA 4LGDE 1BCCJ 1URQC 4N3YB 2O3JA 1PIXA 2QIWA 1YYCA 2XV5A 4I7ZC 2KSEA 4DOJA 2GUVA 4XE5B 1FZCB 3AE4C 1SQQJ 4I6MC 3G3ZA 1Q82Q 3L70G 5TISH 3HTKB 2K3RA 1M7LA 4ASVA 3CCMP 1GL2C 3L71E 3L71J 3V6IA 1AVYA 2E75B 3VP9A 4WY4B 1NU1E 4PJ0E 3FWLA 1NU1J 3HD7B 2P58A 3H1KE 2J58A 2PP6A 2YKOA 2WSCJ 3H1KJ 1P84H 1OW6A 1KB9E 1EQ7A 2KLUA 1Q7YQ 4XFJA 2W6BA 1PGJA 2FKWB 2N1TA 3KXDA 2Q9IA 1AQ5A 3WMM0 5AVRB 3ITKA 4B86A 4H44B 4L76A 2BCCE 4XA4A 1OVUA 1R8EA 1FJKA 5H2FE 1SQQK 3CCRP 2WPQA 3MD0A 4I2LC 3GMAA 3HE4B 2ZT9C 2D2CB 3AE3C 2NPSB 4H13B 2FXMA 2MKVA 2Q7CA 1J1EB 2FFDC 3CI9A 1GK4A 5CHXA 1LTBC 1SP4A 3VMZA 2K37A 1NU1K 5AVQB 4KHXA 1BDCA 1RHZB 3CLQA 3WUUA 4WVZA 2O01J 2R5BA 2Y9ZA 3KDPB 2XNXA 3BRTB 3L75G 3TNUA 3RK2B 1H89A 3Q5RA 3EWKA 2E75D 1LTJB 3CMAP 4WY4D 2KUBA 3HD7D 1GU5A 2WQYC 1HGZA 5AW0B 4RESB 3L73D 1PGPA 1VF5C 1QX8A 5CCHC 3S1KA 4TLFA 1ZW0A 3H6PA 2J59M 1RF1A 3BVHA 1LTIC 1JY2P 4H44D 1LP1A 2YMKA 5AW2B 1MUUA 1N7SB 4C46A 2D2CD 2NPSD 2FYUD 2B88A 1VQLP 2CPSA 1JTHA 3VMXA 3A0HH 1W5CE 5B5EH 3FWNA 2FYZA 3SFEC 2Y9YA 2L91A 5CBOA 1RE4C 3NXSA 2M5AB 4WBAA 2WTYA 1FDIA 4HJGH 1M8OB 4UB6H 5APXA 3RK2D 2YXQB 5AW5B 1J1DB 1M90Q 5BU8B 1E79H 1GMJA 3KZIH 3C1LA 1VQ6P 2WSEH 1X79B 2OGUA 1FC2C 2WSFJ 1PP9G 3IFMA 4YPCA 2E74B 4QMAA 3HRNA 2Q3IA 1SQXD 1FZFA 1BE3G 4GT1A 3TK1A 3BRVB 5APTA 1YQ4C 2KZJA 1L4AB 2CPBA 1QGKB 1N7SD 3H1IG 3U59A 4K3AA 2WPVB 1CW5A 1KYOE 2IDBA 3MZWB 3L73J 3S9OA 3UIAA 1W2EA 3P8CE 2E42A 3RK3B 1LTTC 3R2PA 2FXPA 1JNMA 3AE2C 1OFCX 1OMIA 1VQ5P 4AQRD 1IFJA 3IF4A 1Y8AA 2O01N 3H1LD 1RQVA 4HB1A 4AYCA 1RY3A 2ZYAA 2LKMA 1QLED 4GODA 2E74D 1FZCA 1NKZB 1CI6B 3NFQA 2OTKE 3H1HG 2QJYB 2YKQA 2E5TA 3HTKA 4EOTA 4U3FD 3V2QA 4UB8H 1VQNP 2C0XA 4C7NA 3L4FA 3G4SP 1N2DC 4WY4A 5KAFH 3AEGC 4IL6X 3B5NC 5B66H 5KAIH 2R44A 2YXRB 3CXHH 1YTZT 3AEAC 2DW3A 3PRJA 3MTUE 1AQTA 4L74A 1VL2A 2M0BA 1YBKA 3P32A 2VRSA 3PP5A 4IFDK 3RK3D 2E5YA 4H0LB 4W80A 1EDLA 1N73A 1IO4A 1URQB 4GKGA 1IK9A 1DH3A 1SQXE 2XDJA 4I7ZB 5GTIE 1SQXJ 2J5UA 2B87B 2N9BA 1LT1A 3SSUA 3M91A 1QVFO 3WU2E 3K5BA 2BEQD 3L71D 3W67A 3HE4A 3U1AA 1DIPA 2LXCB 1GL2B 1KQSO 2WT7A 2H43A 1U57A 3TGUD 3SWFA 2QRXA 4OGQC 1K05A 3BCCG 3D6YA 3M0DA 5CCGA 1WRGA 3M06A 5KLVG 2KNCB 1Q86Q 1BGYG 1L0LG 1OW7A 1NTZD 1ZP0C 2BCCD 3MP7B 2BASA 1ZLLA 3AEBC 4HYTB 1SQXK 3H1LE 3OAKA 3H1LJ 3M9QA 2LR2A 2QJPC 4H0LD 1FZAA 2Z5IA 2AXCA 1URQD 1NYHA 2ZT9B 1R5LA 2HYNA 1JMMA 2IYPA 3L74G 5AW8B 1M1JC 2A45G 4U3FE 2ZVNB 2FFDB 2PRRA 5K5GB 4U3FJ 4DJGA 4LC1A 5TISE 2KSJA 1AVOA 1N7SA 2HFED 2I8DA 1PP9E 1SQPG 3LIEA 1GL2D 2YO3A 2A06G 1IFPA 3MIWA 2QG4A 1PZQA 3L37A 4EYYQ 1BE3E 1P84E 3MUDC 1S5LH 5CBNA 2AEFA 5AW4B 3RK3E 2KK7A 5KLIB 1LWUA 3B71A 2XNDH 3L72G 1VF5B 2AEJA 3AEDC 2WPSA 4YXWH 1HF9A 2IBZG 1FDOA 3USSA 1JY3N 2Y0EA 4BRYB 2ZYGA 2QJKC 1GK6A 2RMZA 3B4SA 3G71P 3V2PA 4YTPC 3AE6C 3II6A 5CJ0A 1H0TB 4C7RA 1QL1A 2HODA 3V2RA 2ZT9D 1JY2O 2NZ2A 2OYIC 1KILC 3TGUE 3A0BH 2BEZF 3GHGC 1T2KC 3TGUJ 5GTHH 4YXDC 1NAFA 2NRGA 1FJPA 1MFTA 1L4AA 3I5CA 1H8AA 1BSNA 1M57D 1NKNA 1A02J 3V5BA 3RL0C 3CCVP 2YIUC 1NTZE 3Q2YA 3H1JG 1NTZJ 2BCCJ 2FYUG 1VQKP 2GA1A 5EFWB 4ZNCA 3A3YB 5KJ7C 1HGVA 5KKZB 3ZDMA 2C9LY 1LGHB 2GUSA 1MZ9A 4KT0J 2W6AA 3G6EP 4GIFA 4OH8B 1NTMG 1VF5D 2P67A 1ZMEC 5CCHD 1NTKD 1GU4A 2O1KA 1GTWA 2ZJSE 1NH4A 2JP3A 2WSCH 2P7JA 2QSIA 1QVGO 3GF7A 2H88C 3M9BA 1NJIQ 2KYVA 1XTCC 2KS1B 3EQ2A 1K9MQ 1CI6A 1L0NG 1SQVG 4IOIH 3D6ZA 2OQQA 3M0AA 3CWBG 1KYOD 3A0HE 3H32A 3CCUP 5B5EE 1NTZK 3L70D 3CX5H 1D7MA 3O8ZA 3P8CD 1KILE 1KB9I 1IFDA 2K9JB 3HUSA 3M9HA 4UB6E 4PD4H 4OWFA 1IFMA 1FZEA 5C39A 3H25A 4EI2A 2OARA 4RJTA 1K04A 1RF0C 3KZIE 3L35A 1JMBA 3CXHD 1EZVG 2WSEJ 2Z5HA 3BCCE 5AW1B 3BATA 2QM8A 1YI2P 1OWAA 1URQA 3GG2A 5AVXB 2I1KA 1NO4A 3KPEA 2ZVOB 1AV1A 1BGYE 2YNYA 1U7JA 1PPJG 3Q5SA 1MKMA 3HE5A 1VQ8P 2E76C 2G3AA 1Q81Q 1JCDA 1GL2A 2IYOA 1N73C 2YMYA 3MGNA 2QM7A 1VQ9P 5APVA 3B5NB 1FE6A 1PFIA 4RO0A 3PJSK 2ITAA 2YKPA 3I56P 1FOSF 4D6TG 3L75D 2KNCA 4H13C 1SFCC 1SQPE 1GD2E 1NTKE 3RL0g 1NTKJ 2A06E 1G1IA 3E1IA 5E79H 1QL2A 2B89A 5APWA
chains in the Genus database with same CATH topology
3L75J 3CX5I 1EZVI 5KLVJ 1NTMJ 1SQXJ 1BCCJ 1P84I 3H1KJ 1KB9I 1BGYJ 1L0LJ 3H1JJ 3TGUJ 1BE3J 2FYUJ 1SQPJ 1NTZJ 2BCCJ 1SQVJ 1NTKJ 1L0NJ 3L71J 1KYOI 3L72J 1PP9J 3L74J 1SQBJ 3CWBJ 2IBZI 3BCCJ 4PD4I 3H1HJ 4D6TJ 3L73J 1SQQJ 3L70J 3H1IJ 3H1LJ 4U3FJ 1NU1J 3CXHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 J;  3CX5 I;  1EZV I;  5KLV J;  1NTM J;  1SQX J;  1BCC J;  1P84 I;  3H1K J;  1KB9 I;  1BGY J;  1L0L J;  3H1J J;  3TGU J;  1BE3 J;  2FYU J;  1SQP J;  1NTZ J;  2BCC J;  1SQV J;  1NTK J;  1L0N J;  3L71 J;  1KYO I;  3L72 J;  1PP9 J;  3L74 J;  1SQB J;  3CWB J;  2IBZ I;  3BCC J;  4PD4 I;  3H1H J;  4D6T J;  3L73 J;  1SQQ J;  3L70 J;  3H1I J;  3H1L J;  4U3F J;  1NU1 J;  3CXH I; 
#chains in the Genus database with same CATH topology
 1X22 A;  1KC8 Q;  1BCC G;  2KLV A;  3O6Q B;  3L72 E;  5CCG C;  1S4X A;  4OVN F;  4L73 A;  2H7H A;  2A45 H;  2IBZ E;  1Q90 D;  2AEM A;  2FFD A;  3L70 E;  1SQQ G;  3CCJ P;  2OYH B;  3L70 J;  3G9R A;  4UB8 E;  2IFN A;  4W7Y A;  4OGQ B;  4JQ0 D;  2XKM A;  2GM4 A;  2WSF H;  1G1J A;  3GLM A;  1YIJ P;  2PGD A;  5APQ A;  3T97 B;  1EDJ A;  1SQB G;  1HWT C;  5KAF E;  1GW3 A;  5B66 E;  5KAI E;  1WMK A;  1NU1 G;  3CXH E;  3B5N D;  1NTK K;  3H1K G;  4JBZ A;  1BSH A;  3SWY A;  5APU A;  1U7M A;  5AW9 B;  3CC2 P;  2Q5U A;  2HG5 D;  2QJP B;  1MV8 A;  1GDT A;  1EXJ A;  3E1R A;  1S72 P;  4HKZ H;  2SPZ A;  1S3J A;  1LT9 C;  1M1J B;  2XU6 A;  3AEC C;  1PP9 D;  2ZYD A;  1TU3 F;  1E5W A;  3OJA B;  3V4W A;  3F5H A;  1LWU C;  1M56 D;  3HD7 A;  1VQ7 P;  2W6J H;  4Y99 C;  2WPR A;  1SVF A;  2K88 A;  2V7Q J;  2Q6Q A;  4M3L A;  1BE3 D;  1L2P A;  1P84 D;  1KYO I;  3Q5P A;  2P2U A;  2IZ1 A;  4OGQ D;  3EFF K;  3L75 E;  4ZKU A;  3H1I D;  3L75 J;  1SQV E;  3TSI A;  1SQV J;  2KZI A;  2NPS A;  1L4A C;  3B8E B;  3CXH I;  2HPC B;  4IL6 H;  2N1T C;  3FXE A;  1JEK A;  1KQL A;  4WB4 A;  3CC4 P;  4DCK A;  1LTG C;  5APY A;  3RGU A;  4N78 D;  3QWO C;  4A7P A;  3AEF C;  2KP8 A;  2OYI B;  1KIL B;  1JO5 A;  4PV1 C;  1N7L A;  3GHG B;  3QH9 A;  5CMZ A;  3PHL A;  1KV4 A;  1RH5 B;  1T3U A;  1LTJ A;  2MJZ A;  1G2C B;  3IN6 A;  4I1L A;  3VOP A;  1GW4 A;  2XZR A;  3H1H D;  3R4Y A;  3RL0 B;  1Q2N A;  4JF7 A;  1KQF B;  1FDM A;  3VYI A;  3SWK A;  1PPJ E;  2YIU B;  2IZ0 A;  1SQV K;  4RKU J;  1S5L E;  3CX5 D;  3W68 A;  3LW5 H;  1WT6 A;  1Y9B A;  1KOR A;  2AXT H;  3I55 P;  4PD4 D;  1PV3 A;  1LTA C;  1USD A;  1NVO A;  2POH A;  3AEE C;  1YQ3 C;  1LTS C;  3JC2 2;  2WMM A;  2FYN C;  1PP9 J;  2JDI H;  3HUS C;  1RF1 C;  3PH0 A;  1S9K D;  3BAS A;  2KB7 P;  2ZXE B;  2M5A A;  3A0B E;  3CCL P;  4K35 A;  1BE3 J;  5GTH E;  1KIL D;  1YHQ P;  1T2K D;  2KI7 B;  3H1I E;  4DZO A;  2L5G B;  3H1I J;  1ZRT E;  4JPZ B;  3V2N A;  2R5D A;  1H88 A;  3GW6 A;  4WWI A;  2Z4E A;  3RL0 D;  3B5N A;  4EDF A;  2HR3 A;  3AE8 C;  3MHV A;  1SQQ E;  1JOC A;  3BCC D;  1JY3 P;  1VQO P;  5KJ7 D;  2ZAE B;  3L73 G;  5DJU B;  4GOE A;  3FXD A;  3JCU H;  1JB0 J;  5KLV D;  1VPC A;  4AUW A;  1BGY D;  1L0L D;  4C7N B;  5BVZ A;  1KTM A;  1PGO A;  1SQB E;  4N78 E;  2QVA A;  1SQB J;  1Z56 A;  3TDK A;  2Q1K A;  2QE7 H;  1YIT P;  4N6J A;  3C8V A;  1IJD B;  2E76 B;  2OTL P;  3O6Q A;  4Y28 J;  1DD3 A;  2WVR A;  3WUT A;  4R4M A;  3LID A;  3H1H E;  3L74 D;  3U1C A;  4NPE A;  3H1H J;  3AE9 C;  2UWJ E;  1N73 B;  2OYH A;  1YTZ I;  4LLH A;  1DD4 A;  1VQ4 P;  2I1J A;  1EDI A;  2JKV A;  3CX5 E;  2IX7 C;  4GOF A;  1JUN A;  1P84 I;  3AE5 C;  3NTN A;  5L8R J;  1SQP D;  1QEX A;  4NPF X;  2Q3E A;  3T97 A;  4NPD A;  1YJN P;  3P8M C;  1RE3 A;  3CD6 P;  4PD4 E;  5AW6 B;  2A06 D;  4PJ0 H;  1SFC B;  1FZB A;  3Q3D A;  1K73 Q;  1SQB K;  1KB9 H;  2WT7 B;  3EFG A;  3CCE P;  2LXB A;  3L72 D;  1S9K E;  3RBX A;  2IBZ D;  1IFI A;  3IAO A;  3L36 A;  1T3J A;  2R3S A;  4IFF A;  1SQX G;  1T6A A;  1OVR A;  1M1J A;  5H2F H;  1DEE G;  3V4Q A;  4Z1M H;  1FAV A;  2E76 D;  1JY2 N;  5KLI C;  5AVT B;  3CPW O;  1FZC C;  1M1K Q;  4TT3 H;  1CSB A;  1NGM B;  2E43 A;  4JYC A;  1JM0 A;  1OXZ A;  1NOH A;  1ZR2 A;  3BCC J;  3P7K A;  3CC7 P;  2O01 H;  3MUD A;  1KFN A;  1ZN5 A;  5KLV E;  2E75 C;  3CX5 I;  4WY4 C;  5KLV J;  1OX3 A;  1L0L E;  2B87 A;  3HD7 C;  1BGY J;  1L0L J;  1SS1 A;  3H1J D;  4H13 D;  1SFC D;  2WWW A;  1KMI Z;  1T8Z A;  3KYQ A;  2FXO A;  1YJ9 P;  1YJW P;  1AA0 A;  5E79 E;  2C9N Y;  4PD4 I;  1KFM A;  2OYO A;  2FBW C;  2JO1 A;  1HH0 A;  2HPC A;  3H1L G;  1LT9 B;  1HVV A;  2M3E A;  1EC5 A;  1NTM D;  1KQG B;  3VTP C;  1W2B O;  4H44 C;  1NHL A;  3L74 E;  1OW8 A;  3L74 J;  2W8Z A;  1LWU B;  1AFO A;  1AJY A;  2M3B A;  3N7N A;  5CCG D;  1OVV A;  4Y99 B;  2OYI A;  1KIL A;  2B9B A;  2H8P D;  1ZV8 A;  5KKZ C;  1N86 A;  3CL3 D;  3GHG A;  2WZ7 A;  1IZN B;  4U3F G;  1PGQ A;  1OIP A;  2D2C C;  2NPS C;  5AVV B;  1G2C A;  2JR8 A;  5DJT B;  2PAJ A;  1SQP J;  3SFD C;  1J1E C;  1FU1 A;  1L0N D;  1SQV D;  2WIT A;  3AE1 C;  5CJ4 A;  3CWB D;  5KLV K;  1L0L K;  2P10 A;  1KD1 Q;  2HOD B;  3CCS P;  1VQM P;  1KZU B;  4ASW A;  5KJ7 A;  4ZKP A;  1USE A;  1X8Y A;  3RK2 C;  3M0D C;  3L72 J;  1LTJ C;  1OZH A;  1NAY A;  3GF3 A;  1X0T A;  5KTB A;  2N1T B;  3KHU A;  1KN7 A;  2R3C A;  1EZV D;  5AW7 B;  1R5S A;  3OA7 A;  2WSS H;  2P1J A;  2OTJ P;  3L71 G;  4PV1 B;  3L73 E;  3VMA A;  1HTL C;  2IFM A;  2IPP A;  3AE7 C;  3CME P;  1Y47 A;  1SQP K;  4W7Z A;  1J2J B;  1K8A Q;  5AW3 B;  1PPJ D;  1IFN A;  2HLO A;  2M8R A;  3TGU G;  2RN0 A;  2N9Y B;  2A45 I;  1N7S C;  5AVU B;  5CCH A;  1FS0 E;  3S4R A;  3RBZ A;  4IFM A;  4BRY A;  3TNU B;  3H1J E;  2FYU E;  3H1J J;  2FYU J;  1NTZ G;  2BCC G;  3A5T A;  3TF5 A;  2JEE A;  1KYO H;  1HJ0 A;  1N8R Q;  5AVY B;  1H0T A;  3WUV A;  1RF0 A;  1RQU A;  3H32 B;  3IR9 A;  3PTZ A;  1HBW A;  1UII A;  1NTM E;  4KJM A;  4D6T D;  2FYN B;  1NTM J;  1LNQ A;  1J1D C;  1FOS E;  1L4A D;  4IL6 E;  4ZMD A;  4DT0 A;  2Y0D A;  1FBM A;  3HUS B;  2N1T D;  3FX0 A;  1RF1 B;  2K1A A;  1S2E A;  3VP8 A;  2IBZ I;  1VDF A;  4BXL A;  1JCC A;  2O1J A;  1PL5 A;  3D71 A;  1RE4 A;  4R4L A;  2KIK A;  1LP1 B;  3C9I A;  1MFZ A;  1ZRT D;  4U7J A;  3D70 A;  2E74 C;  4PV1 D;  1BCC D;  1VQP P;  5M1B A;  2JWA A;  3N4X A;  5APS A;  1L0N E;  4L75 A;  1L0N J;  3CWB E;  3ABV C;  3CWB J;  1ZR4 A;  1ZOY C;  1HUC A;  2K9Y A;  2ZFC A;  5AVZ B;  1JTH B;  2RH0 A;  1SQQ D;  2QJK B;  2FYU K;  2ZXX A;  4HH2 A;  3HE5 B;  1EDK A;  3LW5 J;  2FY8 A;  2AXT E;  1SQB D;  1NTM K;  1SFC A;  2PFX A;  2H89 C;  2W83 C;  1NU1 D;  2V7Q H;  2JJL A;  1EZV E;  2W27 A;  3PLN A;  2OYH C;  3H1K D;  3RK3 C;  2QA4 P;  2KS1 A;  3FGA D;  1JY3 O;  1KB9 D;  3A7O A;  5AVS B;  2KXP B;  3NMD A;  3CCQ P;  2CK3 H;  1NWQ A;  3F89 A;  4JYB A;  1DX7 A;  1RE3 C;  1EXI A;  1IC2 A;  5GTI H;  1L0N K;  3JSV C;  5AVW B;  3TYY A;  4EIJ A;  2K9J A;  3VMY A;  3KQG A;  3WU2 H;  1GZL A;  4O9B A;  1A02 F;  4GDO A;  1S5L X;  1SLQ A;  2RKL A;  1UIX A;  3VN0 A;  2QJY C;  2KOG A;  4MN4 C;  2QEX P;  2YO2 A;  2Y0C A;  3OW2 O;  1X9V A;  2W90 A;  3A2A A;  1S1C X;  1DEB A;  1ZXG A;  4D6T E;  1FZG A;  2C0W A;  4D6T J;  3E7K A;  3JCU E;  1XTG B;  5BU5 A;  1HJB A;  5TJH A;  1CZQ A;  4BWN A;  1NTK G;  2JWD A;  1BDD A;  2G8Y A;  1LJ2 A;  2V4H A;  3Q1M A;  1IK7 A;  2R32 A;  4H0L C;  1LT9 A;  1EZV I;  1BCC E;  4CPG A;  4LGD E;  1BCC J;  1URQ C;  4N3Y B;  2O3J A;  1PIX A;  2QIW A;  1YYC A;  2XV5 A;  4I7Z C;  2KSE A;  4DOJ A;  2GUV A;  4XE5 B;  1FZC B;  3AE4 C;  1SQQ J;  4I6M C;  3G3Z A;  1Q82 Q;  3L70 G;  5TIS H;  3HTK B;  2K3R A;  1M7L A;  4ASV A;  3CCM P;  1GL2 C;  3L71 E;  3L71 J;  3V6I A;  1AVY A;  2E75 B;  3VP9 A;  4WY4 B;  1NU1 E;  4PJ0 E;  3FWL A;  1NU1 J;  3HD7 B;  2P58 A;  3H1K E;  2J58 A;  2PP6 A;  2YKO A;  2WSC J;  3H1K J;  1P84 H;  1OW6 A;  1KB9 E;  1EQ7 A;  2KLU A;  1Q7Y Q;  4XFJ A;  2W6B A;  1PGJ A;  2FKW B;  2N1T A;  3KXD A;  2Q9I A;  1AQ5 A;  3WMM 0;  5AVR B;  3ITK A;  4B86 A;  4H44 B;  4L76 A;  2BCC E;  4XA4 A;  1OVU A;  1R8E A;  1FJK A;  5H2F E;  1SQQ K;  3CCR P;  2WPQ A;  3MD0 A;  4I2L C;  3GMA A;  3HE4 B;  2ZT9 C;  2D2C B;  3AE3 C;  2NPS B;  4H13 B;  2FXM A;  2MKV A;  2Q7C A;  1J1E B;  2FFD C;  3CI9 A;  1GK4 A;  5CHX A;  1LTB C;  1SP4 A;  3VMZ A;  2K37 A;  1NU1 K;  5AVQ B;  4KHX A;  1BDC A;  1RHZ B;  3CLQ A;  3WUU A;  4WVZ A;  2O01 J;  2R5B A;  2Y9Z A;  3KDP B;  2XNX A;  3BRT B;  3L75 G;  3TNU A;  3RK2 B;  1H89 A;  3Q5R A;  3EWK A;  2E75 D;  1LTJ B;  3CMA P;  4WY4 D;  2KUB A;  3HD7 D;  1GU5 A;  2WQY C;  1HGZ A;  5AW0 B;  4RES B;  3L73 D;  1PGP A;  1VF5 C;  1QX8 A;  5CCH C;  3S1K A;  4TLF A;  1ZW0 A;  3H6P A;  2J59 M;  1RF1 A;  3BVH A;  1LTI C;  1JY2 P;  4H44 D;  1LP1 A;  2YMK A;  5AW2 B;  1MUU A;  1N7S B;  4C46 A;  2D2C D;  2NPS D;  2FYU D;  2B88 A;  1VQL P;  2CPS A;  1JTH A;  3VMX A;  3A0H H;  1W5C E;  5B5E H;  3FWN A;  2FYZ A;  3SFE C;  2Y9Y A;  2L91 A;  5CBO A;  1RE4 C;  3NXS A;  2M5A B;  4WBA A;  2WTY A;  1FDI A;  4HJG H;  1M8O B;  4UB6 H;  5APX A;  3RK2 D;  2YXQ B;  5AW5 B;  1J1D B;  1M90 Q;  5BU8 B;  1E79 H;  1GMJ A;  3KZI H;  3C1L A;  1VQ6 P;  2WSE H;  1X79 B;  2OGU A;  1FC2 C;  2WSF J;  1PP9 G;  3IFM A;  4YPC A;  2E74 B;  4QMA A;  3HRN A;  2Q3I A;  1SQX D;  1FZF A;  1BE3 G;  4GT1 A;  3TK1 A;  3BRV B;  5APT A;  1YQ4 C;  2KZJ A;  1L4A B;  2CPB A;  1QGK B;  1N7S D;  3H1I G;  3U59 A;  4K3A A;  2WPV B;  1CW5 A;  1KYO E;  2IDB A;  3MZW B;  3L73 J;  3S9O A;  3UIA A;  1W2E A;  3P8C E;  2E42 A;  3RK3 B;  1LTT C;  3R2P A;  2FXP A;  1JNM A;  3AE2 C;  1OFC X;  1OMI A;  1VQ5 P;  4AQR D;  1IFJ A;  3IF4 A;  1Y8A A;  2O01 N;  3H1L D;  1RQV A;  4HB1 A;  4AYC A;  1RY3 A;  2ZYA A;  2LKM A;  1QLE D;  4GOD A;  2E74 D;  1FZC A;  1NKZ B;  1CI6 B;  3NFQ A;  2OTK E;  3H1H G;  2QJY B;  2YKQ A;  2E5T A;  3HTK A;  4EOT A;  4U3F D;  3V2Q A;  4UB8 H;  1VQN P;  2C0X A;  4C7N A;  3L4F A;  3G4S P;  1N2D C;  4WY4 A;  5KAF H;  3AEG C;  4IL6 X;  3B5N C;  5B66 H;  5KAI H;  2R44 A;  2YXR B;  3CXH H;  1YTZ T;  3AEA C;  2DW3 A;  3PRJ A;  3MTU E;  1AQT A;  4L74 A;  1VL2 A;  2M0B A;  1YBK A;  3P32 A;  2VRS A;  3PP5 A;  4IFD K;  3RK3 D;  2E5Y A;  4H0L B;  4W80 A;  1EDL A;  1N73 A;  1IO4 A;  1URQ B;  4GKG A;  1IK9 A;  1DH3 A;  1SQX E;  2XDJ A;  4I7Z B;  5GTI E;  1SQX J;  2J5U A;  2B87 B;  2N9B A;  1LT1 A;  3SSU A;  3M91 A;  1QVF O;  3WU2 E;  3K5B A;  2BEQ D;  3L71 D;  3W67 A;  3HE4 A;  3U1A A;  1DIP A;  2LXC B;  1GL2 B;  1KQS O;  2WT7 A;  2H43 A;  1U57 A;  3TGU D;  3SWF A;  2QRX A;  4OGQ C;  1K05 A;  3BCC G;  3D6Y A;  3M0D A;  5CCG A;  1WRG A;  3M06 A;  5KLV G;  2KNC B;  1Q86 Q;  1BGY G;  1L0L G;  1OW7 A;  1NTZ D;  1ZP0 C;  2BCC D;  3MP7 B;  2BAS A;  1ZLL A;  3AEB C;  4HYT B;  1SQX K;  3H1L E;  3OAK A;  3H1L J;  3M9Q A;  2LR2 A;  2QJP C;  4H0L D;  1FZA A;  2Z5I A;  2AXC A;  1URQ D;  1NYH A;  2ZT9 B;  1R5L A;  2HYN A;  1JMM A;  2IYP A;  3L74 G;  5AW8 B;  1M1J C;  2A45 G;  4U3F E;  2ZVN B;  2FFD B;  2PRR A;  5K5G B;  4U3F J;  4DJG A;  4LC1 A;  5TIS E;  2KSJ A;  1AVO A;  1N7S A;  2HFE D;  2I8D A;  1PP9 E;  1SQP G;  3LIE A;  1GL2 D;  2YO3 A;  2A06 G;  1IFP A;  3MIW A;  2QG4 A;  1PZQ A;  3L37 A;  4EYY Q;  1BE3 E;  1P84 E;  3MUD C;  1S5L H;  5CBN A;  2AEF A;  5AW4 B;  3RK3 E;  2KK7 A;  5KLI B;  1LWU A;  3B71 A;  2XND H;  3L72 G;  1VF5 B;  2AEJ A;  3AED C;  2WPS A;  4YXW H;  1HF9 A;  2IBZ G;  1FDO A;  3USS A;  1JY3 N;  2Y0E A;  4BRY B;  2ZYG A;  2QJK C;  1GK6 A;  2RMZ A;  3B4S A;  3G71 P;  3V2P A;  4YTP C;  3AE6 C;  3II6 A;  5CJ0 A;  1H0T B;  4C7R A;  1QL1 A;  2HOD A;  3V2R A;  2ZT9 D;  1JY2 O;  2NZ2 A;  2OYI C;  1KIL C;  3TGU E;  3A0B H;  2BEZ F;  3GHG C;  1T2K C;  3TGU J;  5GTH H;  4YXD C;  1NAF A;  2NRG A;  1FJP A;  1MFT A;  1L4A A;  3I5C A;  1H8A A;  1BSN A;  1M57 D;  1NKN A;  1A02 J;  3V5B A;  3RL0 C;  3CCV P;  2YIU C;  1NTZ E;  3Q2Y A;  3H1J G;  1NTZ J;  2BCC J;  2FYU G;  1VQK P;  2GA1 A;  5EFW B;  4ZNC A;  3A3Y B;  5KJ7 C;  1HGV A;  5KKZ B;  3ZDM A;  2C9L Y;  1LGH B;  2GUS A;  1MZ9 A;  4KT0 J;  2W6A A;  3G6E P;  4GIF A;  4OH8 B;  1NTM G;  1VF5 D;  2P67 A;  1ZME C;  5CCH D;  1NTK D;  1GU4 A;  2O1K A;  1GTW A;  2ZJS E;  1NH4 A;  2JP3 A;  2WSC H;  2P7J A;  2QSI A;  1QVG O;  3GF7 A;  2H88 C;  3M9B A;  1NJI Q;  2KYV A;  1XTC C;  2KS1 B;  3EQ2 A;  1K9M Q;  1CI6 A;  1L0N G;  1SQV G;  4IOI H;  3D6Z A;  2OQQ A;  3M0A A;  3CWB G;  1KYO D;  3A0H E;  3H32 A;  3CCU P;  5B5E E;  1NTZ K;  3L70 D;  3CX5 H;  1D7M A;  3O8Z A;  3P8C D;  1KIL E;  1KB9 I;  1IFD A;  2K9J B;  3HUS A;  3M9H A;  4UB6 E;  4PD4 H;  4OWF A;  1IFM A;  1FZE A;  5C39 A;  3H25 A;  4EI2 A;  2OAR A;  4RJT A;  1K04 A;  1RF0 C;  3KZI E;  3L35 A;  1JMB A;  3CXH D;  1EZV G;  2WSE J;  2Z5H A;  3BCC E;  5AW1 B;  3BAT A;  2QM8 A;  1YI2 P;  1OWA A;  1URQ A;  3GG2 A;  5AVX B;  2I1K A;  1NO4 A;  3KPE A;  2ZVO B;  1AV1 A;  1BGY E;  2YNY A;  1U7J A;  1PPJ G;  3Q5S A;  1MKM A;  3HE5 A;  1VQ8 P;  2E76 C;  2G3A A;  1Q81 Q;  1JCD A;  1GL2 A;  2IYO A;  1N73 C;  2YMY A;  3MGN A;  2QM7 A;  1VQ9 P;  5APV A;  3B5N B;  1FE6 A;  1PFI A;  4RO0 A;  3PJS K;  2ITA A;  2YKP A;  3I56 P;  1FOS F;  4D6T G;  3L75 D;  2KNC A;  4H13 C;  1SFC C;  1SQP E;  1GD2 E;  1NTK E;  3RL0 g;  1NTK J;  2A06 E;  1G1I A;  3E1I A;  5E79 H;  1QL2 A;  2B89 A;  5APW A; 
#chains in the Genus database with same CATH homology
 3L75 J;  3CX5 I;  1EZV I;  5KLV J;  1NTM J;  1SQX J;  1BCC J;  1P84 I;  3H1K J;  1KB9 I;  1BGY J;  1L0L J;  3H1J J;  3TGU J;  1BE3 J;  2FYU J;  1SQP J;  1NTZ J;  2BCC J;  1SQV J;  1NTK J;  1L0N J;  3L71 J;  1KYO I;  3L72 J;  1PP9 J;  3L74 J;  1SQB J;  3CWB J;  2IBZ I;  3BCC J;  4PD4 I;  3H1H J;  4D6T J;  3L73 J;  1SQQ J;  3L70 J;  3H1I J;  3H1L J;  4U3F J;  1NU1 J;  3CXH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...