2E75B

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e75B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75B01
4KT0J 1Q90D 2E74B 2E75B 1JB0J 3LW5J 2QSIA 4H13B 2QJYC 2WPVB 5L8RJ 2QJKC 2O01J 5KKZC 4H0LB 2YIUC 2WSEJ 2FYNC 2QJPC 4OGQB 2K9YA 1VF5B 4I7ZB 2WSFJ 2D2CB 2E76B 4IL6X 2ZT9B 4H44B 1S5LX 4RKUJ 4Y28J 5KLIC 3C8VA 2QIWA 2WSCJ 1ZRTE 4PV1B
chains in the Genus database with same CATH superfamily
1V9PA 2BOBC 3ABMB 3M06A 1AVMA 4GZRB 2D2CD 2QJPB 4J41A 4FPPA 1WLEA 5APYA 1NU1H 4FLTA 1L2PA 1KTMA 1JX9A 1JNMA 1RSOA 1H8AA 1JY3N 1M5IA 5GTHZ 1IBKO 3OUFA 1YCIA 2WLIB 2MJZA 1GN2A 3MAQA 4ZKUA 1A02J 3CMEV 3L74E 5APVA 4U7JA 3WU2Z 4LF4B 3KXDA 2XUMA 3CCJP 2YC0A 1H2KA 3O8ZA 4R4MA 1K4DC 3HB3B 4RO0A 3UCSC 5DM6V 5LMUO 1FFXA 1GTOA 4ABMA 3ASOB 3SYOA 4R4LA 3B8MA 3HUSB 1JPXA 5ITZB 3F89A 5KJ7C 3IC9A 3JAKB 1EDIA 3J81N 2XAHA 1QBZA 2KS1A 3B77A 2G38A 3KDPB 3GW6A 4JPRA 1KILD 2NPSC 3SWFA 1TVKB 2PY5A 3ZRXA 3V5BA 3WUVA 1HNZO 2YXHA 3Q3DA 1EDLA 1RSOB 1IXBA 1TAEA 1BQZA 3RW0A 1SQBG 4JPZB 1SFCC 2WA3A 2JJLA 1KV4A 1HTLC 5CCGA 4DZOA 3GMAA 4CS4A 1N7SC 3H9VA 4FIPC 3BA9A 1WRGA 3VQYA 1HJ0A 4LF8B 2ZNIA 3LSQA 3K08A 1BGYG 3JD1A 4UB6H 1F23A 3OTOO 1T5EA 1GL2A 5CA1A 1WPXA 3H1KJ 5FLXN 5CJ4A 3CMEP 1QHTA 1X59A 4JZ2A 4X89A 1MG1A 2P22C 1IO4A 3OJAB 2E5LO 3G4SP 3EXAA 5FNVB 2IYPA 4MN4C 4UUJC 4RWUA 2P4VA 4N21A 1NTKJ 3L74G 4X65O 1M57C 3AEGC 2JDIH 4JI2O 2YSUB 4H0LB 3VQXA 2YIUC 2ITAA 3BRVB 5AW8B 4RJTA 2ZCEA 2QJYB 1KKCA 2Z3YA 4CZZA 3CC7V 1F51A 4JI5B 1HVVA 4JASA 3SSUA 4RKUJ 1GO3F 3N2GA 1ENVA 3ZMSA 5BZBA 2R9RB 5KLIB 5BMVB 4DUYB 4DV3B 4K0KB 4L75A 3MIWA 4K8ZA 1PL0A 2XTAA 2FYUD 4DR5B 1JFFA 2IFNA 3ZS8C 1G2CA 2Q7HA 3ZRSA 3MUDC 3L71H 2FTKA 2QM8A 1FZCB 1R3KC 2WLJA 2VWJA 4OH8B 4OGQC 1GM9A 3QF7A 1Z5VA 3R2PA 2SPZA 1RM1C 1HNXB 2E74D 2N04A 3ICXA 3BASA 1YHQV 4JQ0D 3A8TA 4DR2B 1SQQJ 2WAMA 1QL2A 4N3YB 3T1HO 1KYOF 3SJAC 2ZDIC 1SQBE 2JVDA 1AP5A 1VL2A 1IK9A 3V2QA 1JMBA 1KILA 3L75D 2KZIA 4PD4I 3H01A 5EZYA 3UO2A 1FKAO 2DMXA 3RK2C 1OCCB 4LF9B 4JYCA 5KHJA 5KKZB 2B1GA 3GB7C 1FZGA 4XE5B 1K04A 3BRTB 3DSQA 2I8DA 1DEBA 1XNQO 5KX5B 1KILC 5AW5B 3ZHUA 4BW5A 1BS3A 3L73G 3H6PA 1BCCE 1HNWB 2F93B 4R8CA 1YIJV 1N36B 1SLQA 1FOSF 1OW7A 1KQSU 4AQYO 2QSAA 4GKJO 1FE6A 1LT1A 3ABKB 4PV1C 1QCEA 3H1HD 3ZEDA 4LC1A 2HLOA 2EINC 3S9OA 5JH7B 1BGYJ 1XTGB 5M1BA 3N2GB 1SETA 2Z0AA 1GZLA 1GAXA 4CPGA 3L71E 4IGGA 2QJKB 3OGIB 4BWAA 1XDCA 3ZRWA 1MV8A 1SQVD 3VMYA 1LWUC 3N2KA 2W8ZA 3V2PA 5C8YA 4CH4A 1R3JC 5LP6C 3ZMZA 3V2NA 3UT5A 3CCSV 3M0DC 1THZA 2IJHA 1SQBH 1E79G 1TA8A 3P3NA 2QRXA 1KD1W 2WMMA 1JUNA 4MSWC 1FJGO 4NB5A 1J95A 1GN4A 3U1CA 1N0JA 3JSLA 2W0XA 4F6RA 4JGSA 3BCCD 2R9AA 3W7UA 1ZTEA 3L73H 4ZI7A 3FX7A 3JAMN 2FYNB 5AVRB 4LFBO 1WNSA 1HDJA 5CCGC 2FYUJ 1UFIA 4O4LB 1G6UA 5IT9N 1DLBA 4U3JB 1SQXD 2VRSA 5B1OA 1GL2C 3IFXA 3CCQV 2RN0A 1RF1B 3AEIA 4WF9V 4FFBA 1VQ5V 1D7MA 1F4NA 3Q2YA 4ZOLB 1X79B 1IXMA 4OXSA 2N1TB 4W7YA 3ABLB 1TUBA 1N7SA 5J2TB 1P84E 1ZR2A 2ZVNB 2IJKA 5CMZA 4FJCC 3BFRA 3TNUB 4ASUG 4N6JA 2LJ2A 5APSA 4PDVA 1LT9C 1OVRA 4B3RO 1YTZT 2WSFH 3MHVA 4WY4D 2OYQA 4ZNCA 3KYQA 5L8RJ 1H38A 1IBMO 4DUZB 2AZ0A 4J9YB 1WA8A 5JCOA 4JI1B 1BT8A 4ICGA 1G2CB 1J1DB 4A5UB 3CB2A 3V2RA 3VMXA 4PHZA 5LGUA 2A45H 2GTAA 4I50A 2E42A 4KXRA 3O65A 3ABUA 5DEDA 3L73E 1B3QA 3L9DA 2VWKA 4K35A 5L3CA 3H1KE 4HYTB 1FXHA 2UXCO 1W0KG 3A2AA 3I55P 2WT7A 3RK3B 4GUNA 3NMDA 2IX7C 1UPGA 1UJWB 5IYBO 3H1LE 4EI2A 4Z1MG 5KJ7A 4NPDA 4KUMA 2ZJSE 3NXSA 3HE5B 5CCHC 2WLNA 3SDLA 2HPCA 5AG2A 2BCCG 5H2FH 3HE4B 1N32O 2LQTA 4JF3A 1KYOD 3JAWB 3MZWB 2CTPA 5KLVK 1FFTB 3JASA 3RGUA 3ZIAG 1SQPH 3NR7A 4GX1A 4HNAA 1R6TA 3V4QA 1OCZB 4DV2B 1N73A 1HH0A 3RYHA 2YKQA 3AEDC 1VQLP 3CXHD 1K92A 3AG4C 4IT5A 2P2UA 3A0HE 3RL0D 2BTQA 2LP7A 2QDOA 3F5HA 3L75E 1KZUB 5AVWB 1HWTC 4MVSA 5E79E 1U96A 3ETQA 3G4SV 1PPJG 3HKCA 1XMQB 3HRNA 1JO5A 3T2MA 1J1EC 2QEXP 1ZLZA 2WLIA 3M99B 1ZP0C 2WQYC 1NJIW 1LUVA 1DK1A 1USDA 3HD7B 2DYRC 4KP4A 3L70D 3EWKA 1L0LK 4I1LA 3D70A 2Y0DA 1GK4A 3VMAA 4WY4B 2ZE8A 2YNYA 1L8DA 3VQVA 2KSEA 3M0AA 1PD3A 2IBZG 3FGAD 5L3DA 5LYJA 1LTIC 4GIFA 1SZXA 2L6LA 5H2FE 1QQCA 1DF4A 3TGUE 1KN7A 1L0NG 5D5QA 1Z56A 1AQ5A 4QPKA 1GMJA 2UXDB 1L0NH 4CC6A 4L73A 3AE3C 4JAUA 1SQVE 4PJ0E 2KLVA 1MMMA 5KLVH 1KILE 2DQ0A 3JAWA 1WB7A 1H88A 5IJ9B 1S77D 3CRMA 2H88C 1H2GA 2Q7EA 5APUA 1E79H 3S3XA 1XMOO 4DR1B 2FFDA 1RPRA 4IL6H 1L0LG 2F1MA 3D3QA 4YY3B 1T3UA 2W6JG 1VQ9P 4TV9A 2Z4EA 1V54B 2A9HA 2XAJA 1NI8A 3L70E 1MA1A 3S1KA 4IOIH 2NPSB 1G1JA 3AG2B 2KP8A 1L1FA 4ASWA 3HPLC 3CPWU 1RF1C 2JWAA 4GX2A 1BMFG 1PGQA 3E8HA 2Q6AA 3HKDA 2EIKB 5IDJA 1J5EB 4UVAA 1W5CE 3CX5D 2ZIOA 1RHZB 2LGQA 1NVPB 4TLFA 2ZT9B 1FAFA 3CX5H 1K73Q 2R5DA 3LDCA 3H1IE 2OTLP 1AR1B 1I5YA 1KB9I 1TUEB 2RN9A 1NKZB 3RT3C 2IBZE 4XDLA 2OIEA 2YXLA 4O4JA 2CTQA 4DV1B 1GN6A 4FVMA 5LGNA 2Q7GA 5CBOA 1AI7A 2FYUE 2CPSA 1RE3C 2HEPA 1H2NA 1AV1A 3B09A 4N23A 4FLVA 3KCYA 2WLHA 2ZKOA 3WU2E 1SQBJ 2DOSA 2P06A 2XASA 3E2EA 2C0XA 4O2BA 1HR0B 1XUQA 5KHHA 2ODMA 2QTSA 2PTMA 1L0NJ 1DIPA 1AP6A 4UCVA 5AVZB 1M56B 5EBWC 5LOVB 2UXNA 3WG7C 4D6TJ 4JI6B 2QWOB 1AVOA 3K0DA 1RFYA 5APQA 3D8CA 2UU9B 3HKBA 1XI1A 1XBLA 2WLLB 4B3MO 3CC2P 2W6AA 1W2EA 2WLKA 4DV4O 1QGKB 4MVMA 4P9OA 2HVJC 3KZIH 1WPBA 4XA4A 2YEVB 2A7WA 3RK2B 5KTBA 3OGCC 4HKZH 1HJBA 1F4MA 5K5GB 5AW9B 1LTSC 1QNMA 3IAYA 2V7QG 2IPPA 3F5TA 4U3FE 1AJQA 1TUBB 3E83A 1N7SB 2FYUH 4MT8A 4DRXA 3R65A 4DR6O 2K88A 4ZKPA 3ZMUA 2IH1C 1J5EO 3UIAA 1RF0C 1RM1B 5B1NA 4AI8A 3L71D 1RE4A 1NTZH 3QH9A 1P4RA 1S5JA 4KHXA 1EDKA 2YS8A 3CHXA 1PGOA 2M0BA 4PJ0Z 3FB5C 3K79A 1J1EB 1Q86W 2PUSA 3QNEA 4F6EA 4LLHA 1GK6A 4GDOA 5AVYB 1TVKA 1NAFA 3NTNA 4D6TD 4R50A 4B3TO 4BIOA 2QJ1A 4D6TH 1KB9H 3SFEC 3CCUP 2QSIA 5B5EE 3AG4B 4LFCB 1KB9D 3CXHF 5KHGA 3E22A 3IR9A 2EZPA 3OD4A 2QEXV 4WCEV 4DJGA 3KZIE 5A9GA 4WBNA 5H9CA 1SF9A 1FJPA 1DF5A 3ETGA 1IVSA 4GODA 3BVHA 1IFMA 2JGDB 2Q6QA 1NGMB 1VQ4V 4I7ZC 4I55B 1S72V 3BABA 1SQXJ 3GHGC 1BE3E 3W7SA 2E5YA 5D5PA 1SQPK 2A45I 4H44D 4LNUA 5EBLC 2JIZG 3C1LA 4AQRD 2Q5ZA 3U0ZA 5BMVA 4JI7B 3D36C 3F7YC 1P7BA 1K7DA 3K59A 1NU1J 1M93A 5AVSB 1PV3A 4DV0B 3ZHTA 2QWNB 5GW7A 2OWOA 1VF5B 4E4EA 1EZVG 1GMGA 1NKNA 1BHAA 4U7OA 1FZAA 4EYYQ 3FB7C 1PP9G 1L0LD 1P84F 3C3SA 4I0XB 1IJDB 1NR7A 2OQQA 2JEEA 2JO1A 2EILC 4YPCA 3S4RA 4UB8E 1VMGA 3BCCH 1BSNA 1K5QA 2XT9A 3OAAG 2HHHB 5CBNA 3B2EE 4GCZA 1IURA 1CW5A 4RO2A 3AE9C 2Q7CA 3AEBC 5AW6B 3FD9A 5KHKA 1I7FA 1QVGO 4DV6B 4DW0A 1SESA 4QJFB 2CDYA 3H1ID 3H1LD 3K9AA 3FXDA 1M90Q 1NYHA 2Y4UA 4NTXA 2KB1A 5LYJB 4JYAO 2OYIC 2AHYA 4QE7A 2R3CA 2FFDB 1VF5D 1N32B 3D3IA 1BSMA 2HJDA 2KG7B 1GK9A 3GLMA 3SYQA 1I08A 3E8GA 3WMM0 1GD2E 3CMAP 1SS1A 3T97A 4X1KB 4AILC 4LWSA 1PP9H 2VQFB 1JOYA 3L75J 5H5NA 1FYJA 3AEEC 1ZLLA 3QWOC 4YIPA 1U7JA 1X4TA 4DR3O 1PIXA 4FM1A 1LTTC 3H1JE 4OX9B 2XNXA 1WP8A 3J80N 5L3EA 2FL4A 2BOCC 5C39A 5EIBD 3F7VC 3BY6A 1S5LZ 4NTWA 3HKDB 3FAVB 4DV0O 2EIMB 1XNRB 3ZJZA 1PV0A 2O3JA 3A0BH 4XBFA 1M4UA 2W27A 4IHJB 3E8FA 2ZINA 1NTMH 4DUZO 1K5SA 1AJPA 3OEHG 2YKOA 3QG5A 1OHHG 3JARA 2X0LA 3N4XA 3RGBA 1SQBK 2LO1A 2BEZF 2IJIA 2YXYA 3GHGB 4ASVA 3TXQA 1RF1A 2BSKB 4U3FD 1K9MQ 3EFFK 2E75D 3WB0A 1OXZA 1FBMA 1J1DC 1Q6IA 1NTZJ 3K58A 1KBHA 4RQEA 3C9IA 2N1TC 2OYIB 2B87B 3CWBG 1Q6HA 2A0LA 1MUUA 4D7SA 1KQLA 3K0GA 2YICA 4F4LA 5KKZC 1YBKA 1T2KD 5HFMA 4FMTA 4LFBB 2ETNA 3C90A 5ITZA 1PM9A 3L72H 1HGVA 3IF4A 3P7KA 4PDMA 3CMAV 2ZR3A 1SS3A 4R6ZA 1PNMA 1ZW0A 5IE9A 3A2FA 4DR7B 2KNCA 3CCMV 1P49A 3Q5RA 3LNMB 2BTOA 1Q43A 1FJGB 1X0TA 3IGAC 1JY2N 1JTHB 3B8NA 2O1JA 2K3RA 3HD7D 3MGNA 1VF6A 4ZBMA 2QA4P 3RFRA 3K5BA 3AE1C 1IZ3A 4KJMA 3OFNG 4L8JA 1PPJD 2UWJE 3E35A 3I56V 2OYHB 1Y6XA 3VOPA 5KAIE 5H6RA 3HKCB 3A0RA 1YI2P 1SA0B 5CBFA 4Z1MH 3SYAA 1KB9F 4DV4B 4AQYB 3RYHB 3TGUJ 1HNWO 2RMKB 2PI4A 3FWNA 4HAMA 2AGAA 2XAQA 1U7MA 4NKGB 4DRXB 1EZVD 3TNUA 3FB6C 1XNQB 2IU3A 1EZVH 4B7KA 1AILA 1H0TB 1FAVA 2AXCA 4LF9O 2FXPA 5A2QN 5AW0B 4JTDB 3G6EP 3SJBC 2E5TA 3DXRB 1KKDA 2NZ2A 4Y99B 3E86A 2EBOA 1OCOB 2Q69A 4OX9O 4U3JA 2GM4A 4DR3B 1FDOA 4DR2O 5TISH 1JA8A 1VQOV 3KZIZ 3MHHC 1HNXO 2PYJA 3QVNA 1F7YA 1YTFB 3CCUV 1ZWIC 2P6JA 5KAIH 5IY5B 3W7WA 3M9QA 3G80A 2WA4A 5CA0B 1OMIA 2WWWA 4I7ZB 1P84D 2C0WA 4DR5O 3CWBE 2J59M 1P84H 1ZL8A 2LXBA 4Y28J 3BEHA 4J9ZB 1QLEC 1S5HC 1YDXA 5L3BA 1JMMA 1NTKE 2CK3H 4LCUC 2ITCC 2K9JB 1ZAUA 4TWKA 1S0VA 2KYVA 1HGZA 1BDDA 4TT3H 4C46A 5BVZA 1FS0E 2OGUA 1KC8Q 4JI5O 1YQ3C 5B1BB 1KP3A 3JARB 4NPFX 2QKSA 3R4YA 4DV6O 3E22B 4JI2B 3BATA 1YITP 2IDBA 1YJWP 1RQUA 4DOJA 3I5DA 1ZXGA 2JDIG 3K5LA 1NBMG 4LR3A 1KQFB 3QTCA 1CZQA 2Q1KA 1I5XA 3L70J 1U97A 1K4CC 4BXLA 2WPQA 3H1KH 3RYCB 5E79Z 1NU1E 3OUSA 2WSEH 1VQPV 3OTOB 1CI6A 1OWAA 2H3OA 4DR1O 2R3SA 2CPBA 3UKMA 2Q0OC 3BPZA 2C9NY 5GTHE 4DV5O 3SFDC 4WFGA 3APOA 1LTAC 5B66E 2FY8A 3ZMVA 3CRAA 5EC1C 3CCJV 1EXIA 2CAZC 2Q8VA 3PRJA 1O9GA 3IC7A 4AUWA 1G8MA 3L75G 1TU3F 4PDRA 1SQVJ 4H13D 1I94O 5KUKA 1I94B 2WSCJ 1NU1K 4TV9B 3GWOA 4WB4A 3K5MA 1J2JB 1FZEA 3W7XA 4X1YB 2F66C 1FXKA 1MABG 1MNGA 3AK3A 3SPGA 1QX8A 2YI9A 2VS0A 1AJNA 1XHZA 1AA0A 4UCOA 5C93A 4DV5B 3G6EV 3VP8A 3PH0A 1EDJA 1HBWA 1DH3A 2IYOA 4FLUA 2CGOA 1CP9A 3CL3D 2ZE5A 3GF7A 1XHXA 2N9YB 3KPEA 2AXTE 2IZ0A 1VQ8P 2HG5C 1T8ZA 2YIAA 4XDKA 1Z2GA 5AVQB 4ZMDA 4H44C 3CPWO 2H43A 3BRCA 4L87A 1FXKB 4I2LC 2YEVA 1MFTA 2ITDC 1SQPG 3RL0B 1V54C 4FM2A 3H25A 3UO3A 2AW9A 3R66A 1DTOA 1I0HA 3D6YA 1SQQK 5LP6A 3A5TA 1KECA 1CXZB 4UV9A 4UV8A 2R5BA 5IJ9A 3ABLC 1PGJA 2P7JA 2IFMA 3CRRA 2FB5A 2PGGA 1URQD 2Y48A 4UFZA 2XKMA 3M9BA 3L70G 2BCCD 3LIEA 2XNDH 1N33O 1AFOA 2O01N 2XNDG 3AG1B 4WBNB 3OT7A 2V4HA 1RPOA 4B3MB 3N27A 2O57A 2YI8A 2XAFA 3OMNB 4F6RB 1GH6A 4W4KA 3L72J 5IYCO 3WB1A 1JY2O 1QL1A 3SPCA 4JI6O 3ZN0A 2FXOA 1S4XA 1NTZG 3RYIA 2YO2A 1DD4A 4MVOA 1OCCC 2LXCB 1Q8IA 4J10A 1VQ5P 1VDFA 2YDEA 1OV9A 4JI1O 1HP8A 5GONB 3L35A 1HR0O 3HR0A 1VQNV 1EQ7A 3MD0A 2ILMA 1IBMB 1AROP 2N05A 1OVUA 2YMKA 3B5NB 2P10A 4LH6A 1FXVA 2Q5UA 2P4KA 3CCEV 4U7NA 2EINB 4LFAO 4DV1O 2HODA 1SQPE 4DCKA 2ZYGA 2HKOA 1Q5OA 1FXKC 5CA3A 2L5GB 1SKVA 2PAJA 3RL0C 2RKLA 1NVOA 4WFEA 2KSJA 2YXRB 5IYDO 3TJTA 1Q7YQ 3BA8A 2A06D 3WFVA 3L75H 3K5NA 2R44A 2A06H 1AJYA 1SFCA 5E79H 4I4TB 4WBAA 2NRGA 1DGSA 3VBBA 4MS2A 5AW2B 3B40A 3DTUB 3P32A 3GHGA 3PHLA 1M90W 2WLLA 2HG5D 1YEWA 3B4SA 4TUYB 2L91A 5AW3B 3H32B 4BR6A 2WTYA 4UB6Z 4DR7O 3DGEA 3L36A 3ZCCA 2E75C 3SGIA 1SQXE 1SQXK 5HFLA 2QIWA 1R6KA 1R3LC 2FYZA 2E74C 1M9NA 3FXEA 2BTQB 2LKMA 1IFDA 1KORA 3JATA 3USSA 4MTGA 2OIGA 4W4LA 1D2DA 3NFQA 5KHIA 1R1BA 5IYZB 1XMOB 1SQPJ 3CS5A 2ADQB 4X1YA 1SQVH 1BL8A 4PJ0H 1W2BU 4RQFA 3CLQA 5KLVE 3CCLV 3RL0g 1Q3EA 5APTA 4NPEA 3I55V 4OVNF 3M7MX 1SQQH 1H8EG 2MK3A 2V1DA 4I9QA 2Z5UA 4PD4H 1K8AW 1PPJE 3VQWA 4X1KA 3ETDA 4JAVA 1RE4C 2HP8A 4JYBA 3ZHVA 4GKJB 5GTIE 2R9IA 3H1HG 4D7TA 2HJFC 1M57B 2E75B 3CCLP 5LA6B 3MTUE 1IFNA 2Q3IA 2H7HA 4X9QA 3CCVV 2VQEB 2XOKG 1XREA 2UUAB 1BGYE 1VQPP 1S5LH 3L73D 5KAIZ 4MVQA 5KMGA 1XNRO 4IL6Z 2NNUA 2W0FC 3CI9A 4EIJA 3H1HJ 1FOSE 3L72D 5TISZ 5FPOA 5JJEB 1AR5A 4OPHA 2PF4E 3U1AA 3T1HB 2QE7H 5JQGB 1EBOA 1YITV 3CCRV 1XMQO 3O6QA 1SQVG 4MVRA 4HZ3A 5BXZA 4I55A 2VQFO 1N4CA 3H1LJ 2IZ1A 3X2QB 2KSDA 3IFMA 2CH7B 1VQMP 2OT5A 1X22A 1A02F 3B5NC 1E1QG 5GONA 3H1KG 4DV2O 2I1KA 4G28B 5J2TA 2VRZA 1BE3H 3AECC 1FJKA 2EULA 1B6QA 1NWQA 4L74A 2OTJP 1KQSO 1VF6C 4ZKIA 1NTMK 1M1KQ 4JYAB 4MVZA 1GL2D 3AE8C 1RY3A 3JAKA 1BGYD 3THOA 3FYIB 2ZXWC 3QO7A 5EYPB 4BW9A 2OYOA 3HUSA 5CHXA 4YHHO 1YJNV 4L76A 4EKWA 4BRYB 4CS2A 4AHCA 1YVWA 3RK3C 2HHHO 3HKEA 4GKKB 3AK2A 4ZI7B 4FLWA 2HFED 2R32A 2WSEJ 2E5LB 1PKXA 1NH4A 2AEJA 4PA6A 4FZ1A 3CX5I 1ZOYC 3SPIA 4WY4C 3K03A 3JCUZ 2C9LY 2JRIA 3VTPC 4EDFA 2KOGA 1ZR4A 3C8VA 1S9KD 2DYRB 2LW7A 3LSSA 4CH5A 2N1TA 5KLVG 4TUYA 1LUWA 1LTJC 5B3SB 4EEQA 5LP6B 4LF8O 3BCCJ 5KJ7D 1MOFA 1KYOH 1IBLB 3MDSA 3LNNA 3A0HZ 4X20B 2QWQB 1SQPD 1QR8A 1AR4A 3ABMC 4JI7O 3CXCU 1IZNB 1SFCB 4GKGA 1FZCA 3A7OA 1LT9B 2X6CA 1GKFA 1AQTA 1H2SB 4OGQB 1R73A 3X2QC 1HNZB 4DXWA 1FZCC 3L71G 3HKBB 5JH7A 4X88A 4MTFA 3E1IA 2DE0X 1PL5A 2OYHA 1MZ9A 1SZTA 2NN4A 1L4AB 4ZIBA 1FS0G 5CBGA 2A45G 2E76C 3II6A 1JJOA 5CCHD 2Q9LA 3CD6V 4UCSA 2WSSH 1KMIZ 3RWRD 4Z2WA 5CJ0A 1D5NA 1KC8W 1HWYA 3HUSC 4RESB 1NJIQ 4U3FJ 4O2BB 2D3OW 3JCZA 2BCCJ 4IFMA 2F43G 4LFCO 1B06A 1Y67A 5LA6A 5LMUB 3U10A 1QEXA 1KB9E 1ZV8A 4B3TB 3ASOC 1JMKC 1URFA 1IDSA 5GTIZ 2GA1A 4LF7B 3AE6C 5KUMA 1Q82W 4O2AB 5CB4A 2WVRA 1KU9A 1K33A 3ML0A 1YQ4C 2QKCA 3LSUA 3F5WC 1IBKB 2E43A 3STLC 3L71J 1NTME 5KLVD 2OYIA 2O01H 4LGDE 2JK5C 3CRCA 4DR6B 3QO5A 1JFFB 2K1AA 2LFRA 1LWUB 1XL6A 1EFRG 4BIUA 1YI2V 1PNKA 3AE4C 3LUTB 1NH2B 1LTJB 2P1JA 3SWYA 1IC2A 1Y66A 3IAOA 2L35A 1XEQA 4DV7O 1EXJA 4MTXA 2X6BA 2JJ1G 4J7JA 1N0NA 2OCHA 1N86A 2KB7P 4G27B 1QLNA 1JJ2U 4OGQD 1SQGA 1Z5WA 2HFEC 2KS1B 1W0JG 4C7UA 1RP3B 5EFWB 5JJNB 3DC5A 1PGPA 2YMYA 4B86A 2N9BA 2QR4A 1KQGB 1JM0A 1XILA 1KYOI 4XFJA 2EIJC 3WG7B 2UU9O 3CXHI 3CCMP 1VQNP 2CK3G 3ZRVA 1MSDA 5J2UB 5IYZA 1S76D 2Y9YA 2IBZH 5AVVB 3LDEA 3Q4HB 4PD4F 3V4WA 5CCHA 2IBZD 4H37A 4PI0A 5JVDB 2FYUG 1BHBA 3UQ8A 1R5SA 1R6NA 3CYOA 3BVOA 2M3BA 3Q5SA 4TSFG 1M56D 2ZT9C 1URQA 1EN5A 1JCDA 2YKPA 1CEZA 2GDSA 3I5CA 3G67A 3OR6C 4RUEA 5KLVJ 1ZUQA 2B5UA 4BIZA 2G3AA 1HF9A 2Q73A 1E1RG 1GM8A 2YIBD 2B9BA 2BSKA 2CTWA 3L72G 1QU7A 2WPDG 3CJHA 4O9BA 3N2KB 4HYOA 2E76D 3ZHRA 2M6YA 3D6ZA 1PL4A 2EILB 4LP8A 1NTMG 3FFQA 2HVKC 4PA7A 1SVFA 4DV3O 4GLXA 4K0KO 1JQ0A 1PFIA 5B3SC 1PP9E 1URQB 2XU6A 1G1IA 1QR9A 3HTKA 4I50B 2QM7A 2R72A 2IU0A 4K3AA 1JOCA 2KUBA 2AHZA 1KFNA 5LHGA 2QJYC 1OW8A 5K1PA 4EOTA 2YIUB 4H0LC 1WA8B 1AB3A 4C7RA 1WMKA 3OMAB 2FMLA 3BAAA 4EB6A 5AVTB 4PI2A 4X65B 2F4VO 2PFXA 2CGNA 4DR4B 1NTKK 5JCOC 4O4HA 3TETA 3A0BE 3E89A 3H1HH 4TOIA 4JI3O 1A32A 4FZ0A 3LIDA 3PTZA 2V7QJ 1WN7A 5DECA 3SWKA 3CP1A 2DYSB 4YY3O 5TISE 3T97B 1FD9A 2D2CC 2ZE7A 1OX3A 2H94A 2OTKE 4HBNA 1HW7A 2BE3A 4K8XA 2KZJA 4W80A 3K04A 4JI8O 4QGPA 5LGTA 5APWA 1FPOA 1LWUA 3H1JJ 1SQBD 3JD4A 4H33A 4UXNA 1LP1B 2O1KA 4DW1A 1HUCA 4TV8A 2QGNA 1VIBA 4P30A 5L3GA 1NTKD 1NTZD 3ITKA 5AW1B 3CCVP 1NTKH 4WFFA 3CD6P 1NTKG 3L74J 2UXDO 1Q86Q 4CBCA 3AEFC 3M8AA 2YXQB 3ZN1A 3I56P 5CB4B 1DD3A 4O4IA 3L72E 3PP5A 1KUQA 3TGUG 3OW2O 3MP7B 1L0LE 4M3LA 3SYPA 2UUCO 1GRJA 1RH5B 1AVYA 2DW4A 2QKAA 2EIKC 2X7RB 4J80A 1ORQC 3HD7C 4DK0A 1NQTA 4DO2A 1RQVA 2HPCB 4TV8B 1O9HA 2Z5IA 2PI5A 2EIJB 3HE5A 5C8YB 1YYCA 1EM1A 5LBQA 2B88A 3AE2C 3L37A 1EN4A 1OVVA 3CJHB 5LL6Y 3M91A 2ZAEB 2E76B 2M5AB 5LMNB 5FNVA 1SQXG 4IL6X 3RVZA 3KHUA 4P9PA 2IH3C 2M8RA 5K1XA 1M1JB 2ZVOB 3A3YB 1H0TA 2W6IG 4IYHA 5TJHA 1GU5A 4YXWH 2EZOA 2JGUA 1YJWV 5B66H 2P67A 5IJ0B 1N8RQ 4X1IB 1Q81W 1NTMJ 2GUZA 1JR9A 3CX5F 1SERA 3TXSA 3ZMTA 5L3FA 1YJ9V 3P8MC 4LF5O 5KAFH 1S72P 2QJPC 1LTGC 1Y74B 1YF2A 2EX3A 2HYNA 1Q6UA 1N73B 2D2CB 2ZFCA 1GTWA 4X8AA 1AI4A 4FLYA 1S5LX 4HNAB 1KD1Q 3G3ZA 4J7ZA 2X6AA 1S2EA 1SQQD 2FKWB 4PD4D 4IYIA 4MTOA 3CC2V 4H0LD 3W67A 4B08A 1L0LH 4GT1A 1JEKA 4PV1B 3OTFA 1K05A 5AVXB 3GVMA 3LW5J 1NT2B 3MUDA 4O2AA 4UVCA 2RQ6A 1S9KE 1MZEA 4H13B 1BE3J 1M57D 5KA6A 2ZXXA 3Q1MA 1LR1A 2ZYAA 3OM3B 1YTFD 4JV5B 4I5SA 2ZM6B 2ZXWB 4JI4B 1BCCG 2UXCB 3TDKA 2P58A 1VP7A 4FLZA 1WB8A 2MKVA 1K8AQ 2A3QA 2A06G 3JATB 3EFGA 1H8HG 3H1LH 1NTZK 2W6BA 2YO3A 4J7KA 3CRQA 3L74H 4X1IA 4Z1VA 4MW3A 3L74D 2JP3A 2FYUK 3JASB 1VF7A 1M7LA 2ARHA 1S1CX 3OE7G 4UCTA 3H1JG 4JI0O 4IIJB 3AE5C 3RK3D 5KAFE 2J5UA 1GN3A 3H1JH 3Q4HA 4B3RB 4C7NB 3H1JD 4HB1A 5J2UA 3ZDMA 3PN1A 3APQA 3IJ4A 2AEMA 3ASNB 3JSNA 1PP9D 1K34A 3TK1A 5KX5A 3FX0A 2KKWA 3CXHE 5KLIC 4JZGA 2R70A 2Y0PA 3O6QB 3FKSG 2DJVA 3K57A 4IIJA 2AXTZ 4KT0J 1BCCH 3W68A 2JR8A 1SQQG 4ZHQA 3KKYA 1BCCD 2WSSG 2V4DA 5CA0A 1VF5C 1QVFO 2N74A 5BR8B 4UB8Z 4WWIA 4TQDA 1GDTA 2FKXA 4JTAB 1NTMD 1VQ9V 4FM0A 3AG1C 4W7ZA 2WSFJ 2OCCB 4GOFA 3RYCA 4FFKA 5IWAO 4R7CA 4UB6E 5KA5A 4JF7A 3IN6A 4XDJA 4HJGH 3SPJA 3UM7A 4DK1A 2UUBO 3CWBJ 3AG3B 1VEWA 5LHIA 2Y0EA 5CBHA 3L4FA 3AE7C 1XTCC 1L0NE 1KILB 2WSCH 2QJKC 4O4IB 4DT0A 1VQ7P 2Q9IA 1JTHA 1OFCX 5KAFZ 2P5OA 2KG7A 2UUCB 3CXHH 1NAYA 1YXBA 2NLJC 5BY1A 2F95B 4QMAA 1NZ6A 1M1JC 1CI6B 4P2ZA 4X62O 1GU4A 3K06A 3OW2U 4LF6O 3TCUA 3T1YO 1D5AA 3SJCC 1N36O 3LW5H 1L4AD 1LGHB 4JYYA 3JSVC 3PJSK 3PLNA 3H32A 1V55C 3ABVC 3CCEP 5CN0A 4OWFA 1G1XB 4ZHQB 3AG7A 3L70H 4J42A 4TQFA 1AI5A 3P8CD 1N7LA 2QWPB 4JTCB 4TT3G 1K73W 3FB8C 1JCHA 3VP9A 1OCRC 4KHPB 2K9JA 2V7QH 1T2KC 1YJ9P 2WLMA 4PA3A 2M7WA 1L0ND 3CWBD 2QE7G 1EZVE 4NTYA 4JI3B 1SRYA 1VQ6P 3JCUH 2LGWA 2K9PA 4DR4O 2WPRA 4B3SO 2OCCC 2F4VB 4WFBV 3ETEA 5B1AB 1L0NK 3AG2C 1OZ0A 2H89C 1MFZA 2E3CA 3HKEB 2QTOA 1EZJA 1SQQE 1YTZI 4PD4E 4DUYO 1Q82Q 5J9PC 1YZBA 1LT9A 4G2KA 3FYEB 2RMZA 1QVGU 3N7NA 3RYFB 2P90A 3KG2A 1M56C 2ZT9D 1FFXB 1YJNP 5EYPA 4PDLA 2J58A 1ZRTE 3DXRA 2UXBB 3ABKC 1XQ8A 4YTPC 4JAAA 1COWG 2NR5A 1SP4A 1Y47A 1PNLA 4UCUA 1NU1D 4B3SB 1OIPA 2XAGA 2RCVA 2OTJV 3E8BA 1H2MA 2ZR2A 2XDJA 1YHQP 5B5EZ 1NR1A 4ZOLA 4I9WA 4Q20A 1ZMEC 1VPCA 5FL7G 1NVPD 1LTJA 2Z5HA 3WUUA 5B1BC 2Y9ZA 2CH7A 3G71P 5AVUB 4YIOA 2KK7A 3JC22 4KHPO 1SQVK 1W59A 2GV9A 3ZHQA 2Y69C 2PZSA 2ZNJA 2I1JA 2W83C 2BEQD 3JCUE 5E1AC 1X8YA 2K1EA 1H89A 3EHBB 2FFDC 2M3EA 2RJZA 2H8PD 1T3JA 3OR7C 3SR2C 2Q67A 3A0HH 3CCRP 2GUZB 1XL4A 1GL2B 1JY3O 1VQ7V 1JY3P 3HTKB 4YJ2B 2WPVB 3KQGA 4NXMB 2JS3A 1U57A 3K9SA 2FYNC 2JEUA 2K9YA 2W6JH 1K3EA 3K3WA 4EFBA 4LF6B 1BQ0A 5APXA 4BAYA 4B7EA 3VMZA 1L4AC 4GX5A 2A79B 4PA4A 3RBZA 2K37A 3CC4P 5GTHH 1ZN5A 2M5AA 5EBMC 4O4HB 3ASNC 1NTZE 3T4DA 4DV7B 2CUGA 1SQFA 3SJQC 1LTBC 2HLDG 2PGDA 1WP7A 1XOUA 1IFIA 1ZL8B 3ZHSA 1QVFU 3G71V 3E7KA 4A7PA 3TGUH 1QLED 3OEEG 2RDCA 2WZ7A 2ZDIA 4KL1A 2AEFA 5EC2C 3TGUD 4PELA 4IHJA 4WFAV 3SPHA 1GW4A 3ZBHA 5JVDA 3OAKA 1GM7A 1WAZA 1P84I 2QA4V 2Y69B 1OZHA 2B87A 4CH3A 5B5EH 4X66B 3CEIA 5IWAB 2KXPB 2ZE6A 1CPYA 4MW8A 3B71A 4LF4O 3H1IG 1E5WA 5LHHA 1SC5B 2LR2A 1Y9BA 2BCCH 3B5NA 3GG2A 1P7GA 2NPSD 3TYYA 1BDCA 1CSBA 1PZQA 2MW2B 4LF7O 4I6MC 4J11A 1H2LA 4IL6E 4X66O 1LNQA 2W90A 5EZYB 2ZIMA 5BR8O 2Y0IA 2AXTH 1W2BO 3P30A 3TF5A 2JEXA 1KP2A 4FK5C 5GTIH 3H1LG 4O4JB 3HD7A 4E2LA 2GHYA 2IM9A 3CSXA 1T6AA 3E1RA 3WUTA 4LNUB 3ABTA 1IFJA 1S5LE 1YIJP 3EQ2A 3OMIB 1KFMA 1NKDA 5BU8B 1SA0A 2OARA 1JB0J 2Q0AA 2JGDA 1ZX3A 4X20A 3U11A 4D6TG 4NR1A 2B1IA 5H2FZ 3T1CA 3LDDA 5LXTB 1TGOA 2P7TC 3A0BZ 1UIIA 4N78D 3H1IH 4UVBA 4NXMO 3VN0A 4UB8H 5AW4B 1BSHA 3DC6A 5EIBC 1JCCA 3U59A 3JD2A 1IBLO 3RK3E 1QLEB 2BCCE 2H8PC 1Q7YW 1M8OB 3WB2A 3AEAC 1X9VA 3D36A 3CCSP 1GW3A 4CC5A 2DN9A 4KFMA 2BASA 5BU5A 4QPJA 1VQMV 3CC4V 2EJRA 2ZXEB 1EN6A 4YJ3A 4FLXA 3L73J 4GYCB 3K5OA 4JI4O 3RYIB 5FPRA 2ZM6O 1VQ8V 1IX9A 4QIWF 2KLUA 4JV5O 4C7NA 5JQGA 4GKKO 2GUVA 2WT7B 4WFHA 3T4ZA 2XZRA 2WITA 2JJ2G 1LJ2A 2KQXA 4YHHB 1G4YB 1WJZA 2PYLA 2OTLV 3SYCA 2N1TD 2PRRA 2IW5A 4YJ3B 1OJHA 5F2VO 1EC5A 2QM4A 2UXBO 2B89A 2FXMA 4IFDK 2Y4TA 4I0XA 1US6A 4X64B 1RF0A 1R8EA 1PP9J 1N8RW 2Q4PA 1URQC 2ATKC 4LF5B 4N78E 1NH2D 3JALB 1Q81Q 3BCCG 5DN6G 3RK2D 1OW6A 2FBWC 1FZFA 3CE2A 3AG3C 3JYCA 2F23A 1USEA 1Y76A 2LFSA 2QWRB 1N2DC 4PA9A 1NOHA 1VQKP 1NU1G 4EFEA 1FU1A 3O9OA 4YJ2A 1NHLA 5CA1B 1BCCJ 3B8EB 2Y0CA 1VQKV 4U3FH 4BWNA 2A06E 1NS1A 3KCXA 2G8YA 2ADPA 3JALA 1BE3G 2XV5A 5LMNO 4UCRA 4PV1D 3VYIA 1N34O 2GUSA 4BRYA 2WPSA 3M0DA 2DQ3A 1RE3A 3RVYA 4EB6B 4NXNB 5AW7B 1NO4A 3MHSC 1SQXH 5IJ0A 4LWSB 1FZBA 2UXXA 1V55B 5JJJB 2VQEO 2UUAO 4RUFA 4D6TE 4NVPA 1VQ6V 1EZVI 4YXWG 4H44B 3CC7P 3T1YB 1Q2NA 2Q3EA 3EVKA 3P8CE 4JBZA 1M1KW 3AK1A 3CX5E 4X62B 4YXDC 1L0LJ 3UT5B 3G9RA 4NYKA 1IK7A 3JD3A 4IFFA 2EJ7A 2LW1A 3ZRWB 4DYLA 4JI8B 4NXNO 3J7AU 1MZFA 1PPJH 1FDIA 5CCGD 1K97A 3H1HE 4MVUA 2YUAA 1IFPA 3W7TA 1BE3D 2GSMB 1L4AA 1N34B 1ZSPA 3JD0A 2HODB 5LXTA 3C3TA 2UUBB 2QG4A 3WU2H 1BGYH 5KMGB 2RH0A 1VQOP 4HH2A 3ZX6A 1Y4MA 4QE9A 2AZ2A 5CMUA 4QNHB 2C2AA 1Q90D 2E74B 1VARA 1AI6A 2JS5A 1VQLV 3OA7A 2CTRA 2POHA 1BZKA 2OYHC 2YIBA 1R3IC 3VOUA 1UIXA 1ROPA 2EIMC 2B9ZA 3QO8A 2GTSA 5DJTB 2GBOA 2JWDA 3P3PA 3BHPA 4X64O 5H6QA 2IJJA 3BCCE 2YIDA 5LOVA 1K9MW 4GOEA 3FAVA 1JVMA 4FFBB 5DJUB 4LH7A 3H1IJ 1WT6A 5EK0A 5B1AC 2KNCB 2ZYDA 2CE4A 2DW3A 1ZRTD 4O4LA 4LFAB 4OPAA 1LP1A 3S3WA 2O01J 2ZQMA 2KIKA 3M9HA 1OCZC 4WY4A 2KI7B 4JI0B 1SFCD 1FDMA 3STZC 1OCRB 2XHBA 5B66Z 3RBXA 3Q5PA 3TSIA 1Y76B 2RNBA 3V6IA 1N7SD 1S3JA 3GWKC 4AYCA 4Q6GA 2PP6A 3G6BA 4GX0A 1FC2C 4U3FG 2JKVA 2DYSC 4I4TA 3RYFA 3CWBH 3D71A 5IY5C 1MSWD 1Y74A 4CS3A 1DEEG 1Y8AA 1DX7A 2HR3A 4RAIA 1R5LA 2QVAA 3GF3A 4H13C 2IBZI 4CH6A 3FWLA 1N33B 1MKMA 5JWPA 3H1KD 4LBEC 1YSCA 1KYOE 1OCOC 4WVZA 1B04A 2NPSA 4Y99C 1JY2P 3B5ND 2ZD9A 3RN4A 1M1JA 2DWEC 2Q68A 3CCQP 2DWDC 1N73C 1VQ4P 3HE4A
chains in the Genus database with same CATH topology
1DD3A 4OGQD 4KT0J 1JB0J 4YTPC 1KILE 3G9RA 1AJYA 2D2CD 1IK7A 1KQGB 1VF5C 5L8RJ 4XFJA 1FDIA 2H88C 4OGQC 1KTMA 1RQVA 2WSEJ 3AEEC 2E74D 3AE2C 1ZMEC 1ZOYC 3GF7A 2FXPA 2WSFJ 3RK3E 2E76B 1PIXA 4IL6X 4U7JA 2E75C 1VL2A 3AEAC 2QIWA 3C8VA 4GDOA 2NZ2A 2E74C 2BEQD 3Q5SA 3IN6A 4H44C 2ZT9C 4R4MA 3SFEC 1Q90D 2E74B 1FDOA 1KORA 2QSIA 3H25A 3AE7C 1K04A 2G3AA 4R4LA 1HF9A 2WPVB 1UIXA 2QJKC 3D6YA 1U57A 2FYNC 1OMIA 3RL0g 2QJPC 4OGQB 2K9YA 1OW7A 4I7ZB 2E76D 2BEZF 2D2CB 3D6ZA 2ZT9B 1S5LX 4PV1C 1NGMB 4Y28J 1PL5A 4I7ZC 3S9OA 2E75D 4H0LD 1K05A 2E76C 4PV1B 5M1BA 4TT3H 3Q3DA 1R8EA 4H44D 2E75B 3LW5J 1KMIZ 1YQ3C 4H13B 1OW6A 2FBWC 1OW8A 2QJYC 3ABVC 3Q1MA 4H0LC 3R4YA 1WMKA 3AEDC 2IDBA 2O01J 1RQUA 3GMAA 1PV3A 5KKZC 3Q5RA 1HJ0A 3AE1C 1VF5B 2MKVA 1KQFB 3Q5PA 2G8YA 3AE6C 3B71A 1DD4A 2V7QJ 1Y9BA 2OQQA 4PV1D 1DIPA 3T97B 1YQ4C 3O6QA 2JP3A 2JO1A 2D2CC 1ZP0C 2WQYC 3AEFC 3D71A 1S1CX 3EWKA 2YMKA 3SFDC 3D70A 3AE5C 2P10A 3AE9C 2J5UA 3AEGC 3AEBC 3GF3A 4H13C 1EXIA 4H0LB 2YIUC 2H89C 3FGAD 3AE4C 1MKMA 1NYHA 1TU3F 3AECC 3Q2YA 4H44B 4H13D 1GMJA 4RKUJ 5KLIC 3IAOA 2WSCJ 2ZT9D 4Z1MH 1EXJA 1VF5D 3AE3C 3AE8C 1ZRTE 4YXDC 3GLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 J;  1Q90 D;  2E74 B;  2E75 B;  1JB0 J;  3LW5 J;  2QSI A;  4H13 B;  2QJY C;  2WPV B;  5L8R J;  2QJK C;  2O01 J;  5KKZ C;  4H0L B;  2YIU C;  2WSE J;  2FYN C;  2QJP C;  4OGQ B;  2K9Y A;  1VF5 B;  4I7Z B;  2WSF J;  2D2C B;  2E76 B;  4IL6 X;  2ZT9 B;  4H44 B;  1S5L X;  4RKU J;  4Y28 J;  5KLI C;  3C8V A;  2QIW A;  2WSC J;  1ZRT E;  4PV1 B; 
#chains in the Genus database with same CATH topology
 1V9P A;  2BOB C;  3ABM B;  3M06 A;  1AVM A;  4GZR B;  2D2C D;  2QJP B;  4J41 A;  4FPP A;  1WLE A;  5APY A;  1NU1 H;  4FLT A;  1L2P A;  1KTM A;  1JX9 A;  1JNM A;  1RSO A;  1H8A A;  1JY3 N;  1M5I A;  5GTH Z;  1IBK O;  3OUF A;  1YCI A;  2WLI B;  2MJZ A;  1GN2 A;  3MAQ A;  4ZKU A;  1A02 J;  3CME V;  3L74 E;  5APV A;  4U7J A;  3WU2 Z;  4LF4 B;  3KXD A;  2XUM A;  3CCJ P;  2YC0 A;  1H2K A;  3O8Z A;  4R4M A;  1K4D C;  3HB3 B;  4RO0 A;  3UCS C;  5DM6 V;  5LMU O;  1FFX A;  1GTO A;  4ABM A;  3ASO B;  3SYO A;  4R4L A;  3B8M A;  3HUS B;  1JPX A;  5ITZ B;  3F89 A;  5KJ7 C;  3IC9 A;  3JAK B;  1EDI A;  3J81 N;  2XAH A;  1QBZ A;  2KS1 A;  3B77 A;  2G38 A;  3KDP B;  3GW6 A;  4JPR A;  1KIL D;  2NPS C;  3SWF A;  1TVK B;  2PY5 A;  3ZRX A;  3V5B A;  3WUV A;  1HNZ O;  2YXH A;  3Q3D A;  1EDL A;  1RSO B;  1IXB A;  1TAE A;  1BQZ A;  3RW0 A;  1SQB G;  4JPZ B;  1SFC C;  2WA3 A;  2JJL A;  1KV4 A;  1HTL C;  5CCG A;  4DZO A;  3GMA A;  4CS4 A;  1N7S C;  3H9V A;  4FIP C;  3BA9 A;  1WRG A;  3VQY A;  1HJ0 A;  4LF8 B;  2ZNI A;  3LSQ A;  3K08 A;  1BGY G;  3JD1 A;  4UB6 H;  1F23 A;  3OTO O;  1T5E A;  1GL2 A;  5CA1 A;  1WPX A;  3H1K J;  5FLX N;  5CJ4 A;  3CME P;  1QHT A;  1X59 A;  4JZ2 A;  4X89 A;  1MG1 A;  2P22 C;  1IO4 A;  3OJA B;  2E5L O;  3G4S P;  3EXA A;  5FNV B;  2IYP A;  4MN4 C;  4UUJ C;  4RWU A;  2P4V A;  4N21 A;  1NTK J;  3L74 G;  4X65 O;  1M57 C;  3AEG C;  2JDI H;  4JI2 O;  2YSU B;  4H0L B;  3VQX A;  2YIU C;  2ITA A;  3BRV B;  5AW8 B;  4RJT A;  2ZCE A;  2QJY B;  1KKC A;  2Z3Y A;  4CZZ A;  3CC7 V;  1F51 A;  4JI5 B;  1HVV A;  4JAS A;  3SSU A;  4RKU J;  1GO3 F;  3N2G A;  1ENV A;  3ZMS A;  5BZB A;  2R9R B;  5KLI B;  5BMV B;  4DUY B;  4DV3 B;  4K0K B;  4L75 A;  3MIW A;  4K8Z A;  1PL0 A;  2XTA A;  2FYU D;  4DR5 B;  1JFF A;  2IFN A;  3ZS8 C;  1G2C A;  2Q7H A;  3ZRS A;  3MUD C;  3L71 H;  2FTK A;  2QM8 A;  1FZC B;  1R3K C;  2WLJ A;  2VWJ A;  4OH8 B;  4OGQ C;  1GM9 A;  3QF7 A;  1Z5V A;  3R2P A;  2SPZ A;  1RM1 C;  1HNX B;  2E74 D;  2N04 A;  3ICX A;  3BAS A;  1YHQ V;  4JQ0 D;  3A8T A;  4DR2 B;  1SQQ J;  2WAM A;  1QL2 A;  4N3Y B;  3T1H O;  1KYO F;  3SJA C;  2ZDI C;  1SQB E;  2JVD A;  1AP5 A;  1VL2 A;  1IK9 A;  3V2Q A;  1JMB A;  1KIL A;  3L75 D;  2KZI A;  4PD4 I;  3H01 A;  5EZY A;  3UO2 A;  1FKA O;  2DMX A;  3RK2 C;  1OCC B;  4LF9 B;  4JYC A;  5KHJ A;  5KKZ B;  2B1G A;  3GB7 C;  1FZG A;  4XE5 B;  1K04 A;  3BRT B;  3DSQ A;  2I8D A;  1DEB A;  1XNQ O;  5KX5 B;  1KIL C;  5AW5 B;  3ZHU A;  4BW5 A;  1BS3 A;  3L73 G;  3H6P A;  1BCC E;  1HNW B;  2F93 B;  4R8C A;  1YIJ V;  1N36 B;  1SLQ A;  1FOS F;  1OW7 A;  1KQS U;  4AQY O;  2QSA A;  4GKJ O;  1FE6 A;  1LT1 A;  3ABK B;  4PV1 C;  1QCE A;  3H1H D;  3ZED A;  4LC1 A;  2HLO A;  2EIN C;  3S9O A;  5JH7 B;  1BGY J;  1XTG B;  5M1B A;  3N2G B;  1SET A;  2Z0A A;  1GZL A;  1GAX A;  4CPG A;  3L71 E;  4IGG A;  2QJK B;  3OGI B;  4BWA A;  1XDC A;  3ZRW A;  1MV8 A;  1SQV D;  3VMY A;  1LWU C;  3N2K A;  2W8Z A;  3V2P A;  5C8Y A;  4CH4 A;  1R3J C;  5LP6 C;  3ZMZ A;  3V2N A;  3UT5 A;  3CCS V;  3M0D C;  1THZ A;  2IJH A;  1SQB H;  1E79 G;  1TA8 A;  3P3N A;  2QRX A;  1KD1 W;  2WMM A;  1JUN A;  4MSW C;  1FJG O;  4NB5 A;  1J95 A;  1GN4 A;  3U1C A;  1N0J A;  3JSL A;  2W0X A;  4F6R A;  4JGS A;  3BCC D;  2R9A A;  3W7U A;  1ZTE A;  3L73 H;  4ZI7 A;  3FX7 A;  3JAM N;  2FYN B;  5AVR B;  4LFB O;  1WNS A;  1HDJ A;  5CCG C;  2FYU J;  1UFI A;  4O4L B;  1G6U A;  5IT9 N;  1DLB A;  4U3J B;  1SQX D;  2VRS A;  5B1O A;  1GL2 C;  3IFX A;  3CCQ V;  2RN0 A;  1RF1 B;  3AEI A;  4WF9 V;  4FFB A;  1VQ5 V;  1D7M A;  1F4N A;  3Q2Y A;  4ZOL B;  1X79 B;  1IXM A;  4OXS A;  2N1T B;  4W7Y A;  3ABL B;  1TUB A;  1N7S A;  5J2T B;  1P84 E;  1ZR2 A;  2ZVN B;  2IJK A;  5CMZ A;  4FJC C;  3BFR A;  3TNU B;  4ASU G;  4N6J A;  2LJ2 A;  5APS A;  4PDV A;  1LT9 C;  1OVR A;  4B3R O;  1YTZ T;  2WSF H;  3MHV A;  4WY4 D;  2OYQ A;  4ZNC A;  3KYQ A;  5L8R J;  1H38 A;  1IBM O;  4DUZ B;  2AZ0 A;  4J9Y B;  1WA8 A;  5JCO A;  4JI1 B;  1BT8 A;  4ICG A;  1G2C B;  1J1D B;  4A5U B;  3CB2 A;  3V2R A;  3VMX A;  4PHZ A;  5LGU A;  2A45 H;  2GTA A;  4I50 A;  2E42 A;  4KXR A;  3O65 A;  3ABU A;  5DED A;  3L73 E;  1B3Q A;  3L9D A;  2VWK A;  4K35 A;  5L3C A;  3H1K E;  4HYT B;  1FXH A;  2UXC O;  1W0K G;  3A2A A;  3I55 P;  2WT7 A;  3RK3 B;  4GUN A;  3NMD A;  2IX7 C;  1UPG A;  1UJW B;  5IYB O;  3H1L E;  4EI2 A;  4Z1M G;  5KJ7 A;  4NPD A;  4KUM A;  2ZJS E;  3NXS A;  3HE5 B;  5CCH C;  2WLN A;  3SDL A;  2HPC A;  5AG2 A;  2BCC G;  5H2F H;  3HE4 B;  1N32 O;  2LQT A;  4JF3 A;  1KYO D;  3JAW B;  3MZW B;  2CTP A;  5KLV K;  1FFT B;  3JAS A;  3RGU A;  3ZIA G;  1SQP H;  3NR7 A;  4GX1 A;  4HNA A;  1R6T A;  3V4Q A;  1OCZ B;  4DV2 B;  1N73 A;  1HH0 A;  3RYH A;  2YKQ A;  3AED C;  1VQL P;  3CXH D;  1K92 A;  3AG4 C;  4IT5 A;  2P2U A;  3A0H E;  3RL0 D;  2BTQ A;  2LP7 A;  2QDO A;  3F5H A;  3L75 E;  1KZU B;  5AVW B;  1HWT C;  4MVS A;  5E79 E;  1U96 A;  3ETQ A;  3G4S V;  1PPJ G;  3HKC A;  1XMQ B;  3HRN A;  1JO5 A;  3T2M A;  1J1E C;  2QEX P;  1ZLZ A;  2WLI A;  3M99 B;  1ZP0 C;  2WQY C;  1NJI W;  1LUV A;  1DK1 A;  1USD A;  3HD7 B;  2DYR C;  4KP4 A;  3L70 D;  3EWK A;  1L0L K;  4I1L A;  3D70 A;  2Y0D A;  1GK4 A;  3VMA A;  4WY4 B;  2ZE8 A;  2YNY A;  1L8D A;  3VQV A;  2KSE A;  3M0A A;  1PD3 A;  2IBZ G;  3FGA D;  5L3D A;  5LYJ A;  1LTI C;  4GIF A;  1SZX A;  2L6L A;  5H2F E;  1QQC A;  1DF4 A;  3TGU E;  1KN7 A;  1L0N G;  5D5Q A;  1Z56 A;  1AQ5 A;  4QPK A;  1GMJ A;  2UXD B;  1L0N H;  4CC6 A;  4L73 A;  3AE3 C;  4JAU A;  1SQV E;  4PJ0 E;  2KLV A;  1MMM A;  5KLV H;  1KIL E;  2DQ0 A;  3JAW A;  1WB7 A;  1H88 A;  5IJ9 B;  1S77 D;  3CRM A;  2H88 C;  1H2G A;  2Q7E A;  5APU A;  1E79 H;  3S3X A;  1XMO O;  4DR1 B;  2FFD A;  1RPR A;  4IL6 H;  1L0L G;  2F1M A;  3D3Q A;  4YY3 B;  1T3U A;  2W6J G;  1VQ9 P;  4TV9 A;  2Z4E A;  1V54 B;  2A9H A;  2XAJ A;  1NI8 A;  3L70 E;  1MA1 A;  3S1K A;  4IOI H;  2NPS B;  1G1J A;  3AG2 B;  2KP8 A;  1L1F A;  4ASW A;  3HPL C;  3CPW U;  1RF1 C;  2JWA A;  4GX2 A;  1BMF G;  1PGQ A;  3E8H A;  2Q6A A;  3HKD A;  2EIK B;  5IDJ A;  1J5E B;  4UVA A;  1W5C E;  3CX5 D;  2ZIO A;  1RHZ B;  2LGQ A;  1NVP B;  4TLF A;  2ZT9 B;  1FAF A;  3CX5 H;  1K73 Q;  2R5D A;  3LDC A;  3H1I E;  2OTL P;  1AR1 B;  1I5Y A;  1KB9 I;  1TUE B;  2RN9 A;  1NKZ B;  3RT3 C;  2IBZ E;  4XDL A;  2OIE A;  2YXL A;  4O4J A;  2CTQ A;  4DV1 B;  1GN6 A;  4FVM A;  5LGN A;  2Q7G A;  5CBO A;  1AI7 A;  2FYU E;  2CPS A;  1RE3 C;  2HEP A;  1H2N A;  1AV1 A;  3B09 A;  4N23 A;  4FLV A;  3KCY A;  2WLH A;  2ZKO A;  3WU2 E;  1SQB J;  2DOS A;  2P06 A;  2XAS A;  3E2E A;  2C0X A;  4O2B A;  1HR0 B;  1XUQ A;  5KHH A;  2ODM A;  2QTS A;  2PTM A;  1L0N J;  1DIP A;  1AP6 A;  4UCV A;  5AVZ B;  1M56 B;  5EBW C;  5LOV B;  2UXN A;  3WG7 C;  4D6T J;  4JI6 B;  2QWO B;  1AVO A;  3K0D A;  1RFY A;  5APQ A;  3D8C A;  2UU9 B;  3HKB A;  1XI1 A;  1XBL A;  2WLL B;  4B3M O;  3CC2 P;  2W6A A;  1W2E A;  2WLK A;  4DV4 O;  1QGK B;  4MVM A;  4P9O A;  2HVJ C;  3KZI H;  1WPB A;  4XA4 A;  2YEV B;  2A7W A;  3RK2 B;  5KTB A;  3OGC C;  4HKZ H;  1HJB A;  1F4M A;  5K5G B;  5AW9 B;  1LTS C;  1QNM A;  3IAY A;  2V7Q G;  2IPP A;  3F5T A;  4U3F E;  1AJQ A;  1TUB B;  3E83 A;  1N7S B;  2FYU H;  4MT8 A;  4DRX A;  3R65 A;  4DR6 O;  2K88 A;  4ZKP A;  3ZMU A;  2IH1 C;  1J5E O;  3UIA A;  1RF0 C;  1RM1 B;  5B1N A;  4AI8 A;  3L71 D;  1RE4 A;  1NTZ H;  3QH9 A;  1P4R A;  1S5J A;  4KHX A;  1EDK A;  2YS8 A;  3CHX A;  1PGO A;  2M0B A;  4PJ0 Z;  3FB5 C;  3K79 A;  1J1E B;  1Q86 W;  2PUS A;  3QNE A;  4F6E A;  4LLH A;  1GK6 A;  4GDO A;  5AVY B;  1TVK A;  1NAF A;  3NTN A;  4D6T D;  4R50 A;  4B3T O;  4BIO A;  2QJ1 A;  4D6T H;  1KB9 H;  3SFE C;  3CCU P;  2QSI A;  5B5E E;  3AG4 B;  4LFC B;  1KB9 D;  3CXH F;  5KHG A;  3E22 A;  3IR9 A;  2EZP A;  3OD4 A;  2QEX V;  4WCE V;  4DJG A;  3KZI E;  5A9G A;  4WBN A;  5H9C A;  1SF9 A;  1FJP A;  1DF5 A;  3ETG A;  1IVS A;  4GOD A;  3BVH A;  1IFM A;  2JGD B;  2Q6Q A;  1NGM B;  1VQ4 V;  4I7Z C;  4I55 B;  1S72 V;  3BAB A;  1SQX J;  3GHG C;  1BE3 E;  3W7S A;  2E5Y A;  5D5P A;  1SQP K;  2A45 I;  4H44 D;  4LNU A;  5EBL C;  2JIZ G;  3C1L A;  4AQR D;  2Q5Z A;  3U0Z A;  5BMV A;  4JI7 B;  3D36 C;  3F7Y C;  1P7B A;  1K7D A;  3K59 A;  1NU1 J;  1M93 A;  5AVS B;  1PV3 A;  4DV0 B;  3ZHT A;  2QWN B;  5GW7 A;  2OWO A;  1VF5 B;  4E4E A;  1EZV G;  1GMG A;  1NKN A;  1BHA A;  4U7O A;  1FZA A;  4EYY Q;  3FB7 C;  1PP9 G;  1L0L D;  1P84 F;  3C3S A;  4I0X B;  1IJD B;  1NR7 A;  2OQQ A;  2JEE A;  2JO1 A;  2EIL C;  4YPC A;  3S4R A;  4UB8 E;  1VMG A;  3BCC H;  1BSN A;  1K5Q A;  2XT9 A;  3OAA G;  2HHH B;  5CBN A;  3B2E E;  4GCZ A;  1IUR A;  1CW5 A;  4RO2 A;  3AE9 C;  2Q7C A;  3AEB C;  5AW6 B;  3FD9 A;  5KHK A;  1I7F A;  1QVG O;  4DV6 B;  4DW0 A;  1SES A;  4QJF B;  2CDY A;  3H1I D;  3H1L D;  3K9A A;  3FXD A;  1M90 Q;  1NYH A;  2Y4U A;  4NTX A;  2KB1 A;  5LYJ B;  4JYA O;  2OYI C;  2AHY A;  4QE7 A;  2R3C A;  2FFD B;  1VF5 D;  1N32 B;  3D3I A;  1BSM A;  2HJD A;  2KG7 B;  1GK9 A;  3GLM A;  3SYQ A;  1I08 A;  3E8G A;  3WMM 0;  1GD2 E;  3CMA P;  1SS1 A;  3T97 A;  4X1K B;  4AIL C;  4LWS A;  1PP9 H;  2VQF B;  1JOY A;  3L75 J;  5H5N A;  1FYJ A;  3AEE C;  1ZLL A;  3QWO C;  4YIP A;  1U7J A;  1X4T A;  4DR3 O;  1PIX A;  4FM1 A;  1LTT C;  3H1J E;  4OX9 B;  2XNX A;  1WP8 A;  3J80 N;  5L3E A;  2FL4 A;  2BOC C;  5C39 A;  5EIB D;  3F7V C;  3BY6 A;  1S5L Z;  4NTW A;  3HKD B;  3FAV B;  4DV0 O;  2EIM B;  1XNR B;  3ZJZ A;  1PV0 A;  2O3J A;  3A0B H;  4XBF A;  1M4U A;  2W27 A;  4IHJ B;  3E8F A;  2ZIN A;  1NTM H;  4DUZ O;  1K5S A;  1AJP A;  3OEH G;  2YKO A;  3QG5 A;  1OHH G;  3JAR A;  2X0L A;  3N4X A;  3RGB A;  1SQB K;  2LO1 A;  2BEZ F;  2IJI A;  2YXY A;  3GHG B;  4ASV A;  3TXQ A;  1RF1 A;  2BSK B;  4U3F D;  1K9M Q;  3EFF K;  2E75 D;  3WB0 A;  1OXZ A;  1FBM A;  1J1D C;  1Q6I A;  1NTZ J;  3K58 A;  1KBH A;  4RQE A;  3C9I A;  2N1T C;  2OYI B;  2B87 B;  3CWB G;  1Q6H A;  2A0L A;  1MUU A;  4D7S A;  1KQL A;  3K0G A;  2YIC A;  4F4L A;  5KKZ C;  1YBK A;  1T2K D;  5HFM A;  4FMT A;  4LFB B;  2ETN A;  3C90 A;  5ITZ A;  1PM9 A;  3L72 H;  1HGV A;  3IF4 A;  3P7K A;  4PDM A;  3CMA V;  2ZR3 A;  1SS3 A;  4R6Z A;  1PNM A;  1ZW0 A;  5IE9 A;  3A2F A;  4DR7 B;  2KNC A;  3CCM V;  1P49 A;  3Q5R A;  3LNM B;  2BTO A;  1Q43 A;  1FJG B;  1X0T A;  3IGA C;  1JY2 N;  1JTH B;  3B8N A;  2O1J A;  2K3R A;  3HD7 D;  3MGN A;  1VF6 A;  4ZBM A;  2QA4 P;  3RFR A;  3K5B A;  3AE1 C;  1IZ3 A;  4KJM A;  3OFN G;  4L8J A;  1PPJ D;  2UWJ E;  3E35 A;  3I56 V;  2OYH B;  1Y6X A;  3VOP A;  5KAI E;  5H6R A;  3HKC B;  3A0R A;  1YI2 P;  1SA0 B;  5CBF A;  4Z1M H;  3SYA A;  1KB9 F;  4DV4 B;  4AQY B;  3RYH B;  3TGU J;  1HNW O;  2RMK B;  2PI4 A;  3FWN A;  4HAM A;  2AGA A;  2XAQ A;  1U7M A;  4NKG B;  4DRX B;  1EZV D;  3TNU A;  3FB6 C;  1XNQ B;  2IU3 A;  1EZV H;  4B7K A;  1AIL A;  1H0T B;  1FAV A;  2AXC A;  4LF9 O;  2FXP A;  5A2Q N;  5AW0 B;  4JTD B;  3G6E P;  3SJB C;  2E5T A;  3DXR B;  1KKD A;  2NZ2 A;  4Y99 B;  3E86 A;  2EBO A;  1OCO B;  2Q69 A;  4OX9 O;  4U3J A;  2GM4 A;  4DR3 B;  1FDO A;  4DR2 O;  5TIS H;  1JA8 A;  1VQO V;  3KZI Z;  3MHH C;  1HNX O;  2PYJ A;  3QVN A;  1F7Y A;  1YTF B;  3CCU V;  1ZWI C;  2P6J A;  5KAI H;  5IY5 B;  3W7W A;  3M9Q A;  3G80 A;  2WA4 A;  5CA0 B;  1OMI A;  2WWW A;  4I7Z B;  1P84 D;  2C0W A;  4DR5 O;  3CWB E;  2J59 M;  1P84 H;  1ZL8 A;  2LXB A;  4Y28 J;  3BEH A;  4J9Z B;  1QLE C;  1S5H C;  1YDX A;  5L3B A;  1JMM A;  1NTK E;  2CK3 H;  4LCU C;  2ITC C;  2K9J B;  1ZAU A;  4TWK A;  1S0V A;  2KYV A;  1HGZ A;  1BDD A;  4TT3 H;  4C46 A;  5BVZ A;  1FS0 E;  2OGU A;  1KC8 Q;  4JI5 O;  1YQ3 C;  5B1B B;  1KP3 A;  3JAR B;  4NPF X;  2QKS A;  3R4Y A;  4DV6 O;  3E22 B;  4JI2 B;  3BAT A;  1YIT P;  2IDB A;  1YJW P;  1RQU A;  4DOJ A;  3I5D A;  1ZXG A;  2JDI G;  3K5L A;  1NBM G;  4LR3 A;  1KQF B;  3QTC A;  1CZQ A;  2Q1K A;  1I5X A;  3L70 J;  1U97 A;  1K4C C;  4BXL A;  2WPQ A;  3H1K H;  3RYC B;  5E79 Z;  1NU1 E;  3OUS A;  2WSE H;  1VQP V;  3OTO B;  1CI6 A;  1OWA A;  2H3O A;  4DR1 O;  2R3S A;  2CPB A;  3UKM A;  2Q0O C;  3BPZ A;  2C9N Y;  5GTH E;  4DV5 O;  3SFD C;  4WFG A;  3APO A;  1LTA C;  5B66 E;  2FY8 A;  3ZMV A;  3CRA A;  5EC1 C;  3CCJ V;  1EXI A;  2CAZ C;  2Q8V A;  3PRJ A;  1O9G A;  3IC7 A;  4AUW A;  1G8M A;  3L75 G;  1TU3 F;  4PDR A;  1SQV J;  4H13 D;  1I94 O;  5KUK A;  1I94 B;  2WSC J;  1NU1 K;  4TV9 B;  3GWO A;  4WB4 A;  3K5M A;  1J2J B;  1FZE A;  3W7X A;  4X1Y B;  2F66 C;  1FXK A;  1MAB G;  1MNG A;  3AK3 A;  3SPG A;  1QX8 A;  2YI9 A;  2VS0 A;  1AJN A;  1XHZ A;  1AA0 A;  4UCO A;  5C93 A;  4DV5 B;  3G6E V;  3VP8 A;  3PH0 A;  1EDJ A;  1HBW A;  1DH3 A;  2IYO A;  4FLU A;  2CGO A;  1CP9 A;  3CL3 D;  2ZE5 A;  3GF7 A;  1XHX A;  2N9Y B;  3KPE A;  2AXT E;  2IZ0 A;  1VQ8 P;  2HG5 C;  1T8Z A;  2YIA A;  4XDK A;  1Z2G A;  5AVQ B;  4ZMD A;  4H44 C;  3CPW O;  2H43 A;  3BRC A;  4L87 A;  1FXK B;  4I2L C;  2YEV A;  1MFT A;  2ITD C;  1SQP G;  3RL0 B;  1V54 C;  4FM2 A;  3H25 A;  3UO3 A;  2AW9 A;  3R66 A;  1DTO A;  1I0H A;  3D6Y A;  1SQQ K;  5LP6 A;  3A5T A;  1KEC A;  1CXZ B;  4UV9 A;  4UV8 A;  2R5B A;  5IJ9 A;  3ABL C;  1PGJ A;  2P7J A;  2IFM A;  3CRR A;  2FB5 A;  2PGG A;  1URQ D;  2Y48 A;  4UFZ A;  2XKM A;  3M9B A;  3L70 G;  2BCC D;  3LIE A;  2XND H;  1N33 O;  1AFO A;  2O01 N;  2XND G;  3AG1 B;  4WBN B;  3OT7 A;  2V4H A;  1RPO A;  4B3M B;  3N27 A;  2O57 A;  2YI8 A;  2XAF A;  3OMN B;  4F6R B;  1GH6 A;  4W4K A;  3L72 J;  5IYC O;  3WB1 A;  1JY2 O;  1QL1 A;  3SPC A;  4JI6 O;  3ZN0 A;  2FXO A;  1S4X A;  1NTZ G;  3RYI A;  2YO2 A;  1DD4 A;  4MVO A;  1OCC C;  2LXC B;  1Q8I A;  4J10 A;  1VQ5 P;  1VDF A;  2YDE A;  1OV9 A;  4JI1 O;  1HP8 A;  5GON B;  3L35 A;  1HR0 O;  3HR0 A;  1VQN V;  1EQ7 A;  3MD0 A;  2ILM A;  1IBM B;  1ARO P;  2N05 A;  1OVU A;  2YMK A;  3B5N B;  2P10 A;  4LH6 A;  1FXV A;  2Q5U A;  2P4K A;  3CCE V;  4U7N A;  2EIN B;  4LFA O;  4DV1 O;  2HOD A;  1SQP E;  4DCK A;  2ZYG A;  2HKO A;  1Q5O A;  1FXK C;  5CA3 A;  2L5G B;  1SKV A;  2PAJ A;  3RL0 C;  2RKL A;  1NVO A;  4WFE A;  2KSJ A;  2YXR B;  5IYD O;  3TJT A;  1Q7Y Q;  3BA8 A;  2A06 D;  3WFV A;  3L75 H;  3K5N A;  2R44 A;  2A06 H;  1AJY A;  1SFC A;  5E79 H;  4I4T B;  4WBA A;  2NRG A;  1DGS A;  3VBB A;  4MS2 A;  5AW2 B;  3B40 A;  3DTU B;  3P32 A;  3GHG A;  3PHL A;  1M90 W;  2WLL A;  2HG5 D;  1YEW A;  3B4S A;  4TUY B;  2L91 A;  5AW3 B;  3H32 B;  4BR6 A;  2WTY A;  4UB6 Z;  4DR7 O;  3DGE A;  3L36 A;  3ZCC A;  2E75 C;  3SGI A;  1SQX E;  1SQX K;  5HFL A;  2QIW A;  1R6K A;  1R3L C;  2FYZ A;  2E74 C;  1M9N A;  3FXE A;  2BTQ B;  2LKM A;  1IFD A;  1KOR A;  3JAT A;  3USS A;  4MTG A;  2OIG A;  4W4L A;  1D2D A;  3NFQ A;  5KHI A;  1R1B A;  5IYZ B;  1XMO B;  1SQP J;  3CS5 A;  2ADQ B;  4X1Y A;  1SQV H;  1BL8 A;  4PJ0 H;  1W2B U;  4RQF A;  3CLQ A;  5KLV E;  3CCL V;  3RL0 g;  1Q3E A;  5APT A;  4NPE A;  3I55 V;  4OVN F;  3M7M X;  1SQQ H;  1H8E G;  2MK3 A;  2V1D A;  4I9Q A;  2Z5U A;  4PD4 H;  1K8A W;  1PPJ E;  3VQW A;  4X1K A;  3ETD A;  4JAV A;  1RE4 C;  2HP8 A;  4JYB A;  3ZHV A;  4GKJ B;  5GTI E;  2R9I A;  3H1H G;  4D7T A;  2HJF C;  1M57 B;  2E75 B;  3CCL P;  5LA6 B;  3MTU E;  1IFN A;  2Q3I A;  2H7H A;  4X9Q A;  3CCV V;  2VQE B;  2XOK G;  1XRE A;  2UUA B;  1BGY E;  1VQP P;  1S5L H;  3L73 D;  5KAI Z;  4MVQ A;  5KMG A;  1XNR O;  4IL6 Z;  2NNU A;  2W0F C;  3CI9 A;  4EIJ A;  3H1H J;  1FOS E;  3L72 D;  5TIS Z;  5FPO A;  5JJE B;  1AR5 A;  4OPH A;  2PF4 E;  3U1A A;  3T1H B;  2QE7 H;  5JQG B;  1EBO A;  1YIT V;  3CCR V;  1XMQ O;  3O6Q A;  1SQV G;  4MVR A;  4HZ3 A;  5BXZ A;  4I55 A;  2VQF O;  1N4C A;  3H1L J;  2IZ1 A;  3X2Q B;  2KSD A;  3IFM A;  2CH7 B;  1VQM P;  2OT5 A;  1X22 A;  1A02 F;  3B5N C;  1E1Q G;  5GON A;  3H1K G;  4DV2 O;  2I1K A;  4G28 B;  5J2T A;  2VRZ A;  1BE3 H;  3AEC C;  1FJK A;  2EUL A;  1B6Q A;  1NWQ A;  4L74 A;  2OTJ P;  1KQS O;  1VF6 C;  4ZKI A;  1NTM K;  1M1K Q;  4JYA B;  4MVZ A;  1GL2 D;  3AE8 C;  1RY3 A;  3JAK A;  1BGY D;  3THO A;  3FYI B;  2ZXW C;  3QO7 A;  5EYP B;  4BW9 A;  2OYO A;  3HUS A;  5CHX A;  4YHH O;  1YJN V;  4L76 A;  4EKW A;  4BRY B;  4CS2 A;  4AHC A;  1YVW A;  3RK3 C;  2HHH O;  3HKE A;  4GKK B;  3AK2 A;  4ZI7 B;  4FLW A;  2HFE D;  2R32 A;  2WSE J;  2E5L B;  1PKX A;  1NH4 A;  2AEJ A;  4PA6 A;  4FZ1 A;  3CX5 I;  1ZOY C;  3SPI A;  4WY4 C;  3K03 A;  3JCU Z;  2C9L Y;  2JRI A;  3VTP C;  4EDF A;  2KOG A;  1ZR4 A;  3C8V A;  1S9K D;  2DYR B;  2LW7 A;  3LSS A;  4CH5 A;  2N1T A;  5KLV G;  4TUY A;  1LUW A;  1LTJ C;  5B3S B;  4EEQ A;  5LP6 B;  4LF8 O;  3BCC J;  5KJ7 D;  1MOF A;  1KYO H;  1IBL B;  3MDS A;  3LNN A;  3A0H Z;  4X20 B;  2QWQ B;  1SQP D;  1QR8 A;  1AR4 A;  3ABM C;  4JI7 O;  3CXC U;  1IZN B;  1SFC B;  4GKG A;  1FZC A;  3A7O A;  1LT9 B;  2X6C A;  1GKF A;  1AQT A;  1H2S B;  4OGQ B;  1R73 A;  3X2Q C;  1HNZ B;  4DXW A;  1FZC C;  3L71 G;  3HKB B;  5JH7 A;  4X88 A;  4MTF A;  3E1I A;  2DE0 X;  1PL5 A;  2OYH A;  1MZ9 A;  1SZT A;  2NN4 A;  1L4A B;  4ZIB A;  1FS0 G;  5CBG A;  2A45 G;  2E76 C;  3II6 A;  1JJO A;  5CCH D;  2Q9L A;  3CD6 V;  4UCS A;  2WSS H;  1KMI Z;  3RWR D;  4Z2W A;  5CJ0 A;  1D5N A;  1KC8 W;  1HWY A;  3HUS C;  4RES B;  1NJI Q;  4U3F J;  4O2B B;  2D3O W;  3JCZ A;  2BCC J;  4IFM A;  2F43 G;  4LFC O;  1B06 A;  1Y67 A;  5LA6 A;  5LMU B;  3U10 A;  1QEX A;  1KB9 E;  1ZV8 A;  4B3T B;  3ASO C;  1JMK C;  1URF A;  1IDS A;  5GTI Z;  2GA1 A;  4LF7 B;  3AE6 C;  5KUM A;  1Q82 W;  4O2A B;  5CB4 A;  2WVR A;  1KU9 A;  1K33 A;  3ML0 A;  1YQ4 C;  2QKC A;  3LSU A;  3F5W C;  1IBK B;  2E43 A;  3STL C;  3L71 J;  1NTM E;  5KLV D;  2OYI A;  2O01 H;  4LGD E;  2JK5 C;  3CRC A;  4DR6 B;  3QO5 A;  1JFF B;  2K1A A;  2LFR A;  1LWU B;  1XL6 A;  1EFR G;  4BIU A;  1YI2 V;  1PNK A;  3AE4 C;  3LUT B;  1NH2 B;  1LTJ B;  2P1J A;  3SWY A;  1IC2 A;  1Y66 A;  3IAO A;  2L35 A;  1XEQ A;  4DV7 O;  1EXJ A;  4MTX A;  2X6B A;  2JJ1 G;  4J7J A;  1N0N A;  2OCH A;  1N86 A;  2KB7 P;  4G27 B;  1QLN A;  1JJ2 U;  4OGQ D;  1SQG A;  1Z5W A;  2HFE C;  2KS1 B;  1W0J G;  4C7U A;  1RP3 B;  5EFW B;  5JJN B;  3DC5 A;  1PGP A;  2YMY A;  4B86 A;  2N9B A;  2QR4 A;  1KQG B;  1JM0 A;  1XIL A;  1KYO I;  4XFJ A;  2EIJ C;  3WG7 B;  2UU9 O;  3CXH I;  3CCM P;  1VQN P;  2CK3 G;  3ZRV A;  1MSD A;  5J2U B;  5IYZ A;  1S76 D;  2Y9Y A;  2IBZ H;  5AVV B;  3LDE A;  3Q4H B;  4PD4 F;  3V4W A;  5CCH A;  2IBZ D;  4H37 A;  4PI0 A;  5JVD B;  2FYU G;  1BHB A;  3UQ8 A;  1R5S A;  1R6N A;  3CYO A;  3BVO A;  2M3B A;  3Q5S A;  4TSF G;  1M56 D;  2ZT9 C;  1URQ A;  1EN5 A;  1JCD A;  2YKP A;  1CEZ A;  2GDS A;  3I5C A;  3G67 A;  3OR6 C;  4RUE A;  5KLV J;  1ZUQ A;  2B5U A;  4BIZ A;  2G3A A;  1HF9 A;  2Q73 A;  1E1R G;  1GM8 A;  2YIB D;  2B9B A;  2BSK A;  2CTW A;  3L72 G;  1QU7 A;  2WPD G;  3CJH A;  4O9B A;  3N2K B;  4HYO A;  2E76 D;  3ZHR A;  2M6Y A;  3D6Z A;  1PL4 A;  2EIL B;  4LP8 A;  1NTM G;  3FFQ A;  2HVK C;  4PA7 A;  1SVF A;  4DV3 O;  4GLX A;  4K0K O;  1JQ0 A;  1PFI A;  5B3S C;  1PP9 E;  1URQ B;  2XU6 A;  1G1I A;  1QR9 A;  3HTK A;  4I50 B;  2QM7 A;  2R72 A;  2IU0 A;  4K3A A;  1JOC A;  2KUB A;  2AHZ A;  1KFN A;  5LHG A;  2QJY C;  1OW8 A;  5K1P A;  4EOT A;  2YIU B;  4H0L C;  1WA8 B;  1AB3 A;  4C7R A;  1WMK A;  3OMA B;  2FML A;  3BAA A;  4EB6 A;  5AVT B;  4PI2 A;  4X65 B;  2F4V O;  2PFX A;  2CGN A;  4DR4 B;  1NTK K;  5JCO C;  4O4H A;  3TET A;  3A0B E;  3E89 A;  3H1H H;  4TOI A;  4JI3 O;  1A32 A;  4FZ0 A;  3LID A;  3PTZ A;  2V7Q J;  1WN7 A;  5DEC A;  3SWK A;  3CP1 A;  2DYS B;  4YY3 O;  5TIS E;  3T97 B;  1FD9 A;  2D2C C;  2ZE7 A;  1OX3 A;  2H94 A;  2OTK E;  4HBN A;  1HW7 A;  2BE3 A;  4K8X A;  2KZJ A;  4W80 A;  3K04 A;  4JI8 O;  4QGP A;  5LGT A;  5APW A;  1FPO A;  1LWU A;  3H1J J;  1SQB D;  3JD4 A;  4H33 A;  4UXN A;  1LP1 B;  2O1K A;  4DW1 A;  1HUC A;  4TV8 A;  2QGN A;  1VIB A;  4P30 A;  5L3G A;  1NTK D;  1NTZ D;  3ITK A;  5AW1 B;  3CCV P;  1NTK H;  4WFF A;  3CD6 P;  1NTK G;  3L74 J;  2UXD O;  1Q86 Q;  4CBC A;  3AEF C;  3M8A A;  2YXQ B;  3ZN1 A;  3I56 P;  5CB4 B;  1DD3 A;  4O4I A;  3L72 E;  3PP5 A;  1KUQ A;  3TGU G;  3OW2 O;  3MP7 B;  1L0L E;  4M3L A;  3SYP A;  2UUC O;  1GRJ A;  1RH5 B;  1AVY A;  2DW4 A;  2QKA A;  2EIK C;  2X7R B;  4J80 A;  1ORQ C;  3HD7 C;  4DK0 A;  1NQT A;  4DO2 A;  1RQV A;  2HPC B;  4TV8 B;  1O9H A;  2Z5I A;  2PI5 A;  2EIJ B;  3HE5 A;  5C8Y B;  1YYC A;  1EM1 A;  5LBQ A;  2B88 A;  3AE2 C;  3L37 A;  1EN4 A;  1OVV A;  3CJH B;  5LL6 Y;  3M91 A;  2ZAE B;  2E76 B;  2M5A B;  5LMN B;  5FNV A;  1SQX G;  4IL6 X;  3RVZ A;  3KHU A;  4P9P A;  2IH3 C;  2M8R A;  5K1X A;  1M1J B;  2ZVO B;  3A3Y B;  1H0T A;  2W6I G;  4IYH A;  5TJH A;  1GU5 A;  4YXW H;  2EZO A;  2JGU A;  1YJW V;  5B66 H;  2P67 A;  5IJ0 B;  1N8R Q;  4X1I B;  1Q81 W;  1NTM J;  2GUZ A;  1JR9 A;  3CX5 F;  1SER A;  3TXS A;  3ZMT A;  5L3F A;  1YJ9 V;  3P8M C;  4LF5 O;  5KAF H;  1S72 P;  2QJP C;  1LTG C;  1Y74 B;  1YF2 A;  2EX3 A;  2HYN A;  1Q6U A;  1N73 B;  2D2C B;  2ZFC A;  1GTW A;  4X8A A;  1AI4 A;  4FLY A;  1S5L X;  4HNA B;  1KD1 Q;  3G3Z A;  4J7Z A;  2X6A A;  1S2E A;  1SQQ D;  2FKW B;  4PD4 D;  4IYI A;  4MTO A;  3CC2 V;  4H0L D;  3W67 A;  4B08 A;  1L0L H;  4GT1 A;  1JEK A;  4PV1 B;  3OTF A;  1K05 A;  5AVX B;  3GVM A;  3LW5 J;  1NT2 B;  3MUD A;  4O2A A;  4UVC A;  2RQ6 A;  1S9K E;  1MZE A;  4H13 B;  1BE3 J;  1M57 D;  5KA6 A;  2ZXX A;  3Q1M A;  1LR1 A;  2ZYA A;  3OM3 B;  1YTF D;  4JV5 B;  4I5S A;  2ZM6 B;  2ZXW B;  4JI4 B;  1BCC G;  2UXC B;  3TDK A;  2P58 A;  1VP7 A;  4FLZ A;  1WB8 A;  2MKV A;  1K8A Q;  2A3Q A;  2A06 G;  3JAT B;  3EFG A;  1H8H G;  3H1L H;  1NTZ K;  2W6B A;  2YO3 A;  4J7K A;  3CRQ A;  3L74 H;  4X1I A;  4Z1V A;  4MW3 A;  3L74 D;  2JP3 A;  2FYU K;  3JAS B;  1VF7 A;  1M7L A;  2ARH A;  1S1C X;  3OE7 G;  4UCT A;  3H1J G;  4JI0 O;  4IIJ B;  3AE5 C;  3RK3 D;  5KAF E;  2J5U A;  1GN3 A;  3H1J H;  3Q4H A;  4B3R B;  4C7N B;  3H1J D;  4HB1 A;  5J2U A;  3ZDM A;  3PN1 A;  3APQ A;  3IJ4 A;  2AEM A;  3ASN B;  3JSN A;  1PP9 D;  1K34 A;  3TK1 A;  5KX5 A;  3FX0 A;  2KKW A;  3CXH E;  5KLI C;  4JZG A;  2R70 A;  2Y0P A;  3O6Q B;  3FKS G;  2DJV A;  3K57 A;  4IIJ A;  2AXT Z;  4KT0 J;  1BCC H;  3W68 A;  2JR8 A;  1SQQ G;  4ZHQ A;  3KKY A;  1BCC D;  2WSS G;  2V4D A;  5CA0 A;  1VF5 C;  1QVF O;  2N74 A;  5BR8 B;  4UB8 Z;  4WWI A;  4TQD A;  1GDT A;  2FKX A;  4JTA B;  1NTM D;  1VQ9 V;  4FM0 A;  3AG1 C;  4W7Z A;  2WSF J;  2OCC B;  4GOF A;  3RYC A;  4FFK A;  5IWA O;  4R7C A;  4UB6 E;  5KA5 A;  4JF7 A;  3IN6 A;  4XDJ A;  4HJG H;  3SPJ A;  3UM7 A;  4DK1 A;  2UUB O;  3CWB J;  3AG3 B;  1VEW A;  5LHI A;  2Y0E A;  5CBH A;  3L4F A;  3AE7 C;  1XTC C;  1L0N E;  1KIL B;  2WSC H;  2QJK C;  4O4I B;  4DT0 A;  1VQ7 P;  2Q9I A;  1JTH A;  1OFC X;  5KAF Z;  2P5O A;  2KG7 A;  2UUC B;  3CXH H;  1NAY A;  1YXB A;  2NLJ C;  5BY1 A;  2F95 B;  4QMA A;  1NZ6 A;  1M1J C;  1CI6 B;  4P2Z A;  4X62 O;  1GU4 A;  3K06 A;  3OW2 U;  4LF6 O;  3TCU A;  3T1Y O;  1D5A A;  3SJC C;  1N36 O;  3LW5 H;  1L4A D;  1LGH B;  4JYY A;  3JSV C;  3PJS K;  3PLN A;  3H32 A;  1V55 C;  3ABV C;  3CCE P;  5CN0 A;  4OWF A;  1G1X B;  4ZHQ B;  3AG7 A;  3L70 H;  4J42 A;  4TQF A;  1AI5 A;  3P8C D;  1N7L A;  2QWP B;  4JTC B;  4TT3 G;  1K73 W;  3FB8 C;  1JCH A;  3VP9 A;  1OCR C;  4KHP B;  2K9J A;  2V7Q H;  1T2K C;  1YJ9 P;  2WLM A;  4PA3 A;  2M7W A;  1L0N D;  3CWB D;  2QE7 G;  1EZV E;  4NTY A;  4JI3 B;  1SRY A;  1VQ6 P;  3JCU H;  2LGW A;  2K9P A;  4DR4 O;  2WPR A;  4B3S O;  2OCC C;  2F4V B;  4WFB V;  3ETE A;  5B1A B;  1L0N K;  3AG2 C;  1OZ0 A;  2H89 C;  1MFZ A;  2E3C A;  3HKE B;  2QTO A;  1EZJ A;  1SQQ E;  1YTZ I;  4PD4 E;  4DUY O;  1Q82 Q;  5J9P C;  1YZB A;  1LT9 A;  4G2K A;  3FYE B;  2RMZ A;  1QVG U;  3N7N A;  3RYF B;  2P90 A;  3KG2 A;  1M56 C;  2ZT9 D;  1FFX B;  1YJN P;  5EYP A;  4PDL A;  2J58 A;  1ZRT E;  3DXR A;  2UXB B;  3ABK C;  1XQ8 A;  4YTP C;  4JAA A;  1COW G;  2NR5 A;  1SP4 A;  1Y47 A;  1PNL A;  4UCU A;  1NU1 D;  4B3S B;  1OIP A;  2XAG A;  2RCV A;  2OTJ V;  3E8B A;  1H2M A;  2ZR2 A;  2XDJ A;  1YHQ P;  5B5E Z;  1NR1 A;  4ZOL A;  4I9W A;  4Q20 A;  1ZME C;  1VPC A;  5FL7 G;  1NVP D;  1LTJ A;  2Z5H A;  3WUU A;  5B1B C;  2Y9Z A;  2CH7 A;  3G71 P;  5AVU B;  4YIO A;  2KK7 A;  3JC2 2;  4KHP O;  1SQV K;  1W59 A;  2GV9 A;  3ZHQ A;  2Y69 C;  2PZS A;  2ZNJ A;  2I1J A;  2W83 C;  2BEQ D;  3JCU E;  5E1A C;  1X8Y A;  2K1E A;  1H89 A;  3EHB B;  2FFD C;  2M3E A;  2RJZ A;  2H8P D;  1T3J A;  3OR7 C;  3SR2 C;  2Q67 A;  3A0H H;  3CCR P;  2GUZ B;  1XL4 A;  1GL2 B;  1JY3 O;  1VQ7 V;  1JY3 P;  3HTK B;  4YJ2 B;  2WPV B;  3KQG A;  4NXM B;  2JS3 A;  1U57 A;  3K9S A;  2FYN C;  2JEU A;  2K9Y A;  2W6J H;  1K3E A;  3K3W A;  4EFB A;  4LF6 B;  1BQ0 A;  5APX A;  4BAY A;  4B7E A;  3VMZ A;  1L4A C;  4GX5 A;  2A79 B;  4PA4 A;  3RBZ A;  2K37 A;  3CC4 P;  5GTH H;  1ZN5 A;  2M5A A;  5EBM C;  4O4H B;  3ASN C;  1NTZ E;  3T4D A;  4DV7 B;  2CUG A;  1SQF A;  3SJQ C;  1LTB C;  2HLD G;  2PGD A;  1WP7 A;  1XOU A;  1IFI A;  1ZL8 B;  3ZHS A;  1QVF U;  3G71 V;  3E7K A;  4A7P A;  3TGU H;  1QLE D;  3OEE G;  2RDC A;  2WZ7 A;  2ZDI A;  4KL1 A;  2AEF A;  5EC2 C;  3TGU D;  4PEL A;  4IHJ A;  4WFA V;  3SPH A;  1GW4 A;  3ZBH A;  5JVD A;  3OAK A;  1GM7 A;  1WAZ A;  1P84 I;  2QA4 V;  2Y69 B;  1OZH A;  2B87 A;  4CH3 A;  5B5E H;  4X66 B;  3CEI A;  5IWA B;  2KXP B;  2ZE6 A;  1CPY A;  4MW8 A;  3B71 A;  4LF4 O;  3H1I G;  1E5W A;  5LHH A;  1SC5 B;  2LR2 A;  1Y9B A;  2BCC H;  3B5N A;  3GG2 A;  1P7G A;  2NPS D;  3TYY A;  1BDC A;  1CSB A;  1PZQ A;  2MW2 B;  4LF7 O;  4I6M C;  4J11 A;  1H2L A;  4IL6 E;  4X66 O;  1LNQ A;  2W90 A;  5EZY B;  2ZIM A;  5BR8 O;  2Y0I A;  2AXT H;  1W2B O;  3P30 A;  3TF5 A;  2JEX A;  1KP2 A;  4FK5 C;  5GTI H;  3H1L G;  4O4J B;  3HD7 A;  4E2L A;  2GHY A;  2IM9 A;  3CSX A;  1T6A A;  3E1R A;  3WUT A;  4LNU B;  3ABT A;  1IFJ A;  1S5L E;  1YIJ P;  3EQ2 A;  3OMI B;  1KFM A;  1NKD A;  5BU8 B;  1SA0 A;  2OAR A;  1JB0 J;  2Q0A A;  2JGD A;  1ZX3 A;  4X20 A;  3U11 A;  4D6T G;  4NR1 A;  2B1I A;  5H2F Z;  3T1C A;  3LDD A;  5LXT B;  1TGO A;  2P7T C;  3A0B Z;  1UII A;  4N78 D;  3H1I H;  4UVB A;  4NXM O;  3VN0 A;  4UB8 H;  5AW4 B;  1BSH A;  3DC6 A;  5EIB C;  1JCC A;  3U59 A;  3JD2 A;  1IBL O;  3RK3 E;  1QLE B;  2BCC E;  2H8P C;  1Q7Y W;  1M8O B;  3WB2 A;  3AEA C;  1X9V A;  3D36 A;  3CCS P;  1GW3 A;  4CC5 A;  2DN9 A;  4KFM A;  2BAS A;  5BU5 A;  4QPJ A;  1VQM V;  3CC4 V;  2EJR A;  2ZXE B;  1EN6 A;  4YJ3 A;  4FLX A;  3L73 J;  4GYC B;  3K5O A;  4JI4 O;  3RYI B;  5FPR A;  2ZM6 O;  1VQ8 V;  1IX9 A;  4QIW F;  2KLU A;  4JV5 O;  4C7N A;  5JQG A;  4GKK O;  2GUV A;  2WT7 B;  4WFH A;  3T4Z A;  2XZR A;  2WIT A;  2JJ2 G;  1LJ2 A;  2KQX A;  4YHH B;  1G4Y B;  1WJZ A;  2PYL A;  2OTL V;  3SYC A;  2N1T D;  2PRR A;  2IW5 A;  4YJ3 B;  1OJH A;  5F2V O;  1EC5 A;  2QM4 A;  2UXB O;  2B89 A;  2FXM A;  4IFD K;  2Y4T A;  4I0X A;  1US6 A;  4X64 B;  1RF0 A;  1R8E A;  1PP9 J;  1N8R W;  2Q4P A;  1URQ C;  2ATK C;  4LF5 B;  4N78 E;  1NH2 D;  3JAL B;  1Q81 Q;  3BCC G;  5DN6 G;  3RK2 D;  1OW6 A;  2FBW C;  1FZF A;  3CE2 A;  3AG3 C;  3JYC A;  2F23 A;  1USE A;  1Y76 A;  2LFS A;  2QWR B;  1N2D C;  4PA9 A;  1NOH A;  1VQK P;  1NU1 G;  4EFE A;  1FU1 A;  3O9O A;  4YJ2 A;  1NHL A;  5CA1 B;  1BCC J;  3B8E B;  2Y0C A;  1VQK V;  4U3F H;  4BWN A;  2A06 E;  1NS1 A;  3KCX A;  2G8Y A;  2ADP A;  3JAL A;  1BE3 G;  2XV5 A;  5LMN O;  4UCR A;  4PV1 D;  3VYI A;  1N34 O;  2GUS A;  4BRY A;  2WPS A;  3M0D A;  2DQ3 A;  1RE3 A;  3RVY A;  4EB6 B;  4NXN B;  5AW7 B;  1NO4 A;  3MHS C;  1SQX H;  5IJ0 A;  4LWS B;  1FZB A;  2UXX A;  1V55 B;  5JJJ B;  2VQE O;  2UUA O;  4RUF A;  4D6T E;  4NVP A;  1VQ6 V;  1EZV I;  4YXW G;  4H44 B;  3CC7 P;  3T1Y B;  1Q2N A;  2Q3E A;  3EVK A;  3P8C E;  4JBZ A;  1M1K W;  3AK1 A;  3CX5 E;  4X62 B;  4YXD C;  1L0L J;  3UT5 B;  3G9R A;  4NYK A;  1IK7 A;  3JD3 A;  4IFF A;  2EJ7 A;  2LW1 A;  3ZRW B;  4DYL A;  4JI8 B;  4NXN O;  3J7A U;  1MZF A;  1PPJ H;  1FDI A;  5CCG D;  1K97 A;  3H1H E;  4MVU A;  2YUA A;  1IFP A;  3W7T A;  1BE3 D;  2GSM B;  1L4A A;  1N34 B;  1ZSP A;  3JD0 A;  2HOD B;  5LXT A;  3C3T A;  2UUB B;  2QG4 A;  3WU2 H;  1BGY H;  5KMG B;  2RH0 A;  1VQO P;  4HH2 A;  3ZX6 A;  1Y4M A;  4QE9 A;  2AZ2 A;  5CMU A;  4QNH B;  2C2A A;  1Q90 D;  2E74 B;  1VAR A;  1AI6 A;  2JS5 A;  1VQL V;  3OA7 A;  2CTR A;  2POH A;  1BZK A;  2OYH C;  2YIB A;  1R3I C;  3VOU A;  1UIX A;  1ROP A;  2EIM C;  2B9Z A;  3QO8 A;  2GTS A;  5DJT B;  2GBO A;  2JWD A;  3P3P A;  3BHP A;  4X64 O;  5H6Q A;  2IJJ A;  3BCC E;  2YID A;  5LOV A;  1K9M W;  4GOE A;  3FAV A;  1JVM A;  4FFB B;  5DJU B;  4LH7 A;  3H1I J;  1WT6 A;  5EK0 A;  5B1A C;  2KNC B;  2ZYD A;  2CE4 A;  2DW3 A;  1ZRT D;  4O4L A;  4LFA B;  4OPA A;  1LP1 A;  3S3W A;  2O01 J;  2ZQM A;  2KIK A;  3M9H A;  1OCZ C;  4WY4 A;  2KI7 B;  4JI0 B;  1SFC D;  1FDM A;  3STZ C;  1OCR B;  2XHB A;  5B66 Z;  3RBX A;  3Q5P A;  3TSI A;  1Y76 B;  2RNB A;  3V6I A;  1N7S D;  1S3J A;  3GWK C;  4AYC A;  4Q6G A;  2PP6 A;  3G6B A;  4GX0 A;  1FC2 C;  4U3F G;  2JKV A;  2DYS C;  4I4T A;  3RYF A;  3CWB H;  3D71 A;  5IY5 C;  1MSW D;  1Y74 A;  4CS3 A;  1DEE G;  1Y8A A;  1DX7 A;  2HR3 A;  4RAI A;  1R5L A;  2QVA A;  3GF3 A;  4H13 C;  2IBZ I;  4CH6 A;  3FWL A;  1N33 B;  1MKM A;  5JWP A;  3H1K D;  4LBE C;  1YSC A;  1KYO E;  1OCO C;  4WVZ A;  1B04 A;  2NPS A;  4Y99 C;  1JY2 P;  3B5N D;  2ZD9 A;  3RN4 A;  1M1J A;  2DWE C;  2Q68 A;  3CCQ P;  2DWD C;  1N73 C;  1VQ4 P;  3HE4 A; 
#chains in the Genus database with same CATH homology
 1DD3 A;  4OGQ D;  4KT0 J;  1JB0 J;  4YTP C;  1KIL E;  3G9R A;  1AJY A;  2D2C D;  1IK7 A;  1KQG B;  1VF5 C;  5L8R J;  4XFJ A;  1FDI A;  2H88 C;  4OGQ C;  1KTM A;  1RQV A;  2WSE J;  3AEE C;  2E74 D;  3AE2 C;  1ZME C;  1ZOY C;  3GF7 A;  2FXP A;  2WSF J;  3RK3 E;  2E76 B;  1PIX A;  4IL6 X;  4U7J A;  2E75 C;  1VL2 A;  3AEA C;  2QIW A;  3C8V A;  4GDO A;  2NZ2 A;  2E74 C;  2BEQ D;  3Q5S A;  3IN6 A;  4H44 C;  2ZT9 C;  4R4M A;  3SFE C;  1Q90 D;  2E74 B;  1FDO A;  1KOR A;  2QSI A;  3H25 A;  3AE7 C;  1K04 A;  2G3A A;  4R4L A;  1HF9 A;  2WPV B;  1UIX A;  2QJK C;  3D6Y A;  1U57 A;  2FYN C;  1OMI A;  3RL0 g;  2QJP C;  4OGQ B;  2K9Y A;  1OW7 A;  4I7Z B;  2E76 D;  2BEZ F;  2D2C B;  3D6Z A;  2ZT9 B;  1S5L X;  4PV1 C;  1NGM B;  4Y28 J;  1PL5 A;  4I7Z C;  3S9O A;  2E75 D;  4H0L D;  1K05 A;  2E76 C;  4PV1 B;  5M1B A;  4TT3 H;  3Q3D A;  1R8E A;  4H44 D;  2E75 B;  3LW5 J;  1KMI Z;  1YQ3 C;  4H13 B;  1OW6 A;  2FBW C;  1OW8 A;  2QJY C;  3ABV C;  3Q1M A;  4H0L C;  3R4Y A;  1WMK A;  3AED C;  2IDB A;  2O01 J;  1RQU A;  3GMA A;  1PV3 A;  5KKZ C;  3Q5R A;  1HJ0 A;  3AE1 C;  1VF5 B;  2MKV A;  1KQF B;  3Q5P A;  2G8Y A;  3AE6 C;  3B71 A;  1DD4 A;  2V7Q J;  1Y9B A;  2OQQ A;  4PV1 D;  1DIP A;  3T97 B;  1YQ4 C;  3O6Q A;  2JP3 A;  2JO1 A;  2D2C C;  1ZP0 C;  2WQY C;  3AEF C;  3D71 A;  1S1C X;  3EWK A;  2YMK A;  3SFD C;  3D70 A;  3AE5 C;  2P10 A;  3AE9 C;  2J5U A;  3AEG C;  3AEB C;  3GF3 A;  4H13 C;  1EXI A;  4H0L B;  2YIU C;  2H89 C;  3FGA D;  3AE4 C;  1MKM A;  1NYH A;  1TU3 F;  3AEC C;  3Q2Y A;  4H44 B;  4H13 D;  1GMJ A;  4RKU J;  5KLI C;  3IAO A;  2WSC J;  2ZT9 D;  4Z1M H;  1EXJ A;  1VF5 D;  3AE3 C;  3AE8 C;  1ZRT E;  4YXD C;  3GLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...