2E75B

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e75B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75B01
2FYNC 4RKUJ 1VF5B 2K9YA 4OGQB 4PV1B 2WSCJ 2E74B 4H13B 2QSIA 1JB0J 4Y28J 2ZT9B 1ZRTE 4I7ZB 2QJKC 4IL6X 2WPVB 1S5LX 2O01J 5KLIC 2E76B 2E75B 2D2CB 2WSEJ 2WSFJ 5KKZC 2QJPC 3C8VA 3LW5J 4H44B 1Q90D 2QJYC 4KT0J 2YIUC 4H0LB 2QIWA 5L8RJ
chains in the Genus database with same CATH superfamily
1S9KE 1RE3C 1KUQA 3CRCA 4FLZA 2C9NY 2AXTH 1Q82W 4UXNA 2K1AA 4AI8A 4G28B 3I5DA 2Q3IA 1OCRB 5CMZA 2IJJA 4MT8A 1Q6IA 1TUBB 2Q5UA 2IJIA 2JGDB 4NXMB 1EQ7A 1FS0E 1MSWD 1QEXA 2H89C 4JYCA 3M06A 5KLVJ 3H1HJ 2MW2B 3BA9A 3VOPA 1YIJP 2OIGA 3F7VC 1V54B 4QJFB 1JFFB 3K5NA 1AVOA 5L3BA 3RVZA 5JWPA 1RM1B 1K05A 5B66Z 1J1DB 1AVMA 1PP9G 3VYIA 4O9BA 2QWRB 1URFA 1IZNB 3H1LJ 3CC4V 2NNUA 5E1AC 2WLLB 2F43G 5EBMC 1JEKA 5GTHZ 2ZT9B 2AGAA 5CBGA 4LH7A 2LP7A 2WAMA 3H1JG 3WUVA 4X20B 3TCUA 3RL0C 1KQLA 1P7BA 4BXLA 3ZIAG 5FNVB 3BY6A 3OMIB 1L0LE 3OEEG 1VPCA 2A0LA 1KKCA 3HKCB 2UUBB 1H2MA 2BCCG 2IYOA 1FXKC 5LMNO 3T2MA 4DR3O 3AE4C 3JAKA 3CX5I 2ZQMA 3E8HA 1JA8A 1PPJD 1MV8A 2RJZA 4YIPA 5CA1A 2CPSA 1N8RQ 1XNQB 1ROPA 3LSSA 5LA6B 2CPBA 1SQQK 1VF7A 1Y76B 3WB2A 3A0HH 4NXNB 1UPGA 4DR2O 4EIJA 1HNWO 1X59A 3BAAA 3MIWA 2QWQB 1MNGA 1YHQV 1FU1A 4B7KA 1BGYG 4TT3H 4C7NB 4MVMA 5J2TB 1NH2D 2HYNA 3FB7C 4O4LA 4QPKA 3O65A 4TLFA 1EBOA 4PA7A 3QWOC 4MVRA 4WY4D 2DJVA 1KILB 5CB4B 3E2EA 4J7JA 5LHHA 2HKOA 3B5NC 1YEWA 1RY3A 3TGUD 5EIBC 1CEZA 2JDIH 3QTCA 1NTKG 2WVRA 1SQQJ 3ABKB 4U3JB 3CPWU 3D70A 1XMQO 3L71E 4EDFA 2EJ7A 1OWAA 2N1TB 3O6QA 2R32A 5F2VO 5KJ7D 1FZCC 4J7ZA 1VQOV 2BCCD 1KKDA 1NJIQ 3ABTA 2X6BA 3JALA 1W2EA 1ZL8A 3FYIB 2CDYA 1SQPE 2YIBD 2DN9A 4LFBB 1NAFA 3ZEDA 1EZVG 3UO2A 4KL1A 4Y99B 4RWUA 4X8AA 5KLVE 1DIPA 1XUQA 3H1HE 1U96A 1J95A 2XNXA 1OCCB 1SFCC 2YO3A 3VMAA 3Q3DA 1AP6A 3RYFA 2H8PC 2CK3H 2K9JB 4HZ3A 1H88A 3IR9A 1A02J 2KYVA 4Q6GA 4QPJA 5KAIZ 3OAKA 1WA8B 1ZTEA 1QVFU 4L87A 1M1JC 1F51A 3VOUA 1QVGU 3O9OA 3OT7A 2JRIA 1SQBG 3CD6P 1PKXA 3WU2E 4N78D 4O4JB 4DUYB 3H1LE 5JQGB 1IBMB 2E74D 3ZHRA 4D6TG 3H1KG 4QMAA 2ZR2A 2KNCB 4OGQB 1T8ZA 1GKFA 1KP3A 2EIKB 5CA0A 2KI7B 1XILA 1J5EO 1T6AA 3M0AA 2ZR3A 3G4SV 3KKYA 2E75D 1NR7A 4ASVA 5LXTA 4EB6A 2YS8A 2XHBA 5B1AC 1HGZA 2HODA 4L75A 4LF5B 3ASOC 1GM9A 2RMKB 2JP3A 2LXCB 1KU9A 4UVAA 5DM6V 4DW0A 3A3YB 2E76B 1HDJA 1Z5WA 2YIUB 1EZVD 1GDTA 3AEAC 2QE7H 4GKKB 3U11A 3SFEC 3ZRWB 1BSNA 1YIJV 2JWAA 3ZMZA 3D8CA 5IT9N 2Y0DA 1JCDA 3OUFA 3VMZA 2XAFA 4FLWA 1SS1A 5AW6B 3HD7A 3E1IA 3ZHSA 4WBNA 2ZKOA 3JD2A 1ZP0C 1SQVH 4FFBA 4GODA 3RWRD 1SZXA 4OWFA 1GO3F 2WTYA 3M9BA 1VQMP 3JAWB 1GW4A 3SYQA 2ZIMA 2ETNA 1EN6A 3RT3C 1WNSA 4H44B 5LMUB 1W0JG 1KP2A 2HLOA 5LHGA 2OCCB 1VIBA 5H5NA 2ZYDA 2FL4A 3SPHA 1CI6A 4RO0A 4IL6E 4DR4B 2PI5A 1TAEA 3T4DA 1SQXH 4R4MA 1G1IA 5KHIA 1FJPA 5FL7G 2P90A 3CHXA 1M93A 2MK3A 3N2GB 4CC6A 1LUVA 4C7UA 5IJ9A 3ABVC 2QSAA 1OCRC 2H43A 3BVHA 1CW5A 1NTMD 2KQXA 3R65A 3L70J 5J2UA 1MKMA 3ITKA 4LH6A 4KHPB 4H0LB 1V54C 3F7YC 3L75E 3SJQC 2AZ0A 1R5LA 1QGKB 2ZINA 1USDA 1XTGB 5H2FH 2IX7C 2M7WA 4H33A 5EBLC 1RSOA 4LFCB 1OMIA 2B5UA 3APQA 1B06A 5JJEB 1BQZA 1E79H 3M8AA 5CCHD 4FM0A 2GUZA 3RYIA 3F5WC 3ZRVA 1S1CX 2ZT9C 2E42A 1IBLO 2Q6QA 5IYCO 2WLNA 1KQFB 4F6RB 2ADQB 4UB8H 2GTAA 4PDVA 4ZOLB 1PP9J 3MZWB 1P49A 2O1KA 5LP6B 1YCIA 1AI7A 1OFCX 3AE3C 3QF7A 2AXTZ 3W7WA 3AG1B 2A3QA 4Z1MH 3KXDA 1BHBA 1FDMA 4JPZB 3OTFA 3AE1C 3E7KA 3H1JJ 1J2JB 4WB4A 2ZYGA 4Y28J 1M1KQ 1ZWIC 3Q1MA 3JC22 3FFQA 1N7SD 4FMTA 3KZIE 3SPCA 5BXZA 4WFBV 3B8NA 4TV9B 4J7KA 2C0WA 2YKOA 2O01J 2BCCJ 3IC7A 2RN0A 1BE3H 3ZDMA 5TISH 1AVYA 2IZ1A 3BVOA 5L3DA 3X2QB 3PJSK 5JVDA 2IPPA 5LOVA 2YMKA 1URQB 4DR6B 4PHZA 5GTIH 1VQ7P 5JCOC 4UCTA 2KLUA 1YTFD 1WAZA 3E8GA 1HWTC 3CX5F 1Z56A 3OD4A 1UIXA 3AEBC 2ZFCA 1DEEG 2PP6A 3AEEC 2IM9A 4TOIA 1BGYJ 4U7NA 1NU1H 3ABUA 3WFVA 4E4EA 2P7TC 4ABMA 1ZR4A 2XAHA 3ABKC 1EZVI 4JI6O 3SPGA 3BATA 2X6AA 1M56C 1S2EA 3RBZA 1NVOA 4W7ZA 1P84H 4BRYB 1RF1A 2DWEC 5LBQA 4DV0B 4WF9V 4X65O 1NTKJ 2RMZA 1MZEA 1HR0O 1EDLA 3C3TA 3AECC 1BDCA 1WB8A 1OCZC 3LIEA 2YC0A 4YXWH 3TETA 5FPOA 2ZCEA 2UU9B 2B1GA 3BA8A 3L70E 1OZHA 1WN7A 1S9KD 2Z5UA 1SQBK 1KC8Q 3HB3B 1K73Q 2RQ6A 4O4IA 1ZLZA 3P8CE 2HR3A 3HE4B 1G6UA 2E5TA 1XHXA 4LLHA 3OE7G 4TT3G 4WFGA 4L73A 1RFYA 1NOHA 4PD4H 1VQMV 3IGAC 1IFNA 4K0KB 1H2GA 4RKUJ 1DEBA 2M8RA 3Q4HA 2K9YA 4F6EA 5B1NA 3SDLA 4DR1B 3P8MC 1SQGA 1KQSO 3QO5A 4JZ2A 5L3GA 2Q6AA 1VQ6P 4OGQC 4I55A 1L0NH 2IZ0A 4GOEA 1PP9E 1K5QA 1SQBJ 3M0DA 4R4LA 4EI2A 2GV9A 2EX3A 4YIOA 1NTMK 1FFTB 3RYCA 2M5AA 5DN6G 1KD1Q 3EVKA 1LP1A 1LTJB 4D6TJ 4BW9A 2WSFH 3H1KJ 4J10A 4UVCA 1NS1A 2FXMA 2LO1A 3FWLA 2O3JA 4JF3A 2E76C 3H1JE 5B66E 2Y9YA 4DV2O 2YIUC 1GTOA 3AG3C 1N2DC 1TU3F 3AK1A 4DR5B 4NXMO 3JARB 3FB8C 1KB9E 1N73A 2KIKA 2DW3A 1FZEA 2BCCE 1KYOE 2CTQA 2ADPA 5KHKA 1B3QA 1JJOA 1MFTA 1VQ5V 5AVWB 2L6LA 3CMEV 1B04A 2CK3G 4DJGA 5AVYB 4TUYA 2I1JA 3BASA 4I1LA 2JGUA 4LF8O 1USEA 2GUVA 1DD4A 1Q43A 2W90A 3KQGA 3B8MA 1FOSF 1YJNP 5DEDA 4X66B 4H44C 3CCEV 3B09A 4NYKA 3D3IA 3FAVA 1BGYE 1NJIW 1YVWA 3CP1A 4XE5B 3C1LA 5KHJA 4YHHB 4JTCB 2N05A 3VQWA 3TXSA 2QEXP 4PA3A 3HPLC 2DOSA 5BVZA 2P06A 2AEFA 2NPSD 3QO7A 3JD3A 4MTXA 1NTKE 3V4QA 3E8BA 1AA0A 3L71D 3ABLB 4O4LB 3SYPA 1IZ3A 1VQ4P 1OCOC 1E1QG 4FVMA 1NZ6A 3CCVP 3E1RA 3FYEB 2RDCA 2XDJA 2EIJB 2UWJE 4FPPA 4R6ZA 2LW7A 3SPIA 2QE7G 3OTOB 5KJ7C 4DV6O 1IFDA 4H0LC 1H2KA 3UQ8A 3I5CA 1NQTA 1SQPD 1VQ7V 4RAIA 4DV5B 1R6KA 1BQ0A 4PJ0H 1EZVE 3Q2YA 1YJ9P 3CXCU 3O6QB 3CWBH 2V4DA 4PA4A 3ZBHA 4DV7O 3THOA 4TQDA 4MTGA 1J1EB 1X79B 2B89A 5APUA 3RK3B 1YITP 5JJJB 4B3RO 3H1HD 3ASNB 4LF6O 5KLVD 2O01N 3AE6C 4OPHA 3E8FA 3P32A 4YJ3A 2VQEB 4P9PA 1SQVG 3GHGA 4ZKUA 2P4VA 4G2KA 4NB5A 3MHHC 4N23A 2GTSA 4DXWA 2CH7A 4JV5O 4CS4A 5LP6C 2N9YB 1HBWA 2VQFB 2W6BA 2XU6A 4DZOA 1KFNA 1Q6UA 4LNUA 1SQBE 3AEFC 4IHJA 4H13B 3H1LD 2CTRA 4FK5C 1K3EA 5KMGB 3JASB 2K9PA 3N2KB 5CBNA 4D6TE 2VS0A 3H1KE 2ZE6A 1JVMA 2OYHA 2R9RB 3K5MA 4LFBO 1BSHA 2QM4A 1SQXG 1GMGA 1FZAA 3J7AU 2LFRA 2JS3A 2UUCB 4ICGA 2PY5A 3CMAV 2KSJA 2PF4E 2WSEJ 5APYA 4J11A 2HJFC 1AV1A 3LDCA 3SJAC 4BIZA 5ITZA 1HF9A 5H2FZ 3CC4P 3CC2V 4DV4O 2E75C 1S76D 3CC7V 1RHZB 3UT5A 4DUZB 1ZR2A 3B40A 1BHAA 1D7MA 2QA4V 1VL2A 4C46A 5IY5B 2PAJA 4WY4A 4OPAA 1BMFG 5AVVB 2OGUA 4MW3A 1IBMO 4EB6B 4YJ2A 1L1FA 2HODB 2K3RA 2QRXA 2Q0OC 1JNMA 3L75G 1E79G 4CH6A 2Q7HA 1VQ6V 2POHA 4N3YB 4CH3A 3L73H 2PZSA 1MSDA 2Y0IA 3LDDA 2DYRB 3CXHH 2ZT9D 2E3CA 4UB6H 2HVKC 4LWSB 2W6IG 4LF5O 3FGAD 3U10A 4NKGB 1VQ9P 2WSCJ 4Z1MG 1YHQP 1VQNV 5AVQB 1BCCH 1SS3A 3J80N 4X1YA 3HD7B 4WBNB 4GKKO 1M7LA 4JGSA 4FFBB 3CCMV 3IFMA 4EFBA 1GL2A 3K5BA 3K9SA 3QG5A 3L72H 4O2AA 2LR2A 2Z0AA 2ZJSE 2Y4UA 1BDDA 3F89A 1G2CA 1EN5A 1BE3G 1JCHA 1FC2C 1Q81Q 2ZM6O 1KQGB 3VTPC 1EDJA 1RF0A 1CI6B 2FYUH 1AI6A 4MVOA 2H3OA 3PN1A 1YJNV 3EFFK 3M91A 3V2QA 3NR7A 1LWUA 1IFMA 5LMUO 5IJ9B 3L75D 5D5QA 2RN9A 2KG7A 4ZBMA 3E83A 3BRVB 1IXMA 1KILD 1RPOA 1NU1G 2CAZC 5J2UB 2CUGA 2OYIA 1YI2P 2QEXV 2QR4A 3M7MX 1GMJA 1LTJC 2QWNB 2WLKA 1VQ8V 2N1TD 3CCLV 4D7TA 1OIPA 1ENVA 1JMKC 5HFLA 1Y4MA 4Z2WA 1W5CE 4CZZA 1VQ4V 2QKCA 3ZRXA 3I56P 1RSOB 2P4KA 1OW8A 3OGCC 3CCVV 1SQPK 1CXZB 1H8EG 2W27A 5FLXN 2JS5A 1NI8A 2FKWB 2QG4A 1FZBA 4YXWG 4IYIA 2GUZB 3RYIB 1DF5A 2Y69B 1S5LH 1JUNA 4HB1A 5AVSB 1XEQA 3RK3E 2Y9ZA 3MUDA 1XOUA 2AXTE 1W2BO 2DW4A 1L4AA 1YITV 4MW8A 4TV8A 2EIMB 4W80A 2KSEA 1RP3B 1EM1A 4I9WA 1N7SC 1RH5B 4QIWF 1T5EA 2A45I 1H2LA 2JEXA 5CMUA 1SQPJ 2Q7GA 2R5BA 1T2KC 4IIJA 5AW5B 1IX9A 1D5AA 4CPGA 1NYHA 1SF9A 2YIDA 2ZIOA 4B7EA 1DK1A 1L0NG 4OXSA 2BASA 2NN4A 4OGQD 1Q86W 2N04A 4YY3O 2ZXWC 1OVRA 3BRCA 1THZA 4LF7O 3K06A 2XAGA 4P2ZA 3ABLC 4RO2A 4EKWA 1N32B 1EXJA 1LR1A 3CS5A 3OGIB 4JI8O 3FKSG 4JYAO 1IK7A 2E76D 3L74H 5KLIB 4XBFA 3T97A 2DYSB 2WQYC 4DR6O 1U97A 1SQVK 4O2BA 1Q8IA 3TSIA 4ZI7B 2OQQA 3AE2C 3RK3C 3CCJV 3L70D 1NTZH 2XASA 1N36O 3ASNC 4ZKPA 4AHCA 1KZUB 2WLIA 4X1IB 2WT7B 2IJHA 2GBOA 5AW7B 1O9GA 1QR9A 3JATA 3P8CD 4GOFA 2B88A 1LTIC 3F5TA 2QTSA 4JI2B 1SQXK 4LFAB 2F1MA 2DE0X 2IDBA 4H13C 4H44D 3JD1A 1SQVJ 2OTKE 1VQ9V 4JI1B 2BSKB 1EN4A 4A7PA 4O4IB 3LNNA 2ZD9A 1FAFA 2F93B 1RE3A 2Q7CA 1YXBA 1PP9D 1OV9A 1D5NA 1TVKA 3OW2O 2WWWA 3DC6A 4MVZA 4HH2A 3M9HA 4WWIA 3LSUA 5CA3A 4AQYO 2BOCC 4NPDA 3USSA 1PNLA 3H1JD 1GN2A 4JASA 4BR6A 1MUUA 4NTYA 1SQXJ 3B77A 5H6QA 3AEDC 1M8OB 2HPCB 5IY5C 1EFRG 1KB9D 4IL6X 2Y4TA 3K0GA 5BR8B 4H0LD 1R5SA 4JAUA 2V7QH 2M5AB 5B1BB 4Z1VA 1N7LA 4DV3O 1LP1B 1YTZT 1OHHG 4HBNA 4DR1O 1KYOD 3CWBG 3N7NA 2WSSH 2FYNB 2QJ1A 1Z2GA 1GN6A 1W0KG 4M3LA 2F4VB 1SZTA 3JAMN 1N73B 4DW1A 1YI2V 4OX9O 5CJ4A 4OH8B 4MN4C 3L75J 3CEIA 4KUMA 5KA5A 2BEQD 2UXCO 5KHHA 2Q7EA 1BGYD 4W7YA 3I56V 2JK5C 2W8ZA 3HD7C 4TUYB 5CCGD 1FXKA 2OT5A 3G80A 2KUBA 2UXBB 4IOIH 2UUAO 5L3CA 2ATKC 4I2LC 3V2PA 4PDMA 1FDOA 5CN0A 2CGNA 3L9DA 4WFAV 4GUNA 1JR9A 4R8CA 4JTDB 1FZFA 1NTKD 2FFDC 5LGNA 3FAVB 4WCEV 2QGNA 4ZHQB 3R4YA 3UO3A 3WG7B 2NPSC 1T3JA 2C2AA 1HNXB 1T3UA 2WPSA 3U59A 3C90A 2DQ0A 5KKZB 1URQD 1QLEB 3K9AA 1YZBA 1IBKO 3EXAA 5APVA 1BE3J 3HE5A 4MVUA 1XMOB 1UIIA 1H2SB 3NXSA 1KV4A 3B5NA 5L3FA 4LF4O 3MDSA 2YEVA 2E5LB 2PRRA 1IC2A 3B8EB 3L73G 3ABMC 1SLQA 2GUSA 2JKVA 1SQVE 3BPZA 1U57A 2W6AA 4HKZH 3ZN1A 1VDFA 2A06H 1Q3EA 2XT9A 1NU1J 2R3CA 2B9BA 1V9PA 5KX5A 4GKJB 3H32A 3N4XA 3D71A 2WLJA 4IFDK 1SQBD 1BCCG 3GB7C 5LHIA 3MTUE 2ZE7A 1E1RG 4UV9A 1Q7YQ 1LT9B 3UIAA 3JCUH 4EEQA 4D6TD 3H1KD 4JI0B 2Y69C 1FFXA 4DV5O 1I94B 3L72G 1SQXE 3ZMSA 1SFCA 1YJWV 3CYOA 2QWOB 4GX0A 3S3XA 2R5DA 1FPOA 4IHJB 4ZKIA 1M4UA 1Y74B 1IXBA 1M1JA 3VMXA 2KOGA 1L0NK 5DECA 3KG2A 4I0XA 2FYUG 1M90Q 3T1CA 2OYHB 2EBOA 3PP5A 2HJDA 2CGOA 3M99B 2HHHO 3H1IH 2QJYB 3BCCH 3DGEA 3G3ZA 1NKNA 3CRAA 5H2FE 3L73D 5K1XA 2BTQA 5APTA 3C3SA 3UT5B 3G6EV 4HJGH 3ZN0A 1K34A 5C93A 1VQ5P 3CX5H 4UUJC 3CB2A 1RM1C 2QJKB 1SQQH 1DD3A 1KB9I 1J1DC 1OVVA 5KTBA 1JB0J 1KILE 3NFQA 3CMEP 3RW0A 2XZRA 4QE7A 4FLVA 4JI5O 3K79A 1L0NJ 1XTCC 4UB8E 1SESA 1Q81W 4YJ2B 3ZX6A 5KUKA 2AZ2A 1FAVA 1KYOI 2QJPB 3M9QA 5EYPA 3ZCCA 1XL4A 4U3FH 1FJGB 5CBFA 2DYSC 2QTOA 3OUSA 3RBXA 4JYYA 2WSFJ 3HUSB 1L8DA 3CCEP 2YSUB 5IYBO 3T1YO 4IYHA 2LKMA 4R50A 1I5XA 2R9AA 2YICA 3NMDA 4LF9B 1AP5A 1I7FA 1JJ2U 5JH7A 4JI4O 3IFXA 1A32A 3B4SA 2UXDO 4EYYQ 3FXEA 5BMVA 3G6BA 4X1YB 1BE3E 5TISE 1IURA 3ZS8C 4W4KA 2KB1A 1XREA 5BY1A 5EC2C 1GL2B 1T2KD 1N33B 1LT1A 2W6JH 4ASWA 1KN7A 1LTTC 3IAYA 4UCOA 5GONA 3RGBA 1WP7A 2J5UA 3QH9A 1G2CB 4C7RA 2R9IA 4CH5A 5E79H 1NTKK 1K92A 1NU1E 2ZVNB 4I5SA 2IBZH 2E74B 3ETEA 4X1KA 2B87A 1KILC 5AW4B 1XHZA 2H88C 3AE5C 2Q67A 3II6A 1YF2A 1AQ5A 3GW6A 1K9MQ 2KG7B 1P84E 1MA1A 4JQ0D 3E22A 2KS1A 4DYLA 3L74G 1FE6A 1F4MA 2N1TC 2M3EA 3KZIH 2OYIB 1HVVA 2FTKA 1X4TA 4I6MC 3H6PA 3K5LA 1KQSU 5IE9A 3FX7A 3P3NA 1NTZG 1ZN5A 2FYNC 2OIEA 3A0HZ 2P2UA 5B5EH 3DXRB 3ETQA 3RK3D 1OZ0A 4PV1B 3ZMVA 5LMNB 4DR3B 3PRJA 4Y99C 3ZHQA 1A02F 1VQLP 2WLHA 2AHYA 2P5OA 3CMAP 3QVNA 4X20A 1Y47A 4I7ZB 3CWBJ 1OCCC 3OR7C 2AHZA 4XDKA 1FOSE 3CC2P 4JI3O 2JJ2G 4PD4E 2ZXEB 3CC7P 1Q82Q 1GK4A 2PTMA 1JQ0A 5IYZA 5JJNB 1HNWB 2QA4P 2YNYA 4H13D 3AE8C 4MTOA 4XDJA 4X62B 1L4AB 4TV8B 4JF7A 4UCSA 1YQ3C 3HTKA 3FXDA 2QWPB 1L0NE 1HWYA 2P10A 2OYHC 1K5SA 5LL6Y 2LGWA 2RH0A 5LA6A 5BU8B 4U7OA 3MAQA 2AEMA 1DTOA 1Y76A 1TGOA 3EQ2A 2CTWA 3IC9A 3ZRSA 1QLNA 4DV1B 3BHPA 2Z5IA 1NKDA 2EIKC 4NTWA 2W0FC 2JDIG 1IFIA 2CTPA 3K3WA 3VQYA 3AK2A 5J2TA 1XI1A 1N8RW 3CCUP 1XMQB 3LNMB 5JCOA 4I9QA 2XOKG 3MHSC 3SWYA 4LBEC 1N86A 4PDLA 1K97A 1NVPB 1PPJH 3ZHVA 1VQNP 2WSSG 1S0VA 1MZ9A 2WPDG 1PL5A 4PA6A 4IFFA 1IDSA 1AQTA 3CCMP 3AE7C 1HP8A 2Y0PA 4KJMA 3SJCC 3T97B 1AI5A 1TUEB 1R3LC 2EINB 4O2BB 1K04A 2E43A 3W68A 1CSBA 1JY2N 2X0LA 2M0BA 1YQ4C 3UKMA 4P9OA 3K04A 1JMBA 4X64B 3L73J 4UFZA 2WPRA 2WLIB 1LT9C 3JAKB 2EULA 3HD7D 3CRRA 3A0RA 1H2NA 3TGUH 3HR0A 4KHXA 5CA1B 3RFRA 4JI7B 5LYJA 2OCCC 4DRXA 4B08A 3K58A 1BCCJ 2R44A 1F23A 2JEEA 1V55B 2UUBO 2YIAA 5GTHH 4RUFA 2BCCH 2KLVA 1J5EB 2P7JA 3L72J 1M57B 1QL2A 2D2CB 4EOTA 1VQ8P 2Q5ZA 2LGQA 1ZLLA 3EWKA 2Z3YA 1YYCA 1UFIA 1WPXA 1XNQO 3V6IA 3CCLP 5JQGA 4DK1A 2AEJA 1HGVA 4LFAO 4JAAA 4HYOA 4NXNO 2QIWA 5AVUB 3G67A 2H7HA 3TNUA 4CBCA 2OTLP 4JI1O 4PI0A 3V2NA 2FYUJ 2IFNA 3CWBE 2G3AA 1DH3A 1S5JA 1RE4C 4I4TA 2IH1C 3JCZA 4WBAA 3I55P 2BEZF 1GU4A 4U7JA 2B9ZA 4LCUC 3LUTB 2A06G 3TF5A 1NKZB 4L76A 3JALB 2L91A 1ZL8B 2Y0CA 4ZMDA 4JTAB 3ZRWA 3HUSC 2YO2A 2ZDIA 5BR8O 2WLMA 5APSA 1ZMEC 3RL0B 3AG1C 5CCGC 4B3MB 5HFMA 3CCSV 1KB9F 3RYFB 4RUEA 1ZSPA 4LP8A 3MP7B 2PYLA 4G27B 4JPRA 3RK2B 3JAWA 2NZ2A 3CRMA 1VQLV 2PI4A 3D3QA 3H01A 1GL2C 4I50A 2FYZA 3H1IG 3K0DA 2JEUA 1WPBA 3D36C 3BCCG 2Y0EA 1AJQA 3OR6C 2Y48A 4KXRA 3X2QC 4KP4A 3K03A 1URQC 4BIUA 5CA0B 3C9IA 2P58A 1OW6A 4DOJA 1WB7A 3G71V 1JTHA 3DC5A 3OMAB 2L5GB 3W7XA 5LXTB 4DUYO 1SQQG 1S5HC 3L73E 3CCJP 4UB8Z 1BL8A 2Z4EA 1SQVD 4NTXA 1D2DA 3CXHE 2IYPA 2ZAEB 5KAIH 4UB6E 1HUCA 1NTZK 3B5NB 2V1DA 3QO8A 1HNXO 4U3FG 5KJ7A 2VRSA 3ETGA 3CI9A 1BCCE 3CRQA 3CCUV 1JCCA 1RQVA 1TA8A 5AW8B 1LUWA 2YUAA 1H38A 1HTLC 3V4WA 1FD9A 2NRGA 2RKLA 3KPEA 3L74J 2YIBA 3Q5RA 3L72E 1SQXD 4PV1C 1S72V 2E5LO 5LGTA 3H32B 4AQRD 5TISZ 1NTMH 1JY2O 3H1ID 1VQKP 1OW7A 2JR8A 3CJHA 2LJ2A 2Q8VA 1OXZA 2M3BA 5LP6A 5GTIZ 1NTZJ 2W0XA 2FYUE 3FX0A 5AVRB 1FFXB 2IU3A 2QM7A 2C0XA 2W6JG 5KAFH 1SFCB 3JD4A 5H6RA 3MUDC 2ITAA 3EHBB 1ZAUA 1Y6XA 4CS2A 1VF6C 4GCZA 1M1JB 3K59A 3BRTB 4I0XB 2IBZG 1K8AQ 4HAMA 1DLBA 4RQFA 3SGIA 1Q90D 3HKEA 2BTQB 4DR4O 4JI6B 5B5EZ 1M1KW 2F66C 1GU5A 3T1HB 2JJLA 3DSQA 4WFEA 1FBMA 1YSCA 5APWA 2N74A 5B1AB 1JM0A 1R3JC 5J9PC 3A0BH 1PIXA 3J81N 1S5LE 4X65B 3HKBA 4K35A 4LR3A 2OTLV 4KHPO 2JVDA 2XAQA 4NPEA 1X8YA 1G8MA 3U0ZA 4DR7B 1GZLA 3I55V 1BE3D 5AW0B 1XDCA 1GTWA 3CE2A 1NH4A 4LFCO 4NPFX 5EBWC 2Q4PA 3VP9A 3JSLA 3U1CA 4FIPC 3BEHA 3RL0g 1FJGO 2HFED 2Z5HA 3QNEA 2IBZD 3ICXA 4IGGA 3TK1A 4HNAA 5IJ0A 3AG2B 5BMVB 3L35A 1NU1D 1PNMA 3JSNA 2YKPA 2GSMB 1HNZB 2GA1A 4O4HA 5DJUB 2L35A 4LF9O 3MD0A 4CH4A 2YKQA 5GONB 1AB3A 2Q69A 1P84D 5JVDB 1M57C 1DGSA 5LOVB 3L74E 2B1IA 1KC8W 3O8ZA 2NLJC 1K73W 2ODMA 2LW1A 1VF5B 1QLED 4N6JA 3SSUA 1PPJG 2X6CA 4GT1A 4X1KB 3RVYA 2B87B 5EFWB 2EIJC 1N33O 4DV2B 2LFSA 4D7SA 5BU5A 3TYYA 1NTZE 2WPVB 3E22B 2KS1B 3OW2U 2ARHA 3VP8A 1LTJA 2ITCC 1S4XA 1YJWP 3GVMA 3LW5H 4HYTB 1J1EC 2XUMA 5CCHA 2R70A 1RF1B 3CCQP 3GWKC 1IFPA 3JARA 1Y9BA 1NHLA 5CHXA 2H94A 4L8JA 3A0HE 4PD4D 4LF8B 2WSCH 3FB5C 3TDKA 3JSVC 1H89A 3TGUG 4DV0O 1L0ND 1SVFA 4R7CA 1XQ8A 1BZKA 2X7RB 1R3IC 3BABA 1NT2B 4QGPA 2FKXA 5A2QN 5AVXB 3G6EP 3OAAG 5IYZB 3RK2C 5AW3B 1N7SA 3RYHA 1VQKV 3HTKB 2UU9O 3VBBA 1PFIA 1PV3A 1COWG 2OYQA 5AW9B 2A7WA 5AVTB 4Q20A 1Y66A 4PELA 1L0LH 3Q4HB 2XTAA 4PJ0Z 4JYBA 4KFMA 1AJYA 4QE9A 4I55B 4J42A 4X62O 1MZFA 3H25A 1SA0A 3SJBC 4ASUG 2HG5C 4DV6B 3H1IJ 1PL0A 4K0KO 5KA6A 1NO4A 3BCCJ 1K7DA 1FKAO 1JPXA 3RYCB 1EC5A 1YDXA 1N34B 4RJTA 1VMGA 2KK7A 1QR8A 4XFJA 4DV7B 3AG7A 4DV1O 4B3RB 5IWAB 4LF6B 4LGDE 1PD3A 4K3AA 1FZGA 4GYCB 1QQCA 3KHUA 2DYRC 1NWQA 4GX5A 3ZMUA 3HKDA 1NAYA 4JV5B 1M56B 2YXRB 1PNKA 2WPQA 2NR5A 1RPRA 3K08A 2JO1A 4FZ0A 3LDEA 4FFKA 3RN4A 4U3FJ 4DR5O 1CZQA 1NR1A 4XA4A 3L71H 1S77D 1EDIA 3IF4A 4BAYA 3CCRV 1OCZB 1GK9A 3W67A 2ZVOB 4P30A 2FB5A 2IBZI 1R73A 2VWJA 5BZBA 2EILB 1LTGC 2M6YA 2GDSA 4PDRA 5LYJB 1WP8A 1GL2D 1SQPH 4DRXB 5KMGA 1JY3N 1R8EA 3JASA 4B3SB 2YXHA 4IT5A 3N2KA 3TXQA 4X64O 4DV4B 2O1JA 3S4RA 1VQPV 2PGDA 1NU1K 1UJWB 3AG4B 5KLVH 3H1HH 3CWBD 4X66O 1P84I 3SR2C 1WJZA 3OMNB 1KFMA 3CPWO 1WT6A 1BSMA 3K57A 4JI7O 1HW7A 1K4DC 4UB6Z 1BT8A 1GRJA 1X9VA 2QM8A 3AEGC 2WA4A 4YHHO 1KMIZ 2A06E 1NBMG 3GF3A 3TNUB 2OTJV 1E5WA 3E89A 4UCRA 3JD0A 3WU2H 3H1LH 5EK0A 2J58A 1FZCA 4I4TB 4BIOA 1ZUQA 2ZYAA 2A45H 5C8YA 3JCUE 1AR5A 3FB6C 1QX8A 5H9CA 2W83C 1AR4A 3AG3B 3OTOO 1OVUA 2ZXXA 4YJ3B 5KAFZ 2KKWA 4NVPA 2G8YA 2ITDC 4F4LA 1NTMG 3GHGB 4PD4I 4PV1D 1IO4A 2KZJA 3ZHUA 3SWKA 1QVFO 4LWSA 1QVGO 2CH7B 2R3SA 2OWOA 4FZ1A 1YBKA 4LNUB 4H37A 1P4RA 1PV0A 2EIMC 3SYOA 3CCQV 3H1IE 3KDPB 3U1AA 1PM9A 2VQEO 3BCCE 3SPJA 2ZM6B 1G1JA 4GKGA 1MG1A 1L4AD 3AG2C 5DJTB 3T4ZA 1ORQC 3S9OA 2J59M 2VQFO 4GX1A 1VARA 4LC1A 4FLYA 4BW5A 2FFDA 1LGHB 4I50B 4B3MO 3CX5E 3OA7A 1HJBA 1SQQE 2KSDA 5ITZB 2XAJA 1NGMB 2NPSA 2PUSA 3A0BZ 1IVSA 3CXHD 1NH2B 3KYQA 2PYJA 3CLQA 2UUCO 4U3FE 1VF5C 4WY4B 3DTUB 3OEHG 1JTHB 1BCCD 1ZRTE 1GK6A 4RQEA 1S5LZ 4B3TB 1JY2P 5EZYA 1NVPD 1OCOB 4IL6H 2XKMA 5APXA 5KLIC 4DUZO 3HRNA 2Q3EA 3JYCA 3L72D 4X88A 3UCSC 2HLDG 1K8AW 2K88A 3Q5PA 1H0TA 4FLUA 1N0NA 2FY8A 1XNRB 1RF1C 4UV8A 4AYCA 1I0HA 1S3JA 1FYJA 3GLMA 2FYUD 2Q68A 2PFXA 2UXNA 3L75H 1BS3A 2YI8A 1F7YA 2Q1KA 1WRGA 3ML0A 3PH0A 5AG2A 2LXBA 1AROP 3D6YA 2ZE8A 3ZHTA 3CJHB 2HEPA 1JOCA 2DWDC 5GTIE 5E79E 4O2AB 1FJKA 3FD9A 1PL4A 2IBZE 2FBWC 2YDEA 3IAOA 4FLXA 3TGUJ 4OVNF 3D6ZA 4W4LA 1JY3O 4YY3B 1U7MA 2KZIA 1P7GA 4LF7B 1M57D 4J80A 4UVBA 2D2CD 1QCEA 1LWUB 1TUBA 5B3SB 2JGDA 1PGOA 1LTBC 4JI8B 1SKVA 1CP9A 3GG2A 3VN0A 5TJHA 4JYAB 1AJPA 1JO5A 2BE3A 2E75B 1JX9A 4DO2A 1JMMA 1JFFA 3M0DC 5B5EE 2K37A 2HP8A 3HKEB 4XDLA 5B1BC 5AW2B 5L8RJ 1FS0G 3E35A 3CD6V 3CCSP 1SRYA 4FLTA 1N36B 1MABG 2WLLA 3SYCA 1M5IA 3E86A 1ZV8A 2F23A 2YMYA 4MSWC 2P6JA 3APOA 3HKBB 2QVAA 2XNDH 3F5HA 2BOBC 3G9RA 2AW9A 2VRZA 1N73C 1ZXGA 4TWKA 2EJRA 3T1HO 2LQTA 4JZGA 4ZI7A 4WVZA 1SETA 5FNVA 4DR2B 2HFEC 3KCYA 3RL0D 3HKCA 3A8TA 1KBHA 1G4YB 1GM8A 4X1IA 3SFDC 2WT7A 3RGUA 3G71P 1Y67A 2IW5A 3RK2D 4QNHB 2EILC 4DR7O 2ZE5A 4HNAB 2V4HA 5IJ0B 3L37A 4UCUA 1Q86Q 3OJAB 3LIDA 4IIJB 1L0LG 3L74D 4J41A 1Q2NA 1KECA 1MOFA 3WG7C 3SWFA 4AQYB 2BSKA 3PLNA 4YPCA 1N4CA 3AE9C 4O4HB 4CC5A 1PPJE 4C7NA 1GM7A 5CBOA 1B6QA 4UCVA 3L70H 3AG4C 5KUMA 5KKZC 3CXHI 1QLEC 2EZOA 1NTZD 4KT0J 2HG5D 2V7QG 4GDOA 3P7KA 2JJ1G 1KILA 5CB4A 1CPYA 4DV3B 1SC5B 1HNZO 1R1BA 1S72P 4EFEA 1GD2E 2P67A 3V5BA 3IJ4A 5D5PA 4U3JA 2WZ7A 1G1XB 1RQUA 2HPCA 3K5OA 4GX2A 5A9GA 5CBHA 2N1TA 2ZNJA 1QL1A 3B5ND 2FMLA 5EIBD 1MFZA 4OX9B 1QHTA 1N32O 1Q6HA 3A7OA 1P84F 1PGJA 3A2AA 3TGUE 1PP9H 2UXCB 1O9HA 3L71G 3LSQA 4RESB 2SPZA 2YXYA 3GHGC 2UUAB 3JATB 1PZQA 2I8DA 2BTOA 1L0LD 3VQXA 2YXLA 3H1JH 2FYUK 5B66H 5GTHE 1AILA 2GM4A 2ZDIC 1FDIA 2K9JA 1XBLA 2RNBA 1KB9H 1SQPG 1WA8A 2YI9A 4L74A 1NTMJ 3W7UA 5CJ0A 1PGPA 2O01H 1SFCD 1KYOH 2N9BA 3H9VA 2H8PD 3MGNA 2GHYA 2D3OW 3SYAA 1JOYA 4AILC 1LNQA 5C39A 5KLVG 3H1HG 1N7SB 4O4JA 4JI2O 3RYHB 2QJYC 3WU2Z 4PD4F 1IBKB 1TVKB 2O57A 4BWAA 3S3WA 4TSFG 5FPRA 2R72A 4ZHQA 4PJ0E 2KNCA 2CE4A 1LJ2A 5IYDO 4A5UB 2IU0A 2HVJC 5GW7A 5B1OA 4LF4B 1OX3A 2C9LY 4DCKA 1BGYH 1YTFB 3H1LG 4N78E 1EZJA 1SA0B 2QJKC 2YXQB 3VMYA 4WY4C 2ZXWB 3JCUZ 2A45G 5IDJA 4DK0A 1OJHA 2QJPC 1W59A 4FM1A 1H8AA 1XL6A 1NTKH 1N0JA 2FXOA 1AFOA 4MS2A 3AK3A 3STZC 3PHLA 3W7SA 1ZOYC 1AI4A 1GW3A 4PA9A 2K1EA 4J9ZB 4FM2A 3HKDB 1N34O 3P30A 4MVQA 2AXCA 2I1KA 4X89A 3KCXA 2FXPA 2EZPA 5LGUA 2JIZG 5IWAO 1S5LX 2F4VO 1KYOF 4GZRB 1FXKB 3WMM0 1LT9A 1EZVH 1HH0A 3C8VA 3GF7A 1GN4A 3S1KA 1R3KC 3V2RA 4WFHA 2QKSA 2OCHA 2HHHB 4K8XA 2KXPB 2QKAA 1FXVA 1L2PA 1M9NA 1ZX3A 2KP8A 4B86A 1Q7YW 2JWDA 2QSIA 1Y74A 1K33A 2UXBO 1Z5VA 5KAIE 4IL6Z 1RF0C 2A06D 3NTNA 3N2GA 4N21A 2E74C 1SQBH 3WUUA 1Y8AA 3A5TA 1KORA 1LWUC 1WLEA 1I08A 5B3SC 3HE5B 1VF5D 4D6TH 3H1KH 1VP7A 4JI5B 2OARA 4B3SO 1IK9A 1M90W 1IFJA 2Q0AA 1WMKA 2YEVB 3CL3D 1RE4A 2OYIC 1IBLB 1F4NA 5M1BA 3WB1A 4JBZA 5K5GB 2E5YA 3T1YB 2VWKA 1NTME 1FZCB 1EXIA 2IH3C 3OM3B 2DMXA 2QDOA 3GWOA 1XMOO 4MTFA 1FXHA 3IN6A 5C8YB 1AJNA 3UM7A 3CSXA 5KX5B 1K4CC 1X22A 2WMMA 4JAVA 4JI4B 3W7TA 1MMMA 2UXDB 1KD1W 3HUSA 3L36A 5KAFE 4F6RA 3AEIA 4I7ZC 2A9HA 3BCCD 4ZOLA 1HJ0A 3LW5J 1US6A 2UXXA 5E79Z 1GH6A 4ZNCA 1KTMA 3B2EE 4BWNA 5CCGA 2P22C 3Q5SA 4GKJO 2PGGA 2MJZA 1L0LK 1IJDB 1L4AC 1I5YA 3CX5D 1SQQD 3L4FA 2IJKA 2A79B 1EDKA 1H8HG 2Q9LA 4JI0O 2P1JA 3PTZA 4GIFA 2Q9IA 3BFRA 1W2BU 1I94O 2IFMA 4TQFA 3KZIZ 4TV9A 4WFFA 4CS3A 3D36A 1QBZA 4U3FD 5KHGA 3L70G 5L3EA 3WUTA 2FFDB 2Q73A 1ZRTD 3MHVA 1Q5OA 1URQA 5AVZB 3A0BE 2NPSB 4YTPC 1SP4A 2KB7P 2ZNIA 1R6TA 1L0LJ 1R6NA 4X9QA 2DQ3A 3WB0A 3ZJZA 3GMAA 5APQA 2ILMA 1VQOP 3ASOB 5AW1B 3FWNA 1LTSC 1PGQA 1HR0B 3CCRP 2WITA 5EZYB 4K8ZA 5EC1C 4YXDC 5EYPB 2XNDG 1YTZI 2V7QJ 2EINC 4FJCC 1AR1B 3R66A 4BRYA 3R2PA 2MKVA 3ABMB 1DX7A 3A2FA 3P3PA 3CXHF 1X0TA 4ZIBA 1K9MW 1DF4A 1M56D 4JI3B 1H0TB 5CCHC 2RCVA 4B3TO 1VEWA 1LTAC 1VQPP 4AUWA 3DXRA 3ETDA 1QU7A 1QNMA 3EFGA 1JY3P 3N27A 5JH7B 4IFMA 5K1PA 4PI2A 4J9YB 4NR1A 1SERA 3VQVA 4DT0A 1ZW0A 1GAXA 3STLC 5KLVK 2XV5A 1GN3A 1XNRO 3L71J 2OYOA 1YJ9V 2WSEH 3B71A 2F95B 1V55C 3OFNG 4GLXA 3HE4A 4E2LA 2OTJP 2G38A 1SQFA 2WA3A 4MVSA 3TJTA 1VF6A 3G4SP 2D2CC 1U7JA 3ZMTA
chains in the Genus database with same CATH topology
2FYNC 4RKUJ 5M1BA 2K9YA 3D6ZA 4PV1B 3AEFC 1DIPA 4H13B 1OW8A 2G3AA 1EXIA 1OMIA 3Q3DA 1FDIA 2D2CD 4OGQC 3AEDC 3IN6A 2BEZF 2H89C 4U7JA 4I7ZB 4R4LA 4IL6X 4H0LD 1S1CX 2ZT9C 2E75B 1KQFB 2WSEJ 4I7ZC 3LW5J 2G8YA 1HJ0A 3RK3E 4PV1D 4H13D 1Q90D 3AE3C 3AE8C 2E76C 1HF9A 2E74D 2QJYC 2YIUC 1K05A 1KTMA 2E75C 1YQ3C 1TU3F 5L8RJ 4Z1MH 1PV3A 3Q5SA 1VL2A 2P10A 4OGQB 3AE1C 1ZMEC 1DD3A 1JB0J 1KILE 1AJYA 2E75D 3IAOA 4Y28J 1PIXA 2ZT9B 3G9RA 2BEQD 3Q1MA 3H25A 2QJKC 1NYHA 2JP3A 3S9OA 2O01J 2NZ2A 2E76B 2WSFJ 2QJPC 4OGQD 4XFJA 3AEAC 1DD4A 1FDOA 2YMKA 3SFDC 3AE4C 3SFEC 1NGMB 2ZT9D 4YTPC 4H44C 1EXJA 1ZOYC 3AEBC 3FGAD 1PL5A 1UIXA 3RL0g 3R4YA 2WSCJ 3AE7C 3GMAA 1IK7A 2E76D 1OW6A 3AEEC 1VF5C 3T97B 1ZRTE 2WQYC 2FXPA 1ZP0C 1K04A 2JO1A 3AE9C 4YXDC 1S5LX 5KLIC 4TT3H 1YQ4C 2V7QJ 2OQQA 5KKZC 3C8VA 3AE2C 3GF7A 4H44B 2MKVA 2J5UA 4KT0J 3Q5PA 4GDOA 1KQGB 3AECC 1RQVA 1VF5B 4H0LC 3GLMA 2E74B 1U57A 2QSIA 1R8EA 3D70A 2H88C 3AE5C 1KMIZ 3Q5RA 1RQUA 4R4MA 4PV1C 2IDBA 3Q2YA 4H13C 4H44D 3O6QA 2E74C 3ABVC 3D71A 2WPVB 1KORA 3D6YA 1OW7A 3AE6C 2D2CB 3B71A 1VF5D 3EWKA 1MKMA 4H0LB 1GMJA 1WMKA 2FBWC 3AEGC 2QIWA 2D2CC 1Y9BA 3GF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYN C;  4RKU J;  1VF5 B;  2K9Y A;  4OGQ B;  4PV1 B;  2WSC J;  2E74 B;  4H13 B;  2QSI A;  1JB0 J;  4Y28 J;  2ZT9 B;  1ZRT E;  4I7Z B;  2QJK C;  4IL6 X;  2WPV B;  1S5L X;  2O01 J;  5KLI C;  2E76 B;  2E75 B;  2D2C B;  2WSE J;  2WSF J;  5KKZ C;  2QJP C;  3C8V A;  3LW5 J;  4H44 B;  1Q90 D;  2QJY C;  4KT0 J;  2YIU C;  4H0L B;  2QIW A;  5L8R J; 
#chains in the Genus database with same CATH topology
 1S9K E;  1RE3 C;  1KUQ A;  3CRC A;  4FLZ A;  2C9N Y;  2AXT H;  1Q82 W;  4UXN A;  2K1A A;  4AI8 A;  4G28 B;  3I5D A;  2Q3I A;  1OCR B;  5CMZ A;  2IJJ A;  4MT8 A;  1Q6I A;  1TUB B;  2Q5U A;  2IJI A;  2JGD B;  4NXM B;  1EQ7 A;  1FS0 E;  1MSW D;  1QEX A;  2H89 C;  4JYC A;  3M06 A;  5KLV J;  3H1H J;  2MW2 B;  3BA9 A;  3VOP A;  1YIJ P;  2OIG A;  3F7V C;  1V54 B;  4QJF B;  1JFF B;  3K5N A;  1AVO A;  5L3B A;  3RVZ A;  5JWP A;  1RM1 B;  1K05 A;  5B66 Z;  1J1D B;  1AVM A;  1PP9 G;  3VYI A;  4O9B A;  2QWR B;  1URF A;  1IZN B;  3H1L J;  3CC4 V;  2NNU A;  5E1A C;  2WLL B;  2F43 G;  5EBM C;  1JEK A;  5GTH Z;  2ZT9 B;  2AGA A;  5CBG A;  4LH7 A;  2LP7 A;  2WAM A;  3H1J G;  3WUV A;  4X20 B;  3TCU A;  3RL0 C;  1KQL A;  1P7B A;  4BXL A;  3ZIA G;  5FNV B;  3BY6 A;  3OMI B;  1L0L E;  3OEE G;  1VPC A;  2A0L A;  1KKC A;  3HKC B;  2UUB B;  1H2M A;  2BCC G;  2IYO A;  1FXK C;  5LMN O;  3T2M A;  4DR3 O;  3AE4 C;  3JAK A;  3CX5 I;  2ZQM A;  3E8H A;  1JA8 A;  1PPJ D;  1MV8 A;  2RJZ A;  4YIP A;  5CA1 A;  2CPS A;  1N8R Q;  1XNQ B;  1ROP A;  3LSS A;  5LA6 B;  2CPB A;  1SQQ K;  1VF7 A;  1Y76 B;  3WB2 A;  3A0H H;  4NXN B;  1UPG A;  4DR2 O;  4EIJ A;  1HNW O;  1X59 A;  3BAA A;  3MIW A;  2QWQ B;  1MNG A;  1YHQ V;  1FU1 A;  4B7K A;  1BGY G;  4TT3 H;  4C7N B;  4MVM A;  5J2T B;  1NH2 D;  2HYN A;  3FB7 C;  4O4L A;  4QPK A;  3O65 A;  4TLF A;  1EBO A;  4PA7 A;  3QWO C;  4MVR A;  4WY4 D;  2DJV A;  1KIL B;  5CB4 B;  3E2E A;  4J7J A;  5LHH A;  2HKO A;  3B5N C;  1YEW A;  1RY3 A;  3TGU D;  5EIB C;  1CEZ A;  2JDI H;  3QTC A;  1NTK G;  2WVR A;  1SQQ J;  3ABK B;  4U3J B;  3CPW U;  3D70 A;  1XMQ O;  3L71 E;  4EDF A;  2EJ7 A;  1OWA A;  2N1T B;  3O6Q A;  2R32 A;  5F2V O;  5KJ7 D;  1FZC C;  4J7Z A;  1VQO V;  2BCC D;  1KKD A;  1NJI Q;  3ABT A;  2X6B A;  3JAL A;  1W2E A;  1ZL8 A;  3FYI B;  2CDY A;  1SQP E;  2YIB D;  2DN9 A;  4LFB B;  1NAF A;  3ZED A;  1EZV G;  3UO2 A;  4KL1 A;  4Y99 B;  4RWU A;  4X8A A;  5KLV E;  1DIP A;  1XUQ A;  3H1H E;  1U96 A;  1J95 A;  2XNX A;  1OCC B;  1SFC C;  2YO3 A;  3VMA A;  3Q3D A;  1AP6 A;  3RYF A;  2H8P C;  2CK3 H;  2K9J B;  4HZ3 A;  1H88 A;  3IR9 A;  1A02 J;  2KYV A;  4Q6G A;  4QPJ A;  5KAI Z;  3OAK A;  1WA8 B;  1ZTE A;  1QVF U;  4L87 A;  1M1J C;  1F51 A;  3VOU A;  1QVG U;  3O9O A;  3OT7 A;  2JRI A;  1SQB G;  3CD6 P;  1PKX A;  3WU2 E;  4N78 D;  4O4J B;  4DUY B;  3H1L E;  5JQG B;  1IBM B;  2E74 D;  3ZHR A;  4D6T G;  3H1K G;  4QMA A;  2ZR2 A;  2KNC B;  4OGQ B;  1T8Z A;  1GKF A;  1KP3 A;  2EIK B;  5CA0 A;  2KI7 B;  1XIL A;  1J5E O;  1T6A A;  3M0A A;  2ZR3 A;  3G4S V;  3KKY A;  2E75 D;  1NR7 A;  4ASV A;  5LXT A;  4EB6 A;  2YS8 A;  2XHB A;  5B1A C;  1HGZ A;  2HOD A;  4L75 A;  4LF5 B;  3ASO C;  1GM9 A;  2RMK B;  2JP3 A;  2LXC B;  1KU9 A;  4UVA A;  5DM6 V;  4DW0 A;  3A3Y B;  2E76 B;  1HDJ A;  1Z5W A;  2YIU B;  1EZV D;  1GDT A;  3AEA C;  2QE7 H;  4GKK B;  3U11 A;  3SFE C;  3ZRW B;  1BSN A;  1YIJ V;  2JWA A;  3ZMZ A;  3D8C A;  5IT9 N;  2Y0D A;  1JCD A;  3OUF A;  3VMZ A;  2XAF A;  4FLW A;  1SS1 A;  5AW6 B;  3HD7 A;  3E1I A;  3ZHS A;  4WBN A;  2ZKO A;  3JD2 A;  1ZP0 C;  1SQV H;  4FFB A;  4GOD A;  3RWR D;  1SZX A;  4OWF A;  1GO3 F;  2WTY A;  3M9B A;  1VQM P;  3JAW B;  1GW4 A;  3SYQ A;  2ZIM A;  2ETN A;  1EN6 A;  3RT3 C;  1WNS A;  4H44 B;  5LMU B;  1W0J G;  1KP2 A;  2HLO A;  5LHG A;  2OCC B;  1VIB A;  5H5N A;  2ZYD A;  2FL4 A;  3SPH A;  1CI6 A;  4RO0 A;  4IL6 E;  4DR4 B;  2PI5 A;  1TAE A;  3T4D A;  1SQX H;  4R4M A;  1G1I A;  5KHI A;  1FJP A;  5FL7 G;  2P90 A;  3CHX A;  1M93 A;  2MK3 A;  3N2G B;  4CC6 A;  1LUV A;  4C7U A;  5IJ9 A;  3ABV C;  2QSA A;  1OCR C;  2H43 A;  3BVH A;  1CW5 A;  1NTM D;  2KQX A;  3R65 A;  3L70 J;  5J2U A;  1MKM A;  3ITK A;  4LH6 A;  4KHP B;  4H0L B;  1V54 C;  3F7Y C;  3L75 E;  3SJQ C;  2AZ0 A;  1R5L A;  1QGK B;  2ZIN A;  1USD A;  1XTG B;  5H2F H;  2IX7 C;  2M7W A;  4H33 A;  5EBL C;  1RSO A;  4LFC B;  1OMI A;  2B5U A;  3APQ A;  1B06 A;  5JJE B;  1BQZ A;  1E79 H;  3M8A A;  5CCH D;  4FM0 A;  2GUZ A;  3RYI A;  3F5W C;  3ZRV A;  1S1C X;  2ZT9 C;  2E42 A;  1IBL O;  2Q6Q A;  5IYC O;  2WLN A;  1KQF B;  4F6R B;  2ADQ B;  4UB8 H;  2GTA A;  4PDV A;  4ZOL B;  1PP9 J;  3MZW B;  1P49 A;  2O1K A;  5LP6 B;  1YCI A;  1AI7 A;  1OFC X;  3AE3 C;  3QF7 A;  2AXT Z;  3W7W A;  3AG1 B;  2A3Q A;  4Z1M H;  3KXD A;  1BHB A;  1FDM A;  4JPZ B;  3OTF A;  3AE1 C;  3E7K A;  3H1J J;  1J2J B;  4WB4 A;  2ZYG A;  4Y28 J;  1M1K Q;  1ZWI C;  3Q1M A;  3JC2 2;  3FFQ A;  1N7S D;  4FMT A;  3KZI E;  3SPC A;  5BXZ A;  4WFB V;  3B8N A;  4TV9 B;  4J7K A;  2C0W A;  2YKO A;  2O01 J;  2BCC J;  3IC7 A;  2RN0 A;  1BE3 H;  3ZDM A;  5TIS H;  1AVY A;  2IZ1 A;  3BVO A;  5L3D A;  3X2Q B;  3PJS K;  5JVD A;  2IPP A;  5LOV A;  2YMK A;  1URQ B;  4DR6 B;  4PHZ A;  5GTI H;  1VQ7 P;  5JCO C;  4UCT A;  2KLU A;  1YTF D;  1WAZ A;  3E8G A;  1HWT C;  3CX5 F;  1Z56 A;  3OD4 A;  1UIX A;  3AEB C;  2ZFC A;  1DEE G;  2PP6 A;  3AEE C;  2IM9 A;  4TOI A;  1BGY J;  4U7N A;  1NU1 H;  3ABU A;  3WFV A;  4E4E A;  2P7T C;  4ABM A;  1ZR4 A;  2XAH A;  3ABK C;  1EZV I;  4JI6 O;  3SPG A;  3BAT A;  2X6A A;  1M56 C;  1S2E A;  3RBZ A;  1NVO A;  4W7Z A;  1P84 H;  4BRY B;  1RF1 A;  2DWE C;  5LBQ A;  4DV0 B;  4WF9 V;  4X65 O;  1NTK J;  2RMZ A;  1MZE A;  1HR0 O;  1EDL A;  3C3T A;  3AEC C;  1BDC A;  1WB8 A;  1OCZ C;  3LIE A;  2YC0 A;  4YXW H;  3TET A;  5FPO A;  2ZCE A;  2UU9 B;  2B1G A;  3BA8 A;  3L70 E;  1OZH A;  1WN7 A;  1S9K D;  2Z5U A;  1SQB K;  1KC8 Q;  3HB3 B;  1K73 Q;  2RQ6 A;  4O4I A;  1ZLZ A;  3P8C E;  2HR3 A;  3HE4 B;  1G6U A;  2E5T A;  1XHX A;  4LLH A;  3OE7 G;  4TT3 G;  4WFG A;  4L73 A;  1RFY A;  1NOH A;  4PD4 H;  1VQM V;  3IGA C;  1IFN A;  4K0K B;  1H2G A;  4RKU J;  1DEB A;  2M8R A;  3Q4H A;  2K9Y A;  4F6E A;  5B1N A;  3SDL A;  4DR1 B;  3P8M C;  1SQG A;  1KQS O;  3QO5 A;  4JZ2 A;  5L3G A;  2Q6A A;  1VQ6 P;  4OGQ C;  4I55 A;  1L0N H;  2IZ0 A;  4GOE A;  1PP9 E;  1K5Q A;  1SQB J;  3M0D A;  4R4L A;  4EI2 A;  2GV9 A;  2EX3 A;  4YIO A;  1NTM K;  1FFT B;  3RYC A;  2M5A A;  5DN6 G;  1KD1 Q;  3EVK A;  1LP1 A;  1LTJ B;  4D6T J;  4BW9 A;  2WSF H;  3H1K J;  4J10 A;  4UVC A;  1NS1 A;  2FXM A;  2LO1 A;  3FWL A;  2O3J A;  4JF3 A;  2E76 C;  3H1J E;  5B66 E;  2Y9Y A;  4DV2 O;  2YIU C;  1GTO A;  3AG3 C;  1N2D C;  1TU3 F;  3AK1 A;  4DR5 B;  4NXM O;  3JAR B;  3FB8 C;  1KB9 E;  1N73 A;  2KIK A;  2DW3 A;  1FZE A;  2BCC E;  1KYO E;  2CTQ A;  2ADP A;  5KHK A;  1B3Q A;  1JJO A;  1MFT A;  1VQ5 V;  5AVW B;  2L6L A;  3CME V;  1B04 A;  2CK3 G;  4DJG A;  5AVY B;  4TUY A;  2I1J A;  3BAS A;  4I1L A;  2JGU A;  4LF8 O;  1USE A;  2GUV A;  1DD4 A;  1Q43 A;  2W90 A;  3KQG A;  3B8M A;  1FOS F;  1YJN P;  5DED A;  4X66 B;  4H44 C;  3CCE V;  3B09 A;  4NYK A;  3D3I A;  3FAV A;  1BGY E;  1NJI W;  1YVW A;  3CP1 A;  4XE5 B;  3C1L A;  5KHJ A;  4YHH B;  4JTC B;  2N05 A;  3VQW A;  3TXS A;  2QEX P;  4PA3 A;  3HPL C;  2DOS A;  5BVZ A;  2P06 A;  2AEF A;  2NPS D;  3QO7 A;  3JD3 A;  4MTX A;  1NTK E;  3V4Q A;  3E8B A;  1AA0 A;  3L71 D;  3ABL B;  4O4L B;  3SYP A;  1IZ3 A;  1VQ4 P;  1OCO C;  1E1Q G;  4FVM A;  1NZ6 A;  3CCV P;  3E1R A;  3FYE B;  2RDC A;  2XDJ A;  2EIJ B;  2UWJ E;  4FPP A;  4R6Z A;  2LW7 A;  3SPI A;  2QE7 G;  3OTO B;  5KJ7 C;  4DV6 O;  1IFD A;  4H0L C;  1H2K A;  3UQ8 A;  3I5C A;  1NQT A;  1SQP D;  1VQ7 V;  4RAI A;  4DV5 B;  1R6K A;  1BQ0 A;  4PJ0 H;  1EZV E;  3Q2Y A;  1YJ9 P;  3CXC U;  3O6Q B;  3CWB H;  2V4D A;  4PA4 A;  3ZBH A;  4DV7 O;  3THO A;  4TQD A;  4MTG A;  1J1E B;  1X79 B;  2B89 A;  5APU A;  3RK3 B;  1YIT P;  5JJJ B;  4B3R O;  3H1H D;  3ASN B;  4LF6 O;  5KLV D;  2O01 N;  3AE6 C;  4OPH A;  3E8F A;  3P32 A;  4YJ3 A;  2VQE B;  4P9P A;  1SQV G;  3GHG A;  4ZKU A;  2P4V A;  4G2K A;  4NB5 A;  3MHH C;  4N23 A;  2GTS A;  4DXW A;  2CH7 A;  4JV5 O;  4CS4 A;  5LP6 C;  2N9Y B;  1HBW A;  2VQF B;  2W6B A;  2XU6 A;  4DZO A;  1KFN A;  1Q6U A;  4LNU A;  1SQB E;  3AEF C;  4IHJ A;  4H13 B;  3H1L D;  2CTR A;  4FK5 C;  1K3E A;  5KMG B;  3JAS B;  2K9P A;  3N2K B;  5CBN A;  4D6T E;  2VS0 A;  3H1K E;  2ZE6 A;  1JVM A;  2OYH A;  2R9R B;  3K5M A;  4LFB O;  1BSH A;  2QM4 A;  1SQX G;  1GMG A;  1FZA A;  3J7A U;  2LFR A;  2JS3 A;  2UUC B;  4ICG A;  2PY5 A;  3CMA V;  2KSJ A;  2PF4 E;  2WSE J;  5APY A;  4J11 A;  2HJF C;  1AV1 A;  3LDC A;  3SJA C;  4BIZ A;  5ITZ A;  1HF9 A;  5H2F Z;  3CC4 P;  3CC2 V;  4DV4 O;  2E75 C;  1S76 D;  3CC7 V;  1RHZ B;  3UT5 A;  4DUZ B;  1ZR2 A;  3B40 A;  1BHA A;  1D7M A;  2QA4 V;  1VL2 A;  4C46 A;  5IY5 B;  2PAJ A;  4WY4 A;  4OPA A;  1BMF G;  5AVV B;  2OGU A;  4MW3 A;  1IBM O;  4EB6 B;  4YJ2 A;  1L1F A;  2HOD B;  2K3R A;  2QRX A;  2Q0O C;  1JNM A;  3L75 G;  1E79 G;  4CH6 A;  2Q7H A;  1VQ6 V;  2POH A;  4N3Y B;  4CH3 A;  3L73 H;  2PZS A;  1MSD A;  2Y0I A;  3LDD A;  2DYR B;  3CXH H;  2ZT9 D;  2E3C A;  4UB6 H;  2HVK C;  4LWS B;  2W6I G;  4LF5 O;  3FGA D;  3U10 A;  4NKG B;  1VQ9 P;  2WSC J;  4Z1M G;  1YHQ P;  1VQN V;  5AVQ B;  1BCC H;  1SS3 A;  3J80 N;  4X1Y A;  3HD7 B;  4WBN B;  4GKK O;  1M7L A;  4JGS A;  4FFB B;  3CCM V;  3IFM A;  4EFB A;  1GL2 A;  3K5B A;  3K9S A;  3QG5 A;  3L72 H;  4O2A A;  2LR2 A;  2Z0A A;  2ZJS E;  2Y4U A;  1BDD A;  3F89 A;  1G2C A;  1EN5 A;  1BE3 G;  1JCH A;  1FC2 C;  1Q81 Q;  2ZM6 O;  1KQG B;  3VTP C;  1EDJ A;  1RF0 A;  1CI6 B;  2FYU H;  1AI6 A;  4MVO A;  2H3O A;  3PN1 A;  1YJN V;  3EFF K;  3M91 A;  3V2Q A;  3NR7 A;  1LWU A;  1IFM A;  5LMU O;  5IJ9 B;  3L75 D;  5D5Q A;  2RN9 A;  2KG7 A;  4ZBM A;  3E83 A;  3BRV B;  1IXM A;  1KIL D;  1RPO A;  1NU1 G;  2CAZ C;  5J2U B;  2CUG A;  2OYI A;  1YI2 P;  2QEX V;  2QR4 A;  3M7M X;  1GMJ A;  1LTJ C;  2QWN B;  2WLK A;  1VQ8 V;  2N1T D;  3CCL V;  4D7T A;  1OIP A;  1ENV A;  1JMK C;  5HFL A;  1Y4M A;  4Z2W A;  1W5C E;  4CZZ A;  1VQ4 V;  2QKC A;  3ZRX A;  3I56 P;  1RSO B;  2P4K A;  1OW8 A;  3OGC C;  3CCV V;  1SQP K;  1CXZ B;  1H8E G;  2W27 A;  5FLX N;  2JS5 A;  1NI8 A;  2FKW B;  2QG4 A;  1FZB A;  4YXW G;  4IYI A;  2GUZ B;  3RYI B;  1DF5 A;  2Y69 B;  1S5L H;  1JUN A;  4HB1 A;  5AVS B;  1XEQ A;  3RK3 E;  2Y9Z A;  3MUD A;  1XOU A;  2AXT E;  1W2B O;  2DW4 A;  1L4A A;  1YIT V;  4MW8 A;  4TV8 A;  2EIM B;  4W80 A;  2KSE A;  1RP3 B;  1EM1 A;  4I9W A;  1N7S C;  1RH5 B;  4QIW F;  1T5E A;  2A45 I;  1H2L A;  2JEX A;  5CMU A;  1SQP J;  2Q7G A;  2R5B A;  1T2K C;  4IIJ A;  5AW5 B;  1IX9 A;  1D5A A;  4CPG A;  1NYH A;  1SF9 A;  2YID A;  2ZIO A;  4B7E A;  1DK1 A;  1L0N G;  4OXS A;  2BAS A;  2NN4 A;  4OGQ D;  1Q86 W;  2N04 A;  4YY3 O;  2ZXW C;  1OVR A;  3BRC A;  1THZ A;  4LF7 O;  3K06 A;  2XAG A;  4P2Z A;  3ABL C;  4RO2 A;  4EKW A;  1N32 B;  1EXJ A;  1LR1 A;  3CS5 A;  3OGI B;  4JI8 O;  3FKS G;  4JYA O;  1IK7 A;  2E76 D;  3L74 H;  5KLI B;  4XBF A;  3T97 A;  2DYS B;  2WQY C;  4DR6 O;  1U97 A;  1SQV K;  4O2B A;  1Q8I A;  3TSI A;  4ZI7 B;  2OQQ A;  3AE2 C;  3RK3 C;  3CCJ V;  3L70 D;  1NTZ H;  2XAS A;  1N36 O;  3ASN C;  4ZKP A;  4AHC A;  1KZU B;  2WLI A;  4X1I B;  2WT7 B;  2IJH A;  2GBO A;  5AW7 B;  1O9G A;  1QR9 A;  3JAT A;  3P8C D;  4GOF A;  2B88 A;  1LTI C;  3F5T A;  2QTS A;  4JI2 B;  1SQX K;  4LFA B;  2F1M A;  2DE0 X;  2IDB A;  4H13 C;  4H44 D;  3JD1 A;  1SQV J;  2OTK E;  1VQ9 V;  4JI1 B;  2BSK B;  1EN4 A;  4A7P A;  4O4I B;  3LNN A;  2ZD9 A;  1FAF A;  2F93 B;  1RE3 A;  2Q7C A;  1YXB A;  1PP9 D;  1OV9 A;  1D5N A;  1TVK A;  3OW2 O;  2WWW A;  3DC6 A;  4MVZ A;  4HH2 A;  3M9H A;  4WWI A;  3LSU A;  5CA3 A;  4AQY O;  2BOC C;  4NPD A;  3USS A;  1PNL A;  3H1J D;  1GN2 A;  4JAS A;  4BR6 A;  1MUU A;  4NTY A;  1SQX J;  3B77 A;  5H6Q A;  3AED C;  1M8O B;  2HPC B;  5IY5 C;  1EFR G;  1KB9 D;  4IL6 X;  2Y4T A;  3K0G A;  5BR8 B;  4H0L D;  1R5S A;  4JAU A;  2V7Q H;  2M5A B;  5B1B B;  4Z1V A;  1N7L A;  4DV3 O;  1LP1 B;  1YTZ T;  1OHH G;  4HBN A;  4DR1 O;  1KYO D;  3CWB G;  3N7N A;  2WSS H;  2FYN B;  2QJ1 A;  1Z2G A;  1GN6 A;  1W0K G;  4M3L A;  2F4V B;  1SZT A;  3JAM N;  1N73 B;  4DW1 A;  1YI2 V;  4OX9 O;  5CJ4 A;  4OH8 B;  4MN4 C;  3L75 J;  3CEI A;  4KUM A;  5KA5 A;  2BEQ D;  2UXC O;  5KHH A;  2Q7E A;  1BGY D;  4W7Y A;  3I56 V;  2JK5 C;  2W8Z A;  3HD7 C;  4TUY B;  5CCG D;  1FXK A;  2OT5 A;  3G80 A;  2KUB A;  2UXB B;  4IOI H;  2UUA O;  5L3C A;  2ATK C;  4I2L C;  3V2P A;  4PDM A;  1FDO A;  5CN0 A;  2CGN A;  3L9D A;  4WFA V;  4GUN A;  1JR9 A;  4R8C A;  4JTD B;  1FZF A;  1NTK D;  2FFD C;  5LGN A;  3FAV B;  4WCE V;  2QGN A;  4ZHQ B;  3R4Y A;  3UO3 A;  3WG7 B;  2NPS C;  1T3J A;  2C2A A;  1HNX B;  1T3U A;  2WPS A;  3U59 A;  3C90 A;  2DQ0 A;  5KKZ B;  1URQ D;  1QLE B;  3K9A A;  1YZB A;  1IBK O;  3EXA A;  5APV A;  1BE3 J;  3HE5 A;  4MVU A;  1XMO B;  1UII A;  1H2S B;  3NXS A;  1KV4 A;  3B5N A;  5L3F A;  4LF4 O;  3MDS A;  2YEV A;  2E5L B;  2PRR A;  1IC2 A;  3B8E B;  3L73 G;  3ABM C;  1SLQ A;  2GUS A;  2JKV A;  1SQV E;  3BPZ A;  1U57 A;  2W6A A;  4HKZ H;  3ZN1 A;  1VDF A;  2A06 H;  1Q3E A;  2XT9 A;  1NU1 J;  2R3C A;  2B9B A;  1V9P A;  5KX5 A;  4GKJ B;  3H32 A;  3N4X A;  3D71 A;  2WLJ A;  4IFD K;  1SQB D;  1BCC G;  3GB7 C;  5LHI A;  3MTU E;  2ZE7 A;  1E1R G;  4UV9 A;  1Q7Y Q;  1LT9 B;  3UIA A;  3JCU H;  4EEQ A;  4D6T D;  3H1K D;  4JI0 B;  2Y69 C;  1FFX A;  4DV5 O;  1I94 B;  3L72 G;  1SQX E;  3ZMS A;  1SFC A;  1YJW V;  3CYO A;  2QWO B;  4GX0 A;  3S3X A;  2R5D A;  1FPO A;  4IHJ B;  4ZKI A;  1M4U A;  1Y74 B;  1IXB A;  1M1J A;  3VMX A;  2KOG A;  1L0N K;  5DEC A;  3KG2 A;  4I0X A;  2FYU G;  1M90 Q;  3T1C A;  2OYH B;  2EBO A;  3PP5 A;  2HJD A;  2CGO A;  3M99 B;  2HHH O;  3H1I H;  2QJY B;  3BCC H;  3DGE A;  3G3Z A;  1NKN A;  3CRA A;  5H2F E;  3L73 D;  5K1X A;  2BTQ A;  5APT A;  3C3S A;  3UT5 B;  3G6E V;  4HJG H;  3ZN0 A;  1K34 A;  5C93 A;  1VQ5 P;  3CX5 H;  4UUJ C;  3CB2 A;  1RM1 C;  2QJK B;  1SQQ H;  1DD3 A;  1KB9 I;  1J1D C;  1OVV A;  5KTB A;  1JB0 J;  1KIL E;  3NFQ A;  3CME P;  3RW0 A;  2XZR A;  4QE7 A;  4FLV A;  4JI5 O;  3K79 A;  1L0N J;  1XTC C;  4UB8 E;  1SES A;  1Q81 W;  4YJ2 B;  3ZX6 A;  5KUK A;  2AZ2 A;  1FAV A;  1KYO I;  2QJP B;  3M9Q A;  5EYP A;  3ZCC A;  1XL4 A;  4U3F H;  1FJG B;  5CBF A;  2DYS C;  2QTO A;  3OUS A;  3RBX A;  4JYY A;  2WSF J;  3HUS B;  1L8D A;  3CCE P;  2YSU B;  5IYB O;  3T1Y O;  4IYH A;  2LKM A;  4R50 A;  1I5X A;  2R9A A;  2YIC A;  3NMD A;  4LF9 B;  1AP5 A;  1I7F A;  1JJ2 U;  5JH7 A;  4JI4 O;  3IFX A;  1A32 A;  3B4S A;  2UXD O;  4EYY Q;  3FXE A;  5BMV A;  3G6B A;  4X1Y B;  1BE3 E;  5TIS E;  1IUR A;  3ZS8 C;  4W4K A;  2KB1 A;  1XRE A;  5BY1 A;  5EC2 C;  1GL2 B;  1T2K D;  1N33 B;  1LT1 A;  2W6J H;  4ASW A;  1KN7 A;  1LTT C;  3IAY A;  4UCO A;  5GON A;  3RGB A;  1WP7 A;  2J5U A;  3QH9 A;  1G2C B;  4C7R A;  2R9I A;  4CH5 A;  5E79 H;  1NTK K;  1K92 A;  1NU1 E;  2ZVN B;  4I5S A;  2IBZ H;  2E74 B;  3ETE A;  4X1K A;  2B87 A;  1KIL C;  5AW4 B;  1XHZ A;  2H88 C;  3AE5 C;  2Q67 A;  3II6 A;  1YF2 A;  1AQ5 A;  3GW6 A;  1K9M Q;  2KG7 B;  1P84 E;  1MA1 A;  4JQ0 D;  3E22 A;  2KS1 A;  4DYL A;  3L74 G;  1FE6 A;  1F4M A;  2N1T C;  2M3E A;  3KZI H;  2OYI B;  1HVV A;  2FTK A;  1X4T A;  4I6M C;  3H6P A;  3K5L A;  1KQS U;  5IE9 A;  3FX7 A;  3P3N A;  1NTZ G;  1ZN5 A;  2FYN C;  2OIE A;  3A0H Z;  2P2U A;  5B5E H;  3DXR B;  3ETQ A;  3RK3 D;  1OZ0 A;  4PV1 B;  3ZMV A;  5LMN B;  4DR3 B;  3PRJ A;  4Y99 C;  3ZHQ A;  1A02 F;  1VQL P;  2WLH A;  2AHY A;  2P5O A;  3CMA P;  3QVN A;  4X20 A;  1Y47 A;  4I7Z B;  3CWB J;  1OCC C;  3OR7 C;  2AHZ A;  4XDK A;  1FOS E;  3CC2 P;  4JI3 O;  2JJ2 G;  4PD4 E;  2ZXE B;  3CC7 P;  1Q82 Q;  1GK4 A;  2PTM A;  1JQ0 A;  5IYZ A;  5JJN B;  1HNW B;  2QA4 P;  2YNY A;  4H13 D;  3AE8 C;  4MTO A;  4XDJ A;  4X62 B;  1L4A B;  4TV8 B;  4JF7 A;  4UCS A;  1YQ3 C;  3HTK A;  3FXD A;  2QWP B;  1L0N E;  1HWY A;  2P10 A;  2OYH C;  1K5S A;  5LL6 Y;  2LGW A;  2RH0 A;  5LA6 A;  5BU8 B;  4U7O A;  3MAQ A;  2AEM A;  1DTO A;  1Y76 A;  1TGO A;  3EQ2 A;  2CTW A;  3IC9 A;  3ZRS A;  1QLN A;  4DV1 B;  3BHP A;  2Z5I A;  1NKD A;  2EIK C;  4NTW A;  2W0F C;  2JDI G;  1IFI A;  2CTP A;  3K3W A;  3VQY A;  3AK2 A;  5J2T A;  1XI1 A;  1N8R W;  3CCU P;  1XMQ B;  3LNM B;  5JCO A;  4I9Q A;  2XOK G;  3MHS C;  3SWY A;  4LBE C;  1N86 A;  4PDL A;  1K97 A;  1NVP B;  1PPJ H;  3ZHV A;  1VQN P;  2WSS G;  1S0V A;  1MZ9 A;  2WPD G;  1PL5 A;  4PA6 A;  4IFF A;  1IDS A;  1AQT A;  3CCM P;  3AE7 C;  1HP8 A;  2Y0P A;  4KJM A;  3SJC C;  3T97 B;  1AI5 A;  1TUE B;  1R3L C;  2EIN B;  4O2B B;  1K04 A;  2E43 A;  3W68 A;  1CSB A;  1JY2 N;  2X0L A;  2M0B A;  1YQ4 C;  3UKM A;  4P9O A;  3K04 A;  1JMB A;  4X64 B;  3L73 J;  4UFZ A;  2WPR A;  2WLI B;  1LT9 C;  3JAK B;  2EUL A;  3HD7 D;  3CRR A;  3A0R A;  1H2N A;  3TGU H;  3HR0 A;  4KHX A;  5CA1 B;  3RFR A;  4JI7 B;  5LYJ A;  2OCC C;  4DRX A;  4B08 A;  3K58 A;  1BCC J;  2R44 A;  1F23 A;  2JEE A;  1V55 B;  2UUB O;  2YIA A;  5GTH H;  4RUF A;  2BCC H;  2KLV A;  1J5E B;  2P7J A;  3L72 J;  1M57 B;  1QL2 A;  2D2C B;  4EOT A;  1VQ8 P;  2Q5Z A;  2LGQ A;  1ZLL A;  3EWK A;  2Z3Y A;  1YYC A;  1UFI A;  1WPX A;  1XNQ O;  3V6I A;  3CCL P;  5JQG A;  4DK1 A;  2AEJ A;  1HGV A;  4LFA O;  4JAA A;  4HYO A;  4NXN O;  2QIW A;  5AVU B;  3G67 A;  2H7H A;  3TNU A;  4CBC A;  2OTL P;  4JI1 O;  4PI0 A;  3V2N A;  2FYU J;  2IFN A;  3CWB E;  2G3A A;  1DH3 A;  1S5J A;  1RE4 C;  4I4T A;  2IH1 C;  3JCZ A;  4WBA A;  3I55 P;  2BEZ F;  1GU4 A;  4U7J A;  2B9Z A;  4LCU C;  3LUT B;  2A06 G;  3TF5 A;  1NKZ B;  4L76 A;  3JAL B;  2L91 A;  1ZL8 B;  2Y0C A;  4ZMD A;  4JTA B;  3ZRW A;  3HUS C;  2YO2 A;  2ZDI A;  5BR8 O;  2WLM A;  5APS A;  1ZME C;  3RL0 B;  3AG1 C;  5CCG C;  4B3M B;  5HFM A;  3CCS V;  1KB9 F;  3RYF B;  4RUE A;  1ZSP A;  4LP8 A;  3MP7 B;  2PYL A;  4G27 B;  4JPR A;  3RK2 B;  3JAW A;  2NZ2 A;  3CRM A;  1VQL V;  2PI4 A;  3D3Q A;  3H01 A;  1GL2 C;  4I50 A;  2FYZ A;  3H1I G;  3K0D A;  2JEU A;  1WPB A;  3D36 C;  3BCC G;  2Y0E A;  1AJQ A;  3OR6 C;  2Y48 A;  4KXR A;  3X2Q C;  4KP4 A;  3K03 A;  1URQ C;  4BIU A;  5CA0 B;  3C9I A;  2P58 A;  1OW6 A;  4DOJ A;  1WB7 A;  3G71 V;  1JTH A;  3DC5 A;  3OMA B;  2L5G B;  3W7X A;  5LXT B;  4DUY O;  1SQQ G;  1S5H C;  3L73 E;  3CCJ P;  4UB8 Z;  1BL8 A;  2Z4E A;  1SQV D;  4NTX A;  1D2D A;  3CXH E;  2IYP A;  2ZAE B;  5KAI H;  4UB6 E;  1HUC A;  1NTZ K;  3B5N B;  2V1D A;  3QO8 A;  1HNX O;  4U3F G;  5KJ7 A;  2VRS A;  3ETG A;  3CI9 A;  1BCC E;  3CRQ A;  3CCU V;  1JCC A;  1RQV A;  1TA8 A;  5AW8 B;  1LUW A;  2YUA A;  1H38 A;  1HTL C;  3V4W A;  1FD9 A;  2NRG A;  2RKL A;  3KPE A;  3L74 J;  2YIB A;  3Q5R A;  3L72 E;  1SQX D;  4PV1 C;  1S72 V;  2E5L O;  5LGT A;  3H32 B;  4AQR D;  5TIS Z;  1NTM H;  1JY2 O;  3H1I D;  1VQK P;  1OW7 A;  2JR8 A;  3CJH A;  2LJ2 A;  2Q8V A;  1OXZ A;  2M3B A;  5LP6 A;  5GTI Z;  1NTZ J;  2W0X A;  2FYU E;  3FX0 A;  5AVR B;  1FFX B;  2IU3 A;  2QM7 A;  2C0X A;  2W6J G;  5KAF H;  1SFC B;  3JD4 A;  5H6R A;  3MUD C;  2ITA A;  3EHB B;  1ZAU A;  1Y6X A;  4CS2 A;  1VF6 C;  4GCZ A;  1M1J B;  3K59 A;  3BRT B;  4I0X B;  2IBZ G;  1K8A Q;  4HAM A;  1DLB A;  4RQF A;  3SGI A;  1Q90 D;  3HKE A;  2BTQ B;  4DR4 O;  4JI6 B;  5B5E Z;  1M1K W;  2F66 C;  1GU5 A;  3T1H B;  2JJL A;  3DSQ A;  4WFE A;  1FBM A;  1YSC A;  5APW A;  2N74 A;  5B1A B;  1JM0 A;  1R3J C;  5J9P C;  3A0B H;  1PIX A;  3J81 N;  1S5L E;  4X65 B;  3HKB A;  4K35 A;  4LR3 A;  2OTL V;  4KHP O;  2JVD A;  2XAQ A;  4NPE A;  1X8Y A;  1G8M A;  3U0Z A;  4DR7 B;  1GZL A;  3I55 V;  1BE3 D;  5AW0 B;  1XDC A;  1GTW A;  3CE2 A;  1NH4 A;  4LFC O;  4NPF X;  5EBW C;  2Q4P A;  3VP9 A;  3JSL A;  3U1C A;  4FIP C;  3BEH A;  3RL0 g;  1FJG O;  2HFE D;  2Z5H A;  3QNE A;  2IBZ D;  3ICX A;  4IGG A;  3TK1 A;  4HNA A;  5IJ0 A;  3AG2 B;  5BMV B;  3L35 A;  1NU1 D;  1PNM A;  3JSN A;  2YKP A;  2GSM B;  1HNZ B;  2GA1 A;  4O4H A;  5DJU B;  2L35 A;  4LF9 O;  3MD0 A;  4CH4 A;  2YKQ A;  5GON B;  1AB3 A;  2Q69 A;  1P84 D;  5JVD B;  1M57 C;  1DGS A;  5LOV B;  3L74 E;  2B1I A;  1KC8 W;  3O8Z A;  2NLJ C;  1K73 W;  2ODM A;  2LW1 A;  1VF5 B;  1QLE D;  4N6J A;  3SSU A;  1PPJ G;  2X6C A;  4GT1 A;  4X1K B;  3RVY A;  2B87 B;  5EFW B;  2EIJ C;  1N33 O;  4DV2 B;  2LFS A;  4D7S A;  5BU5 A;  3TYY A;  1NTZ E;  2WPV B;  3E22 B;  2KS1 B;  3OW2 U;  2ARH A;  3VP8 A;  1LTJ A;  2ITC C;  1S4X A;  1YJW P;  3GVM A;  3LW5 H;  4HYT B;  1J1E C;  2XUM A;  5CCH A;  2R70 A;  1RF1 B;  3CCQ P;  3GWK C;  1IFP A;  3JAR A;  1Y9B A;  1NHL A;  5CHX A;  2H94 A;  4L8J A;  3A0H E;  4PD4 D;  4LF8 B;  2WSC H;  3FB5 C;  3TDK A;  3JSV C;  1H89 A;  3TGU G;  4DV0 O;  1L0N D;  1SVF A;  4R7C A;  1XQ8 A;  1BZK A;  2X7R B;  1R3I C;  3BAB A;  1NT2 B;  4QGP A;  2FKX A;  5A2Q N;  5AVX B;  3G6E P;  3OAA G;  5IYZ B;  3RK2 C;  5AW3 B;  1N7S A;  3RYH A;  1VQK V;  3HTK B;  2UU9 O;  3VBB A;  1PFI A;  1PV3 A;  1COW G;  2OYQ A;  5AW9 B;  2A7W A;  5AVT B;  4Q20 A;  1Y66 A;  4PEL A;  1L0L H;  3Q4H B;  2XTA A;  4PJ0 Z;  4JYB A;  4KFM A;  1AJY A;  4QE9 A;  4I55 B;  4J42 A;  4X62 O;  1MZF A;  3H25 A;  1SA0 A;  3SJB C;  4ASU G;  2HG5 C;  4DV6 B;  3H1I J;  1PL0 A;  4K0K O;  5KA6 A;  1NO4 A;  3BCC J;  1K7D A;  1FKA O;  1JPX A;  3RYC B;  1EC5 A;  1YDX A;  1N34 B;  4RJT A;  1VMG A;  2KK7 A;  1QR8 A;  4XFJ A;  4DV7 B;  3AG7 A;  4DV1 O;  4B3R B;  5IWA B;  4LF6 B;  4LGD E;  1PD3 A;  4K3A A;  1FZG A;  4GYC B;  1QQC A;  3KHU A;  2DYR C;  1NWQ A;  4GX5 A;  3ZMU A;  3HKD A;  1NAY A;  4JV5 B;  1M56 B;  2YXR B;  1PNK A;  2WPQ A;  2NR5 A;  1RPR A;  3K08 A;  2JO1 A;  4FZ0 A;  3LDE A;  4FFK A;  3RN4 A;  4U3F J;  4DR5 O;  1CZQ A;  1NR1 A;  4XA4 A;  3L71 H;  1S77 D;  1EDI A;  3IF4 A;  4BAY A;  3CCR V;  1OCZ B;  1GK9 A;  3W67 A;  2ZVO B;  4P30 A;  2FB5 A;  2IBZ I;  1R73 A;  2VWJ A;  5BZB A;  2EIL B;  1LTG C;  2M6Y A;  2GDS A;  4PDR A;  5LYJ B;  1WP8 A;  1GL2 D;  1SQP H;  4DRX B;  5KMG A;  1JY3 N;  1R8E A;  3JAS A;  4B3S B;  2YXH A;  4IT5 A;  3N2K A;  3TXQ A;  4X64 O;  4DV4 B;  2O1J A;  3S4R A;  1VQP V;  2PGD A;  1NU1 K;  1UJW B;  3AG4 B;  5KLV H;  3H1H H;  3CWB D;  4X66 O;  1P84 I;  3SR2 C;  1WJZ A;  3OMN B;  1KFM A;  3CPW O;  1WT6 A;  1BSM A;  3K57 A;  4JI7 O;  1HW7 A;  1K4D C;  4UB6 Z;  1BT8 A;  1GRJ A;  1X9V A;  2QM8 A;  3AEG C;  2WA4 A;  4YHH O;  1KMI Z;  2A06 E;  1NBM G;  3GF3 A;  3TNU B;  2OTJ V;  1E5W A;  3E89 A;  4UCR A;  3JD0 A;  3WU2 H;  3H1L H;  5EK0 A;  2J58 A;  1FZC A;  4I4T B;  4BIO A;  1ZUQ A;  2ZYA A;  2A45 H;  5C8Y A;  3JCU E;  1AR5 A;  3FB6 C;  1QX8 A;  5H9C A;  2W83 C;  1AR4 A;  3AG3 B;  3OTO O;  1OVU A;  2ZXX A;  4YJ3 B;  5KAF Z;  2KKW A;  4NVP A;  2G8Y A;  2ITD C;  4F4L A;  1NTM G;  3GHG B;  4PD4 I;  4PV1 D;  1IO4 A;  2KZJ A;  3ZHU A;  3SWK A;  1QVF O;  4LWS A;  1QVG O;  2CH7 B;  2R3S A;  2OWO A;  4FZ1 A;  1YBK A;  4LNU B;  4H37 A;  1P4R A;  1PV0 A;  2EIM C;  3SYO A;  3CCQ V;  3H1I E;  3KDP B;  3U1A A;  1PM9 A;  2VQE O;  3BCC E;  3SPJ A;  2ZM6 B;  1G1J A;  4GKG A;  1MG1 A;  1L4A D;  3AG2 C;  5DJT B;  3T4Z A;  1ORQ C;  3S9O A;  2J59 M;  2VQF O;  4GX1 A;  1VAR A;  4LC1 A;  4FLY A;  4BW5 A;  2FFD A;  1LGH B;  4I50 B;  4B3M O;  3CX5 E;  3OA7 A;  1HJB A;  1SQQ E;  2KSD A;  5ITZ B;  2XAJ A;  1NGM B;  2NPS A;  2PUS A;  3A0B Z;  1IVS A;  3CXH D;  1NH2 B;  3KYQ A;  2PYJ A;  3CLQ A;  2UUC O;  4U3F E;  1VF5 C;  4WY4 B;  3DTU B;  3OEH G;  1JTH B;  1BCC D;  1ZRT E;  1GK6 A;  4RQE A;  1S5L Z;  4B3T B;  1JY2 P;  5EZY A;  1NVP D;  1OCO B;  4IL6 H;  2XKM A;  5APX A;  5KLI C;  4DUZ O;  3HRN A;  2Q3E A;  3JYC A;  3L72 D;  4X88 A;  3UCS C;  2HLD G;  1K8A W;  2K88 A;  3Q5P A;  1H0T A;  4FLU A;  1N0N A;  2FY8 A;  1XNR B;  1RF1 C;  4UV8 A;  4AYC A;  1I0H A;  1S3J A;  1FYJ A;  3GLM A;  2FYU D;  2Q68 A;  2PFX A;  2UXN A;  3L75 H;  1BS3 A;  2YI8 A;  1F7Y A;  2Q1K A;  1WRG A;  3ML0 A;  3PH0 A;  5AG2 A;  2LXB A;  1ARO P;  3D6Y A;  2ZE8 A;  3ZHT A;  3CJH B;  2HEP A;  1JOC A;  2DWD C;  5GTI E;  5E79 E;  4O2A B;  1FJK A;  3FD9 A;  1PL4 A;  2IBZ E;  2FBW C;  2YDE A;  3IAO A;  4FLX A;  3TGU J;  4OVN F;  3D6Z A;  4W4L A;  1JY3 O;  4YY3 B;  1U7M A;  2KZI A;  1P7G A;  4LF7 B;  1M57 D;  4J80 A;  4UVB A;  2D2C D;  1QCE A;  1LWU B;  1TUB A;  5B3S B;  2JGD A;  1PGO A;  1LTB C;  4JI8 B;  1SKV A;  1CP9 A;  3GG2 A;  3VN0 A;  5TJH A;  4JYA B;  1AJP A;  1JO5 A;  2BE3 A;  2E75 B;  1JX9 A;  4DO2 A;  1JMM A;  1JFF A;  3M0D C;  5B5E E;  2K37 A;  2HP8 A;  3HKE B;  4XDL A;  5B1B C;  5AW2 B;  5L8R J;  1FS0 G;  3E35 A;  3CD6 V;  3CCS P;  1SRY A;  4FLT A;  1N36 B;  1MAB G;  2WLL A;  3SYC A;  1M5I A;  3E86 A;  1ZV8 A;  2F23 A;  2YMY A;  4MSW C;  2P6J A;  3APO A;  3HKB B;  2QVA A;  2XND H;  3F5H A;  2BOB C;  3G9R A;  2AW9 A;  2VRZ A;  1N73 C;  1ZXG A;  4TWK A;  2EJR A;  3T1H O;  2LQT A;  4JZG A;  4ZI7 A;  4WVZ A;  1SET A;  5FNV A;  4DR2 B;  2HFE C;  3KCY A;  3RL0 D;  3HKC A;  3A8T A;  1KBH A;  1G4Y B;  1GM8 A;  4X1I A;  3SFD C;  2WT7 A;  3RGU A;  3G71 P;  1Y67 A;  2IW5 A;  3RK2 D;  4QNH B;  2EIL C;  4DR7 O;  2ZE5 A;  4HNA B;  2V4H A;  5IJ0 B;  3L37 A;  4UCU A;  1Q86 Q;  3OJA B;  3LID A;  4IIJ B;  1L0L G;  3L74 D;  4J41 A;  1Q2N A;  1KEC A;  1MOF A;  3WG7 C;  3SWF A;  4AQY B;  2BSK A;  3PLN A;  4YPC A;  1N4C A;  3AE9 C;  4O4H B;  4CC5 A;  1PPJ E;  4C7N A;  1GM7 A;  5CBO A;  1B6Q A;  4UCV A;  3L70 H;  3AG4 C;  5KUM A;  5KKZ C;  3CXH I;  1QLE C;  2EZO A;  1NTZ D;  4KT0 J;  2HG5 D;  2V7Q G;  4GDO A;  3P7K A;  2JJ1 G;  1KIL A;  5CB4 A;  1CPY A;  4DV3 B;  1SC5 B;  1HNZ O;  1R1B A;  1S72 P;  4EFE A;  1GD2 E;  2P67 A;  3V5B A;  3IJ4 A;  5D5P A;  4U3J A;  2WZ7 A;  1G1X B;  1RQU A;  2HPC A;  3K5O A;  4GX2 A;  5A9G A;  5CBH A;  2N1T A;  2ZNJ A;  1QL1 A;  3B5N D;  2FML A;  5EIB D;  1MFZ A;  4OX9 B;  1QHT A;  1N32 O;  1Q6H A;  3A7O A;  1P84 F;  1PGJ A;  3A2A A;  3TGU E;  1PP9 H;  2UXC B;  1O9H A;  3L71 G;  3LSQ A;  4RES B;  2SPZ A;  2YXY A;  3GHG C;  2UUA B;  3JAT B;  1PZQ A;  2I8D A;  2BTO A;  1L0L D;  3VQX A;  2YXL A;  3H1J H;  2FYU K;  5B66 H;  5GTH E;  1AIL A;  2GM4 A;  2ZDI C;  1FDI A;  2K9J A;  1XBL A;  2RNB A;  1KB9 H;  1SQP G;  1WA8 A;  2YI9 A;  4L74 A;  1NTM J;  3W7U A;  5CJ0 A;  1PGP A;  2O01 H;  1SFC D;  1KYO H;  2N9B A;  3H9V A;  2H8P D;  3MGN A;  2GHY A;  2D3O W;  3SYA A;  1JOY A;  4AIL C;  1LNQ A;  5C39 A;  5KLV G;  3H1H G;  1N7S B;  4O4J A;  4JI2 O;  3RYH B;  2QJY C;  3WU2 Z;  4PD4 F;  1IBK B;  1TVK B;  2O57 A;  4BWA A;  3S3W A;  4TSF G;  5FPR A;  2R72 A;  4ZHQ A;  4PJ0 E;  2KNC A;  2CE4 A;  1LJ2 A;  5IYD O;  4A5U B;  2IU0 A;  2HVJ C;  5GW7 A;  5B1O A;  4LF4 B;  1OX3 A;  2C9L Y;  4DCK A;  1BGY H;  1YTF B;  3H1L G;  4N78 E;  1EZJ A;  1SA0 B;  2QJK C;  2YXQ B;  3VMY A;  4WY4 C;  2ZXW B;  3JCU Z;  2A45 G;  5IDJ A;  4DK0 A;  1OJH A;  2QJP C;  1W59 A;  4FM1 A;  1H8A A;  1XL6 A;  1NTK H;  1N0J A;  2FXO A;  1AFO A;  4MS2 A;  3AK3 A;  3STZ C;  3PHL A;  3W7S A;  1ZOY C;  1AI4 A;  1GW3 A;  4PA9 A;  2K1E A;  4J9Z B;  4FM2 A;  3HKD B;  1N34 O;  3P30 A;  4MVQ A;  2AXC A;  2I1K A;  4X89 A;  3KCX A;  2FXP A;  2EZP A;  5LGU A;  2JIZ G;  5IWA O;  1S5L X;  2F4V O;  1KYO F;  4GZR B;  1FXK B;  3WMM 0;  1LT9 A;  1EZV H;  1HH0 A;  3C8V A;  3GF7 A;  1GN4 A;  3S1K A;  1R3K C;  3V2R A;  4WFH A;  2QKS A;  2OCH A;  2HHH B;  4K8X A;  2KXP B;  2QKA A;  1FXV A;  1L2P A;  1M9N A;  1ZX3 A;  2KP8 A;  4B86 A;  1Q7Y W;  2JWD A;  2QSI A;  1Y74 A;  1K33 A;  2UXB O;  1Z5V A;  5KAI E;  4IL6 Z;  1RF0 C;  2A06 D;  3NTN A;  3N2G A;  4N21 A;  2E74 C;  1SQB H;  3WUU A;  1Y8A A;  3A5T A;  1KOR A;  1LWU C;  1WLE A;  1I08 A;  5B3S C;  3HE5 B;  1VF5 D;  4D6T H;  3H1K H;  1VP7 A;  4JI5 B;  2OAR A;  4B3S O;  1IK9 A;  1M90 W;  1IFJ A;  2Q0A A;  1WMK A;  2YEV B;  3CL3 D;  1RE4 A;  2OYI C;  1IBL B;  1F4N A;  5M1B A;  3WB1 A;  4JBZ A;  5K5G B;  2E5Y A;  3T1Y B;  2VWK A;  1NTM E;  1FZC B;  1EXI A;  2IH3 C;  3OM3 B;  2DMX A;  2QDO A;  3GWO A;  1XMO O;  4MTF A;  1FXH A;  3IN6 A;  5C8Y B;  1AJN A;  3UM7 A;  3CSX A;  5KX5 B;  1K4C C;  1X22 A;  2WMM A;  4JAV A;  4JI4 B;  3W7T A;  1MMM A;  2UXD B;  1KD1 W;  3HUS A;  3L36 A;  5KAF E;  4F6R A;  3AEI A;  4I7Z C;  2A9H A;  3BCC D;  4ZOL A;  1HJ0 A;  3LW5 J;  1US6 A;  2UXX A;  5E79 Z;  1GH6 A;  4ZNC A;  1KTM A;  3B2E E;  4BWN A;  5CCG A;  2P22 C;  3Q5S A;  4GKJ O;  2PGG A;  2MJZ A;  1L0L K;  1IJD B;  1L4A C;  1I5Y A;  3CX5 D;  1SQQ D;  3L4F A;  2IJK A;  2A79 B;  1EDK A;  1H8H G;  2Q9L A;  4JI0 O;  2P1J A;  3PTZ A;  4GIF A;  2Q9I A;  3BFR A;  1W2B U;  1I94 O;  2IFM A;  4TQF A;  3KZI Z;  4TV9 A;  4WFF A;  4CS3 A;  3D36 A;  1QBZ A;  4U3F D;  5KHG A;  3L70 G;  5L3E A;  3WUT A;  2FFD B;  2Q73 A;  1ZRT D;  3MHV A;  1Q5O A;  1URQ A;  5AVZ B;  3A0B E;  2NPS B;  4YTP C;  1SP4 A;  2KB7 P;  2ZNI A;  1R6T A;  1L0L J;  1R6N A;  4X9Q A;  2DQ3 A;  3WB0 A;  3ZJZ A;  3GMA A;  5APQ A;  2ILM A;  1VQO P;  3ASO B;  5AW1 B;  3FWN A;  1LTS C;  1PGQ A;  1HR0 B;  3CCR P;  2WIT A;  5EZY B;  4K8Z A;  5EC1 C;  4YXD C;  5EYP B;  2XND G;  1YTZ I;  2V7Q J;  2EIN C;  4FJC C;  1AR1 B;  3R66 A;  4BRY A;  3R2P A;  2MKV A;  3ABM B;  1DX7 A;  3A2F A;  3P3P A;  3CXH F;  1X0T A;  4ZIB A;  1K9M W;  1DF4 A;  1M56 D;  4JI3 B;  1H0T B;  5CCH C;  2RCV A;  4B3T O;  1VEW A;  1LTA C;  1VQP P;  4AUW A;  3DXR A;  3ETD A;  1QU7 A;  1QNM A;  3EFG A;  1JY3 P;  3N27 A;  5JH7 B;  4IFM A;  5K1P A;  4PI2 A;  4J9Y B;  4NR1 A;  1SER A;  3VQV A;  4DT0 A;  1ZW0 A;  1GAX A;  3STL C;  5KLV K;  2XV5 A;  1GN3 A;  1XNR O;  3L71 J;  2OYO A;  1YJ9 V;  2WSE H;  3B71 A;  2F95 B;  1V55 C;  3OFN G;  4GLX A;  3HE4 A;  4E2L A;  2OTJ P;  2G38 A;  1SQF A;  2WA3 A;  4MVS A;  3TJT A;  1VF6 A;  3G4S P;  2D2C C;  1U7J A;  3ZMT A; 
#chains in the Genus database with same CATH homology
 2FYN C;  4RKU J;  5M1B A;  2K9Y A;  3D6Z A;  4PV1 B;  3AEF C;  1DIP A;  4H13 B;  1OW8 A;  2G3A A;  1EXI A;  1OMI A;  3Q3D A;  1FDI A;  2D2C D;  4OGQ C;  3AED C;  3IN6 A;  2BEZ F;  2H89 C;  4U7J A;  4I7Z B;  4R4L A;  4IL6 X;  4H0L D;  1S1C X;  2ZT9 C;  2E75 B;  1KQF B;  2WSE J;  4I7Z C;  3LW5 J;  2G8Y A;  1HJ0 A;  3RK3 E;  4PV1 D;  4H13 D;  1Q90 D;  3AE3 C;  3AE8 C;  2E76 C;  1HF9 A;  2E74 D;  2QJY C;  2YIU C;  1K05 A;  1KTM A;  2E75 C;  1YQ3 C;  1TU3 F;  5L8R J;  4Z1M H;  1PV3 A;  3Q5S A;  1VL2 A;  2P10 A;  4OGQ B;  3AE1 C;  1ZME C;  1DD3 A;  1JB0 J;  1KIL E;  1AJY A;  2E75 D;  3IAO A;  4Y28 J;  1PIX A;  2ZT9 B;  3G9R A;  2BEQ D;  3Q1M A;  3H25 A;  2QJK C;  1NYH A;  2JP3 A;  3S9O A;  2O01 J;  2NZ2 A;  2E76 B;  2WSF J;  2QJP C;  4OGQ D;  4XFJ A;  3AEA C;  1DD4 A;  1FDO A;  2YMK A;  3SFD C;  3AE4 C;  3SFE C;  1NGM B;  2ZT9 D;  4YTP C;  4H44 C;  1EXJ A;  1ZOY C;  3AEB C;  3FGA D;  1PL5 A;  1UIX A;  3RL0 g;  3R4Y A;  2WSC J;  3AE7 C;  3GMA A;  1IK7 A;  2E76 D;  1OW6 A;  3AEE C;  1VF5 C;  3T97 B;  1ZRT E;  2WQY C;  2FXP A;  1ZP0 C;  1K04 A;  2JO1 A;  3AE9 C;  4YXD C;  1S5L X;  5KLI C;  4TT3 H;  1YQ4 C;  2V7Q J;  2OQQ A;  5KKZ C;  3C8V A;  3AE2 C;  3GF7 A;  4H44 B;  2MKV A;  2J5U A;  4KT0 J;  3Q5P A;  4GDO A;  1KQG B;  3AEC C;  1RQV A;  1VF5 B;  4H0L C;  3GLM A;  2E74 B;  1U57 A;  2QSI A;  1R8E A;  3D70 A;  2H88 C;  3AE5 C;  1KMI Z;  3Q5R A;  1RQU A;  4R4M A;  4PV1 C;  2IDB A;  3Q2Y A;  4H13 C;  4H44 D;  3O6Q A;  2E74 C;  3ABV C;  3D71 A;  2WPV B;  1KOR A;  3D6Y A;  1OW7 A;  3AE6 C;  2D2C B;  3B71 A;  1VF5 D;  3EWK A;  1MKM A;  4H0L B;  1GMJ A;  1WMK A;  2FBW C;  3AEG C;  2QIW A;  2D2C C;  1Y9B A;  3GF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...