2E75B

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
b'MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2e75B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75B01
2QJKC 3C8VA 4H44B 2WSCJ 5L8RJ 2QJPC 4I7ZB 4H0LB 4PV1B 2QJYC 2QSIA 2WSFJ 2WPVB 1Q90D 2K9YA 2ZT9B 2YIUC 2D2CB 4H13B 3LW5J 4RKUJ 1JB0J 4OGQB 4IL6X 2E76B 2E74B 2E75B 2WSEJ 4Y28J 2FYNC 2QIWA 1VF5B 1S5LX 4KT0J 2O01J 1ZRTE 5KKZC 5KLIC
chains in the Genus database with same CATH superfamily
2N9BA 1L0NE 3D70A 1HUCA 3OE7G 4JTAB 2CGNA 1VQ9P 3QO7A 4O4LA 2IJJA 1MNGA 1PP9H 1IFMA 3L70G 1M56B 1FD9A 1ZSPA 4DR5B 3SWFA 4G2KA 1AP6A 1IFDA 1NTZJ 1A02J 4H13B 3CRCA 1BZKA 1SQXJ 1NKDA 1RFYA 2DOSA 3CI9A 3S3XA 5L3CA 3PH0A 4Z1MH 2WLKA 3OR7C 4UCUA 2ZNIA 3L75D 2E42A 4ZI7B 1VQ8P 1S0VA 1N7LA 2P22C 2QWOB 4X66O 4OX9B 4AUWA 2ZQMA 2HFED 2AHZA 1D5NA 3JD4A 2E3CA 1T5EA 1XUQA 1BGYJ 1J1EB 2KK7A 1P4RA 4DV4O 2XAGA 4FMTA 3KZIH 1RE3C 5AVQB 4O4IA 2IU0A 1AI6A 1QLNA 4MS2A 2GHYA 1KILC 5B5EZ 3K79A 5LMUO 2WSCH 2JDIH 3BEHA 5CCGD 3RBXA 2KG7A 1S72P 3CCQP 1OCRC 1MV8A 4O4HA 1BDCA 2J59M 2E76D 4MVSA 1S5HC 1WA8B 2R72A 3H1IE 2Q7HA 5B66H 1KILB 2WLIB 4TV9B 1UPGA 3HKCA 1KORA 3OGIB 1NVPB 1RE4A 1H0TA 3BRTB 3L73J 2AGAA 1SQVH 1FZAA 1NAYA 1THZA 4U3JA 2OCCC 1JB0J 4GKKO 2FBWC 3A0BH 1OCRB 2Q0AA 2M3EA 4TUYB 1OVVA 3U1CA 4G28B 5FNVA 2UU9B 1W2BU 2WT7B 1NWQA 2FFDA 1AVMA 1GD2E 5AW1B 4NYKA 1VQ5P 3VOPA 4ZKUA 2KIKA 1IBMB 1SESA 1TVKA 1URQA 3B8EB 3UIAA 4I50A 1NU1G 4ABMA 4FFBB 2HVKC 5DJUB 5AVXB 1MSDA 4DR3B 3JSNA 3HKDB 3BCCD 2K88A 1JOCA 2V7QJ 4H44C 1RPRA 1BL8A 2OGUA 3CX5H 1GN4A 5LGNA 1EZJA 2OIEA 4TSFG 1CP9A 4UCRA 5JWPA 2JKVA 1SETA 3IJ4A 1M8OB 3JYCA 3EWKA 1SQPD 4H44B 4RJTA 3ZMTA 1IFNA 1N0JA 5APTA 1SQXK 1AJYA 2EX3A 3L74E 5TJHA 2YEVB 1JY2P 1IFIA 4JI3B 3AG4B 2VRSA 1L0ND 1Q86Q 3AEEC 1E79G 4O2BA 1KQLA 4IL6X 3CC4P 4LF9B 2BTQA 3W7SA 4KXRA 1LWUA 1Y74A 1WNSA 4DW0A 2QJKB 4N78E 4GKJO 4PV1D 3T1CA 5CCHC 5KLVE 3APOA 3QNEA 2IH3C 2JJ2G 1E5WA 1AROP 2N1TD 3OW2U 1OVUA 5B5EH 1AJPA 1COWG 3BFRA 4LFBO 2VWJA 3OMAB 1JQ0A 2LGQA 1MOFA 3WG7C 2Y0PA 3MAQA 2Y69C 1P84H 2A45H 4MTOA 4DV0O 2Q8VA 3VN0A 4X88A 2HP8A 2Q6QA 3HD7D 1EM1A 4BW5A 3G67A 1ZLLA 3L75G 5CJ4A 1R5SA 1LTBC 2IW5A 2QWQB 4MVQA 3RWRD 1VP7A 2E75C 1JJOA 2WPDG 5JQGA 2HJFC 4JBZA 5AW3B 3WG7B 1DH3A 1FS0E 3BA8A 2EIMC 2FYUH 3SPJA 4MVZA 1WAZA 2Y0IA 1JTHB 1IBKB 1YJ9V 1Z2GA 4PDMA 3JD0A 3M9HA 3K9AA 3H1ID 3RK3C 4TV8B 4ZOLA 3G71P 3CJHA 2ADQB 3M0DA 2E5LO 2YDEA 1FDIA 4GODA 4WY4C 1BSMA 1ZWIC 2F43G 2IPPA 1JCCA 3SSUA 5C93A 2K9PA 3ETEA 3QVNA 1EZVI 2HODA 4YXWG 2F4VO 1MSWD 3CCSP 3AE4C 3ZHSA 2XHBA 4NPDA 1W59A 4I0XB 3L35A 3WUUA 2ZVNB 3CC7P 1U57A 1CW5A 5GTHZ 2OYQA 1KILE 1LTJC 2DWEC 1Q82Q 4JQ0D 5H9CA 3GWKC 1FFXA 3H1JH 2ZJSE 2JGDB 4JI5B 4WY4B 1K73Q 5AVTB 3ZJZA 1Q90D 4FZ0A 4TT3G 3HKEA 3RYFB 3WUVA 1VARA 2DW4A 1NJIQ 1AR5A 1SFCC 1RF1B 4QMAA 2AZ2A 3AEIA 3CL3D 4W7YA 1WB8A 3LNMB 4GUNA 4DO2A 4OGQC 4D6TH 1SKVA 4UVBA 1AILA 2I1KA 4GKGA 3K06A 1VQKP 1GMJA 1NTMG 3NTNA 1Q7YQ 2X6AA 3E2EA 2NPSD 1VQNV 3CRMA 4IHJA 4DYLA 2ZAEB 3B5NC 3BCCG 1NTKJ 2Y0EA 2QEXP 5DEDA 3H1LH 1G2CA 2W27A 2XKMA 2ATKC 2O1JA 4OGQB 1B04A 5AVVB 4XFJA 4JI2B 2OYHC 2CTWA 3L74D 1FXHA 3H32A 3L70J 3CCVV 4DV6O 3U59A 1H8HG 3U11A 1WMKA 1QBZA 1L4AD 3CEIA 2BCCE 3U1AA 3UT5A 3IAYA 2AXTE 5B3SC 1SQPG 2DYSC 4N78D 3FGAD 2OCHA 2JO1A 4PD4H 2OYHB 1O9GA 5KLVD 1FAFA 2C2AA 1T3JA 1PL4A 2OYIC 1LJ2A 1L0NG 3LW5J 5EYPB 3GW6A 4MN4C 5IWAO 4UCSA 1Q86W 2XZRA 4LF6O 1KTMA 1EZVE 3L71G 3SPGA 4RWUA 4EDFA 1LUWA 4X20A 3R2PA 1ZLZA 4ZIBA 5L3BA 1SQBE 3CD6P 3G4SV 5BMVA 1XMQB 1JX9A 5CB4A 4J80A 3MHHC 1SFCD 4DOJA 1XNRB 1KD1Q 2KB7P 2B88A 4JZ2A 2OYIB 3OTOB 3CHXA 2P7TC 1T3UA 1T2KC 1N86A 2WMMA 3FXDA 1SQQE 1SQGA 4X64O 3Q4HB 3IFMA 1D2DA 4RKUJ 5KAFZ 2IZ0A 3PN1A 3WU2E 5GTHH 3A5TA 2EIJC 1R73A 4LGDE 1SZXA 2UXNA 2BE3A 1FXKA 3CS5A 3CRAA 2IBZI 1YIJP 5CBOA 2FY8A 3Q2YA 1BQZA 1OCZC 5AVWB 1YJWP 5IDJA 4YY3O 2W6JH 1JFFA 1Q5OA 3U0ZA 4UB8Z 1GM7A 3AEFC 3SYAA 4I5SA 2KS1A 3T1YO 3K03A 4YIOA 4LWSA 1JCHA 2ZD9A 1JMBA 4PDRA 4X65B 5GTIE 1NU1J 3L72J 1TUEB 3H1IG 1FZGA 2JS5A 1R6KA 4LF8B 3IC7A 1KILD 2ADPA 5DJTB 3M7MX 1PP9E 3ASOB 3LIDA 5APYA 3CCJP 3NFQA 4OPAA 1OV9A 3RK2C 3AECC 2X6CA 3MHSC 1QEXA 2WSFH 2HFEC 2L91A 2PGDA 3RK3E 2PAJA 2FXMA 2WA4A 4F6EA 3HKBB 1JCDA 1KC8W 2J58A 3ZIAG 4BRYA 2Q69A 3UO3A 2UXCB 5CN0A 1J5EB 4AILC 3M91A 3K04A 1BCCJ 1G1XB 3ZS8C 2JRIA 3CCEP 4J7ZA 2UUAO 4EFEA 2I8DA 1HTLC 2P58A 4PA7A 3WUTA 4F6RA 1HWTC 3LDCA 4IOIH 2EBOA 3J7AU 4IIJB 4B08A 4WBNB 3K5BA 3V2PA 1Q2NA 1JO5A 4HH2A 1Q7YW 1KQFB 2BCCD 1FJPA 4H44D 5B66E 5L3FA 1BE3H 2E76B 5FL7G 2KSDA 3JAKB 1HR0O 2IBZE 3JD3A 1RSOA 3L74G 4X66B 2ZXXA 1S5LZ 2CAZC 3UM7A 3A0BE 2WSSH 3JSLA 3SFDC 2V4HA 5JJJB 1ZL8B 1NTZH 2ZE6A 1EZVD 1SQXH 1AVYA 5KAFH 2F66C 1VF7A 2Y4UA 4DV4B 1NS1A 1XOUA 1SQBD 2CPSA 3L75J 4HAMA 3E1RA 5KLVG 3B8NA 2OWOA 5LMUB 3FYIB 3F5TA 4B3RO 1KP2A 4NTXA 4UCVA 1IK9A 3D36A 1MFTA 4QJFB 3I56V 2WAMA 1L8DA 2RH0A 1SQQD 2Q3IA 4UB8H 2QDOA 5C8YA 1BGYH 2O01J 2R32A 4I6MC 4NXMO 1X4TA 3FWLA 5CCHD 3CXHH 2AEFA 1WJZA 2Q0OC 1VQ6V 1W5CE 4EOTA 5H6QA 2QGNA 1NT2B 4PJ0Z 2PYLA 1FOSF 1NU1K 2BEQD 4AQYO 2CK3H 1KKCA 3Q5RA 5EK0A 4JI6O 2POHA 4K0KO 3CMEP 5CBHA 5AVZB 2B89A 5TISH 2ZXWC 3ZDMA 4OXSA 3ETGA 2YIBA 2BASA 3TF5A 2R70A 1FS0G 1N33O 2QM4A 1DD4A 3AE3C 4IL6E 4ZI7A 1Y47A 4Y99C 5LYJA 4PV1C 5K1XA 2ARHA 4JI7O 1WP7A 1VF6A 3HUSA 1GN2A 1MZFA 3ABUA 2QKCA 3L73H 3JCUE 4ZMDA 2E75D 2FMLA 2WVRA 2BEZF 1PP9D 4NB5A 1VQ7P 1KB9H 5AVSB 1V54C 2FL4A 1US6A 3AG3C 5D5PA 3BY6A 3FYEB 1OW6A 2ZXEB 4Y99B 4PV1B 1L1FA 1R5LA 5J2TB 1YQ3C 4R8CA 4W7ZA 4XE5B 3RK3D 2WSEJ 3DC6A 2RMZA 3CMAV 1JY3N 3D71A 4WY4D 3AEAC 1BSNA 3AG3B 4JTDB 2VQEB 1H89A 5L3GA 3HRNA 4DR7O 4H33A 1Z5WA 1QVGO 1KILA 2WLIA 4TV9A 3HTKB 4FJCC 3MDSA 1GZLA 2YSUB 3VMZA 3VOUA 1RPOA 3JC22 3G6EP 1YSCA 3TNUA 3CPWO 3TYYA 1KECA 4DV3O 4TUYA 1S5LH 1PM9A 5B1NA 3FD9A 2XTAA 4GKJB 3N2GA 1SQPJ 3AE2C 1OIPA 1V55C 1H2LA 2ZFCA 3B71A 3C1LA 2IH1C 5AW5B 1EQ7A 1NQTA 1PGPA 4K8ZA 5CBGA 4FFBA 2Z5UA 3CCMP 1L0NJ 4OGQD 3WB0A 4LFBB 3HKDA 5LOVB 2IBZD 3V2NA 3E89A 3SJQC 1P7BA 5DECA 4PI0A 3AEDC 1Y67A 4DV0B 3B5ND 2KKWA 3TGUJ 3ETDA 2YKOA 2J5UA 3C9IA 4MVUA 2BCCG 2HKOA 3CRRA 3K08A 3CXHF 3T1HO 1GMGA 1PV3A 5CA0A 3VYIA 4PJ0H 1GK4A 4JYAB 5KTBA 3H1JE 1M9NA 1N7SC 2XNDH 3ZMSA 2ZT9C 1CI6B 3N2KB 2LFRA 5KHJA 4Q6GA 2ZE7A 4JAVA 4KUMA 4I4TB 2EJ7A 4UCTA 3K3WA 4DZOA 1HWYA 1KYOI 5LP6C 4MVRA 2YEVA 3TXSA 3ETQA 1EZVG 3PJSK 2AXCA 1LTTC 2QTOA 3E35A 3AE7C 2UXDO 3V4QA 4MW8A 1SQBG 2OARA 1B3QA 1KQSU 1N7SB 2E5LB 4BWAA 2ZT9B 3LSUA 4N23A 3CCLV 1NH4A 1GM9A 4MTFA 2NNUA 1NTME 2ITDC 1OCOC 5LP6B 2F4VB 3JAMN 3KXDA 3E83A 2NPSB 1SQQG 1EXIA 2PUSA 4CH4A 2FB5A 4JPRA 3H1IJ 2H7HA 1YHQP 4FK5C 1L0LE 3J81N 1K92A 1K8AQ 1MG1A 3JD2A 1IZ3A 2YXQB 3SDLA 1TGOA 2QE7H 1KV4A 2QKSA 3D3IA 3JD1A 4O9BA 1FKAO 1UJWB 1NTMK 1T2KD 1FFTB 2UXBO 4X1YB 5CBNA 4OPHA 1JA8A 1PKXA 4XA4A 1GU4A 1M93A 1ZXGA 2Q3EA 1L4AB 4PD4E 4CC6A 2QWPB 5JVDB 3STZC 1AI7A 3ZN1A 1V9PA 3I55V 1YJNV 2PP6A 4H0LC 4U3FG 5B1AC 2NR5A 2OTJV 5AVYB 1VEWA 5AW4B 4FLWA 5EC2C 1USEA 3V2QA 3VTPC 4I1LA 4CS2A 1XDCA 1RF0C 3GVMA 4X8AA 1JTHA 1PP9G 2H88C 1EBOA 3L71E 1M5IA 1N2DC 1SQPK 4H0LB 4TV8A 2YKQA 2E5YA 1VL2A 3UCSC 2HVJC 2O57A 2VRZA 4OWFA 4DV6B 4Z1MG 2M7WA 1SFCB 1L0NK 1FZCA 3M06A 1VQLP 4WWIA 4J11A 1JVMA 3RK2D 2A06H 1KYOE 3KG2A 2Z4EA 1JM0A 1NTKH 1XL4A 3VBBA 2Y9YA 1DIPA 1PIXA 4F4LA 3TK1A 1YZBA 1N34O 4FVMA 1VQMP 2JGDA 1S72V 4ZKPA 3IR9A 3L70H 3RL0g 2QSIA 5IWAB 4UV9A 4C7NA 3RYFA 4LF6B 5EFWB 1N73A 1RF1A 3KDPB 4X1KA 2JDIG 3IAOA 2B1IA 5KLVJ 5H5NA 4CBCA 3RGBA 3TSIA 1QL1A 3Q3DA 4GT1A 2EINC 2NLJC 3L37A 2X0LA 1SQFA 3LW5H 2GUSA 1VQ5V 4PA6A 3H1JD 2YXYA 2IBZG 4HYOA 1OZHA 3NR7A 1YI2P 3VQVA 2KLVA 2G8YA 2VQFO 1FPOA 4AYCA 1QL2A 1W0KG 2BSKB 2EINB 4MVOA 3AG2C 3JCZA 2Q67A 4WFHA 3A2AA 1PPJH 4JTCB 4YY3B 3MTUE 4DXWA 2P06A 4HNAA 2OYHA 1LUVA 3TXQA 4JI1B 1NTMD 3T1YB 3VP8A 2OCCB 5IYCO 3BVHA 3AG2B 3K5LA 1ZR2A 2QA4P 3JASA 5EYPA 3N27A 1L0LD 2N9YB 5CHXA 1PL0A 1M4UA 3CRQA 1YYCA 3H1HH 3F7VC 1EFRG 2QSAA 2KUBA 1FZBA 2YMYA 1K4DC 3CC4V 1WLEA 4MT8A 5B1BC 2P90A 1BE3E 4RO0A 1NBMG 1VMGA 1N36O 3L72H 3H9VA 1MFZA 1PFIA 4X89A 1K8AW 3Q4HA 4NVPA 5LXTB 2HYNA 5LMNO 3FX0A 1NTZE 1N4CA 4UB6Z 1EC5A 1Q43A 2DMXA 1ZAUA 2WLJA 1Q6HA 3IFXA 2W0FC 2UUAB 1K5SA 3L71D 4JI4O 2LXCB 5M1BA 1GAXA 1AR1B 1Q81W 4J10A 4FZ1A 3MZWB 5DN6G 5APQA 2LO1A 4GX2A 2P4VA 1SVFA 4NPFX 4IFFA 4UB8E 1BCCH 4LF5O 1OWAA 2ZCEA 4FLVA 1KYOD 2XAQA 3HR0A 4J41A 3SYOA 2A45G 5KLVK 4LNUA 1YITP 2F1MA 1HBWA 4B3TO 3F89A 4PA3A 3IC9A 2XASA 1W2EA 4N3YB 2IDBA 5TISE 3G71V 3P7KA 1M57C 1LP1A 2BCCJ 1SS1A 2JP3A 1LTIC 2Y69B 1FZEA 1XILA 1BHBA 4B3RB 3CCSV 1VQ4P 1CPYA 3L73E 1GDTA 4LFAO 4W4LA 4FM2A 3CC7V 2QJ1A 1MABG 4MVMA 1S76D 1KFNA 2V4DA 3OJAB 1M57B 3X2QC 2E75B 4N21A 4DR6O 3W68A 1NOHA 4JI8O 2YNYA 1IXMA 1SQBJ 3O8ZA 4X62B 2EIMB 3SPIA 2M0BA 4JPZB 2ZE8A 4WBNA 2OYOA 3GLMA 3JATB 1LR1A 1LTAC 4JI6B 1KC8Q 3RK3B 4K0KB 5CBFA 2W6AA 3B4SA 1JUNA 3X2QB 3H1JG 5CCGA 1K9MW 1SQQJ 3ZX6A 1YF2A 2DN9A 1XMOO 1QGKB 2LW7A 1VQKV 3MUDA 5APVA 5BR8O 4JI7B 1S5JA 1N0NA 1TUBA 2QEXV 4EB6B 4YJ3B 1S5LE 2CDYA 1ZL8A 2DQ3A 1N7SD 2KP8A 4TLFA 1LTJB 2ZT9D 1XTCC 4YXWH 4UB6H 2W6BA 3FB6C 4DRXA 1X59A 4LBEC 5EZYA 1A32A 5JCOC 2KQXA 3H1KE 1FDMA 1WB7A 5IY5C 2Q9IA 1SP4A 2FKXA 3FAVA 2UWJE 1K04A 4JYBA 3H1LG 1BE3D 2QJYC 1MMMA 3A8TA 4X9QA 2VWKA 1KUQA 2UUCO 1L0LG 4O4IB 4TT3H 1DD3A 4GYCB 1PP9J 4LF7O 3MGNA 4JI0O 4DR7B 1RE4C 1QLEC 1NTZD 3O6QB 5IY5B 2P7JA 5APUA 1JY3P 1YQ4C 4O4JA 3H6PA 3B5NB 3SWKA 1FXVA 2QJYB 1IBLO 1L2PA 4O4HB 3RYHB 1VPCA 4QIWF 3DC5A 3ZN0A 2FFDC 5EIBC 2WSEH 3BPZA 3JAWB 3M8AA 4DV3B 4JV5O 3EFFK 1QU7A 2JK5C 4UVCA 4FLZA 1XHXA 5BXZA 2ZR3A 4YIPA 1QLEB 2YIUC 1FU1A 3VQYA 1HNZB 3ZMZA 3STLC 4FM0A 2GBOA 3AG7A 1DEEG 2YO3A 4KJMA 5EBLC 2JEUA 4UXNA 1XI1A 1QVFU 1H2KA 4HZ3A 3FXEA 1W2BO 1NR7A 4H0LD 5FNVB 5L3DA 4XDJA 2YXRB 5B3SB 4WBAA 2DYSB 1YBKA 1VQNP 3IN6A 1H2GA 1OW7A 4BWNA 3ABMC 1K97A 3C8VA 4CH6A 3VMAA 2AEJA 2X6BA 1GN6A 3CWBH 4GX1A 4I50B 2Q68A 4IYIA 4HB1A 1SQPH 4OX9O 5H2FE 3V4WA 1VQOP 4BR6A 3M0AA 1YIJV 1BMFG 1PNLA 5J2TA 3VQWA 3JARB 2BOBC 4QPKA 1ZOYC 1YJWV 5KJ7C 1CXZB 2N1TA 1S77D 1SQBK 1L0NH 1PL5A 1DF4A 3ABMB 1JNMA 3S4RA 1Y4MA 1ROPA 2DYRC 1X0TA 2MW2B 3L73D 1H38A 2KYVA 1N8RQ 1K05A 4O2AA 4DUYO 2ITCC 1R3JC 4CPGA 2C9NY 1HH0A 5KLIC 4IT5A 3CCJV 3TGUH 1SQQK 1YTZI 4LP8A 2UXDB 1LWUC 4NXNO 3LSQA 3HD7A 1KP3A 1IVSA 4U3FE 5AW0B 1G4YB 2DYRB 2EIJB 1J1DC 2RCVA 3RYCB 4BXLA 2BTOA 5IYZB 3RL0C 4WFAV 4Y28J 2QG4A 3OFNG 2PY5A 3TJTA 1OCZB 3FKSG 3P3PA 1IFJA 1LWUB 2UU9O 1RH5B 2NZ2A 2LFSA 5LOVA 2ZIMA 1H88A 1K3EA 1P7GA 3HE4B 2QWRB 3V6IA 1J1DB 1GRJA 5GONA 3OW2O 4Z2WA 4YHHO 3CX5I 5KA6A 1N32B 2UXBB 3G3ZA 3MIWA 4QE7A 1NTKE 4J9YB 5AW7B 4PA4A 2WTYA 4KP4A 3RK2B 5BVZA 1KMIZ 5A2QN 2AZ0A 2LGWA 2JWDA 4DUZO 2O1KA 2YC0A 4DV7O 3H1KD 3L36A 3H1IH 1P49A 1CI6A 3N2KA 2HLOA 2KNCB 4RAIA 1F23A 4BIUA 1XEQA 2B9BA 3KZIE 1DK1A 4B3MO 3N4XA 3T97B 2AEMA 3QG5A 3LNNA 4A5UB 3CCRP 5JJNB 3ITKA 3OEEG 3SWYA 3C3SA 4E4EA 1YCIA 2YI9A 3QF7A 1BE3G 2FTKA 3A0RA 2ZDIC 1X9VA 1XQ8A 4PI2A 4D7TA 5LP6A 2XOKG 3G80A 2DJVA 4YJ2B 4PDLA 4AHCA 3CJHB 3ZHTA 4PHZA 3ABKC 1HJ0A 4I55B 1U7MA 2NPSA 5AW9B 2RJZA 2K9JA 2RKLA 1YXBA 1SQVE 2WSSG 1XHZA 5E1AC 3QWOC 2IU3A 1NTZG 1IURA 2FXPA 2HODB 2KOGA 1USDA 3DXRB 3OT7A 3L4FA 4P9OA 2LR2A 5L3EA 4RO2A 3OTFA 1PGQA 1QR9A 1P84I 2A45I 5KX5B 4W4KA 1LTSC 2GV9A 2QTSA 4NPEA 2WITA 3CC2P 1PPJE 5EC1C 1K4CC 3PHLA 4GIFA 1L4AA 3SR2C 1S1CX 1FFXB 5J2UB 1F51A 1WPBA 4WFGA 5GW7A 1Q3EA 4QNHB 2GDSA 1GL2D 3D8CA 3RBZA 3C90A 2W6IG 2HHHO 2FYNC 3CMEV 5A9GA 4DV1O 1EN5A 4P30A 4QGPA 4DR1O 1S4XA 4DK0A 4UV8A 2CTRA 1HNXO 3M9BA 4L8JA 3OGCC 2WPRA 3CX5E 1QR8A 1KYOF 3H1HE 4CZZA 3E8FA 4EEQA 2CK3G 3OMNB 1OHHG 2VQFB 2FYNB 5BZBA 2JEXA 1FJKA 1JMMA 5KMGB 1XNQO 3AEBC 4YTPC 2H94A 1RQVA 4GKKB 1SFCA 2K9YA 1IBKO 3L72E 1RHZB 3VP9A 5KHGA 3HB3B 3BRCA 4U3FD 3H1JJ 2B87B 1R3IC 2OTLP 2ILMA 4XDKA 3T4ZA 3H32B 5AVUB 4KFMA 3CB2A 3L73G 1RP3B 2IX7C 3R4YA 2P5OA 2Y0CA 1N8RW 2W8ZA 2JIZG 1M57D 2GA1A 3E22B 1X8YA 4OVNF 2ZXWB 2R3CA 1XBLA 3UQ8A 2ZE5A 3ZRVA 4DJGA 1J95A 5CA3A 5LL6Y 2Z5IA 2WPVB 4JF7A 2RNBA 3LDEA 3KCXA 2GUVA 3G6EV 5B5EE 2Y9ZA 1BDDA 2Q5UA 4UUJC 4DCKA 2RQ6A 5KHKA 2Q4PA 2WA3A 3AG1C 3K5MA 2WLLB 1NTMJ 1QVFO 3KKYA 4K8XA 2DE0X 1NTKD 4LLHA 3SYQA 4M3LA 3BCCJ 1V54B 2N04A 1N36B 3HE5B 4YPCA 3H25A 1WA8A 2IJKA 1P84E 2YMKA 1IDSA 2P6JA 2WLNA 1JY2O 1RE3A 2V7QH 2R9AA 1L0LJ 3ZCCA 3GF7A 5CB4B 3JSVC 3S9OA 5KAIZ 5LMNB 2KZJA 3K58A 1SC5B 1FXKC 3AG1B 3CCMV 2BSKA 1AJNA 2LJ2A 2IJHA 2XUMA 3GHGC 4JI4B 2AW9A 2WT7A 5JJEB 2FYUE 1ZN5A 3WU2Z 3H1KG 3S1KA 1WP8A 1S5LX 3ZRSA 3AE1C 2B1GA 4PD4I 4WFBV 3NMDA 4IFMA 3E7KA 3ZRXA 1YEWA 3K0GA 3RVYA 2H8PC 2E5TA 2UXXA 2LXBA 1Y6XA 1Y76B 2EULA 5ITZB 3GHGB 3L71J 1SQVD 4LF4O 1NZ6A 1VQPV 1V55B 3RFRA 2KS1B 4OH8B 4B3TB 3SPCA 4LWSB 5GTIZ 1TA8A 4RUEA 1WN7A 3CCUP 2HJDA 2XNDG 3FX7A 5APXA 2GTSA 1RY3A 3RVZA 1PPJD 1URFA 2BOCC 2WWWA 2W0XA 2IM9A 1HNWO 1FZFA 3CP1A 1QLED 1PD3A 3P3NA 2V1DA 1Y8AA 1KBHA 4CC5A 1B6QA 5LHHA 5KUMA 4GDOA 1Q6IA 4LFAB 3KCYA 3TCUA 3OD4A 5EIBD 4KHPO 2D3OW 3CLQA 4D6TE 1BS3A 4GOEA 1GO3F 1YHQV 3CX5D 4UB6E 1AVOA 4BRYB 2Q7CA 3F5HA 3H1HD 1MZEA 4DR6B 4TQDA 2BCCH 4JI8B 5JH7B 2AHYA 1KZUB 1QNMA 3ZHQA 4WFFA 1ZTEA 3BA9A 2D2CC 4GX5A 3H1LE 3L72D 1AI4A 4RQEA 1R1BA 2N74A 3LDDA 2QE7G 4F6RB 3APQA 2B9ZA 4FPPA 1XMOB 1EZVH 1U97A 4H37A 3ZBHA 1GW3A 5CCHA 1SQBH 4GOFA 1OCOB 3EFGA 5BR8B 2D2CB 5KJ7D 3VMXA 1LTGC 1VQ9V 2HG5C 4X65O 1Q6UA 5KAIH 2M6YA 1Q81Q 1L0LK 3AK3A 1HF9A 1KU9A 3KYQA 1SQQH 3ZHUA 1S9KE 1R8EA 1GN3A 3QTCA 1AQTA 2EIKC 3D36C 1F7YA 4LFCO 1VQLV 1X22A 1R6TA 2Q5ZA 4XBFA 3CCLP 2C0XA 2QWNB 3P8MC 3WU2H 2GUZB 1VQ8V 1IK7A 1SF9A 2UUCB 1P84D 2GM4A 3JALB 5B1AB 4LF7B 4JI0B 2GTAA 1VQMV 2H89C 3G6BA 3BATA 2Z5HA 3CWBE 2EZPA 4HBNA 4MW3A 1M56C 4DV2O 5CA1B 2EIKB 1HGZA 3RL0D 5FLXN 4RQFA 2YXHA 2NN4A 3SYCA 4ZHQB 4H13C 1IX9A 1IBLB 1EDLA 1NTKG 2YUAA 1BE3J 3JATA 5C8YB 1QHTA 4FIPC 2F23A 4I0XA 4ICGA 1BQ0A 1FYJA 4JV5B 5GTIH 2FYUD 2RMKB 3QO5A 5GTHE 4UVAA 3EQ2A 4WY4A 3O65A 1TU3F 3I5DA 3F7YC 3L74J 1ZP0C 3CCQV 2R3SA 3I55P 1YJNP 1QX8A 1VF6C 3HUSC 1PGOA 4HKZH 3TGUE 2M5AB 4XDLA 3A0HZ 2OTJP 1AJQA 3ZMVA 4ZKIA 5E79Z 3OR6C 4EB6A 1J1EC 1DTOA 4IL6Z 4KL1A 4YJ3A 1YI2V 3KPEA 1LTJA 1AI5A 1M1KQ 5LYJB 1I7FA 4RESB 2C9LY 1AQ5A 1IJDB 3JCUZ 1NH2B 2IYPA 3HUSB 5LHGA 4C7RA 1FOSE 3D6ZA 1VF5C 4B3SO 2JS3A 1K9MQ 1LGHB 3AK1A 2L6LA 4X64B 3K57A 1SQVG 4R6ZA 1WRGA 5JCOA 3WMM0 2CH7B 3CXHI 1MZ9A 2MKVA 2CE4A 2LQTA 3K9SA 4DUYB 2QA4V 3O6QA 4JGSA 5HFLA 1VF5B 1LNQA 2G38A 2CUGA 1YDXA 1E1RG 4D6TD 3B5NA 1PPJG 2EJRA 3RYHA 3THOA 2P10A 2QM8A 4NXNB 3D6YA 2JR8A 2XV5A 3Q5SA 3JAWA 4EI2A 1KN7A 3OAAG 2FXOA 3ZRWB 3AE9C 3OMIB 4BIOA 2IBZH 4JZGA 3H1LD 3TNUB 4CS3A 1WT6A 1ZMEC 1H8EG 4LH7A 1BSHA 1CEZA 1EN4A 3H1HG 1LT9C 3BVOA 5C39A 2XAJA 3N2GB 2LP7A 2RDCA 5LA6B 2ITAA 3S3WA 2Y48A 2P2UA 3K59A 1KB9I 4X1IB 4YHHB 1B06A 3L72G 2OYIA 4ASVA 5J9PC 4PD4D 1M1JC 1U96A 1NU1H 1SA0B 3UO2A 3JARA 4WB4A 2HPCB 3TDKA 1LT9B 1BT8A 2L5GB 3AEGC 4DUZB 2N05A 1IZNB 1NKZB 5AW8B 1S9KD 4DV7B 5IJ0B 1TAEA 2R9RB 3MP7B 1GL2C 1SQXE 5KAFE 4R4MA 5B1BB 1S3JA 3E86A 2JWAA 1UIIA 2OIGA 3AG4C 1M1JB 1GTOA 1OZ0A 5CA0B 3RGUA 4LR3A 5LGUA 2ZNJA 4B3MB 5KJ7A 1YITV 4DV5O 1J2JB 3CWBD 5EBMC 3A0HH 3EXAA 2VQEO 2QJKC 1SLQA 5E79H 1NTZK 1BCCG 1G6UA 3H1KJ 1GL2B 2LW1A 3EVKA 5KA5A 4IL6H 3L9DA 2QR4A 4JYYA 2ZM6O 2R44A 1BGYE 3RYCA 2P1JA 1FBMA 2YKPA 1NAFA 3CXHE 5IYZA 2KSJA 1KQSO 3RYIB 3ABVC 1M90W 2MJZA 2ZR2A 1HR0B 3JCUH 4N6JA 1E79H 4U7OA 1VQ4V 1JMKC 1FJGO 3W7TA 2P4KA 1GKFA 2KXPB 2QVAA 3MD0A 3HE4A 3TGUD 1ZR4A 2PGGA 1IO4A 1D7MA 1JEKA 4GCZA 3CSXA 5IE9A 3OUSA 1YTFB 1K5QA 3DGEA 5IJ9B 3HKBA 1G1IA 2FYUG 2I1JA 2ZVOB 3W67A 4ASWA 2Y4TA 2PI5A 2XAHA 1PNMA 2HHHB 2XAFA 2EZOA 1AV1A 4DV1B 2KNCA 2P67A 1F4NA 4DR1B 5F2VO 1FAVA 1KB9E 1OMIA 3P30A 1HNXB 2YI8A 1MKMA 2JJ1G 2DWDC 2ZIOA 3VQXA 3ABTA 3B8MA 4E2LA 4NXMB 4JYAO 3GF3A 3L75H 5AG2A 1NI8A 1H2NA 3T97A 1M1KW 5IYBO 1NYHA 4IIJA 4AQYB 2H8PD 1R3KC 4C7UA 1XNQB 2ZKOA 3OM3B 1FZCC 4FLTA 4C46A 2PZSA 1HVVA 2YIDA 4O4LB 4KHXA 1EXJA 1AFOA 5K1PA 1NO4A 1QCEA 4YJ2A 1N33B 2O01H 4DR2O 2MK3A 4I55A 3JAKA 1PZQA 3R65A 2RN9A 1DGSA 3SJCC 3OAKA 1FZCB 1FC2C 4D6TG 3DXRA 2QRXA 2ZDIA 1NKNA 1YJ9P 1RF1C 2UUBO 1KKDA 2Q9LA 3IGAC 4IGGA 5KX5A 3PTZA 3CX5F 3B09A 2XNXA 3MHVA 4U3FJ 4AI8A 3B2EE 1AR4A 5J2UA 2K1AA 4PELA 2DW3A 2WLHA 3II6A 4I9QA 2WPSA 4C7NB 3WFVA 4CS4A 4P9PA 2QM7A 4WFEA 1N73B 4QPJA 4X1KB 3RN4A 2OT5A 2C0WA 1I94O 5FPRA 2PTMA 2D2CD 1BHAA 3SYPA 1SQXD 4YXDC 4DR4O 2KG7B 4PJ0E 4EIJA 3RT3C 1JOYA 5KMGA 2A7WA 2Z3YA 3BABA 1NTMH 3CD6V 3GMAA 4MTXA 4BW9A 3HKCB 5APWA 3Q5PA 3BCCH 4J42A 4JAAA 4U7NA 1URQC 1H0TB 3O9OA 2B87A 4J7JA 1VQOV 3QO8A 1L0LH 4U3JB 4DR5O 3KQGA 2HG5D 1EN6A 4IYHA 1BGYD 2QIWA 3BASA 4BIZA 1N73C 3ASNC 3CXHD 4L76A 2FFDB 3E22A 3V2RA 3HPLC 3LSSA 4JAUA 1FDOA 4L75A 3CWBG 2B5UA 4LF4B 1P84F 1TVKB 4G27B 2O3JA 1URQB 1WPXA 4HNAB 2OTKE 2WSCJ 2YIUB 1OW8A 1Z5VA 3ZMUA 2HLDG 3ML0A 3BHPA 3FB7C 1I0HA 3ASNB 3LUTB 3T1HB 3CCVP 3JASB 3TETA 1I5XA 2WLLA 1GTWA 1JJ2U 4GZRB 2Q1KA 4FM1A 1HNWB 1K33A 2PF4E 4LH6A 2WZ7A 3HE5A 1QQCA 1M56D 3L71H 2IZ1A 1SQVJ 3E8BA 2VS0A 1JR9A 4H13D 3TGUG 1MUUA 3LIEA 1QVGU 2E74C 3HTKA 3VMYA 1KB9D 5KAIE 1F4MA 4KHPB 2YIBD 1RM1C 1M7LA 2W6JG 1T8ZA 1GW4A 1NHLA 3CPWU 2OQQA 3K5NA 3USSA 4CH5A 4ASUG 1KYOH 1ZW0A 2WQYC 1NH2D 2WLMA 2E43A 3WB2A 1ORQC 2YO2A 3G4SP 1ZX3A 3FB5C 2E74B 3A2FA 2Q73A 3T4DA 4ZNCA 5KLIB 1AB3A 4O2BB 3PP5A 5CJ0A 1RM1B 2KZIA 2PYJA 2BTQB 3ZEDA 3I5CA 5AW6B 1Y74B 2G3AA 4EFBA 4B86A 1EDJA 3ASOC 1Y76A 5ITZA 1IBMO 3GHGA 3SJBC 5KUKA 3H1HJ 1AA0A 2M8RA 4WF9V 1VF5D 3CCEV 4RUFA 4JI1O 3RL0B 2A06E 3AE8C 2ZYAA 4NR1A 3W7XA 5LHIA 4DR3O 3FFQA 4K3AA 1T6AA 2WPQA 1XTGB 3D3QA 1VIBA 3CCRV 3E8HA 3SPHA 4LNUB 2IFMA 1NVPD 5DM6V 2KLUA 3C3TA 4J9ZB 3L70E 3M99B 5TISZ 4R7CA 4LFCB 4I4TA 3B40A 1GK9A 1NTKK 1LP1B 1DF5A 3M0DC 4B7EA 2Q7GA 5JQGB 1JY2N 1VDFA 1O9HA 5B1OA 1Y66A 3FB8C 4TQFA 5FPOA 1N7SA 3IF4A 4JASA 1EDKA 1Q82W 1LT1A 1K73W 5JH7A 2IJIA 4DV2B 4JI3O 1OJHA 2SPZA 5EBWC 3CC2V 4ZOLB 4P2ZA 4A7PA 5CCGC 3ABLC 1NJIW 4PD4F 4LF9O 5KHIA 2A79B 2E76C 2A9HA 3MUDC 2F95B 1N34B 4LC1A 1SQXG 3QH9A 1H8AA 4B7KA 1MA1A 3SJAC 2Z0AA 2K3RA 1KFMA 4X1YA 4W80A 3ABKB 3ABLB 4DW1A 5D5QA 1SQVK 5JVDA 2R9IA 1HDJA 2FYUJ 4D7SA 2ETNA 3FWNA 4MTGA 1H2SB 3HKEB 2K37A 4KT0J 2Y0DA 1TUBB 1BGYG 3L74H 3NXSA 4AQRD 3ICXA 5KKZC 4B3SB 2YXLA 4J7KA 3UKMA 1CZQA 3K5OA 2KSEA 2ZYGA 1DEBA 1GH6A 2IYOA 1NGMB 4R4LA 2OTLV 4NTYA 1XL6A 2GUZA 1FE6A 5L8RJ 2QJPC 4DRXB 1ZUQA 2A0LA 5EZYB 1IC2A 5APSA 2XU6A 3P8CE 3V5BA 3JALA 5LGTA 3FAVB 1K34A 4CH3A 5KLVH 4IHJB 1IFPA 2JEEA 1EDIA 3N7NA 1VQ7V 1NU1E 3E8GA 3U10A 5CA1A 5KKZB 1YTFD 4I7ZC 2XT9A 1Z56A 1G2CB 4ZHQA 2IFNA 3GG2A 1RF0A 1SS3A 2QJPB 2FYZA 4FLUA 1YTZT 3G9RA 4X62O 3BAAA 3OUFA 2JGUA 4O4JB 1KD1W 2AXTZ 3UT5B 4I7ZB 1HW7A 2M5AA 4FLYA 4FLXA 1OX3A 4D6TJ 3A0HE 3I56P 5K5GB 4MSWC 1UFIA 2A3QA 1DLBA 2DQ0A 5E79E 5CMUA 4JI5O 1HGVA 2W90A 2YS8A 1SERA 1BCCE 1PV0A 1VQ6P 2ZYDA 3GB7C 2ODMA 2A06D 2PI4A 4JYCA 1SRYA 3H1LJ 5H6RA 1KQGB 1ZRTE 2V7QG 4PDVA 4X20B 2N1TC 1I08A 5BMVB 4GX0A 4HJGH 1HJBA 4FFKA 4I9WA 2R5BA 3L70D 5H2FZ 2K1EA 2YIAA 2EILC 2H3OA 1OXZA 2CH7A 3RW0A 4K35A 3W7WA 2N1TB 3B77A 3PRJA 4NKGB 3PLNA 3HD7C 4DV5B 3WB1A 4JI2O 5AVRB 3J80N 5KHHA 3M9QA 4O2AB 3ZRWA 1ENVA 1FXKB 2EILB 3CCUV 2XDJA 3A3YB 5CMZA 3OEHG 4LF5B 2ZM6B 2L35A 1OVRA 3CE2A 2O01N 1JPXA 2JVDA 1G1JA 3L75E 2FYUK 2Q6AA 3HD7B 1PGJA 1JFFB 3CMAP 3OA7A 3CWBJ 4EKWA 1U7JA 4HYTB 5LA6A 1FJGB 1HNZO 1A02F 2F93B 2R5DA 3KHUA 3H1KH 1Y9BA 4X1IA 1W0JG 3A7OA 3DSQA 3ZHVA 2NRGA 2X7RB 3CYOA 1SA0A 1SZTA 2HR3A 1E1QG 2GSMB 2KB1A 2HPCA 1K7DA 1XMQO 4L74A 1LT9A 1X79B 2ZINA 2KI7B 4GLXA 3Q1MA 1XNRO 5GONB 3P32A 5LXTA 5IJ0A 2Q7EA 3OTOO 4L73A 1AP5A 2PFXA 4I2LC 3T2MA 3SGIA 1M1JA 1GU5A 1URQD 2H43A 5IT9N 2CPBA 3P8CD 4DT0A 1D5AA 3BRVB 2AXTH 1IXBA 1GM8A 1DX7A 1YVWA 4EYYQ 1G8MA 3CXCU 3KZIZ 4DK1A 3SFEC 3E1IA 1NU1D 1VQPP 5BU8B 1GL2A 1R3LC 1R6NA 5BY1A 2NPSC 2HEPA 4QE9A 2CGOA 4UFZA 3RYIA 1Q8IA 4NTWA 5LBQA 4DR2B 1NVOA 3H01A 1UIXA 4ZBMA 2WSFJ 3GWOA 2LKMA 4UCOA 1S2EA 3R66A 2FKWB 5B66Z 4Z1VA 3ZHRA 1CSBA 5H2FH 1KB9F 1OCCC 4LF8O 2RN0A 2QKAA 2UUBB 3BCCE 2K9JB 1L4AC 2PRRA 1GK6A 2CTQA 1RSOB 1RQUA 3W7UA 5IJ9A 4TOIA 4IFDK 3A0BZ 4WVZA 2E74D 1BCCD 3EHBB 2W83C 4LCUC 4TWKA 1ZV8A 1XREA 1OFCX 2JJLA 3AE6C 4Q20A 1ZRTD 4PA9A 1N32O 1M90Q 1PNKA 1OCCB 1HP8A 4R50A 4BAYA 5AW2B 3F5WC 5HFMA 2CTPA 1JY3O 3AK2A 5BU5A 2YICA 2UXCO 1SQPE 3AE5C 1I94B 3DTUB 1J5EO 4WCEV 1NR1A 3K0DA 5IYDO 2A06G 4JF3A 4U3FH 4DR4B 1I5YA 2M3BA 1H2MA 4U7JA 4L87A
chains in the Genus database with same CATH topology
1FDOA 2E75D 3EWKA 3D70A 4OGQC 4H44B 3GLMA 2BEZF 3D6ZA 1VF5C 2WSCJ 3AEGC 1GMJA 4GDOA 3RK3E 1OW8A 1AJYA 1OW6A 3AEBC 4PV1B 4YTPC 1RQVA 2K9YA 3AEEC 4H13B 4IL6X 4OGQB 1YQ3C 4XFJA 2WSEJ 2MKVA 4Y28J 4H0LC 1OMIA 3O6QA 1MKMA 4Z1MH 1VF5B 1Y9BA 4PV1D 3D71A 4KT0J 3AEAC 2D2CC 3GF3A 2NZ2A 1WMKA 2ZT9D 2P10A 3R4YA 4H13D 5KKZC 2E74C 1NYHA 3D6YA 1NGMB 4R4LA 3Q5SA 3AE9C 5L8RJ 2QJPC 3FGAD 3Q1MA 2H88C 2JO1A 2OQQA 4H0LB 1K04A 2QJYC 1KQFB 1EXJA 1VL2A 2WQYC 2WPVB 1KMIZ 1ZMEC 2D2CB 3LW5J 4H44D 2E76B 2E74B 1DD3A 3AE2C 4I7ZC 4TT3H 1KTMA 3B71A 5M1BA 1HF9A 2G3AA 3G9RA 3H25A 1YQ4C 2E75C 3SFEC 3SFDC 2YMKA 1R8EA 2E76D 4OGQD 1DIPA 3GF7A 3S9OA 3T97B 1PIXA 1VF5D 4I7ZB 3AEDC 1KORA 3AE8C 1IK7A 3RL0g 2QSIA 1UIXA 2WSFJ 2J5UA 2YIUC 4RKUJ 1JB0J 2H89C 2FBWC 4R4MA 1FDIA 1PV3A 3IAOA 1HJ0A 1S5LX 4H0LD 2ZT9C 2IDBA 4H13C 3AE1C 2O01J 1ZRTE 1KQGB 1RQUA 3IN6A 3Q3DA 2FXPA 2D2CD 1OW7A 3AE4C 3Q2YA 4YXDC 2QJKC 3C8VA 2E74D 2JP3A 1U57A 1KILE 2BEQD 3AEFC 1TU3F 3GMAA 3AE7C 3AE6C 3Q5RA 1ZP0C 1ZOYC 2V7QJ 4H44C 1S1CX 1Q90D 2G8YA 2ZT9B 3ABVC 3Q5PA 1PL5A 2E75B 3AE3C 1DD4A 2FYNC 3AE5C 2QIWA 4PV1C 3AECC 1K05A 1EXIA 2E76C 4U7JA 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJK C;  3C8V A;  4H44 B;  2WSC J;  5L8R J;  2QJP C;  4I7Z B;  4H0L B;  4PV1 B;  2QJY C;  2QSI A;  2WSF J;  2WPV B;  1Q90 D;  2K9Y A;  2ZT9 B;  2YIU C;  2D2C B;  4H13 B;  3LW5 J;  4RKU J;  1JB0 J;  4OGQ B;  4IL6 X;  2E76 B;  2E74 B;  2E75 B;  2WSE J;  4Y28 J;  2FYN C;  2QIW A;  1VF5 B;  1S5L X;  4KT0 J;  2O01 J;  1ZRT E;  5KKZ C;  5KLI C; 
#chains in the Genus database with same CATH topology
 2N9B A;  1L0N E;  3D70 A;  1HUC A;  3OE7 G;  4JTA B;  2CGN A;  1VQ9 P;  3QO7 A;  4O4L A;  2IJJ A;  1MNG A;  1PP9 H;  1IFM A;  3L70 G;  1M56 B;  1FD9 A;  1ZSP A;  4DR5 B;  3SWF A;  4G2K A;  1AP6 A;  1IFD A;  1NTZ J;  1A02 J;  4H13 B;  3CRC A;  1BZK A;  1SQX J;  1NKD A;  1RFY A;  2DOS A;  3CI9 A;  3S3X A;  5L3C A;  3PH0 A;  4Z1M H;  2WLK A;  3OR7 C;  4UCU A;  2ZNI A;  3L75 D;  2E42 A;  4ZI7 B;  1VQ8 P;  1S0V A;  1N7L A;  2P22 C;  2QWO B;  4X66 O;  4OX9 B;  4AUW A;  2ZQM A;  2HFE D;  2AHZ A;  1D5N A;  3JD4 A;  2E3C A;  1T5E A;  1XUQ A;  1BGY J;  1J1E B;  2KK7 A;  1P4R A;  4DV4 O;  2XAG A;  4FMT A;  3KZI H;  1RE3 C;  5AVQ B;  4O4I A;  2IU0 A;  1AI6 A;  1QLN A;  4MS2 A;  2GHY A;  1KIL C;  5B5E Z;  3K79 A;  5LMU O;  2WSC H;  2JDI H;  3BEH A;  5CCG D;  3RBX A;  2KG7 A;  1S72 P;  3CCQ P;  1OCR C;  1MV8 A;  4O4H A;  1BDC A;  2J59 M;  2E76 D;  4MVS A;  1S5H C;  1WA8 B;  2R72 A;  3H1I E;  2Q7H A;  5B66 H;  1KIL B;  2WLI B;  4TV9 B;  1UPG A;  3HKC A;  1KOR A;  3OGI B;  1NVP B;  1RE4 A;  1H0T A;  3BRT B;  3L73 J;  2AGA A;  1SQV H;  1FZA A;  1NAY A;  1THZ A;  4U3J A;  2OCC C;  1JB0 J;  4GKK O;  2FBW C;  3A0B H;  1OCR B;  2Q0A A;  2M3E A;  4TUY B;  1OVV A;  3U1C A;  4G28 B;  5FNV A;  2UU9 B;  1W2B U;  2WT7 B;  1NWQ A;  2FFD A;  1AVM A;  1GD2 E;  5AW1 B;  4NYK A;  1VQ5 P;  3VOP A;  4ZKU A;  2KIK A;  1IBM B;  1SES A;  1TVK A;  1URQ A;  3B8E B;  3UIA A;  4I50 A;  1NU1 G;  4ABM A;  4FFB B;  2HVK C;  5DJU B;  5AVX B;  1MSD A;  4DR3 B;  3JSN A;  3HKD B;  3BCC D;  2K88 A;  1JOC A;  2V7Q J;  4H44 C;  1RPR A;  1BL8 A;  2OGU A;  3CX5 H;  1GN4 A;  5LGN A;  1EZJ A;  2OIE A;  4TSF G;  1CP9 A;  4UCR A;  5JWP A;  2JKV A;  1SET A;  3IJ4 A;  1M8O B;  3JYC A;  3EWK A;  1SQP D;  4H44 B;  4RJT A;  3ZMT A;  1IFN A;  1N0J A;  5APT A;  1SQX K;  1AJY A;  2EX3 A;  3L74 E;  5TJH A;  2YEV B;  1JY2 P;  1IFI A;  4JI3 B;  3AG4 B;  2VRS A;  1L0N D;  1Q86 Q;  3AEE C;  1E79 G;  4O2B A;  1KQL A;  4IL6 X;  3CC4 P;  4LF9 B;  2BTQ A;  3W7S A;  4KXR A;  1LWU A;  1Y74 A;  1WNS A;  4DW0 A;  2QJK B;  4N78 E;  4GKJ O;  4PV1 D;  3T1C A;  5CCH C;  5KLV E;  3APO A;  3QNE A;  2IH3 C;  2JJ2 G;  1E5W A;  1ARO P;  2N1T D;  3OW2 U;  1OVU A;  5B5E H;  1AJP A;  1COW G;  3BFR A;  4LFB O;  2VWJ A;  3OMA B;  1JQ0 A;  2LGQ A;  1MOF A;  3WG7 C;  2Y0P A;  3MAQ A;  2Y69 C;  1P84 H;  2A45 H;  4MTO A;  4DV0 O;  2Q8V A;  3VN0 A;  4X88 A;  2HP8 A;  2Q6Q A;  3HD7 D;  1EM1 A;  4BW5 A;  3G67 A;  1ZLL A;  3L75 G;  5CJ4 A;  1R5S A;  1LTB C;  2IW5 A;  2QWQ B;  4MVQ A;  3RWR D;  1VP7 A;  2E75 C;  1JJO A;  2WPD G;  5JQG A;  2HJF C;  4JBZ A;  5AW3 B;  3WG7 B;  1DH3 A;  1FS0 E;  3BA8 A;  2EIM C;  2FYU H;  3SPJ A;  4MVZ A;  1WAZ A;  2Y0I A;  1JTH B;  1IBK B;  1YJ9 V;  1Z2G A;  4PDM A;  3JD0 A;  3M9H A;  3K9A A;  3H1I D;  3RK3 C;  4TV8 B;  4ZOL A;  3G71 P;  3CJH A;  2ADQ B;  3M0D A;  2E5L O;  2YDE A;  1FDI A;  4GOD A;  4WY4 C;  1BSM A;  1ZWI C;  2F43 G;  2IPP A;  1JCC A;  3SSU A;  5C93 A;  2K9P A;  3ETE A;  3QVN A;  1EZV I;  2HOD A;  4YXW G;  2F4V O;  1MSW D;  3CCS P;  3AE4 C;  3ZHS A;  2XHB A;  4NPD A;  1W59 A;  4I0X B;  3L35 A;  3WUU A;  2ZVN B;  3CC7 P;  1U57 A;  1CW5 A;  5GTH Z;  2OYQ A;  1KIL E;  1LTJ C;  2DWE C;  1Q82 Q;  4JQ0 D;  5H9C A;  3GWK C;  1FFX A;  3H1J H;  2ZJS E;  2JGD B;  4JI5 B;  4WY4 B;  1K73 Q;  5AVT B;  3ZJZ A;  1Q90 D;  4FZ0 A;  4TT3 G;  3HKE A;  3RYF B;  3WUV A;  1VAR A;  2DW4 A;  1NJI Q;  1AR5 A;  1SFC C;  1RF1 B;  4QMA A;  2AZ2 A;  3AEI A;  3CL3 D;  4W7Y A;  1WB8 A;  3LNM B;  4GUN A;  4DO2 A;  4OGQ C;  4D6T H;  1SKV A;  4UVB A;  1AIL A;  2I1K A;  4GKG A;  3K06 A;  1VQK P;  1GMJ A;  1NTM G;  3NTN A;  1Q7Y Q;  2X6A A;  3E2E A;  2NPS D;  1VQN V;  3CRM A;  4IHJ A;  4DYL A;  2ZAE B;  3B5N C;  3BCC G;  1NTK J;  2Y0E A;  2QEX P;  5DED A;  3H1L H;  1G2C A;  2W27 A;  2XKM A;  2ATK C;  2O1J A;  4OGQ B;  1B04 A;  5AVV B;  4XFJ A;  4JI2 B;  2OYH C;  2CTW A;  3L74 D;  1FXH A;  3H32 A;  3L70 J;  3CCV V;  4DV6 O;  3U59 A;  1H8H G;  3U11 A;  1WMK A;  1QBZ A;  1L4A D;  3CEI A;  2BCC E;  3U1A A;  3UT5 A;  3IAY A;  2AXT E;  5B3S C;  1SQP G;  2DYS C;  4N78 D;  3FGA D;  2OCH A;  2JO1 A;  4PD4 H;  2OYH B;  1O9G A;  5KLV D;  1FAF A;  2C2A A;  1T3J A;  1PL4 A;  2OYI C;  1LJ2 A;  1L0N G;  3LW5 J;  5EYP B;  3GW6 A;  4MN4 C;  5IWA O;  4UCS A;  1Q86 W;  2XZR A;  4LF6 O;  1KTM A;  1EZV E;  3L71 G;  3SPG A;  4RWU A;  4EDF A;  1LUW A;  4X20 A;  3R2P A;  1ZLZ A;  4ZIB A;  5L3B A;  1SQB E;  3CD6 P;  3G4S V;  5BMV A;  1XMQ B;  1JX9 A;  5CB4 A;  4J80 A;  3MHH C;  1SFC D;  4DOJ A;  1XNR B;  1KD1 Q;  2KB7 P;  2B88 A;  4JZ2 A;  2OYI B;  3OTO B;  3CHX A;  2P7T C;  1T3U A;  1T2K C;  1N86 A;  2WMM A;  3FXD A;  1SQQ E;  1SQG A;  4X64 O;  3Q4H B;  3IFM A;  1D2D A;  4RKU J;  5KAF Z;  2IZ0 A;  3PN1 A;  3WU2 E;  5GTH H;  3A5T A;  2EIJ C;  1R73 A;  4LGD E;  1SZX A;  2UXN A;  2BE3 A;  1FXK A;  3CS5 A;  3CRA A;  2IBZ I;  1YIJ P;  5CBO A;  2FY8 A;  3Q2Y A;  1BQZ A;  1OCZ C;  5AVW B;  1YJW P;  5IDJ A;  4YY3 O;  2W6J H;  1JFF A;  1Q5O A;  3U0Z A;  4UB8 Z;  1GM7 A;  3AEF C;  3SYA A;  4I5S A;  2KS1 A;  3T1Y O;  3K03 A;  4YIO A;  4LWS A;  1JCH A;  2ZD9 A;  1JMB A;  4PDR A;  4X65 B;  5GTI E;  1NU1 J;  3L72 J;  1TUE B;  3H1I G;  1FZG A;  2JS5 A;  1R6K A;  4LF8 B;  3IC7 A;  1KIL D;  2ADP A;  5DJT B;  3M7M X;  1PP9 E;  3ASO B;  3LID A;  5APY A;  3CCJ P;  3NFQ A;  4OPA A;  1OV9 A;  3RK2 C;  3AEC C;  2X6C A;  3MHS C;  1QEX A;  2WSF H;  2HFE C;  2L91 A;  2PGD A;  3RK3 E;  2PAJ A;  2FXM A;  2WA4 A;  4F6E A;  3HKB B;  1JCD A;  1KC8 W;  2J58 A;  3ZIA G;  4BRY A;  2Q69 A;  3UO3 A;  2UXC B;  5CN0 A;  1J5E B;  4AIL C;  3M91 A;  3K04 A;  1BCC J;  1G1X B;  3ZS8 C;  2JRI A;  3CCE P;  4J7Z A;  2UUA O;  4EFE A;  2I8D A;  1HTL C;  2P58 A;  4PA7 A;  3WUT A;  4F6R A;  1HWT C;  3LDC A;  4IOI H;  2EBO A;  3J7A U;  4IIJ B;  4B08 A;  4WBN B;  3K5B A;  3V2P A;  1Q2N A;  1JO5 A;  4HH2 A;  1Q7Y W;  1KQF B;  2BCC D;  1FJP A;  4H44 D;  5B66 E;  5L3F A;  1BE3 H;  2E76 B;  5FL7 G;  2KSD A;  3JAK B;  1HR0 O;  2IBZ E;  3JD3 A;  1RSO A;  3L74 G;  4X66 B;  2ZXX A;  1S5L Z;  2CAZ C;  3UM7 A;  3A0B E;  2WSS H;  3JSL A;  3SFD C;  2V4H A;  5JJJ B;  1ZL8 B;  1NTZ H;  2ZE6 A;  1EZV D;  1SQX H;  1AVY A;  5KAF H;  2F66 C;  1VF7 A;  2Y4U A;  4DV4 B;  1NS1 A;  1XOU A;  1SQB D;  2CPS A;  3L75 J;  4HAM A;  3E1R A;  5KLV G;  3B8N A;  2OWO A;  5LMU B;  3FYI B;  3F5T A;  4B3R O;  1KP2 A;  4NTX A;  4UCV A;  1IK9 A;  3D36 A;  1MFT A;  4QJF B;  3I56 V;  2WAM A;  1L8D A;  2RH0 A;  1SQQ D;  2Q3I A;  4UB8 H;  2QDO A;  5C8Y A;  1BGY H;  2O01 J;  2R32 A;  4I6M C;  4NXM O;  1X4T A;  3FWL A;  5CCH D;  3CXH H;  2AEF A;  1WJZ A;  2Q0O C;  1VQ6 V;  1W5C E;  4EOT A;  5H6Q A;  2QGN A;  1NT2 B;  4PJ0 Z;  2PYL A;  1FOS F;  1NU1 K;  2BEQ D;  4AQY O;  2CK3 H;  1KKC A;  3Q5R A;  5EK0 A;  4JI6 O;  2POH A;  4K0K O;  3CME P;  5CBH A;  5AVZ B;  2B89 A;  5TIS H;  2ZXW C;  3ZDM A;  4OXS A;  3ETG A;  2YIB A;  2BAS A;  3TF5 A;  2R70 A;  1FS0 G;  1N33 O;  2QM4 A;  1DD4 A;  3AE3 C;  4IL6 E;  4ZI7 A;  1Y47 A;  4Y99 C;  5LYJ A;  4PV1 C;  5K1X A;  2ARH A;  4JI7 O;  1WP7 A;  1VF6 A;  3HUS A;  1GN2 A;  1MZF A;  3ABU A;  2QKC A;  3L73 H;  3JCU E;  4ZMD A;  2E75 D;  2FML A;  2WVR A;  2BEZ F;  1PP9 D;  4NB5 A;  1VQ7 P;  1KB9 H;  5AVS B;  1V54 C;  2FL4 A;  1US6 A;  3AG3 C;  5D5P A;  3BY6 A;  3FYE B;  1OW6 A;  2ZXE B;  4Y99 B;  4PV1 B;  1L1F A;  1R5L A;  5J2T B;  1YQ3 C;  4R8C A;  4W7Z A;  4XE5 B;  3RK3 D;  2WSE J;  3DC6 A;  2RMZ A;  3CMA V;  1JY3 N;  3D71 A;  4WY4 D;  3AEA C;  1BSN A;  3AG3 B;  4JTD B;  2VQE B;  1H89 A;  5L3G A;  3HRN A;  4DR7 O;  4H33 A;  1Z5W A;  1QVG O;  1KIL A;  2WLI A;  4TV9 A;  3HTK B;  4FJC C;  3MDS A;  1GZL A;  2YSU B;  3VMZ A;  3VOU A;  1RPO A;  3JC2 2;  3G6E P;  1YSC A;  3TNU A;  3CPW O;  3TYY A;  1KEC A;  4DV3 O;  4TUY A;  1S5L H;  1PM9 A;  5B1N A;  3FD9 A;  2XTA A;  4GKJ B;  3N2G A;  1SQP J;  3AE2 C;  1OIP A;  1V55 C;  1H2L A;  2ZFC A;  3B71 A;  3C1L A;  2IH1 C;  5AW5 B;  1EQ7 A;  1NQT A;  1PGP A;  4K8Z A;  5CBG A;  4FFB A;  2Z5U A;  3CCM P;  1L0N J;  4OGQ D;  3WB0 A;  4LFB B;  3HKD A;  5LOV B;  2IBZ D;  3V2N A;  3E89 A;  3SJQ C;  1P7B A;  5DEC A;  4PI0 A;  3AED C;  1Y67 A;  4DV0 B;  3B5N D;  2KKW A;  3TGU J;  3ETD A;  2YKO A;  2J5U A;  3C9I A;  4MVU A;  2BCC G;  2HKO A;  3CRR A;  3K08 A;  3CXH F;  3T1H O;  1GMG A;  1PV3 A;  5CA0 A;  3VYI A;  4PJ0 H;  1GK4 A;  4JYA B;  5KTB A;  3H1J E;  1M9N A;  1N7S C;  2XND H;  3ZMS A;  2ZT9 C;  1CI6 B;  3N2K B;  2LFR A;  5KHJ A;  4Q6G A;  2ZE7 A;  4JAV A;  4KUM A;  4I4T B;  2EJ7 A;  4UCT A;  3K3W A;  4DZO A;  1HWY A;  1KYO I;  5LP6 C;  4MVR A;  2YEV A;  3TXS A;  3ETQ A;  1EZV G;  3PJS K;  2AXC A;  1LTT C;  2QTO A;  3E35 A;  3AE7 C;  2UXD O;  3V4Q A;  4MW8 A;  1SQB G;  2OAR A;  1B3Q A;  1KQS U;  1N7S B;  2E5L B;  4BWA A;  2ZT9 B;  3LSU A;  4N23 A;  3CCL V;  1NH4 A;  1GM9 A;  4MTF A;  2NNU A;  1NTM E;  2ITD C;  1OCO C;  5LP6 B;  2F4V B;  3JAM N;  3KXD A;  3E83 A;  2NPS B;  1SQQ G;  1EXI A;  2PUS A;  4CH4 A;  2FB5 A;  4JPR A;  3H1I J;  2H7H A;  1YHQ P;  4FK5 C;  1L0L E;  3J81 N;  1K92 A;  1K8A Q;  1MG1 A;  3JD2 A;  1IZ3 A;  2YXQ B;  3SDL A;  1TGO A;  2QE7 H;  1KV4 A;  2QKS A;  3D3I A;  3JD1 A;  4O9B A;  1FKA O;  1UJW B;  1NTM K;  1T2K D;  1FFT B;  2UXB O;  4X1Y B;  5CBN A;  4OPH A;  1JA8 A;  1PKX A;  4XA4 A;  1GU4 A;  1M93 A;  1ZXG A;  2Q3E A;  1L4A B;  4PD4 E;  4CC6 A;  2QWP B;  5JVD B;  3STZ C;  1AI7 A;  3ZN1 A;  1V9P A;  3I55 V;  1YJN V;  2PP6 A;  4H0L C;  4U3F G;  5B1A C;  2NR5 A;  2OTJ V;  5AVY B;  1VEW A;  5AW4 B;  4FLW A;  5EC2 C;  1USE A;  3V2Q A;  3VTP C;  4I1L A;  4CS2 A;  1XDC A;  1RF0 C;  3GVM A;  4X8A A;  1JTH A;  1PP9 G;  2H88 C;  1EBO A;  3L71 E;  1M5I A;  1N2D C;  1SQP K;  4H0L B;  4TV8 A;  2YKQ A;  2E5Y A;  1VL2 A;  3UCS C;  2HVJ C;  2O57 A;  2VRZ A;  4OWF A;  4DV6 B;  4Z1M G;  2M7W A;  1SFC B;  1L0N K;  1FZC A;  3M06 A;  1VQL P;  4WWI A;  4J11 A;  1JVM A;  3RK2 D;  2A06 H;  1KYO E;  3KG2 A;  2Z4E A;  1JM0 A;  1NTK H;  1XL4 A;  3VBB A;  2Y9Y A;  1DIP A;  1PIX A;  4F4L A;  3TK1 A;  1YZB A;  1N34 O;  4FVM A;  1VQM P;  2JGD A;  1S72 V;  4ZKP A;  3IR9 A;  3L70 H;  3RL0 g;  2QSI A;  5IWA B;  4UV9 A;  4C7N A;  3RYF A;  4LF6 B;  5EFW B;  1N73 A;  1RF1 A;  3KDP B;  4X1K A;  2JDI G;  3IAO A;  2B1I A;  5KLV J;  5H5N A;  4CBC A;  3RGB A;  3TSI A;  1QL1 A;  3Q3D A;  4GT1 A;  2EIN C;  2NLJ C;  3L37 A;  2X0L A;  1SQF A;  3LW5 H;  2GUS A;  1VQ5 V;  4PA6 A;  3H1J D;  2YXY A;  2IBZ G;  4HYO A;  1OZH A;  3NR7 A;  1YI2 P;  3VQV A;  2KLV A;  2G8Y A;  2VQF O;  1FPO A;  4AYC A;  1QL2 A;  1W0K G;  2BSK B;  2EIN B;  4MVO A;  3AG2 C;  3JCZ A;  2Q67 A;  4WFH A;  3A2A A;  1PPJ H;  4JTC B;  4YY3 B;  3MTU E;  4DXW A;  2P06 A;  4HNA A;  2OYH A;  1LUV A;  3TXQ A;  4JI1 B;  1NTM D;  3T1Y B;  3VP8 A;  2OCC B;  5IYC O;  3BVH A;  3AG2 B;  3K5L A;  1ZR2 A;  2QA4 P;  3JAS A;  5EYP A;  3N27 A;  1L0L D;  2N9Y B;  5CHX A;  1PL0 A;  1M4U A;  3CRQ A;  1YYC A;  3H1H H;  3F7V C;  1EFR G;  2QSA A;  2KUB A;  1FZB A;  2YMY A;  1K4D C;  3CC4 V;  1WLE A;  4MT8 A;  5B1B C;  2P90 A;  1BE3 E;  4RO0 A;  1NBM G;  1VMG A;  1N36 O;  3L72 H;  3H9V A;  1MFZ A;  1PFI A;  4X89 A;  1K8A W;  3Q4H A;  4NVP A;  5LXT B;  2HYN A;  5LMN O;  3FX0 A;  1NTZ E;  1N4C A;  4UB6 Z;  1EC5 A;  1Q43 A;  2DMX A;  1ZAU A;  2WLJ A;  1Q6H A;  3IFX A;  2W0F C;  2UUA B;  1K5S A;  3L71 D;  4JI4 O;  2LXC B;  5M1B A;  1GAX A;  1AR1 B;  1Q81 W;  4J10 A;  4FZ1 A;  3MZW B;  5DN6 G;  5APQ A;  2LO1 A;  4GX2 A;  2P4V A;  1SVF A;  4NPF X;  4IFF A;  4UB8 E;  1BCC H;  4LF5 O;  1OWA A;  2ZCE A;  4FLV A;  1KYO D;  2XAQ A;  3HR0 A;  4J41 A;  3SYO A;  2A45 G;  5KLV K;  4LNU A;  1YIT P;  2F1M A;  1HBW A;  4B3T O;  3F89 A;  4PA3 A;  3IC9 A;  2XAS A;  1W2E A;  4N3Y B;  2IDB A;  5TIS E;  3G71 V;  3P7K A;  1M57 C;  1LP1 A;  2BCC J;  1SS1 A;  2JP3 A;  1LTI C;  2Y69 B;  1FZE A;  1XIL A;  1BHB A;  4B3R B;  3CCS V;  1VQ4 P;  1CPY A;  3L73 E;  1GDT A;  4LFA O;  4W4L A;  4FM2 A;  3CC7 V;  2QJ1 A;  1MAB G;  4MVM A;  1S76 D;  1KFN A;  2V4D A;  3OJA B;  1M57 B;  3X2Q C;  2E75 B;  4N21 A;  4DR6 O;  3W68 A;  1NOH A;  4JI8 O;  2YNY A;  1IXM A;  1SQB J;  3O8Z A;  4X62 B;  2EIM B;  3SPI A;  2M0B A;  4JPZ B;  2ZE8 A;  4WBN A;  2OYO A;  3GLM A;  3JAT B;  1LR1 A;  1LTA C;  4JI6 B;  1KC8 Q;  3RK3 B;  4K0K B;  5CBF A;  2W6A A;  3B4S A;  1JUN A;  3X2Q B;  3H1J G;  5CCG A;  1K9M W;  1SQQ J;  3ZX6 A;  1YF2 A;  2DN9 A;  1XMO O;  1QGK B;  2LW7 A;  1VQK V;  3MUD A;  5APV A;  5BR8 O;  4JI7 B;  1S5J A;  1N0N A;  1TUB A;  2QEX V;  4EB6 B;  4YJ3 B;  1S5L E;  2CDY A;  1ZL8 A;  2DQ3 A;  1N7S D;  2KP8 A;  4TLF A;  1LTJ B;  2ZT9 D;  1XTC C;  4YXW H;  4UB6 H;  2W6B A;  3FB6 C;  4DRX A;  1X59 A;  4LBE C;  5EZY A;  1A32 A;  5JCO C;  2KQX A;  3H1K E;  1FDM A;  1WB7 A;  5IY5 C;  2Q9I A;  1SP4 A;  2FKX A;  3FAV A;  2UWJ E;  1K04 A;  4JYB A;  3H1L G;  1BE3 D;  2QJY C;  1MMM A;  3A8T A;  4X9Q A;  2VWK A;  1KUQ A;  2UUC O;  1L0L G;  4O4I B;  4TT3 H;  1DD3 A;  4GYC B;  1PP9 J;  4LF7 O;  3MGN A;  4JI0 O;  4DR7 B;  1RE4 C;  1QLE C;  1NTZ D;  3O6Q B;  5IY5 B;  2P7J A;  5APU A;  1JY3 P;  1YQ4 C;  4O4J A;  3H6P A;  3B5N B;  3SWK A;  1FXV A;  2QJY B;  1IBL O;  1L2P A;  4O4H B;  3RYH B;  1VPC A;  4QIW F;  3DC5 A;  3ZN0 A;  2FFD C;  5EIB C;  2WSE H;  3BPZ A;  3JAW B;  3M8A A;  4DV3 B;  4JV5 O;  3EFF K;  1QU7 A;  2JK5 C;  4UVC A;  4FLZ A;  1XHX A;  5BXZ A;  2ZR3 A;  4YIP A;  1QLE B;  2YIU C;  1FU1 A;  3VQY A;  1HNZ B;  3ZMZ A;  3STL C;  4FM0 A;  2GBO A;  3AG7 A;  1DEE G;  2YO3 A;  4KJM A;  5EBL C;  2JEU A;  4UXN A;  1XI1 A;  1QVF U;  1H2K A;  4HZ3 A;  3FXE A;  1W2B O;  1NR7 A;  4H0L D;  5FNV B;  5L3D A;  4XDJ A;  2YXR B;  5B3S B;  4WBA A;  2DYS B;  1YBK A;  1VQN P;  3IN6 A;  1H2G A;  1OW7 A;  4BWN A;  3ABM C;  1K97 A;  3C8V A;  4CH6 A;  3VMA A;  2AEJ A;  2X6B A;  1GN6 A;  3CWB H;  4GX1 A;  4I50 B;  2Q68 A;  4IYI A;  4HB1 A;  1SQP H;  4OX9 O;  5H2F E;  3V4W A;  1VQO P;  4BR6 A;  3M0A A;  1YIJ V;  1BMF G;  1PNL A;  5J2T A;  3VQW A;  3JAR B;  2BOB C;  4QPK A;  1ZOY C;  1YJW V;  5KJ7 C;  1CXZ B;  2N1T A;  1S77 D;  1SQB K;  1L0N H;  1PL5 A;  1DF4 A;  3ABM B;  1JNM A;  3S4R A;  1Y4M A;  1ROP A;  2DYR C;  1X0T A;  2MW2 B;  3L73 D;  1H38 A;  2KYV A;  1N8R Q;  1K05 A;  4O2A A;  4DUY O;  2ITC C;  1R3J C;  4CPG A;  2C9N Y;  1HH0 A;  5KLI C;  4IT5 A;  3CCJ V;  3TGU H;  1SQQ K;  1YTZ I;  4LP8 A;  2UXD B;  1LWU C;  4NXN O;  3LSQ A;  3HD7 A;  1KP3 A;  1IVS A;  4U3F E;  5AW0 B;  1G4Y B;  2DYR B;  2EIJ B;  1J1D C;  2RCV A;  3RYC B;  4BXL A;  2BTO A;  5IYZ B;  3RL0 C;  4WFA V;  4Y28 J;  2QG4 A;  3OFN G;  2PY5 A;  3TJT A;  1OCZ B;  3FKS G;  3P3P A;  1IFJ A;  1LWU B;  2UU9 O;  1RH5 B;  2NZ2 A;  2LFS A;  5LOV A;  2ZIM A;  1H88 A;  1K3E A;  1P7G A;  3HE4 B;  2QWR B;  3V6I A;  1J1D B;  1GRJ A;  5GON A;  3OW2 O;  4Z2W A;  4YHH O;  3CX5 I;  5KA6 A;  1N32 B;  2UXB B;  3G3Z A;  3MIW A;  4QE7 A;  1NTK E;  4J9Y B;  5AW7 B;  4PA4 A;  2WTY A;  4KP4 A;  3RK2 B;  5BVZ A;  1KMI Z;  5A2Q N;  2AZ0 A;  2LGW A;  2JWD A;  4DUZ O;  2O1K A;  2YC0 A;  4DV7 O;  3H1K D;  3L36 A;  3H1I H;  1P49 A;  1CI6 A;  3N2K A;  2HLO A;  2KNC B;  4RAI A;  1F23 A;  4BIU A;  1XEQ A;  2B9B A;  3KZI E;  1DK1 A;  4B3M O;  3N4X A;  3T97 B;  2AEM A;  3QG5 A;  3LNN A;  4A5U B;  3CCR P;  5JJN B;  3ITK A;  3OEE G;  3SWY A;  3C3S A;  4E4E A;  1YCI A;  2YI9 A;  3QF7 A;  1BE3 G;  2FTK A;  3A0R A;  2ZDI C;  1X9V A;  1XQ8 A;  4PI2 A;  4D7T A;  5LP6 A;  2XOK G;  3G80 A;  2DJV A;  4YJ2 B;  4PDL A;  4AHC A;  3CJH B;  3ZHT A;  4PHZ A;  3ABK C;  1HJ0 A;  4I55 B;  1U7M A;  2NPS A;  5AW9 B;  2RJZ A;  2K9J A;  2RKL A;  1YXB A;  1SQV E;  2WSS G;  1XHZ A;  5E1A C;  3QWO C;  2IU3 A;  1NTZ G;  1IUR A;  2FXP A;  2HOD B;  2KOG A;  1USD A;  3DXR B;  3OT7 A;  3L4F A;  4P9O A;  2LR2 A;  5L3E A;  4RO2 A;  3OTF A;  1PGQ A;  1QR9 A;  1P84 I;  2A45 I;  5KX5 B;  4W4K A;  1LTS C;  2GV9 A;  2QTS A;  4NPE A;  2WIT A;  3CC2 P;  1PPJ E;  5EC1 C;  1K4C C;  3PHL A;  4GIF A;  1L4A A;  3SR2 C;  1S1C X;  1FFX B;  5J2U B;  1F51 A;  1WPB A;  4WFG A;  5GW7 A;  1Q3E A;  4QNH B;  2GDS A;  1GL2 D;  3D8C A;  3RBZ A;  3C90 A;  2W6I G;  2HHH O;  2FYN C;  3CME V;  5A9G A;  4DV1 O;  1EN5 A;  4P30 A;  4QGP A;  4DR1 O;  1S4X A;  4DK0 A;  4UV8 A;  2CTR A;  1HNX O;  3M9B A;  4L8J A;  3OGC C;  2WPR A;  3CX5 E;  1QR8 A;  1KYO F;  3H1H E;  4CZZ A;  3E8F A;  4EEQ A;  2CK3 G;  3OMN B;  1OHH G;  2VQF B;  2FYN B;  5BZB A;  2JEX A;  1FJK A;  1JMM A;  5KMG B;  1XNQ O;  3AEB C;  4YTP C;  2H94 A;  1RQV A;  4GKK B;  1SFC A;  2K9Y A;  1IBK O;  3L72 E;  1RHZ B;  3VP9 A;  5KHG A;  3HB3 B;  3BRC A;  4U3F D;  3H1J J;  2B87 B;  1R3I C;  2OTL P;  2ILM A;  4XDK A;  3T4Z A;  3H32 B;  5AVU B;  4KFM A;  3CB2 A;  3L73 G;  1RP3 B;  2IX7 C;  3R4Y A;  2P5O A;  2Y0C A;  1N8R W;  2W8Z A;  2JIZ G;  1M57 D;  2GA1 A;  3E22 B;  1X8Y A;  4OVN F;  2ZXW B;  2R3C A;  1XBL A;  3UQ8 A;  2ZE5 A;  3ZRV A;  4DJG A;  1J95 A;  5CA3 A;  5LL6 Y;  2Z5I A;  2WPV B;  4JF7 A;  2RNB A;  3LDE A;  3KCX A;  2GUV A;  3G6E V;  5B5E E;  2Y9Z A;  1BDD A;  2Q5U A;  4UUJ C;  4DCK A;  2RQ6 A;  5KHK A;  2Q4P A;  2WA3 A;  3AG1 C;  3K5M A;  2WLL B;  1NTM J;  1QVF O;  3KKY A;  4K8X A;  2DE0 X;  1NTK D;  4LLH A;  3SYQ A;  4M3L A;  3BCC J;  1V54 B;  2N04 A;  1N36 B;  3HE5 B;  4YPC A;  3H25 A;  1WA8 A;  2IJK A;  1P84 E;  2YMK A;  1IDS A;  2P6J A;  2WLN A;  1JY2 O;  1RE3 A;  2V7Q H;  2R9A A;  1L0L J;  3ZCC A;  3GF7 A;  5CB4 B;  3JSV C;  3S9O A;  5KAI Z;  5LMN B;  2KZJ A;  3K58 A;  1SC5 B;  1FXK C;  3AG1 B;  3CCM V;  2BSK A;  1AJN A;  2LJ2 A;  2IJH A;  2XUM A;  3GHG C;  4JI4 B;  2AW9 A;  2WT7 A;  5JJE B;  2FYU E;  1ZN5 A;  3WU2 Z;  3H1K G;  3S1K A;  1WP8 A;  1S5L X;  3ZRS A;  3AE1 C;  2B1G A;  4PD4 I;  4WFB V;  3NMD A;  4IFM A;  3E7K A;  3ZRX A;  1YEW A;  3K0G A;  3RVY A;  2H8P C;  2E5T A;  2UXX A;  2LXB A;  1Y6X A;  1Y76 B;  2EUL A;  5ITZ B;  3GHG B;  3L71 J;  1SQV D;  4LF4 O;  1NZ6 A;  1VQP V;  1V55 B;  3RFR A;  2KS1 B;  4OH8 B;  4B3T B;  3SPC A;  4LWS B;  5GTI Z;  1TA8 A;  4RUE A;  1WN7 A;  3CCU P;  2HJD A;  2XND G;  3FX7 A;  5APX A;  2GTS A;  1RY3 A;  3RVZ A;  1PPJ D;  1URF A;  2BOC C;  2WWW A;  2W0X A;  2IM9 A;  1HNW O;  1FZF A;  3CP1 A;  1QLE D;  1PD3 A;  3P3N A;  2V1D A;  1Y8A A;  1KBH A;  4CC5 A;  1B6Q A;  5LHH A;  5KUM A;  4GDO A;  1Q6I A;  4LFA B;  3KCY A;  3TCU A;  3OD4 A;  5EIB D;  4KHP O;  2D3O W;  3CLQ A;  4D6T E;  1BS3 A;  4GOE A;  1GO3 F;  1YHQ V;  3CX5 D;  4UB6 E;  1AVO A;  4BRY B;  2Q7C A;  3F5H A;  3H1H D;  1MZE A;  4DR6 B;  4TQD A;  2BCC H;  4JI8 B;  5JH7 B;  2AHY A;  1KZU B;  1QNM A;  3ZHQ A;  4WFF A;  1ZTE A;  3BA9 A;  2D2C C;  4GX5 A;  3H1L E;  3L72 D;  1AI4 A;  4RQE A;  1R1B A;  2N74 A;  3LDD A;  2QE7 G;  4F6R B;  3APQ A;  2B9Z A;  4FPP A;  1XMO B;  1EZV H;  1U97 A;  4H37 A;  3ZBH A;  1GW3 A;  5CCH A;  1SQB H;  4GOF A;  1OCO B;  3EFG A;  5BR8 B;  2D2C B;  5KJ7 D;  3VMX A;  1LTG C;  1VQ9 V;  2HG5 C;  4X65 O;  1Q6U A;  5KAI H;  2M6Y A;  1Q81 Q;  1L0L K;  3AK3 A;  1HF9 A;  1KU9 A;  3KYQ A;  1SQQ H;  3ZHU A;  1S9K E;  1R8E A;  1GN3 A;  3QTC A;  1AQT A;  2EIK C;  3D36 C;  1F7Y A;  4LFC O;  1VQL V;  1X22 A;  1R6T A;  2Q5Z A;  4XBF A;  3CCL P;  2C0X A;  2QWN B;  3P8M C;  3WU2 H;  2GUZ B;  1VQ8 V;  1IK7 A;  1SF9 A;  2UUC B;  1P84 D;  2GM4 A;  3JAL B;  5B1A B;  4LF7 B;  4JI0 B;  2GTA A;  1VQM V;  2H89 C;  3G6B A;  3BAT A;  2Z5H A;  3CWB E;  2EZP A;  4HBN A;  4MW3 A;  1M56 C;  4DV2 O;  5CA1 B;  2EIK B;  1HGZ A;  3RL0 D;  5FLX N;  4RQF A;  2YXH A;  2NN4 A;  3SYC A;  4ZHQ B;  4H13 C;  1IX9 A;  1IBL B;  1EDL A;  1NTK G;  2YUA A;  1BE3 J;  3JAT A;  5C8Y B;  1QHT A;  4FIP C;  2F23 A;  4I0X A;  4ICG A;  1BQ0 A;  1FYJ A;  4JV5 B;  5GTI H;  2FYU D;  2RMK B;  3QO5 A;  5GTH E;  4UVA A;  3EQ2 A;  4WY4 A;  3O65 A;  1TU3 F;  3I5D A;  3F7Y C;  3L74 J;  1ZP0 C;  3CCQ V;  2R3S A;  3I55 P;  1YJN P;  1QX8 A;  1VF6 C;  3HUS C;  1PGO A;  4HKZ H;  3TGU E;  2M5A B;  4XDL A;  3A0H Z;  2OTJ P;  1AJQ A;  3ZMV A;  4ZKI A;  5E79 Z;  3OR6 C;  4EB6 A;  1J1E C;  1DTO A;  4IL6 Z;  4KL1 A;  4YJ3 A;  1YI2 V;  3KPE A;  1LTJ A;  1AI5 A;  1M1K Q;  5LYJ B;  1I7F A;  4RES B;  2C9L Y;  1AQ5 A;  1IJD B;  3JCU Z;  1NH2 B;  2IYP A;  3HUS B;  5LHG A;  4C7R A;  1FOS E;  3D6Z A;  1VF5 C;  4B3S O;  2JS3 A;  1K9M Q;  1LGH B;  3AK1 A;  2L6L A;  4X64 B;  3K57 A;  1SQV G;  4R6Z A;  1WRG A;  5JCO A;  3WMM 0;  2CH7 B;  3CXH I;  1MZ9 A;  2MKV A;  2CE4 A;  2LQT A;  3K9S A;  4DUY B;  2QA4 V;  3O6Q A;  4JGS A;  5HFL A;  1VF5 B;  1LNQ A;  2G38 A;  2CUG A;  1YDX A;  1E1R G;  4D6T D;  3B5N A;  1PPJ G;  2EJR A;  3RYH A;  3THO A;  2P10 A;  2QM8 A;  4NXN B;  3D6Y A;  2JR8 A;  2XV5 A;  3Q5S A;  3JAW A;  4EI2 A;  1KN7 A;  3OAA G;  2FXO A;  3ZRW B;  3AE9 C;  3OMI B;  4BIO A;  2IBZ H;  4JZG A;  3H1L D;  3TNU B;  4CS3 A;  1WT6 A;  1ZME C;  1H8E G;  4LH7 A;  1BSH A;  1CEZ A;  1EN4 A;  3H1H G;  1LT9 C;  3BVO A;  5C39 A;  2XAJ A;  3N2G B;  2LP7 A;  2RDC A;  5LA6 B;  2ITA A;  3S3W A;  2Y48 A;  2P2U A;  3K59 A;  1KB9 I;  4X1I B;  4YHH B;  1B06 A;  3L72 G;  2OYI A;  4ASV A;  5J9P C;  4PD4 D;  1M1J C;  1U96 A;  1NU1 H;  1SA0 B;  3UO2 A;  3JAR A;  4WB4 A;  2HPC B;  3TDK A;  1LT9 B;  1BT8 A;  2L5G B;  3AEG C;  4DUZ B;  2N05 A;  1IZN B;  1NKZ B;  5AW8 B;  1S9K D;  4DV7 B;  5IJ0 B;  1TAE A;  2R9R B;  3MP7 B;  1GL2 C;  1SQX E;  5KAF E;  4R4M A;  5B1B B;  1S3J A;  3E86 A;  2JWA A;  1UII A;  2OIG A;  3AG4 C;  1M1J B;  1GTO A;  1OZ0 A;  5CA0 B;  3RGU A;  4LR3 A;  5LGU A;  2ZNJ A;  4B3M B;  5KJ7 A;  1YIT V;  4DV5 O;  1J2J B;  3CWB D;  5EBM C;  3A0H H;  3EXA A;  2VQE O;  2QJK C;  1SLQ A;  5E79 H;  1NTZ K;  1BCC G;  1G6U A;  3H1K J;  1GL2 B;  2LW1 A;  3EVK A;  5KA5 A;  4IL6 H;  3L9D A;  2QR4 A;  4JYY A;  2ZM6 O;  2R44 A;  1BGY E;  3RYC A;  2P1J A;  1FBM A;  2YKP A;  1NAF A;  3CXH E;  5IYZ A;  2KSJ A;  1KQS O;  3RYI B;  3ABV C;  1M90 W;  2MJZ A;  2ZR2 A;  1HR0 B;  3JCU H;  4N6J A;  1E79 H;  4U7O A;  1VQ4 V;  1JMK C;  1FJG O;  3W7T A;  2P4K A;  1GKF A;  2KXP B;  2QVA A;  3MD0 A;  3HE4 A;  3TGU D;  1ZR4 A;  2PGG A;  1IO4 A;  1D7M A;  1JEK A;  4GCZ A;  3CSX A;  5IE9 A;  3OUS A;  1YTF B;  1K5Q A;  3DGE A;  5IJ9 B;  3HKB A;  1G1I A;  2FYU G;  2I1J A;  2ZVO B;  3W67 A;  4ASW A;  2Y4T A;  2PI5 A;  2XAH A;  1PNM A;  2HHH B;  2XAF A;  2EZO A;  1AV1 A;  4DV1 B;  2KNC A;  2P67 A;  1F4N A;  4DR1 B;  5F2V O;  1FAV A;  1KB9 E;  1OMI A;  3P30 A;  1HNX B;  2YI8 A;  1MKM A;  2JJ1 G;  2DWD C;  2ZIO A;  3VQX A;  3ABT A;  3B8M A;  4E2L A;  4NXM B;  4JYA O;  3GF3 A;  3L75 H;  5AG2 A;  1NI8 A;  1H2N A;  3T97 A;  1M1K W;  5IYB O;  1NYH A;  4IIJ A;  4AQY B;  2H8P D;  1R3K C;  4C7U A;  1XNQ B;  2ZKO A;  3OM3 B;  1FZC C;  4FLT A;  4C46 A;  2PZS A;  1HVV A;  2YID A;  4O4L B;  4KHX A;  1EXJ A;  1AFO A;  5K1P A;  1NO4 A;  1QCE A;  4YJ2 A;  1N33 B;  2O01 H;  4DR2 O;  2MK3 A;  4I55 A;  3JAK A;  1PZQ A;  3R65 A;  2RN9 A;  1DGS A;  3SJC C;  3OAK A;  1FZC B;  1FC2 C;  4D6T G;  3DXR A;  2QRX A;  2ZDI A;  1NKN A;  1YJ9 P;  1RF1 C;  2UUB O;  1KKD A;  2Q9L A;  3IGA C;  4IGG A;  5KX5 A;  3PTZ A;  3CX5 F;  3B09 A;  2XNX A;  3MHV A;  4U3F J;  4AI8 A;  3B2E E;  1AR4 A;  5J2U A;  2K1A A;  4PEL A;  2DW3 A;  2WLH A;  3II6 A;  4I9Q A;  2WPS A;  4C7N B;  3WFV A;  4CS4 A;  4P9P A;  2QM7 A;  4WFE A;  1N73 B;  4QPJ A;  4X1K B;  3RN4 A;  2OT5 A;  2C0W A;  1I94 O;  5FPR A;  2PTM A;  2D2C D;  1BHA A;  3SYP A;  1SQX D;  4YXD C;  4DR4 O;  2KG7 B;  4PJ0 E;  4EIJ A;  3RT3 C;  1JOY A;  5KMG A;  2A7W A;  2Z3Y A;  3BAB A;  1NTM H;  3CD6 V;  3GMA A;  4MTX A;  4BW9 A;  3HKC B;  5APW A;  3Q5P A;  3BCC H;  4J42 A;  4JAA A;  4U7N A;  1URQ C;  1H0T B;  3O9O A;  2B87 A;  4J7J A;  1VQO V;  3QO8 A;  1L0L H;  4U3J B;  4DR5 O;  3KQG A;  2HG5 D;  1EN6 A;  4IYH A;  1BGY D;  2QIW A;  3BAS A;  4BIZ A;  1N73 C;  3ASN C;  3CXH D;  4L76 A;  2FFD B;  3E22 A;  3V2R A;  3HPL C;  3LSS A;  4JAU A;  1FDO A;  4L75 A;  3CWB G;  2B5U A;  4LF4 B;  1P84 F;  1TVK B;  4G27 B;  2O3J A;  1URQ B;  1WPX A;  4HNA B;  2OTK E;  2WSC J;  2YIU B;  1OW8 A;  1Z5V A;  3ZMU A;  2HLD G;  3ML0 A;  3BHP A;  3FB7 C;  1I0H A;  3ASN B;  3LUT B;  3T1H B;  3CCV P;  3JAS B;  3TET A;  1I5X A;  2WLL A;  1GTW A;  1JJ2 U;  4GZR B;  2Q1K A;  4FM1 A;  1HNW B;  1K33 A;  2PF4 E;  4LH6 A;  2WZ7 A;  3HE5 A;  1QQC A;  1M56 D;  3L71 H;  2IZ1 A;  1SQV J;  3E8B A;  2VS0 A;  1JR9 A;  4H13 D;  3TGU G;  1MUU A;  3LIE A;  1QVG U;  2E74 C;  3HTK A;  3VMY A;  1KB9 D;  5KAI E;  1F4M A;  4KHP B;  2YIB D;  1RM1 C;  1M7L A;  2W6J G;  1T8Z A;  1GW4 A;  1NHL A;  3CPW U;  2OQQ A;  3K5N A;  3USS A;  4CH5 A;  4ASU G;  1KYO H;  1ZW0 A;  2WQY C;  1NH2 D;  2WLM A;  2E43 A;  3WB2 A;  1ORQ C;  2YO2 A;  3G4S P;  1ZX3 A;  3FB5 C;  2E74 B;  3A2F A;  2Q73 A;  3T4D A;  4ZNC A;  5KLI B;  1AB3 A;  4O2B B;  3PP5 A;  5CJ0 A;  1RM1 B;  2KZI A;  2PYJ A;  2BTQ B;  3ZED A;  3I5C A;  5AW6 B;  1Y74 B;  2G3A A;  4EFB A;  4B86 A;  1EDJ A;  3ASO C;  1Y76 A;  5ITZ A;  1IBM O;  3GHG A;  3SJB C;  5KUK A;  3H1H J;  1AA0 A;  2M8R A;  4WF9 V;  1VF5 D;  3CCE V;  4RUF A;  4JI1 O;  3RL0 B;  2A06 E;  3AE8 C;  2ZYA A;  4NR1 A;  3W7X A;  5LHI A;  4DR3 O;  3FFQ A;  4K3A A;  1T6A A;  2WPQ A;  1XTG B;  3D3Q A;  1VIB A;  3CCR V;  3E8H A;  3SPH A;  4LNU B;  2IFM A;  1NVP D;  5DM6 V;  2KLU A;  3C3T A;  4J9Z B;  3L70 E;  3M99 B;  5TIS Z;  4R7C A;  4LFC B;  4I4T A;  3B40 A;  1GK9 A;  1NTK K;  1LP1 B;  1DF5 A;  3M0D C;  4B7E A;  2Q7G A;  5JQG B;  1JY2 N;  1VDF A;  1O9H A;  5B1O A;  1Y66 A;  3FB8 C;  4TQF A;  5FPO A;  1N7S A;  3IF4 A;  4JAS A;  1EDK A;  1Q82 W;  1LT1 A;  1K73 W;  5JH7 A;  2IJI A;  4DV2 B;  4JI3 O;  1OJH A;  2SPZ A;  5EBW C;  3CC2 V;  4ZOL B;  4P2Z A;  4A7P A;  5CCG C;  3ABL C;  1NJI W;  4PD4 F;  4LF9 O;  5KHI A;  2A79 B;  2E76 C;  2A9H A;  3MUD C;  2F95 B;  1N34 B;  4LC1 A;  1SQX G;  3QH9 A;  1H8A A;  4B7K A;  1MA1 A;  3SJA C;  2Z0A A;  2K3R A;  1KFM A;  4X1Y A;  4W80 A;  3ABK B;  3ABL B;  4DW1 A;  5D5Q A;  1SQV K;  5JVD A;  2R9I A;  1HDJ A;  2FYU J;  4D7S A;  2ETN A;  3FWN A;  4MTG A;  1H2S B;  3HKE B;  2K37 A;  4KT0 J;  2Y0D A;  1TUB B;  1BGY G;  3L74 H;  3NXS A;  4AQR D;  3ICX A;  5KKZ C;  4B3S B;  2YXL A;  4J7K A;  3UKM A;  1CZQ A;  3K5O A;  2KSE A;  2ZYG A;  1DEB A;  1GH6 A;  2IYO A;  1NGM B;  4R4L A;  2OTL V;  4NTY A;  1XL6 A;  2GUZ A;  1FE6 A;  5L8R J;  2QJP C;  4DRX B;  1ZUQ A;  2A0L A;  5EZY B;  1IC2 A;  5APS A;  2XU6 A;  3P8C E;  3V5B A;  3JAL A;  5LGT A;  3FAV B;  1K34 A;  4CH3 A;  5KLV H;  4IHJ B;  1IFP A;  2JEE A;  1EDI A;  3N7N A;  1VQ7 V;  1NU1 E;  3E8G A;  3U10 A;  5CA1 A;  5KKZ B;  1YTF D;  4I7Z C;  2XT9 A;  1Z56 A;  1G2C B;  4ZHQ A;  2IFN A;  3GG2 A;  1RF0 A;  1SS3 A;  2QJP B;  2FYZ A;  4FLU A;  1YTZ T;  3G9R A;  4X62 O;  3BAA A;  3OUF A;  2JGU A;  4O4J B;  1KD1 W;  2AXT Z;  3UT5 B;  4I7Z B;  1HW7 A;  2M5A A;  4FLY A;  4FLX A;  1OX3 A;  4D6T J;  3A0H E;  3I56 P;  5K5G B;  4MSW C;  1UFI A;  2A3Q A;  1DLB A;  2DQ0 A;  5E79 E;  5CMU A;  4JI5 O;  1HGV A;  2W90 A;  2YS8 A;  1SER A;  1BCC E;  1PV0 A;  1VQ6 P;  2ZYD A;  3GB7 C;  2ODM A;  2A06 D;  2PI4 A;  4JYC A;  1SRY A;  3H1L J;  5H6R A;  1KQG B;  1ZRT E;  2V7Q G;  4PDV A;  4X20 B;  2N1T C;  1I08 A;  5BMV B;  4GX0 A;  4HJG H;  1HJB A;  4FFK A;  4I9W A;  2R5B A;  3L70 D;  5H2F Z;  2K1E A;  2YIA A;  2EIL C;  2H3O A;  1OXZ A;  2CH7 A;  3RW0 A;  4K35 A;  3W7W A;  2N1T B;  3B77 A;  3PRJ A;  4NKG B;  3PLN A;  3HD7 C;  4DV5 B;  3WB1 A;  4JI2 O;  5AVR B;  3J80 N;  5KHH A;  3M9Q A;  4O2A B;  3ZRW A;  1ENV A;  1FXK B;  2EIL B;  3CCU V;  2XDJ A;  3A3Y B;  5CMZ A;  3OEH G;  4LF5 B;  2ZM6 B;  2L35 A;  1OVR A;  3CE2 A;  2O01 N;  1JPX A;  2JVD A;  1G1J A;  3L75 E;  2FYU K;  2Q6A A;  3HD7 B;  1PGJ A;  1JFF B;  3CMA P;  3OA7 A;  3CWB J;  4EKW A;  1U7J A;  4HYT B;  5LA6 A;  1FJG B;  1HNZ O;  1A02 F;  2F93 B;  2R5D A;  3KHU A;  3H1K H;  1Y9B A;  4X1I A;  1W0J G;  3A7O A;  3DSQ A;  3ZHV A;  2NRG A;  2X7R B;  3CYO A;  1SA0 A;  1SZT A;  2HR3 A;  1E1Q G;  2GSM B;  2KB1 A;  2HPC A;  1K7D A;  1XMQ O;  4L74 A;  1LT9 A;  1X79 B;  2ZIN A;  2KI7 B;  4GLX A;  3Q1M A;  1XNR O;  5GON B;  3P32 A;  5LXT A;  5IJ0 A;  2Q7E A;  3OTO O;  4L73 A;  1AP5 A;  2PFX A;  4I2L C;  3T2M A;  3SGI A;  1M1J A;  1GU5 A;  1URQ D;  2H43 A;  5IT9 N;  2CPB A;  3P8C D;  4DT0 A;  1D5A A;  3BRV B;  2AXT H;  1IXB A;  1GM8 A;  1DX7 A;  1YVW A;  4EYY Q;  1G8M A;  3CXC U;  3KZI Z;  4DK1 A;  3SFE C;  3E1I A;  1NU1 D;  1VQP P;  5BU8 B;  1GL2 A;  1R3L C;  1R6N A;  5BY1 A;  2NPS C;  2HEP A;  4QE9 A;  2CGO A;  4UFZ A;  3RYI A;  1Q8I A;  4NTW A;  5LBQ A;  4DR2 B;  1NVO A;  3H01 A;  1UIX A;  4ZBM A;  2WSF J;  3GWO A;  2LKM A;  4UCO A;  1S2E A;  3R66 A;  2FKW B;  5B66 Z;  4Z1V A;  3ZHR A;  1CSB A;  5H2F H;  1KB9 F;  1OCC C;  4LF8 O;  2RN0 A;  2QKA A;  2UUB B;  3BCC E;  2K9J B;  1L4A C;  2PRR A;  1GK6 A;  2CTQ A;  1RSO B;  1RQU A;  3W7U A;  5IJ9 A;  4TOI A;  4IFD K;  3A0B Z;  4WVZ A;  2E74 D;  1BCC D;  3EHB B;  2W83 C;  4LCU C;  4TWK A;  1ZV8 A;  1XRE A;  1OFC X;  2JJL A;  3AE6 C;  4Q20 A;  1ZRT D;  4PA9 A;  1N32 O;  1M90 Q;  1PNK A;  1OCC B;  1HP8 A;  4R50 A;  4BAY A;  5AW2 B;  3F5W C;  5HFM A;  2CTP A;  1JY3 O;  3AK2 A;  5BU5 A;  2YIC A;  2UXC O;  1SQP E;  3AE5 C;  1I94 B;  3DTU B;  1J5E O;  4WCE V;  1NR1 A;  3K0D A;  5IYD O;  2A06 G;  4JF3 A;  4U3F H;  4DR4 B;  1I5Y A;  2M3B A;  1H2M A;  4U7J A;  4L87 A; 
#chains in the Genus database with same CATH homology
 1FDO A;  2E75 D;  3EWK A;  3D70 A;  4OGQ C;  4H44 B;  3GLM A;  2BEZ F;  3D6Z A;  1VF5 C;  2WSC J;  3AEG C;  1GMJ A;  4GDO A;  3RK3 E;  1OW8 A;  1AJY A;  1OW6 A;  3AEB C;  4PV1 B;  4YTP C;  1RQV A;  2K9Y A;  3AEE C;  4H13 B;  4IL6 X;  4OGQ B;  1YQ3 C;  4XFJ A;  2WSE J;  2MKV A;  4Y28 J;  4H0L C;  1OMI A;  3O6Q A;  1MKM A;  4Z1M H;  1VF5 B;  1Y9B A;  4PV1 D;  3D71 A;  4KT0 J;  3AEA C;  2D2C C;  3GF3 A;  2NZ2 A;  1WMK A;  2ZT9 D;  2P10 A;  3R4Y A;  4H13 D;  5KKZ C;  2E74 C;  1NYH A;  3D6Y A;  1NGM B;  4R4L A;  3Q5S A;  3AE9 C;  5L8R J;  2QJP C;  3FGA D;  3Q1M A;  2H88 C;  2JO1 A;  2OQQ A;  4H0L B;  1K04 A;  2QJY C;  1KQF B;  1EXJ A;  1VL2 A;  2WQY C;  2WPV B;  1KMI Z;  1ZME C;  2D2C B;  3LW5 J;  4H44 D;  2E76 B;  2E74 B;  1DD3 A;  3AE2 C;  4I7Z C;  4TT3 H;  1KTM A;  3B71 A;  5M1B A;  1HF9 A;  2G3A A;  3G9R A;  3H25 A;  1YQ4 C;  2E75 C;  3SFE C;  3SFD C;  2YMK A;  1R8E A;  2E76 D;  4OGQ D;  1DIP A;  3GF7 A;  3S9O A;  3T97 B;  1PIX A;  1VF5 D;  4I7Z B;  3AED C;  1KOR A;  3AE8 C;  1IK7 A;  3RL0 g;  2QSI A;  1UIX A;  2WSF J;  2J5U A;  2YIU C;  4RKU J;  1JB0 J;  2H89 C;  2FBW C;  4R4M A;  1FDI A;  1PV3 A;  3IAO A;  1HJ0 A;  1S5L X;  4H0L D;  2ZT9 C;  2IDB A;  4H13 C;  3AE1 C;  2O01 J;  1ZRT E;  1KQG B;  1RQU A;  3IN6 A;  3Q3D A;  2FXP A;  2D2C D;  1OW7 A;  3AE4 C;  3Q2Y A;  4YXD C;  2QJK C;  3C8V A;  2E74 D;  2JP3 A;  1U57 A;  1KIL E;  2BEQ D;  3AEF C;  1TU3 F;  3GMA A;  3AE7 C;  3AE6 C;  3Q5R A;  1ZP0 C;  1ZOY C;  2V7Q J;  4H44 C;  1S1C X;  1Q90 D;  2G8Y A;  2ZT9 B;  3ABV C;  3Q5P A;  1PL5 A;  2E75 B;  3AE3 C;  1DD4 A;  2FYN C;  3AE5 C;  2QIW A;  4PV1 C;  3AEC C;  1K05 A;  1EXI A;  2E76 C;  4U7J A;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...