2E75B

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e75B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75B01
5KKZC 2O01J 2QIWA 2D2CB 1VF5B 5KLIC 2E76B 2WSFJ 2FYNC 2QSIA 4RKUJ 4OGQB 2QJYC 2E74B 2E75B 3C8VA 4Y28J 2QJKC 4KT0J 3LW5J 4H13B 2YIUC 4I7ZB 1S5LX 2WSCJ 4H44B 4H0LB 2WSEJ 5L8RJ 1Q90D 4IL6X 2QJPC 2K9YA 2WPVB 2ZT9B 4PV1B 1JB0J 1ZRTE
chains in the Genus database with same CATH superfamily
3J80N 5H2FH 4JTAB 4JYCA 4QPJA 3V2PA 1KILC 1OCOB 3K5OA 1AA0A 5IJ0A 3HTKB 2LKMA 3M9HA 1K97A 1URQB 3J7AU 3T1HO 1WAZA 1RM1B 1DX7A 2LXBA 1BDDA 2CK3H 4ZKIA 3CCQP 1H2LA 2OIGA 2JJLA 4UCUA 1SQXH 3JYCA 1SZXA 3JATB 4WBNA 4KP4A 1KP2A 3K59A 3FYEB 1Q8IA 1ORQC 3K0DA 1K7DA 4LF7B 1DGSA 1KILB 2KI7B 4LBEC 4DV7B 3FB8C 4KJMA 1IXBA 3MUDC 3JD4A 1AROP 1KYOD 1EDIA 1L0LJ 5KHKA 2YEVB 1X4TA 3FWLA 2FYUH 3H25A 1PNKA 5CA3A 4YJ3B 4DR2B 1OMIA 1HP8A 3Q4HA 1SQPD 1I5XA 3B4SA 5KAFH 2SPZA 3K04A 2Y0IA 5BZBA 5CBNA 3L74D 1VF6C 1CPYA 3VQYA 4AI8A 1MSWD 3SJCC 3D3QA 1BSNA 1NU1H 1DF4A 3SDLA 3CD6P 1F4NA 2LR2A 4QGPA 2CPSA 3LIDA 1RPRA 3D36A 3O6QB 3ZEDA 2V4DA 3HKCB 3J81N 1SQBJ 2OT5A 3LUTB 3L75G 2DQ0A 3VQVA 5AVSB 3AECC 1JFFA 3IC9A 3K3WA 3CC4P 3P8CE 1W0JG 2FFDC 2CTWA 3MZWB 5CCHD 1FXHA 1BMFG 1KB9E 1GU4A 1NTKD 1PNLA 4QIWF 4MTFA 1LTIC 2UUBB 3JSNA 5ITZA 2Y48A 1ZLLA 5IYZB 2HLDG 4PA7A 1B3QA 2Y4TA 2KLVA 1N7LA 3HUSA 2D2CC 1XREA 2JJ1G 1K34A 2ZR2A 2OARA 2XT9A 1E1QG 2P06A 1ENVA 1Q6HA 5LA6A 5DECA 2P4VA 2ZNIA 2FFDB 2KB1A 3B77A 3H1KG 4UV9A 4DZOA 4LFCB 1WRGA 5BU8B 4IHJB 3B09A 2AXCA 1IO4A 5EYPA 1XDCA 2QJ1A 2ZIOA 5CB4B 1NVPD 3E22B 2D2CB 4W4LA 4RO2A 3SPJA 2PYJA 1DTOA 3PJSK 4DK0A 2OGUA 1N73A 4UB6E 1LT9C 1OXZA 4HYTB 1P84E 3H1IH 3RVYA 1SQQE 4LFBB 3EQ2A 1S2EA 3TGUG 5GTIE 3MP7B 5JCOA 2MJZA 3V4WA 2UXNA 1G4YB 1Y8AA 1R5LA 5AVQB 2HG5D 1NH2D 1J1EC 3SFDC 4H13C 1VQPP 2ARHA 3W7WA 1JOYA 3L35A 4MW8A 2LW7A 2K1AA 3ASOC 3THOA 4PA9A 3ABUA 3AE3C 2F1MA 2YXLA 2QIWA 2KLUA 1D2DA 1LT9B 4KHPB 2ZVOB 2V7QG 3HKEA 3P32A 4UB6Z 3TSIA 3BRCA 2Z0AA 5BR8O 2WLIA 1GW4A 2X7RB 3M0AA 4Y99C 2HR3A 4BXLA 3TETA 3ZMSA 5FPRA 5GTIZ 3N2KA 2FYZA 1W5CE 2RKLA 1FC2C 2E74C 5AVZB 1XI1A 2H94A 1J1EB 1GK4A 5GONB 2C9NY 3PN1A 3MDSA 2IPPA 1BE3D 4F4LA 3A7OA 5J2TA 4I4TA 3AEBC 2M5AA 1P4RA 2P58A 4I5SA 1X8YA 2I8DA 3UO3A 1FDIA 1LUWA 4Y99B 2N1TA 4B3TB 1R6NA 2B9ZA 1HNZB 1WA8A 4RJTA 4JF7A 2E74B 2RN0A 2M7WA 2NNUA 4MVQA 1ZP0C 5EIBD 3LW5J 1KB9I 3H1JG 2A45G 1L0LH 1VQ7P 4TUYB 1E79H 3OGIB 1AVMA 5LXTB 3JD2A 3TNUA 2AEJA 1QCEA 2LXCB 2G8YA 5B1BC 3H1KD 4P2ZA 1W0KG 4I1LA 1EZJA 1RY3A 5EFWB 3M9QA 5K5GB 1XQ8A 3DXRB 2YNYA 4BIOA 1VQ9V 4EFBA 3E8BA 1KBHA 3JD3A 4QMAA 5EC1C 4YPCA 5CBOA 4FM0A 2QJKC 5JH7A 3K03A 2KZJA 5TISH 1DEBA 1H88A 1N8RW 1GDTA 4ZOLA 3H1LG 3RYIA 5CCGD 5LHGA 4DR1O 1JCDA 4RUFA 1OW8A 3M0DC 1KORA 2IBZI 1SP4A 4RWUA 4I50B 4ZIBA 5JQGB 4L73A 1SQBH 5K1PA 3TGUD 5B1BB 2R70A 4U3JB 3CC2P 3CCVP 1GM7A 1Q43A 1F4MA 1P84I 1T5EA 1I94B 5LHIA 1IXMA 5LGTA 2O01J 2KKWA 5EZYB 4C7RA 3D6YA 3QNEA 2KIKA 1JUNA 2Y0PA 1M1KW 3SFEC 3W7TA 3SYOA 2IZ0A 4K0KO 2QVAA 1AI5A 2R5BA 2QWOB 3OGCC 2QJKB 3D3IA 2Z4EA 3L37A 1RF0C 2YS8A 2K9JB 4JPRA 1AP6A 1K8AW 2OTLP 1IFJA 1LTSC 5BR8B 2B87A 1PL0A 5LP6C 2FYUK 4U7OA 1H8AA 2AXTH 2B1IA 2IW5A 3UT5A 1FBMA 4EI2A 2Q7EA 1VQKP 3JARB 5GTHE 4PD4F 5B66H 2EULA 5KLIC 2N05A 1EZVH 1JVMA 1A32A 1AB3A 1YQ4C 4G27B 1KILE 1THZA 4GT1A 3ABVC 3CCUV 2GV9A 1NTZG 1XNQO 4ZHQA 4D7SA 1PZQA 3ZHVA 5LP6B 3AE2C 3L72G 4TSFG 2DOSA 2Q7CA 5CBFA 3GVMA 2GM4A 4PDVA 1RQVA 4LWSB 4GKJB 4LP8A 2FYUG 3CRMA 3LIEA 3L71E 5GTHZ 3H1JD 2P2UA 4NPDA 2RMKB 5KLIB 1GM9A 1R1BA 2MW2B 3E8GA 2ADQB 2WSCH 3HTKA 1URQA 2DN9A 4OGQD 3SPCA 2IM9A 1SQQJ 2P6JA 4DV6B 2QEXV 3WMM0 3HD7D 1H38A 5B5EH 4LCUC 2VRZA 3JATA 3RYHA 1S4XA 2ZYDA 2EILC 3E86A 4X1YB 1IBKO 3TYYA 2Q69A 4PV1D 5CHXA 1GTOA 4EKWA 4DR1B 4ZI7B 1KILA 1HW7A 5L3EA 1F7YA 3H1LD 4OX9B 3VBBA 1XOUA 1NJIW 3SYCA 2OWOA 3O65A 4DV4O 1WPXA 4O2AA 4E4EA 4EFEA 2M0BA 4YJ3A 4YY3O 5IJ0B 3T4ZA 4GODA 1PPJH 3CCLP 2Q3EA 5APUA 1IBMO 1S0VA 4K0KB 3K79A 3K08A 1SRYA 1CP9A 4MVRA 1NYHA 3CCMV 2RMZA 2EILB 1X59A 2QKCA 4A5UB 1G8MA 4WBNB 1US6A 1WLEA 4FLVA 1JOCA 1E1RG 3ITKA 3LW5H 2OCHA 4Z2WA 1VQ6V 2IJJA 5IDJA 3KPEA 2ZE6A 4Q6GA 4GYCB 4JI6O 3O6QA 2KG7B 2WSFJ 4N78D 3HKCA 4O4JB 4DR7O 2A3QA 2JS5A 2PF4E 4J7ZA 1OHHG 5KX5B 3OW2U 5KA6A 2JKVA 1NWQA 4NB5A 1VPCA 2N9BA 4M3LA 2CGNA 4W7YA 4K3AA 2QTSA 2Q68A 2ZAEB 1XNQB 1R5SA 1YBKA 4LF8O 1VQ8V 1N7SD 3PP5A 1YIJP 2ZD9A 1NTZD 3OAAG 2WPSA 3H1IG 2WLNA 2B9BA 3DTUB 2CTQA 1NTMJ 3L72D 3MD0A 3SSUA 5IYZA 1D7MA 4UCVA 1VMGA 1SLQA 1KQFB 2CUGA 2E76D 4DV0O 2WLLB 1HJBA 5CJ0A 5CBGA 2AZ2A 3K9SA 2FYUD 1S9KD 2FXPA 1FPOA 4OH8B 3OW2O 1OIPA 5APTA 4OVNF 3CX5D 4D6TG 2FFDA 2BCCG 2O01H 1NJIQ 4YJ2A 5BMVA 1JY2P 4O4HA 4IHJA 4FJCC 4B08A 5LL6Y 3LSSA 3FWNA 2YIBA 5D5QA 4B3RO 1L2PA 4GKGA 3P7KA 5CB4A 1VQ5V 4JYBA 3AEAC 4LC1A 1N32O 3KDPB 1IBKB 4WFEA 2I1KA 1L0LK 3KG2A 3PTZA 4PD4E 2H8PD 1Q7YQ 2QKAA 1AQTA 1ZR4A 2RDCA 2DYSC 1W59A 3CRCA 4IYHA 4L87A 1YYCA 1KB9H 3VQWA 4DV4B 1NR7A 4DUZB 4DYLA 5M1BA 1N73C 2EIMC 4JI7O 5LGNA 3AE5C 5FPOA 4GOFA 1IBMB 2HG5C 2X6AA 1S77D 3LSUA 3X2QC 2DJVA 3BABA 3E2EA 4R7CA 3G71V 3PHLA 3AE1C 5F2VO 1NVPB 1ZR2A 1LT9A 2B89A 1T3UA 2YO3A 1JY3P 3ZS8C 2HPCB 2DYSB 5IE9A 1FKAO 1SERA 1L0LG 3L70J 1SQBK 3LSQA 4PA3A 4MVZA 1KYOF 4QJFB 2W90A 5KLVJ 1N73B 2HJFC 2C0WA 2EIMB 1WMKA 2JRIA 2QG4A 1YZBA 3UCSC 2E43A 5GONA 1FZEA 4GLXA 4DR7B 2R3SA 2QM8A 1NH2B 4K35A 4QPKA 2B88A 4RAIA 1BGYG 1GL2D 2GTAA 3I56V 3KYQA 3X2QB 2W83C 1N0JA 5H6RA 4UB6H 1AFOA 1P84H 1SQQH 4P30A 4P9PA 1NBMG 3NTNA 1BCCE 3L71J 5GTIH 1HTLC 2HODB 4EDFA 4WFAV 3AE6C 1L0NE 4UXNA 5APQA 2ZE8A 4C7NB 3SWKA 4B3MO 1GW3A 3H1ID 4HH2A 4RKUJ 3CMAP 2P10A 4Z1MH 1SFCD 4YHHO 4DV0B 1EDJA 5DEDA 4QNHB 1WP7A 4JAUA 1VQOP 5EIBC 5AW9B 1BZKA 5LXTA 5IJ9B 1T6AA 1F51A 1ZLZA 3BAAA 3JAKB 5J2TB 3VP9A 1M1JC 2ZT9D 4D6TD 1ZMEC 1IC2A 2BCCD 1WB8A 1SESA 2WA3A 2PI5A 2VQEO 3A0RA 2JK5C 4PDMA 2QA4V 3CWBG 3RK3C 3OE7G 4RUEA 2K9PA 2A06E 1FE6A 4TT3G 1EXIA 3GB7C 1KUQA 3ZN0A 5JJNB 1N32B 2NRGA 4GX5A 1VIBA 3F5TA 1VQMV 3CMEV 3N2GB 1ZV8A 3JD1A 4ASUG 4CH3A 1FYJA 1HVVA 1KFMA 3N27A 5LMUO 1XMQO 2Q0OC 2WSFH 2HFED 2ETNA 5JQGA 1M1JB 3A3YB 1AILA 1TU3F 1QVFO 5CCGC 4U3JA 3B8NA 1R3LC 5EK0A 2QJPC 3VQXA 3D6ZA 4JI7B 3TNUB 3APOA 1N34O 5H5NA 1PP9D 5EZYA 2BSKB 2WA4A 3TXQA 4FLZA 2C2AA 1B06A 2JWAA 1FZFA 3K5LA 2YXQB 1MNGA 1YF2A 1ZSPA 1WPBA 4LF9O 3SPHA 4H0LD 2JS3A 5JH7B 3RGBA 4DV3B 2W27A 1EZVE 4RESB 2MK3A 2LO1A 2Q73A 3RN4A 1QGKB 4MVSA 2PI4A 3NXSA 4X20A 1YJ9V 4N3YB 1NI8A 2K3RA 4U3FD 1BGYD 3CRQA 2H7HA 1RF0A 3FX0A 1JJOA 3H1HD 4KL1A 4X62O 5LMNO 2A79B 2Z3YA 3CYOA 1QNMA 3RGUA 5B1NA 1TAEA 3G6BA 2YI9A 4B3MB 2IFMA 2ZDIC 4O4IB 5EBWC 2JJ2G 4YXWG 4YHHB 1IK7A 4LWSA 3O9OA 4DO2A 4DOJA 1YITV 3QF7A 2P90A 2BTQB 3UT5B 2WZ7A 2QKSA 1YJWP 4NXMB 4JI4O 2XDJA 4GX0A 3AE7C 1HGZA 2QWRB 1MABG 2N74A 1MA1A 3WFVA 3C9IA 4OGQC 3TJTA 3AEGC 1O9GA 5GTHH 1JEKA 3O8ZA 2EJRA 4ZHQB 4XDLA 1KYOE 3CWBD 1Q86Q 4IFDK 1AJPA 3HD7C 4X1YA 3L70H 3ZBHA 1SQPE 2UXBO 1V54C 1YHQP 4E2LA 4ZI7A 3SWFA 4BIZA 3QO8A 1XMQB 1EDKA 1HNXO 4PV1C 2W6JH 1XL4A 3L74E 2OIEA 3WU2E 1ZTEA 4GOEA 2KNCB 3LDDA 1R3IC 4OGQB 4QE7A 2E75D 3PLNA 1LTTC 1TGOA 2CE4A 3L71H 2KP8A 3FFQA 1VQLP 1B6QA 3HD7B 4QE9A 1LNQA 1DD3A 4O2BB 3IJ4A 1K73W 1G2CA 4B86A 1V54B 4UUJC 2IYOA 3RYHB 4HKZH 4R4LA 1HR0O 2P67A 4PV1B 5KJ7A 3FKSG 4PHZA 4X66O 4MTOA 2VQFO 1BCCJ 4X1IA 2P7TC 3L73J 3WU2Z 1LTAC 2KG7A 2Q7GA 4X1KA 4JF3A 4O4JA 1QQCA 3ZRVA 1JCCA 1L0NJ 3LNMB 3EXAA 4O2AB 4JYAO 1NTKE 3QH9A 5CA0A 3RYCB 3VYIA 5KX5A 1EZVI 2BE3A 5KUKA 4MTXA 1SQVD 2XKMA 4CH5A 1IFPA 3KCYA 5KHHA 1FDMA 4X62B 2K1EA 1TVKB 5LMNB 2PAJA 5APXA 1YEWA 3A8TA 1SA0A 4NXNO 1M57D 3R66A 1EN4A 2UXCB 2Q6AA 5AVXB 1KQSU 4PA6A 2WLLA 2IJIA 2IJKA 3KKYA 3SPIA 3JCZA 4CC6A 2E76C 3S4RA 1Y74A 2HP8A 1SQQK 4JI4B 4TOIA 1N36B 3CXHE 2ZE7A 1XUQA 3PH0A 1MZFA 2N04A 1VQNV 1NZ6A 1DF5A 3BPZA 1OWAA 5CCHA 4WFBV 2F66C 2WPDG 3CC4V 3MHSC 3ZHQA 1KQSO 2ZIMA 3RW0A 3SPGA 3E8FA 3ETEA 1TUBB 2Q5UA 1JMBA 2E76B 2FL4A 3E83A 3ZHSA 1D5NA 2IBZG 1K73Q 4G28B 3R2PA 1XTGB 4PI2A 2H8PC 4XDKA 1IZ3A 4JTDB 1PL4A 4YJ2B 1SVFA 5BMVB 3T1HB 4DUYO 2JGDB 4O4HB 1YTZT 4KXRA 4YIPA 4AHCA 2R9AA 2OYQA 1BE3E 4LF4O 1FD9A 5LYJA 1Y4MA 2HPCA 1HR0B 4X66B 1PKXA 2VQFB 4J80A 2WLJA 1MZ9A 1GN6A 2OTKE 3T1YO 3U1CA 3MGNA 3AE9C 3ZRXA 3BFRA 4JYAB 1K5QA 5AVUB 1Y9BA 3HB3B 2UUCO 4LF6O 1ZL8B 4PD4H 2Q5ZA 5KAIE 2Q8VA 1NKNA 5KTBA 3OAKA 2QDOA 4DW1A 2JWDA 5DM6V 1GL2C 1S5LE 1CW5A 4BAYA 1QU7A 2FTKA 2HODA 3BRTB 2V1DA 3ZDMA 2QSAA 1JCHA 2G38A 1S1CX 4C7NA 2JDIH 1S5JA 2WVRA 3BCCG 4GIFA 1QL2A 4R8CA 3H1KE 3DC6A 1GMJA 2XTAA 3RK3E 1U57A 3F89A 2HJDA 2JEUA 1SFCC 2Q9IA 5IJ9A 2YC0A 3JAKA 1IBLO 3STLC 1G1IA 5KAIZ 1HNWO 1BSHA 1GL2B 3CCSV 2HEPA 5JVDB 1SQPJ 3L75D 5BU5A 2ATKC 1S5LZ 1HH0A 2E42A 1AI7A 3U11A 3VTPC 2E3CA 3CCJV 2ZFCA 2ZT9C 4DR6O 4B3SO 4ABMA 3CXHI 3L74J 3B8MA 5TJHA 4N23A 3TGUE 4OPHA 2Q9LA 3N2GA 4GCZA 1NH4A 2WSSH 1SFCB 1YI2V 1BCCH 3ICXA 1S76D 4DV1O 1AV1A 4J41A 4HBNA 2IBZD 2CH7B 4WFGA 3CX5F 4HAMA 1LR1A 1U7MA 4NR1A 1M1JA 4MVOA 3HRNA 4I2LC 1L0NH 1Y76B 2OTJV 2BASA 2PYLA 3FB5C 1FZCC 5J2UB 4JBZA 1P84D 2HFEC 4J7JA 4J42A 2EIKB 2ZT9B 2POHA 5AW1B 2XAFA 3V5BA 1KN7A 2BSKA 1OZHA 1NTME 2KK7A 3WUTA 1K9MW 3C1LA 1Z5WA 4X65O 1H8HG 2IJHA 3K57A 1GMGA 4ICGA 1NTKJ 1M8OB 4IGGA 2YKQA 2FB5A 5AW0B 1FS0G 4RQEA 5CCGA 4WFHA 3KZIZ 1S3JA 1FZCB 2A06H 1WN7A 2Y69C 3A2AA 1XMOO 3P3NA 1AQ5A 2UU9O 2UUCB 1HWTC 2ZKOA 4X9QA 1A02F 4AYCA 1JY3N 1OCZC 1FXKA 2WAMA 4FFBA 1SQXK 3OR7C 4F6RB 1PGPA 3H1JE 2R3CA 4JV5O 5LBQA 1Z56A 4O4IA 2W6JG 3BCCD 2Y69B 2QWPB 1BQZA 5CJ4A 1JQ0A 4O4LB 1OCZB 2BTQA 5AVRB 2PTMA 3OM3B 1HNWB 1GK6A 1VF5D 2XV5A 4X8AA 1GKFA 4X20B 2CK3G 4DR4O 1K3EA 4AQYO 3L70E 1SQXG 4DK1A 4B7KA 2LGWA 1BS3A 5KLVE 3C8VA 4B3SB 1Q3EA 2YKOA 4LGDE 2ZDIA 2PUSA 1NU1K 1M9NA 1JNMA 3WUUA 2ADPA 3E89A 4XA4A 3M7MX 4ZKUA 1K9MQ 3CEIA 3RBZA 3ETDA 4CC5A 4DV1B 1IK9A 2JEEA 3FYIB 2XASA 2O1JA 1ZX3A 3EFGA 2DE0X 2HVJC 4JZGA 1BE3J 2RJZA 3CCUP 2KNCA 2IU0A 3E35A 1VQ4V 1AJNA 3HR0A 2XOKG 2IDBA 2GUZB 2QRXA 3G3ZA 3EHBB 3MIWA 1R6KA 3EVKA 1AVOA 3HD7A 3QO5A 4MT8A 2E75C 4X65B 2ZINA 3OTOO 4O2BA 4N78E 1NU1G 1M93A 1OZ0A 4MS2A 1EC5A 3ZMUA 3A5TA 4NPFX 1KQGB 1NR1A 3JALB 1VEWA 3FXEA 3F5WC 1KYOH 1XMOB 3G6EV 3I5CA 1NTZE 5IWAO 1VL2A 4R4MA 3RYCA 1SQPH 1OJHA 2E75B 4JAVA 2R5DA 3H1KJ 3L72E 4C46A 3SGIA 1JA8A 3G4SV 1QVGU 1PGQA 5IT9N 2Q7HA 3L74H 1TVKA 1JPXA 2VWJA 1QLED 4JV5B 3WU2H 1Q7YW 2Y9YA 1G2CB 2VS0A 3JSLA 3CX5E 2OQQA 4H33A 1UFIA 4DR3O 1CI6A 2WLHA 1NKZB 2YXYA 1M57C 2UXXA 4X1IB 1SQGA 5KUMA 1RE3C 2W6AA 3CLQA 1NGMB 3WUVA 4X1KB 5AVWB 3TGUJ 4ZKPA 3OJAB 1QL1A 2XAGA 2EZOA 3Q2YA 3CCMP 3W68A 1IZNB 5DJUB 5CA0B 4JI2O 1QVGO 4DR4B 2XAHA 1PGOA 1N33O 2QE7H 4AQYB 3AG2C 2NZ2A 4TLFA 4GZRB 4GUNA 3RK2D 1SQXD 1VQ6P 2VWKA 3VOUA 1FU1A 1N7SA 1BL8A 4PJ0E 1NTKH 4DRXB 4UV8A 1SA0B 1RFYA 1GTWA 1TUBA 1M57B 5CCHC 2V7QJ 2BTOA 2IFNA 4FLTA 1CZQA 2X6CA 4JZ2A 1M7LA 4PELA 5H9CA 5E1AC 2WT7B 2F4VO 1PNMA 3AG2B 3AK2A 3VMYA 3CI9A 1BDCA 1Y74B 2ZVNB 1VQ8P 1QEXA 1YJNV 3A0BE 2W8ZA 2DWDC 1X79B 3BEHA 1L8DA 5BVZA 1Q90D 4FZ0A 3N4XA 2JGDA 5APYA 4J11A 4PJ0Z 1EBOA 2RNBA 3OTOB 2WWWA 2WPVB 1SKVA 2Y0DA 3ZHUA 1JM0A 2GSMB 1NU1D 3CXHH 2H43A 1FXVA 3V2QA 3R4YA 1KP3A 2Y9ZA 2JP3A 1L0NK 1IDSA 3CCEV 1GAXA 1RSOB 1ZN5A 5AW6B 2KB7P 2L6LA 3H1JJ 2CTRA 3ZCCA 4IFMA 3DC5A 3A0BZ 3QTCA 4MW3A 1RQUA 4YY3B 4EIJA 2ITAA 1ZL8A 1VQ5P 3E1RA 3B5ND 3K58A 5AVVB 2YIDA 3B40A 2OYHC 4XFJA 4PDLA 1NS1A 4BWAA 3RVZA 3ZX6A 2IH3C 2WSSG 2GBOA 1USEA 2OYOA 2C0XA 3JSVC 5LYJB 3H6PA 4U7JA 4D6TE 1AP5A 2P5OA 1IFMA 2BCCE 1L0NG 1E79G 4LR3A 3H1LJ 4JI6B 1KFNA 4IYIA 5EBMC 4FZ1A 1YVWA 1FZAA 3CX5I 1ZRTD 1BE3H 3NFQA 4N21A 2KOGA 3I55V 1Q81Q 1URFA 4IIJB 3CHXA 2OYHB 1QR8A 1GL2A 1Q6IA 4L8JA 5JVDA 1JX9A 1FDOA 1COWG 1BHBA 1FFXB 4P9OA 1MSDA 2YKPA 1DIPA 4FVMA 2XZRA 3OA7A 3ABKC 3L73E 4LF8B 2YMYA 2P1JA 3IC7A 3MTUE 4UCTA 2FYNC 3JD0A 3NMDA 1UJWB 2ODMA 3FAVB 1BT8A 3BASA 1LTGC 5KAIH 1SFCA 1PP9E 1XNRO 4K8ZA 1SQBG 1S5LH 2CGOA 1FJKA 1Z5VA 4H13D 3I56P 2CH7A 1PFIA 4C7UA 5EC2C 1BSMA 1FFTB 2ZQMA 2F4VB 1YQ3C 1N4CA 1Y76A 4DV2O 4I7ZC 1MG1A 3UQ8A 4LH6A 5J2UA 4LFAO 3TF5A 4WB4A 2ZXWC 3C3TA 3H1KH 3ABKB 4L76A 1R3JC 3AEFC 1WT6A 2FYNB 4JYYA 5AW3B 4B3RB 2QWNB 3L9DA 1NTZJ 3S9OA 1E5WA 1CSBA 3Q3DA 4FPPA 4ASWA 1IJDB 3L72J 1X0TA 1M4UA 1X9VA 2IU3A 4U3FE 1BGYE 2EX3A 3U1AA 2A9HA 4I7ZB 1Q2NA 2QWQB 1FZCA 3K9AA 3OUFA 4JI1O 2ZM6O 3L4FA 4WBAA 2FYUJ 1JTHB 3BA8A 3H1HE 3TGUH 1JJ2U 2ZXWB 3IF4A 1R6TA 1OVUA 1Q82Q 1EZVG 1ZOYC 2QA4P 2AHZA 5LOVB 1HJ0A 4PD4I 3ZRWB 3B8EB 3OEEG 3CC7V 1Q86W 4JPZB 4WY4D 3CCRP 4FFKA 1VQMP 1G6UA 3CMEP 1HDJA 4TQDA 3KZIH 4F6RA 1T2KD 1FXKC 2L91A 2R9RB 1X22A 4BW5A 1QLNA 5BY1A 4JI8O 5C8YA 4DR5O 2M3BA 2V7QH 1NTMH 3FXDA 2J59M 3LDCA 3UKMA 1QR9A 1SZTA 4CBCA 5FNVA 5EBLC 4CS3A 1L0LD 1USDA 2EBOA 1OW7A 1SQPK 4O4LA 1V55C 2B1GA 2EZPA 3CWBE 1MOFA 4UB8E 1IX9A 3ZMVA 2UXDO 1RE4A 1FXKB 2XNDH 2YUAA 1VF5C 1MKMA 3GWOA 4FFBB 3ZN1A 2F23A 1H2SB 3FB6C 2E5YA 4D7TA 3KQGA 2NPSD 4RQFA 1IFDA 1GN4A 4YIOA 1KB9F 3SR2C 2JEXA 2WSEJ 1K4DC 4YXDC 1XNRB 1V55B 4CH4A 4Q20A 1YJ9P 3EWKA 1SQBD 3OMIB 3H1JH 4OPAA 1Y47A 2A45H 2VRSA 1D5AA 4BW9A 2KSDA 2ZCEA 4UB8Z 4UCOA 1W2BU 3P3PA 1LGHB 1PPJG 1VF5B 3RFRA 3BRVB 3IN6A 3SWYA 5CMZA 2R9IA 1RHZB 2MKVA 1EN6A 1H2KA 2EINC 1NTKK 2GUZA 2J5UA 3P30A 2AGAA 2VQEB 3IFXA 2NR5A 3K5NA 2YIUC 1G1JA 1S5LX 2GHYA 3NR7A 3CS5A 1FZBA 2K37A 4JQ0D 1L4AD 3H1IJ 4HYOA 4UVCA 1ZAUA 3JALA 2KS1B 5KLVH 4JI1B 2ZM6B 5LMUB 4X64O 1AI6A 1S72V 1P84F 1SQVE 2WLKA 4NKGB 3UM7A 4NYKA 2EINB 5IY5C 3AEEC 4EOTA 2IX7C 2FMLA 3LDEA 1N34B 2E5LO 1EZVD 4D6TJ 3ZHRA 2BCCJ 5APWA 2YIUB 3OMAB 3ZMZA 4BRYB 5L3CA 3OR6C 3GW6A 1J5EO 1DD4A 4DJGA 2UUBO 4UFZA 1IVSA 3T97B 4JI8B 3CCQV 4LF9B 1TUEB 1QLEC 3KHUA 1NHLA 1VF7A 1N0NA 1WJZA 3KCXA 3G67A 5KJ7D 4ASVA 5IY5B 2P7JA 1H2MA 2PGDA 3Q5SA 1UIXA 1JY2O 3HKBB 3SYAA 4U3FG 3HE5B 4LFCO 1DK1A 2UUAO 2JVDA 2LP7A 5L3FA 2UXDB 1PP9J 3CXCU 4YTPC 3VOPA 4EB6B 4H44D 2YMKA 5E79E 1QLEB 2OCCC 4DW0A 2J58A 1NTZH 2RCVA 3OT7A 4DRXA 3RK2C 3CRRA 1KD1Q 3L72H 3RWRD 3CE2A 2LQTA 1N7SC 1RE3A 4LFBO 5AW5B 1CI6B 4IL6E 3IAYA 2YIAA 1MFTA 3USSA 3CD6V 4PI0A 1HBWA 1FZGA 2WT7A 3V6IA 2ITDC 1AR4A 3CX5H 3K5BA 1K5SA 1DLBA 1PPJD 1OVRA 1GU5A 1XEQA 2KSJA 4U3FJ 1BGYJ 2OCCB 1Y6XA 5E79Z 4UVAA 1JY3O 1BQ0A 1M90Q 3RK2B 3ZMTA 3E8HA 3ZHTA 2WITA 3H1HJ 4KHPO 4J10A 2BOCC 1N7SB 4MSWC 1FJGO 1GN2A 4IL6Z 4FK5C 1PL5A 5AW4B 4UCSA 4UCRA 1AR1B 1K05A 2UXBB 2HYNA 1BE3G 5L3BA 3GF3A 1RSOA 3HKDA 4X64B 3ZIAG 3IFMA 1OV9A 1KYOI 1EDLA 4PJ0H 2QJYC 1HNXB 3N7NA 3GG2A 1VQNP 1JR9A 1QX8A 2BEQD 1HGVA 1SQQG 3VMXA 4I9QA 3APQA 2E5LB 2ZXEB 2DQ3A 1KMIZ 2X0LA 2WTYA 5JJJB 2A0LA 1LUVA 4I55B 3FB7C 4B3TO 1HNZO 3VN0A 1J5EB 1OW6A 2FBWC 3B5NC 1MV8A 3S1KA 3CWBJ 4Z1MG 1XBLA 1I08A 2V4HA 3A0BH 2WSEH 3F7VC 3CRAA 4FM2A 2QJYB 3L75E 2H3OA 2PRRA 1RPOA 2LW1A 1G1XB 1DEEG 4Y28J 5HFMA 1F23A 1HUCA 2YXHA 1FJPA 4L75A 5H6QA 4IIJA 4MVUA 2OYHA 4LLHA 2UUAB 2JIZG 2C9LY 3B5NB 3AG7A 1FFXA 4JI3O 3JC22 2PGGA 1VQPV 2IBZE 5KA5A 4AILC 1NO4A 3CXHD 1RF1C 1R3KC 1NTMK 2HKOA 1IFNA 3L36A 3S3XA 3IR9A 1H2GA 3P8CD 4NXNB 1U97A 3FAVA 3WB0A 4ZBMA 4FLYA 1MUUA 1GM8A 4JI5O 1KB9D 2OYIC 3W7XA 4KFMA 2KXPB 2WSCJ 1I94O 1KU9A 3AG3C 2R44A 2L5GB 5C39A 1Y67A 3GWKC 4D6TH 1NOHA 2BCCH 3KXDA 1RF1B 5CA1A 3IGAC 3UO2A 2O1KA 1B04A 1Q6UA 1SQVJ 1VP7A 2EIKC 1R8EA 3TK1A 1LP1A 1NTMG 2XAQA 1IFIA 1FJGB 3DGEA 2OYIB 3TDKA 5JWPA 4H13B 5FL7G 1JY2N 2E5TA 2F95B 2AEMA 3CCSP 3AG3B 3L73H 1YTFD 1JTHA 3ASOB 3KZIE 3CCJP 1PD3A 2XAJA 3BVHA 1V9PA 2XNDG 1BHAA 4AUWA 5LOVA 3MAQA 3AEIA 1PP9H 3ZRWA 1VQ7V 1SQQD 2Q3IA 5AW8B 3DSQA 3C90A 3BCCE 1IURA 2IH1C 4NTXA 4DUYB 4EYYQ 2N1TD 1YI2P 1H0TA 3QG5A 3JCUE 4WY4C 1J2JB 2EIJC 1P7BA 2ITCC 1ZUQA 2O57A 2W6IG 5KLVK 4LF4B 1T2KC 3D71A 2P4KA 4TV8B 5AG2A 4GKJO 2OTJP 1GN3A 1JO5A 5KMGB 2ILMA 4NVPA 1EM1A 2JR8A 4I0XA 1MZEA 2FXMA 4BR6A 3RL0D 3T1YB 4FIPC 4H0LC 2YDEA 1YTZI 2GUSA 1CEZA 3ETQA 3W7SA 1ROPA 4R50A 3RK3D 1S5HC 3CP1A 3T2MA 2Q6QA 4LF6B 4DV6O 5K1XA 4U3FH 1BGYH 4FLWA 4WY4B 5GW7A 4JI3B 1VQ9P 2EIJB 3CC2V 3CCVV 1FAFA 3JCUZ 3MHHC 4LF5O 1AI4A 2JGUA 3H1HH 1M56D 4LNUB 3RBXA 2NLJC 1RE4C 1NKDA 1LWUC 2Z5IA 3L70G 4KT0J 1FOSF 1NT2B 3H9VA 3G9RA 5KLVG 2YSUB 4IFFA 5C8YB 5HFLA 2NPSC 3EFFK 4H0LB 4OX9O 1AJYA 3QWOC 4JI5B 2Z5UA 3H32A 5C93A 5FNVB 5APVA 2OTLV 3RYFB 4ZMDA 1PV0A 2AW9A 4HNAB 2Q4PA 4AQRD 4IT5A 1TA8A 1LJ2A 1IBLB 1GD2E 3BVOA 3GMAA 3K06A 3L71G 5DJTB 3SYPA 1K33A 3CJHB 1VQKV 1AVYA 1KTMA 3A0HE 3C3SA 1LWUB 1NTZK 1SF9A 1EFRG 3AK1A 3U10A 3JAWB 1NQTA 2LFSA 1FS0E 4DR6B 3H1LE 3BHPA 3CWBH 2NPSB 3Q5RA 2QM7A 4UB8H 1P49A 5A2QN 2AHYA 1NTMD 3IAOA 4TT3H 3V2NA 4JI0O 1R73A 2PFXA 3HE4A 1GO3F 1T3JA 2KS1A 1ZWIC 1L4AC 2IZ1A 3JASA 3F5HA 2BOBC 1KZUB 1EN5A 3A0HZ 2YXRB 1I5YA 1KKCA 3L75J 3M9BA 1O9HA 4CS2A 3ABTA 4A7PA 5IYBO 3II6A 5H2FE 1GK9A 4W7ZA 4BRYA 5IYDO 2X6BA 5FLXN 2ZJSE 3WG7C 4HJGH 3OTFA 1QHTA 2GUVA 3FD9A 1L4AB 3T97A 1LTJC 3G80A 1U7JA 4NTYA 4WF9V 3GHGA 4J7KA 1CXZB 4TV9B 2RN9A 1N8RQ 1VQ4P 4JASA 1SQXE 3HKBA 5KJ7C 5KHIA 4BWNA 2UU9B 2QEXP 3AK3A 3HE5A 1URQD 1K4CC 3ETGA 1AJQA 5H2FZ 4W4KA 3E7KA 4LH7A 3WG7B 2CDYA 4EB6A 4LF5B 1KQLA 1SQVH 4DCKA 5J9PC 1LTJB 2H89C 5L8RJ 5B1OA 3CCLV 2FYUE 2M8RA 1S9KE 1M1KQ 2GA1A 4H44C 2ZR3A 5KHJA 4TQFA 3L70D 1DH3A 5KLVD 1KILD 2Z5HA 5KAFE 3G6EP 1VARA 2RQ6A 3M91A 4YXWH 2LGQA 4DUZO 1K8AQ 2A45I 2YEVA 2K88A 2WLMA 2DW4A 3G4SP 4X88A 3AE4C 3LNNA 3U0ZA 1H89A 1NU1E 2R32A 2W0XA 5CMUA 3L71D 4J9ZB 2FKWB 4L74A 4H44B 3SJAC 3B2EE 2IYPA 5IYCO 3B71A 3AG1C 2YI8A 3CSXA 4WFFA 3MUDA 1HWYA 3CL3D 5KAFZ 3E1IA 4JI0B 1PV3A 1JMMA 1M5IA 4XBFA 1YIJV 4CS4A 2HVKC 3BCCJ 2DWEC 3R65A 1WNSA 1Q81W 1WB7A 1AR5A 5E79H 2QSIA 1GH6A 3WB2A 4BIUA 3F7YC 2YO2A 4FMTA 3S3WA 3GF7A 1Z2GA 3D36C 5APSA 3Q4HB 3RL0g 3ABMC 1VF6A 4EEQA 3D8CA 3M99B 2LJ2A 2QTOA 4IL6H 3T1CA 3AG1B 1LTBC 4I55A 1FOSE 4N6JA 1MFZA 2WPQA 4I9WA 2JDIG 4HB1A 5DN6G 1ZRTE 1OCRC 1FAVA 2KZIA 4Z1VA 3UIAA 1PGJA 4GKKO 2QGNA 1I0HA 2ZXXA 4OWFA 2GTSA 1RH5B 1YJNP 2B5UA 2EJ7A 3ABMB 3HKDB 1GRJA 3HUSC 1PM9A 1YXBA 1HF9A 3A2FA 3K0GA 1OVVA 4DV5O 2H88C 1JFFB 5IWAB 2LFRA 3B5NA 3H1IE 2N9YB 5A9GA 2YIBD 1OCRB 3BA9A 3P8MC 4O9BA 2KYVA 2KUBA 2FY8A 2WQYC 3E22A 2PP6A 3CPWU 3CCEP 2D2CD 3GLMA 2L35A 3SJQC 5ITZB 1BCCG 4MVMA 5L3DA 3L73G 3HUSB 2A7WA 1J1DC 4DR3B 4WCEV 1GZLA 2CAZC 1Q82W 3ZRSA 3ML0A 1U96A 5LA6B 4JGSA 1PP9G 3AE8C 2FKXA 2W6BA 5JCOC 5B3SC 2P22C 1L1FA 4UVBA 3L75H 4JI2B 5AVYB 3V4QA 3G71P 1N33B 1RF1A 5EYPB 3VMZA 3CPWO 4HZ3A 1YSCA 3CCRV 1NAFA 3FGAD 2QM4A 1XILA 2UWJE 1J1DB 3CB2A 3JAMN 4F6EA 2OYIA 5B1AC 3OD4A 2XNXA 4DV3O 3QO7A 2DMXA 1XL6A 3U59A 3I55P 2A06G 3Q5PA 3T4DA 2RH0A 4JAAA 1SS1A 2IBZH 4ZNCA 5B3SB 3CMAV 1K92A 2BEZF 4WVZA 1QBZA 2O3JA 3BY6A 2XU6A 1VQOV 1SS3A 2JO1A 2F43G 4PD4D 1SC5B 3H1HG 4TWKA 2HHHO 2Q67A 5CA1B 5CBHA 3OUSA 3D70A 1L0LE 1SQXJ 1PIXA 5B1AB 2XUMA 4W80A 1ZXGA 2Y0EA 3HKEB 2ZYAA 1LP1B 2M3EA 2E74D 2N1TC 2WLIB 4TV8A 4GKKB 3N2KB 1EXJA 5KMGA 3ABLC 1W2EA 1NVOA 4TUYA 3V2RA 3AEDC 4GX1A 1YTFB 1LT1A 3AG4C 5LHHA 4NXMO 2O01N 4IL6X 4DV5B 2Q1KA 4CPGA 1QVFU 4I4TB 4MTGA 4OXSA 2M5AB 4R6ZA 1T8ZA 4GX2A 3RL0C 5LGUA 1JMKC 1JB0J 5TISE 4KUMA 2ZNJA 4WY4A 3DXRA 1Q5OA 4CH6A 2Q0AA 1OFCX 2M6YA 1SQBE 4LNUA 2N1TB 5AW7B 1WA8B 5AVTB 1H0TB 3ABLB 3VMAA 4MN4C 1M56C 1NU1J 1SQFA 1BCCD 3AG4B 3WB1A 3STZC 1Y66A 3BCCH 4I50A 5CN0A 3L73D 4I0XB 1J95A 1YDXA 2G3AA 3JCUH 4KHXA 3RYFA 1L0ND 3RL0B 3CC7P 4HNAA 4DT0A 3TXSA 2K9YA 2YICA 1K04A 3H01A 3SYQA 4H37A 5TISZ 4XDJA 4XE5B 2F93B 2I1JA 3RK3B 4FM1A 1SQVK 3CJHA 3CXHF 2DW3A 1SETA 1LWUA 3OMNB 1KC8W 2AXTE 3JAWA 1NAYA 2HLOA 4WWIA 1VDFA 1M56B 4G2KA 2K9JA 1A02J 3M06A 1XTCC 2KSEA 1XHXA 1H8EG 2NPSA 3M0DA 2DYRC 1EQ7A 5B66E 2ZE5A 1KV4A 4LF7O 3M8AA 1N86A 4ZOLB 3RYIB 2QJPB 3VP8A 4DV7O 3H32B 3JARA 4PA4A 3HPLC 2A06D 2KQXA 4X89A 4CZZA 4DXWA 1SQPG 1I7FA 4DR2O 1KKDA 2PZSA 4DV2B 2WMMA 2W0FC 4IOIH 2D3OW 1UPGA 1SQVG 4K8XA 4LFAB 4GDOA 3BATA 4U7NA 2AXTZ 2HHHB 1YJWV 3W7UA 3L74G 5AW2B 5L3GA 2DYRB 4J9YB 1OCCC 5B66Z 1KD1W 3TCUA 1RP3B 5BXZA 5LP6A 2R72A 1XHZA 3OFNG 5JJEB 4NPEA 4PDRA 2UXCO 1UIIA 1L4AA 1N2DC 2Y4UA 2B87B 1YITP 4NTWA 2XHBA 4FLUA 3A0HH 3FX7A 3HE4B 4TV9A 2Y0CA 1W2BO 3K5MA 3ASNC 3H1LH 5B5EE 5KKZC 2ZYGA 1MMMA 3GHGC 3JASB 1YHQV 1KECA 2CTPA 1N36O 2PY5A 3QVNA 2AZ0A 2QE7G 3MHVA 1M90W 2CPBA 2QR4A 1WP8A 5D5PA 1OCOC 1OX3A 1OCCB 2WPRA 1P7GA 3OEHG 4RO0A 1URQC 1NTKG 3Q1MA 4B7EA 3W67A 3I5DA 3RT3C 1RM1C 4I6MC 1LTJA 2AEFA 3PRJA 4JTCB 1S72P 4FLXA 1YCIA 2GDSA 1VQLV 2FXOA 3ASNB 1KC8Q 4DR5B 3SJBC 1PPJE 5KKZB 3GHGB 3ZJZA 1H2NA 5B5EZ 2NN4A 1ZW0A 5KHGA
chains in the Genus database with same CATH topology
2O01J 3D6YA 1R8EA 2D2CB 3O6QA 3AE6C 2E76B 2WSFJ 3SFEC 4U7JA 1VF5C 1VL2A 3AE7C 4R4MA 1MKMA 4RKUJ 2P10A 2E75B 4Z1MH 1HF9A 2H88C 4OGQC 3AEGC 4H13B 2WSEJ 4YXDC 3SFDC 4H13C 2G3AA 1FDOA 3EWKA 2ZT9D 2K9YA 1K04A 1ZMEC 2OQQA 2WQYC 3AE3C 1DIPA 4PV1C 2D2CD 3GLMA 1PL5A 2QIWA 1KQFB 1VF5B 2E76D 1K05A 5KLIC 3IN6A 2FYNC 1NGMB 2MKVA 3GF3A 3H25A 2FXPA 1EXIA 4OGQB 1OMIA 1KILE 1YQ4C 2E75D 2J5UA 2QJYC 3ABVC 3Q2YA 3D71A 2E74C 3AE9C 4H13D 2BEQD 2YIUC 2NZ2A 3AE8C 1S5LX 1Y9BA 1DD3A 2H89C 3AE2C 1KMIZ 5L8RJ 1YQ3C 4I7ZC 1TU3F 4H44C 4H0LC 3AEBC 1RQVA 2QJPC 3D6ZA 4R4LA 4PV1B 1OW6A 2FBWC 3FGAD 3AEAC 2V7QJ 3AEFC 1VF5D 1FDIA 4GDOA 3AEEC 1S1CX 4OGQD 3AE4C 3S9OA 2E74B 3Q3DA 1GMJA 3C8VA 1ZP0C 4Y28J 3RK3E 4KT0J 3Q5PA 3LW5J 1U57A 3AECC 3G9RA 5M1BA 4H0LD 4I7ZB 3AE5C 4H44B 4H0LB 1DD4A 2BEZF 1AJYA 1Q90D 3B71A 3T97B 2JO1A 4PV1D 2WPVB 1ZOYC 1HJ0A 2G8YA 1PV3A 2ZT9C 3AE1C 5KKZC 3Q5SA 3R4YA 3GMAA 3D70A 1UIXA 1PIXA 1KTMA 2JP3A 2QSIA 2D2CC 2E76C 2E74D 3GF7A 2IDBA 1WMKA 2QJKC 4YTPC 3RL0g 1EXJA 3Q1MA 2E75C 3Q5RA 1NYHA 1RQUA 3IAOA 3AEDC 4H44D 2WSCJ 4TT3H 1OW8A 2YMKA 1KORA 4IL6X 1IK7A 1OW7A 4XFJA 1KQGB 2ZT9B 1JB0J 1ZRTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KKZ C;  2O01 J;  2QIW A;  2D2C B;  1VF5 B;  5KLI C;  2E76 B;  2WSF J;  2FYN C;  2QSI A;  4RKU J;  4OGQ B;  2QJY C;  2E74 B;  2E75 B;  3C8V A;  4Y28 J;  2QJK C;  4KT0 J;  3LW5 J;  4H13 B;  2YIU C;  4I7Z B;  1S5L X;  2WSC J;  4H44 B;  4H0L B;  2WSE J;  5L8R J;  1Q90 D;  4IL6 X;  2QJP C;  2K9Y A;  2WPV B;  2ZT9 B;  4PV1 B;  1JB0 J;  1ZRT E; 
#chains in the Genus database with same CATH topology
 3J80 N;  5H2F H;  4JTA B;  4JYC A;  4QPJ A;  3V2P A;  1KIL C;  1OCO B;  3K5O A;  1AA0 A;  5IJ0 A;  3HTK B;  2LKM A;  3M9H A;  1K97 A;  1URQ B;  3J7A U;  3T1H O;  1WAZ A;  1RM1 B;  1DX7 A;  2LXB A;  1BDD A;  2CK3 H;  4ZKI A;  3CCQ P;  1H2L A;  2OIG A;  2JJL A;  4UCU A;  1SQX H;  3JYC A;  1SZX A;  3JAT B;  4WBN A;  4KP4 A;  1KP2 A;  3K59 A;  3FYE B;  1Q8I A;  1ORQ C;  3K0D A;  1K7D A;  4LF7 B;  1DGS A;  1KIL B;  2KI7 B;  4LBE C;  4DV7 B;  3FB8 C;  4KJM A;  1IXB A;  3MUD C;  3JD4 A;  1ARO P;  1KYO D;  1EDI A;  1L0L J;  5KHK A;  2YEV B;  1X4T A;  3FWL A;  2FYU H;  3H25 A;  1PNK A;  5CA3 A;  4YJ3 B;  4DR2 B;  1OMI A;  1HP8 A;  3Q4H A;  1SQP D;  1I5X A;  3B4S A;  5KAF H;  2SPZ A;  3K04 A;  2Y0I A;  5BZB A;  5CBN A;  3L74 D;  1VF6 C;  1CPY A;  3VQY A;  4AI8 A;  1MSW D;  3SJC C;  3D3Q A;  1BSN A;  1NU1 H;  1DF4 A;  3SDL A;  3CD6 P;  1F4N A;  2LR2 A;  4QGP A;  2CPS A;  3LID A;  1RPR A;  3D36 A;  3O6Q B;  3ZED A;  2V4D A;  3HKC B;  3J81 N;  1SQB J;  2OT5 A;  3LUT B;  3L75 G;  2DQ0 A;  3VQV A;  5AVS B;  3AEC C;  1JFF A;  3IC9 A;  3K3W A;  3CC4 P;  3P8C E;  1W0J G;  2FFD C;  2CTW A;  3MZW B;  5CCH D;  1FXH A;  1BMF G;  1KB9 E;  1GU4 A;  1NTK D;  1PNL A;  4QIW F;  4MTF A;  1LTI C;  2UUB B;  3JSN A;  5ITZ A;  2Y48 A;  1ZLL A;  5IYZ B;  2HLD G;  4PA7 A;  1B3Q A;  2Y4T A;  2KLV A;  1N7L A;  3HUS A;  2D2C C;  1XRE A;  2JJ1 G;  1K34 A;  2ZR2 A;  2OAR A;  2XT9 A;  1E1Q G;  2P06 A;  1ENV A;  1Q6H A;  5LA6 A;  5DEC A;  2P4V A;  2ZNI A;  2FFD B;  2KB1 A;  3B77 A;  3H1K G;  4UV9 A;  4DZO A;  4LFC B;  1WRG A;  5BU8 B;  4IHJ B;  3B09 A;  2AXC A;  1IO4 A;  5EYP A;  1XDC A;  2QJ1 A;  2ZIO A;  5CB4 B;  1NVP D;  3E22 B;  2D2C B;  4W4L A;  4RO2 A;  3SPJ A;  2PYJ A;  1DTO A;  3PJS K;  4DK0 A;  2OGU A;  1N73 A;  4UB6 E;  1LT9 C;  1OXZ A;  4HYT B;  1P84 E;  3H1I H;  3RVY A;  1SQQ E;  4LFB B;  3EQ2 A;  1S2E A;  3TGU G;  5GTI E;  3MP7 B;  5JCO A;  2MJZ A;  3V4W A;  2UXN A;  1G4Y B;  1Y8A A;  1R5L A;  5AVQ B;  2HG5 D;  1NH2 D;  1J1E C;  3SFD C;  4H13 C;  1VQP P;  2ARH A;  3W7W A;  1JOY A;  3L35 A;  4MW8 A;  2LW7 A;  2K1A A;  3ASO C;  3THO A;  4PA9 A;  3ABU A;  3AE3 C;  2F1M A;  2YXL A;  2QIW A;  2KLU A;  1D2D A;  1LT9 B;  4KHP B;  2ZVO B;  2V7Q G;  3HKE A;  3P32 A;  4UB6 Z;  3TSI A;  3BRC A;  2Z0A A;  5BR8 O;  2WLI A;  1GW4 A;  2X7R B;  3M0A A;  4Y99 C;  2HR3 A;  4BXL A;  3TET A;  3ZMS A;  5FPR A;  5GTI Z;  3N2K A;  2FYZ A;  1W5C E;  2RKL A;  1FC2 C;  2E74 C;  5AVZ B;  1XI1 A;  2H94 A;  1J1E B;  1GK4 A;  5GON B;  2C9N Y;  3PN1 A;  3MDS A;  2IPP A;  1BE3 D;  4F4L A;  3A7O A;  5J2T A;  4I4T A;  3AEB C;  2M5A A;  1P4R A;  2P58 A;  4I5S A;  1X8Y A;  2I8D A;  3UO3 A;  1FDI A;  1LUW A;  4Y99 B;  2N1T A;  4B3T B;  1R6N A;  2B9Z A;  1HNZ B;  1WA8 A;  4RJT A;  4JF7 A;  2E74 B;  2RN0 A;  2M7W A;  2NNU A;  4MVQ A;  1ZP0 C;  5EIB D;  3LW5 J;  1KB9 I;  3H1J G;  2A45 G;  1L0L H;  1VQ7 P;  4TUY B;  1E79 H;  3OGI B;  1AVM A;  5LXT B;  3JD2 A;  3TNU A;  2AEJ A;  1QCE A;  2LXC B;  2G8Y A;  5B1B C;  3H1K D;  4P2Z A;  1W0K G;  4I1L A;  1EZJ A;  1RY3 A;  5EFW B;  3M9Q A;  5K5G B;  1XQ8 A;  3DXR B;  2YNY A;  4BIO A;  1VQ9 V;  4EFB A;  3E8B A;  1KBH A;  3JD3 A;  4QMA A;  5EC1 C;  4YPC A;  5CBO A;  4FM0 A;  2QJK C;  5JH7 A;  3K03 A;  2KZJ A;  5TIS H;  1DEB A;  1H88 A;  1N8R W;  1GDT A;  4ZOL A;  3H1L G;  3RYI A;  5CCG D;  5LHG A;  4DR1 O;  1JCD A;  4RUF A;  1OW8 A;  3M0D C;  1KOR A;  2IBZ I;  1SP4 A;  4RWU A;  4I50 B;  4ZIB A;  5JQG B;  4L73 A;  1SQB H;  5K1P A;  3TGU D;  5B1B B;  2R70 A;  4U3J B;  3CC2 P;  3CCV P;  1GM7 A;  1Q43 A;  1F4M A;  1P84 I;  1T5E A;  1I94 B;  5LHI A;  1IXM A;  5LGT A;  2O01 J;  2KKW A;  5EZY B;  4C7R A;  3D6Y A;  3QNE A;  2KIK A;  1JUN A;  2Y0P A;  1M1K W;  3SFE C;  3W7T A;  3SYO A;  2IZ0 A;  4K0K O;  2QVA A;  1AI5 A;  2R5B A;  2QWO B;  3OGC C;  2QJK B;  3D3I A;  2Z4E A;  3L37 A;  1RF0 C;  2YS8 A;  2K9J B;  4JPR A;  1AP6 A;  1K8A W;  2OTL P;  1IFJ A;  1LTS C;  5BR8 B;  2B87 A;  1PL0 A;  5LP6 C;  2FYU K;  4U7O A;  1H8A A;  2AXT H;  2B1I A;  2IW5 A;  3UT5 A;  1FBM A;  4EI2 A;  2Q7E A;  1VQK P;  3JAR B;  5GTH E;  4PD4 F;  5B66 H;  2EUL A;  5KLI C;  2N05 A;  1EZV H;  1JVM A;  1A32 A;  1AB3 A;  1YQ4 C;  4G27 B;  1KIL E;  1THZ A;  4GT1 A;  3ABV C;  3CCU V;  2GV9 A;  1NTZ G;  1XNQ O;  4ZHQ A;  4D7S A;  1PZQ A;  3ZHV A;  5LP6 B;  3AE2 C;  3L72 G;  4TSF G;  2DOS A;  2Q7C A;  5CBF A;  3GVM A;  2GM4 A;  4PDV A;  1RQV A;  4LWS B;  4GKJ B;  4LP8 A;  2FYU G;  3CRM A;  3LIE A;  3L71 E;  5GTH Z;  3H1J D;  2P2U A;  4NPD A;  2RMK B;  5KLI B;  1GM9 A;  1R1B A;  2MW2 B;  3E8G A;  2ADQ B;  2WSC H;  3HTK A;  1URQ A;  2DN9 A;  4OGQ D;  3SPC A;  2IM9 A;  1SQQ J;  2P6J A;  4DV6 B;  2QEX V;  3WMM 0;  3HD7 D;  1H38 A;  5B5E H;  4LCU C;  2VRZ A;  3JAT A;  3RYH A;  1S4X A;  2ZYD A;  2EIL C;  3E86 A;  4X1Y B;  1IBK O;  3TYY A;  2Q69 A;  4PV1 D;  5CHX A;  1GTO A;  4EKW A;  4DR1 B;  4ZI7 B;  1KIL A;  1HW7 A;  5L3E A;  1F7Y A;  3H1L D;  4OX9 B;  3VBB A;  1XOU A;  1NJI W;  3SYC A;  2OWO A;  3O65 A;  4DV4 O;  1WPX A;  4O2A A;  4E4E A;  4EFE A;  2M0B A;  4YJ3 A;  4YY3 O;  5IJ0 B;  3T4Z A;  4GOD A;  1PPJ H;  3CCL P;  2Q3E A;  5APU A;  1IBM O;  1S0V A;  4K0K B;  3K79 A;  3K08 A;  1SRY A;  1CP9 A;  4MVR A;  1NYH A;  3CCM V;  2RMZ A;  2EIL B;  1X59 A;  2QKC A;  4A5U B;  1G8M A;  4WBN B;  1US6 A;  1WLE A;  4FLV A;  1JOC A;  1E1R G;  3ITK A;  3LW5 H;  2OCH A;  4Z2W A;  1VQ6 V;  2IJJ A;  5IDJ A;  3KPE A;  2ZE6 A;  4Q6G A;  4GYC B;  4JI6 O;  3O6Q A;  2KG7 B;  2WSF J;  4N78 D;  3HKC A;  4O4J B;  4DR7 O;  2A3Q A;  2JS5 A;  2PF4 E;  4J7Z A;  1OHH G;  5KX5 B;  3OW2 U;  5KA6 A;  2JKV A;  1NWQ A;  4NB5 A;  1VPC A;  2N9B A;  4M3L A;  2CGN A;  4W7Y A;  4K3A A;  2QTS A;  2Q68 A;  2ZAE B;  1XNQ B;  1R5S A;  1YBK A;  4LF8 O;  1VQ8 V;  1N7S D;  3PP5 A;  1YIJ P;  2ZD9 A;  1NTZ D;  3OAA G;  2WPS A;  3H1I G;  2WLN A;  2B9B A;  3DTU B;  2CTQ A;  1NTM J;  3L72 D;  3MD0 A;  3SSU A;  5IYZ A;  1D7M A;  4UCV A;  1VMG A;  1SLQ A;  1KQF B;  2CUG A;  2E76 D;  4DV0 O;  2WLL B;  1HJB A;  5CJ0 A;  5CBG A;  2AZ2 A;  3K9S A;  2FYU D;  1S9K D;  2FXP A;  1FPO A;  4OH8 B;  3OW2 O;  1OIP A;  5APT A;  4OVN F;  3CX5 D;  4D6T G;  2FFD A;  2BCC G;  2O01 H;  1NJI Q;  4YJ2 A;  5BMV A;  1JY2 P;  4O4H A;  4IHJ A;  4FJC C;  4B08 A;  5LL6 Y;  3LSS A;  3FWN A;  2YIB A;  5D5Q A;  4B3R O;  1L2P A;  4GKG A;  3P7K A;  5CB4 A;  1VQ5 V;  4JYB A;  3AEA C;  4LC1 A;  1N32 O;  3KDP B;  1IBK B;  4WFE A;  2I1K A;  1L0L K;  3KG2 A;  3PTZ A;  4PD4 E;  2H8P D;  1Q7Y Q;  2QKA A;  1AQT A;  1ZR4 A;  2RDC A;  2DYS C;  1W59 A;  3CRC A;  4IYH A;  4L87 A;  1YYC A;  1KB9 H;  3VQW A;  4DV4 B;  1NR7 A;  4DUZ B;  4DYL A;  5M1B A;  1N73 C;  2EIM C;  4JI7 O;  5LGN A;  3AE5 C;  5FPO A;  4GOF A;  1IBM B;  2HG5 C;  2X6A A;  1S77 D;  3LSU A;  3X2Q C;  2DJV A;  3BAB A;  3E2E A;  4R7C A;  3G71 V;  3PHL A;  3AE1 C;  5F2V O;  1NVP B;  1ZR2 A;  1LT9 A;  2B89 A;  1T3U A;  2YO3 A;  1JY3 P;  3ZS8 C;  2HPC B;  2DYS B;  5IE9 A;  1FKA O;  1SER A;  1L0L G;  3L70 J;  1SQB K;  3LSQ A;  4PA3 A;  4MVZ A;  1KYO F;  4QJF B;  2W90 A;  5KLV J;  1N73 B;  2HJF C;  2C0W A;  2EIM B;  1WMK A;  2JRI A;  2QG4 A;  1YZB A;  3UCS C;  2E43 A;  5GON A;  1FZE A;  4GLX A;  4DR7 B;  2R3S A;  2QM8 A;  1NH2 B;  4K35 A;  4QPK A;  2B88 A;  4RAI A;  1BGY G;  1GL2 D;  2GTA A;  3I56 V;  3KYQ A;  3X2Q B;  2W83 C;  1N0J A;  5H6R A;  4UB6 H;  1AFO A;  1P84 H;  1SQQ H;  4P30 A;  4P9P A;  1NBM G;  3NTN A;  1BCC E;  3L71 J;  5GTI H;  1HTL C;  2HOD B;  4EDF A;  4WFA V;  3AE6 C;  1L0N E;  4UXN A;  5APQ A;  2ZE8 A;  4C7N B;  3SWK A;  4B3M O;  1GW3 A;  3H1I D;  4HH2 A;  4RKU J;  3CMA P;  2P10 A;  4Z1M H;  1SFC D;  4YHH O;  4DV0 B;  1EDJ A;  5DED A;  4QNH B;  1WP7 A;  4JAU A;  1VQO P;  5EIB C;  5AW9 B;  1BZK A;  5LXT A;  5IJ9 B;  1T6A A;  1F51 A;  1ZLZ A;  3BAA A;  3JAK B;  5J2T B;  3VP9 A;  1M1J C;  2ZT9 D;  4D6T D;  1ZME C;  1IC2 A;  2BCC D;  1WB8 A;  1SES A;  2WA3 A;  2PI5 A;  2VQE O;  3A0R A;  2JK5 C;  4PDM A;  2QA4 V;  3CWB G;  3RK3 C;  3OE7 G;  4RUE A;  2K9P A;  2A06 E;  1FE6 A;  4TT3 G;  1EXI A;  3GB7 C;  1KUQ A;  3ZN0 A;  5JJN B;  1N32 B;  2NRG A;  4GX5 A;  1VIB A;  3F5T A;  1VQM V;  3CME V;  3N2G B;  1ZV8 A;  3JD1 A;  4ASU G;  4CH3 A;  1FYJ A;  1HVV A;  1KFM A;  3N27 A;  5LMU O;  1XMQ O;  2Q0O C;  2WSF H;  2HFE D;  2ETN A;  5JQG A;  1M1J B;  3A3Y B;  1AIL A;  1TU3 F;  1QVF O;  5CCG C;  4U3J A;  3B8N A;  1R3L C;  5EK0 A;  2QJP C;  3VQX A;  3D6Z A;  4JI7 B;  3TNU B;  3APO A;  1N34 O;  5H5N A;  1PP9 D;  5EZY A;  2BSK B;  2WA4 A;  3TXQ A;  4FLZ A;  2C2A A;  1B06 A;  2JWA A;  1FZF A;  3K5L A;  2YXQ B;  1MNG A;  1YF2 A;  1ZSP A;  1WPB A;  4LF9 O;  3SPH A;  4H0L D;  2JS3 A;  5JH7 B;  3RGB A;  4DV3 B;  2W27 A;  1EZV E;  4RES B;  2MK3 A;  2LO1 A;  2Q73 A;  3RN4 A;  1QGK B;  4MVS A;  2PI4 A;  3NXS A;  4X20 A;  1YJ9 V;  4N3Y B;  1NI8 A;  2K3R A;  4U3F D;  1BGY D;  3CRQ A;  2H7H A;  1RF0 A;  3FX0 A;  1JJO A;  3H1H D;  4KL1 A;  4X62 O;  5LMN O;  2A79 B;  2Z3Y A;  3CYO A;  1QNM A;  3RGU A;  5B1N A;  1TAE A;  3G6B A;  2YI9 A;  4B3M B;  2IFM A;  2ZDI C;  4O4I B;  5EBW C;  2JJ2 G;  4YXW G;  4YHH B;  1IK7 A;  4LWS A;  3O9O A;  4DO2 A;  4DOJ A;  1YIT V;  3QF7 A;  2P90 A;  2BTQ B;  3UT5 B;  2WZ7 A;  2QKS A;  1YJW P;  4NXM B;  4JI4 O;  2XDJ A;  4GX0 A;  3AE7 C;  1HGZ A;  2QWR B;  1MAB G;  2N74 A;  1MA1 A;  3WFV A;  3C9I A;  4OGQ C;  3TJT A;  3AEG C;  1O9G A;  5GTH H;  1JEK A;  3O8Z A;  2EJR A;  4ZHQ B;  4XDL A;  1KYO E;  3CWB D;  1Q86 Q;  4IFD K;  1AJP A;  3HD7 C;  4X1Y A;  3L70 H;  3ZBH A;  1SQP E;  2UXB O;  1V54 C;  1YHQ P;  4E2L A;  4ZI7 A;  3SWF A;  4BIZ A;  3QO8 A;  1XMQ B;  1EDK A;  1HNX O;  4PV1 C;  2W6J H;  1XL4 A;  3L74 E;  2OIE A;  3WU2 E;  1ZTE A;  4GOE A;  2KNC B;  3LDD A;  1R3I C;  4OGQ B;  4QE7 A;  2E75 D;  3PLN A;  1LTT C;  1TGO A;  2CE4 A;  3L71 H;  2KP8 A;  3FFQ A;  1VQL P;  1B6Q A;  3HD7 B;  4QE9 A;  1LNQ A;  1DD3 A;  4O2B B;  3IJ4 A;  1K73 W;  1G2C A;  4B86 A;  1V54 B;  4UUJ C;  2IYO A;  3RYH B;  4HKZ H;  4R4L A;  1HR0 O;  2P67 A;  4PV1 B;  5KJ7 A;  3FKS G;  4PHZ A;  4X66 O;  4MTO A;  2VQF O;  1BCC J;  4X1I A;  2P7T C;  3L73 J;  3WU2 Z;  1LTA C;  2KG7 A;  2Q7G A;  4X1K A;  4JF3 A;  4O4J A;  1QQC A;  3ZRV A;  1JCC A;  1L0N J;  3LNM B;  3EXA A;  4O2A B;  4JYA O;  1NTK E;  3QH9 A;  5CA0 A;  3RYC B;  3VYI A;  5KX5 A;  1EZV I;  2BE3 A;  5KUK A;  4MTX A;  1SQV D;  2XKM A;  4CH5 A;  1IFP A;  3KCY A;  5KHH A;  1FDM A;  4X62 B;  2K1E A;  1TVK B;  5LMN B;  2PAJ A;  5APX A;  1YEW A;  3A8T A;  1SA0 A;  4NXN O;  1M57 D;  3R66 A;  1EN4 A;  2UXC B;  2Q6A A;  5AVX B;  1KQS U;  4PA6 A;  2WLL A;  2IJI A;  2IJK A;  3KKY A;  3SPI A;  3JCZ A;  4CC6 A;  2E76 C;  3S4R A;  1Y74 A;  2HP8 A;  1SQQ K;  4JI4 B;  4TOI A;  1N36 B;  3CXH E;  2ZE7 A;  1XUQ A;  3PH0 A;  1MZF A;  2N04 A;  1VQN V;  1NZ6 A;  1DF5 A;  3BPZ A;  1OWA A;  5CCH A;  4WFB V;  2F66 C;  2WPD G;  3CC4 V;  3MHS C;  3ZHQ A;  1KQS O;  2ZIM A;  3RW0 A;  3SPG A;  3E8F A;  3ETE A;  1TUB B;  2Q5U A;  1JMB A;  2E76 B;  2FL4 A;  3E83 A;  3ZHS A;  1D5N A;  2IBZ G;  1K73 Q;  4G28 B;  3R2P A;  1XTG B;  4PI2 A;  2H8P C;  4XDK A;  1IZ3 A;  4JTD B;  1PL4 A;  4YJ2 B;  1SVF A;  5BMV B;  3T1H B;  4DUY O;  2JGD B;  4O4H B;  1YTZ T;  4KXR A;  4YIP A;  4AHC A;  2R9A A;  2OYQ A;  1BE3 E;  4LF4 O;  1FD9 A;  5LYJ A;  1Y4M A;  2HPC A;  1HR0 B;  4X66 B;  1PKX A;  2VQF B;  4J80 A;  2WLJ A;  1MZ9 A;  1GN6 A;  2OTK E;  3T1Y O;  3U1C A;  3MGN A;  3AE9 C;  3ZRX A;  3BFR A;  4JYA B;  1K5Q A;  5AVU B;  1Y9B A;  3HB3 B;  2UUC O;  4LF6 O;  1ZL8 B;  4PD4 H;  2Q5Z A;  5KAI E;  2Q8V A;  1NKN A;  5KTB A;  3OAK A;  2QDO A;  4DW1 A;  2JWD A;  5DM6 V;  1GL2 C;  1S5L E;  1CW5 A;  4BAY A;  1QU7 A;  2FTK A;  2HOD A;  3BRT B;  2V1D A;  3ZDM A;  2QSA A;  1JCH A;  2G38 A;  1S1C X;  4C7N A;  2JDI H;  1S5J A;  2WVR A;  3BCC G;  4GIF A;  1QL2 A;  4R8C A;  3H1K E;  3DC6 A;  1GMJ A;  2XTA A;  3RK3 E;  1U57 A;  3F89 A;  2HJD A;  2JEU A;  1SFC C;  2Q9I A;  5IJ9 A;  2YC0 A;  3JAK A;  1IBL O;  3STL C;  1G1I A;  5KAI Z;  1HNW O;  1BSH A;  1GL2 B;  3CCS V;  2HEP A;  5JVD B;  1SQP J;  3L75 D;  5BU5 A;  2ATK C;  1S5L Z;  1HH0 A;  2E42 A;  1AI7 A;  3U11 A;  3VTP C;  2E3C A;  3CCJ V;  2ZFC A;  2ZT9 C;  4DR6 O;  4B3S O;  4ABM A;  3CXH I;  3L74 J;  3B8M A;  5TJH A;  4N23 A;  3TGU E;  4OPH A;  2Q9L A;  3N2G A;  4GCZ A;  1NH4 A;  2WSS H;  1SFC B;  1YI2 V;  1BCC H;  3ICX A;  1S76 D;  4DV1 O;  1AV1 A;  4J41 A;  4HBN A;  2IBZ D;  2CH7 B;  4WFG A;  3CX5 F;  4HAM A;  1LR1 A;  1U7M A;  4NR1 A;  1M1J A;  4MVO A;  3HRN A;  4I2L C;  1L0N H;  1Y76 B;  2OTJ V;  2BAS A;  2PYL A;  3FB5 C;  1FZC C;  5J2U B;  4JBZ A;  1P84 D;  2HFE C;  4J7J A;  4J42 A;  2EIK B;  2ZT9 B;  2POH A;  5AW1 B;  2XAF A;  3V5B A;  1KN7 A;  2BSK A;  1OZH A;  1NTM E;  2KK7 A;  3WUT A;  1K9M W;  3C1L A;  1Z5W A;  4X65 O;  1H8H G;  2IJH A;  3K57 A;  1GMG A;  4ICG A;  1NTK J;  1M8O B;  4IGG A;  2YKQ A;  2FB5 A;  5AW0 B;  1FS0 G;  4RQE A;  5CCG A;  4WFH A;  3KZI Z;  1S3J A;  1FZC B;  2A06 H;  1WN7 A;  2Y69 C;  3A2A A;  1XMO O;  3P3N A;  1AQ5 A;  2UU9 O;  2UUC B;  1HWT C;  2ZKO A;  4X9Q A;  1A02 F;  4AYC A;  1JY3 N;  1OCZ C;  1FXK A;  2WAM A;  4FFB A;  1SQX K;  3OR7 C;  4F6R B;  1PGP A;  3H1J E;  2R3C A;  4JV5 O;  5LBQ A;  1Z56 A;  4O4I A;  2W6J G;  3BCC D;  2Y69 B;  2QWP B;  1BQZ A;  5CJ4 A;  1JQ0 A;  4O4L B;  1OCZ B;  2BTQ A;  5AVR B;  2PTM A;  3OM3 B;  1HNW B;  1GK6 A;  1VF5 D;  2XV5 A;  4X8A A;  1GKF A;  4X20 B;  2CK3 G;  4DR4 O;  1K3E A;  4AQY O;  3L70 E;  1SQX G;  4DK1 A;  4B7K A;  2LGW A;  1BS3 A;  5KLV E;  3C8V A;  4B3S B;  1Q3E A;  2YKO A;  4LGD E;  2ZDI A;  2PUS A;  1NU1 K;  1M9N A;  1JNM A;  3WUU A;  2ADP A;  3E89 A;  4XA4 A;  3M7M X;  4ZKU A;  1K9M Q;  3CEI A;  3RBZ A;  3ETD A;  4CC5 A;  4DV1 B;  1IK9 A;  2JEE A;  3FYI B;  2XAS A;  2O1J A;  1ZX3 A;  3EFG A;  2DE0 X;  2HVJ C;  4JZG A;  1BE3 J;  2RJZ A;  3CCU P;  2KNC A;  2IU0 A;  3E35 A;  1VQ4 V;  1AJN A;  3HR0 A;  2XOK G;  2IDB A;  2GUZ B;  2QRX A;  3G3Z A;  3EHB B;  3MIW A;  1R6K A;  3EVK A;  1AVO A;  3HD7 A;  3QO5 A;  4MT8 A;  2E75 C;  4X65 B;  2ZIN A;  3OTO O;  4O2B A;  4N78 E;  1NU1 G;  1M93 A;  1OZ0 A;  4MS2 A;  1EC5 A;  3ZMU A;  3A5T A;  4NPF X;  1KQG B;  1NR1 A;  3JAL B;  1VEW A;  3FXE A;  3F5W C;  1KYO H;  1XMO B;  3G6E V;  3I5C A;  1NTZ E;  5IWA O;  1VL2 A;  4R4M A;  3RYC A;  1SQP H;  1OJH A;  2E75 B;  4JAV A;  2R5D A;  3H1K J;  3L72 E;  4C46 A;  3SGI A;  1JA8 A;  3G4S V;  1QVG U;  1PGQ A;  5IT9 N;  2Q7H A;  3L74 H;  1TVK A;  1JPX A;  2VWJ A;  1QLE D;  4JV5 B;  3WU2 H;  1Q7Y W;  2Y9Y A;  1G2C B;  2VS0 A;  3JSL A;  3CX5 E;  2OQQ A;  4H33 A;  1UFI A;  4DR3 O;  1CI6 A;  2WLH A;  1NKZ B;  2YXY A;  1M57 C;  2UXX A;  4X1I B;  1SQG A;  5KUM A;  1RE3 C;  2W6A A;  3CLQ A;  1NGM B;  3WUV A;  4X1K B;  5AVW B;  3TGU J;  4ZKP A;  3OJA B;  1QL1 A;  2XAG A;  2EZO A;  3Q2Y A;  3CCM P;  3W68 A;  1IZN B;  5DJU B;  5CA0 B;  4JI2 O;  1QVG O;  4DR4 B;  2XAH A;  1PGO A;  1N33 O;  2QE7 H;  4AQY B;  3AG2 C;  2NZ2 A;  4TLF A;  4GZR B;  4GUN A;  3RK2 D;  1SQX D;  1VQ6 P;  2VWK A;  3VOU A;  1FU1 A;  1N7S A;  1BL8 A;  4PJ0 E;  1NTK H;  4DRX B;  4UV8 A;  1SA0 B;  1RFY A;  1GTW A;  1TUB A;  1M57 B;  5CCH C;  2V7Q J;  2BTO A;  2IFN A;  4FLT A;  1CZQ A;  2X6C A;  4JZ2 A;  1M7L A;  4PEL A;  5H9C A;  5E1A C;  2WT7 B;  2F4V O;  1PNM A;  3AG2 B;  3AK2 A;  3VMY A;  3CI9 A;  1BDC A;  1Y74 B;  2ZVN B;  1VQ8 P;  1QEX A;  1YJN V;  3A0B E;  2W8Z A;  2DWD C;  1X79 B;  3BEH A;  1L8D A;  5BVZ A;  1Q90 D;  4FZ0 A;  3N4X A;  2JGD A;  5APY A;  4J11 A;  4PJ0 Z;  1EBO A;  2RNB A;  3OTO B;  2WWW A;  2WPV B;  1SKV A;  2Y0D A;  3ZHU A;  1JM0 A;  2GSM B;  1NU1 D;  3CXH H;  2H43 A;  1FXV A;  3V2Q A;  3R4Y A;  1KP3 A;  2Y9Z A;  2JP3 A;  1L0N K;  1IDS A;  3CCE V;  1GAX A;  1RSO B;  1ZN5 A;  5AW6 B;  2KB7 P;  2L6L A;  3H1J J;  2CTR A;  3ZCC A;  4IFM A;  3DC5 A;  3A0B Z;  3QTC A;  4MW3 A;  1RQU A;  4YY3 B;  4EIJ A;  2ITA A;  1ZL8 A;  1VQ5 P;  3E1R A;  3B5N D;  3K58 A;  5AVV B;  2YID A;  3B40 A;  2OYH C;  4XFJ A;  4PDL A;  1NS1 A;  4BWA A;  3RVZ A;  3ZX6 A;  2IH3 C;  2WSS G;  2GBO A;  1USE A;  2OYO A;  2C0X A;  3JSV C;  5LYJ B;  3H6P A;  4U7J A;  4D6T E;  1AP5 A;  2P5O A;  1IFM A;  2BCC E;  1L0N G;  1E79 G;  4LR3 A;  3H1L J;  4JI6 B;  1KFN A;  4IYI A;  5EBM C;  4FZ1 A;  1YVW A;  1FZA A;  3CX5 I;  1ZRT D;  1BE3 H;  3NFQ A;  4N21 A;  2KOG A;  3I55 V;  1Q81 Q;  1URF A;  4IIJ B;  3CHX A;  2OYH B;  1QR8 A;  1GL2 A;  1Q6I A;  4L8J A;  5JVD A;  1JX9 A;  1FDO A;  1COW G;  1BHB A;  1FFX B;  4P9O A;  1MSD A;  2YKP A;  1DIP A;  4FVM A;  2XZR A;  3OA7 A;  3ABK C;  3L73 E;  4LF8 B;  2YMY A;  2P1J A;  3IC7 A;  3MTU E;  4UCT A;  2FYN C;  3JD0 A;  3NMD A;  1UJW B;  2ODM A;  3FAV B;  1BT8 A;  3BAS A;  1LTG C;  5KAI H;  1SFC A;  1PP9 E;  1XNR O;  4K8Z A;  1SQB G;  1S5L H;  2CGO A;  1FJK A;  1Z5V A;  4H13 D;  3I56 P;  2CH7 A;  1PFI A;  4C7U A;  5EC2 C;  1BSM A;  1FFT B;  2ZQM A;  2F4V B;  1YQ3 C;  1N4C A;  1Y76 A;  4DV2 O;  4I7Z C;  1MG1 A;  3UQ8 A;  4LH6 A;  5J2U A;  4LFA O;  3TF5 A;  4WB4 A;  2ZXW C;  3C3T A;  3H1K H;  3ABK B;  4L76 A;  1R3J C;  3AEF C;  1WT6 A;  2FYN B;  4JYY A;  5AW3 B;  4B3R B;  2QWN B;  3L9D A;  1NTZ J;  3S9O A;  1E5W A;  1CSB A;  3Q3D A;  4FPP A;  4ASW A;  1IJD B;  3L72 J;  1X0T A;  1M4U A;  1X9V A;  2IU3 A;  4U3F E;  1BGY E;  2EX3 A;  3U1A A;  2A9H A;  4I7Z B;  1Q2N A;  2QWQ B;  1FZC A;  3K9A A;  3OUF A;  4JI1 O;  2ZM6 O;  3L4F A;  4WBA A;  2FYU J;  1JTH B;  3BA8 A;  3H1H E;  3TGU H;  1JJ2 U;  2ZXW B;  3IF4 A;  1R6T A;  1OVU A;  1Q82 Q;  1EZV G;  1ZOY C;  2QA4 P;  2AHZ A;  5LOV B;  1HJ0 A;  4PD4 I;  3ZRW B;  3B8E B;  3OEE G;  3CC7 V;  1Q86 W;  4JPZ B;  4WY4 D;  3CCR P;  4FFK A;  1VQM P;  1G6U A;  3CME P;  1HDJ A;  4TQD A;  3KZI H;  4F6R A;  1T2K D;  1FXK C;  2L91 A;  2R9R B;  1X22 A;  4BW5 A;  1QLN A;  5BY1 A;  4JI8 O;  5C8Y A;  4DR5 O;  2M3B A;  2V7Q H;  1NTM H;  3FXD A;  2J59 M;  3LDC A;  3UKM A;  1QR9 A;  1SZT A;  4CBC A;  5FNV A;  5EBL C;  4CS3 A;  1L0L D;  1USD A;  2EBO A;  1OW7 A;  1SQP K;  4O4L A;  1V55 C;  2B1G A;  2EZP A;  3CWB E;  1MOF A;  4UB8 E;  1IX9 A;  3ZMV A;  2UXD O;  1RE4 A;  1FXK B;  2XND H;  2YUA A;  1VF5 C;  1MKM A;  3GWO A;  4FFB B;  3ZN1 A;  2F23 A;  1H2S B;  3FB6 C;  2E5Y A;  4D7T A;  3KQG A;  2NPS D;  4RQF A;  1IFD A;  1GN4 A;  4YIO A;  1KB9 F;  3SR2 C;  2JEX A;  2WSE J;  1K4D C;  4YXD C;  1XNR B;  1V55 B;  4CH4 A;  4Q20 A;  1YJ9 P;  3EWK A;  1SQB D;  3OMI B;  3H1J H;  4OPA A;  1Y47 A;  2A45 H;  2VRS A;  1D5A A;  4BW9 A;  2KSD A;  2ZCE A;  4UB8 Z;  4UCO A;  1W2B U;  3P3P A;  1LGH B;  1PPJ G;  1VF5 B;  3RFR A;  3BRV B;  3IN6 A;  3SWY A;  5CMZ A;  2R9I A;  1RHZ B;  2MKV A;  1EN6 A;  1H2K A;  2EIN C;  1NTK K;  2GUZ A;  2J5U A;  3P30 A;  2AGA A;  2VQE B;  3IFX A;  2NR5 A;  3K5N A;  2YIU C;  1G1J A;  1S5L X;  2GHY A;  3NR7 A;  3CS5 A;  1FZB A;  2K37 A;  4JQ0 D;  1L4A D;  3H1I J;  4HYO A;  4UVC A;  1ZAU A;  3JAL A;  2KS1 B;  5KLV H;  4JI1 B;  2ZM6 B;  5LMU B;  4X64 O;  1AI6 A;  1S72 V;  1P84 F;  1SQV E;  2WLK A;  4NKG B;  3UM7 A;  4NYK A;  2EIN B;  5IY5 C;  3AEE C;  4EOT A;  2IX7 C;  2FML A;  3LDE A;  1N34 B;  2E5L O;  1EZV D;  4D6T J;  3ZHR A;  2BCC J;  5APW A;  2YIU B;  3OMA B;  3ZMZ A;  4BRY B;  5L3C A;  3OR6 C;  3GW6 A;  1J5E O;  1DD4 A;  4DJG A;  2UUB O;  4UFZ A;  1IVS A;  3T97 B;  4JI8 B;  3CCQ V;  4LF9 B;  1TUE B;  1QLE C;  3KHU A;  1NHL A;  1VF7 A;  1N0N A;  1WJZ A;  3KCX A;  3G67 A;  5KJ7 D;  4ASV A;  5IY5 B;  2P7J A;  1H2M A;  2PGD A;  3Q5S A;  1UIX A;  1JY2 O;  3HKB B;  3SYA A;  4U3F G;  3HE5 B;  4LFC O;  1DK1 A;  2UUA O;  2JVD A;  2LP7 A;  5L3F A;  2UXD B;  1PP9 J;  3CXC U;  4YTP C;  3VOP A;  4EB6 B;  4H44 D;  2YMK A;  5E79 E;  1QLE B;  2OCC C;  4DW0 A;  2J58 A;  1NTZ H;  2RCV A;  3OT7 A;  4DRX A;  3RK2 C;  3CRR A;  1KD1 Q;  3L72 H;  3RWR D;  3CE2 A;  2LQT A;  1N7S C;  1RE3 A;  4LFB O;  5AW5 B;  1CI6 B;  4IL6 E;  3IAY A;  2YIA A;  1MFT A;  3USS A;  3CD6 V;  4PI0 A;  1HBW A;  1FZG A;  2WT7 A;  3V6I A;  2ITD C;  1AR4 A;  3CX5 H;  3K5B A;  1K5S A;  1DLB A;  1PPJ D;  1OVR A;  1GU5 A;  1XEQ A;  2KSJ A;  4U3F J;  1BGY J;  2OCC B;  1Y6X A;  5E79 Z;  4UVA A;  1JY3 O;  1BQ0 A;  1M90 Q;  3RK2 B;  3ZMT A;  3E8H A;  3ZHT A;  2WIT A;  3H1H J;  4KHP O;  4J10 A;  2BOC C;  1N7S B;  4MSW C;  1FJG O;  1GN2 A;  4IL6 Z;  4FK5 C;  1PL5 A;  5AW4 B;  4UCS A;  4UCR A;  1AR1 B;  1K05 A;  2UXB B;  2HYN A;  1BE3 G;  5L3B A;  3GF3 A;  1RSO A;  3HKD A;  4X64 B;  3ZIA G;  3IFM A;  1OV9 A;  1KYO I;  1EDL A;  4PJ0 H;  2QJY C;  1HNX B;  3N7N A;  3GG2 A;  1VQN P;  1JR9 A;  1QX8 A;  2BEQ D;  1HGV A;  1SQQ G;  3VMX A;  4I9Q A;  3APQ A;  2E5L B;  2ZXE B;  2DQ3 A;  1KMI Z;  2X0L A;  2WTY A;  5JJJ B;  2A0L A;  1LUV A;  4I55 B;  3FB7 C;  4B3T O;  1HNZ O;  3VN0 A;  1J5E B;  1OW6 A;  2FBW C;  3B5N C;  1MV8 A;  3S1K A;  3CWB J;  4Z1M G;  1XBL A;  1I08 A;  2V4H A;  3A0B H;  2WSE H;  3F7V C;  3CRA A;  4FM2 A;  2QJY B;  3L75 E;  2H3O A;  2PRR A;  1RPO A;  2LW1 A;  1G1X B;  1DEE G;  4Y28 J;  5HFM A;  1F23 A;  1HUC A;  2YXH A;  1FJP A;  4L75 A;  5H6Q A;  4IIJ A;  4MVU A;  2OYH A;  4LLH A;  2UUA B;  2JIZ G;  2C9L Y;  3B5N B;  3AG7 A;  1FFX A;  4JI3 O;  3JC2 2;  2PGG A;  1VQP V;  2IBZ E;  5KA5 A;  4AIL C;  1NO4 A;  3CXH D;  1RF1 C;  1R3K C;  1NTM K;  2HKO A;  1IFN A;  3L36 A;  3S3X A;  3IR9 A;  1H2G A;  3P8C D;  4NXN B;  1U97 A;  3FAV A;  3WB0 A;  4ZBM A;  4FLY A;  1MUU A;  1GM8 A;  4JI5 O;  1KB9 D;  2OYI C;  3W7X A;  4KFM A;  2KXP B;  2WSC J;  1I94 O;  1KU9 A;  3AG3 C;  2R44 A;  2L5G B;  5C39 A;  1Y67 A;  3GWK C;  4D6T H;  1NOH A;  2BCC H;  3KXD A;  1RF1 B;  5CA1 A;  3IGA C;  3UO2 A;  2O1K A;  1B04 A;  1Q6U A;  1SQV J;  1VP7 A;  2EIK C;  1R8E A;  3TK1 A;  1LP1 A;  1NTM G;  2XAQ A;  1IFI A;  1FJG B;  3DGE A;  2OYI B;  3TDK A;  5JWP A;  4H13 B;  5FL7 G;  1JY2 N;  2E5T A;  2F95 B;  2AEM A;  3CCS P;  3AG3 B;  3L73 H;  1YTF D;  1JTH A;  3ASO B;  3KZI E;  3CCJ P;  1PD3 A;  2XAJ A;  3BVH A;  1V9P A;  2XND G;  1BHA A;  4AUW A;  5LOV A;  3MAQ A;  3AEI A;  1PP9 H;  3ZRW A;  1VQ7 V;  1SQQ D;  2Q3I A;  5AW8 B;  3DSQ A;  3C90 A;  3BCC E;  1IUR A;  2IH1 C;  4NTX A;  4DUY B;  4EYY Q;  2N1T D;  1YI2 P;  1H0T A;  3QG5 A;  3JCU E;  4WY4 C;  1J2J B;  2EIJ C;  1P7B A;  2ITC C;  1ZUQ A;  2O57 A;  2W6I G;  5KLV K;  4LF4 B;  1T2K C;  3D71 A;  2P4K A;  4TV8 B;  5AG2 A;  4GKJ O;  2OTJ P;  1GN3 A;  1JO5 A;  5KMG B;  2ILM A;  4NVP A;  1EM1 A;  2JR8 A;  4I0X A;  1MZE A;  2FXM A;  4BR6 A;  3RL0 D;  3T1Y B;  4FIP C;  4H0L C;  2YDE A;  1YTZ I;  2GUS A;  1CEZ A;  3ETQ A;  3W7S A;  1ROP A;  4R50 A;  3RK3 D;  1S5H C;  3CP1 A;  3T2M A;  2Q6Q A;  4LF6 B;  4DV6 O;  5K1X A;  4U3F H;  1BGY H;  4FLW A;  4WY4 B;  5GW7 A;  4JI3 B;  1VQ9 P;  2EIJ B;  3CC2 V;  3CCV V;  1FAF A;  3JCU Z;  3MHH C;  4LF5 O;  1AI4 A;  2JGU A;  3H1H H;  1M56 D;  4LNU B;  3RBX A;  2NLJ C;  1RE4 C;  1NKD A;  1LWU C;  2Z5I A;  3L70 G;  4KT0 J;  1FOS F;  1NT2 B;  3H9V A;  3G9R A;  5KLV G;  2YSU B;  4IFF A;  5C8Y B;  5HFL A;  2NPS C;  3EFF K;  4H0L B;  4OX9 O;  1AJY A;  3QWO C;  4JI5 B;  2Z5U A;  3H32 A;  5C93 A;  5FNV B;  5APV A;  2OTL V;  3RYF B;  4ZMD A;  1PV0 A;  2AW9 A;  4HNA B;  2Q4P A;  4AQR D;  4IT5 A;  1TA8 A;  1LJ2 A;  1IBL B;  1GD2 E;  3BVO A;  3GMA A;  3K06 A;  3L71 G;  5DJT B;  3SYP A;  1K33 A;  3CJH B;  1VQK V;  1AVY A;  1KTM A;  3A0H E;  3C3S A;  1LWU B;  1NTZ K;  1SF9 A;  1EFR G;  3AK1 A;  3U10 A;  3JAW B;  1NQT A;  2LFS A;  1FS0 E;  4DR6 B;  3H1L E;  3BHP A;  3CWB H;  2NPS B;  3Q5R A;  2QM7 A;  4UB8 H;  1P49 A;  5A2Q N;  2AHY A;  1NTM D;  3IAO A;  4TT3 H;  3V2N A;  4JI0 O;  1R73 A;  2PFX A;  3HE4 A;  1GO3 F;  1T3J A;  2KS1 A;  1ZWI C;  1L4A C;  2IZ1 A;  3JAS A;  3F5H A;  2BOB C;  1KZU B;  1EN5 A;  3A0H Z;  2YXR B;  1I5Y A;  1KKC A;  3L75 J;  3M9B A;  1O9H A;  4CS2 A;  3ABT A;  4A7P A;  5IYB O;  3II6 A;  5H2F E;  1GK9 A;  4W7Z A;  4BRY A;  5IYD O;  2X6B A;  5FLX N;  2ZJS E;  3WG7 C;  4HJG H;  3OTF A;  1QHT A;  2GUV A;  3FD9 A;  1L4A B;  3T97 A;  1LTJ C;  3G80 A;  1U7J A;  4NTY A;  4WF9 V;  3GHG A;  4J7K A;  1CXZ B;  4TV9 B;  2RN9 A;  1N8R Q;  1VQ4 P;  4JAS A;  1SQX E;  3HKB A;  5KJ7 C;  5KHI A;  4BWN A;  2UU9 B;  2QEX P;  3AK3 A;  3HE5 A;  1URQ D;  1K4C C;  3ETG A;  1AJQ A;  5H2F Z;  4W4K A;  3E7K A;  4LH7 A;  3WG7 B;  2CDY A;  4EB6 A;  4LF5 B;  1KQL A;  1SQV H;  4DCK A;  5J9P C;  1LTJ B;  2H89 C;  5L8R J;  5B1O A;  3CCL V;  2FYU E;  2M8R A;  1S9K E;  1M1K Q;  2GA1 A;  4H44 C;  2ZR3 A;  5KHJ A;  4TQF A;  3L70 D;  1DH3 A;  5KLV D;  1KIL D;  2Z5H A;  5KAF E;  3G6E P;  1VAR A;  2RQ6 A;  3M91 A;  4YXW H;  2LGQ A;  4DUZ O;  1K8A Q;  2A45 I;  2YEV A;  2K88 A;  2WLM A;  2DW4 A;  3G4S P;  4X88 A;  3AE4 C;  3LNN A;  3U0Z A;  1H89 A;  1NU1 E;  2R32 A;  2W0X A;  5CMU A;  3L71 D;  4J9Z B;  2FKW B;  4L74 A;  4H44 B;  3SJA C;  3B2E E;  2IYP A;  5IYC O;  3B71 A;  3AG1 C;  2YI8 A;  3CSX A;  4WFF A;  3MUD A;  1HWY A;  3CL3 D;  5KAF Z;  3E1I A;  4JI0 B;  1PV3 A;  1JMM A;  1M5I A;  4XBF A;  1YIJ V;  4CS4 A;  2HVK C;  3BCC J;  2DWE C;  3R65 A;  1WNS A;  1Q81 W;  1WB7 A;  1AR5 A;  5E79 H;  2QSI A;  1GH6 A;  3WB2 A;  4BIU A;  3F7Y C;  2YO2 A;  4FMT A;  3S3W A;  3GF7 A;  1Z2G A;  3D36 C;  5APS A;  3Q4H B;  3RL0 g;  3ABM C;  1VF6 A;  4EEQ A;  3D8C A;  3M99 B;  2LJ2 A;  2QTO A;  4IL6 H;  3T1C A;  3AG1 B;  1LTB C;  4I55 A;  1FOS E;  4N6J A;  1MFZ A;  2WPQ A;  4I9W A;  2JDI G;  4HB1 A;  5DN6 G;  1ZRT E;  1OCR C;  1FAV A;  2KZI A;  4Z1V A;  3UIA A;  1PGJ A;  4GKK O;  2QGN A;  1I0H A;  2ZXX A;  4OWF A;  2GTS A;  1RH5 B;  1YJN P;  2B5U A;  2EJ7 A;  3ABM B;  3HKD B;  1GRJ A;  3HUS C;  1PM9 A;  1YXB A;  1HF9 A;  3A2F A;  3K0G A;  1OVV A;  4DV5 O;  2H88 C;  1JFF B;  5IWA B;  2LFR A;  3B5N A;  3H1I E;  2N9Y B;  5A9G A;  2YIB D;  1OCR B;  3BA9 A;  3P8M C;  4O9B A;  2KYV A;  2KUB A;  2FY8 A;  2WQY C;  3E22 A;  2PP6 A;  3CPW U;  3CCE P;  2D2C D;  3GLM A;  2L35 A;  3SJQ C;  5ITZ B;  1BCC G;  4MVM A;  5L3D A;  3L73 G;  3HUS B;  2A7W A;  1J1D C;  4DR3 B;  4WCE V;  1GZL A;  2CAZ C;  1Q82 W;  3ZRS A;  3ML0 A;  1U96 A;  5LA6 B;  4JGS A;  1PP9 G;  3AE8 C;  2FKX A;  2W6B A;  5JCO C;  5B3S C;  2P22 C;  1L1F A;  4UVB A;  3L75 H;  4JI2 B;  5AVY B;  3V4Q A;  3G71 P;  1N33 B;  1RF1 A;  5EYP B;  3VMZ A;  3CPW O;  4HZ3 A;  1YSC A;  3CCR V;  1NAF A;  3FGA D;  2QM4 A;  1XIL A;  2UWJ E;  1J1D B;  3CB2 A;  3JAM N;  4F6E A;  2OYI A;  5B1A C;  3OD4 A;  2XNX A;  4DV3 O;  3QO7 A;  2DMX A;  1XL6 A;  3U59 A;  3I55 P;  2A06 G;  3Q5P A;  3T4D A;  2RH0 A;  4JAA A;  1SS1 A;  2IBZ H;  4ZNC A;  5B3S B;  3CMA V;  1K92 A;  2BEZ F;  4WVZ A;  1QBZ A;  2O3J A;  3BY6 A;  2XU6 A;  1VQO V;  1SS3 A;  2JO1 A;  2F43 G;  4PD4 D;  1SC5 B;  3H1H G;  4TWK A;  2HHH O;  2Q67 A;  5CA1 B;  5CBH A;  3OUS A;  3D70 A;  1L0L E;  1SQX J;  1PIX A;  5B1A B;  2XUM A;  4W80 A;  1ZXG A;  2Y0E A;  3HKE B;  2ZYA A;  1LP1 B;  2M3E A;  2E74 D;  2N1T C;  2WLI B;  4TV8 A;  4GKK B;  3N2K B;  1EXJ A;  5KMG A;  3ABL C;  1W2E A;  1NVO A;  4TUY A;  3V2R A;  3AED C;  4GX1 A;  1YTF B;  1LT1 A;  3AG4 C;  5LHH A;  4NXM O;  2O01 N;  4IL6 X;  4DV5 B;  2Q1K A;  4CPG A;  1QVF U;  4I4T B;  4MTG A;  4OXS A;  2M5A B;  4R6Z A;  1T8Z A;  4GX2 A;  3RL0 C;  5LGU A;  1JMK C;  1JB0 J;  5TIS E;  4KUM A;  2ZNJ A;  4WY4 A;  3DXR A;  1Q5O A;  4CH6 A;  2Q0A A;  1OFC X;  2M6Y A;  1SQB E;  4LNU A;  2N1T B;  5AW7 B;  1WA8 B;  5AVT B;  1H0T B;  3ABL B;  3VMA A;  4MN4 C;  1M56 C;  1NU1 J;  1SQF A;  1BCC D;  3AG4 B;  3WB1 A;  3STZ C;  1Y66 A;  3BCC H;  4I50 A;  5CN0 A;  3L73 D;  4I0X B;  1J95 A;  1YDX A;  2G3A A;  3JCU H;  4KHX A;  3RYF A;  1L0N D;  3RL0 B;  3CC7 P;  4HNA A;  4DT0 A;  3TXS A;  2K9Y A;  2YIC A;  1K04 A;  3H01 A;  3SYQ A;  4H37 A;  5TIS Z;  4XDJ A;  4XE5 B;  2F93 B;  2I1J A;  3RK3 B;  4FM1 A;  1SQV K;  3CJH A;  3CXH F;  2DW3 A;  1SET A;  1LWU A;  3OMN B;  1KC8 W;  2AXT E;  3JAW A;  1NAY A;  2HLO A;  4WWI A;  1VDF A;  1M56 B;  4G2K A;  2K9J A;  1A02 J;  3M06 A;  1XTC C;  2KSE A;  1XHX A;  1H8E G;  2NPS A;  3M0D A;  2DYR C;  1EQ7 A;  5B66 E;  2ZE5 A;  1KV4 A;  4LF7 O;  3M8A A;  1N86 A;  4ZOL B;  3RYI B;  2QJP B;  3VP8 A;  4DV7 O;  3H32 B;  3JAR A;  4PA4 A;  3HPL C;  2A06 D;  2KQX A;  4X89 A;  4CZZ A;  4DXW A;  1SQP G;  1I7F A;  4DR2 O;  1KKD A;  2PZS A;  4DV2 B;  2WMM A;  2W0F C;  4IOI H;  2D3O W;  1UPG A;  1SQV G;  4K8X A;  4LFA B;  4GDO A;  3BAT A;  4U7N A;  2AXT Z;  2HHH B;  1YJW V;  3W7U A;  3L74 G;  5AW2 B;  5L3G A;  2DYR B;  4J9Y B;  1OCC C;  5B66 Z;  1KD1 W;  3TCU A;  1RP3 B;  5BXZ A;  5LP6 A;  2R72 A;  1XHZ A;  3OFN G;  5JJE B;  4NPE A;  4PDR A;  2UXC O;  1UII A;  1L4A A;  1N2D C;  2Y4U A;  2B87 B;  1YIT P;  4NTW A;  2XHB A;  4FLU A;  3A0H H;  3FX7 A;  3HE4 B;  4TV9 A;  2Y0C A;  1W2B O;  3K5M A;  3ASN C;  3H1L H;  5B5E E;  5KKZ C;  2ZYG A;  1MMM A;  3GHG C;  3JAS B;  1YHQ V;  1KEC A;  2CTP A;  1N36 O;  2PY5 A;  3QVN A;  2AZ0 A;  2QE7 G;  3MHV A;  1M90 W;  2CPB A;  2QR4 A;  1WP8 A;  5D5P A;  1OCO C;  1OX3 A;  1OCC B;  2WPR A;  1P7G A;  3OEH G;  4RO0 A;  1URQ C;  1NTK G;  3Q1M A;  4B7E A;  3W67 A;  3I5D A;  3RT3 C;  1RM1 C;  4I6M C;  1LTJ A;  2AEF A;  3PRJ A;  4JTC B;  1S72 P;  4FLX A;  1YCI A;  2GDS A;  1VQL V;  2FXO A;  3ASN B;  1KC8 Q;  4DR5 B;  3SJB C;  1PPJ E;  5KKZ B;  3GHG B;  3ZJZ A;  1H2N A;  5B5E Z;  2NN4 A;  1ZW0 A;  5KHG A; 
#chains in the Genus database with same CATH homology
 2O01 J;  3D6Y A;  1R8E A;  2D2C B;  3O6Q A;  3AE6 C;  2E76 B;  2WSF J;  3SFE C;  4U7J A;  1VF5 C;  1VL2 A;  3AE7 C;  4R4M A;  1MKM A;  4RKU J;  2P10 A;  2E75 B;  4Z1M H;  1HF9 A;  2H88 C;  4OGQ C;  3AEG C;  4H13 B;  2WSE J;  4YXD C;  3SFD C;  4H13 C;  2G3A A;  1FDO A;  3EWK A;  2ZT9 D;  2K9Y A;  1K04 A;  1ZME C;  2OQQ A;  2WQY C;  3AE3 C;  1DIP A;  4PV1 C;  2D2C D;  3GLM A;  1PL5 A;  2QIW A;  1KQF B;  1VF5 B;  2E76 D;  1K05 A;  5KLI C;  3IN6 A;  2FYN C;  1NGM B;  2MKV A;  3GF3 A;  3H25 A;  2FXP A;  1EXI A;  4OGQ B;  1OMI A;  1KIL E;  1YQ4 C;  2E75 D;  2J5U A;  2QJY C;  3ABV C;  3Q2Y A;  3D71 A;  2E74 C;  3AE9 C;  4H13 D;  2BEQ D;  2YIU C;  2NZ2 A;  3AE8 C;  1S5L X;  1Y9B A;  1DD3 A;  2H89 C;  3AE2 C;  1KMI Z;  5L8R J;  1YQ3 C;  4I7Z C;  1TU3 F;  4H44 C;  4H0L C;  3AEB C;  1RQV A;  2QJP C;  3D6Z A;  4R4L A;  4PV1 B;  1OW6 A;  2FBW C;  3FGA D;  3AEA C;  2V7Q J;  3AEF C;  1VF5 D;  1FDI A;  4GDO A;  3AEE C;  1S1C X;  4OGQ D;  3AE4 C;  3S9O A;  2E74 B;  3Q3D A;  1GMJ A;  3C8V A;  1ZP0 C;  4Y28 J;  3RK3 E;  4KT0 J;  3Q5P A;  3LW5 J;  1U57 A;  3AEC C;  3G9R A;  5M1B A;  4H0L D;  4I7Z B;  3AE5 C;  4H44 B;  4H0L B;  1DD4 A;  2BEZ F;  1AJY A;  1Q90 D;  3B71 A;  3T97 B;  2JO1 A;  4PV1 D;  2WPV B;  1ZOY C;  1HJ0 A;  2G8Y A;  1PV3 A;  2ZT9 C;  3AE1 C;  5KKZ C;  3Q5S A;  3R4Y A;  3GMA A;  3D70 A;  1UIX A;  1PIX A;  1KTM A;  2JP3 A;  2QSI A;  2D2C C;  2E76 C;  2E74 D;  3GF7 A;  2IDB A;  1WMK A;  2QJK C;  4YTP C;  3RL0 g;  1EXJ A;  3Q1M A;  2E75 C;  3Q5R A;  1NYH A;  1RQU A;  3IAO A;  3AED C;  4H44 D;  2WSC J;  4TT3 H;  1OW8 A;  2YMK A;  1KOR A;  4IL6 X;  1IK7 A;  1OW7 A;  4XFJ A;  1KQG B;  2ZT9 B;  1JB0 J;  1ZRT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...