2E75B

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e75B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75B01
1S5LX 4H0LB 4OGQB 2D2CB 1VF5B 2ZT9B 2QJPC 2QJKC 4H44B 2WPVB 4IL6X 2K9YA 3LW5J 2YIUC 1JB0J 2WSCJ 4RKUJ 2QSIA 4I7ZB 2E75B 2E74B 1Q90D 3C8VA 1ZRTE 2WSEJ 4H13B 2O01J 2QIWA 5KKZC 2E76B 2WSFJ 4KT0J 5L8RJ 2FYNC 4PV1B 4Y28J 5KLIC 2QJYC
chains in the Genus database with same CATH superfamily
4DV1B 3AG1B 3GHGB 2LO1A 1LGHB 3JAWB 4X1YA 1URQB 1BGYJ 2F4VB 3CCEP 1LP1A 4AHCA 4DV7O 2R3SA 3T1CA 1BE3E 4TV8B 1Y9BA 1IBKB 5KHJA 2PFXA 5CHXA 2POHA 3BRCA 3BA8A 5KJ7C 5KAFE 2VWJA 2KS1B 2JRIA 3L70D 1VQNV 1SQQD 1WP7A 3D8CA 1M56C 4R4LA 3Q5PA 1KU9A 5CN0A 1L2PA 4TOIA 1ZLZA 3AK3A 4QGPA 4E4EA 2V7QG 3AG4C 1WP8A 2UXDB 1KILD 2QJPB 3TYYA 2FFDC 1PGQA 4IYHA 4BIUA 1OXZA 5CA0A 3VTPC 1PPJE 3RK3E 1MMMA 4DR6B 3L74D 2IBZD 3CJHB 1LWUB 3H1KE 4LF6O 1N33O 3CCRV 3CD6P 2WLKA 4UCTA 3KHUA 4EIJA 2GDSA 3ABLC 3B8MA 3SPIA 1JY2P 2W6JH 3H1LE 5KHHA 1G1XB 4P2ZA 4RQFA 2LJ2A 3G3ZA 2OYHC 3EFFK 1TGOA 1Q6UA 4JTCB 2VQEO 4L87A 2K3RA 5LXTB 3V2PA 4LFBO 3F5TA 3FGAD 2WPRA 2DYRB 4O4HA 4DXWA 4FLZA 4UV9A 1BE3G 4D7SA 1X4TA 1AVMA 5B1NA 4JZ2A 2E43A 4DR1B 4IGGA 4NXMO 2L5GB 3ZBHA 2W83C 1PV3A 5FPRA 2CK3G 3SGIA 1K9MQ 1BGYH 4EKWA 4IYIA 2XASA 5AVZB 2P67A 4AQYB 1M90Q 1R3LC 1VQMV 3VMXA 3CCLV 3JAMN 1SQVE 3H25A 4J11A 5DN6G 4D7TA 1FKAO 1Y47A 5KKZC 4WBNA 2JJ1G 3FB5C 3NXSA 2B87A 4HAMA 2JR8A 3M91A 2FYUJ 1L0LD 3H1KG 2Y4UA 1AVOA 3VYIA 2ZXEB 2ITCC 3V2QA 2PYJA 3LSUA 2O57A 3DGEA 5KA6A 1JOCA 1SQPK 2K9YA 2OCCC 3AG2C 2G38A 2E5YA 1XHZA 3HPLC 2Y48A 2WLNA 3RYHB 4DRXB 2X6CA 5HFMA 4FM2A 1MABG 2ZYGA 5LMUB 2JEXA 2EIKB 5EBLC 5GTHE 1S5LH 3CCVV 5AW8B 3N27A 2HHHO 3BCCE 2ZDIC 4X65O 1XL4A 3APQA 2DW4A 4IHJA 3WG7B 2CTRA 4DV2B 4UXNA 1MOFA 1OCOB 1JA8A 3KQGA 1VF5B 5GW7A 1VQ7P 4IFDK 4RESB 2QWPB 3AG3C 5C8YB 4N6JA 5K1XA 1JFFB 2QA4V 1OCCB 1Q8IA 2B1IA 3IAOA 1L0NH 1SA0A 2PY5A 1E79H 3CXHI 3AECC 2Q9IA 3MUDC 4UVBA 1BSNA 4ZI7B 1J2JB 1YXBA 3RW0A 4I55B 1NAYA 1P84F 4IFFA 2A06H 1FFXA 1XREA 4BW5A 2KSJA 3M8AA 1EDLA 4BR6A 4KUMA 1B06A 1YIJV 1S5LZ 1JMKC 2PTMA 4RQEA 1K73W 1EN4A 4FLWA 2P4KA 4Q6GA 4H0LC 3G6EP 1H8HG 1H0TA 1AR5A 3ABMC 4MT8A 3RK2D 1N7SC 3R66A 4UB8Z 1SFCC 1QNMA 1JNMA 1NR1A 1R6KA 3OW2O 5BR8B 3SWKA 4JPZB 3LDDA 4I50B 1N7LA 1P7GA 1GM7A 1L4AA 1RF0A 3I5DA 2LGWA 5IY5B 4DV4B 4JYYA 1BQZA 4PV1D 1OHHG 3LDEA 5CB4B 2KIKA 2WAMA 1HH0A 1CI6A 2R9IA 3OE7G 2YO3A 5GTIE 2WLLA 2ILMA 1S2EA 1PZQA 2XU6A 2ZFCA 1NJIW 4JQ0D 2A0LA 3SPCA 1J5EO 3VP9A 3HKEB 5J2TA 3SYPA 3O8ZA 1VQ9V 2A7WA 4GZRB 1NTZK 4UUJC 4WFAV 2YO2A 4DV0O 2QVAA 1ZRTD 2QJ1A 2EZOA 2XUMA 4M3LA 4U3JA 1GKFA 1IZ3A 1VQLP 3V4WA 3I56P 1WMKA 1KBHA 3OMIB 2P7TC 2WWWA 3A2FA 4DR2B 4GX1A 3RVZA 2WLIB 4EEQA 2PP6A 1BCCD 5IJ0B 3CCJP 3SDLA 2OTLV 1J1DC 2LXCB 3L70E 1SQQE 3HUSA 1FJKA 1H38A 3A0BH 1PP9E 4J7ZA 3IAYA 1K5QA 2GM4A 3DC5A 4EOTA 1KILE 4OGQC 4PA9A 3B5NC 2YIUC 4JYAB 2RN0A 5EBMC 1NTMD 3E8GA 4GKKO 1L4AD 3A0HH 3L74E 4PDLA 2IBZE 4ZKIA 2WMMA 3ZX6A 1QVFO 3C8VA 3JSNA 3KXDA 4JI2O 1SKVA 1GL2A 3AE8C 3SSUA 2N1TA 4C7NA 3J80N 3RGUA 1GK6A 3GVMA 1N86A 2ZXWC 1G2CA 2H7HA 4J80A 2ZJSE 3DSQA 4HKZH 4NPDA 3K5OA 4O2AA 3RK3B 2GV9A 4EI2A 4DCKA 4X64B 2X6AA 5KA5A 5B3SB 1KQFB 3W7TA 1SQBK 1SS1A 4X88A 1KILC 2FXPA 3SFEC 2YIAA 1CSBA 2Y9YA 3A0BZ 4LF8B 3AEBC 1K5SA 1Y74B 3CCEV 4O2BA 1SQXK 3MDSA 3JSVC 2W0FC 3ZN1A 1SQPJ 1PP9G 2BEZF 4LF6B 1GMJA 2HODA 3A0HZ 1QVFU 4GKGA 1JMMA 4I1LA 4TUYB 1I5YA 3HKBB 1FAVA 1R73A 1L0LE 2R9RB 2CPBA 3WUVA 1MNGA 1CXZB 4J9YB 1O9GA 1KQSU 3AE7C 3AE3C 1JB0J 4MN4C 2N04A 3TSIA 1XUQA 2HPCA 1M93A 3OT7A 4KHPB 1X79B 1NU1G 2O01J 2K9JA 4FLVA 5LP6C 3SJBC 3CD6V 1X22A 3HE5A 1ZR4A 1H2KA 1HNZB 5APYA 2EINB 4ZOLB 1KORA 2E76C 1IFIA 3O6QA 5CCHA 1JFFA 3BASA 3L75E 2AHYA 1N73B 4DV3O 2JGDA 2LFRA 1M57D 4U3FD 1ZL8A 1J1EC 1VARA 3BEHA 5C93A 1OWAA 5LHGA 4O4IB 1BHAA 1HR0B 4XA4A 5AVWB 2YUAA 1FD9A 4QPKA 1NH2B 2E5LO 2B9ZA 3TNUB 1FAFA 2D2CD 1M1KQ 2IYPA 3H1HJ 5K5GB 4RJTA 2ZT9B 3ASNB 3Q1MA 5B66E 5APQA 4FPPA 1XILA 1DEEG 3Q5RA 2E42A 4JI6O 4GUNA 4BW9A 2K1EA 4GOFA 2RCVA 1AVYA 4H13D 3H1JD 1GK9A 1KMIZ 1LTJC 4FFKA 1ZSPA 3G80A 3TETA 2JWAA 2E74B 4FLXA 2FKXA 1GO3F 4YJ3B 5KAIH 1NTZJ 5GONA 3I5CA 2AEMA 1Q7YQ 3OTFA 1LT9C 3HD7C 2O01H 2WITA 3L71D 3L75G 4YTPC 4CC6A 4B3TO 3RL0C 2W90A 3RYCB 5CCHD 3MD0A 5CCGC 1SF9A 5KJ7A 3CPWO 1L8DA 1QBZA 4NTXA 4IL6Z 1L0LK 2UXBB 3VOUA 3SPHA 4RWUA 2B89A 5EIBD 4CS2A 2JS5A 4C46A 5FLXN 1ZUQA 2WSEJ 2FFDA 1GW3A 4BAYA 3CX5D 4PI2A 4I7ZC 5KLVD 1VIBA 5B1BC 1NT2B 3GF7A 3JD0A 4ABMA 3S4RA 4BRYA 4I0XB 4W7ZA 1ZX3A 5LYJA 1BCCE 2Q68A 1ZOYC 5D5PA 3AE4C 2UUBO 3H1HH 2OYHA 3FFQA 4U7OA 2CDYA 1ENVA 2NPSC 1Q6HA 2JVDA 1H2NA 1I08A 1XDCA 4P9PA 1P84H 1GN4A 3G6EV 3LNMB 5H5NA 2AHZA 1J5EB 2FYNB 1YVWA 3ZHTA 1NTME 5K1PA 3L35A 1FC2C 1JTHA 2YEVA 1VPCA 1JPXA 1SQBJ 1TVKB 4DR5B 4JF3A 1NTZH 5TJHA 2N9BA 1AI5A 3OAKA 4FLUA 5KJ7D 2UXNA 3E1RA 2Q67A 2W6JG 3U1CA 2WLJA 3NFQA 4JAUA 3N2KA 1SQXJ 1IFJA 2CH7B 1M56D 4WF9V 5DECA 3VQYA 2WSCJ 4CH4A 4DV5O 2YXQB 2M5AB 1NVPD 1NTKK 2O01N 4DJGA 1PNKA 2EJRA 1QVGO 4B86A 2OYIC 5JJJB 1K34A 4QMAA 1FZFA 2LQTA 2QJYB 2OWOA 2P6JA 1YQ3C 1VQLV 2KI7B 3I56V 2WSEH 2R72A 3ZHVA 2PYLA 2JK5C 2C0WA 5CJ0A 2YKOA 1S0VA 2C9LY 5EYPB 2J59M 1RF1C 5LA6B 3BA9A 1YDXA 4OVNF 1BE3D 1G1JA 3L73J 1BGYG 4JI2B 3CCJV 2KLVA 1AP5A 2ZDIA 4LF5O 3LW5J 4X1YB 4PD4F 4GKJB 3CL3D 4WBAA 1BQ0A 3GF3A 1JCHA 1LP1B 3V2NA 3R4YA 5KHKA 1PL0A 2RDCA 1WLEA 2DW3A 4PD4I 5CJ4A 3IFXA 1WPXA 4DUYO 4DV6O 2AEJA 4LLHA 2I8DA 1WN7A 2VRSA 1YJ9P 2IJIA 2R44A 3H1KD 1BZKA 2GUZA 3D3QA 3QH9A 1XEQA 1SQBH 1CP9A 5CA0B 3BABA 3LDCA 2DYSC 1V55C 2Q9LA 3UT5A 2P7JA 4NXNO 5APUA 4I9QA 3MAQA 5AVXB 2P2UA 2KP8A 3KZIH 4U3FE 2WSCH 3CWBJ 3E7KA 1VDFA 4UB6H 2KSEA 2P06A 2BOBC 1N7SA 3ZHRA 3JAKA 1SFCA 3P30A 4CS3A 3P7KA 1WJZA 2UUAO 1RE3A 4CZZA 1L0NG 1E79G 2UXCO 1OCRB 3M9BA 4C7RA 2Q7GA 4O4HB 3ZIAG 3ABKC 2Q4PA 3W7XA 2KLUA 3CCSP 2D3OW 2VS0A 4JI4O 3L73H 4MSWC 1VEWA 3MP7B 2A06G 4YJ2A 2YC0A 4YJ3A 1WNSA 3LW5H 1BL8A 2ODMA 4JF7A 4JAVA 1EDKA 2ZAEB 4YXWH 2Z3YA 2GTAA 3L4FA 4JI1B 2PI5A 5AW0B 2BOCC 1AJPA 1L0LJ 3RBXA 1JVMA 5B5EH 5L3CA 5CA1A 4WBNB 5LMNB 4LF4O 2HFEC 1LJ2A 4D6TH 2B87B 1KFMA 2FL4A 3B40A 3KZIZ 3L71E 1VQ4P 2B1GA 4UB6Z 5AW2B 2E5LB 4L73A 3ZN0A 3CB2A 3CC7V 4BIZA 3RK2B 1U96A 3K04A 2F43G 3FYIB 3JD3A 2HVJC 1K7DA 3QWOC 5EFWB 2VWKA 5AVVB 2AZ2A 4DT0A 1GH6A 4PA6A 4H0LD 4I0XA 1K3EA 3ETQA 4RAIA 1N7SD 4W80A 1SFCD 4P9OA 4PV1B 1YTFD 5DJUB 1KECA 4IHJB 3CX5E 3CWBH 3R65A 3CCUP 2F66C 3G4SP 5HFLA 1W2EA 3RFRA 1QLEC 2A79B 1HTLC 2QJKC 2JS3A 4ZMDA 1XMOO 1DK1A 4L74A 4OH8B 1SQFA 3WU2E 2A3QA 1NGMB 3PHLA 5B5EZ 5KMGA 2QWRB 2XOKG 5IWAO 1OVVA 4FJCC 1YBKA 3FX0A 4DR4O 2K9PA 4DR7O 3CRCA 3ZDMA 3JYCA 1TVKA 4C7UA 1HWTC 2UXXA 4JI0O 2JDIH 4DYLA 2ITDC 3PN1A 1FFXB 1NTKJ 1KILA 2Y69B 1B04A 2O1JA 3N7NA 2AW9A 1M5IA 4ICGA 2EILC 3IGAC 1KB9D 4YY3O 2WVRA 2IU3A 3HB3B 1M1KW 1S5HC 1H0TB 3VBBA 1ZV8A 1UIXA 1PNMA 3HTKA 3ETDA 1L4AB 3S3XA 4MTOA 3P8CD 4OGQD 3B5ND 3JD2A 3N2GA 4LR3A 3L9DA 1CI6B 3EQ2A 2FYZA 3QO5A 2WLLB 3TF5A 5BY1A 4CH5A 1IFPA 1KYOD 1AB3A 4MVUA 4ASWA 2HR3A 2ZVNB 4JYBA 5LP6A 2EIJC 5J2TB 2ZIOA 4TLFA 1TAEA 1U97A 1GK4A 4O9BA 3U10A 1BDDA 3BPZA 1ROPA 4U3JB 1VP7A 1HJBA 4K0KO 1FZBA 1AQ5A 2BCCH 1BCCJ 1USEA 1AP6A 2HVKC 1PP9D 5APWA 4YHHB 2UUCB 2Y0DA 1CZQA 2A9HA 1RQUA 4UFZA 2Z5HA 1VF7A 3WB2A 4JASA 4DV5B 2CTWA 3W7SA 5KLVK 3ABVC 2Q3EA 4F4LA 2KZJA 2VQFB 3HUSB 3RGBA 1NTKH 3O65A 1EZVH 3FAVA 3NTNA 5L3BA 1FOSF 4LFCB 3PRJA 3BRTB 2EIMB 1UJWB 1NU1D 4KFMA 3MHSC 2E3CA 3AEIA 2KSDA 5KAIE 1BSHA 4JV5B 1QR8A 4AUWA 1GL2B 3AE1C 1YF2A 2JEUA 1W2BU 2DWDC 3H1IH 3JCUZ 2N1TB 4C7NB 4UCVA 2JJ2G 1G2CB 1LTJA 1GD2E 3JASA 3PJSK 3FWNA 3KG2A 2OCHA 3TXSA 4O2AB 3CI9A 4IL6X 2OGUA 2K88A 1YJNP 4DV6B 1YI2P 1M1JC 2JP3A 5LGNA 3J81N 2E5TA 1LT9A 2W0XA 3D70A 3HD7A 2E76D 1WRGA 5DJTB 1NO4A 1M57B 1JX9A 4YPCA 3VMYA 1PL4A 1USDA 5CCGA 3FXDA 3MTUE 4KL1A 1P49A 1XNQO 3VN0A 4O2BB 1LT1A 5E79H 2A45I 4ZHQA 1G8MA 3L72J 2D2CB 1XTCC 4NXNB 4PD4H 3QO8A 2HODB 3ZRXA 2BE3A 4LFAO 3CCQP 3OMNB 4MVZA 5TISE 4HZ3A 2Y0PA 3THOA 1AJYA 1P84E 1NZ6A 1LTIC 3OM3B 3CLQA 4NVPA 2HPCB 2UU9B 5IYCO 2J58A 2Q5ZA 5EZYA 5AVTB 4LF7O 2K9JB 4UB8H 4Y28J 3HE5B 1VMGA 2NPSA 3L75D 4TT3G 5BXZA 4JI7O 3CRAA 3ZRSA 2GUSA 2M7WA 1HNXB 1RM1B 2Y9ZA 3K5BA 1WT6A 3USSA 2Q0OC 3CXHF 5JQGA 3O6QB 2Y4TA 4LBEC 1FZCC 5E79Z 2HLDG 3SYAA 3HD7D 2JGDB 1EN5A 2F1MA 1ZL8B 3RL0D 4LF4B 3OTOB 1V54B 1I94B 2ZD9A 3BY6A 1R3IC 4TSFG 5CCGD 5IJ9A 1IK9A 3X2QC 2NNUA 2P22C 2WTYA 4K35A 2W8ZA 3H1HG 5AW5B 2GBOA 4CPGA 1GN3A 3CRMA 1S72V 3P3NA 4J42A 1FS0G 4Y99C 2FYUH 1DF4A 2OYIA 3L72H 3H1JJ 4JTAB 5DEDA 1IBMO 3J7AU 4X62O 3GMAA 1JR9A 1NH4A 1KB9E 2OTJP 1NS1A 1VQ4V 1E5WA 3JSLA 3C9IA 1RF1A 1NTZG 1WB7A 4TWKA 2IU0A 1SRYA 4L75A 2YDEA 1XMOB 1SQVK 2CTQA 2NPSD 4FMTA 3OD4A 3TDKA 2Q8VA 5GONB 2QKCA 3P8CE 2YIDA 4JI5O 3TK1A 4XDJA 3JATA 1PD3A 3AE6C 5H2FE 4DW0A 5IWAB 1E1QG 4DR4B 3OR7C 5JJEB 1JCCA 3RN4A 3G4SV 2Y0CA 3TGUJ 3N4XA 1AROP 5J2UA 4J10A 1VQ5P 1KYOE 1M56B 5APSA 4WY4D 1IJDB 3Q4HA 2Y0EA 5KLVJ 2OQQA 3OEHG 1NVPB 3AG4B 2IJJA 1FJGB 2Q7HA 4OX9B 4L76A 2FFDB 5ITZA 1ZMEC 1R6NA 1RSOA 2DQ0A 4YY3B 4FLYA 2KK7A 2RJZA 2V4HA 1HBWA 2OARA 3MZWB 4N3YB 4DK1A 4B3SB 5BU8B 4X1KA 2K1AA 4WVZA 3T97A 1H8EG 1S1CX 4BRYB 3QVNA 3FB7C 2WZ7A 1BGYD 4GIFA 3ABLB 5LYJB 3LUTB 1P7BA 3ZHSA 3L37A 2WT7B 3CRRA 3K3WA 1VQ6V 2JJLA 2RMKB 3PH0A 4OWFA 3FD9A 2OYHB 4YXDC 2OT5A 3CSXA 1SZXA 2IH3C 2Z5UA 5B1AC 4FM1A 1Q86Q 1WAZA 2Q73A 1T6AA 2V7QJ 1NU1E 1EFRG 1KQSO 4DV7B 3BVHA 1JTHB 3T4DA 4D6TE 1DLBA 2IFMA 2YEVB 1JM0A 3SJCC 2PF4E 1PKXA 1D2DA 4K0KB 2QG4A 2LP7A 4TV9A 3RWRD 1T2KC 1FJPA 4PJ0E 3H01A 3N2KB 1GMGA 1SS3A 1I0HA 4LNUA 2YKQA 3JALA 1F4NA 3K59A 1FXKA 1N34O 5LBQA 1IFDA 1FZAA 1EXJA 5B1OA 3CRQA 4I5SA 1EN6A 3HR0A 4X20A 5APTA 4X66O 4N23A 1N33B 3D71A 1ZWIC 2OCCB 1N36O 3AG2B 1BE3J 4WB4A 3L73G 1L0ND 1IBLO 4JTDB 2IX7C 3T1HO 1IO4A 4N78D 2NN4A 2ZE8A 3ETGA 5EC1C 2RQ6A 4YXWG 1MKMA 2VQEB 2NR5A 1MA1A 4HBNA 2Q7CA 2A06D 4LFBB 1X8YA 1Z5WA 2ITAA 2ZVOB 3G9RA 4CH6A 4D6TG 2LFSA 3JC22 1M4UA 5AVYB 3H1KJ 3QTCA 4I9WA 3AG3B 2XAQA 2IBZI 4NXMB 1YITP 4JI3O 2KOGA 1SQQK 3H1LJ 2GUZB 5C39A 3D36C 4JYCA 3T1YO 2KUBA 4X8AA 1AFOA 2HG5C 3IFMA 1RE4C 2YS8A 2AXTH 3UT5B 1J95A 2HFED 3CWBG 5FPOA 1YJNV 4MS2A 3HKCB 1YI2V 4LFAB 4FZ1A 4LWSB 2UWJE 4IL6H 2F93B 1GN6A 2CGNA 3A3YB 1LTGC 2KXPB 4H0LB 3WB0A 3ABMB 1N7SB 5APXA 1SQPH 3JAKB 1SFCB 3WUUA 2YIBA 1YTFB 2WSSH 1DGSA 1JMBA 1KP3A 2JKVA 1FBMA 2HHHB 4YIPA 3H6PA 3WMM0 4X65B 1F7YA 2N05A 1N8RQ 2OIEA 1RQVA 2A45H 1SQVJ 1D7MA 4FZ0A 4F6EA 3CCQV 5KAFH 2JDIG 1VQKP 2RH0A 3ML0A 1YEWA 2BCCE 1QLED 4YJ2B 3Q2YA 3ABUA 1QX8A 1OCZC 2ZINA 2XT9A 4K8ZA 2ETNA 4B3RO 4IIJA 1XMQO 2AXTZ 1PPJH 1K9MW 3ASOC 4B3MO 3ZMTA 5LL6Y 2XDJA 3ZMUA 1M90W 5CA1B 1BHBA 5LHHA 1IVSA 1H2LA 1ZN5A 1Y67A 2B5UA 3IR9A 2PAJA 2H88C 3BCCJ 3EFGA 3H1LH 5JVDA 2KKWA 1SC5B 1VQ7V 4GLXA 1XNRO 5CMUA 1FFTB 3D6YA 3DTUB 1J1DB 1KUQA 5L8RJ 3ABTA 4QIWF 2CAZC 5KUMA 1RH5B 1TA8A 1P4RA 3CXHH 5AVSB 2F95B 3DC6A 1N0NA 1EDIA 1M8OB 4U7NA 3GLMA 4OGQB 5KAFZ 3B5NB 2YIBD 2WPDG 2YIUB 3U59A 2WT7A 2MKVA 2KQXA 1US6A 2QE7H 2AEFA 3AE2C 2BCCG 4H44C 4K3AA 3FB8C 1BGYE 2XZRA 2ZXWB 4R8CA 2L6LA 1X59A 4PDVA 5KMGB 1FE6A 2E75C 2HYNA 1SQVH 4MW3A 2ZXXA 3F5HA 1ZR2A 2HJFC 1MZ9A 1Z2GA 3E35A 1FU1A 4UCRA 3FWLA 2B9BA 5D5QA 5J9PC 4DV0B 2K37A 2OTJV 2ZM6O 5H9CA 1NTKG 2DJVA 4FLTA 1EZVG 1M1JA 2BSKA 4WY4C 4EFEA 3E22A 3B09A 1W0JG 3M7MX 1KILB 3ZS8C 1QGKB 5AW7B 4GX2A 1S76D 2Q6QA 3RT3C 3T2MA 2WLMA 4DV1O 3W7UA 2YMKA 3IC7A 5LGTA 1K04A 3D6ZA 2QM8A 1W0KG 1S5LE 2Z0AA 3H1IG 3B8EB 2F4VO 2P58A 3BCCH 3OJAB 4PA7A 3W68A 4A7PA 3HTKB 1F4MA 2XAFA 1OFCX 2P1JA 1VQ5V 4UB8E 2FBWC 3HKDA 5L3EA 4GKKB 3CE2A 2M3EA 1EXIA 3N2GB 3KCXA 1SQGA 3UQ8A 1NBMG 2UXDO 3AE9C 3JD1A 4MVRA 1L0NE 2CPSA 5LP6B 4DR6O 1N32O 4MVSA 3ZHUA 3C3TA 2R5DA 1PGOA 4N78E 2IPPA 4MW8A 3L70J 2JIZG 1SQQJ 2E76B 1SQPD 1PP9J 3FX7A 2A06E 2I1KA 1FZCA 2XHBA 2GSMB 2XNXA 2R32A 2ATKC 2QSAA 2GTSA 4ZKUA 5GTHZ 4Z2WA 1Z56A 5KX5A 2MK3A 3L74J 3MUDA 1J1EB 1T5EA 1NKNA 1PL5A 1AI6A 3M06A 3U1AA 3AG1C 4FFBA 3GHGC 4EB6A 2ZYDA 4O4JA 1URQC 3UM7A 4RO0A 4LC1A 5JH7A 1QCEA 1MV8A 1YHQP 3UCSC 2XAJA 3FAVB 3HKCA 4HNAA 1SQXH 1PIXA 1THZA 4LWSA 1N36B 3V6IA 2EX3A 1LR1A 4MTXA 2IZ0A 1NTMK 5GTIH 4GCZA 1UPGA 3T1HB 2FTKA 3U11A 1KTMA 3OUSA 4GODA 4XBFA 2QJPC 2O1KA 1IURA 3O9OA 1XTGB 1LTJB 4JGSA 1DD4A 3JASB 2LGQA 4R50A 2X7RB 2DQ3A 1I7FA 1LWUC 4RUEA 1HF9A 5FNVA 1HUCA 2YMYA 1A02F 2RMZA 1LT9B 5APVA 4UCUA 5EC2C 3HD7B 1PM9A 1RPRA 1AQTA 3AK2A 4P30A 1S77D 3RL0B 5LOVB 1EM1A 5LMUO 1BS3A 3E8BA 2P90A 4DV3B 3L70H 1XOUA 2FYUG 3H1HD 1SQQH 3L72G 2N1TC 3A0BE 1DX7A 1P84D 2DYRC 3DXRA 4NR1A 4ZHQB 4DV2O 4PDRA 3M9HA 3K9SA 1S9KD 3ZMZA 5GTIZ 1YITV 3L74H 2IBZH 2QDOA 4I7ZB 4B7EA 3A0HE 1L0NK 5B1BB 2FXOA 4PHZA 1YIJP 3ETEA 1NTZD 1AI7A 3E89A 2IYOA 1VQPP 1MUUA 3E8FA 1H2MA 1ZXGA 4KXRA 2IJKA 4JI6B 2PZSA 3L75J 1GDTA 3B5NA 3VQVA 2KNCA 1FDMA 5EZYB 1BT8A 1OX3A 1MSDA 1PGPA 2NPSB 2Z5IA 3CP1A 1MSWD 4I4TA 5CA3A 4MVMA 2KB7P 3GW6A 1ZAUA 5JQGB 1FPOA 3G6BA 3RYIA 1XMQB 2RNBA 4JBZA 4B3TB 1MZFA 4UVAA 3K0GA 2EIKC 4W4KA 2R5BA 5BR8O 1QLNA 3OGCC 3HE4B 1IXBA 2QWNB 1QR9A 2PGDA 3WG7C 1VQKV 5IJ9B 3A0RA 1F23A 1XNRB 1OCOC 5M1BA 3K79A 2Q3IA 1L0LH 1X0TA 1BDCA 1VF5C 5BU5A 4PELA 3CC2P 3I55P 3VP8A 3BVOA 2QSIA 5AW1B 2OYIB 2ZIMA 3K5MA 1OCCC 4QPJA 2OTLP 4X1IA 4NKGB 3CMEP 1QU7A 4W7YA 1NR7A 2FKWB 3R2PA 3MHVA 3OFNG 1IDSA 1OZ0A 1VQOP 2UUBB 4PA3A 5A9GA 2AZ0A 5JJNB 4PI0A 1RF1B 4W4LA 3BRVB 1N8RW 1SQBD 3AE5C 3PTZA 3M9QA 1H89A 1EBOA 4J7KA 4GX0A 3RYFA 3TXQA 2C2AA 3P3PA 3CX5F 1LTTC 1SQXD 4R7CA 3UO3A 3JATB 1R5LA 1JY2N 1JCDA 3QF7A 1Q7YW 5L3DA 4UCOA 3K5NA 3JCUH 3CX5I 1W2BO 3SFDC 4FM0A 2QWOB 5H6RA 1R6TA 2KZIA 3H9VA 1H2GA 5J2UB 4JYAO 1OMIA 4IL6E 1WA8A 3WFVA 5IY5C 3Q4HB 3Q3DA 2KYVA 1T2KD 5E1AC 3VMZA 1M9NA 1HVVA 2W27A 5ITZB 3Q5SA 1A32A 1RE4A 1RSOB 4G27B 5IDJA 1SQPE 2DYSB 1V55B 2F23A 5B66H 4WFFA 4JPRA 3L73D 3II6A 3ZCCA 4X1KB 2EULA 1OW7A 2M3BA 3T97B 2QKAA 2H8PC 1ZTEA 1NTMJ 4XDLA 4X64O 1Q5OA 1K05A 1KC8Q 5A2QN 4J7JA 1S3JA 1OVRA 3UIAA 4DR3O 1U57A 4NTYA 4D6TD 1AV1A 4GDOA 4LF8O 2V1DA 4NTWA 2FXMA 4O4LA 4LF5B 1L1FA 2ZNJA 3ABKB 4IOIH 2B88A 1RP3B 1N32B 1COWG 4H37A 3M0DC 2WPSA 3BATA 1RHZB 4LH6A 4DUYB 1HGVA 1YJWP 2FMLA 2YSUB 3GWKC 3LSSA 1H8AA 4TV9B 5IT9N 5B66Z 2M6YA 2DN9A 1DIPA 3CWBD 1JJ2U 1LNQA 5LOVA 4QE7A 4LNUB 1GZLA 3JALB 1SQPG 3ZHQA 3E86A 1FXKB 1ORQC 1EZJA 2WSSG 4KHPO 2AGAA 3CXHE 1NAFA 2JGUA 2HG5D 3CCMP 5AW4B 3S1KA 4X20B 1A02J 1BCCH 1SVFA 3LSQA 1L0NJ 2A45G 1SZTA 4WFBV 1HNZO 1K4DC 1VF6C 3W7WA 3RK3C 3H1HE 4MVOA 1RFYA 1YJ9V 2Q1KA 4R6ZA 5B3SC 4BXLA 3SYQA 4I2LC 4QE9A 2AXCA 4LF9O 4NPFX 3OEEG 1FS0E 1JJOA 1MFZA 4BIOA 3D3IA 1E1RG 4H13B 4JAAA 3EVKA 4L8JA 1S9KE 2LKMA 1NTMH 2UUAB 1PPJG 2Q6AA 2QM4A 2UXCB 3SWFA 2IW5A 1YHQV 2OYQA 3LNNA 1QL2A 2H3OA 1OJHA 1QLEB 2QJKB 2QRXA 1HR0O 5AVUB 3WUTA 1NTZE 4JI4B 2XAGA 3CEIA 1YZBA 3H1LG 1OW6A 1YSCA 3B71A 4HH2A 1T3UA 4RO2A 4BWNA 1OW8A 2O3JA 4U3FJ 5BMVA 2N74A 1FYJA 4F6RA 4HJGH 4WCEV 3G71P 4CBCA 4HB1A 1LTSC 1IFMA 1NYHA 3BAAA 3HE4A 2DWEC 5CBOA 4OPAA 4WY4A 5IYZA 1KQLA 4EDFA 3CCSV 2LXBA 5KLIB 1QHTA 3U0ZA 1URFA 3ZRWA 1HP8A 1HGZA 3P8MC 2JEEA 2QE7G 4LCUC 3VQWA 4AI8A 2EILB 2Y0IA 2EINC 1HNWO 3C90A 2KG7A 4QJFB 1N2DC 2PI4A 3SYOA 1GTOA 1SQVG 2L91A 2BCCD 1N73C 1XL6A 4OXSA 2XNDH 1Y76A 4AILC 1SETA 3CXCU 1JO5A 3T4ZA 2UXBO 4AYCA 1KKCA 3V2RA 1D5AA 2Q69A 1JOYA 2WSFJ 4NYKA 2ZYAA 4OPHA 3SR2C 1PFIA 3OGIB 4DUZO 1HDJA 3L71J 4H44D 1P84I 3EXAA 1I5XA 4KHXA 1NTKD 1EZVD 3AEGC 2XV5A 2EIJB 1VQPV 4IIJB 3JARA 3APOA 2ARHA 1PNLA 5CBFA 4WFEA 1SQBE 2E75D 2ZE5A 1SLQA 2ZT9C 2XTAA 3ASNC 3BCCG 2ZE7A 4DR7B 3CCUV 1RE3C 3LIDA 1AI4A 2R70A 4Q20A 5BVZA 5IYDO 4JI0B 2IH1C 3E2EA 1LTBC 1GM9A 1B3QA 1SQXE 4U3FH 3H1ID 4XE5B 3E83A 5JVDB 3ICXA 3KZIE 1XQ8A 2YXRB 2E74C 1GU5A 4UB6E 4BWAA 2MW2B 3GHGA 2ZQMA 3JAWA 1QQCA 1Y6XA 5FL7G 1URQA 5AVQB 4FIPC 4HYOA 4FK5C 4TV8A 1JY3N 2XKMA 3ZMVA 2OIGA 4DR5O 3PP5A 1HJ0A 2KS1A 3L73E 4GOEA 4GYCB 2FY8A 2YI9A 4QNHB 2QKSA 3H1JH 1IZNB 3CC2V 3I55V 1UFIA 3OW2U 3IN6A 2IFNA 3F7VC 1KN7A 3LIEA 4PD4D 4HYTB 1KB9F 1S5JA 5CBNA 1KD1Q 1SQBG 5B5EE 3CMEV 3CJHA 1LWUA 1DD3A 2WSFH 1SESA 1JY2O 1KB9I 2ZR3A 4KP4A 1T8ZA 1VQOV 5CMZA 3L71H 5KTBA 1M1JB 1G6UA 2OYOA 1SQXG 4Z1MH 2BSKB 4Z1VA 3E22B 2PUSA 2EBOA 2OTKE 1LUWA 2J5UA 4JI8O 2H43A 1AR1B 5KKZB 2IM9A 5LXTA 2QIWA 2YKPA 4AQRD 4GKJO 3BFRA 1G4YB 4TQFA 1VL2A 2RKLA 3TGUH 1KYOF 3L36A 1YTZT 1HW7A 2BTQB 2FYNC 3CX5H 3STLC 5KLVH 3EHBB 1URQD 3CWBE 3CMAP 5AG2A 1KYOI 1R3JC 3SWYA 2NRGA 3KPEA 3HKDB 4PDMA 1LUVA 1GRJA 3VQXA 5JCOC 3WU2H 4K8XA 3AG7A 4DR3B 1JY3P 1QEXA 1DF5A 3H32B 3W67A 2NLJC 1QL1A 5KUKA 1OVUA 3ZJZA 1ZLLA 1Q90D 2QTSA 4GX5A 3JCZA 3L70G 1SQQG 4LGDE 4ASUG 2C9NY 4DK0A 1NKDA 1FDIA 2G3AA 2QJYC 2FYUD 3L72D 1FZCB 4WWIA 1G1IA 3ITKA 3L74G 2IBZG 3E8HA 3RYHA 4DRXA 1DTOA 3KCYA 2V7QH 5AW6B 3SYCA 1GU4A 5KX5B 4CC5A 1AJNA 1Q81Q 4RKUJ 4IT5A 3A2AA 1XNQB 4DOJA 1H88A 4FFBB 1GL2D 3NMDA 4EB6B 5H6QA 1AILA 1NHLA 3X2QB 3OR6C 4O4JB 2N1TD 2BASA 5JH7B 5LHIA 3OA7A 2ZNIA 5EK0A 4WFGA 4LP8A 1YJWV 4HNAB 3WU2Z 2YNYA 2I1JA 3IC9A 2X6BA 2BTOA 1V9PA 4LH7A 1S4XA 1JEKA 3VMAA 2QR4A 1KFNA 5C8YA 1KC8W 4Y99B 3CC7P 1W59A 4LF9B 1NU1K 1Y4MA 3B4SA 3KDPB 1Q82Q 2ZCEA 1R8EA 1WPBA 3BHPA 4JI1O 4GT1A 2CUGA 3M99B 4ZBMA 3CCMV 1IC2A 4R4MA 4ZI7A 5LMNO 1M7LA 3A5TA 3K06A 3JCUE 1BE3H 1K8AQ 4LF7B 3OUFA 4I55A 2W6AA 1KKDA 3KYQA 4JI7B 1ZW0A 1TUEB 5FNVB 1IXMA 3P32A 3WB1A 1EQ7A 3K08A 2CK3H 4KT0J 2YXYA 3JD4A 2WPQA 2CGOA 1L0LG 5KHIA 2GHYA 4DO2A 2YXLA 2H94A 1N0JA 4G2KA 1YYCA 1CW5A 1Q43A 2Q7EA 3SJAC 2P10A 4I50A 2WPVB 3H1KH 3SPJA 2HJDA 2YICA 1NTKE 3M0AA 1OCRC 3SPGA 1EZVE 3DXRB 3A8TA 2R9AA 2Z4EA 5CB4A 3OMAB 2Q0AA 1XBLA 5BZBA 3CC4P 1HNWB 1D5NA 2ZKOA 1XHXA 1VF5D 3G71V 1FXVA 4IFMA 4XFJA 2QEXP 3H1IE 3HKEA 1IBMB 2M0BA 4X62B 1W5CE 3IJ4A 2KNCB 2LW7A 4TT3H 1VQ8P 4CS4A 3MIWA 3AK1A 4I4TB 2L35A 3TGUD 2ZR2A 4DUZB 2WLIA 3C3SA 2G8YA 3QNEA 1H2SB 5B1AB 1ZRTE 5IJ0A 3K0DA 5EBWC 4JI5B 3RK2C 3V5BA 3RYIB 3M0DA 5CBGA 1U7MA 5E79E 4U7JA 1IFNA 4JZGA 3TCUA 1TUBB 1FDOA 2DE0X 4PV1C 4PD4E 4UV8A 5TISH 2P5OA 5KAIZ 4N21A 4WFHA 1KP2A 4X9QA 1NKZB 2X0LA 2NZ2A 2YI8A 1VQNP 4NPEA 5AVRB 1Q2NA 2VRZA 2W6IG 3CPWU 3MGNA 3GWOA 1GN2A 5GTHH 3V4QA 4X89A 5AW9B 2BTQA 3B2EE 3FYEB 4X1IB 4B7KA 1SERA 1VF6A 1IBKO 1EZVI 2JWDA 2QTOA 4G28B 3SJQC 1OV9A 2H8PD 3K58A 1GM8A 1HWYA 3K9AA 1JY3O 3AEEC 3CCRP 1RPOA 4DW1A 2C0XA 4J9ZB 2QM7A 3H32A 5L3FA 4YHHO 1AJQA 2UUCO 1RY3A 1GAXA 2Y69C 3RYFB 1Y74A 1Y8AA 1YTZI 1CPYA 2VQFO 2H89C 2QGNA 4UCSA 5TISZ 3ZMSA 1R3KC 1BCCG 2LW1A 1JUNA 4LFCO 4TUYA 1KZUB 1L4AC 1RF0C 2ZE6A 3HKBA 1WA8B 3RVYA 4I6MC 3G67A 3E1IA 1FZEA 3QO7A 5IYBO 4B08A 4JI8B 1IX9A 4JV5O 3OAAG 2N9YB 2W6BA 2XAHA 2HEPA 1R1BA 3B77A 2FYUE 1VQMP 1NQTA 1OZHA 3L72E 1N34B 3QG5A 3CCLP 2MJZA 1NTMG 2EZPA 4ASVA 2HKOA 4KJMA 2WQYC 3IF4A 1KB9H 2IJHA 4X66B 3UKMA 1NU1J 4TQDA 4ZOLA 1ZP0C 4D6TJ 4DR1O 1B6QA 1PPJD 3RK3D 1IBLB 2KB1A 3F89A 1QVGU 1FZGA 1MFTA 1S5LX 4AQYO 1N73A 2DMXA 3GG2A 4RUFA 4O4LB 5H2FH 3AEFC 3H1LD 1PV0A 1KQGB 3CCVP 1K33A 1AR4A 2SPZA 2EJ7A 3K03A 4MVQA 2WLHA 3CMAV 1BMFG 4O4IA 1Q86W 3HUSC 5F2VO 1KD1W 2CE4A 3TJTA 1KYOH 1IK7A 1K73Q 3TNUA 3NR7A 2M8RA 3ZRVA 1OCZB 3CXHD 2EIMC 4JI3B 2IZ1A 5IE9A 1YCIA 1Y66A 3ASOB 3HRNA 1O9HA 1BSMA 2QA4P 4PA4A 3T1YB 3B8NA 1GL2C 1GW4A 3AEDC 3FXEA 2UU9O 3K57A 1EDJA 1PP9H 1TU3F 1Z5VA 2XNDG 1AA0A 3UO2A 1EC5A 4A5UB 3S3WA 1F51A 1HNXO 4MTFA 1SQVD 1DEBA 2Q5UA 1NJIQ 1DH3A 3CS5A 1GTWA 2P4VA 3H1JE 5H2FZ 2ADPA 2QWQB 3KKYA 1S72P 1OIPA 1M57C 1YQ4C 3RL0g 3EWKA 5KHGA 5DM6V 3RYCA 1NWQA 2V4DA 1NU1H 1K92A 1FXKC 3OTOO 2FB5A 5LGUA 1I94O 3FKSG 4FVMA 3A7OA 2RN9A 5AW3B 3F5WC 1KV4A 3K5LA 4H44B 2WA3A 2D2CC 1FXHA 4U3FG 2CTPA 2FYUK 3BCCD 4PJ0H 1K4CC 4H33A 1NVOA 4CH3A 1NH2D 2E75B 2PGGA 4B3RB 5BMVB 2WA4A 4F6RB 1LTAC 3GB7C 4B3MB 3TGUE 4H13C 1UIIA 3F7YC 1VQ9P 2ZT9D 1TUBA 1Q81W 4WY4B 4EFBA 5IYZB 5KLVE 5JWPA 1U7JA 3VOPA 4DV4O 3CYOA 4DZOA 5CBHA 2HLOA 3ZRWB 4E2LA 1RM1C 4MTGA 2E74D 2PRRA 5L3GA 3H1JG 4XDKA 2BCCJ 2KG7B 4ZNCA 3ZEDA 1N4CA 5CCHC 2YXHA 1SA0B 1Q6IA 1Q82W 1R5SA 2GA1A 3PLNA 1Y76B 4ZKPA 1SP4A 2HP8A 2ADQB 1JQ0A 2R3CA 1V54C 5JCOA 3C1LA 3L71G 4PJ0Z 5EIBC 5KLIC 4Z1MG 1K8AW 1PGJA 1VQ6P 3FB6C 3CC4V 4DR2O 1FJGO 2CH7A 2BEQD 1FOSE 4OX9O 4ZIBA 4EYYQ 1K97A 3L75H 1NI8A 2QEXV 2M5AA 4YIOA 3MHHC 1MG1A 2JO1A 3AEAC 3JARB 1WB8A 1CEZA 4B3SO 1NOHA 1T3JA 4J41A 2IDBA 2GUVA 1MZEA 2DOSA 2LR2A 3TGUG 2AXTE 1X9VA 3H1IJ 2ZM6B 1VQ8V 1XI1A 5KLVG 4UVCA 3S9OA 3STZC 3RBZA 5EYPA 1Q3EA 5LA6A 3CHXA 3D36A 4NB5A
chains in the Genus database with same CATH topology
4H0LB 3AEDC 2D2CB 1VF5B 1FDOA 3AEGC 4PV1C 1TU3F 1EXIA 1S1CX 2E75D 2ZT9C 2NZ2A 3AE9C 1KQFB 3IAOA 1AJYA 3SFEC 1RQVA 1Y9BA 2FXPA 4RKUJ 3AECC 1UIXA 3AEBC 4YXDC 2WSEJ 4I7ZC 1DIPA 2E74C 3Q2YA 2E76B 3Q5PA 4R4LA 4OGQD 2BEZF 1YQ4C 3RL0g 3EWKA 3GF7A 1GMJA 4Y28J 2V7QJ 3AEEC 3RK3E 1ZOYC 3AE4C 1R8EA 5M1BA 4H44B 4H0LC 1PL5A 2D2CC 1VF5C 3AE7C 4R4MA 2H88C 3AE3C 1HJ0A 1JB0J 2QSIA 2E75B 2H89C 1PIXA 4H13B 2O01J 4PV1D 3IN6A 3D6YA 1EXJA 4H13C 4KT0J 2ZT9D 5L8RJ 3FGAD 1RQUA 1KORA 3AE5C 2E76C 1KTMA 3GLMA 3D71A 4OGQB 1DD3A 3O6QA 2QJPC 3ABVC 1OW6A 2P10A 2WPVB 3B71A 1DD4A 4Z1MH 2E74D 2MKVA 1OW8A 3AE2C 4H44C 2WSCJ 1MKMA 1PV3A 3GMAA 2J5UA 2WQYC 1HF9A 3SFDC 1WMKA 1NYHA 3G9RA 2E75C 2QIWA 1ZP0C 3H25A 1OMIA 5KKZC 4H0LD 1VL2A 2D2CD 1YQ3C 1VF5D 3Q3DA 3AE1C 4XFJA 2FYNC 4PV1B 5KLIC 1S5LX 3Q5SA 2ZT9B 3Q1MA 2BEQD 3AE6C 3AEFC 2QJKC 1KQGB 3Q5RA 1KILE 4OGQC 4IL6X 2K9YA 4TT3H 1OW7A 3T97B 4H13D 3LW5J 2YIUC 4H44D 2JO1A 3AEAC 1NGMB 2IDBA 1KMIZ 2JP3A 2YMKA 3GF3A 1FDIA 1K04A 4I7ZB 3D6ZA 3D70A 2E76D 1IK7A 1K05A 2E74B 1Q90D 2G8YA 3C8VA 3R4YA 1ZRTE 3AE8C 2OQQA 3S9OA 1U57A 2WSFJ 1ZMEC 4GDOA 2FBWC 4YTPC 4U7JA 2G3AA 2QJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L X;  4H0L B;  4OGQ B;  2D2C B;  1VF5 B;  2ZT9 B;  2QJP C;  2QJK C;  4H44 B;  2WPV B;  4IL6 X;  2K9Y A;  3LW5 J;  2YIU C;  1JB0 J;  2WSC J;  4RKU J;  2QSI A;  4I7Z B;  2E75 B;  2E74 B;  1Q90 D;  3C8V A;  1ZRT E;  2WSE J;  4H13 B;  2O01 J;  2QIW A;  5KKZ C;  2E76 B;  2WSF J;  4KT0 J;  5L8R J;  2FYN C;  4PV1 B;  4Y28 J;  5KLI C;  2QJY C; 
#chains in the Genus database with same CATH topology
 4DV1 B;  3AG1 B;  3GHG B;  2LO1 A;  1LGH B;  3JAW B;  4X1Y A;  1URQ B;  1BGY J;  2F4V B;  3CCE P;  1LP1 A;  4AHC A;  4DV7 O;  2R3S A;  3T1C A;  1BE3 E;  4TV8 B;  1Y9B A;  1IBK B;  5KHJ A;  2PFX A;  5CHX A;  2POH A;  3BRC A;  3BA8 A;  5KJ7 C;  5KAF E;  2VWJ A;  2KS1 B;  2JRI A;  3L70 D;  1VQN V;  1SQQ D;  1WP7 A;  3D8C A;  1M56 C;  4R4L A;  3Q5P A;  1KU9 A;  5CN0 A;  1L2P A;  4TOI A;  1ZLZ A;  3AK3 A;  4QGP A;  4E4E A;  2V7Q G;  3AG4 C;  1WP8 A;  2UXD B;  1KIL D;  2QJP B;  3TYY A;  2FFD C;  1PGQ A;  4IYH A;  4BIU A;  1OXZ A;  5CA0 A;  3VTP C;  1PPJ E;  3RK3 E;  1MMM A;  4DR6 B;  3L74 D;  2IBZ D;  3CJH B;  1LWU B;  3H1K E;  4LF6 O;  1N33 O;  3CCR V;  3CD6 P;  2WLK A;  4UCT A;  3KHU A;  4EIJ A;  2GDS A;  3ABL C;  3B8M A;  3SPI A;  1JY2 P;  2W6J H;  3H1L E;  5KHH A;  1G1X B;  4P2Z A;  4RQF A;  2LJ2 A;  3G3Z A;  2OYH C;  3EFF K;  1TGO A;  1Q6U A;  4JTC B;  2VQE O;  4L87 A;  2K3R A;  5LXT B;  3V2P A;  4LFB O;  3F5T A;  3FGA D;  2WPR A;  2DYR B;  4O4H A;  4DXW A;  4FLZ A;  4UV9 A;  1BE3 G;  4D7S A;  1X4T A;  1AVM A;  5B1N A;  4JZ2 A;  2E43 A;  4DR1 B;  4IGG A;  4NXM O;  2L5G B;  3ZBH A;  2W83 C;  1PV3 A;  5FPR A;  2CK3 G;  3SGI A;  1K9M Q;  1BGY H;  4EKW A;  4IYI A;  2XAS A;  5AVZ B;  2P67 A;  4AQY B;  1M90 Q;  1R3L C;  1VQM V;  3VMX A;  3CCL V;  3JAM N;  1SQV E;  3H25 A;  4J11 A;  5DN6 G;  4D7T A;  1FKA O;  1Y47 A;  5KKZ C;  4WBN A;  2JJ1 G;  3FB5 C;  3NXS A;  2B87 A;  4HAM A;  2JR8 A;  3M91 A;  2FYU J;  1L0L D;  3H1K G;  2Y4U A;  1AVO A;  3VYI A;  2ZXE B;  2ITC C;  3V2Q A;  2PYJ A;  3LSU A;  2O57 A;  3DGE A;  5KA6 A;  1JOC A;  1SQP K;  2K9Y A;  2OCC C;  3AG2 C;  2G38 A;  2E5Y A;  1XHZ A;  3HPL C;  2Y48 A;  2WLN A;  3RYH B;  4DRX B;  2X6C A;  5HFM A;  4FM2 A;  1MAB G;  2ZYG A;  5LMU B;  2JEX A;  2EIK B;  5EBL C;  5GTH E;  1S5L H;  3CCV V;  5AW8 B;  3N27 A;  2HHH O;  3BCC E;  2ZDI C;  4X65 O;  1XL4 A;  3APQ A;  2DW4 A;  4IHJ A;  3WG7 B;  2CTR A;  4DV2 B;  4UXN A;  1MOF A;  1OCO B;  1JA8 A;  3KQG A;  1VF5 B;  5GW7 A;  1VQ7 P;  4IFD K;  4RES B;  2QWP B;  3AG3 C;  5C8Y B;  4N6J A;  5K1X A;  1JFF B;  2QA4 V;  1OCC B;  1Q8I A;  2B1I A;  3IAO A;  1L0N H;  1SA0 A;  2PY5 A;  1E79 H;  3CXH I;  3AEC C;  2Q9I A;  3MUD C;  4UVB A;  1BSN A;  4ZI7 B;  1J2J B;  1YXB A;  3RW0 A;  4I55 B;  1NAY A;  1P84 F;  4IFF A;  2A06 H;  1FFX A;  1XRE A;  4BW5 A;  2KSJ A;  3M8A A;  1EDL A;  4BR6 A;  4KUM A;  1B06 A;  1YIJ V;  1S5L Z;  1JMK C;  2PTM A;  4RQE A;  1K73 W;  1EN4 A;  4FLW A;  2P4K A;  4Q6G A;  4H0L C;  3G6E P;  1H8H G;  1H0T A;  1AR5 A;  3ABM C;  4MT8 A;  3RK2 D;  1N7S C;  3R66 A;  4UB8 Z;  1SFC C;  1QNM A;  1JNM A;  1NR1 A;  1R6K A;  3OW2 O;  5BR8 B;  3SWK A;  4JPZ B;  3LDD A;  4I50 B;  1N7L A;  1P7G A;  1GM7 A;  1L4A A;  1RF0 A;  3I5D A;  2LGW A;  5IY5 B;  4DV4 B;  4JYY A;  1BQZ A;  4PV1 D;  1OHH G;  3LDE A;  5CB4 B;  2KIK A;  2WAM A;  1HH0 A;  1CI6 A;  2R9I A;  3OE7 G;  2YO3 A;  5GTI E;  2WLL A;  2ILM A;  1S2E A;  1PZQ A;  2XU6 A;  2ZFC A;  1NJI W;  4JQ0 D;  2A0L A;  3SPC A;  1J5E O;  3VP9 A;  3HKE B;  5J2T A;  3SYP A;  3O8Z A;  1VQ9 V;  2A7W A;  4GZR B;  1NTZ K;  4UUJ C;  4WFA V;  2YO2 A;  4DV0 O;  2QVA A;  1ZRT D;  2QJ1 A;  2EZO A;  2XUM A;  4M3L A;  4U3J A;  1GKF A;  1IZ3 A;  1VQL P;  3V4W A;  3I56 P;  1WMK A;  1KBH A;  3OMI B;  2P7T C;  2WWW A;  3A2F A;  4DR2 B;  4GX1 A;  3RVZ A;  2WLI B;  4EEQ A;  2PP6 A;  1BCC D;  5IJ0 B;  3CCJ P;  3SDL A;  2OTL V;  1J1D C;  2LXC B;  3L70 E;  1SQQ E;  3HUS A;  1FJK A;  1H38 A;  3A0B H;  1PP9 E;  4J7Z A;  3IAY A;  1K5Q A;  2GM4 A;  3DC5 A;  4EOT A;  1KIL E;  4OGQ C;  4PA9 A;  3B5N C;  2YIU C;  4JYA B;  2RN0 A;  5EBM C;  1NTM D;  3E8G A;  4GKK O;  1L4A D;  3A0H H;  3L74 E;  4PDL A;  2IBZ E;  4ZKI A;  2WMM A;  3ZX6 A;  1QVF O;  3C8V A;  3JSN A;  3KXD A;  4JI2 O;  1SKV A;  1GL2 A;  3AE8 C;  3SSU A;  2N1T A;  4C7N A;  3J80 N;  3RGU A;  1GK6 A;  3GVM A;  1N86 A;  2ZXW C;  1G2C A;  2H7H A;  4J80 A;  2ZJS E;  3DSQ A;  4HKZ H;  4NPD A;  3K5O A;  4O2A A;  3RK3 B;  2GV9 A;  4EI2 A;  4DCK A;  4X64 B;  2X6A A;  5KA5 A;  5B3S B;  1KQF B;  3W7T A;  1SQB K;  1SS1 A;  4X88 A;  1KIL C;  2FXP A;  3SFE C;  2YIA A;  1CSB A;  2Y9Y A;  3A0B Z;  4LF8 B;  3AEB C;  1K5S A;  1Y74 B;  3CCE V;  4O2B A;  1SQX K;  3MDS A;  3JSV C;  2W0F C;  3ZN1 A;  1SQP J;  1PP9 G;  2BEZ F;  4LF6 B;  1GMJ A;  2HOD A;  3A0H Z;  1QVF U;  4GKG A;  1JMM A;  4I1L A;  4TUY B;  1I5Y A;  3HKB B;  1FAV A;  1R73 A;  1L0L E;  2R9R B;  2CPB A;  3WUV A;  1MNG A;  1CXZ B;  4J9Y B;  1O9G A;  1KQS U;  3AE7 C;  3AE3 C;  1JB0 J;  4MN4 C;  2N04 A;  3TSI A;  1XUQ A;  2HPC A;  1M93 A;  3OT7 A;  4KHP B;  1X79 B;  1NU1 G;  2O01 J;  2K9J A;  4FLV A;  5LP6 C;  3SJB C;  3CD6 V;  1X22 A;  3HE5 A;  1ZR4 A;  1H2K A;  1HNZ B;  5APY A;  2EIN B;  4ZOL B;  1KOR A;  2E76 C;  1IFI A;  3O6Q A;  5CCH A;  1JFF A;  3BAS A;  3L75 E;  2AHY A;  1N73 B;  4DV3 O;  2JGD A;  2LFR A;  1M57 D;  4U3F D;  1ZL8 A;  1J1E C;  1VAR A;  3BEH A;  5C93 A;  1OWA A;  5LHG A;  4O4I B;  1BHA A;  1HR0 B;  4XA4 A;  5AVW B;  2YUA A;  1FD9 A;  4QPK A;  1NH2 B;  2E5L O;  2B9Z A;  3TNU B;  1FAF A;  2D2C D;  1M1K Q;  2IYP A;  3H1H J;  5K5G B;  4RJT A;  2ZT9 B;  3ASN B;  3Q1M A;  5B66 E;  5APQ A;  4FPP A;  1XIL A;  1DEE G;  3Q5R A;  2E42 A;  4JI6 O;  4GUN A;  4BW9 A;  2K1E A;  4GOF A;  2RCV A;  1AVY A;  4H13 D;  3H1J D;  1GK9 A;  1KMI Z;  1LTJ C;  4FFK A;  1ZSP A;  3G80 A;  3TET A;  2JWA A;  2E74 B;  4FLX A;  2FKX A;  1GO3 F;  4YJ3 B;  5KAI H;  1NTZ J;  5GON A;  3I5C A;  2AEM A;  1Q7Y Q;  3OTF A;  1LT9 C;  3HD7 C;  2O01 H;  2WIT A;  3L71 D;  3L75 G;  4YTP C;  4CC6 A;  4B3T O;  3RL0 C;  2W90 A;  3RYC B;  5CCH D;  3MD0 A;  5CCG C;  1SF9 A;  5KJ7 A;  3CPW O;  1L8D A;  1QBZ A;  4NTX A;  4IL6 Z;  1L0L K;  2UXB B;  3VOU A;  3SPH A;  4RWU A;  2B89 A;  5EIB D;  4CS2 A;  2JS5 A;  4C46 A;  5FLX N;  1ZUQ A;  2WSE J;  2FFD A;  1GW3 A;  4BAY A;  3CX5 D;  4PI2 A;  4I7Z C;  5KLV D;  1VIB A;  5B1B C;  1NT2 B;  3GF7 A;  3JD0 A;  4ABM A;  3S4R A;  4BRY A;  4I0X B;  4W7Z A;  1ZX3 A;  5LYJ A;  1BCC E;  2Q68 A;  1ZOY C;  5D5P A;  3AE4 C;  2UUB O;  3H1H H;  2OYH A;  3FFQ A;  4U7O A;  2CDY A;  1ENV A;  2NPS C;  1Q6H A;  2JVD A;  1H2N A;  1I08 A;  1XDC A;  4P9P A;  1P84 H;  1GN4 A;  3G6E V;  3LNM B;  5H5N A;  2AHZ A;  1J5E B;  2FYN B;  1YVW A;  3ZHT A;  1NTM E;  5K1P A;  3L35 A;  1FC2 C;  1JTH A;  2YEV A;  1VPC A;  1JPX A;  1SQB J;  1TVK B;  4DR5 B;  4JF3 A;  1NTZ H;  5TJH A;  2N9B A;  1AI5 A;  3OAK A;  4FLU A;  5KJ7 D;  2UXN A;  3E1R A;  2Q67 A;  2W6J G;  3U1C A;  2WLJ A;  3NFQ A;  4JAU A;  3N2K A;  1SQX J;  1IFJ A;  2CH7 B;  1M56 D;  4WF9 V;  5DEC A;  3VQY A;  2WSC J;  4CH4 A;  4DV5 O;  2YXQ B;  2M5A B;  1NVP D;  1NTK K;  2O01 N;  4DJG A;  1PNK A;  2EJR A;  1QVG O;  4B86 A;  2OYI C;  5JJJ B;  1K34 A;  4QMA A;  1FZF A;  2LQT A;  2QJY B;  2OWO A;  2P6J A;  1YQ3 C;  1VQL V;  2KI7 B;  3I56 V;  2WSE H;  2R72 A;  3ZHV A;  2PYL A;  2JK5 C;  2C0W A;  5CJ0 A;  2YKO A;  1S0V A;  2C9L Y;  5EYP B;  2J59 M;  1RF1 C;  5LA6 B;  3BA9 A;  1YDX A;  4OVN F;  1BE3 D;  1G1J A;  3L73 J;  1BGY G;  4JI2 B;  3CCJ V;  2KLV A;  1AP5 A;  2ZDI A;  4LF5 O;  3LW5 J;  4X1Y B;  4PD4 F;  4GKJ B;  3CL3 D;  4WBA A;  1BQ0 A;  3GF3 A;  1JCH A;  1LP1 B;  3V2N A;  3R4Y A;  5KHK A;  1PL0 A;  2RDC A;  1WLE A;  2DW3 A;  4PD4 I;  5CJ4 A;  3IFX A;  1WPX A;  4DUY O;  4DV6 O;  2AEJ A;  4LLH A;  2I8D A;  1WN7 A;  2VRS A;  1YJ9 P;  2IJI A;  2R44 A;  3H1K D;  1BZK A;  2GUZ A;  3D3Q A;  3QH9 A;  1XEQ A;  1SQB H;  1CP9 A;  5CA0 B;  3BAB A;  3LDC A;  2DYS C;  1V55 C;  2Q9L A;  3UT5 A;  2P7J A;  4NXN O;  5APU A;  4I9Q A;  3MAQ A;  5AVX B;  2P2U A;  2KP8 A;  3KZI H;  4U3F E;  2WSC H;  3CWB J;  3E7K A;  1VDF A;  4UB6 H;  2KSE A;  2P06 A;  2BOB C;  1N7S A;  3ZHR A;  3JAK A;  1SFC A;  3P30 A;  4CS3 A;  3P7K A;  1WJZ A;  2UUA O;  1RE3 A;  4CZZ A;  1L0N G;  1E79 G;  2UXC O;  1OCR B;  3M9B A;  4C7R A;  2Q7G A;  4O4H B;  3ZIA G;  3ABK C;  2Q4P A;  3W7X A;  2KLU A;  3CCS P;  2D3O W;  2VS0 A;  4JI4 O;  3L73 H;  4MSW C;  1VEW A;  3MP7 B;  2A06 G;  4YJ2 A;  2YC0 A;  4YJ3 A;  1WNS A;  3LW5 H;  1BL8 A;  2ODM A;  4JF7 A;  4JAV A;  1EDK A;  2ZAE B;  4YXW H;  2Z3Y A;  2GTA A;  3L4F A;  4JI1 B;  2PI5 A;  5AW0 B;  2BOC C;  1AJP A;  1L0L J;  3RBX A;  1JVM A;  5B5E H;  5L3C A;  5CA1 A;  4WBN B;  5LMN B;  4LF4 O;  2HFE C;  1LJ2 A;  4D6T H;  2B87 B;  1KFM A;  2FL4 A;  3B40 A;  3KZI Z;  3L71 E;  1VQ4 P;  2B1G A;  4UB6 Z;  5AW2 B;  2E5L B;  4L73 A;  3ZN0 A;  3CB2 A;  3CC7 V;  4BIZ A;  3RK2 B;  1U96 A;  3K04 A;  2F43 G;  3FYI B;  3JD3 A;  2HVJ C;  1K7D A;  3QWO C;  5EFW B;  2VWK A;  5AVV B;  2AZ2 A;  4DT0 A;  1GH6 A;  4PA6 A;  4H0L D;  4I0X A;  1K3E A;  3ETQ A;  4RAI A;  1N7S D;  4W80 A;  1SFC D;  4P9O A;  4PV1 B;  1YTF D;  5DJU B;  1KEC A;  4IHJ B;  3CX5 E;  3CWB H;  3R65 A;  3CCU P;  2F66 C;  3G4S P;  5HFL A;  1W2E A;  3RFR A;  1QLE C;  2A79 B;  1HTL C;  2QJK C;  2JS3 A;  4ZMD A;  1XMO O;  1DK1 A;  4L74 A;  4OH8 B;  1SQF A;  3WU2 E;  2A3Q A;  1NGM B;  3PHL A;  5B5E Z;  5KMG A;  2QWR B;  2XOK G;  5IWA O;  1OVV A;  4FJC C;  1YBK A;  3FX0 A;  4DR4 O;  2K9P A;  4DR7 O;  3CRC A;  3ZDM A;  3JYC A;  1TVK A;  4C7U A;  1HWT C;  2UXX A;  4JI0 O;  2JDI H;  4DYL A;  2ITD C;  3PN1 A;  1FFX B;  1NTK J;  1KIL A;  2Y69 B;  1B04 A;  2O1J A;  3N7N A;  2AW9 A;  1M5I A;  4ICG A;  2EIL C;  3IGA C;  1KB9 D;  4YY3 O;  2WVR A;  2IU3 A;  3HB3 B;  1M1K W;  1S5H C;  1H0T B;  3VBB A;  1ZV8 A;  1UIX A;  1PNM A;  3HTK A;  3ETD A;  1L4A B;  3S3X A;  4MTO A;  3P8C D;  4OGQ D;  3B5N D;  3JD2 A;  3N2G A;  4LR3 A;  3L9D A;  1CI6 B;  3EQ2 A;  2FYZ A;  3QO5 A;  2WLL B;  3TF5 A;  5BY1 A;  4CH5 A;  1IFP A;  1KYO D;  1AB3 A;  4MVU A;  4ASW A;  2HR3 A;  2ZVN B;  4JYB A;  5LP6 A;  2EIJ C;  5J2T B;  2ZIO A;  4TLF A;  1TAE A;  1U97 A;  1GK4 A;  4O9B A;  3U10 A;  1BDD A;  3BPZ A;  1ROP A;  4U3J B;  1VP7 A;  1HJB A;  4K0K O;  1FZB A;  1AQ5 A;  2BCC H;  1BCC J;  1USE A;  1AP6 A;  2HVK C;  1PP9 D;  5APW A;  4YHH B;  2UUC B;  2Y0D A;  1CZQ A;  2A9H A;  1RQU A;  4UFZ A;  2Z5H A;  1VF7 A;  3WB2 A;  4JAS A;  4DV5 B;  2CTW A;  3W7S A;  5KLV K;  3ABV C;  2Q3E A;  4F4L A;  2KZJ A;  2VQF B;  3HUS B;  3RGB A;  1NTK H;  3O65 A;  1EZV H;  3FAV A;  3NTN A;  5L3B A;  1FOS F;  4LFC B;  3PRJ A;  3BRT B;  2EIM B;  1UJW B;  1NU1 D;  4KFM A;  3MHS C;  2E3C A;  3AEI A;  2KSD A;  5KAI E;  1BSH A;  4JV5 B;  1QR8 A;  4AUW A;  1GL2 B;  3AE1 C;  1YF2 A;  2JEU A;  1W2B U;  2DWD C;  3H1I H;  3JCU Z;  2N1T B;  4C7N B;  4UCV A;  2JJ2 G;  1G2C B;  1LTJ A;  1GD2 E;  3JAS A;  3PJS K;  3FWN A;  3KG2 A;  2OCH A;  3TXS A;  4O2A B;  3CI9 A;  4IL6 X;  2OGU A;  2K88 A;  1YJN P;  4DV6 B;  1YI2 P;  1M1J C;  2JP3 A;  5LGN A;  3J81 N;  2E5T A;  1LT9 A;  2W0X A;  3D70 A;  3HD7 A;  2E76 D;  1WRG A;  5DJT B;  1NO4 A;  1M57 B;  1JX9 A;  4YPC A;  3VMY A;  1PL4 A;  1USD A;  5CCG A;  3FXD A;  3MTU E;  4KL1 A;  1P49 A;  1XNQ O;  3VN0 A;  4O2B B;  1LT1 A;  5E79 H;  2A45 I;  4ZHQ A;  1G8M A;  3L72 J;  2D2C B;  1XTC C;  4NXN B;  4PD4 H;  3QO8 A;  2HOD B;  3ZRX A;  2BE3 A;  4LFA O;  3CCQ P;  3OMN B;  4MVZ A;  5TIS E;  4HZ3 A;  2Y0P A;  3THO A;  1AJY A;  1P84 E;  1NZ6 A;  1LTI C;  3OM3 B;  3CLQ A;  4NVP A;  2HPC B;  2UU9 B;  5IYC O;  2J58 A;  2Q5Z A;  5EZY A;  5AVT B;  4LF7 O;  2K9J B;  4UB8 H;  4Y28 J;  3HE5 B;  1VMG A;  2NPS A;  3L75 D;  4TT3 G;  5BXZ A;  4JI7 O;  3CRA A;  3ZRS A;  2GUS A;  2M7W A;  1HNX B;  1RM1 B;  2Y9Z A;  3K5B A;  1WT6 A;  3USS A;  2Q0O C;  3CXH F;  5JQG A;  3O6Q B;  2Y4T A;  4LBE C;  1FZC C;  5E79 Z;  2HLD G;  3SYA A;  3HD7 D;  2JGD B;  1EN5 A;  2F1M A;  1ZL8 B;  3RL0 D;  4LF4 B;  3OTO B;  1V54 B;  1I94 B;  2ZD9 A;  3BY6 A;  1R3I C;  4TSF G;  5CCG D;  5IJ9 A;  1IK9 A;  3X2Q C;  2NNU A;  2P22 C;  2WTY A;  4K35 A;  2W8Z A;  3H1H G;  5AW5 B;  2GBO A;  4CPG A;  1GN3 A;  3CRM A;  1S72 V;  3P3N A;  4J42 A;  1FS0 G;  4Y99 C;  2FYU H;  1DF4 A;  2OYI A;  3L72 H;  3H1J J;  4JTA B;  5DED A;  1IBM O;  3J7A U;  4X62 O;  3GMA A;  1JR9 A;  1NH4 A;  1KB9 E;  2OTJ P;  1NS1 A;  1VQ4 V;  1E5W A;  3JSL A;  3C9I A;  1RF1 A;  1NTZ G;  1WB7 A;  4TWK A;  2IU0 A;  1SRY A;  4L75 A;  2YDE A;  1XMO B;  1SQV K;  2CTQ A;  2NPS D;  4FMT A;  3OD4 A;  3TDK A;  2Q8V A;  5GON B;  2QKC A;  3P8C E;  2YID A;  4JI5 O;  3TK1 A;  4XDJ A;  3JAT A;  1PD3 A;  3AE6 C;  5H2F E;  4DW0 A;  5IWA B;  1E1Q G;  4DR4 B;  3OR7 C;  5JJE B;  1JCC A;  3RN4 A;  3G4S V;  2Y0C A;  3TGU J;  3N4X A;  1ARO P;  5J2U A;  4J10 A;  1VQ5 P;  1KYO E;  1M56 B;  5APS A;  4WY4 D;  1IJD B;  3Q4H A;  2Y0E A;  5KLV J;  2OQQ A;  3OEH G;  1NVP B;  3AG4 B;  2IJJ A;  1FJG B;  2Q7H A;  4OX9 B;  4L76 A;  2FFD B;  5ITZ A;  1ZME C;  1R6N A;  1RSO A;  2DQ0 A;  4YY3 B;  4FLY A;  2KK7 A;  2RJZ A;  2V4H A;  1HBW A;  2OAR A;  3MZW B;  4N3Y B;  4DK1 A;  4B3S B;  5BU8 B;  4X1K A;  2K1A A;  4WVZ A;  3T97 A;  1H8E G;  1S1C X;  4BRY B;  3QVN A;  3FB7 C;  2WZ7 A;  1BGY D;  4GIF A;  3ABL B;  5LYJ B;  3LUT B;  1P7B A;  3ZHS A;  3L37 A;  2WT7 B;  3CRR A;  3K3W A;  1VQ6 V;  2JJL A;  2RMK B;  3PH0 A;  4OWF A;  3FD9 A;  2OYH B;  4YXD C;  2OT5 A;  3CSX A;  1SZX A;  2IH3 C;  2Z5U A;  5B1A C;  4FM1 A;  1Q86 Q;  1WAZ A;  2Q73 A;  1T6A A;  2V7Q J;  1NU1 E;  1EFR G;  1KQS O;  4DV7 B;  3BVH A;  1JTH B;  3T4D A;  4D6T E;  1DLB A;  2IFM A;  2YEV B;  1JM0 A;  3SJC C;  2PF4 E;  1PKX A;  1D2D A;  4K0K B;  2QG4 A;  2LP7 A;  4TV9 A;  3RWR D;  1T2K C;  1FJP A;  4PJ0 E;  3H01 A;  3N2K B;  1GMG A;  1SS3 A;  1I0H A;  4LNU A;  2YKQ A;  3JAL A;  1F4N A;  3K59 A;  1FXK A;  1N34 O;  5LBQ A;  1IFD A;  1FZA A;  1EXJ A;  5B1O A;  3CRQ A;  4I5S A;  1EN6 A;  3HR0 A;  4X20 A;  5APT A;  4X66 O;  4N23 A;  1N33 B;  3D71 A;  1ZWI C;  2OCC B;  1N36 O;  3AG2 B;  1BE3 J;  4WB4 A;  3L73 G;  1L0N D;  1IBL O;  4JTD B;  2IX7 C;  3T1H O;  1IO4 A;  4N78 D;  2NN4 A;  2ZE8 A;  3ETG A;  5EC1 C;  2RQ6 A;  4YXW G;  1MKM A;  2VQE B;  2NR5 A;  1MA1 A;  4HBN A;  2Q7C A;  2A06 D;  4LFB B;  1X8Y A;  1Z5W A;  2ITA A;  2ZVO B;  3G9R A;  4CH6 A;  4D6T G;  2LFS A;  3JC2 2;  1M4U A;  5AVY B;  3H1K J;  3QTC A;  4I9W A;  3AG3 B;  2XAQ A;  2IBZ I;  4NXM B;  1YIT P;  4JI3 O;  2KOG A;  1SQQ K;  3H1L J;  2GUZ B;  5C39 A;  3D36 C;  4JYC A;  3T1Y O;  2KUB A;  4X8A A;  1AFO A;  2HG5 C;  3IFM A;  1RE4 C;  2YS8 A;  2AXT H;  3UT5 B;  1J95 A;  2HFE D;  3CWB G;  5FPO A;  1YJN V;  4MS2 A;  3HKC B;  1YI2 V;  4LFA B;  4FZ1 A;  4LWS B;  2UWJ E;  4IL6 H;  2F93 B;  1GN6 A;  2CGN A;  3A3Y B;  1LTG C;  2KXP B;  4H0L B;  3WB0 A;  3ABM B;  1N7S B;  5APX A;  1SQP H;  3JAK B;  1SFC B;  3WUU A;  2YIB A;  1YTF B;  2WSS H;  1DGS A;  1JMB A;  1KP3 A;  2JKV A;  1FBM A;  2HHH B;  4YIP A;  3H6P A;  3WMM 0;  4X65 B;  1F7Y A;  2N05 A;  1N8R Q;  2OIE A;  1RQV A;  2A45 H;  1SQV J;  1D7M A;  4FZ0 A;  4F6E A;  3CCQ V;  5KAF H;  2JDI G;  1VQK P;  2RH0 A;  3ML0 A;  1YEW A;  2BCC E;  1QLE D;  4YJ2 B;  3Q2Y A;  3ABU A;  1QX8 A;  1OCZ C;  2ZIN A;  2XT9 A;  4K8Z A;  2ETN A;  4B3R O;  4IIJ A;  1XMQ O;  2AXT Z;  1PPJ H;  1K9M W;  3ASO C;  4B3M O;  3ZMT A;  5LL6 Y;  2XDJ A;  3ZMU A;  1M90 W;  5CA1 B;  1BHB A;  5LHH A;  1IVS A;  1H2L A;  1ZN5 A;  1Y67 A;  2B5U A;  3IR9 A;  2PAJ A;  2H88 C;  3BCC J;  3EFG A;  3H1L H;  5JVD A;  2KKW A;  1SC5 B;  1VQ7 V;  4GLX A;  1XNR O;  5CMU A;  1FFT B;  3D6Y A;  3DTU B;  1J1D B;  1KUQ A;  5L8R J;  3ABT A;  4QIW F;  2CAZ C;  5KUM A;  1RH5 B;  1TA8 A;  1P4R A;  3CXH H;  5AVS B;  2F95 B;  3DC6 A;  1N0N A;  1EDI A;  1M8O B;  4U7N A;  3GLM A;  4OGQ B;  5KAF Z;  3B5N B;  2YIB D;  2WPD G;  2YIU B;  3U59 A;  2WT7 A;  2MKV A;  2KQX A;  1US6 A;  2QE7 H;  2AEF A;  3AE2 C;  2BCC G;  4H44 C;  4K3A A;  3FB8 C;  1BGY E;  2XZR A;  2ZXW B;  4R8C A;  2L6L A;  1X59 A;  4PDV A;  5KMG B;  1FE6 A;  2E75 C;  2HYN A;  1SQV H;  4MW3 A;  2ZXX A;  3F5H A;  1ZR2 A;  2HJF C;  1MZ9 A;  1Z2G A;  3E35 A;  1FU1 A;  4UCR A;  3FWL A;  2B9B A;  5D5Q A;  5J9P C;  4DV0 B;  2K37 A;  2OTJ V;  2ZM6 O;  5H9C A;  1NTK G;  2DJV A;  4FLT A;  1EZV G;  1M1J A;  2BSK A;  4WY4 C;  4EFE A;  3E22 A;  3B09 A;  1W0J G;  3M7M X;  1KIL B;  3ZS8 C;  1QGK B;  5AW7 B;  4GX2 A;  1S76 D;  2Q6Q A;  3RT3 C;  3T2M A;  2WLM A;  4DV1 O;  3W7U A;  2YMK A;  3IC7 A;  5LGT A;  1K04 A;  3D6Z A;  2QM8 A;  1W0K G;  1S5L E;  2Z0A A;  3H1I G;  3B8E B;  2F4V O;  2P58 A;  3BCC H;  3OJA B;  4PA7 A;  3W68 A;  4A7P A;  3HTK B;  1F4M A;  2XAF A;  1OFC X;  2P1J A;  1VQ5 V;  4UB8 E;  2FBW C;  3HKD A;  5L3E A;  4GKK B;  3CE2 A;  2M3E A;  1EXI A;  3N2G B;  3KCX A;  1SQG A;  3UQ8 A;  1NBM G;  2UXD O;  3AE9 C;  3JD1 A;  4MVR A;  1L0N E;  2CPS A;  5LP6 B;  4DR6 O;  1N32 O;  4MVS A;  3ZHU A;  3C3T A;  2R5D A;  1PGO A;  4N78 E;  2IPP A;  4MW8 A;  3L70 J;  2JIZ G;  1SQQ J;  2E76 B;  1SQP D;  1PP9 J;  3FX7 A;  2A06 E;  2I1K A;  1FZC A;  2XHB A;  2GSM B;  2XNX A;  2R32 A;  2ATK C;  2QSA A;  2GTS A;  4ZKU A;  5GTH Z;  4Z2W A;  1Z56 A;  5KX5 A;  2MK3 A;  3L74 J;  3MUD A;  1J1E B;  1T5E A;  1NKN A;  1PL5 A;  1AI6 A;  3M06 A;  3U1A A;  3AG1 C;  4FFB A;  3GHG C;  4EB6 A;  2ZYD A;  4O4J A;  1URQ C;  3UM7 A;  4RO0 A;  4LC1 A;  5JH7 A;  1QCE A;  1MV8 A;  1YHQ P;  3UCS C;  2XAJ A;  3FAV B;  3HKC A;  4HNA A;  1SQX H;  1PIX A;  1THZ A;  4LWS A;  1N36 B;  3V6I A;  2EX3 A;  1LR1 A;  4MTX A;  2IZ0 A;  1NTM K;  5GTI H;  4GCZ A;  1UPG A;  3T1H B;  2FTK A;  3U11 A;  1KTM A;  3OUS A;  4GOD A;  4XBF A;  2QJP C;  2O1K A;  1IUR A;  3O9O A;  1XTG B;  1LTJ B;  4JGS A;  1DD4 A;  3JAS B;  2LGQ A;  4R50 A;  2X7R B;  2DQ3 A;  1I7F A;  1LWU C;  4RUE A;  1HF9 A;  5FNV A;  1HUC A;  2YMY A;  1A02 F;  2RMZ A;  1LT9 B;  5APV A;  4UCU A;  5EC2 C;  3HD7 B;  1PM9 A;  1RPR A;  1AQT A;  3AK2 A;  4P30 A;  1S77 D;  3RL0 B;  5LOV B;  1EM1 A;  5LMU O;  1BS3 A;  3E8B A;  2P90 A;  4DV3 B;  3L70 H;  1XOU A;  2FYU G;  3H1H D;  1SQQ H;  3L72 G;  2N1T C;  3A0B E;  1DX7 A;  1P84 D;  2DYR C;  3DXR A;  4NR1 A;  4ZHQ B;  4DV2 O;  4PDR A;  3M9H A;  3K9S A;  1S9K D;  3ZMZ A;  5GTI Z;  1YIT V;  3L74 H;  2IBZ H;  2QDO A;  4I7Z B;  4B7E A;  3A0H E;  1L0N K;  5B1B B;  2FXO A;  4PHZ A;  1YIJ P;  3ETE A;  1NTZ D;  1AI7 A;  3E89 A;  2IYO A;  1VQP P;  1MUU A;  3E8F A;  1H2M A;  1ZXG A;  4KXR A;  2IJK A;  4JI6 B;  2PZS A;  3L75 J;  1GDT A;  3B5N A;  3VQV A;  2KNC A;  1FDM A;  5EZY B;  1BT8 A;  1OX3 A;  1MSD A;  1PGP A;  2NPS B;  2Z5I A;  3CP1 A;  1MSW D;  4I4T A;  5CA3 A;  4MVM A;  2KB7 P;  3GW6 A;  1ZAU A;  5JQG B;  1FPO A;  3G6B A;  3RYI A;  1XMQ B;  2RNB A;  4JBZ A;  4B3T B;  1MZF A;  4UVA A;  3K0G A;  2EIK C;  4W4K A;  2R5B A;  5BR8 O;  1QLN A;  3OGC C;  3HE4 B;  1IXB A;  2QWN B;  1QR9 A;  2PGD A;  3WG7 C;  1VQK V;  5IJ9 B;  3A0R A;  1F23 A;  1XNR B;  1OCO C;  5M1B A;  3K79 A;  2Q3I A;  1L0L H;  1X0T A;  1BDC A;  1VF5 C;  5BU5 A;  4PEL A;  3CC2 P;  3I55 P;  3VP8 A;  3BVO A;  2QSI A;  5AW1 B;  2OYI B;  2ZIM A;  3K5M A;  1OCC C;  4QPJ A;  2OTL P;  4X1I A;  4NKG B;  3CME P;  1QU7 A;  4W7Y A;  1NR7 A;  2FKW B;  3R2P A;  3MHV A;  3OFN G;  1IDS A;  1OZ0 A;  1VQO P;  2UUB B;  4PA3 A;  5A9G A;  2AZ0 A;  5JJN B;  4PI0 A;  1RF1 B;  4W4L A;  3BRV B;  1N8R W;  1SQB D;  3AE5 C;  3PTZ A;  3M9Q A;  1H89 A;  1EBO A;  4J7K A;  4GX0 A;  3RYF A;  3TXQ A;  2C2A A;  3P3P A;  3CX5 F;  1LTT C;  1SQX D;  4R7C A;  3UO3 A;  3JAT B;  1R5L A;  1JY2 N;  1JCD A;  3QF7 A;  1Q7Y W;  5L3D A;  4UCO A;  3K5N A;  3JCU H;  3CX5 I;  1W2B O;  3SFD C;  4FM0 A;  2QWO B;  5H6R A;  1R6T A;  2KZI A;  3H9V A;  1H2G A;  5J2U B;  4JYA O;  1OMI A;  4IL6 E;  1WA8 A;  3WFV A;  5IY5 C;  3Q4H B;  3Q3D A;  2KYV A;  1T2K D;  5E1A C;  3VMZ A;  1M9N A;  1HVV A;  2W27 A;  5ITZ B;  3Q5S A;  1A32 A;  1RE4 A;  1RSO B;  4G27 B;  5IDJ A;  1SQP E;  2DYS B;  1V55 B;  2F23 A;  5B66 H;  4WFF A;  4JPR A;  3L73 D;  3II6 A;  3ZCC A;  4X1K B;  2EUL A;  1OW7 A;  2M3B A;  3T97 B;  2QKA A;  2H8P C;  1ZTE A;  1NTM J;  4XDL A;  4X64 O;  1Q5O A;  1K05 A;  1KC8 Q;  5A2Q N;  4J7J A;  1S3J A;  1OVR A;  3UIA A;  4DR3 O;  1U57 A;  4NTY A;  4D6T D;  1AV1 A;  4GDO A;  4LF8 O;  2V1D A;  4NTW A;  2FXM A;  4O4L A;  4LF5 B;  1L1F A;  2ZNJ A;  3ABK B;  4IOI H;  2B88 A;  1RP3 B;  1N32 B;  1COW G;  4H37 A;  3M0D C;  2WPS A;  3BAT A;  1RHZ B;  4LH6 A;  4DUY B;  1HGV A;  1YJW P;  2FML A;  2YSU B;  3GWK C;  3LSS A;  1H8A A;  4TV9 B;  5IT9 N;  5B66 Z;  2M6Y A;  2DN9 A;  1DIP A;  3CWB D;  1JJ2 U;  1LNQ A;  5LOV A;  4QE7 A;  4LNU B;  1GZL A;  3JAL B;  1SQP G;  3ZHQ A;  3E86 A;  1FXK B;  1ORQ C;  1EZJ A;  2WSS G;  4KHP O;  2AGA A;  3CXH E;  1NAF A;  2JGU A;  2HG5 D;  3CCM P;  5AW4 B;  3S1K A;  4X20 B;  1A02 J;  1BCC H;  1SVF A;  3LSQ A;  1L0N J;  2A45 G;  1SZT A;  4WFB V;  1HNZ O;  1K4D C;  1VF6 C;  3W7W A;  3RK3 C;  3H1H E;  4MVO A;  1RFY A;  1YJ9 V;  2Q1K A;  4R6Z A;  5B3S C;  4BXL A;  3SYQ A;  4I2L C;  4QE9 A;  2AXC A;  4LF9 O;  4NPF X;  3OEE G;  1FS0 E;  1JJO A;  1MFZ A;  4BIO A;  3D3I A;  1E1R G;  4H13 B;  4JAA A;  3EVK A;  4L8J A;  1S9K E;  2LKM A;  1NTM H;  2UUA B;  1PPJ G;  2Q6A A;  2QM4 A;  2UXC B;  3SWF A;  2IW5 A;  1YHQ V;  2OYQ A;  3LNN A;  1QL2 A;  2H3O A;  1OJH A;  1QLE B;  2QJK B;  2QRX A;  1HR0 O;  5AVU B;  3WUT A;  1NTZ E;  4JI4 B;  2XAG A;  3CEI A;  1YZB A;  3H1L G;  1OW6 A;  1YSC A;  3B71 A;  4HH2 A;  1T3U A;  4RO2 A;  4BWN A;  1OW8 A;  2O3J A;  4U3F J;  5BMV A;  2N74 A;  1FYJ A;  4F6R A;  4HJG H;  4WCE V;  3G71 P;  4CBC A;  4HB1 A;  1LTS C;  1IFM A;  1NYH A;  3BAA A;  3HE4 A;  2DWE C;  5CBO A;  4OPA A;  4WY4 A;  5IYZ A;  1KQL A;  4EDF A;  3CCS V;  2LXB A;  5KLI B;  1QHT A;  3U0Z A;  1URF A;  3ZRW A;  1HP8 A;  1HGZ A;  3P8M C;  2JEE A;  2QE7 G;  4LCU C;  3VQW A;  4AI8 A;  2EIL B;  2Y0I A;  2EIN C;  1HNW O;  3C90 A;  2KG7 A;  4QJF B;  1N2D C;  2PI4 A;  3SYO A;  1GTO A;  1SQV G;  2L91 A;  2BCC D;  1N73 C;  1XL6 A;  4OXS A;  2XND H;  1Y76 A;  4AIL C;  1SET A;  3CXC U;  1JO5 A;  3T4Z A;  2UXB O;  4AYC A;  1KKC A;  3V2R A;  1D5A A;  2Q69 A;  1JOY A;  2WSF J;  4NYK A;  2ZYA A;  4OPH A;  3SR2 C;  1PFI A;  3OGI B;  4DUZ O;  1HDJ A;  3L71 J;  4H44 D;  1P84 I;  3EXA A;  1I5X A;  4KHX A;  1NTK D;  1EZV D;  3AEG C;  2XV5 A;  2EIJ B;  1VQP V;  4IIJ B;  3JAR A;  3APO A;  2ARH A;  1PNL A;  5CBF A;  4WFE A;  1SQB E;  2E75 D;  2ZE5 A;  1SLQ A;  2ZT9 C;  2XTA A;  3ASN C;  3BCC G;  2ZE7 A;  4DR7 B;  3CCU V;  1RE3 C;  3LID A;  1AI4 A;  2R70 A;  4Q20 A;  5BVZ A;  5IYD O;  4JI0 B;  2IH1 C;  3E2E A;  1LTB C;  1GM9 A;  1B3Q A;  1SQX E;  4U3F H;  3H1I D;  4XE5 B;  3E83 A;  5JVD B;  3ICX A;  3KZI E;  1XQ8 A;  2YXR B;  2E74 C;  1GU5 A;  4UB6 E;  4BWA A;  2MW2 B;  3GHG A;  2ZQM A;  3JAW A;  1QQC A;  1Y6X A;  5FL7 G;  1URQ A;  5AVQ B;  4FIP C;  4HYO A;  4FK5 C;  4TV8 A;  1JY3 N;  2XKM A;  3ZMV A;  2OIG A;  4DR5 O;  3PP5 A;  1HJ0 A;  2KS1 A;  3L73 E;  4GOE A;  4GYC B;  2FY8 A;  2YI9 A;  4QNH B;  2QKS A;  3H1J H;  1IZN B;  3CC2 V;  3I55 V;  1UFI A;  3OW2 U;  3IN6 A;  2IFN A;  3F7V C;  1KN7 A;  3LIE A;  4PD4 D;  4HYT B;  1KB9 F;  1S5J A;  5CBN A;  1KD1 Q;  1SQB G;  5B5E E;  3CME V;  3CJH A;  1LWU A;  1DD3 A;  2WSF H;  1SES A;  1JY2 O;  1KB9 I;  2ZR3 A;  4KP4 A;  1T8Z A;  1VQO V;  5CMZ A;  3L71 H;  5KTB A;  1M1J B;  1G6U A;  2OYO A;  1SQX G;  4Z1M H;  2BSK B;  4Z1V A;  3E22 B;  2PUS A;  2EBO A;  2OTK E;  1LUW A;  2J5U A;  4JI8 O;  2H43 A;  1AR1 B;  5KKZ B;  2IM9 A;  5LXT A;  2QIW A;  2YKP A;  4AQR D;  4GKJ O;  3BFR A;  1G4Y B;  4TQF A;  1VL2 A;  2RKL A;  3TGU H;  1KYO F;  3L36 A;  1YTZ T;  1HW7 A;  2BTQ B;  2FYN C;  3CX5 H;  3STL C;  5KLV H;  3EHB B;  1URQ D;  3CWB E;  3CMA P;  5AG2 A;  1KYO I;  1R3J C;  3SWY A;  2NRG A;  3KPE A;  3HKD B;  4PDM A;  1LUV A;  1GRJ A;  3VQX A;  5JCO C;  3WU2 H;  4K8X A;  3AG7 A;  4DR3 B;  1JY3 P;  1QEX A;  1DF5 A;  3H32 B;  3W67 A;  2NLJ C;  1QL1 A;  5KUK A;  1OVU A;  3ZJZ A;  1ZLL A;  1Q90 D;  2QTS A;  4GX5 A;  3JCZ A;  3L70 G;  1SQQ G;  4LGD E;  4ASU G;  2C9N Y;  4DK0 A;  1NKD A;  1FDI A;  2G3A A;  2QJY C;  2FYU D;  3L72 D;  1FZC B;  4WWI A;  1G1I A;  3ITK A;  3L74 G;  2IBZ G;  3E8H A;  3RYH A;  4DRX A;  1DTO A;  3KCY A;  2V7Q H;  5AW6 B;  3SYC A;  1GU4 A;  5KX5 B;  4CC5 A;  1AJN A;  1Q81 Q;  4RKU J;  4IT5 A;  3A2A A;  1XNQ B;  4DOJ A;  1H88 A;  4FFB B;  1GL2 D;  3NMD A;  4EB6 B;  5H6Q A;  1AIL A;  1NHL A;  3X2Q B;  3OR6 C;  4O4J B;  2N1T D;  2BAS A;  5JH7 B;  5LHI A;  3OA7 A;  2ZNI A;  5EK0 A;  4WFG A;  4LP8 A;  1YJW V;  4HNA B;  3WU2 Z;  2YNY A;  2I1J A;  3IC9 A;  2X6B A;  2BTO A;  1V9P A;  4LH7 A;  1S4X A;  1JEK A;  3VMA A;  2QR4 A;  1KFN A;  5C8Y A;  1KC8 W;  4Y99 B;  3CC7 P;  1W59 A;  4LF9 B;  1NU1 K;  1Y4M A;  3B4S A;  3KDP B;  1Q82 Q;  2ZCE A;  1R8E A;  1WPB A;  3BHP A;  4JI1 O;  4GT1 A;  2CUG A;  3M99 B;  4ZBM A;  3CCM V;  1IC2 A;  4R4M A;  4ZI7 A;  5LMN O;  1M7L A;  3A5T A;  3K06 A;  3JCU E;  1BE3 H;  1K8A Q;  4LF7 B;  3OUF A;  4I55 A;  2W6A A;  1KKD A;  3KYQ A;  4JI7 B;  1ZW0 A;  1TUE B;  5FNV B;  1IXM A;  3P32 A;  3WB1 A;  1EQ7 A;  3K08 A;  2CK3 H;  4KT0 J;  2YXY A;  3JD4 A;  2WPQ A;  2CGO A;  1L0L G;  5KHI A;  2GHY A;  4DO2 A;  2YXL A;  2H94 A;  1N0J A;  4G2K A;  1YYC A;  1CW5 A;  1Q43 A;  2Q7E A;  3SJA C;  2P10 A;  4I50 A;  2WPV B;  3H1K H;  3SPJ A;  2HJD A;  2YIC A;  1NTK E;  3M0A A;  1OCR C;  3SPG A;  1EZV E;  3DXR B;  3A8T A;  2R9A A;  2Z4E A;  5CB4 A;  3OMA B;  2Q0A A;  1XBL A;  5BZB A;  3CC4 P;  1HNW B;  1D5N A;  2ZKO A;  1XHX A;  1VF5 D;  3G71 V;  1FXV A;  4IFM A;  4XFJ A;  2QEX P;  3H1I E;  3HKE A;  1IBM B;  2M0B A;  4X62 B;  1W5C E;  3IJ4 A;  2KNC B;  2LW7 A;  4TT3 H;  1VQ8 P;  4CS4 A;  3MIW A;  3AK1 A;  4I4T B;  2L35 A;  3TGU D;  2ZR2 A;  4DUZ B;  2WLI A;  3C3S A;  2G8Y A;  3QNE A;  1H2S B;  5B1A B;  1ZRT E;  5IJ0 A;  3K0D A;  5EBW C;  4JI5 B;  3RK2 C;  3V5B A;  3RYI B;  3M0D A;  5CBG A;  1U7M A;  5E79 E;  4U7J A;  1IFN A;  4JZG A;  3TCU A;  1TUB B;  1FDO A;  2DE0 X;  4PV1 C;  4PD4 E;  4UV8 A;  5TIS H;  2P5O A;  5KAI Z;  4N21 A;  4WFH A;  1KP2 A;  4X9Q A;  1NKZ B;  2X0L A;  2NZ2 A;  2YI8 A;  1VQN P;  4NPE A;  5AVR B;  1Q2N A;  2VRZ A;  2W6I G;  3CPW U;  3MGN A;  3GWO A;  1GN2 A;  5GTH H;  3V4Q A;  4X89 A;  5AW9 B;  2BTQ A;  3B2E E;  3FYE B;  4X1I B;  4B7K A;  1SER A;  1VF6 A;  1IBK O;  1EZV I;  2JWD A;  2QTO A;  4G28 B;  3SJQ C;  1OV9 A;  2H8P D;  3K58 A;  1GM8 A;  1HWY A;  3K9A A;  1JY3 O;  3AEE C;  3CCR P;  1RPO A;  4DW1 A;  2C0X A;  4J9Z B;  2QM7 A;  3H32 A;  5L3F A;  4YHH O;  1AJQ A;  2UUC O;  1RY3 A;  1GAX A;  2Y69 C;  3RYF B;  1Y74 A;  1Y8A A;  1YTZ I;  1CPY A;  2VQF O;  2H89 C;  2QGN A;  4UCS A;  5TIS Z;  3ZMS A;  1R3K C;  1BCC G;  2LW1 A;  1JUN A;  4LFC O;  4TUY A;  1KZU B;  1L4A C;  1RF0 C;  2ZE6 A;  3HKB A;  1WA8 B;  3RVY A;  4I6M C;  3G67 A;  3E1I A;  1FZE A;  3QO7 A;  5IYB O;  4B08 A;  4JI8 B;  1IX9 A;  4JV5 O;  3OAA G;  2N9Y B;  2W6B A;  2XAH A;  2HEP A;  1R1B A;  3B77 A;  2FYU E;  1VQM P;  1NQT A;  1OZH A;  3L72 E;  1N34 B;  3QG5 A;  3CCL P;  2MJZ A;  1NTM G;  2EZP A;  4ASV A;  2HKO A;  4KJM A;  2WQY C;  3IF4 A;  1KB9 H;  2IJH A;  4X66 B;  3UKM A;  1NU1 J;  4TQD A;  4ZOL A;  1ZP0 C;  4D6T J;  4DR1 O;  1B6Q A;  1PPJ D;  3RK3 D;  1IBL B;  2KB1 A;  3F89 A;  1QVG U;  1FZG A;  1MFT A;  1S5L X;  4AQY O;  1N73 A;  2DMX A;  3GG2 A;  4RUF A;  4O4L B;  5H2F H;  3AEF C;  3H1L D;  1PV0 A;  1KQG B;  3CCV P;  1K33 A;  1AR4 A;  2SPZ A;  2EJ7 A;  3K03 A;  4MVQ A;  2WLH A;  3CMA V;  1BMF G;  4O4I A;  1Q86 W;  3HUS C;  5F2V O;  1KD1 W;  2CE4 A;  3TJT A;  1KYO H;  1IK7 A;  1K73 Q;  3TNU A;  3NR7 A;  2M8R A;  3ZRV A;  1OCZ B;  3CXH D;  2EIM C;  4JI3 B;  2IZ1 A;  5IE9 A;  1YCI A;  1Y66 A;  3ASO B;  3HRN A;  1O9H A;  1BSM A;  2QA4 P;  4PA4 A;  3T1Y B;  3B8N A;  1GL2 C;  1GW4 A;  3AED C;  3FXE A;  2UU9 O;  3K57 A;  1EDJ A;  1PP9 H;  1TU3 F;  1Z5V A;  2XND G;  1AA0 A;  3UO2 A;  1EC5 A;  4A5U B;  3S3W A;  1F51 A;  1HNX O;  4MTF A;  1SQV D;  1DEB A;  2Q5U A;  1NJI Q;  1DH3 A;  3CS5 A;  1GTW A;  2P4V A;  3H1J E;  5H2F Z;  2ADP A;  2QWQ B;  3KKY A;  1S72 P;  1OIP A;  1M57 C;  1YQ4 C;  3RL0 g;  3EWK A;  5KHG A;  5DM6 V;  3RYC A;  1NWQ A;  2V4D A;  1NU1 H;  1K92 A;  1FXK C;  3OTO O;  2FB5 A;  5LGU A;  1I94 O;  3FKS G;  4FVM A;  3A7O A;  2RN9 A;  5AW3 B;  3F5W C;  1KV4 A;  3K5L A;  4H44 B;  2WA3 A;  2D2C C;  1FXH A;  4U3F G;  2CTP A;  2FYU K;  3BCC D;  4PJ0 H;  1K4C C;  4H33 A;  1NVO A;  4CH3 A;  1NH2 D;  2E75 B;  2PGG A;  4B3R B;  5BMV B;  2WA4 A;  4F6R B;  1LTA C;  3GB7 C;  4B3M B;  3TGU E;  4H13 C;  1UII A;  3F7Y C;  1VQ9 P;  2ZT9 D;  1TUB A;  1Q81 W;  4WY4 B;  4EFB A;  5IYZ B;  5KLV E;  5JWP A;  1U7J A;  3VOP A;  4DV4 O;  3CYO A;  4DZO A;  5CBH A;  2HLO A;  3ZRW B;  4E2L A;  1RM1 C;  4MTG A;  2E74 D;  2PRR A;  5L3G A;  3H1J G;  4XDK A;  2BCC J;  2KG7 B;  4ZNC A;  3ZED A;  1N4C A;  5CCH C;  2YXH A;  1SA0 B;  1Q6I A;  1Q82 W;  1R5S A;  2GA1 A;  3PLN A;  1Y76 B;  4ZKP A;  1SP4 A;  2HP8 A;  2ADQ B;  1JQ0 A;  2R3C A;  1V54 C;  5JCO A;  3C1L A;  3L71 G;  4PJ0 Z;  5EIB C;  5KLI C;  4Z1M G;  1K8A W;  1PGJ A;  1VQ6 P;  3FB6 C;  3CC4 V;  4DR2 O;  1FJG O;  2CH7 A;  2BEQ D;  1FOS E;  4OX9 O;  4ZIB A;  4EYY Q;  1K97 A;  3L75 H;  1NI8 A;  2QEX V;  2M5A A;  4YIO A;  3MHH C;  1MG1 A;  2JO1 A;  3AEA C;  3JAR B;  1WB8 A;  1CEZ A;  4B3S O;  1NOH A;  1T3J A;  4J41 A;  2IDB A;  2GUV A;  1MZE A;  2DOS A;  2LR2 A;  3TGU G;  2AXT E;  1X9V A;  3H1I J;  2ZM6 B;  1VQ8 V;  1XI1 A;  5KLV G;  4UVC A;  3S9O A;  3STZ C;  3RBZ A;  5EYP A;  1Q3E A;  5LA6 A;  3CHX A;  3D36 A;  4NB5 A; 
#chains in the Genus database with same CATH homology
 4H0L B;  3AED C;  2D2C B;  1VF5 B;  1FDO A;  3AEG C;  4PV1 C;  1TU3 F;  1EXI A;  1S1C X;  2E75 D;  2ZT9 C;  2NZ2 A;  3AE9 C;  1KQF B;  3IAO A;  1AJY A;  3SFE C;  1RQV A;  1Y9B A;  2FXP A;  4RKU J;  3AEC C;  1UIX A;  3AEB C;  4YXD C;  2WSE J;  4I7Z C;  1DIP A;  2E74 C;  3Q2Y A;  2E76 B;  3Q5P A;  4R4L A;  4OGQ D;  2BEZ F;  1YQ4 C;  3RL0 g;  3EWK A;  3GF7 A;  1GMJ A;  4Y28 J;  2V7Q J;  3AEE C;  3RK3 E;  1ZOY C;  3AE4 C;  1R8E A;  5M1B A;  4H44 B;  4H0L C;  1PL5 A;  2D2C C;  1VF5 C;  3AE7 C;  4R4M A;  2H88 C;  3AE3 C;  1HJ0 A;  1JB0 J;  2QSI A;  2E75 B;  2H89 C;  1PIX A;  4H13 B;  2O01 J;  4PV1 D;  3IN6 A;  3D6Y A;  1EXJ A;  4H13 C;  4KT0 J;  2ZT9 D;  5L8R J;  3FGA D;  1RQU A;  1KOR A;  3AE5 C;  2E76 C;  1KTM A;  3GLM A;  3D71 A;  4OGQ B;  1DD3 A;  3O6Q A;  2QJP C;  3ABV C;  1OW6 A;  2P10 A;  2WPV B;  3B71 A;  1DD4 A;  4Z1M H;  2E74 D;  2MKV A;  1OW8 A;  3AE2 C;  4H44 C;  2WSC J;  1MKM A;  1PV3 A;  3GMA A;  2J5U A;  2WQY C;  1HF9 A;  3SFD C;  1WMK A;  1NYH A;  3G9R A;  2E75 C;  2QIW A;  1ZP0 C;  3H25 A;  1OMI A;  5KKZ C;  4H0L D;  1VL2 A;  2D2C D;  1YQ3 C;  1VF5 D;  3Q3D A;  3AE1 C;  4XFJ A;  2FYN C;  4PV1 B;  5KLI C;  1S5L X;  3Q5S A;  2ZT9 B;  3Q1M A;  2BEQ D;  3AE6 C;  3AEF C;  2QJK C;  1KQG B;  3Q5R A;  1KIL E;  4OGQ C;  4IL6 X;  2K9Y A;  4TT3 H;  1OW7 A;  3T97 B;  4H13 D;  3LW5 J;  2YIU C;  4H44 D;  2JO1 A;  3AEA C;  1NGM B;  2IDB A;  1KMI Z;  2JP3 A;  2YMK A;  3GF3 A;  1FDI A;  1K04 A;  4I7Z B;  3D6Z A;  3D70 A;  2E76 D;  1IK7 A;  1K05 A;  2E74 B;  1Q90 D;  2G8Y A;  3C8V A;  3R4Y A;  1ZRT E;  3AE8 C;  2OQQ A;  3S9O A;  1U57 A;  2WSF J;  1ZME C;  4GDO A;  2FBW C;  4YTP C;  4U7J A;  2G3A A;  2QJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...