2E75B

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e75B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75B01
2D2CB 4H44B 1VF5B 2WPVB 2E75B 1ZRTE 5KLIC 2WSFJ 2O01J 2K9YA 3LW5J 2WSCJ 4I7ZB 4H0LB 2QIWA 2FYNC 4OGQB 2QSIA 2E76B 2QJKC 2QJYC 4PV1B 4Y28J 2E74B 4KT0J 2QJPC 4RKUJ 2ZT9B 1JB0J 2YIUC 4IL6X 4H13B 2WSEJ 3C8VA 5L8RJ 1Q90D 5KKZC 1S5LX
chains in the Genus database with same CATH superfamily
1SQQH 1KYOE 4F6RA 2PAJA 3OJAB 4FJCC 2UWJE 1LTGC 1K8AQ 2AGAA 4IL6E 1LUVA 1XHZA 4OGQC 3J81N 1L0ND 2GBOA 3E1IA 3VMZA 2XOKG 4FM2A 3E83A 3ABKB 4LH7A 4QE7A 1QHTA 2NPSD 3VBBA 1GRJA 2HFED 3B5NB 3SFEC 1S5LE 3CXHE 3S9OA 1LWUC 2EJ7A 4DR7O 1XNQO 1M1JB 3HKDA 3OUSA 2E75D 1S5LH 5IWAB 3H1HJ 1KKDA 5CCHC 3RL0C 4GODA 4IGGA 4K3AA 3F7YC 1KUQA 1W0KG 3TGUD 4J42A 1WPBA 3G67A 3APOA 1JY2N 1PPJH 3CLQA 5E79Z 3U1AA 1R8EA 1SESA 2OYHB 4GKGA 1V9PA 2LXBA 2A7WA 3HR0A 3WB0A 1IJDB 1SQBJ 3H1JJ 2K1EA 2K9YA 1FZGA 4ZBMA 2ZJSE 1VQKP 5KLVH 2WLKA 4WF9V 4I7ZB 4CZZA 5H6QA 3X2QB 4R50A 3L71G 2YICA 3LDDA 3CWBD 4N3YB 2WLMA 1CXZB 5LMNO 2KZJA 1XMOB 1SQVG 3ZS8C 2E3CA 1VDFA 1XMQO 3ASOB 4LFAB 1IFDA 5BU5A 5AVWB 1R6TA 2KP8A 2QKAA 3CCQP 5CBGA 2LKMA 3H32A 1NU1D 2QE7H 5LYJA 3L75G 1UFIA 1VQ6V 3M0AA 3BCCJ 2LQTA 1MSDA 4LF6B 3A7OA 3CMAV 1JTHB 2DW3A 2WSFH 1VQMV 3LIDA 1VQ9P 2HHHO 1VQMP 3PRJA 2NZ2A 4YTPC 2GUZA 3OAKA 5EBMC 3CI9A 3H9VA 4HNAB 4I0XB 1H8AA 5JQGB 1A32A 2P2UA 5H2FH 2JRIA 3L70H 2N05A 2W83C 2LP7A 4ZHQB 4DV6O 4UV9A 2HJDA 3DC5A 1GU5A 2OT5A 3OE7G 5BMVA 1NTZE 3WFVA 1J1DB 4JBZA 5GTHE 3IC9A 1KQLA 2L6LA 2GSMB 5FPRA 1YJ9P 4L74A 5EZYB 2DMXA 3JARA 3C9IA 3HTKA 1AP5A 3AG2B 4KUMA 2Y4TA 3ZHRA 3A2FA 4U3FE 4BR6A 4LH6A 5KMGB 3ZHUA 2RH0A 4TLFA 4NB5A 1XMOO 3TGUE 2JJ2G 5KAIZ 5B1AC 1QLEC 4WY4A 4WVZA 3RYFA 5HFLA 2LGWA 4DO2A 4PA6A 1BCCE 3CCEP 4JI1B 3K5LA 4FLTA 2JEXA 1N7SC 1ORQC 4TUYA 5FNVB 2NRGA 5J2TB 2PY5A 3VMYA 2CTRA 1SQVJ 4TQFA 2QJPB 4A7PA 4ICGA 4YJ2B 3K5BA 3AE1C 2PYJA 3HKBB 4B3RB 1L0NE 4R8CA 2VQFB 5AW7B 1BL8A 1MOFA 1VF7A 3RBZA 4NXNB 2XAFA 1J5EB 2LXCB 2UXNA 1GMJA 2AEFA 3RVYA 2JJLA 3U10A 3ZBHA 4LWSA 4RUEA 1XNRO 1K4CC 1QBZA 2A3QA 4O4LA 4UB6Z 2OYQA 1Y9BA 2R5BA 3H32B 4P30A 1KC8W 2V1DA 2NN4A 4NYKA 3ZX6A 5DJUB 3CX5F 3B8EB 3I56P 2Q8VA 1KQGB 4FLZA 4H44B 1AR4A 4GDOA 1UIIA 3HKEB 1IBLO 4B3TB 1ZOYC 4K35A 1MMMA 4LF4B 2EBOA 1BZKA 3T1YB 2EULA 4HNAA 3P32A 1WA8B 4PELA 4UVBA 2GTAA 4O4HB 1DH3A 3PJSK 4FLYA 3JSVC 2HP8A 3K3WA 4MVSA 5KAFZ 1YITP 1OVRA 4KHXA 1H2MA 1EZVG 3JAMN 2XU6A 4MTOA 3GWKC 1XI1A 5APTA 1KFNA 1EZVD 1HH0A 1FU1A 2AHYA 2C9LY 2JWDA 3JATB 1S9KE 3CCSV 2ZE5A 1O9HA 3GB7C 1SQXH 5IYDO 1AVYA 2CE4A 3M8AA 1H2GA 4N78E 2H7HA 1BE3J 1NTMD 3T1HB 1VQ4P 3QVNA 2ZNIA 1PP9H 1N33O 4JI5B 1ZXGA 4FM1A 2Q3IA 3D36A 2ZFCA 4UCTA 1S5HC 3CSXA 2CDYA 2D2CB 4ZKUA 3D36C 4UCSA 5LHHA 2MK3A 1URQC 3H1IE 1OZHA 1YI2V 3DC6A 3E22A 5GW7A 1XILA 2H89C 1SQQE 4B3SO 1S4XA 1DD4A 3GHGA 1TGOA 4PD4D 4LCUC 4MVOA 1D2DA 1ZV8A 2ZDIA 1G1XB 2KLVA 4IIJB 2E74B 3FAVB 3TXQA 2XV5A 1RF1C 2FYZA 1SQVD 3SSUA 1T2KC 5L3EA 5KKZB 4JASA 4R4MA 2AXTE 3FYEB 2QTSA 1OJHA 2BOBC 3H1JG 1VF6A 3DSQA 2Q6QA 3N4XA 1R5SA 3S3XA 4MN4C 3WG7C 4DUYO 1VQOV 5B3SC 4O4HA 2PZSA 2Y9YA 1VEWA 2Y0EA 4JI2O 3N2GB 2QM4A 1X22A 5LP6C 1OXZA 2WSSG 4PV1B 2KUBA 3K79A 2JO1A 5AW3B 5AW9B 3SPHA 3AE8C 1FXKC 3HB3B 1JNMA 5EZYA 1ZLZA 3A0HE 1BMFG 1L0NH 4X65B 1IFMA 2Q7CA 1L0NG 5APXA 3CB2A 3HUSA 1NTZJ 2FYNB 2W8ZA 2LR2A 1HTLC 3ZDMA 3CPWO 1L1FA 3U1CA 1EDLA 4J7KA 3AG4B 1NH2D 1GL2C 2P10A 5AW5B 1AI4A 4X20A 2QJKC 2FYUH 3H1KH 2WSSH 3G80A 4DV7O 1FC2C 3H1ID 4X1YA 4UV8A 4IL6X 3V2NA 3ABTA 3HKCA 4GX1A 4U3FH 1LT9A 1P84H 3AG1C 5HFMA 4NTXA 5CCHD 4GOFA 1Y4MA 2P22C 3JD4A 3CWBE 1WMKA 2ZCEA 4WFEA 3VQXA 2DYRB 2X6AA 2BASA 1KC8Q 2MJZA 4JI7O 4J7JA 2KKWA 1PGQA 2XKMA 2WA3A 2HYNA 3V4WA 3FX7A 3IF4A 1X79B 1M1KW 5CB4A 1I0HA 4L8JA 2JEEA 3P8CD 2JEUA 4Y99B 1NO4A 2HEPA 1NAYA 1OCCC 3CC7P 3D3QA 3A2AA 2EINB 3KCXA 3CE2A 3B8MA 2UUCO 3ABLB 4PV1D 4YIPA 3ZMSA 1SQBG 4C46A 5CA1B 1X9VA 2P1JA 2FXPA 3A0HH 4JQ0D 1ZRTD 1GO3F 1PIXA 3UM7A 3M99B 4RJTA 5L3FA 1YTFD 2UXCO 2YIBA 3AEFC 1W2BU 1U97A 3FGAD 4HYTB 5K1PA 2WAMA 2QSIA 3N2KB 2P5OA 1R6NA 5EIBC 1TVKA 2YIUC 2A45I 3UQ8A 1IVSA 1L4AB 2LO1A 1SQXD 4EDFA 1E1QG 1XTGB 3M9BA 1YTZT 1VQ6P 2WMMA 1M5IA 2W27A 1O9GA 4QE9A 2PI4A 2QWNB 1M1JA 3ZHSA 4J80A 5KUKA 2A45G 1ZUQA 3I5CA 4WFGA 1FS0E 3L75D 2X7RB 3KXDA 3V6IA 3QTCA 2YIAA 2OTJV 3LW5J 1H2KA 3KYQA 1FFXA 1JFFA 2XTAA 2J58A 5J9PC 1JMBA 2F23A 2NNUA 3ZRWB 1M4UA 4RO0A 1EZVI 1RF1A 1N4CA 1CW5A 1OW6A 4JF7A 5JH7A 2ZT9B 5L8RJ 2YI9A 2PGDA 3V4QA 1VQ7P 5LMUB 1OCOB 3OMAB 2AEMA 4D6TD 3H1JD 1F4MA 2ZR2A 3E86A 4MVQA 4RESB 2BCCH 1KYOI 2GUSA 3H25A 5JWPA 2YEVB 1P49A 1EXJA 2DW4A 2Q67A 2BCCE 3E22B 4UCUA 3JSLA 5IE9A 3P8CE 4CC6A 2HVKC 1B3QA 3EFFK 3OW2O 1IFJA 4MSWC 3JAWB 1SFCA 1VQ9V 3AK2A 1IZNB 4D6TH 3R65A 2CPSA 1LGHB 3H1LD 3R2PA 4HH2A 4GKKB 3CCMP 1NWQA 4O2AB 1HNXB 5ITZB 4DV4B 3L71H 1LTJB 3RYHA 4JYAB 5B5EE 3LDEA 4IHJB 1BE3G 1KB9I 3HUSC 3MHSC 3ZHTA 2FMLA 4WBNA 1SETA 4H33A 1KFMA 2R5DA 1D7MA 1SF9A 4AQYB 3N2GA 1J2JB 2K1AA 4QNHB 1JQ0A 1PD3A 3T1YO 2E75C 1YI2P 1GTOA 5LL6Y 3B77A 1HJBA 3JALB 2BOCC 3FB7C 5H5NA 2DYSB 3HE4A 3CD6V 1N33B 1U96A 3ETGA 4NPDA 1YEWA 4DV5B 4B7KA 1XQ8A 3ML0A 1BQZA 2FYUD 1M56D 2F43G 3K5OA 2OQQA 4WBAA 1EM1A 4DZOA 4MVUA 1I5XA 1S76D 2XT9A 1NU1E 2WPVB 2Z5HA 2VQEB 1Q5OA 4TUYB 1S9KD 3EXAA 1R73A 2UUAO 3IN6A 3VMAA 2CTPA 2WSCJ 1FOSF 2HVJC 5JH7B 4DR1O 2FL4A 1NH4A 2YC0A 2HLOA 4UVAA 3LSQA 1IC2A 1J5EO 4JI0B 1AP6A 1XL4A 3CXHF 4XDKA 3RGBA 4F6EA 3J80N 4JV5B 3TGUH 1BCCD 2WSEJ 3P7KA 1YJWP 3IAOA 1DEEG 3L4FA 4RAIA 4I2LC 3BEHA 4QJFB 4XDLA 3G4SP 4L87A 1KD1Q 5IYZB 4WY4B 4B86A 4O9BA 1QVGO 1VQPV 1P84F 1KORA 2QSAA 1ZW0A 3CWBG 1GL2D 2XUMA 2QGNA 5EYPA 1H2NA 1EDJA 1OFCX 2DE0X 2W6JG 4LF7B 1SQPE 2R70A 1GKFA 3AEAC 5AVVB 4YXDC 1OV9A 1XNQB 3B4SA 1IO4A 3G3ZA 4WB4A 1JB0J 3K57A 1GD2E 2FXOA 2M0BA 3WU2Z 5CA1A 1Y76B 3RGUA 3CHXA 1WPXA 5KHGA 1E79H 3FYIB 1Q86W 2ZIOA 3STLC 2LGQA 5L3CA 5B66H 5AW4B 3D70A 3S4RA 1NTME 2R72A 5AVZB 1GM8A 2CK3G 5J2UA 5KTBA 2CH7B 3RT3C 1NKNA 2ZE8A 2QIWA 3RWRD 2BTOA 3ASNC 3HE4B 3ETEA 1Y8AA 1VQ4V 3L70G 4JI2B 5LGUA 2JGUA 2JGDA 4CS2A 1JMMA 2CGOA 1SFCD 4WY4D 4FMTA 5TISH 1VQLP 1BSMA 1V55C 1OHHG 5LYJB 2FBWC 3RK2D 1N7LA 2K3RA 3IGAC 3BVHA 3EQ2A 1LTSC 1R5LA 4UB8E 2HODA 2OTLV 4W80A 2YI8A 3RYIA 3L73J 4JI3O 1NT2B 2KSDA 3B8NA 2GA1A 4CS3A 3CCUP 2JP3A 1JUNA 1EZJA 3DGEA 4ZIBA 2YXLA 3TDKA 1EN4A 4DV5O 3VP8A 1YBKA 5EBLC 1X59A 4ZMDA 3WMM0 1N0NA 2MW2B 2PUSA 3B40A 5FPOA 3U11A 3K5NA 3F89A 1RF0C 4H37A 1KILC 1BGYG 4FK5C 1KILB 4BRYB 5CBNA 4RQEA 1GN2A 5IY5C 1BSHA 5KLVG 2BE3A 1NTKK 1W59A 5KMGA 4DUZB 2H88C 5CJ0A 5EYPB 1WP8A 1T3UA 4DOJA 3VTPC 2KNCA 4I4TA 4HKZH 4CC5A 1YITV 2R9RB 1KYOD 2KG7B 1CI6B 3JC22 4C7RA 1GW3A 1YIJP 1PV0A 2IBZD 1F51A 2W6AA 4JI1O 1N36B 2HFEC 1M56C 1V55B 2QWQB 3G9RA 5J2UB 5LA6A 5AW8B 4WBNB 3CPWU 4IOIH 1NBMG 3W7SA 3CCLV 4MVMA 3HD7D 1RM1C 2IBZH 3THOA 1AVOA 4U7NA 4WFFA 4U3FD 1P84D 4NR1A 1SQPD 2V7QJ 4O4LB 3C90A 1QVGU 1F7YA 1EZVE 2OTLP 3JD0A 3O65A 2UUBB 2W6IG 3L9DA 2ZNJA 2HODB 1L0LH 1U7JA 2ZYAA 1MZFA 5CJ4A 2YO3A 4N23A 1NTZG 4I9WA 4JAUA 2ZXWC 2B88A 3I56V 1PZQA 2E76C 1KV4A 4Z1VA 2FXMA 1HGZA 1PL4A 1S3JA 1NH2B 4QPKA 3QWOC 4O2BA 2LW7A 3A0BZ 3I55P 1F23A 2EIKB 4AILC 3SFDC 1BGYD 1R6KA 3OMIB 1AI5A 1KILA 4BRYA 1QL2A 4FPPA 1N86A 1UJWB 1URQA 3JSNA 4JI3B 2P7JA 4BXLA 1DD3A 4R7CA 4DR3O 4DV2B 4OPAA 1FJKA 1YSCA 2QG4A 1Y66A 2QJKB 3CXHI 3KZIZ 2IH3C 2QKCA 3CCSP 1QL1A 1CPYA 3EVKA 1GAXA 2A06H 4C7UA 1JCDA 2BSKB 2PI5A 1WJZA 1XNRB 3VOPA 3AE5C 3MTUE 1WLEA 1TAEA 3JASB 5IYBO 1FAVA 2LW1A 3FB5C 1Y76A 1FXKB 1XHXA 4DK1A 1LR1A 5AVSB 4P9OA 2IU0A 2FYUK 1H8HG 4FFBA 3F5HA 4LF5B 3AK1A 3LDCA 3W68A 4U3FG 5DEDA 4DK0A 3K06A 1KILE 1ENVA 5GTHH 3WU2H 5CCGD 3TK1A 1LUWA 2R9AA 1WN7A 2XAGA 2Q3EA 5B66Z 1MFTA 2Q0OC 1J1EC 2KK7A 5DJTB 3SPJA 1ZWIC 3OW2U 3BHPA 3EWKA 1RE3C 1DEBA 5GONA 2QJYC 2PTMA 5C8YA 5APQA 3OD4A 1T5EA 1YHQP 5BZBA 1LTJC 1ZR2A 4MW8A 2ZE6A 3MHHC 3BPZA 3QO8A 2Y0CA 4EKWA 1IK9A 5KKZC 1PNLA 4YJ3B 1J95A 3IC7A 3CX5D 1RF1B 1GN3A 1M9NA 3BABA 3W7TA 1G8MA 2WPSA 3K08A 3HD7B 4MTGA 1L0NK 2ITAA 2AXTH 1DTOA 5JCOC 2IDBA 2PRRA 1TVKB 3K9AA 4YY3O 3L72J 3G6EP 2IYOA 2RCVA 3HTKB 5GTIE 2QWOB 1SQBD 3O9OA 1URQB 3T4ZA 4L73A 1HW7A 4GLXA 4PDRA 2Q5ZA 4ZOLB 3JAKB 2A06E 3GLMA 1Q90D 2QM7A 1KYOF 1Q6UA 2QDOA 1USDA 3GF3A 2WPQA 1FJGO 3SGIA 3UKMA 3V2RA 1Y74A 1LWUA 4JI4O 4K0KB 3CRMA 3S3WA 1YVWA 1GU4A 2CK3H 1AJPA 1AI7A 4X1YB 4NXMB 4PDVA 2Q68A 2OYHA 5B5EZ 1VARA 4LGDE 1S72V 3AG3C 5E1AC 2PFXA 2EIMC 1TUBA 1S2EA 3KG2A 1W5CE 2EIJC 5LBQA 2FB5A 2WQYC 1OVVA 1QLNA 3MP7B 4GT1A 1NTZD 1M7LA 2YIUB 2EZOA 4PI0A 1KECA 5KLVK 1VQPP 5AG2A 1VQ8V 3A5TA 2W0FC 1EQ7A 1IBLB 4B3TO 2QWRB 2EIKC 4E2LA 3T97A 5JCOA 5TISE 3V2PA 3K04A 2QEXP 4I1LA 2H8PD 4J9ZB 1SQPG 1EN6A 1LTJA 1S5LZ 4K0KO 1SQXG 3ZN1A 4DR1B 3H1HE 1MG1A 1K97A 3B09A 4I50A 3JCZA 1HVVA 3ZHQA 1N8RQ 3M9HA 3Q5RA 1H2LA 1GL2A 1L0LG 1V54B 2UXDB 1IXMA 1V54C 1QLED 5AVUB 4X62B 3CC4V 3SJAC 3TJTA 3L35A 2ZINA 4K8XA 1KU9A 4ZI7B 3L72E 3H1JH 3CRQA 1IBMB 3QO5A 2NR5A 1IK7A 4UUJC 2ZDIC 3UT5B 2DQ0A 1RSOA 1M90Q 4PI2A 3BAAA 4LLHA 4PD4H 2X0LA 3AG1B 4LFBO 5KAFE 3CRCA 1M56B 4R6ZA 2EIJB 3B71A 4CS4A 4ZKIA 1VQOP 2EIMB 2Y48A 1H2SB 4JTDB 3SYAA 4U7OA 3AG3B 5B1AB 1YJNV 3BCCH 4Z1MG 2O01H 1SA0A 3RL0g 1HNZB 3A3YB 2WPRA 4BIZA 3CD6P 3H01A 5CHXA 3L74J 3AE2C 5H9CA 2OTKE 1NTKD 3AE4C 2KQXA 1WT6A 2H43A 3HKBA 1SQXJ 5H2FZ 2WPDG 4GUNA 2HLDG 1K9MW 2XAHA 1IBKO 3Q5PA 4NTWA 4I9QA 3CXHD 2UUCB 5JJJB 2QM8A 4UCVA 5AW0B 2UUBO 1FBMA 5K5GB 4JI4B 1P7GA 2FTKA 1I08A 3UCSC 3T97B 4LNUA 1TUEB 3FD9A 1EC5A 2OGUA 4JYCA 3TCUA 1AV1A 4LFBB 5BXZA 4PV1C 3Q1MA 4LF5O 3OFNG 1B6QA 3VQVA 5LP6B 3OEHG 2UXCB 5APVA 2E5LB 3K03A 3SJBC 2KXPB 1ZSPA 4EB6A 2R3SA 1KKCA 4LF9O 2N74A 3H1KD 4CH3A 5B3SB 4JYYA 3WG7B 1NJIW 1VQ5P 5LXTA 3HD7C 2OIEA 1HNZO 2Y4UA 1QX8A 4D6TJ 3GWOA 3Q4HA 2ZXEB 3RYHB 4DV1B 1IDSA 1GZLA 1KN7A 3HRNA 4W4KA 4DR5O 4L75A 4CPGA 2BCCG 3AG7A 5JVDA 2B87A 1Q6IA 3C3SA 4JZGA 4PA9A 4X8AA 4CH4A 3A8TA 2E74C 1GH6A 1SKVA 2FKXA 2G38A 1ZAUA 2O57A 2QJYB 4AYCA 3UT5A 1AJNA 3IJ4A 2WVRA 1KQSO 1FS0G 2QTOA 4OX9O 4DUZO 2YIDA 4AQYO 1WRGA 5B66E 1LJ2A 2E74D 3L74G 1J1EB 3JALA 4LR3A 5LOVA 4DV6B 2KSJA 4U3JB 4YXWG 2Q5UA 1Y67A 4J41A 5FL7G 2D2CC 1SRYA 3E2EA 4DCKA 2K88A 1A02J 3BFRA 2Z3YA 4DRXA 3ABUA 3L75H 1SQPH 4I55A 3CCEV 3RL0B 2MKVA 2OTJP 1AI6A 2B1GA 4B08A 1S5LX 1S1CX 1N7SD 3F5TA 1Y74B 1LWUB 1Z56A 5KUMA 1JY2P 4LF6O 1LP1A 3B5NC 3CWBH 3CS5A 2N1TA 4GIFA 4ASUG 1Q7YW 1JM0A 3B2EE 3JCUE 4G27B 2P06A 2WT7A 4KXRA 4OGQB 4X64B 5LA6B 2L35A 5CA0A 3CC7V 5KAFH 3M91A 1K3EA 4UXNA 3LSSA 1EBOA 4JI0O 3L72D 4XE5B 4YXWH 2FYUJ 3GHGB 1MNGA 2M3EA 4LNUB 2M3BA 2N9YB 2WSEH 3G71V 2XASA 3O6QA 4IL6H 3FAVA 2Q0AA 1SQBE 2ZD9A 4U3FJ 2KG7A 1OMIA 3H1HD 1SQQJ 5K1XA 4MVRA 3G4SV 2IJKA 4ZKPA 1E1RG 5BVZA 1RPOA 3H1HG 3L70D 1FZBA 1Q82Q 3VQYA 2GUZB 1GTWA 1DX7A 1SQBK 2CUGA 2Z0AA 2PP6A 2E76B 3CCVV 3SPIA 2ZXWB 1BDDA 1L4AD 2DJVA 1XMQB 3H1HH 2K9JB 3CCVP 4N21A 3N2KA 1JR9A 1KZUB 2RNBA 1H0TB 1G4YB 3J7AU 2N1TD 5EK0A 2DYSC 2P4KA 2J59M 1Q81W 4DV4O 1T2KD 2ZKOA 3H1IJ 4Z2WA 5AVXB 2XNDG 1JOYA 1QVFO 2Y0IA 2E75B 2YS8A 3AEDC 4P9PA 2CTWA 3RK3D 2CAZC 1D5AA 3GF7A 4EFBA 4G28B 1RM1B 1JMKC 2FKWB 3SYCA 3HUSB 4DUYB 1K05A 4KHPO 1FFXB 1FE6A 3CJHA 2JIZG 4EEQA 3QG5A 3ZRWA 5FNVA 1VQ7V 4IYIA 5CBOA 4RWUA 1EDKA 1NTKH 1BGYJ 2M6YA 5D5PA 1CZQA 3NR7A 1QLEB 3VP9A 2F4VO 1TU3F 2JWAA 3CCJP 1RHZB 5DN6G 5LHGA 2M8RA 3T4DA 4FFBB 1FAFA 3RYCA 1G2CB 1IXBA 3H1KE 3H1LG 2KSEA 4DT0A 2F66C 4HB1A 1NOHA 1EDIA 4BIUA 2WLLA 3OEEG 3CCMV 3M0DC 2GM4A 3JCUH 1K4DC 3PN1A 5IY5B 3P30A 4TQDA 4WCEV 3HKDB 1NU1J 1H8EG 1OCOC 1JY3N 1SQXE 4OWFA 4G2KA 5GONB 3ZMTA 1QR8A 3BA8A 1VF6C 3GG2A 1SQQG 5ITZA 2BSKA 1I94B 1SQVK 2KS1B 3H1IG 2BTQA 1K04A 4DV0B 2QKSA 3TXSA 2ITCC 3AECC 3T1HO 1VL2A 3KZIE 1KILD 2AEJA 1L0LD 2DOSA 1BHAA 3LNMB 4HBNA 1N32B 4MTFA 1VQKV 4JI8B 1HGVA 4PHZA 1VF5D 2IJIA 2E5YA 1ZR4A 2YUAA 2Z5IA 4GKJO 5AVRB 4AUWA 2CPBA 2XNXA 1PGPA 1KMIZ 2ILMA 3SPCA 1SQVH 3CC2V 2ZVOB 3ASNB 1SQFA 5IJ9A 3C1LA 3Q2YA 3OGIB 2C0XA 2EZPA 3Q5SA 1JEKA 2N04A 1GMGA 3UO3A 1JTHA 3D6ZA 1VQNP 4X1IA 4CH6A 1Q8IA 3AE3C 3OMNB 2C9NY 5BY1A 2HPCB 2VRZA 4I55B 4DV0O 3CC4P 1XREA 2AXCA 3G71P 4I0XA 1BS3A 1NQTA 1VQ5V 4B3MB 3ABLC 3RBXA 3A0HZ 1K73Q 2RKLA 1ROPA 2FY8A 1OCCB 1M1JC 3RW0A 1ZP0C 4J7ZA 5KX5B 1VF5B 4A5UB 2RJZA 1N32O 4Y99C 4O2BB 2WA4A 5E79E 4MTXA 5CBHA 1W2BO 2VS0A 5CCGC 3ABKC 4OXSA 2Y9ZA 3JARB 4TV9B 4PDLA 1EXIA 3CXHH 2WSCH 2VQFO 4DW0A 4WY4C 2VRSA 4GYCB 2JK5C 4WFBV 3CCRP 5L3BA 3Q3DA 3E8HA 1FYJA 4ASWA 1AJQA 2G3AA 4NKGB 4JI7B 1IBKB 2XHBA 5EBWC 4EYYQ 1YQ4C 1K5SA 1CEZA 2KB1A 1KYOH 3SPGA 3PTZA 1D5NA 2GTSA 3RN4A 1MUUA 3VQWA 4IL6Z 3AG4C 1GL2B 1E5WA 2Z4EA 1HF9A 1KP2A 2JKVA 1U57A 1URQD 3QO7A 1LTAC 1X8YA 2YKQA 1S0VA 1BE3H 3I5DA 3PP5A 5KLIB 1K92A 4FZ1A 4B3MO 3CC2P 4TT3G 1PP9J 2XAQA 5EC1C 1HNWB 2IW5A 1RQVA 1M90W 1JO5A 4JTAB 1RSOB 3STZC 2OYIA 2JGDB 1I5YA 1BT8A 3OTOO 2LFSA 5IJ9B 4M3LA 2WTYA 3CEIA 1NR7A 3RL0D 4AHCA 1LT9C 1BCCG 3CX5H 2Q9IA 2WLHA 1SQBH 4NPFX 4NVPA 3RYIB 4B3RO 3TGUG 1I7FA 2H3OA 2HPCA 4BAYA 3K58A 4GX5A 3CP1A 3CJHB 3EFGA 1K34A 2YKPA 3WB1A 3BASA 2P67A 4GKJB 4FM0A 1LTBC 3ZHVA 2QEXV 4KP4A 3ZN0A 3FXEA 3CYOA 5KLVE 1DF5A 4FVMA 4UCRA 4ZNCA 2IJJA 4KL1A 4OGQD 1BGYE 4LFAO 4FLVA 2JVDA 4RUFA 1N34O 3L73H 3MD0A 4GX2A 1Y47A 5CCHA 1BCCH 1KTMA 4WWIA 4TV8B 3M06A 5LMNB 1OX3A 4DV3O 5BR8B 2WLLB 1PPJD 1H89A 3ZRVA 1HNWO 1XDCA 1YIJV 4MT8A 5GTIZ 1WB7A 1CI6A 3FWNA 3IR9A 2R32A 3K0DA 1OIPA 3APQA 2W6JH 3JCUZ 2HJFC 4DV1O 1BSNA 2KB7P 3BATA 3IFMA 1SQQK 1IZ3A 1NR1A 1Q43A 2LJ2A 2NLJC 2YSUB 2Q9LA 4X1KB 1NTKG 2ZT9C 2P58A 2OCHA 1NTZH 4JTCB 1SQVE 5DECA 4PA3A 2Q69A 5JVDB 2B87B 4PD4F 3L70E 3PLNA 2R3CA 4OX9B 4NXMO 3BA9A 2IX7C 2ZYGA 1NTMK 1PNMA 1THZA 4N6JA 3BRTB 2ETNA 3TGUJ 4J10A 5LMUO 4DR4O 3H1KJ 1FZAA 4XFJA 3TSIA 2WLJA 3DTUB 4X66O 1L4AC 4JPZB 4U3JA 1OWAA 3HPLC 1PM9A 5IDJA 5LXTB 1NTMH 4F4LA 2CGNA 4GOEA 3UO2A 3VYIA 2N9BA 3WUTA 4D7SA 3MUDA 3BVOA 3P3PA 2WWWA 3U59A 3CL3D 3CX5I 4JAAA 3C3TA 1US6A 4QIWF 4H44C 4X64O 1MZ9A 1U7MA 2DQ3A 2YMYA 3CCQV 2RDCA 3C8VA 1NGMB 2Y69B 4JYAO 3TF5A 4TOIA 4DR6O 3BCCD 2EINC 4R4LA 1FJGB 4EI2A 3H1KG 3H1LE 4Q6GA 1L0LJ 1PPJE 4QMAA 4IFMA 4BIOA 3MHVA 1G6UA 1Z5VA 1KB9H 1SFCB 4PJ0H 4XDJA 5C93A 3B5NA 3QH9A 3L37A 2YXYA 2IZ1A 5M1BA 3E35A 1PKXA 5D5QA 2DYRC 1GK4A 4I4TB 5TISZ 3DXRA 5CA3A 1Q81Q 2QJPC 1JCCA 3E89A 3ZMZA 1XTCC 3I55V 2KZIA 5IWAO 3L73E 1N7SB 1GM9A 1N34B 1M1KQ 1IFPA 4IHJA 3HKCB 1AR5A 3KCYA 3CMEV 2K9JA 3CX5E 2ZYDA 2UXBO 3L73G 4OH8B 2NPSC 1JCHA 2V7QG 1MA1A 3LW5H 3ZIAG 2M5AA 2PGGA 4GCZA 2ARHA 2X6BA 1H0TA 4JAVA 1M57B 4H0LB 2OYOA 2FYNC 3AG2C 3L74H 3SR2C 3AEBC 4PA7A 5BU8B 4QPJA 1UIXA 1N73B 3SYPA 4EIJA 2VWJA 2L5GB 3L70J 3RK3E 2BEZF 1J1DC 1HUCA 5B1NA 1BE3E 4DV7B 2KOGA 2BCCJ 2IFNA 2Q4PA 4X9QA 4JI5O 3RK2B 2JS3A 1MFZA 1ZX3A 3L74D 2YO2A 3OTOB 3JD1A 1L0LE 1FZEA 3LSUA 4IFDK 4FLUA 5JJEB 1RP3B 2HHHB 1RE3A 4D7TA 2O1JA 4X66B 2I1KA 1Q6HA 3AE9C 2UXXA 4RKUJ 4AI8A 3ITKA 2K37A 3HE5A 2HKOA 3FKSG 4DR5B 1YZBA 4D6TE 1S5JA 2UXBB 3S1KA 3II6A 4X62O 1KD1W 3L71J 1N8RW 2Y0PA 4L76A 2OCCB 1OCRC 1LT1A 3E7KA 3H1LJ 3E8BA 4I7ZC 2ODMA 1LTIC 2Q6AA 3KPEA 2F95B 3A0RA 4H44D 1YTZI 3N7NA 1YJNP 4XA4A 5KJ7D 3P8MC 2CTQA 2X6CA 2KYVA 2EJRA 2KS1A 2PYLA 2P4VA 3OAAG 1DF4A 1RY3A 3TNUB 1SQXK 5GTIH 2ZXXA 1M93A 4PD4I 2B9ZA 1KB9F 3RYCB 1G2CA 1M57D 1T6AA 4C7NA 1AJYA 1QCEA 1YQ3C 1L8DA 5CA0B 2A06G 1PFIA 1ZRTE 3M0DA 2XDJA 3BRVB 3ETDA 3A0BH 1IFIA 1N2DC 1VQLV 1MV8A 3ICXA 2W0XA 1NHLA 4Y28J 3SWKA 1VQNV 1G1IA 4DR2B 2SPZA 4X65O 1CP9A 3JYCA 3QNEA 3VOUA 2Z5UA 1XOUA 3VMXA 5EIBD 1PV3A 5AVQB 5C8YB 4UB8H 1X0TA 2EILC 4UFZA 1JJ2U 1R3IC 2ZIMA 3N27A 4O4JA 3E8GA 1SZXA 1HWTC 1Q82W 1WA8A 4FZ0A 3ZEDA 2E42A 2Q73A 4F6RB 5KJ7C 2DN9A 1PP9G 3CCLP 2WLIA 3E8FA 5LGNA 2JJ1G 1OW8A 3ETQA 3HE5B 3OR6C 2BCCD 1SZTA 5B1OA 1WAZA 2IYPA 4JGSA 1KB9D 4KT0J 4XBFA 4DR7B 4YHHO 4JYBA 4MW3A 4UB6E 1SQQD 1K33A 2AZ0A 1XUQA 2B1IA 4X88A 5GTHZ 1WNSA 1IX9A 3ZCCA 1VP7A 3AE6C 3M9QA 1MZEA 3WU2E 1FJPA 2KNCB 2ZM6B 2YNYA 2F1MA 4MVZA 3D6YA 5KLVJ 1NVPB 2D2CD 2QA4P 3ZJZA 1Q86Q 4PJ0Z 2IFMA 1NTKE 3DXRB 4I6MC 2ATKC 2I8DA 1R3JC 3TNUA 2OCCC 4PA4A 4DV2O 3M7MX 4DV3B 5BR8O 5KX5A 3BRCA 2W6BA 1FZFA 1GN4A 3GW6A 4JI6O 1JY2O 2I1JA 1HP8A 5KAIE 2RMZA 2QR4A 3BCCE 2RQ6A 4H13C 5AW6B 4N78D 5CMZA 1SS3A 4W4LA 4Q20A 2ADQB 2XAJA 2WSFJ 4DXWA 1NI8A 1YDXA 3ABMB 3LNNA 2O01J 2WITA 1G1JA 3LIEA 3RK3B 2OYIB 3L72G 1YJWV 3LUTB 1K9MQ 2FYUG 4YIOA 1ZL8A 1YF2A 2O1KA 3PHLA 5IT9N 5H2FE 1WB8A 1PNKA 1R3LC 4FIPC 3W7XA 3TYYA 1FDIA 4BWNA 3U0ZA 4KJMA 1YXBA 3K5MA 1FFTB 1T8ZA 2ZM6O 3V5BA 3O8ZA 3H1JE 4I50B 1YJ9V 1N73C 4EOTA 1URFA 1K7DA 5BMVB 3EHBB 1GW4A 4H0LC 1R3KC 3F7VC 5B5EH 4LF4O 2V4HA 1AVMA 3ABMC 2UU9O 3RK3C 1L4AA 1EZVH 5C39A 1FD9A 4X89A 4JI6B 4HZ3A 2HG5D 2VQEO 1FXVA 2NPSA 1OW7A 3CRAA 3T1CA 4H13B 4LBEC 3OTFA 2WLNA 3ASOC 3WUVA 1YHQV 5TJHA 3OR7C 3MAQA 2F4VB 3E1RA 1AB3A 4JV5O 4NPEA 2GHYA 1OVUA 3BY6A 3X2QC 1YYCA 3UIAA 5AW1B 4B3SB 3FB8C 5J2TA 3MIWA 2WZ7A 4UCOA 2IH1C 5KA5A 3USSA 3ZRSA 2XZRA 4NXNO 1SFCC 4CBCA 2LFRA 1SA0B 2OYHC 2P7TC 3JASA 1GDTA 1DLBA 4FLXA 3D71A 5JJNB 2BEQD 4LFCB 4LF7O 5B1BB 2A45H 1RE4A 3CMAP 2Y69C 3CCUV 2J5UA 3CXCU 1LTTC 1IBMO 3L75J 4CH5A 4IFFA 1PL0A 2POHA 4TV9A 2QE7G 1N36O 5IJ0B 1FZCC 5APWA 2IPPA 1NU1K 4FLWA 1NS1A 1RQUA 3PH0A 3JD3A 1WP7A 3CWBJ 2K9PA 3L71D 3FB6C 3FFQA 3OUFA 2ZE7A 2B5UA 2RMKB 5A2QN 3MGNA 4H0LD 1FKAO 3W7UA 3VN0A 1HJ0A 2HR3A 1NZ6A 2H8PC 2VWKA 1NKDA 2EILB 2P6JA 1UPGA 5APSA 1YCIA 3JD2A 4WFHA 5AVYB 2DWEC 4JZ2A 4YJ3A 3G6EV 3IAYA 4DR2O 3AK3A 3QF7A 1XL6A 3T2MA 2FFDA 3B5ND 4BWAA 1GK6A 4LF8B 1FDMA 1HR0B 4W7ZA 4B7EA 4YPCA 4KFMA 2QJ1A 1QR9A 4UB8Z 3W67A 4BW9A 2WLIB 2R9IA 5H6RA 4HJGH 1ZN5A 3AE7C 2YXRB 3KDPB 1ZMEC 1SVFA 2ADPA 1XEQA 3FWLA 1FOSE 1SS1A 1FXHA 3AEIA 4DYLA 2KI7B 1H38A 3JAKA 2QWPB 4LF9B 3SYOA 4RO2A 1EN5A 4H13D 5LOVB 1KQSU 1NTMG 1MKMA 1HDJA 3KKYA 1NTZK 1W0JG 1Y6XA 2G8YA 1HBWA 4DRXB 1S72P 3ABVC 1JX9A 1N7SA 1LNQA 2YMKA 2A9HA 4LF8O 1P84E 3OA7A 3OM3B 1OCZC 4IT5A 3NMDA 2N1TB 2AZ2A 3NFQA 1OCRB 2PF4E 3MZWB 2EX3A 1N0JA 5APUA 5IJ0A 5IYZA 1FZCA 1BGYH 1AQTA 2ZAEB 4QGPA 4LWSB 2E5TA 1I94O 1KBHA 3JAWA 2ZVNB 2N1TC 3KQGA 1OCZB 3L72H 3P3NA 3CMEP 3WUUA 1BCCJ 4PD4E 1GN6A 4I5SA 4O2AA 2FYUE 2Q7GA 3BCCG 4Z1MH 1DIPA 1VIBA 1JY3O 4W7YA 2BTQB 3RFRA 3HKEA 5FLXN 4YJ2A 3RK2C 3AEEC 2FFDB 2Q7EA 3GVMA 1SQPJ 1AFOA 1BHBA 1FDOA 4FFKA 1NU1H 5L3GA 4ZI7A 1Q3EA 1L0NJ 1SERA 2CH7A 5KHHA 4MS2A 1BQ0A 5KLIC 3RVZA 1PGOA 1M57C 5AVTB 3L36A 2A0LA 2IZ0A 3L71E 1JY3P 2QVAA 2JDIG 2NPSB 2OARA 1T3JA 1NVPD 1P4RA 3L74E 3OGCC 1NYHA 1S77D 2OIGA 4X1IB 1VMGA 3KHUA 1NAFA 1SLQA 2HG5C 1E79G 2YXHA 2M7WA 4X20B 1IURA 1L2PA 1JA8A 1VPCA 2ITDC 2YXQB 3A0BE 2IM9A 5CN0A 2E5LO 4UVCA 1VQ8P 1K5QA 4GZRB 1K73W 1K8AW 2GUVA 1BE3D 1NTMJ 1PGJA 2Q1KA 1DK1A 2OWOA 1B06A 3MDSA 4TSFG 1A02F 4E4EA 3NXSA 2KIKA 5EFWB 2A79B 2YDEA 1PP9E 4RQFA 1MSWD 2O01N 1VF5C 3H6PA 1FZCB 1NKZB 1M8OB 1OZ0A 1HNXO 2Y0DA 1RH5B 3JATA 1R1BA 3L73D 2E76D 4PJ0E 5B1BC 5E79H 3H1IH 4KHPB 4ZOLA 2W90A 2E43A 3CRRA 2JR8A 2JDIH 3V2QA 4DJGA 4EB6B 2IBZG 2IBZI 5CCGA 3L75E 1EFRG 2RN0A 1SQGA 3FX0A 1B04A 5KA6A 1GK9A 1KQFB 3SWFA 5CMUA 4YY3B 4O4JB 4U7JA 3ZRXA 4DR4B 4NTYA 5L3DA 3MUDC 2GV9A 3TETA 2DWDC 3SDLA 1NTKJ 3SWYA 2IJHA 4AQRD 4HYOA 1TUBB 4LP8A 4YHHB 1NJIQ 1NVOA 4EFEA 1PL5A 2M5AB 1BDCA 4ASVA 3CCJV 1ZLLA 4K8ZA 1HWYA 4HAMA 1AA0A 4TWKA 1XBLA 4IIJA 2Q7HA 2D3OW 5A9GA 4JPRA 2UUAB 1RE4C 1N73A 1JVMA 1Z2GA 4LC1A 3GMAA 1QGKB 2QA4V 1QEXA 4BW5A 3KZIH 3K9SA 1USEA 1RFYA 4TT3H 5DM6V 1SQPK 2B9BA 5KJ7A 4DR3B 2UU9B 1KP3A 4ABMA 3D8CA 2C2AA 1JFFB 5KHIA 1F4NA 5KHKA 2A06D 1GM7A 1ZTEA 1COWG 4LFCO 1P84I 1JOCA 3ZMUA 5IYCO 5LGTA 4ZHQA 1DGSA 3CCRV 5KLVD 4O4IA 1LP1B 2FFDC 1QQCA 2AHZA 4PDMA 1MABG 4P2ZA 3SJQC 3AEGC 4D6TG 1RF0A 1JPXA 5EC2C 2WT7B 1RPRA 1TA8A 2YEVA 2OYIC 4IYHA 4JF3A 5KAIH 1AROP 5CBFA 2RN9A 1QU7A 4JI8O 5APYA 4TV8A 1CSBA 1H88A 1YTFB 1QVFU 4GKKO 2IU3A 4DW1A 3RYFB 3SYQA 2P90A 4GX0A 3O6QB 4DR6B 3OT7A 1PP9D 2UXDO 1IFNA 1HR0O 1KB9E 4J9YB 2JS5A 4X1KA 1AR1B 1FPOA 3F5WC 1NU1G 3H1LH 2V7QH 2C0WA 1SP4A 2AXTZ 1W2EA 1FXKA 2ZR3A 2YKOA 1LT9B 1JJOA 1QNMA 1P7BA 4UB6H 3IFXA 4C7NB 3K0GA 3R4YA 1AILA 3R66A 5LHIA 3ZMVA 3D3IA 3W7WA 1Z5WA 4J11A 2KLUA 2H94A 2R44A 3G6BA 5CB4B 1ZL8B 5F2VO 4WFAV 3K59A 1L0LK 3NTNA 2L91A 1AQ5A 2ZQMA 2GDSA 5LP6A 3FXDA 1Q2NA 5KHJA 5AW2B 2QRXA 2AW9A 4OPHA 4OVNF 2F93B 3SJCC 1Q7YQ 2XNDH 2YIBD 2ZT9D 1SC5B 3Q4HB 4O4IB 2IBZE 1X4TA 2B89A 3HD7A 5JQGA 3WB2A 2O3JA 2V4DA 1PPJG 3GHGC
chains in the Genus database with same CATH topology
4OGQD 1OMIA 1KMIZ 3AE1C 3RL0g 4OGQC 3Q2YA 1KORA 2IDBA 1KTMA 3GMAA 3LW5J 3Q5SA 3AE2C 4H0LB 3AEBC 2FYNC 2V7QJ 3AE4C 3D6ZA 4Z1MH 4TT3H 1GMJA 1OW8A 3AEAC 1DIPA 3AE3C 2E76B 3SFEC 4YXDC 1UIXA 3B71A 4PV1B 3S9OA 3D71A 1OW6A 4KT0J 3RK3E 2BEQD 3Q5PA 2ZT9B 1JB0J 2BEZF 2E75D 2JO1A 3AEEC 3O6QA 5L8RJ 3GLMA 1FDOA 1Q90D 1Y9BA 3AE8C 2J5UA 3T97B 3H25A 2ZT9C 3AE6C 3GF3A 1ZP0C 1KQGB 4PV1C 4H44B 1VF5B 1EXJA 3AEGC 3Q1MA 2E76C 1R8EA 4GDOA 3D70A 2E75B 5KLIC 1RQUA 1ZOYC 3AEDC 3D6YA 2K9YA 2D2CD 3GF7A 1EXIA 4I7ZB 2QIWA 4H0LD 2P10A 3SFDC 1HJ0A 1K05A 2QJKC 3AE9C 1NYHA 4RKUJ 4IL6X 3Q3DA 4XFJA 2WQYC 2G3AA 2FBWC 1DD3A 1YQ4C 4H13C 2E74C 1WMKA 1TU3F 2WSFJ 1HF9A 2O01J 4I7ZC 1U57A 2E74D 3AE7C 4H44D 1ZMEC 2JP3A 2NZ2A 4YTPC 2E75C 1VF5C 4H44C 2D2CC 3AE5C 3C8VA 1FDIA 4H13D 3Q5RA 1RQVA 1NGMB 3R4YA 2E76D 2MKVA 1MKMA 4PV1D 4R4LA 1S5LX 1S1CX 2OQQA 2FXPA 2D2CB 1KILE 2G8YA 1AJYA 2H88C 1YQ3C 2WPVB 1PIXA 1ZRTE 3ABVC 4H0LC 1IK7A 2YMKA 2H89C 3IN6A 1K04A 1DD4A 3AEFC 2WSCJ 3AECC 1KQFB 3FGAD 5M1BA 4OGQB 3EWKA 2QSIA 1VL2A 4U7JA 2QJYC 4Y28J 2E74B 1OW7A 2QJPC 2YIUC 2ZT9D 4H13B 2WSEJ 4R4MA 1VF5D 3IAOA 1PL5A 5KKZC 1PV3A 3G9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2C B;  4H44 B;  1VF5 B;  2WPV B;  2E75 B;  1ZRT E;  5KLI C;  2WSF J;  2O01 J;  2K9Y A;  3LW5 J;  2WSC J;  4I7Z B;  4H0L B;  2QIW A;  2FYN C;  4OGQ B;  2QSI A;  2E76 B;  2QJK C;  2QJY C;  4PV1 B;  4Y28 J;  2E74 B;  4KT0 J;  2QJP C;  4RKU J;  2ZT9 B;  1JB0 J;  2YIU C;  4IL6 X;  4H13 B;  2WSE J;  3C8V A;  5L8R J;  1Q90 D;  5KKZ C;  1S5L X; 
#chains in the Genus database with same CATH topology
 1SQQ H;  1KYO E;  4F6R A;  2PAJ A;  3OJA B;  4FJC C;  2UWJ E;  1LTG C;  1K8A Q;  2AGA A;  4IL6 E;  1LUV A;  1XHZ A;  4OGQ C;  3J81 N;  1L0N D;  2GBO A;  3E1I A;  3VMZ A;  2XOK G;  4FM2 A;  3E83 A;  3ABK B;  4LH7 A;  4QE7 A;  1QHT A;  2NPS D;  3VBB A;  1GRJ A;  2HFE D;  3B5N B;  3SFE C;  1S5L E;  3CXH E;  3S9O A;  1LWU C;  2EJ7 A;  4DR7 O;  1XNQ O;  1M1J B;  3HKD A;  3OUS A;  2E75 D;  1S5L H;  5IWA B;  3H1H J;  1KKD A;  5CCH C;  3RL0 C;  4GOD A;  4IGG A;  4K3A A;  3F7Y C;  1KUQ A;  1W0K G;  3TGU D;  4J42 A;  1WPB A;  3G67 A;  3APO A;  1JY2 N;  1PPJ H;  3CLQ A;  5E79 Z;  3U1A A;  1R8E A;  1SES A;  2OYH B;  4GKG A;  1V9P A;  2LXB A;  2A7W A;  3HR0 A;  3WB0 A;  1IJD B;  1SQB J;  3H1J J;  2K1E A;  2K9Y A;  1FZG A;  4ZBM A;  2ZJS E;  1VQK P;  5KLV H;  2WLK A;  4WF9 V;  4I7Z B;  4CZZ A;  5H6Q A;  3X2Q B;  4R50 A;  3L71 G;  2YIC A;  3LDD A;  3CWB D;  4N3Y B;  2WLM A;  1CXZ B;  5LMN O;  2KZJ A;  1XMO B;  1SQV G;  3ZS8 C;  2E3C A;  1VDF A;  1XMQ O;  3ASO B;  4LFA B;  1IFD A;  5BU5 A;  5AVW B;  1R6T A;  2KP8 A;  2QKA A;  3CCQ P;  5CBG A;  2LKM A;  3H32 A;  1NU1 D;  2QE7 H;  5LYJ A;  3L75 G;  1UFI A;  1VQ6 V;  3M0A A;  3BCC J;  2LQT A;  1MSD A;  4LF6 B;  3A7O A;  3CMA V;  1JTH B;  2DW3 A;  2WSF H;  1VQM V;  3LID A;  1VQ9 P;  2HHH O;  1VQM P;  3PRJ A;  2NZ2 A;  4YTP C;  2GUZ A;  3OAK A;  5EBM C;  3CI9 A;  3H9V A;  4HNA B;  4I0X B;  1H8A A;  5JQG B;  1A32 A;  2P2U A;  5H2F H;  2JRI A;  3L70 H;  2N05 A;  2W83 C;  2LP7 A;  4ZHQ B;  4DV6 O;  4UV9 A;  2HJD A;  3DC5 A;  1GU5 A;  2OT5 A;  3OE7 G;  5BMV A;  1NTZ E;  3WFV A;  1J1D B;  4JBZ A;  5GTH E;  3IC9 A;  1KQL A;  2L6L A;  2GSM B;  5FPR A;  1YJ9 P;  4L74 A;  5EZY B;  2DMX A;  3JAR A;  3C9I A;  3HTK A;  1AP5 A;  3AG2 B;  4KUM A;  2Y4T A;  3ZHR A;  3A2F A;  4U3F E;  4BR6 A;  4LH6 A;  5KMG B;  3ZHU A;  2RH0 A;  4TLF A;  4NB5 A;  1XMO O;  3TGU E;  2JJ2 G;  5KAI Z;  5B1A C;  1QLE C;  4WY4 A;  4WVZ A;  3RYF A;  5HFL A;  2LGW A;  4DO2 A;  4PA6 A;  1BCC E;  3CCE P;  4JI1 B;  3K5L A;  4FLT A;  2JEX A;  1N7S C;  1ORQ C;  4TUY A;  5FNV B;  2NRG A;  5J2T B;  2PY5 A;  3VMY A;  2CTR A;  1SQV J;  4TQF A;  2QJP B;  4A7P A;  4ICG A;  4YJ2 B;  3K5B A;  3AE1 C;  2PYJ A;  3HKB B;  4B3R B;  1L0N E;  4R8C A;  2VQF B;  5AW7 B;  1BL8 A;  1MOF A;  1VF7 A;  3RBZ A;  4NXN B;  2XAF A;  1J5E B;  2LXC B;  2UXN A;  1GMJ A;  2AEF A;  3RVY A;  2JJL A;  3U10 A;  3ZBH A;  4LWS A;  4RUE A;  1XNR O;  1K4C C;  1QBZ A;  2A3Q A;  4O4L A;  4UB6 Z;  2OYQ A;  1Y9B A;  2R5B A;  3H32 B;  4P30 A;  1KC8 W;  2V1D A;  2NN4 A;  4NYK A;  3ZX6 A;  5DJU B;  3CX5 F;  3B8E B;  3I56 P;  2Q8V A;  1KQG B;  4FLZ A;  4H44 B;  1AR4 A;  4GDO A;  1UII A;  3HKE B;  1IBL O;  4B3T B;  1ZOY C;  4K35 A;  1MMM A;  4LF4 B;  2EBO A;  1BZK A;  3T1Y B;  2EUL A;  4HNA A;  3P32 A;  1WA8 B;  4PEL A;  4UVB A;  2GTA A;  4O4H B;  1DH3 A;  3PJS K;  4FLY A;  3JSV C;  2HP8 A;  3K3W A;  4MVS A;  5KAF Z;  1YIT P;  1OVR A;  4KHX A;  1H2M A;  1EZV G;  3JAM N;  2XU6 A;  4MTO A;  3GWK C;  1XI1 A;  5APT A;  1KFN A;  1EZV D;  1HH0 A;  1FU1 A;  2AHY A;  2C9L Y;  2JWD A;  3JAT B;  1S9K E;  3CCS V;  2ZE5 A;  1O9H A;  3GB7 C;  1SQX H;  5IYD O;  1AVY A;  2CE4 A;  3M8A A;  1H2G A;  4N78 E;  2H7H A;  1BE3 J;  1NTM D;  3T1H B;  1VQ4 P;  3QVN A;  2ZNI A;  1PP9 H;  1N33 O;  4JI5 B;  1ZXG A;  4FM1 A;  2Q3I A;  3D36 A;  2ZFC A;  4UCT A;  1S5H C;  3CSX A;  2CDY A;  2D2C B;  4ZKU A;  3D36 C;  4UCS A;  5LHH A;  2MK3 A;  1URQ C;  3H1I E;  1OZH A;  1YI2 V;  3DC6 A;  3E22 A;  5GW7 A;  1XIL A;  2H89 C;  1SQQ E;  4B3S O;  1S4X A;  1DD4 A;  3GHG A;  1TGO A;  4PD4 D;  4LCU C;  4MVO A;  1D2D A;  1ZV8 A;  2ZDI A;  1G1X B;  2KLV A;  4IIJ B;  2E74 B;  3FAV B;  3TXQ A;  2XV5 A;  1RF1 C;  2FYZ A;  1SQV D;  3SSU A;  1T2K C;  5L3E A;  5KKZ B;  4JAS A;  4R4M A;  2AXT E;  3FYE B;  2QTS A;  1OJH A;  2BOB C;  3H1J G;  1VF6 A;  3DSQ A;  2Q6Q A;  3N4X A;  1R5S A;  3S3X A;  4MN4 C;  3WG7 C;  4DUY O;  1VQO V;  5B3S C;  4O4H A;  2PZS A;  2Y9Y A;  1VEW A;  2Y0E A;  4JI2 O;  3N2G B;  2QM4 A;  1X22 A;  5LP6 C;  1OXZ A;  2WSS G;  4PV1 B;  2KUB A;  3K79 A;  2JO1 A;  5AW3 B;  5AW9 B;  3SPH A;  3AE8 C;  1FXK C;  3HB3 B;  1JNM A;  5EZY A;  1ZLZ A;  3A0H E;  1BMF G;  1L0N H;  4X65 B;  1IFM A;  2Q7C A;  1L0N G;  5APX A;  3CB2 A;  3HUS A;  1NTZ J;  2FYN B;  2W8Z A;  2LR2 A;  1HTL C;  3ZDM A;  3CPW O;  1L1F A;  3U1C A;  1EDL A;  4J7K A;  3AG4 B;  1NH2 D;  1GL2 C;  2P10 A;  5AW5 B;  1AI4 A;  4X20 A;  2QJK C;  2FYU H;  3H1K H;  2WSS H;  3G80 A;  4DV7 O;  1FC2 C;  3H1I D;  4X1Y A;  4UV8 A;  4IL6 X;  3V2N A;  3ABT A;  3HKC A;  4GX1 A;  4U3F H;  1LT9 A;  1P84 H;  3AG1 C;  5HFM A;  4NTX A;  5CCH D;  4GOF A;  1Y4M A;  2P22 C;  3JD4 A;  3CWB E;  1WMK A;  2ZCE A;  4WFE A;  3VQX A;  2DYR B;  2X6A A;  2BAS A;  1KC8 Q;  2MJZ A;  4JI7 O;  4J7J A;  2KKW A;  1PGQ A;  2XKM A;  2WA3 A;  2HYN A;  3V4W A;  3FX7 A;  3IF4 A;  1X79 B;  1M1K W;  5CB4 A;  1I0H A;  4L8J A;  2JEE A;  3P8C D;  2JEU A;  4Y99 B;  1NO4 A;  2HEP A;  1NAY A;  1OCC C;  3CC7 P;  3D3Q A;  3A2A A;  2EIN B;  3KCX A;  3CE2 A;  3B8M A;  2UUC O;  3ABL B;  4PV1 D;  4YIP A;  3ZMS A;  1SQB G;  4C46 A;  5CA1 B;  1X9V A;  2P1J A;  2FXP A;  3A0H H;  4JQ0 D;  1ZRT D;  1GO3 F;  1PIX A;  3UM7 A;  3M99 B;  4RJT A;  5L3F A;  1YTF D;  2UXC O;  2YIB A;  3AEF C;  1W2B U;  1U97 A;  3FGA D;  4HYT B;  5K1P A;  2WAM A;  2QSI A;  3N2K B;  2P5O A;  1R6N A;  5EIB C;  1TVK A;  2YIU C;  2A45 I;  3UQ8 A;  1IVS A;  1L4A B;  2LO1 A;  1SQX D;  4EDF A;  1E1Q G;  1XTG B;  3M9B A;  1YTZ T;  1VQ6 P;  2WMM A;  1M5I A;  2W27 A;  1O9G A;  4QE9 A;  2PI4 A;  2QWN B;  1M1J A;  3ZHS A;  4J80 A;  5KUK A;  2A45 G;  1ZUQ A;  3I5C A;  4WFG A;  1FS0 E;  3L75 D;  2X7R B;  3KXD A;  3V6I A;  3QTC A;  2YIA A;  2OTJ V;  3LW5 J;  1H2K A;  3KYQ A;  1FFX A;  1JFF A;  2XTA A;  2J58 A;  5J9P C;  1JMB A;  2F23 A;  2NNU A;  3ZRW B;  1M4U A;  4RO0 A;  1EZV I;  1RF1 A;  1N4C A;  1CW5 A;  1OW6 A;  4JF7 A;  5JH7 A;  2ZT9 B;  5L8R J;  2YI9 A;  2PGD A;  3V4Q A;  1VQ7 P;  5LMU B;  1OCO B;  3OMA B;  2AEM A;  4D6T D;  3H1J D;  1F4M A;  2ZR2 A;  3E86 A;  4MVQ A;  4RES B;  2BCC H;  1KYO I;  2GUS A;  3H25 A;  5JWP A;  2YEV B;  1P49 A;  1EXJ A;  2DW4 A;  2Q67 A;  2BCC E;  3E22 B;  4UCU A;  3JSL A;  5IE9 A;  3P8C E;  4CC6 A;  2HVK C;  1B3Q A;  3EFF K;  3OW2 O;  1IFJ A;  4MSW C;  3JAW B;  1SFC A;  1VQ9 V;  3AK2 A;  1IZN B;  4D6T H;  3R65 A;  2CPS A;  1LGH B;  3H1L D;  3R2P A;  4HH2 A;  4GKK B;  3CCM P;  1NWQ A;  4O2A B;  1HNX B;  5ITZ B;  4DV4 B;  3L71 H;  1LTJ B;  3RYH A;  4JYA B;  5B5E E;  3LDE A;  4IHJ B;  1BE3 G;  1KB9 I;  3HUS C;  3MHS C;  3ZHT A;  2FML A;  4WBN A;  1SET A;  4H33 A;  1KFM A;  2R5D A;  1D7M A;  1SF9 A;  4AQY B;  3N2G A;  1J2J B;  2K1A A;  4QNH B;  1JQ0 A;  1PD3 A;  3T1Y O;  2E75 C;  1YI2 P;  1GTO A;  5LL6 Y;  3B77 A;  1HJB A;  3JAL B;  2BOC C;  3FB7 C;  5H5N A;  2DYS B;  3HE4 A;  3CD6 V;  1N33 B;  1U96 A;  3ETG A;  4NPD A;  1YEW A;  4DV5 B;  4B7K A;  1XQ8 A;  3ML0 A;  1BQZ A;  2FYU D;  1M56 D;  2F43 G;  3K5O A;  2OQQ A;  4WBA A;  1EM1 A;  4DZO A;  4MVU A;  1I5X A;  1S76 D;  2XT9 A;  1NU1 E;  2WPV B;  2Z5H A;  2VQE B;  1Q5O A;  4TUY B;  1S9K D;  3EXA A;  1R73 A;  2UUA O;  3IN6 A;  3VMA A;  2CTP A;  2WSC J;  1FOS F;  2HVJ C;  5JH7 B;  4DR1 O;  2FL4 A;  1NH4 A;  2YC0 A;  2HLO A;  4UVA A;  3LSQ A;  1IC2 A;  1J5E O;  4JI0 B;  1AP6 A;  1XL4 A;  3CXH F;  4XDK A;  3RGB A;  4F6E A;  3J80 N;  4JV5 B;  3TGU H;  1BCC D;  2WSE J;  3P7K A;  1YJW P;  3IAO A;  1DEE G;  3L4F A;  4RAI A;  4I2L C;  3BEH A;  4QJF B;  4XDL A;  3G4S P;  4L87 A;  1KD1 Q;  5IYZ B;  4WY4 B;  4B86 A;  4O9B A;  1QVG O;  1VQP V;  1P84 F;  1KOR A;  2QSA A;  1ZW0 A;  3CWB G;  1GL2 D;  2XUM A;  2QGN A;  5EYP A;  1H2N A;  1EDJ A;  1OFC X;  2DE0 X;  2W6J G;  4LF7 B;  1SQP E;  2R70 A;  1GKF A;  3AEA C;  5AVV B;  4YXD C;  1OV9 A;  1XNQ B;  3B4S A;  1IO4 A;  3G3Z A;  4WB4 A;  1JB0 J;  3K57 A;  1GD2 E;  2FXO A;  2M0B A;  3WU2 Z;  5CA1 A;  1Y76 B;  3RGU A;  3CHX A;  1WPX A;  5KHG A;  1E79 H;  3FYI B;  1Q86 W;  2ZIO A;  3STL C;  2LGQ A;  5L3C A;  5B66 H;  5AW4 B;  3D70 A;  3S4R A;  1NTM E;  2R72 A;  5AVZ B;  1GM8 A;  2CK3 G;  5J2U A;  5KTB A;  2CH7 B;  3RT3 C;  1NKN A;  2ZE8 A;  2QIW A;  3RWR D;  2BTO A;  3ASN C;  3HE4 B;  3ETE A;  1Y8A A;  1VQ4 V;  3L70 G;  4JI2 B;  5LGU A;  2JGU A;  2JGD A;  4CS2 A;  1JMM A;  2CGO A;  1SFC D;  4WY4 D;  4FMT A;  5TIS H;  1VQL P;  1BSM A;  1V55 C;  1OHH G;  5LYJ B;  2FBW C;  3RK2 D;  1N7L A;  2K3R A;  3IGA C;  3BVH A;  3EQ2 A;  1LTS C;  1R5L A;  4UB8 E;  2HOD A;  2OTL V;  4W80 A;  2YI8 A;  3RYI A;  3L73 J;  4JI3 O;  1NT2 B;  2KSD A;  3B8N A;  2GA1 A;  4CS3 A;  3CCU P;  2JP3 A;  1JUN A;  1EZJ A;  3DGE A;  4ZIB A;  2YXL A;  3TDK A;  1EN4 A;  4DV5 O;  3VP8 A;  1YBK A;  5EBL C;  1X59 A;  4ZMD A;  3WMM 0;  1N0N A;  2MW2 B;  2PUS A;  3B40 A;  5FPO A;  3U11 A;  3K5N A;  3F89 A;  1RF0 C;  4H37 A;  1KIL C;  1BGY G;  4FK5 C;  1KIL B;  4BRY B;  5CBN A;  4RQE A;  1GN2 A;  5IY5 C;  1BSH A;  5KLV G;  2BE3 A;  1NTK K;  1W59 A;  5KMG A;  4DUZ B;  2H88 C;  5CJ0 A;  5EYP B;  1WP8 A;  1T3U A;  4DOJ A;  3VTP C;  2KNC A;  4I4T A;  4HKZ H;  4CC5 A;  1YIT V;  2R9R B;  1KYO D;  2KG7 B;  1CI6 B;  3JC2 2;  4C7R A;  1GW3 A;  1YIJ P;  1PV0 A;  2IBZ D;  1F51 A;  2W6A A;  4JI1 O;  1N36 B;  2HFE C;  1M56 C;  1V55 B;  2QWQ B;  3G9R A;  5J2U B;  5LA6 A;  5AW8 B;  4WBN B;  3CPW U;  4IOI H;  1NBM G;  3W7S A;  3CCL V;  4MVM A;  3HD7 D;  1RM1 C;  2IBZ H;  3THO A;  1AVO A;  4U7N A;  4WFF A;  4U3F D;  1P84 D;  4NR1 A;  1SQP D;  2V7Q J;  4O4L B;  3C90 A;  1QVG U;  1F7Y A;  1EZV E;  2OTL P;  3JD0 A;  3O65 A;  2UUB B;  2W6I G;  3L9D A;  2ZNJ A;  2HOD B;  1L0L H;  1U7J A;  2ZYA A;  1MZF A;  5CJ4 A;  2YO3 A;  4N23 A;  1NTZ G;  4I9W A;  4JAU A;  2ZXW C;  2B88 A;  3I56 V;  1PZQ A;  2E76 C;  1KV4 A;  4Z1V A;  2FXM A;  1HGZ A;  1PL4 A;  1S3J A;  1NH2 B;  4QPK A;  3QWO C;  4O2B A;  2LW7 A;  3A0B Z;  3I55 P;  1F23 A;  2EIK B;  4AIL C;  3SFD C;  1BGY D;  1R6K A;  3OMI B;  1AI5 A;  1KIL A;  4BRY A;  1QL2 A;  4FPP A;  1N86 A;  1UJW B;  1URQ A;  3JSN A;  4JI3 B;  2P7J A;  4BXL A;  1DD3 A;  4R7C A;  4DR3 O;  4DV2 B;  4OPA A;  1FJK A;  1YSC A;  2QG4 A;  1Y66 A;  2QJK B;  3CXH I;  3KZI Z;  2IH3 C;  2QKC A;  3CCS P;  1QL1 A;  1CPY A;  3EVK A;  1GAX A;  2A06 H;  4C7U A;  1JCD A;  2BSK B;  2PI5 A;  1WJZ A;  1XNR B;  3VOP A;  3AE5 C;  3MTU E;  1WLE A;  1TAE A;  3JAS B;  5IYB O;  1FAV A;  2LW1 A;  3FB5 C;  1Y76 A;  1FXK B;  1XHX A;  4DK1 A;  1LR1 A;  5AVS B;  4P9O A;  2IU0 A;  2FYU K;  1H8H G;  4FFB A;  3F5H A;  4LF5 B;  3AK1 A;  3LDC A;  3W68 A;  4U3F G;  5DED A;  4DK0 A;  3K06 A;  1KIL E;  1ENV A;  5GTH H;  3WU2 H;  5CCG D;  3TK1 A;  1LUW A;  2R9A A;  1WN7 A;  2XAG A;  2Q3E A;  5B66 Z;  1MFT A;  2Q0O C;  1J1E C;  2KK7 A;  5DJT B;  3SPJ A;  1ZWI C;  3OW2 U;  3BHP A;  3EWK A;  1RE3 C;  1DEB A;  5GON A;  2QJY C;  2PTM A;  5C8Y A;  5APQ A;  3OD4 A;  1T5E A;  1YHQ P;  5BZB A;  1LTJ C;  1ZR2 A;  4MW8 A;  2ZE6 A;  3MHH C;  3BPZ A;  3QO8 A;  2Y0C A;  4EKW A;  1IK9 A;  5KKZ C;  1PNL A;  4YJ3 B;  1J95 A;  3IC7 A;  3CX5 D;  1RF1 B;  1GN3 A;  1M9N A;  3BAB A;  3W7T A;  1G8M A;  2WPS A;  3K08 A;  3HD7 B;  4MTG A;  1L0N K;  2ITA A;  2AXT H;  1DTO A;  5JCO C;  2IDB A;  2PRR A;  1TVK B;  3K9A A;  4YY3 O;  3L72 J;  3G6E P;  2IYO A;  2RCV A;  3HTK B;  5GTI E;  2QWO B;  1SQB D;  3O9O A;  1URQ B;  3T4Z A;  4L73 A;  1HW7 A;  4GLX A;  4PDR A;  2Q5Z A;  4ZOL B;  3JAK B;  2A06 E;  3GLM A;  1Q90 D;  2QM7 A;  1KYO F;  1Q6U A;  2QDO A;  1USD A;  3GF3 A;  2WPQ A;  1FJG O;  3SGI A;  3UKM A;  3V2R A;  1Y74 A;  1LWU A;  4JI4 O;  4K0K B;  3CRM A;  3S3W A;  1YVW A;  1GU4 A;  2CK3 H;  1AJP A;  1AI7 A;  4X1Y B;  4NXM B;  4PDV A;  2Q68 A;  2OYH A;  5B5E Z;  1VAR A;  4LGD E;  1S72 V;  3AG3 C;  5E1A C;  2PFX A;  2EIM C;  1TUB A;  1S2E A;  3KG2 A;  1W5C E;  2EIJ C;  5LBQ A;  2FB5 A;  2WQY C;  1OVV A;  1QLN A;  3MP7 B;  4GT1 A;  1NTZ D;  1M7L A;  2YIU B;  2EZO A;  4PI0 A;  1KEC A;  5KLV K;  1VQP P;  5AG2 A;  1VQ8 V;  3A5T A;  2W0F C;  1EQ7 A;  1IBL B;  4B3T O;  2QWR B;  2EIK C;  4E2L A;  3T97 A;  5JCO A;  5TIS E;  3V2P A;  3K04 A;  2QEX P;  4I1L A;  2H8P D;  4J9Z B;  1SQP G;  1EN6 A;  1LTJ A;  1S5L Z;  4K0K O;  1SQX G;  3ZN1 A;  4DR1 B;  3H1H E;  1MG1 A;  1K97 A;  3B09 A;  4I50 A;  3JCZ A;  1HVV A;  3ZHQ A;  1N8R Q;  3M9H A;  3Q5R A;  1H2L A;  1GL2 A;  1L0L G;  1V54 B;  2UXD B;  1IXM A;  1V54 C;  1QLE D;  5AVU B;  4X62 B;  3CC4 V;  3SJA C;  3TJT A;  3L35 A;  2ZIN A;  4K8X A;  1KU9 A;  4ZI7 B;  3L72 E;  3H1J H;  3CRQ A;  1IBM B;  3QO5 A;  2NR5 A;  1IK7 A;  4UUJ C;  2ZDI C;  3UT5 B;  2DQ0 A;  1RSO A;  1M90 Q;  4PI2 A;  3BAA A;  4LLH A;  4PD4 H;  2X0L A;  3AG1 B;  4LFB O;  5KAF E;  3CRC A;  1M56 B;  4R6Z A;  2EIJ B;  3B71 A;  4CS4 A;  4ZKI A;  1VQO P;  2EIM B;  2Y48 A;  1H2S B;  4JTD B;  3SYA A;  4U7O A;  3AG3 B;  5B1A B;  1YJN V;  3BCC H;  4Z1M G;  2O01 H;  1SA0 A;  3RL0 g;  1HNZ B;  3A3Y B;  2WPR A;  4BIZ A;  3CD6 P;  3H01 A;  5CHX A;  3L74 J;  3AE2 C;  5H9C A;  2OTK E;  1NTK D;  3AE4 C;  2KQX A;  1WT6 A;  2H43 A;  3HKB A;  1SQX J;  5H2F Z;  2WPD G;  4GUN A;  2HLD G;  1K9M W;  2XAH A;  1IBK O;  3Q5P A;  4NTW A;  4I9Q A;  3CXH D;  2UUC B;  5JJJ B;  2QM8 A;  4UCV A;  5AW0 B;  2UUB O;  1FBM A;  5K5G B;  4JI4 B;  1P7G A;  2FTK A;  1I08 A;  3UCS C;  3T97 B;  4LNU A;  1TUE B;  3FD9 A;  1EC5 A;  2OGU A;  4JYC A;  3TCU A;  1AV1 A;  4LFB B;  5BXZ A;  4PV1 C;  3Q1M A;  4LF5 O;  3OFN G;  1B6Q A;  3VQV A;  5LP6 B;  3OEH G;  2UXC B;  5APV A;  2E5L B;  3K03 A;  3SJB C;  2KXP B;  1ZSP A;  4EB6 A;  2R3S A;  1KKC A;  4LF9 O;  2N74 A;  3H1K D;  4CH3 A;  5B3S B;  4JYY A;  3WG7 B;  1NJI W;  1VQ5 P;  5LXT A;  3HD7 C;  2OIE A;  1HNZ O;  2Y4U A;  1QX8 A;  4D6T J;  3GWO A;  3Q4H A;  2ZXE B;  3RYH B;  4DV1 B;  1IDS A;  1GZL A;  1KN7 A;  3HRN A;  4W4K A;  4DR5 O;  4L75 A;  4CPG A;  2BCC G;  3AG7 A;  5JVD A;  2B87 A;  1Q6I A;  3C3S A;  4JZG A;  4PA9 A;  4X8A A;  4CH4 A;  3A8T A;  2E74 C;  1GH6 A;  1SKV A;  2FKX A;  2G38 A;  1ZAU A;  2O57 A;  2QJY B;  4AYC A;  3UT5 A;  1AJN A;  3IJ4 A;  2WVR A;  1KQS O;  1FS0 G;  2QTO A;  4OX9 O;  4DUZ O;  2YID A;  4AQY O;  1WRG A;  5B66 E;  1LJ2 A;  2E74 D;  3L74 G;  1J1E B;  3JAL A;  4LR3 A;  5LOV A;  4DV6 B;  2KSJ A;  4U3J B;  4YXW G;  2Q5U A;  1Y67 A;  4J41 A;  5FL7 G;  2D2C C;  1SRY A;  3E2E A;  4DCK A;  2K88 A;  1A02 J;  3BFR A;  2Z3Y A;  4DRX A;  3ABU A;  3L75 H;  1SQP H;  4I55 A;  3CCE V;  3RL0 B;  2MKV A;  2OTJ P;  1AI6 A;  2B1G A;  4B08 A;  1S5L X;  1S1C X;  1N7S D;  3F5T A;  1Y74 B;  1LWU B;  1Z56 A;  5KUM A;  1JY2 P;  4LF6 O;  1LP1 A;  3B5N C;  3CWB H;  3CS5 A;  2N1T A;  4GIF A;  4ASU G;  1Q7Y W;  1JM0 A;  3B2E E;  3JCU E;  4G27 B;  2P06 A;  2WT7 A;  4KXR A;  4OGQ B;  4X64 B;  5LA6 B;  2L35 A;  5CA0 A;  3CC7 V;  5KAF H;  3M91 A;  1K3E A;  4UXN A;  3LSS A;  1EBO A;  4JI0 O;  3L72 D;  4XE5 B;  4YXW H;  2FYU J;  3GHG B;  1MNG A;  2M3E A;  4LNU B;  2M3B A;  2N9Y B;  2WSE H;  3G71 V;  2XAS A;  3O6Q A;  4IL6 H;  3FAV A;  2Q0A A;  1SQB E;  2ZD9 A;  4U3F J;  2KG7 A;  1OMI A;  3H1H D;  1SQQ J;  5K1X A;  4MVR A;  3G4S V;  2IJK A;  4ZKP A;  1E1R G;  5BVZ A;  1RPO A;  3H1H G;  3L70 D;  1FZB A;  1Q82 Q;  3VQY A;  2GUZ B;  1GTW A;  1DX7 A;  1SQB K;  2CUG A;  2Z0A A;  2PP6 A;  2E76 B;  3CCV V;  3SPI A;  2ZXW B;  1BDD A;  1L4A D;  2DJV A;  1XMQ B;  3H1H H;  2K9J B;  3CCV P;  4N21 A;  3N2K A;  1JR9 A;  1KZU B;  2RNB A;  1H0T B;  1G4Y B;  3J7A U;  2N1T D;  5EK0 A;  2DYS C;  2P4K A;  2J59 M;  1Q81 W;  4DV4 O;  1T2K D;  2ZKO A;  3H1I J;  4Z2W A;  5AVX B;  2XND G;  1JOY A;  1QVF O;  2Y0I A;  2E75 B;  2YS8 A;  3AED C;  4P9P A;  2CTW A;  3RK3 D;  2CAZ C;  1D5A A;  3GF7 A;  4EFB A;  4G28 B;  1RM1 B;  1JMK C;  2FKW B;  3SYC A;  3HUS B;  4DUY B;  1K05 A;  4KHP O;  1FFX B;  1FE6 A;  3CJH A;  2JIZ G;  4EEQ A;  3QG5 A;  3ZRW A;  5FNV A;  1VQ7 V;  4IYI A;  5CBO A;  4RWU A;  1EDK A;  1NTK H;  1BGY J;  2M6Y A;  5D5P A;  1CZQ A;  3NR7 A;  1QLE B;  3VP9 A;  2F4V O;  1TU3 F;  2JWA A;  3CCJ P;  1RHZ B;  5DN6 G;  5LHG A;  2M8R A;  3T4D A;  4FFB B;  1FAF A;  3RYC A;  1G2C B;  1IXB A;  3H1K E;  3H1L G;  2KSE A;  4DT0 A;  2F66 C;  4HB1 A;  1NOH A;  1EDI A;  4BIU A;  2WLL A;  3OEE G;  3CCM V;  3M0D C;  2GM4 A;  3JCU H;  1K4D C;  3PN1 A;  5IY5 B;  3P30 A;  4TQD A;  4WCE V;  3HKD B;  1NU1 J;  1H8E G;  1OCO C;  1JY3 N;  1SQX E;  4OWF A;  4G2K A;  5GON B;  3ZMT A;  1QR8 A;  3BA8 A;  1VF6 C;  3GG2 A;  1SQQ G;  5ITZ A;  2BSK A;  1I94 B;  1SQV K;  2KS1 B;  3H1I G;  2BTQ A;  1K04 A;  4DV0 B;  2QKS A;  3TXS A;  2ITC C;  3AEC C;  3T1H O;  1VL2 A;  3KZI E;  1KIL D;  2AEJ A;  1L0L D;  2DOS A;  1BHA A;  3LNM B;  4HBN A;  1N32 B;  4MTF A;  1VQK V;  4JI8 B;  1HGV A;  4PHZ A;  1VF5 D;  2IJI A;  2E5Y A;  1ZR4 A;  2YUA A;  2Z5I A;  4GKJ O;  5AVR B;  4AUW A;  2CPB A;  2XNX A;  1PGP A;  1KMI Z;  2ILM A;  3SPC A;  1SQV H;  3CC2 V;  2ZVO B;  3ASN B;  1SQF A;  5IJ9 A;  3C1L A;  3Q2Y A;  3OGI B;  2C0X A;  2EZP A;  3Q5S A;  1JEK A;  2N04 A;  1GMG A;  3UO3 A;  1JTH A;  3D6Z A;  1VQN P;  4X1I A;  4CH6 A;  1Q8I A;  3AE3 C;  3OMN B;  2C9N Y;  5BY1 A;  2HPC B;  2VRZ A;  4I55 B;  4DV0 O;  3CC4 P;  1XRE A;  2AXC A;  3G71 P;  4I0X A;  1BS3 A;  1NQT A;  1VQ5 V;  4B3M B;  3ABL C;  3RBX A;  3A0H Z;  1K73 Q;  2RKL A;  1ROP A;  2FY8 A;  1OCC B;  1M1J C;  3RW0 A;  1ZP0 C;  4J7Z A;  5KX5 B;  1VF5 B;  4A5U B;  2RJZ A;  1N32 O;  4Y99 C;  4O2B B;  2WA4 A;  5E79 E;  4MTX A;  5CBH A;  1W2B O;  2VS0 A;  5CCG C;  3ABK C;  4OXS A;  2Y9Z A;  3JAR B;  4TV9 B;  4PDL A;  1EXI A;  3CXH H;  2WSC H;  2VQF O;  4DW0 A;  4WY4 C;  2VRS A;  4GYC B;  2JK5 C;  4WFB V;  3CCR P;  5L3B A;  3Q3D A;  3E8H A;  1FYJ A;  4ASW A;  1AJQ A;  2G3A A;  4NKG B;  4JI7 B;  1IBK B;  2XHB A;  5EBW C;  4EYY Q;  1YQ4 C;  1K5S A;  1CEZ A;  2KB1 A;  1KYO H;  3SPG A;  3PTZ A;  1D5N A;  2GTS A;  3RN4 A;  1MUU A;  3VQW A;  4IL6 Z;  3AG4 C;  1GL2 B;  1E5W A;  2Z4E A;  1HF9 A;  1KP2 A;  2JKV A;  1U57 A;  1URQ D;  3QO7 A;  1LTA C;  1X8Y A;  2YKQ A;  1S0V A;  1BE3 H;  3I5D A;  3PP5 A;  5KLI B;  1K92 A;  4FZ1 A;  4B3M O;  3CC2 P;  4TT3 G;  1PP9 J;  2XAQ A;  5EC1 C;  1HNW B;  2IW5 A;  1RQV A;  1M90 W;  1JO5 A;  4JTA B;  1RSO B;  3STZ C;  2OYI A;  2JGD B;  1I5Y A;  1BT8 A;  3OTO O;  2LFS A;  5IJ9 B;  4M3L A;  2WTY A;  3CEI A;  1NR7 A;  3RL0 D;  4AHC A;  1LT9 C;  1BCC G;  3CX5 H;  2Q9I A;  2WLH A;  1SQB H;  4NPF X;  4NVP A;  3RYI B;  4B3R O;  3TGU G;  1I7F A;  2H3O A;  2HPC A;  4BAY A;  3K58 A;  4GX5 A;  3CP1 A;  3CJH B;  3EFG A;  1K34 A;  2YKP A;  3WB1 A;  3BAS A;  2P67 A;  4GKJ B;  4FM0 A;  1LTB C;  3ZHV A;  2QEX V;  4KP4 A;  3ZN0 A;  3FXE A;  3CYO A;  5KLV E;  1DF5 A;  4FVM A;  4UCR A;  4ZNC A;  2IJJ A;  4KL1 A;  4OGQ D;  1BGY E;  4LFA O;  4FLV A;  2JVD A;  4RUF A;  1N34 O;  3L73 H;  3MD0 A;  4GX2 A;  1Y47 A;  5CCH A;  1BCC H;  1KTM A;  4WWI A;  4TV8 B;  3M06 A;  5LMN B;  1OX3 A;  4DV3 O;  5BR8 B;  2WLL B;  1PPJ D;  1H89 A;  3ZRV A;  1HNW O;  1XDC A;  1YIJ V;  4MT8 A;  5GTI Z;  1WB7 A;  1CI6 A;  3FWN A;  3IR9 A;  2R32 A;  3K0D A;  1OIP A;  3APQ A;  2W6J H;  3JCU Z;  2HJF C;  4DV1 O;  1BSN A;  2KB7 P;  3BAT A;  3IFM A;  1SQQ K;  1IZ3 A;  1NR1 A;  1Q43 A;  2LJ2 A;  2NLJ C;  2YSU B;  2Q9L A;  4X1K B;  1NTK G;  2ZT9 C;  2P58 A;  2OCH A;  1NTZ H;  4JTC B;  1SQV E;  5DEC A;  4PA3 A;  2Q69 A;  5JVD B;  2B87 B;  4PD4 F;  3L70 E;  3PLN A;  2R3C A;  4OX9 B;  4NXM O;  3BA9 A;  2IX7 C;  2ZYG A;  1NTM K;  1PNM A;  1THZ A;  4N6J A;  3BRT B;  2ETN A;  3TGU J;  4J10 A;  5LMU O;  4DR4 O;  3H1K J;  1FZA A;  4XFJ A;  3TSI A;  2WLJ A;  3DTU B;  4X66 O;  1L4A C;  4JPZ B;  4U3J A;  1OWA A;  3HPL C;  1PM9 A;  5IDJ A;  5LXT B;  1NTM H;  4F4L A;  2CGN A;  4GOE A;  3UO2 A;  3VYI A;  2N9B A;  3WUT A;  4D7S A;  3MUD A;  3BVO A;  3P3P A;  2WWW A;  3U59 A;  3CL3 D;  3CX5 I;  4JAA A;  3C3T A;  1US6 A;  4QIW F;  4H44 C;  4X64 O;  1MZ9 A;  1U7M A;  2DQ3 A;  2YMY A;  3CCQ V;  2RDC A;  3C8V A;  1NGM B;  2Y69 B;  4JYA O;  3TF5 A;  4TOI A;  4DR6 O;  3BCC D;  2EIN C;  4R4L A;  1FJG B;  4EI2 A;  3H1K G;  3H1L E;  4Q6G A;  1L0L J;  1PPJ E;  4QMA A;  4IFM A;  4BIO A;  3MHV A;  1G6U A;  1Z5V A;  1KB9 H;  1SFC B;  4PJ0 H;  4XDJ A;  5C93 A;  3B5N A;  3QH9 A;  3L37 A;  2YXY A;  2IZ1 A;  5M1B A;  3E35 A;  1PKX A;  5D5Q A;  2DYR C;  1GK4 A;  4I4T B;  5TIS Z;  3DXR A;  5CA3 A;  1Q81 Q;  2QJP C;  1JCC A;  3E89 A;  3ZMZ A;  1XTC C;  3I55 V;  2KZI A;  5IWA O;  3L73 E;  1N7S B;  1GM9 A;  1N34 B;  1M1K Q;  1IFP A;  4IHJ A;  3HKC B;  1AR5 A;  3KCY A;  3CME V;  2K9J A;  3CX5 E;  2ZYD A;  2UXB O;  3L73 G;  4OH8 B;  2NPS C;  1JCH A;  2V7Q G;  1MA1 A;  3LW5 H;  3ZIA G;  2M5A A;  2PGG A;  4GCZ A;  2ARH A;  2X6B A;  1H0T A;  4JAV A;  1M57 B;  4H0L B;  2OYO A;  2FYN C;  3AG2 C;  3L74 H;  3SR2 C;  3AEB C;  4PA7 A;  5BU8 B;  4QPJ A;  1UIX A;  1N73 B;  3SYP A;  4EIJ A;  2VWJ A;  2L5G B;  3L70 J;  3RK3 E;  2BEZ F;  1J1D C;  1HUC A;  5B1N A;  1BE3 E;  4DV7 B;  2KOG A;  2BCC J;  2IFN A;  2Q4P A;  4X9Q A;  4JI5 O;  3RK2 B;  2JS3 A;  1MFZ A;  1ZX3 A;  3L74 D;  2YO2 A;  3OTO B;  3JD1 A;  1L0L E;  1FZE A;  3LSU A;  4IFD K;  4FLU A;  5JJE B;  1RP3 B;  2HHH B;  1RE3 A;  4D7T A;  2O1J A;  4X66 B;  2I1K A;  1Q6H A;  3AE9 C;  2UXX A;  4RKU J;  4AI8 A;  3ITK A;  2K37 A;  3HE5 A;  2HKO A;  3FKS G;  4DR5 B;  1YZB A;  4D6T E;  1S5J A;  2UXB B;  3S1K A;  3II6 A;  4X62 O;  1KD1 W;  3L71 J;  1N8R W;  2Y0P A;  4L76 A;  2OCC B;  1OCR C;  1LT1 A;  3E7K A;  3H1L J;  3E8B A;  4I7Z C;  2ODM A;  1LTI C;  2Q6A A;  3KPE A;  2F95 B;  3A0R A;  4H44 D;  1YTZ I;  3N7N A;  1YJN P;  4XA4 A;  5KJ7 D;  3P8M C;  2CTQ A;  2X6C A;  2KYV A;  2EJR A;  2KS1 A;  2PYL A;  2P4V A;  3OAA G;  1DF4 A;  1RY3 A;  3TNU B;  1SQX K;  5GTI H;  2ZXX A;  1M93 A;  4PD4 I;  2B9Z A;  1KB9 F;  3RYC B;  1G2C A;  1M57 D;  1T6A A;  4C7N A;  1AJY A;  1QCE A;  1YQ3 C;  1L8D A;  5CA0 B;  2A06 G;  1PFI A;  1ZRT E;  3M0D A;  2XDJ A;  3BRV B;  3ETD A;  3A0B H;  1IFI A;  1N2D C;  1VQL V;  1MV8 A;  3ICX A;  2W0X A;  1NHL A;  4Y28 J;  3SWK A;  1VQN V;  1G1I A;  4DR2 B;  2SPZ A;  4X65 O;  1CP9 A;  3JYC A;  3QNE A;  3VOU A;  2Z5U A;  1XOU A;  3VMX A;  5EIB D;  1PV3 A;  5AVQ B;  5C8Y B;  4UB8 H;  1X0T A;  2EIL C;  4UFZ A;  1JJ2 U;  1R3I C;  2ZIM A;  3N27 A;  4O4J A;  3E8G A;  1SZX A;  1HWT C;  1Q82 W;  1WA8 A;  4FZ0 A;  3ZED A;  2E42 A;  2Q73 A;  4F6R B;  5KJ7 C;  2DN9 A;  1PP9 G;  3CCL P;  2WLI A;  3E8F A;  5LGN A;  2JJ1 G;  1OW8 A;  3ETQ A;  3HE5 B;  3OR6 C;  2BCC D;  1SZT A;  5B1O A;  1WAZ A;  2IYP A;  4JGS A;  1KB9 D;  4KT0 J;  4XBF A;  4DR7 B;  4YHH O;  4JYB A;  4MW3 A;  4UB6 E;  1SQQ D;  1K33 A;  2AZ0 A;  1XUQ A;  2B1I A;  4X88 A;  5GTH Z;  1WNS A;  1IX9 A;  3ZCC A;  1VP7 A;  3AE6 C;  3M9Q A;  1MZE A;  3WU2 E;  1FJP A;  2KNC B;  2ZM6 B;  2YNY A;  2F1M A;  4MVZ A;  3D6Y A;  5KLV J;  1NVP B;  2D2C D;  2QA4 P;  3ZJZ A;  1Q86 Q;  4PJ0 Z;  2IFM A;  1NTK E;  3DXR B;  4I6M C;  2ATK C;  2I8D A;  1R3J C;  3TNU A;  2OCC C;  4PA4 A;  4DV2 O;  3M7M X;  4DV3 B;  5BR8 O;  5KX5 A;  3BRC A;  2W6B A;  1FZF A;  1GN4 A;  3GW6 A;  4JI6 O;  1JY2 O;  2I1J A;  1HP8 A;  5KAI E;  2RMZ A;  2QR4 A;  3BCC E;  2RQ6 A;  4H13 C;  5AW6 B;  4N78 D;  5CMZ A;  1SS3 A;  4W4L A;  4Q20 A;  2ADQ B;  2XAJ A;  2WSF J;  4DXW A;  1NI8 A;  1YDX A;  3ABM B;  3LNN A;  2O01 J;  2WIT A;  1G1J A;  3LIE A;  3RK3 B;  2OYI B;  3L72 G;  1YJW V;  3LUT B;  1K9M Q;  2FYU G;  4YIO A;  1ZL8 A;  1YF2 A;  2O1K A;  3PHL A;  5IT9 N;  5H2F E;  1WB8 A;  1PNK A;  1R3L C;  4FIP C;  3W7X A;  3TYY A;  1FDI A;  4BWN A;  3U0Z A;  4KJM A;  1YXB A;  3K5M A;  1FFT B;  1T8Z A;  2ZM6 O;  3V5B A;  3O8Z A;  3H1J E;  4I50 B;  1YJ9 V;  1N73 C;  4EOT A;  1URF A;  1K7D A;  5BMV B;  3EHB B;  1GW4 A;  4H0L C;  1R3K C;  3F7V C;  5B5E H;  4LF4 O;  2V4H A;  1AVM A;  3ABM C;  2UU9 O;  3RK3 C;  1L4A A;  1EZV H;  5C39 A;  1FD9 A;  4X89 A;  4JI6 B;  4HZ3 A;  2HG5 D;  2VQE O;  1FXV A;  2NPS A;  1OW7 A;  3CRA A;  3T1C A;  4H13 B;  4LBE C;  3OTF A;  2WLN A;  3ASO C;  3WUV A;  1YHQ V;  5TJH A;  3OR7 C;  3MAQ A;  2F4V B;  3E1R A;  1AB3 A;  4JV5 O;  4NPE A;  2GHY A;  1OVU A;  3BY6 A;  3X2Q C;  1YYC A;  3UIA A;  5AW1 B;  4B3S B;  3FB8 C;  5J2T A;  3MIW A;  2WZ7 A;  4UCO A;  2IH1 C;  5KA5 A;  3USS A;  3ZRS A;  2XZR A;  4NXN O;  1SFC C;  4CBC A;  2LFR A;  1SA0 B;  2OYH C;  2P7T C;  3JAS A;  1GDT A;  1DLB A;  4FLX A;  3D71 A;  5JJN B;  2BEQ D;  4LFC B;  4LF7 O;  5B1B B;  2A45 H;  1RE4 A;  3CMA P;  2Y69 C;  3CCU V;  2J5U A;  3CXC U;  1LTT C;  1IBM O;  3L75 J;  4CH5 A;  4IFF A;  1PL0 A;  2POH A;  4TV9 A;  2QE7 G;  1N36 O;  5IJ0 B;  1FZC C;  5APW A;  2IPP A;  1NU1 K;  4FLW A;  1NS1 A;  1RQU A;  3PH0 A;  3JD3 A;  1WP7 A;  3CWB J;  2K9P A;  3L71 D;  3FB6 C;  3FFQ A;  3OUF A;  2ZE7 A;  2B5U A;  2RMK B;  5A2Q N;  3MGN A;  4H0L D;  1FKA O;  3W7U A;  3VN0 A;  1HJ0 A;  2HR3 A;  1NZ6 A;  2H8P C;  2VWK A;  1NKD A;  2EIL B;  2P6J A;  1UPG A;  5APS A;  1YCI A;  3JD2 A;  4WFH A;  5AVY B;  2DWE C;  4JZ2 A;  4YJ3 A;  3G6E V;  3IAY A;  4DR2 O;  3AK3 A;  3QF7 A;  1XL6 A;  3T2M A;  2FFD A;  3B5N D;  4BWA A;  1GK6 A;  4LF8 B;  1FDM A;  1HR0 B;  4W7Z A;  4B7E A;  4YPC A;  4KFM A;  2QJ1 A;  1QR9 A;  4UB8 Z;  3W67 A;  4BW9 A;  2WLI B;  2R9I A;  5H6R A;  4HJG H;  1ZN5 A;  3AE7 C;  2YXR B;  3KDP B;  1ZME C;  1SVF A;  2ADP A;  1XEQ A;  3FWL A;  1FOS E;  1SS1 A;  1FXH A;  3AEI A;  4DYL A;  2KI7 B;  1H38 A;  3JAK A;  2QWP B;  4LF9 B;  3SYO A;  4RO2 A;  1EN5 A;  4H13 D;  5LOV B;  1KQS U;  1NTM G;  1MKM A;  1HDJ A;  3KKY A;  1NTZ K;  1W0J G;  1Y6X A;  2G8Y A;  1HBW A;  4DRX B;  1S72 P;  3ABV C;  1JX9 A;  1N7S A;  1LNQ A;  2YMK A;  2A9H A;  4LF8 O;  1P84 E;  3OA7 A;  3OM3 B;  1OCZ C;  4IT5 A;  3NMD A;  2N1T B;  2AZ2 A;  3NFQ A;  1OCR B;  2PF4 E;  3MZW B;  2EX3 A;  1N0J A;  5APU A;  5IJ0 A;  5IYZ A;  1FZC A;  1BGY H;  1AQT A;  2ZAE B;  4QGP A;  4LWS B;  2E5T A;  1I94 O;  1KBH A;  3JAW A;  2ZVN B;  2N1T C;  3KQG A;  1OCZ B;  3L72 H;  3P3N A;  3CME P;  3WUU A;  1BCC J;  4PD4 E;  1GN6 A;  4I5S A;  4O2A A;  2FYU E;  2Q7G A;  3BCC G;  4Z1M H;  1DIP A;  1VIB A;  1JY3 O;  4W7Y A;  2BTQ B;  3RFR A;  3HKE A;  5FLX N;  4YJ2 A;  3RK2 C;  3AEE C;  2FFD B;  2Q7E A;  3GVM A;  1SQP J;  1AFO A;  1BHB A;  1FDO A;  4FFK A;  1NU1 H;  5L3G A;  4ZI7 A;  1Q3E A;  1L0N J;  1SER A;  2CH7 A;  5KHH A;  4MS2 A;  1BQ0 A;  5KLI C;  3RVZ A;  1PGO A;  1M57 C;  5AVT B;  3L36 A;  2A0L A;  2IZ0 A;  3L71 E;  1JY3 P;  2QVA A;  2JDI G;  2NPS B;  2OAR A;  1T3J A;  1NVP D;  1P4R A;  3L74 E;  3OGC C;  1NYH A;  1S77 D;  2OIG A;  4X1I B;  1VMG A;  3KHU A;  1NAF A;  1SLQ A;  2HG5 C;  1E79 G;  2YXH A;  2M7W A;  4X20 B;  1IUR A;  1L2P A;  1JA8 A;  1VPC A;  2ITD C;  2YXQ B;  3A0B E;  2IM9 A;  5CN0 A;  2E5L O;  4UVC A;  1VQ8 P;  1K5Q A;  4GZR B;  1K73 W;  1K8A W;  2GUV A;  1BE3 D;  1NTM J;  1PGJ A;  2Q1K A;  1DK1 A;  2OWO A;  1B06 A;  3MDS A;  4TSF G;  1A02 F;  4E4E A;  3NXS A;  2KIK A;  5EFW B;  2A79 B;  2YDE A;  1PP9 E;  4RQF A;  1MSW D;  2O01 N;  1VF5 C;  3H6P A;  1FZC B;  1NKZ B;  1M8O B;  1OZ0 A;  1HNX O;  2Y0D A;  1RH5 B;  3JAT A;  1R1B A;  3L73 D;  2E76 D;  4PJ0 E;  5B1B C;  5E79 H;  3H1I H;  4KHP B;  4ZOL A;  2W90 A;  2E43 A;  3CRR A;  2JR8 A;  2JDI H;  3V2Q A;  4DJG A;  4EB6 B;  2IBZ G;  2IBZ I;  5CCG A;  3L75 E;  1EFR G;  2RN0 A;  1SQG A;  3FX0 A;  1B04 A;  5KA6 A;  1GK9 A;  1KQF B;  3SWF A;  5CMU A;  4YY3 B;  4O4J B;  4U7J A;  3ZRX A;  4DR4 B;  4NTY A;  5L3D A;  3MUD C;  2GV9 A;  3TET A;  2DWD C;  3SDL A;  1NTK J;  3SWY A;  2IJH A;  4AQR D;  4HYO A;  1TUB B;  4LP8 A;  4YHH B;  1NJI Q;  1NVO A;  4EFE A;  1PL5 A;  2M5A B;  1BDC A;  4ASV A;  3CCJ V;  1ZLL A;  4K8Z A;  1HWY A;  4HAM A;  1AA0 A;  4TWK A;  1XBL A;  4IIJ A;  2Q7H A;  2D3O W;  5A9G A;  4JPR A;  2UUA B;  1RE4 C;  1N73 A;  1JVM A;  1Z2G A;  4LC1 A;  3GMA A;  1QGK B;  2QA4 V;  1QEX A;  4BW5 A;  3KZI H;  3K9S A;  1USE A;  1RFY A;  4TT3 H;  5DM6 V;  1SQP K;  2B9B A;  5KJ7 A;  4DR3 B;  2UU9 B;  1KP3 A;  4ABM A;  3D8C A;  2C2A A;  1JFF B;  5KHI A;  1F4N A;  5KHK A;  2A06 D;  1GM7 A;  1ZTE A;  1COW G;  4LFC O;  1P84 I;  1JOC A;  3ZMU A;  5IYC O;  5LGT A;  4ZHQ A;  1DGS A;  3CCR V;  5KLV D;  4O4I A;  1LP1 B;  2FFD C;  1QQC A;  2AHZ A;  4PDM A;  1MAB G;  4P2Z A;  3SJQ C;  3AEG C;  4D6T G;  1RF0 A;  1JPX A;  5EC2 C;  2WT7 B;  1RPR A;  1TA8 A;  2YEV A;  2OYI C;  4IYH A;  4JF3 A;  5KAI H;  1ARO P;  5CBF A;  2RN9 A;  1QU7 A;  4JI8 O;  5APY A;  4TV8 A;  1CSB A;  1H88 A;  1YTF B;  1QVF U;  4GKK O;  2IU3 A;  4DW1 A;  3RYF B;  3SYQ A;  2P90 A;  4GX0 A;  3O6Q B;  4DR6 B;  3OT7 A;  1PP9 D;  2UXD O;  1IFN A;  1HR0 O;  1KB9 E;  4J9Y B;  2JS5 A;  4X1K A;  1AR1 B;  1FPO A;  3F5W C;  1NU1 G;  3H1L H;  2V7Q H;  2C0W A;  1SP4 A;  2AXT Z;  1W2E A;  1FXK A;  2ZR3 A;  2YKO A;  1LT9 B;  1JJO A;  1QNM A;  1P7B A;  4UB6 H;  3IFX A;  4C7N B;  3K0G A;  3R4Y A;  1AIL A;  3R66 A;  5LHI A;  3ZMV A;  3D3I A;  3W7W A;  1Z5W A;  4J11 A;  2KLU A;  2H94 A;  2R44 A;  3G6B A;  5CB4 B;  1ZL8 B;  5F2V O;  4WFA V;  3K59 A;  1L0L K;  3NTN A;  2L91 A;  1AQ5 A;  2ZQM A;  2GDS A;  5LP6 A;  3FXD A;  1Q2N A;  5KHJ A;  5AW2 B;  2QRX A;  2AW9 A;  4OPH A;  4OVN F;  2F93 B;  3SJC C;  1Q7Y Q;  2XND H;  2YIB D;  2ZT9 D;  1SC5 B;  3Q4H B;  4O4I B;  2IBZ E;  1X4T A;  2B89 A;  3HD7 A;  5JQG A;  3WB2 A;  2O3J A;  2V4D A;  1PPJ G;  3GHG C; 
#chains in the Genus database with same CATH homology
 4OGQ D;  1OMI A;  1KMI Z;  3AE1 C;  3RL0 g;  4OGQ C;  3Q2Y A;  1KOR A;  2IDB A;  1KTM A;  3GMA A;  3LW5 J;  3Q5S A;  3AE2 C;  4H0L B;  3AEB C;  2FYN C;  2V7Q J;  3AE4 C;  3D6Z A;  4Z1M H;  4TT3 H;  1GMJ A;  1OW8 A;  3AEA C;  1DIP A;  3AE3 C;  2E76 B;  3SFE C;  4YXD C;  1UIX A;  3B71 A;  4PV1 B;  3S9O A;  3D71 A;  1OW6 A;  4KT0 J;  3RK3 E;  2BEQ D;  3Q5P A;  2ZT9 B;  1JB0 J;  2BEZ F;  2E75 D;  2JO1 A;  3AEE C;  3O6Q A;  5L8R J;  3GLM A;  1FDO A;  1Q90 D;  1Y9B A;  3AE8 C;  2J5U A;  3T97 B;  3H25 A;  2ZT9 C;  3AE6 C;  3GF3 A;  1ZP0 C;  1KQG B;  4PV1 C;  4H44 B;  1VF5 B;  1EXJ A;  3AEG C;  3Q1M A;  2E76 C;  1R8E A;  4GDO A;  3D70 A;  2E75 B;  5KLI C;  1RQU A;  1ZOY C;  3AED C;  3D6Y A;  2K9Y A;  2D2C D;  3GF7 A;  1EXI A;  4I7Z B;  2QIW A;  4H0L D;  2P10 A;  3SFD C;  1HJ0 A;  1K05 A;  2QJK C;  3AE9 C;  1NYH A;  4RKU J;  4IL6 X;  3Q3D A;  4XFJ A;  2WQY C;  2G3A A;  2FBW C;  1DD3 A;  1YQ4 C;  4H13 C;  2E74 C;  1WMK A;  1TU3 F;  2WSF J;  1HF9 A;  2O01 J;  4I7Z C;  1U57 A;  2E74 D;  3AE7 C;  4H44 D;  1ZME C;  2JP3 A;  2NZ2 A;  4YTP C;  2E75 C;  1VF5 C;  4H44 C;  2D2C C;  3AE5 C;  3C8V A;  1FDI A;  4H13 D;  3Q5R A;  1RQV A;  1NGM B;  3R4Y A;  2E76 D;  2MKV A;  1MKM A;  4PV1 D;  4R4L A;  1S5L X;  1S1C X;  2OQQ A;  2FXP A;  2D2C B;  1KIL E;  2G8Y A;  1AJY A;  2H88 C;  1YQ3 C;  2WPV B;  1PIX A;  1ZRT E;  3ABV C;  4H0L C;  1IK7 A;  2YMK A;  2H89 C;  3IN6 A;  1K04 A;  1DD4 A;  3AEF C;  2WSC J;  3AEC C;  1KQF B;  3FGA D;  5M1B A;  4OGQ B;  3EWK A;  2QSI A;  1VL2 A;  4U7J A;  2QJY C;  4Y28 J;  2E74 B;  1OW7 A;  2QJP C;  2YIU C;  2ZT9 D;  4H13 B;  2WSE J;  4R4M A;  1VF5 D;  3IAO A;  1PL5 A;  5KKZ C;  1PV3 A;  3G9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...