1NTZJ

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1ntzJ00
1BCCJ 1PP9J 2IBZI 3H1HJ 3CXHI 1SQXJ 3CX5I 4D6TJ 2BCCJ 1EZVI 3L71J 1BGYJ 1SQQJ 3H1LJ 1SQVJ 3L72J 3L70J 1L0NJ 1NTMJ 1NTZJ 1SQPJ 3L75J 3L73J 1NTKJ 3H1KJ 3H1IJ 4PD4I 2FYUJ 3BCCJ 1P84I 3CWBJ 1KYOI 1L0LJ 1NU1J 3H1JJ 4U3FJ 1KB9I 3L74J 1BE3J 1SQBJ 3TGUJ 5KLVJ
chains in the Genus database with same CATH superfamily
2O3JA 3GHGA 4XA4A 5AVWB 4RJTA 3H1HJ 3MZWB 2D2CB 5APQA 1GZLA 1YTZT 2E5YA 3CXHI 3PHLA 4PD4H 4BWNA 3HE5B 1GL2D 1CI6B 2YKOA 1PL5A 2IX7C 1RF0A 2D2CD 3PLNA 1SQQJ 5CCHC 1GL2C 3H1LJ 2E74B 4BRYB 3L72J 1SQQE 4CPGA 3CC4P 2RKLA 2PRRA 1JO5A 5CCHD 3LIEA 1U57A 1L0LE 1NHLA 3D6ZA 2G3AA 1G2CA 2V7QH 3CX5D 2JDIH 4EOTA 1A02F 2ZT9C 1S5LE 2QRXA 2NPSA 2FBWC 1BDCA 2L5GB 2QSIA 3HUSB 2ZT9D 1KILD 2W8ZA 3B5NC 2FFDB 3O6QA 1NYHA 3L75D 1QLED 2KS1B 3CCVP 3G4SP 3L74J 4I2LC 3WUTA 1H88A 5L8RJ 1KQSO 3EQ2A 1D7MA 5AW2B 2BCCG 5CCHA 2YNYA 2BEZF 1JB0J 3B5NA 4PD4D 4PJ0H 2R5DA 3MTUE 2QJYC 1LWUB 3HE4A 1HGZA 3EWKA 5TISE 1KTMA 3M0DC 2G8YA 2O1KA 1RQVA 1J1DB 3TNUB 3TGUE 1DD3A 3H1KG 1L0LK 3HE5A 2WT7A 1UIXA 2HLOA 2IYOA 2WQYC 5E79H 3S9OA 1FE6A 1AJYA 5AVXB 1SQPK 2Y0EA 2W6AA 2Q5UA 3D6YA 2PGDA 4OVNF 3P7KA 2QJPB 4RESB 5B5EE 1L0LG 1XTCC 1VQNP 2MJZA 1Q2NA 1YIJP 4IFDK 2E74D 2HPCA 3A0BH 2JR8A 1L2PA 1LJ2A 4MN4C 3CD6P 2GA1A 3HUSA 2NPSD 3L73D 2WMMA 3N7NA 1SQPD 1BCCG 1ZN5A 4M3LA 1Q82Q 2E76C 3RBXA 2Y0DA 2FYZA 3GG2A 1KV4A 1VF5D 1KB9E 1ZRTE 3P8CD 2WVRA 3TGUJ 1PIXA 5AW9B 2OYHA 3CC2P 4WWIA 4D6TD 2JKVA 2QM8A 2CPBA 3MHVA 2B89A 2E75C 1EDIA 3H1HE 3G6EP 4YXDC 2WPVB 1KQFB 3L73G 2WSEJ 4I1LA 5KAIE 4HKZH 2Q3IA 3A0HE 4L76A 1NAFA 1AV1A 1PGQA 1KQLA 1NH4A 1FZBA 2A45H 1J1DC 3FXDA 4N78D 3GHGB 4AYCA 2JWAA 4ZMDA 1H89A 1LWUC 3AE6C 4JQ0D 1KZUB 3RK3D 1NU1E 3KYQA 4GDOA 1NTKG 2WT7B 4GOFA 3U1AA 2KB7P 4L75A 3CX5H 5AW6B 1VQ6P 5CBOA 1FBMA 2NZ2A 1SQVK 2K9JB 3K5BA 3UIAA 1RF1B 1U7JA 4EDFA 2E76B 1HBWA 1RY3A 3HUSC 4YPCA 2ZFCA 3VMYA 1PPJD 1NO4A 1CZQA 1URQB 1NU1G 1NKZB 1PV3A 3E1IA 5CJ4A 3KZIH 4UB8E 1BSHA 1LGHB 1IK9A 2K9JA 4H13C 1T6AA 1PP9D 1OW8A 3O6QB 1ZR2A 5KLVD 1N7SC 2ZYGA 1FU1A 2P7JA 3MP7B 2AEMA 2E74C 1VQ8P 2NRGA 1NTMJ 1KYOE 3RK2C 1JTHB 4EI2A 1VDFA 1WRGA 3BRVB 2N9YB 1IFPA 2KZJA 1P84H 3WUVA 3L74G 5AW3B 4YXWH 3H1ID 1YQ3C 4NPFX 2IBZG 3CXHD 5APSA 1KYOI 1JM0A 2FKWB 1Y9BA 2FYNC 2PP6A 1PP9G 2M8RA 1YBKA 3C9IA 3L74E 3P8MC 4PV1C 4H0LD 3CCJP 1LTIC 1TU3F 1X8YA 2O1JA 3LW5J 2WSFJ 1R5LA 1FOSF 3L71D 1PP9E 4JYCA 2RN0A 1KFMA 2XNDH 2XZRA 1Q90D 2CK3H 3AE3C 3L72E 4U3FG 1T2KD 1Q7YQ 1JOCA 5GTHH 3HD7B 1HUCA 2FXOA 5CCGC 3V4QA 3TDKA 1FZCC 2K88A 3TGUD 1YJ9P 2I8DA 5KAFH 1L0NJ 2QA4P 2KP8A 4HB1A 4JBZA 2XNXA 1S4XA 1S3JA 3B8EB 3AEAC 3BCCD 3KXDA 1VQOP 1SFCD 2O01J 1JY2P 2W83C 3B5ND 2WSCJ 3L4FA 2ZXXA 2OYOA 1EZVG 1SFCC 3M91A 1BE3G 5CMZA 5C39A 3TGUG 3BCCJ 3G9RA 4ZNCA 3CC7P 3SWYA 1FOSE 1LTBC 2HODA 1KILC 2FYUE 2XKMA 3SFDC 3M0DA 3VMAA 4BXLA 1BGYD 4DOJA 1EDJA 3V2RA 1LTJA 2DW3A 2FY8A 3Q1MA 2M5AA 1OMIA 5KKZC 3Q5RA 1H0TA 2QE7H 3IN6A 1SQXJ 4TT3H 1BCCD 1KQGB 1P84D 1FZAA 1L4AD 1KYOD 1M7LA 2WPSA 3JCUH 3FWNA 5KAFE 3V2PA 2I1KA 3H1HG 1BE3D 3M9HA 3WU2H 5BVZA 1R8EA 1NGMB 3VYIA 2JO1A 5AW8B 3PTZA 1OVRA 1L4AB 1SQBK 3GMAA 3IAOA 3L71E 1SLQA 1NTKJ 4H13D 1FZCA 1X9VA 1LP1A 1SS1A 1KILE 2KK7A 3I5CA 4H0LC 1GW4A 2P10A 3A2AA 3BRTB 2IBZD 2PAJA 1S1CX 1SQXE 2QG4A 3TK1A 1OW6A 1ZV8A 3H1IG 1NU1J 3A0HH 4DCKA 1NTZD 1NTMD 1FAVA 1USDA 2Q3EA 1SFCA 3E7KA 1RE3A 1RE4C 1HVVA 1KFNA 1SQQD 1OW7A 2P67A 3P8CE 3H32A 3CL3D 4DT0A 5KLVJ 3CWBG 1LTJB 1PPJG 4ASWA 1YJWP 3KQGA 5BU8B 2C0WA 3PP5A 4DJGA 3F5HA 1LTAC 2Q9IA 2RMZA 5B66E 3L70G 4GT1A 4YTPC 1JNMA 2C9LY 1OXZA 1AFOA 1AA0A 4HH2A 5H2FH 1OVVA 1IFIA 3SWKA 2PFXA 1IFDA 2YXQB 3L75E 3CLQA 2OYIA 2W27A 1MUUA 4GKGA 4LC1A 5AW1B 1OZHA 3CWBD 3CCQP 1L0NE 1MFTA 3NFQA 2LKMA 1FZCB 3KZIE 4UB8H 1L4AA 2Z4EA 2D2CC 2W90A 1K9MQ 1ZMEC 1HF9A 1NTZG 1IK7A 1GW3A 4OWFA 3V2QA 4XFJA 3I56P 5APWA 4U7JA 1BE3E 1M1JC 1NTKD 1SP4A 1EZVD 1L0LJ 1NVOA 3HTKB 2Q7CA 4AUWA 1E5WA 2XU6A 1DD4A 2KUBA 1N7LA 2FYUG 2IFMA 1BCCJ 1E79H 1HJBA 1FJKA 1SQXD 4R4MA 1M56D 1T3JA 1IFMA 2QM7A 3VTPC 3ZDMA 1L0NG 2ZVOB 5KJ7C 4D6TJ 1AQTA 1GK6A 2A06D 2WSSH 3M9BA 1YYCA 1JCCA 1BGYJ 3BATA 4I6MC 3USSA 3L36A 3PJSK 4Y99B 5K5GB 3CCEP 4D6TE 2W6JH 1JUNA 3VP8A 1SQPJ 3H1JD 2NPSC 2M5AB 3L73J 1GTWA 1KB9D 3AE4C 2H43A 3BCCG 4KHXA 1N7SA 2H88C 2YKQA 1KN7A 1M8OB 1EDLA 1J1EB 3BASA 2L91A 1J2JB 1S72P 1KB9H 1CSBA 3M06A 2JP3A 2XV5A 2Y0CA 3H1KD 3NMDA 3R2PA 3AEGC 5CJ0A 3TNUA 3IFMA 3H1JJ 1AQ5A 1KD1Q 2WITA 1L0ND 3Q5SA 1YI2P 1SQXG 5APUA 3G71P 4WY4A 1M1JA 2YMYA 3PH0A 3GF3A 1ZLLA 3WU2E 3CMEP 3FWLA 2FFDA 3WMM0 3JCUE 2QJPC 3CX5I 2ZT9B 1T2KC 2FYUK 1JY3O 4L74A 3Q5PA 2H7HA 4KT0J 4N3YB 3BCCE 3GHGC 1SQVJ 2K9YA 3A5TA 1AVOA 3RL0B 1ZR4A 2W6BA 1USEA 3JC22 3JSVC 1IFNA 2IPPA 3EFFK 1YHQP 1EXIA 2MKVA 4JPZB 3H25A 2ZJSE 2N9BA 2RH0A 1DEEG 2LXBA 3H1IJ 4PJ0E 2JEEA 4H44D 5AVUB 3RL0D 1VQ9P 1NTMG 5EFWB 2E75B 1LTSC 2LR2A 1HGVA 4PD4I 3AEEC 2R3SA 2OQQA 4W80A 5CBNA 2B9BA 2LXCB 5KLVG 3CWBJ 1BSNA 4C7NB 1FC2C 1LTTC 1FJPA 1SVFA 2ZXEB 5KJ7D 3LIDA 2OARA 2POHA 3HRNA 1URQA 3MIWA 3G3ZA 2AXTE 2K1AA 3N4XA 5AVQB 1S5LH 3S1KA 2FFDC 4NPDA 2UWJE 1H8AA 1PP9J 3KDPB 1A02J 1EXJA 4IFMA 1NTKE 3QH9A 1JMBA 4W7YA 1LT9B 3AE8C 4WY4C 2Y9ZA 4H0LB 2WPRA 1IJDB 2IFNA 3EFGA 1JEKA 4Z1MH 3L70E 4WB4A 2HPCB 2B87A 2J5UA 1L4AC 1BGYE 3I55P 1NTZJ 1OX3A 4K35A 1NU1D 3CWBE 1N73B 2V7QJ 2JJLA 3CXHH 3V4WA 4IL6E 3RBZA 1FZGA 3ITKA 4HYTB 3MGNA 1JCDA 5B66H 1SQXK 2YMKA 5AVSB 4ASVA 1HH0A 1S9KD 2FYUJ 1EC5A 1NU1K 2QJKC 4C46A 1KMIZ 3AEFC 1PPJE 3C8VA 3HE4B 3OJAB 3U1CA 1RF1C 5AW7B 2GUVA 1BE3J 1KYOH 3B5NB 2Y9YA 3GF7A 3B4SA 4GODA 4ZKPA 1VPCA 1X79B 2WWWA 4UB6H 1M1KQ 3RK3B 5CHXA 1BGYG 1T3UA 1URQD 1R5SA 2HYNA 3M0AA 4BRYA 4W7ZA 1NOHA 2BASA 3MUDA 1RE4A 2QIWA 1EZVI 3RK2B 1AVYA 2AEFA 4HJGH 2NPSB 3L37A 2R5BA 4N78E 1L0NK 3OA7A 2Z5IA 1K73Q 3T97A 5AVZB 1G2CB 2J58A 2ZYAA 4RO0A 5BU5A 1VQKP 3AEDC 3L35A 4K3AA 4WY4B 3TF5A 2KLVA 3CCRP 3IR9A 2QJYB 2B87B 3AEBC 1PZQA 1QL2A 2AXCA 2KSEA 2N1TC 3H6PA 4TLFA 1FDOA 1UIIA 3HTKA 4ZKUA 1IC2A 4B86A 4C7RA 1GD2E 1N73C 1IO4A 1NTME 1LWUA 3SSUA 2V4HA 4H44C 1QEXA 1N8RQ 1G1JA 3RGUA 4AQRD 5AW5B 2XDJA 3H32B 1NJIQ 2OTKE 5KTBA 1EQ7A 1Q81Q 5KLVE 1SQQG 2A45G 3H1LG 1RE3C 1SQVG 2N1TB 1N7SD 2GUSA 5KAIH 3II6A 4C7NA 2BEQD 2YIUB 4IFFA 4IOIH 2OTLP 3L71J 4IL6X 3V6IA 3E1RA 3FGAD 5AW0B 3QWOC 2H8PD 2Z5HA 4OGQC 5KLIC 3HD7A 3L74D 3BVHA 3L70J 3V2NA 2K3RA 1N86A 2KLUA 1Y8AA 3FX0A 3PRJA 3CX5E 1PGPA 1FZFA 3S4RA 3RK2D 2IZ0A 3CPWO 1M90Q 2C9NY 2HG5D 1JY3P 2R3CA 2ZYDA 1KILA 3L75G 2IBZE 5GTHE 1GMJA 1LTJC 1URQC 3L73E 4QMAA 1EDKA 1KILB 2KSJA 4OH8B 5APVA 1YITP 2Q6QA 3L72D 1MFZA 1LTGC 3FXEA 1GDTA 3Q2YA 3H1LD 2P1JA 4L73A 4N6JA 2GM4A 1VL2A 1YQ4C 1OIPA 1VQPP 2IYPA 2QJKB 3WUUA 3F89A 1VQ5P 2IBZI 4IL6H 3CCLP 3CXHE 3TSIA 3H1HD 1KC8Q 1VQ4P 1BCCE 1P84E 1VF5C 3H1IE 4WVZA 3VMZA 3CCMP 3M9QA 3RL0g 5CCGD 1SQQK 2J59M 1LNQA 3H1KE 3GLMA 4Y99C 1GL2B 1ZRTD 5M1BA 3D70A 1DIPA 1U7MA 3O8ZA 3RL0C 1N7SB 1NTKK 1X0TA 2E75D 3VN0A 4D6TG 5CCGA 2WTYA 2FYUD 5DJTB 4H13B 2YKPA 3HD7C 2R32A 3AECC 1RHZB 1BDDA 1GL2A 3H1JE 4RKUJ 3B71A 1SQPG 4I7ZB 1DH3A 1FDMA 1W5CE 3HD7D 2E5TA 1YTZI 2KNCB 2M3EA 2SPZA 3H1LE 3NXSA 5KKZB 1OFCX 1RQUA 3CCUP 2A06E 1YJNP 3AE2C 1PGJA 3AE1C 2FXPA 2FYNB 2WSFH 2HR3A 2YXRB 3A3YB 4Y28J 2E43A 2ITAA 2WZ7A 5E79E 1ZP0C 1NAYA 3MUDC 3MD0A 2A45I 3H1JG 3T97B 4GOEA 5APTA 3VMXA 1GU4A 2E42A 1NWQA 1SFCB 1K04A 1JY3N 1SQBG 2VRSA 3OAKA 3KHUA 2A06G 1WT6A 2OYIC 1QVFO 5APXA 4PD4E 5AVTB 3VP9A 1T8ZA 2M0BA 1GU5A 2WSEH 2B88A 2Q1KA 2ZAEB 5DJUB 1SQPE 1NTZK 4U3FD 3AE7C 2OYHB 3SFEC 1ZOYC 1S9KE 2O01H 1JTHA 2WSCH 1HTLC 4R4LA 3L72G 2OYIB 1Y47A 2HODB 1VQ7P 1LT1A 1PFIA 1JMMA 3V5BA 3OW2O 1ZW0A 1P84I 2KNCA 1CI6A 3AE5C 3C1LA 2YO3A 4DZOA 1S2EA 3L70D 5AW4B 2HFED 1KORA 3NTNA 4H44B 1SQVD 2O01N 2E76D 1IFJA 1GK4A 2BCCD 1M1JB 3L71G 4I7ZC 3CCSP 3RK3E 1VQMP 1FDIA 4WBAA 3A0BE 1RF1A 1MZ9A 3KPEA 4LLHA 2WPQA 1J1EC 3GW6A 4UB6E 1K05A 1DX7A 1JY2N 4EYYQ 2BCCJ 2K37A 1QGKB 4GIFA 1MV8A 1SQBE 4JYBA 4NPEA 5B5EH 1LT9A 3SWFA 1HWTC 1OWAA 3VOPA 1NKNA 1LP1B 1MKMA 2KYVA 1IZNB 1VF5B 2YO2A 3L75J 4EIJA 2YIUC 2IZ1A 3H1KJ 3IF4A 2N1TD 5GTIH 2OTJP 1WMKA 1LT9C 2KS1A 3ABVC 1FS0E 5TISH 3RK3C 4JF7A 4O9BA 1EZVE 2QEXP 2BCCE 3R4YA 4LGDE 4U3FJ 5AVYB 3CMAP 1DEBA 1Q86Q 1NTMK 3D71A 1QVGO 1H0TB 1SQVE 5KJ7A 3TYYA 2C0XA 2CPSA 1PGOA 1NTZE 2KOGA 1M57D 3LW5H 5KLVK 4KJMA 1RF0C 1CW5A 2OGUA 2AXTH 5AVRB 1JY2O 1N2DC 4OGQD 2P2UA 3A7OA 2H89C 5AVVB 1SQBD 1VQLP 1HJ0A 4A7PA 1Z56A 3CI9A 3P32A 3W67A 4OGQB 1QX8A 2KZIA 1OVUA 2I1JA 4U3FE 1XTGB 4XE5B 5KLIB 1L0LD 1W2EA 2KI7B 2KXPB 4WY4D 2M3BA 2KIKA 2QVAA 5H2FE 3W68A 3Q3DA 2R44A 5APYA 2P58A 2IDBA 1X22A 2AEJA 2FXMA 5TJHA 3AE9C 4PV1D 1G1IA 2OYHC 1ZXGA 1RH5B 3U59A 2JWDA 2ZVNB 5GTIE 1W2BO 1KB9I 1S5LX 1QL1A 2N1TA 4PV1B 1K8AQ 1SQBJ 1FZEA 1N73A
chains in the Genus database with same CATH topology
1BCCJ 1PP9J 2IBZI 3H1HJ 3CXHI 1SQXJ 3CX5I 4D6TJ 2BCCJ 1EZVI 3L71J 1BGYJ 1SQQJ 3H1LJ 1SQVJ 3L72J 3L70J 1L0NJ 1NTMJ 1NTZJ 1SQPJ 3L75J 3L73J 1NTKJ 3H1KJ 3H1IJ 4PD4I 2FYUJ 3BCCJ 1P84I 3CWBJ 1KYOI 1L0LJ 1NU1J 3H1JJ 4U3FJ 1KB9I 3L74J 1BE3J 1SQBJ 3TGUJ 5KLVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC J;  1PP9 J;  2IBZ I;  3H1H J;  3CXH I;  1SQX J;  3CX5 I;  4D6T J;  2BCC J;  1EZV I;  3L71 J;  1BGY J;  1SQQ J;  3H1L J;  1SQV J;  3L72 J;  3L70 J;  1L0N J;  1NTM J;  1NTZ J;  1SQP J;  3L75 J;  3L73 J;  1NTK J;  3H1K J;  3H1I J;  4PD4 I;  2FYU J;  3BCC J;  1P84 I;  3CWB J;  1KYO I;  1L0L J;  1NU1 J;  3H1J J;  4U3F J;  1KB9 I;  3L74 J;  1BE3 J;  1SQB J;  3TGU J;  5KLV J; 
#chains in the Genus database with same CATH topology
 2O3J A;  3GHG A;  4XA4 A;  5AVW B;  4RJT A;  3H1H J;  3MZW B;  2D2C B;  5APQ A;  1GZL A;  1YTZ T;  2E5Y A;  3CXH I;  3PHL A;  4PD4 H;  4BWN A;  3HE5 B;  1GL2 D;  1CI6 B;  2YKO A;  1PL5 A;  2IX7 C;  1RF0 A;  2D2C D;  3PLN A;  1SQQ J;  5CCH C;  1GL2 C;  3H1L J;  2E74 B;  4BRY B;  3L72 J;  1SQQ E;  4CPG A;  3CC4 P;  2RKL A;  2PRR A;  1JO5 A;  5CCH D;  3LIE A;  1U57 A;  1L0L E;  1NHL A;  3D6Z A;  2G3A A;  1G2C A;  2V7Q H;  3CX5 D;  2JDI H;  4EOT A;  1A02 F;  2ZT9 C;  1S5L E;  2QRX A;  2NPS A;  2FBW C;  1BDC A;  2L5G B;  2QSI A;  3HUS B;  2ZT9 D;  1KIL D;  2W8Z A;  3B5N C;  2FFD B;  3O6Q A;  1NYH A;  3L75 D;  1QLE D;  2KS1 B;  3CCV P;  3G4S P;  3L74 J;  4I2L C;  3WUT A;  1H88 A;  5L8R J;  1KQS O;  3EQ2 A;  1D7M A;  5AW2 B;  2BCC G;  5CCH A;  2YNY A;  2BEZ F;  1JB0 J;  3B5N A;  4PD4 D;  4PJ0 H;  2R5D A;  3MTU E;  2QJY C;  1LWU B;  3HE4 A;  1HGZ A;  3EWK A;  5TIS E;  1KTM A;  3M0D C;  2G8Y A;  2O1K A;  1RQV A;  1J1D B;  3TNU B;  3TGU E;  1DD3 A;  3H1K G;  1L0L K;  3HE5 A;  2WT7 A;  1UIX A;  2HLO A;  2IYO A;  2WQY C;  5E79 H;  3S9O A;  1FE6 A;  1AJY A;  5AVX B;  1SQP K;  2Y0E A;  2W6A A;  2Q5U A;  3D6Y A;  2PGD A;  4OVN F;  3P7K A;  2QJP B;  4RES B;  5B5E E;  1L0L G;  1XTC C;  1VQN P;  2MJZ A;  1Q2N A;  1YIJ P;  4IFD K;  2E74 D;  2HPC A;  3A0B H;  2JR8 A;  1L2P A;  1LJ2 A;  4MN4 C;  3CD6 P;  2GA1 A;  3HUS A;  2NPS D;  3L73 D;  2WMM A;  3N7N A;  1SQP D;  1BCC G;  1ZN5 A;  4M3L A;  1Q82 Q;  2E76 C;  3RBX A;  2Y0D A;  2FYZ A;  3GG2 A;  1KV4 A;  1VF5 D;  1KB9 E;  1ZRT E;  3P8C D;  2WVR A;  3TGU J;  1PIX A;  5AW9 B;  2OYH A;  3CC2 P;  4WWI A;  4D6T D;  2JKV A;  2QM8 A;  2CPB A;  3MHV A;  2B89 A;  2E75 C;  1EDI A;  3H1H E;  3G6E P;  4YXD C;  2WPV B;  1KQF B;  3L73 G;  2WSE J;  4I1L A;  5KAI E;  4HKZ H;  2Q3I A;  3A0H E;  4L76 A;  1NAF A;  1AV1 A;  1PGQ A;  1KQL A;  1NH4 A;  1FZB A;  2A45 H;  1J1D C;  3FXD A;  4N78 D;  3GHG B;  4AYC A;  2JWA A;  4ZMD A;  1H89 A;  1LWU C;  3AE6 C;  4JQ0 D;  1KZU B;  3RK3 D;  1NU1 E;  3KYQ A;  4GDO A;  1NTK G;  2WT7 B;  4GOF A;  3U1A A;  2KB7 P;  4L75 A;  3CX5 H;  5AW6 B;  1VQ6 P;  5CBO A;  1FBM A;  2NZ2 A;  1SQV K;  2K9J B;  3K5B A;  3UIA A;  1RF1 B;  1U7J A;  4EDF A;  2E76 B;  1HBW A;  1RY3 A;  3HUS C;  4YPC A;  2ZFC A;  3VMY A;  1PPJ D;  1NO4 A;  1CZQ A;  1URQ B;  1NU1 G;  1NKZ B;  1PV3 A;  3E1I A;  5CJ4 A;  3KZI H;  4UB8 E;  1BSH A;  1LGH B;  1IK9 A;  2K9J A;  4H13 C;  1T6A A;  1PP9 D;  1OW8 A;  3O6Q B;  1ZR2 A;  5KLV D;  1N7S C;  2ZYG A;  1FU1 A;  2P7J A;  3MP7 B;  2AEM A;  2E74 C;  1VQ8 P;  2NRG A;  1NTM J;  1KYO E;  3RK2 C;  1JTH B;  4EI2 A;  1VDF A;  1WRG A;  3BRV B;  2N9Y B;  1IFP A;  2KZJ A;  1P84 H;  3WUV A;  3L74 G;  5AW3 B;  4YXW H;  3H1I D;  1YQ3 C;  4NPF X;  2IBZ G;  3CXH D;  5APS A;  1KYO I;  1JM0 A;  2FKW B;  1Y9B A;  2FYN C;  2PP6 A;  1PP9 G;  2M8R A;  1YBK A;  3C9I A;  3L74 E;  3P8M C;  4PV1 C;  4H0L D;  3CCJ P;  1LTI C;  1TU3 F;  1X8Y A;  2O1J A;  3LW5 J;  2WSF J;  1R5L A;  1FOS F;  3L71 D;  1PP9 E;  4JYC A;  2RN0 A;  1KFM A;  2XND H;  2XZR A;  1Q90 D;  2CK3 H;  3AE3 C;  3L72 E;  4U3F G;  1T2K D;  1Q7Y Q;  1JOC A;  5GTH H;  3HD7 B;  1HUC A;  2FXO A;  5CCG C;  3V4Q A;  3TDK A;  1FZC C;  2K88 A;  3TGU D;  1YJ9 P;  2I8D A;  5KAF H;  1L0N J;  2QA4 P;  2KP8 A;  4HB1 A;  4JBZ A;  2XNX A;  1S4X A;  1S3J A;  3B8E B;  3AEA C;  3BCC D;  3KXD A;  1VQO P;  1SFC D;  2O01 J;  1JY2 P;  2W83 C;  3B5N D;  2WSC J;  3L4F A;  2ZXX A;  2OYO A;  1EZV G;  1SFC C;  3M91 A;  1BE3 G;  5CMZ A;  5C39 A;  3TGU G;  3BCC J;  3G9R A;  4ZNC A;  3CC7 P;  3SWY A;  1FOS E;  1LTB C;  2HOD A;  1KIL C;  2FYU E;  2XKM A;  3SFD C;  3M0D A;  3VMA A;  4BXL A;  1BGY D;  4DOJ A;  1EDJ A;  3V2R A;  1LTJ A;  2DW3 A;  2FY8 A;  3Q1M A;  2M5A A;  1OMI A;  5KKZ C;  3Q5R A;  1H0T A;  2QE7 H;  3IN6 A;  1SQX J;  4TT3 H;  1BCC D;  1KQG B;  1P84 D;  1FZA A;  1L4A D;  1KYO D;  1M7L A;  2WPS A;  3JCU H;  3FWN A;  5KAF E;  3V2P A;  2I1K A;  3H1H G;  1BE3 D;  3M9H A;  3WU2 H;  5BVZ A;  1R8E A;  1NGM B;  3VYI A;  2JO1 A;  5AW8 B;  3PTZ A;  1OVR A;  1L4A B;  1SQB K;  3GMA A;  3IAO A;  3L71 E;  1SLQ A;  1NTK J;  4H13 D;  1FZC A;  1X9V A;  1LP1 A;  1SS1 A;  1KIL E;  2KK7 A;  3I5C A;  4H0L C;  1GW4 A;  2P10 A;  3A2A A;  3BRT B;  2IBZ D;  2PAJ A;  1S1C X;  1SQX E;  2QG4 A;  3TK1 A;  1OW6 A;  1ZV8 A;  3H1I G;  1NU1 J;  3A0H H;  4DCK A;  1NTZ D;  1NTM D;  1FAV A;  1USD A;  2Q3E A;  1SFC A;  3E7K A;  1RE3 A;  1RE4 C;  1HVV A;  1KFN A;  1SQQ D;  1OW7 A;  2P67 A;  3P8C E;  3H32 A;  3CL3 D;  4DT0 A;  5KLV J;  3CWB G;  1LTJ B;  1PPJ G;  4ASW A;  1YJW P;  3KQG A;  5BU8 B;  2C0W A;  3PP5 A;  4DJG A;  3F5H A;  1LTA C;  2Q9I A;  2RMZ A;  5B66 E;  3L70 G;  4GT1 A;  4YTP C;  1JNM A;  2C9L Y;  1OXZ A;  1AFO A;  1AA0 A;  4HH2 A;  5H2F H;  1OVV A;  1IFI A;  3SWK A;  2PFX A;  1IFD A;  2YXQ B;  3L75 E;  3CLQ A;  2OYI A;  2W27 A;  1MUU A;  4GKG A;  4LC1 A;  5AW1 B;  1OZH A;  3CWB D;  3CCQ P;  1L0N E;  1MFT A;  3NFQ A;  2LKM A;  1FZC B;  3KZI E;  4UB8 H;  1L4A A;  2Z4E A;  2D2C C;  2W90 A;  1K9M Q;  1ZME C;  1HF9 A;  1NTZ G;  1IK7 A;  1GW3 A;  4OWF A;  3V2Q A;  4XFJ A;  3I56 P;  5APW A;  4U7J A;  1BE3 E;  1M1J C;  1NTK D;  1SP4 A;  1EZV D;  1L0L J;  1NVO A;  3HTK B;  2Q7C A;  4AUW A;  1E5W A;  2XU6 A;  1DD4 A;  2KUB A;  1N7L A;  2FYU G;  2IFM A;  1BCC J;  1E79 H;  1HJB A;  1FJK A;  1SQX D;  4R4M A;  1M56 D;  1T3J A;  1IFM A;  2QM7 A;  3VTP C;  3ZDM A;  1L0N G;  2ZVO B;  5KJ7 C;  4D6T J;  1AQT A;  1GK6 A;  2A06 D;  2WSS H;  3M9B A;  1YYC A;  1JCC A;  1BGY J;  3BAT A;  4I6M C;  3USS A;  3L36 A;  3PJS K;  4Y99 B;  5K5G B;  3CCE P;  4D6T E;  2W6J H;  1JUN A;  3VP8 A;  1SQP J;  3H1J D;  2NPS C;  2M5A B;  3L73 J;  1GTW A;  1KB9 D;  3AE4 C;  2H43 A;  3BCC G;  4KHX A;  1N7S A;  2H88 C;  2YKQ A;  1KN7 A;  1M8O B;  1EDL A;  1J1E B;  3BAS A;  2L91 A;  1J2J B;  1S72 P;  1KB9 H;  1CSB A;  3M06 A;  2JP3 A;  2XV5 A;  2Y0C A;  3H1K D;  3NMD A;  3R2P A;  3AEG C;  5CJ0 A;  3TNU A;  3IFM A;  3H1J J;  1AQ5 A;  1KD1 Q;  2WIT A;  1L0N D;  3Q5S A;  1YI2 P;  1SQX G;  5APU A;  3G71 P;  4WY4 A;  1M1J A;  2YMY A;  3PH0 A;  3GF3 A;  1ZLL A;  3WU2 E;  3CME P;  3FWL A;  2FFD A;  3WMM 0;  3JCU E;  2QJP C;  3CX5 I;  2ZT9 B;  1T2K C;  2FYU K;  1JY3 O;  4L74 A;  3Q5P A;  2H7H A;  4KT0 J;  4N3Y B;  3BCC E;  3GHG C;  1SQV J;  2K9Y A;  3A5T A;  1AVO A;  3RL0 B;  1ZR4 A;  2W6B A;  1USE A;  3JC2 2;  3JSV C;  1IFN A;  2IPP A;  3EFF K;  1YHQ P;  1EXI A;  2MKV A;  4JPZ B;  3H25 A;  2ZJS E;  2N9B A;  2RH0 A;  1DEE G;  2LXB A;  3H1I J;  4PJ0 E;  2JEE A;  4H44 D;  5AVU B;  3RL0 D;  1VQ9 P;  1NTM G;  5EFW B;  2E75 B;  1LTS C;  2LR2 A;  1HGV A;  4PD4 I;  3AEE C;  2R3S A;  2OQQ A;  4W80 A;  5CBN A;  2B9B A;  2LXC B;  5KLV G;  3CWB J;  1BSN A;  4C7N B;  1FC2 C;  1LTT C;  1FJP A;  1SVF A;  2ZXE B;  5KJ7 D;  3LID A;  2OAR A;  2POH A;  3HRN A;  1URQ A;  3MIW A;  3G3Z A;  2AXT E;  2K1A A;  3N4X A;  5AVQ B;  1S5L H;  3S1K A;  2FFD C;  4NPD A;  2UWJ E;  1H8A A;  1PP9 J;  3KDP B;  1A02 J;  1EXJ A;  4IFM A;  1NTK E;  3QH9 A;  1JMB A;  4W7Y A;  1LT9 B;  3AE8 C;  4WY4 C;  2Y9Z A;  4H0L B;  2WPR A;  1IJD B;  2IFN A;  3EFG A;  1JEK A;  4Z1M H;  3L70 E;  4WB4 A;  2HPC B;  2B87 A;  2J5U A;  1L4A C;  1BGY E;  3I55 P;  1NTZ J;  1OX3 A;  4K35 A;  1NU1 D;  3CWB E;  1N73 B;  2V7Q J;  2JJL A;  3CXH H;  3V4W A;  4IL6 E;  3RBZ A;  1FZG A;  3ITK A;  4HYT B;  3MGN A;  1JCD A;  5B66 H;  1SQX K;  2YMK A;  5AVS B;  4ASV A;  1HH0 A;  1S9K D;  2FYU J;  1EC5 A;  1NU1 K;  2QJK C;  4C46 A;  1KMI Z;  3AEF C;  1PPJ E;  3C8V A;  3HE4 B;  3OJA B;  3U1C A;  1RF1 C;  5AW7 B;  2GUV A;  1BE3 J;  1KYO H;  3B5N B;  2Y9Y A;  3GF7 A;  3B4S A;  4GOD A;  4ZKP A;  1VPC A;  1X79 B;  2WWW A;  4UB6 H;  1M1K Q;  3RK3 B;  5CHX A;  1BGY G;  1T3U A;  1URQ D;  1R5S A;  2HYN A;  3M0A A;  4BRY A;  4W7Z A;  1NOH A;  2BAS A;  3MUD A;  1RE4 A;  2QIW A;  1EZV I;  3RK2 B;  1AVY A;  2AEF A;  4HJG H;  2NPS B;  3L37 A;  2R5B A;  4N78 E;  1L0N K;  3OA7 A;  2Z5I A;  1K73 Q;  3T97 A;  5AVZ B;  1G2C B;  2J58 A;  2ZYA A;  4RO0 A;  5BU5 A;  1VQK P;  3AED C;  3L35 A;  4K3A A;  4WY4 B;  3TF5 A;  2KLV A;  3CCR P;  3IR9 A;  2QJY B;  2B87 B;  3AEB C;  1PZQ A;  1QL2 A;  2AXC A;  2KSE A;  2N1T C;  3H6P A;  4TLF A;  1FDO A;  1UII A;  3HTK A;  4ZKU A;  1IC2 A;  4B86 A;  4C7R A;  1GD2 E;  1N73 C;  1IO4 A;  1NTM E;  1LWU A;  3SSU A;  2V4H A;  4H44 C;  1QEX A;  1N8R Q;  1G1J A;  3RGU A;  4AQR D;  5AW5 B;  2XDJ A;  3H32 B;  1NJI Q;  2OTK E;  5KTB A;  1EQ7 A;  1Q81 Q;  5KLV E;  1SQQ G;  2A45 G;  3H1L G;  1RE3 C;  1SQV G;  2N1T B;  1N7S D;  2GUS A;  5KAI H;  3II6 A;  4C7N A;  2BEQ D;  2YIU B;  4IFF A;  4IOI H;  2OTL P;  3L71 J;  4IL6 X;  3V6I A;  3E1R A;  3FGA D;  5AW0 B;  3QWO C;  2H8P D;  2Z5H A;  4OGQ C;  5KLI C;  3HD7 A;  3L74 D;  3BVH A;  3L70 J;  3V2N A;  2K3R A;  1N86 A;  2KLU A;  1Y8A A;  3FX0 A;  3PRJ A;  3CX5 E;  1PGP A;  1FZF A;  3S4R A;  3RK2 D;  2IZ0 A;  3CPW O;  1M90 Q;  2C9N Y;  2HG5 D;  1JY3 P;  2R3C A;  2ZYD A;  1KIL A;  3L75 G;  2IBZ E;  5GTH E;  1GMJ A;  1LTJ C;  1URQ C;  3L73 E;  4QMA A;  1EDK A;  1KIL B;  2KSJ A;  4OH8 B;  5APV A;  1YIT P;  2Q6Q A;  3L72 D;  1MFZ A;  1LTG C;  3FXE A;  1GDT A;  3Q2Y A;  3H1L D;  2P1J A;  4L73 A;  4N6J A;  2GM4 A;  1VL2 A;  1YQ4 C;  1OIP A;  1VQP P;  2IYP A;  2QJK B;  3WUU A;  3F89 A;  1VQ5 P;  2IBZ I;  4IL6 H;  3CCL P;  3CXH E;  3TSI A;  3H1H D;  1KC8 Q;  1VQ4 P;  1BCC E;  1P84 E;  1VF5 C;  3H1I E;  4WVZ A;  3VMZ A;  3CCM P;  3M9Q A;  3RL0 g;  5CCG D;  1SQQ K;  2J59 M;  1LNQ A;  3H1K E;  3GLM A;  4Y99 C;  1GL2 B;  1ZRT D;  5M1B A;  3D70 A;  1DIP A;  1U7M A;  3O8Z A;  3RL0 C;  1N7S B;  1NTK K;  1X0T A;  2E75 D;  3VN0 A;  4D6T G;  5CCG A;  2WTY A;  2FYU D;  5DJT B;  4H13 B;  2YKP A;  3HD7 C;  2R32 A;  3AEC C;  1RHZ B;  1BDD A;  1GL2 A;  3H1J E;  4RKU J;  3B71 A;  1SQP G;  4I7Z B;  1DH3 A;  1FDM A;  1W5C E;  3HD7 D;  2E5T A;  1YTZ I;  2KNC B;  2M3E A;  2SPZ A;  3H1L E;  3NXS A;  5KKZ B;  1OFC X;  1RQU A;  3CCU P;  2A06 E;  1YJN P;  3AE2 C;  1PGJ A;  3AE1 C;  2FXP A;  2FYN B;  2WSF H;  2HR3 A;  2YXR B;  3A3Y B;  4Y28 J;  2E43 A;  2ITA A;  2WZ7 A;  5E79 E;  1ZP0 C;  1NAY A;  3MUD C;  3MD0 A;  2A45 I;  3H1J G;  3T97 B;  4GOE A;  5APT A;  3VMX A;  1GU4 A;  2E42 A;  1NWQ A;  1SFC B;  1K04 A;  1JY3 N;  1SQB G;  2VRS A;  3OAK A;  3KHU A;  2A06 G;  1WT6 A;  2OYI C;  1QVF O;  5APX A;  4PD4 E;  5AVT B;  3VP9 A;  1T8Z A;  2M0B A;  1GU5 A;  2WSE H;  2B88 A;  2Q1K A;  2ZAE B;  5DJU B;  1SQP E;  1NTZ K;  4U3F D;  3AE7 C;  2OYH B;  3SFE C;  1ZOY C;  1S9K E;  2O01 H;  1JTH A;  2WSC H;  1HTL C;  4R4L A;  3L72 G;  2OYI B;  1Y47 A;  2HOD B;  1VQ7 P;  1LT1 A;  1PFI A;  1JMM A;  3V5B A;  3OW2 O;  1ZW0 A;  1P84 I;  2KNC A;  1CI6 A;  3AE5 C;  3C1L A;  2YO3 A;  4DZO A;  1S2E A;  3L70 D;  5AW4 B;  2HFE D;  1KOR A;  3NTN A;  4H44 B;  1SQV D;  2O01 N;  2E76 D;  1IFJ A;  1GK4 A;  2BCC D;  1M1J B;  3L71 G;  4I7Z C;  3CCS P;  3RK3 E;  1VQM P;  1FDI A;  4WBA A;  3A0B E;  1RF1 A;  1MZ9 A;  3KPE A;  4LLH A;  2WPQ A;  1J1E C;  3GW6 A;  4UB6 E;  1K05 A;  1DX7 A;  1JY2 N;  4EYY Q;  2BCC J;  2K37 A;  1QGK B;  4GIF A;  1MV8 A;  1SQB E;  4JYB A;  4NPE A;  5B5E H;  1LT9 A;  3SWF A;  1HWT C;  1OWA A;  3VOP A;  1NKN A;  1LP1 B;  1MKM A;  2KYV A;  1IZN B;  1VF5 B;  2YO2 A;  3L75 J;  4EIJ A;  2YIU C;  2IZ1 A;  3H1K J;  3IF4 A;  2N1T D;  5GTI H;  2OTJ P;  1WMK A;  1LT9 C;  2KS1 A;  3ABV C;  1FS0 E;  5TIS H;  3RK3 C;  4JF7 A;  4O9B A;  1EZV E;  2QEX P;  2BCC E;  3R4Y A;  4LGD E;  4U3F J;  5AVY B;  3CMA P;  1DEB A;  1Q86 Q;  1NTM K;  3D71 A;  1QVG O;  1H0T B;  1SQV E;  5KJ7 A;  3TYY A;  2C0X A;  2CPS A;  1PGO A;  1NTZ E;  2KOG A;  1M57 D;  3LW5 H;  5KLV K;  4KJM A;  1RF0 C;  1CW5 A;  2OGU A;  2AXT H;  5AVR B;  1JY2 O;  1N2D C;  4OGQ D;  2P2U A;  3A7O A;  2H89 C;  5AVV B;  1SQB D;  1VQL P;  1HJ0 A;  4A7P A;  1Z56 A;  3CI9 A;  3P32 A;  3W67 A;  4OGQ B;  1QX8 A;  2KZI A;  1OVU A;  2I1J A;  4U3F E;  1XTG B;  4XE5 B;  5KLI B;  1L0L D;  1W2E A;  2KI7 B;  2KXP B;  4WY4 D;  2M3B A;  2KIK A;  2QVA A;  5H2F E;  3W68 A;  3Q3D A;  2R44 A;  5APY A;  2P58 A;  2IDB A;  1X22 A;  2AEJ A;  2FXM A;  5TJH A;  3AE9 C;  4PV1 D;  1G1I A;  2OYH C;  1ZXG A;  1RH5 B;  3U59 A;  2JWD A;  2ZVN B;  5GTI E;  1W2B O;  1KB9 I;  1S5L X;  1QL1 A;  2N1T A;  4PV1 B;  1K8A Q;  1SQB J;  1FZE A;  1N73 A; 
#chains in the Genus database with same CATH homology
 1BCC J;  1PP9 J;  2IBZ I;  3H1H J;  3CXH I;  1SQX J;  3CX5 I;  4D6T J;  2BCC J;  1EZV I;  3L71 J;  1BGY J;  1SQQ J;  3H1L J;  1SQV J;  3L72 J;  3L70 J;  1L0N J;  1NTM J;  1NTZ J;  1SQP J;  3L75 J;  3L73 J;  1NTK J;  3H1K J;  3H1I J;  4PD4 I;  2FYU J;  3BCC J;  1P84 I;  3CWB J;  1KYO I;  1L0L J;  1NU1 J;  3H1J J;  4U3F J;  1KB9 I;  3L74 J;  1BE3 J;  1SQB J;  3TGU J;  5KLV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...