2A45I

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
DNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombin light chain
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 12
structure length 40
sequence length 40
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45I00
1RE4C 1JY3P 2Q9IA 1JY3N 3BVHA 1RF1C 1FZGA 1T3UA 3HUSC 2A45G 1JY3O 2FFDC 2A45I 1W2EA 3H32A 1FZAA 1M1JA 3H32B 1LTJC 1M1JB 2Z4EA 1FZBA 2OYHA 2OYHB 1LT9A 1N86A 2OYIC 1LT9B 1FZCC 3GHGC 2OYIA 1RF0C 1RE4A 2OYIB 1N73C 1RF1A 2H43A 2HPCA 2HPCB 1RF1B 1LWUC 3HUSA 2FFDA 3HUSB 2FFDB 1RE3C 1LTJA 2HLOA 1FZEA 1LTJB 2A45H 2HODA 1RF0A 2HODB 1M1JC 3E1IA 3GHGA 1FZCA 3GHGB 1N73A 1JY2P 2OYHC 1JY2N 1FZCB 1LT9C 1FZFA 1N73B 1LWUA 1JY2O 1RE3A 2XNXA 1LWUB
chains in the Genus database with same CATH superfamily
2YXRB 4KJMA 5BVZA 1QEXA 5CBOA 3BATA 3PRJA 4N3YB 1NTZJ 1VQLP 3HE5A 2YKPA 2NPSA 2BEQD 1FZCA 3L73G 1LT9C 1L4AB 2QIWA 1BE3D 4GOFA 2QE7H 1T6AA 4O9BA 1LT1A 2ZYGA 1S9KD 4EI2A 1BCCG 2IZ1A 4WVZA 1MUUA 2P2UA 1S1CX 2B89A 1DX7A 2IFMA 3TF5A 1FE6A 5AVSB 1PP9E 2QRXA 2OYIA 1AQ5A 3TGUJ 4IL6X 1KYOI 3V2RA 3PH0A 4TT3H 4DJGA 1JY2N 3Q2YA 1EDIA 1KD1Q 1P84D 3AEDC 3MTUE 4W80A 1IK7A 5TISE 3PHLA 2O01N 3VMXA 4YXWH 1VQKP 1QVFO 2O1JA 3RBXA 4A7PA 2KK7A 1IFDA 4PV1D 3VOPA 2Q6QA 4HYTB 2NPSD 4K3AA 3CC4P 4JYCA 1KV4A 1FAVA 2CPSA 3H32A 4UB6H 4I6MC 4KHXA 3LW5H 1YTZI 1LTIC 1NTKG 3HD7B 2W8ZA 3AEAC 1JO5A 2H7HA 1RF0A 1KILA 2C0XA 3L70G 3M9HA 2YKOA 1SQXJ 1RF1C 1LTAC 3NMDA 1GDTA 3I55P 1USDA 3O8ZA 4WY4D 2QSIA 1HVVA 5CCHD 1FDMA 1R5LA 3CMAP 1XTGB 2FYUK 3KZIH 3A0HH 4QMAA 3L71E 3CCLP 1HGVA 1JTHB 4B86A 1SQQE 1ZV8A 1OXZA 1PGPA 4EDFA 1GL2C 3WUVA 2XDJA 1VQOP 3B8EB 3L73D 3N7NA 1RQUA 1CSBA 2ZFCA 2AXTE 1DEBA 1N7SA 2LXBA 4PD4H 1PZQA 3E7KA 1AA0A 3QH9A 3CL3D 1BCCD 4EOTA 5AVWB 3T97A 4ZKPA 2IYOA 2H43A 1K04A 4Z1MH 5AW9B 3Q5PA 2NRGA 2IBZG 1KILD 5K5GB 1L0NE 1JUNA 4JF7A 1NU1G 2XU6A 3HTKA 4JBZA 4PV1C 1Q82Q 1OW8A 2NPSC 2YIUB 3GHGC 1SQQK 5B66E 4L76A 3EFFK 2P1JA 2Y0DA 2YMKA 1J1DC 1RH5B 5AW8B 1H0TA 4GT1A 2QJKB 5DJTB 2PAJA 2FFDA 1NTME 2KIKA 4WY4C 4OGQD 3I56P 1SQVJ 1N7SD 5CCHC 5KKZB 2N1TD 2WT7B 3B5NB 1JCCA 3BVHA 1ZW0A 1NTKD 2A45G 1JY3O 4CPGA 2B87A 5TJHA 4HH2A 2BCCJ 3ZDMA 3BCCJ 3L70D 1S5LH 2HODA 1NTZE 3AE4C 3M9QA 5KLVD 1JEKA 1YIJP 2IFNA 3HUSC 3CC7P 3CWBJ 2M8RA 3CXHD 1SFCA 4H13B 1PL5A 2A06G 3MUDA 4M3LA 1L0LJ 3GW6A 4ASVA 1JOCA 4D6TJ 2E43A 1NTMK 1OWAA 5AVUB 4BWNA 3RBZA 2MJZA 1NAYA 3PLNA 4RKUJ 2WTYA 1RF0C 1KILC 4XA4A 1PIXA 1J1EB 3TSIA 3M0DA 3TGUE 3AE3C 4IFFA 5AW6B 3VP8A 2N9YB 1KFNA 3GF3A 2KZIA 3D6ZA 5AVVB 2ZT9D 1SQBE 1M1JB 3A3YB 1NTZK 3MIWA 4GDOA 1IFMA 2IBZD 3LIDA 3MZWB 2GUVA 1BDDA 2K3RA 3BRTB 1NU1D 4U3FG 5AVTB 1FZFA 1KFMA 3P8CD 1BE3J 1SQPG 2XV5A 1JB0J 2FYNB 1YJWP 1SS1A 1X8YA 1FU1A 1LT9A 1QL2A 4OGQC 1N7SC 2N1TC 3CC2P 2Y9YA 1DIPA 1PPJE 2KB7P 4D6TG 1M8OB 3KZIE 2YO3A 3A0HE 3L72E 2CK3H 2YO2A 1HJ0A 3SFEC 3V4WA 5TISH 2J59M 3CCJP 1KB9I 5CBNA 1OX3A 3CPWO 2K88A 5KLIC 1GU4A 3FXEA 3JSVC 3SWKA 3RGUA 2QM7A 2CPBA 3H1KE 1AVYA 5C39A 1LWUA 3AE5C 1G2CA 1VDFA 2WQYC 3L74G 2Q3EA 1KYOH 2A45I 5AVRB 3IAOA 2XZRA 5AW7B 5CJ4A 3FWNA 5KAIH 1BE3G 2HR3A 2AEFA 1U7MA 1FS0E 1FZEA 2OTJP 5AW2B 2AXCA 1YYCA 2KLVA 3L75E 4DOJA 2J58A 3H1IE 3G9RA 1LTTC 1JNMA 4I7ZB 1FDOA 1W2BO 1FOSE 2I1KA 4RJTA 1SQXK 2ZT9C 2QJPC 4AQRD 2WSCH 2E75D 2ZYDA 3CX5I 2WSFJ 3AE6C 3H1JD 3ABVC 4HJGH 2K9YA 1RE4A 1YI2P 4OWFA 1RF1A 1VF5B 3JCUE 1EQ7A 4H0LB 1MFTA 1JY3N 5APUA 2PGDA 1LTJC 1DD4A 3M06A 1GW4A 3L73J 2O1KA 4U3FD 3V5BA 2JKVA 3C1LA 1HWTC 2E74B 1KTMA 1GL2A 1SQPD 1S5LE 3NXSA 3A5TA 1N73A 1SQVE 1CZQA 4H13C 1USEA 3D6YA 1BCCJ 5GTIH 1VQ6P 1S3JA 4C7NB 3RL0B 2GUSA 2BCCE 3BCCE 2W6AA 1YQ4C 3L37A 1PGOA 2H89C 1H89A 3PP5A 2Q3IA 2GM4A 1FZAA 2WWWA 3RK3E 3AE7C 2L91A 1KORA 3L74D 4WWIA 3HE5B 4GODA 3GHGA 2ZVOB 2J5UA 3AEGC 2PFXA 1XTCC 2W83C 2JR8A 2RH0A 2JWDA 2E75C 1SQVK 1PV3A 2OTKE 3KHUA 1ZLLA 1GL2D 1AQTA 4ZNCA 2KXPB 2IZ0A 1NTKJ 1NOHA 4W7ZA 3P32A 1EZVG 4WY4A 4GIFA 5CCHA 3IR9A 1U7JA 2KNCB 2W27A 2OYIB 3L70J 3I5CA 1LWUC 4LLHA 3A7OA 1OVVA 2P10A 5KLVJ 1M90Q 2FYUE 1YITP 3EQ2A 3TNUA 1L0LK 1P84I 3HUSA 2LXCB 2IX7C 2K9JA 5KJ7D 3L35A 1NKZB 1N8RQ 4PJ0H 1EDKA 3E1IA 3E1RA 3OW2O 2D2CB 1MKMA 1WT6A 2ZVNB 3CCQP 3H32B 1KYOE 1URQB 2R3SA 4JPZB 3H6PA 2Q5UA 5KAIE 2BASA 3PTZA 2JP3A 3FWLA 2AEMA 1L4AD 3IFMA 3R4YA 1YJNP 2XNXA 1RE4C 1YHQP 3PJSK 1NJIQ 5KLVG 1FC2C 1NU1J 1BGYG 3RK2B 2WZ7A 2FKWB 3C9IA 1NWQA 1K8AQ 3AEBC 1DEEG 4RO0A 2NZ2A 2R44A 1EXIA 5CCGD 1SQBG 1N73C 3HE4A 1VQ5P 2I1JA 3IN6A 3P8MC 1UIXA 2OYHC 1L0ND 2N1TA 1M1KQ 2WSEJ 3G6EP 1IZNB 1RQVA 2PRRA 2P7JA 1RHZB 3H1HE 2FXPA 4BRYA 1FBMA 2FY8A 1NO4A 1KB9H 2AEJA 1EZVD 2P58A 1X22A 5AW1B 2Z5IA 2WSEH 2HG5D 3HTKB 1EZVI 5KJ7C 3K5BA 2DW3A 2H8PD 5GTIE 1IFPA 3SSUA 3L73E 3HD7D 4IFMA 1KQFB 4K35A 1VL2A 1YQ3C 3Q1MA 3VN0A 1AFOA 4C7RA 2QEXP 1VQPP 2ITAA 1IO4A 1EDJA 3H1KG 1H0TB 2HPCA 1L4AC 1CW5A 4IL6H 3JCUH 2FFDB 5KTBA 1EXJA 1UIIA 1KILE 1ZP0C 3VYIA 3H1JJ 2P67A 2R5DA 4Y99B 3L75G 2QJYB 2K1AA 2RKLA 2LKMA 3H1IG 3CX5H 2W6JH 2MKVA 2V7QJ 2E76B 2M5AB 3CCSP 1CI6A 2HODB 4H44B 2WT7A 1JY2P 1VQ7P 5CCGC 3B5NA 5AW4B 1KQSO 1QX8A 1ZRTE 1BGYD 1ZMEC 4U3FJ 1W5CE 1X79B 1GK4A 1ZR4A 4XE5B 1SQPJ 1SFCB 2G8YA 1NH4A 3RL0g 3MGNA 1LTJA 2E5TA 1OW6A 2Y9ZA 1X0TA 3CXHI 1Z56A 2OGUA 2ZAEB 3FXDA 2KS1A 1SQBD 1T3UA 2G3AA 3H1LG 3H1JG 4EIJA 2YXQB 2IPPA 2OARA 4LGDE 1URQC 5B5EH 4PJ0E 2HFED 1IC2A 2M3BA 2FBWC 3NFQA 3HD7C 2ZXEB 3O6QA 1AJYA 4N78D 1NYHA 3FX0A 1KQLA 1PPJD 3UIAA 1X9VA 1MZ9A 3KXDA 5AVYB 3L74J 3Q5RA 3L72D 2JEEA 2IBZI 3D71A 1KQGB 2JDIH 1SLQA 4MN4C 1RE3A 3B5ND 1IFNA 2O01J 3S1KA 1M1JA 1Y8AA 1A02F 2XKMA 1LT9B 2C9LY 5E79E 4IOIH 1LNQA 2Z5HA 1NTKK 2Q1KA 4JQ0D 3H1KD 4PD4D 4BXLA 2KP8A 1SQXE 4H13D 5KLVK 2M3EA 1NAFA 1T8ZA 3VMAA 3L75D 5H2FH 2Y0CA 3EFGA 1FDIA 3H1ID 1G2CB 1D7MA 4L75A 4I2LC 4NPEA 2O3JA 1PP9G 2FXMA 1JM0A 3RK3B 5BU8B 3VMYA 1G1IA 4GKGA 2E5YA 1KB9E 2YIUC 1ZR2A 1P84H 1EDLA 4R4LA 3JC22 3KQGA 1E5WA 2KSJA 1E79H 2WPQA 5GTHH 2FYUG 2WMMA 2N9BA 1M56D 5AVXB 2BEZF 4YPCA 3A0BH 3EWKA 2QJKC 3H1LD 3V4QA 1K9MQ 1IJDB 1G1JA 1NU1K 1BDCA 1LJ2A 5KKZC 1OMIA 2KYVA 1RF1B 2OTLP 2JO1A 3B5NC 4IL6E 2HLOA 2R5BA 2WSFH 2JWAA 1N2DC 1T3JA 5AW3B 2A06E 3HRNA 1M7LA 3CX5E 1Q86Q 1IFJA 1QL1A 3C8VA 1L0NJ 5KAFH 3F5HA 2OQQA 3L71G 3V2QA 4AUWA 4DZOA 1MFZA 2W90A 1SQQG 2OYHA 2FYZA 3F89A 3W67A 1AV1A 1Y47A 3GF7A 2QA4P 4R4MA 3G3ZA 1J1EC 2R3CA 1LP1A 1VQNP 4KT0J 3IF4A 3QWOC 5AVZB 4C7NA 4U3FE 3CWBE 2RN0A 1RE3C 5KJ7A 4PV1B 3WU2H 3H1HG 1M1JC 2NPSB 3GHGB 5B5EE 1FZCB 1L0LE 1PP9D 4D6TE 1L0NG 3VTPC 1FJPA 1J1DB 5DJUB 1VF5D 3VP9A 2FYNC 1L2PA 4H0LD 2ZXXA 1YTZT 5APTA 1L4AA 4NPFX 1ZOYC 2B9BA 2FYUD 3SFDC 3ITKA 4WY4B 2ZJSE 1Q81Q 3LIEA 1ZN5A 2QG4A 2C9NY 1AVOA 2E74D 1BSHA 3CCVP 3L74E 1GD2E 1NTMG 3AE8C 5CMZA 1SQPK 1K05A 1BE3E 1BGYJ 1KYOD 3TNUB 2KNCA 1NKNA 4IFDK 4U7JA 5CCGA 1S4XA 1S9KE 4W7YA 3RL0D 1YJ9P 3HUSB 3G71P 2K9JB 3BASA 4HKZH 3GMAA 1J2JB 5H2FE 1SQBJ 1OIPA 1OVRA 2ZYAA 3BRVB 1FZGA 3RK3C 1NTZG 3OA7A 3AE9C 3SWFA 3AE1C 1HJBA 3CXHH 3LW5J 1OW7A 1GK6A 4JYBA 1S5LX 1U57A 3L71D 1VPCA 4I7ZC 3CLQA 1KILB 1SQQD 1NHLA 1P84E 1IFIA 1M57D 1URQA 3KDPB 4DCKA 5GTHE 5E79H 3HD7A 1MV8A 3L72J 5M1BA 2XNDH 3R2PA 1GU5A 3A0BE 2E42A 1A02J 3TGUG 1JY3P 1VF5C 1LTGC 3CI9A 3II6A 3KYQA 1VQ9P 1NVOA 4YXDC 1WMKA 4H0LC 3H1HD 3HE4B 3USSA 1T2KD 4AYCA 3H1KJ 1JTHA 4OGQB 1N7SB 2N1TB 2JJLA 4ZMDA 2V4HA 2I8DA 2E74C 1GZLA 2UWJE 3U1CA 3G4SP 3WMM0 3T97B 2YMYA 1N7LA 3GLMA 4BRYB 3L75J 3CCEP 1JMMA 1PPJG 3H1IJ 2D2CD 5KAFE 1WRGA 5KLIB 1R5SA 3RL0C 1OVUA 3L72G 1GMJA 2WPVB 1URQD 2KI7B 1YBKA 3AECC 1SQXG 1NTMD 2A45H 1VQ4P 3A2AA 3S4RA 4ASWA 3KPEA 4ZKUA 1W2EA 2VRSA 3Q5SA 3VMZA 1OFCX 3OJAB 1FZCC 1BCCE 2HPCB 3RK2D 3MP7B 3H25A 1NTZD 3WUUA 1EZVE 3H1LJ 3WU2E 4UB8H 1QVGO 2ZT9B 1ZRTD 2QJPB 2KUBA 4N6JA 2B87B 3P7KA 1KN7A 2KSEA 1SP4A 1CI6B 3AEFC 2OYIC 4Y28J 3L4FA 3TK1A 1T2KC 2C0WA 1FZBA 2IYPA 3Q3DA 1N86A 1L0NK 3M0AA 1FJKA 2M5AA 3TGUD 2V7QH 1K73Q 1LTJB 1KMIZ 4OH8B 3V2PA 2FXOA 4HB1A 1Q7YQ 1EC5A 2KS1B 4OVNF 1NTKE 2WSSH 2QVAA 4I1LA 4L73A 1VQMP 4WBAA 5AW5B 2LR2A 2D2CC 3L70E 4TLFA 2L5GB 2YNYA 3TYYA 1KC8Q 3TDKA 5KLVE 1HF9A 2YKQA 3O6QB 1S72P 1BGYE 1SQVG 5APYA 3CXHE 4DT0A 3V2NA 1PGJA 1RY3A 2W6BA 2QM8A 1BSNA 4XFJA 1H8AA 3CCUP 2BCCG 3BCCG 1PP9J 3MD0A 1SQXD 3RK2C 2POHA 4UB6E 5APXA 3SWYA 4EYYQ 2WPRA 2E76D 2Y0EA 3CWBG 4H44D 1QLED 2E75B 2HYNA 2FYUJ 2GA1A 3M91A 2WPSA 1VQ8P 2O01H 4YTPC 1L0LG 4N78E 2Z4EA 4PD4I 1SFCD 2IBZE 3AE2C 3CD6P 1JCDA 2B88A 1DD3A 1NU1E 3L36A 3WUTA 1KB9D 1DH3A 3P8CE 1JY2O 3B71A 1LWUB 1PGQA 2WVRA 1OZHA 1GW3A 1LTSC 1SQBK 5AVQB 3CCMP 2OYOA 5CJ0A 1LGHB 1FOSF 4PD4E 5L8RJ 1IK9A 5APSA 1ZXGA 1HUCA 2IDBA 1GTWA 1R8EA 4NPDA 1SVFA 3L71J 2KZJA 2WSCJ 2Q7CA 1SQQJ 4LC1A 5CHXA 1KZUB 2RMZA 1QGKB 2FFDC 2A06D 3CCRP 4GOEA 2R32A 3CX5D 1LTBC 5EFWB 1HTLC 4C46A 1S2EA 1JMBA 4Y99C 2QJYC 3U1AA 1SQVD 1Q90D 3M9BA 2H88C 3NTNA 4UB8E 3N4XA 3GG2A 2E76C 3H1HJ 4H44C 5APVA 3S9OA 2KOGA 2BCCD 2AXTH 1GL2B 3BCCD 1HGZA 2SPZA 3U59A 1N73B 3D70A 3H1LE 2M0BA 1SFCC 2Q9IA 3H1JE 3AEEC 1HH0A 1Q2NA 3MUDC 1NGMB 2OYHB 5BU5A 3CWBD 4RESB 3CMEP 3FGAD 3RK3D 2K37A 1Y9BA 2PP6A 1L0LD 2KLUA 3B4SA 3MHVA 2WITA 4WB4A 3W68A 3V6IA 5APWA 3M0DC 4D6TD 3OAKA 1LP1B 5B66H 1HBWA 1NTMJ 4L74A 1PFIA 5APQA 1SQPE 1H88A 1TU3F 5AW0B
chains in the Genus database with same CATH topology
1G2CA 1JY3P 1VDFA 1LTGC 3CI9A 3II6A 2A45I 3KYQA 5AVRB 5BVZA 2XZRA 5AW7B 1X79B 5CJ4A 1GK4A 1ZR4A 4XE5B 1SFCB 3BATA 1NH4A 3HE4B 1T2KD 3MGNA 4N3YB 1LTJA 4AYCA 1FZEA 3HE5A 2YKPA 2NPSA 1JTHA 5AW2B 1FZCA 1YYCA 2KLVA 1N7SB 1LT9C 4DOJA 2N1TB 1Z56A 2J58A 2JJLA 1L4AB 1LTTC 1GZLA 1T3UA 3U1CA 1JNMA 4O9BA 3WMM0 1S9KD 2YMYA 1FOSE 1N7LA 4EIJA 2I1KA 1SQXK 2IPPA 2OARA 4LGDE 4AQRD 2WSCH 1JMMA 1URQC 1MUUA 2HFED 2P2UA 1IC2A 2M3BA 1DX7A 2IFMA 1WRGA 3NFQA 3HD7C 3RL0C 2ZXEB 5AVSB 4N78D 1URQD 1KQLA 2OYIA 1AQ5A 1RE4A 1RF1A 3UIAA 1X9VA 1MZ9A 5AVYB 1EQ7A 3V2RA 2A45H 2JEEA 3A2AA 1JY2N 1SLQA 1RE3A 3B5ND 1IFNA 1JY3N 3KPEA 3MTUE 4ZKUA 4W80A 5APUA 1W2EA 2VRSA 1M1JA 3VMXA 1LTJC 3VMZA 1A02F 3M06A 1GW4A 2XKMA 1LT9B 3OJAB 2O1KA 1FZCC 2O1JA 2C9LY 3V5BA 1HWTC 2HPCB 1GL2A 3RK2D 1IFDA 1NTKK 2Z5HA 3VOPA 3NXSA 2NPSD 4HYTB 3A5TA 4JYCA 1N73A 1FAVA 2CPSA 1CZQA 2KP8A 3H32A 4I6MC 4KHXA 3LW5H 4C7NB 4N6JA 1YTZI 1LTIC 3HD7B 5KLVK 3RL0B 3P7KA 2GUSA 1NAFA 1JO5A 2W6AA 1T8ZA 2H7HA 1SP4A 1CI6B 1RF0A 1KILA 2C0XA 3L37A 3EFGA 3M9HA 2YKOA 2OYIC 1H89A 3L4FA 1RF1C 3PP5A 1G2CB 1LTAC 3NMDA 3TK1A 1GDTA 1T2KC 2Q3IA 2C0WA 3O8ZA 4WY4D 1FZAA 2GM4A 1HVVA 5CCHD 1FDMA 1FZBA 2WWWA 1N86A 1L0NK 4I2LC 1XTGB 3M0AA 2FYUK 1FJKA 2FXMA 3RK3B 5BU8B 1LTJB 3VMYA 1G1IA 4GKGA 3HE5B 4OH8B 3V2PA 1HGVA 1JTHB 3GHGA 4B86A 1ZR2A 1ZV8A 1XTCC 1OXZA 1GL2C 3KQGA 1E5WA 2KSJA 2XDJA 4I1LA 4WBAA 2WPQA 5AW5B 3B8EB 1SQVK 2N9BA 1ZLLA 5AVXB 1GL2D 3N7NA 1CSBA 2ZFCA 1DEBA 2L5GB 2YNYA 1N7SA 3TYYA 3V4QA 1NOHA 4W7ZA 1IJDB 3P32A 2YKQA 1G1JA 1NU1K 4WY4A 4GIFA 5CCHA 3IR9A 2W27A 3CL3D 5APYA 4EOTA 5AVWB 3T97A 4ZKPA 2OYIB 3I5CA 2H43A 2KYVA 1RF1B 3V2NA 1LWUC 4LLHA 3A7OA 3B5NC 5AW9B 2HLOA 1RY3A 2W6BA 2R5BA 2QM8A 1KILD 1H8AA 1JUNA 2WSFH 4JF7A 2XU6A 3EQ2A 3MD0A 1N2DC 3HTKA 3RK2C 1T3JA 2POHA 3TNUA 5AW3B 5APXA 3HRNA 1L0LK 3SWYA 2NPSC 3GHGC 1SQQK 1M7LA 2WPRA 1IFJA 3HUSA 2IX7C 1QL1A 5KJ7D 3L35A 1NKZB 2P1JA 3E1IA 2HYNA 1J1DC 3M91A 1WT6A 5AW8B 2WPSA 3V2QA 4AUWA 4DZOA 1MFZA 2O01H 3H32B 4N78E 2Z4EA 2OYHA 1URQB 4GT1A 2FYZA 2PAJA 1SFCD 3H6PA 2Q5UA 1JCDA 2FFDA 2BASA 3L36A 4WY4C 1N7SD 5CCHC 2N1TD 1DH3A 1L4AD 3G3ZA 3IFMA 2WT7B 3P8CE 1JY2O 1J1EC 2R3CA 2XNXA 1LWUB 1RE4C 3B5NB 1JCCA 3BVHA 2A45G 1JY3O 5AVZB 1GW3A 4C7NA 4HH2A 1LTSC 1SQBK 5AVQB 5CJ0A 1RE3C 3RK2B 1LGHB 2WZ7A 2FKWB 5KJ7A 1FOSF 2HODA 1M1JC 2NPSB 3C9IA 3GHGB 3M9QA 1FZCB 1NWQA 1IK9A 2IFNA 3HUSC 5APSA 1HUCA 1GTWA 2M8RA 3VTPC 1FJPA 1J1DB 5CCGD 1SFCA 1N73C 3HE4A 1SVFA 3VP9A 2I1JA 2Q7CA 3MUDA 3P8MC 4M3LA 4LC1A 5CHXA 1JOCA 2OYHC 1KZUB 2N1TA 1YTZT 5APTA 1L4AA 2E43A 1NTMK 1OWAA 5AVUB 2FFDC 4WY4B 2MJZA 2WTYA 2P7JA 3LIEA 1ZN5A 1RF0C 2R32A 1KILC 1LTBC 1HTLC 4XA4A 1J1EB 4C46A 2C9NY 3TSIA 3M0DA 4Y99C 1FBMA 1NO4A 4IFFA 5AW6B 3VP8A 3U1AA 1GD2E 5AW1B 1KFNA 2Z5IA 3M9BA 5CMZA 3NTNA 2WSEH 5AVVB 1SQPK 2HG5D 3N4XA 3HTKB 3TNUB 5KJ7C 1M1JB 1NKNA 1NTZK 3A3YB 3MIWA 4IFDK 1IFMA 2H8PD 5CCGA 5APVA 3LIDA 3HD7D 4IFMA 1S9KE 4W7YA 3RL0D 2GUVA 2KOGA 3HUSB 1GL2B 3BASA 3BRTB 1HGZA 3U59A 3VN0A 1J2JB 1AFOA 5AVTB 1FZFA 1KFMA 3P8CD 4C7RA 1N73B 2XV5A 1SFCC 1IO4A 2Q9IA 3BRVB 1FZGA 3RK3C 3OA7A 3SWFA 1HH0A 1X8YA 1HJBA 2OYHB 1FU1A 1LT9A 1QL2A 1GK6A 5BU5A 1N7SC 4JYBA 4RESB 2N1TC 2HPCA 1L4AC 1CW5A 2KB7P 3RK3D 2FFDB 2YO3A 5KTBA 1VPCA 2PP6A 3CLQA 2YO2A 1KILB 3VYIA 2WITA 4WB4A 1NHLA 2P67A 3V4WA 2R5DA 4Y99B 5APWA 3M0DC 1IFIA 2J59M 3OAKA 1URQA 1HBWA 2LKMA 3KDPB 3HD7A 1PFIA 1GU4A 1MV8A 3R2PA 5APQA 1H88A 1GU5A 1CI6A 2HODB 2QM7A 2CPBA 1JY2P 2WT7A 5AW0B 2E42A 1LWUA 5CCGC 3B5NA 1A02J 5AW4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 C;  1JY3 P;  2Q9I A;  1JY3 N;  3BVH A;  1RF1 C;  1FZG A;  1T3U A;  3HUS C;  2A45 G;  1JY3 O;  2FFD C;  2A45 I;  1W2E A;  3H32 A;  1FZA A;  1M1J A;  3H32 B;  1LTJ C;  1M1J B;  2Z4E A;  1FZB A;  2OYH A;  2OYH B;  1LT9 A;  1N86 A;  2OYI C;  1LT9 B;  1FZC C;  3GHG C;  2OYI A;  1RF0 C;  1RE4 A;  2OYI B;  1N73 C;  1RF1 A;  2H43 A;  2HPC A;  2HPC B;  1RF1 B;  1LWU C;  3HUS A;  2FFD A;  3HUS B;  2FFD B;  1RE3 C;  1LTJ A;  2HLO A;  1FZE A;  1LTJ B;  2A45 H;  2HOD A;  1RF0 A;  2HOD B;  1M1J C;  3E1I A;  3GHG A;  1FZC A;  3GHG B;  1N73 A;  1JY2 P;  2OYH C;  1JY2 N;  1FZC B;  1LT9 C;  1FZF A;  1N73 B;  1LWU A;  1JY2 O;  1RE3 A;  2XNX A;  1LWU B; 
#chains in the Genus database with same CATH topology
 2YXR B;  4KJM A;  5BVZ A;  1QEX A;  5CBO A;  3BAT A;  3PRJ A;  4N3Y B;  1NTZ J;  1VQL P;  3HE5 A;  2YKP A;  2NPS A;  2BEQ D;  1FZC A;  3L73 G;  1LT9 C;  1L4A B;  2QIW A;  1BE3 D;  4GOF A;  2QE7 H;  1T6A A;  4O9B A;  1LT1 A;  2ZYG A;  1S9K D;  4EI2 A;  1BCC G;  2IZ1 A;  4WVZ A;  1MUU A;  2P2U A;  1S1C X;  2B89 A;  1DX7 A;  2IFM A;  3TF5 A;  1FE6 A;  5AVS B;  1PP9 E;  2QRX A;  2OYI A;  1AQ5 A;  3TGU J;  4IL6 X;  1KYO I;  3V2R A;  3PH0 A;  4TT3 H;  4DJG A;  1JY2 N;  3Q2Y A;  1EDI A;  1KD1 Q;  1P84 D;  3AED C;  3MTU E;  4W80 A;  1IK7 A;  5TIS E;  3PHL A;  2O01 N;  3VMX A;  4YXW H;  1VQK P;  1QVF O;  2O1J A;  3RBX A;  4A7P A;  2KK7 A;  1IFD A;  4PV1 D;  3VOP A;  2Q6Q A;  4HYT B;  2NPS D;  4K3A A;  3CC4 P;  4JYC A;  1KV4 A;  1FAV A;  2CPS A;  3H32 A;  4UB6 H;  4I6M C;  4KHX A;  3LW5 H;  1YTZ I;  1LTI C;  1NTK G;  3HD7 B;  2W8Z A;  3AEA C;  1JO5 A;  2H7H A;  1RF0 A;  1KIL A;  2C0X A;  3L70 G;  3M9H A;  2YKO A;  1SQX J;  1RF1 C;  1LTA C;  3NMD A;  1GDT A;  3I55 P;  1USD A;  3O8Z A;  4WY4 D;  2QSI A;  1HVV A;  5CCH D;  1FDM A;  1R5L A;  3CMA P;  1XTG B;  2FYU K;  3KZI H;  3A0H H;  4QMA A;  3L71 E;  3CCL P;  1HGV A;  1JTH B;  4B86 A;  1SQQ E;  1ZV8 A;  1OXZ A;  1PGP A;  4EDF A;  1GL2 C;  3WUV A;  2XDJ A;  1VQO P;  3B8E B;  3L73 D;  3N7N A;  1RQU A;  1CSB A;  2ZFC A;  2AXT E;  1DEB A;  1N7S A;  2LXB A;  4PD4 H;  1PZQ A;  3E7K A;  1AA0 A;  3QH9 A;  3CL3 D;  1BCC D;  4EOT A;  5AVW B;  3T97 A;  4ZKP A;  2IYO A;  2H43 A;  1K04 A;  4Z1M H;  5AW9 B;  3Q5P A;  2NRG A;  2IBZ G;  1KIL D;  5K5G B;  1L0N E;  1JUN A;  4JF7 A;  1NU1 G;  2XU6 A;  3HTK A;  4JBZ A;  4PV1 C;  1Q82 Q;  1OW8 A;  2NPS C;  2YIU B;  3GHG C;  1SQQ K;  5B66 E;  4L76 A;  3EFF K;  2P1J A;  2Y0D A;  2YMK A;  1J1D C;  1RH5 B;  5AW8 B;  1H0T A;  4GT1 A;  2QJK B;  5DJT B;  2PAJ A;  2FFD A;  1NTM E;  2KIK A;  4WY4 C;  4OGQ D;  3I56 P;  1SQV J;  1N7S D;  5CCH C;  5KKZ B;  2N1T D;  2WT7 B;  3B5N B;  1JCC A;  3BVH A;  1ZW0 A;  1NTK D;  2A45 G;  1JY3 O;  4CPG A;  2B87 A;  5TJH A;  4HH2 A;  2BCC J;  3ZDM A;  3BCC J;  3L70 D;  1S5L H;  2HOD A;  1NTZ E;  3AE4 C;  3M9Q A;  5KLV D;  1JEK A;  1YIJ P;  2IFN A;  3HUS C;  3CC7 P;  3CWB J;  2M8R A;  3CXH D;  1SFC A;  4H13 B;  1PL5 A;  2A06 G;  3MUD A;  4M3L A;  1L0L J;  3GW6 A;  4ASV A;  1JOC A;  4D6T J;  2E43 A;  1NTM K;  1OWA A;  5AVU B;  4BWN A;  3RBZ A;  2MJZ A;  1NAY A;  3PLN A;  4RKU J;  2WTY A;  1RF0 C;  1KIL C;  4XA4 A;  1PIX A;  1J1E B;  3TSI A;  3M0D A;  3TGU E;  3AE3 C;  4IFF A;  5AW6 B;  3VP8 A;  2N9Y B;  1KFN A;  3GF3 A;  2KZI A;  3D6Z A;  5AVV B;  2ZT9 D;  1SQB E;  1M1J B;  3A3Y B;  1NTZ K;  3MIW A;  4GDO A;  1IFM A;  2IBZ D;  3LID A;  3MZW B;  2GUV A;  1BDD A;  2K3R A;  3BRT B;  1NU1 D;  4U3F G;  5AVT B;  1FZF A;  1KFM A;  3P8C D;  1BE3 J;  1SQP G;  2XV5 A;  1JB0 J;  2FYN B;  1YJW P;  1SS1 A;  1X8Y A;  1FU1 A;  1LT9 A;  1QL2 A;  4OGQ C;  1N7S C;  2N1T C;  3CC2 P;  2Y9Y A;  1DIP A;  1PPJ E;  2KB7 P;  4D6T G;  1M8O B;  3KZI E;  2YO3 A;  3A0H E;  3L72 E;  2CK3 H;  2YO2 A;  1HJ0 A;  3SFE C;  3V4W A;  5TIS H;  2J59 M;  3CCJ P;  1KB9 I;  5CBN A;  1OX3 A;  3CPW O;  2K88 A;  5KLI C;  1GU4 A;  3FXE A;  3JSV C;  3SWK A;  3RGU A;  2QM7 A;  2CPB A;  3H1K E;  1AVY A;  5C39 A;  1LWU A;  3AE5 C;  1G2C A;  1VDF A;  2WQY C;  3L74 G;  2Q3E A;  1KYO H;  2A45 I;  5AVR B;  3IAO A;  2XZR A;  5AW7 B;  5CJ4 A;  3FWN A;  5KAI H;  1BE3 G;  2HR3 A;  2AEF A;  1U7M A;  1FS0 E;  1FZE A;  2OTJ P;  5AW2 B;  2AXC A;  1YYC A;  2KLV A;  3L75 E;  4DOJ A;  2J58 A;  3H1I E;  3G9R A;  1LTT C;  1JNM A;  4I7Z B;  1FDO A;  1W2B O;  1FOS E;  2I1K A;  4RJT A;  1SQX K;  2ZT9 C;  2QJP C;  4AQR D;  2WSC H;  2E75 D;  2ZYD A;  3CX5 I;  2WSF J;  3AE6 C;  3H1J D;  3ABV C;  4HJG H;  2K9Y A;  1RE4 A;  1YI2 P;  4OWF A;  1RF1 A;  1VF5 B;  3JCU E;  1EQ7 A;  4H0L B;  1MFT A;  1JY3 N;  5APU A;  2PGD A;  1LTJ C;  1DD4 A;  3M06 A;  1GW4 A;  3L73 J;  2O1K A;  4U3F D;  3V5B A;  2JKV A;  3C1L A;  1HWT C;  2E74 B;  1KTM A;  1GL2 A;  1SQP D;  1S5L E;  3NXS A;  3A5T A;  1N73 A;  1SQV E;  1CZQ A;  4H13 C;  1USE A;  3D6Y A;  1BCC J;  5GTI H;  1VQ6 P;  1S3J A;  4C7N B;  3RL0 B;  2GUS A;  2BCC E;  3BCC E;  2W6A A;  1YQ4 C;  3L37 A;  1PGO A;  2H89 C;  1H89 A;  3PP5 A;  2Q3I A;  2GM4 A;  1FZA A;  2WWW A;  3RK3 E;  3AE7 C;  2L91 A;  1KOR A;  3L74 D;  4WWI A;  3HE5 B;  4GOD A;  3GHG A;  2ZVO B;  2J5U A;  3AEG C;  2PFX A;  1XTC C;  2W83 C;  2JR8 A;  2RH0 A;  2JWD A;  2E75 C;  1SQV K;  1PV3 A;  2OTK E;  3KHU A;  1ZLL A;  1GL2 D;  1AQT A;  4ZNC A;  2KXP B;  2IZ0 A;  1NTK J;  1NOH A;  4W7Z A;  3P32 A;  1EZV G;  4WY4 A;  4GIF A;  5CCH A;  3IR9 A;  1U7J A;  2KNC B;  2W27 A;  2OYI B;  3L70 J;  3I5C A;  1LWU C;  4LLH A;  3A7O A;  1OVV A;  2P10 A;  5KLV J;  1M90 Q;  2FYU E;  1YIT P;  3EQ2 A;  3TNU A;  1L0L K;  1P84 I;  3HUS A;  2LXC B;  2IX7 C;  2K9J A;  5KJ7 D;  3L35 A;  1NKZ B;  1N8R Q;  4PJ0 H;  1EDK A;  3E1I A;  3E1R A;  3OW2 O;  2D2C B;  1MKM A;  1WT6 A;  2ZVN B;  3CCQ P;  3H32 B;  1KYO E;  1URQ B;  2R3S A;  4JPZ B;  3H6P A;  2Q5U A;  5KAI E;  2BAS A;  3PTZ A;  2JP3 A;  3FWL A;  2AEM A;  1L4A D;  3IFM A;  3R4Y A;  1YJN P;  2XNX A;  1RE4 C;  1YHQ P;  3PJS K;  1NJI Q;  5KLV G;  1FC2 C;  1NU1 J;  1BGY G;  3RK2 B;  2WZ7 A;  2FKW B;  3C9I A;  1NWQ A;  1K8A Q;  3AEB C;  1DEE G;  4RO0 A;  2NZ2 A;  2R44 A;  1EXI A;  5CCG D;  1SQB G;  1N73 C;  3HE4 A;  1VQ5 P;  2I1J A;  3IN6 A;  3P8M C;  1UIX A;  2OYH C;  1L0N D;  2N1T A;  1M1K Q;  2WSE J;  3G6E P;  1IZN B;  1RQV A;  2PRR A;  2P7J A;  1RHZ B;  3H1H E;  2FXP A;  4BRY A;  1FBM A;  2FY8 A;  1NO4 A;  1KB9 H;  2AEJ A;  1EZV D;  2P58 A;  1X22 A;  5AW1 B;  2Z5I A;  2WSE H;  2HG5 D;  3HTK B;  1EZV I;  5KJ7 C;  3K5B A;  2DW3 A;  2H8P D;  5GTI E;  1IFP A;  3SSU A;  3L73 E;  3HD7 D;  4IFM A;  1KQF B;  4K35 A;  1VL2 A;  1YQ3 C;  3Q1M A;  3VN0 A;  1AFO A;  4C7R A;  2QEX P;  1VQP P;  2ITA A;  1IO4 A;  1EDJ A;  3H1K G;  1H0T B;  2HPC A;  1L4A C;  1CW5 A;  4IL6 H;  3JCU H;  2FFD B;  5KTB A;  1EXJ A;  1UII A;  1KIL E;  1ZP0 C;  3VYI A;  3H1J J;  2P67 A;  2R5D A;  4Y99 B;  3L75 G;  2QJY B;  2K1A A;  2RKL A;  2LKM A;  3H1I G;  3CX5 H;  2W6J H;  2MKV A;  2V7Q J;  2E76 B;  2M5A B;  3CCS P;  1CI6 A;  2HOD B;  4H44 B;  2WT7 A;  1JY2 P;  1VQ7 P;  5CCG C;  3B5N A;  5AW4 B;  1KQS O;  1QX8 A;  1ZRT E;  1BGY D;  1ZME C;  4U3F J;  1W5C E;  1X79 B;  1GK4 A;  1ZR4 A;  4XE5 B;  1SQP J;  1SFC B;  2G8Y A;  1NH4 A;  3RL0 g;  3MGN A;  1LTJ A;  2E5T A;  1OW6 A;  2Y9Z A;  1X0T A;  3CXH I;  1Z56 A;  2OGU A;  2ZAE B;  3FXD A;  2KS1 A;  1SQB D;  1T3U A;  2G3A A;  3H1L G;  3H1J G;  4EIJ A;  2YXQ B;  2IPP A;  2OAR A;  4LGD E;  1URQ C;  5B5E H;  4PJ0 E;  2HFE D;  1IC2 A;  2M3B A;  2FBW C;  3NFQ A;  3HD7 C;  2ZXE B;  3O6Q A;  1AJY A;  4N78 D;  1NYH A;  3FX0 A;  1KQL A;  1PPJ D;  3UIA A;  1X9V A;  1MZ9 A;  3KXD A;  5AVY B;  3L74 J;  3Q5R A;  3L72 D;  2JEE A;  2IBZ I;  3D71 A;  1KQG B;  2JDI H;  1SLQ A;  4MN4 C;  1RE3 A;  3B5N D;  1IFN A;  2O01 J;  3S1K A;  1M1J A;  1Y8A A;  1A02 F;  2XKM A;  1LT9 B;  2C9L Y;  5E79 E;  4IOI H;  1LNQ A;  2Z5H A;  1NTK K;  2Q1K A;  4JQ0 D;  3H1K D;  4PD4 D;  4BXL A;  2KP8 A;  1SQX E;  4H13 D;  5KLV K;  2M3E A;  1NAF A;  1T8Z A;  3VMA A;  3L75 D;  5H2F H;  2Y0C A;  3EFG A;  1FDI A;  3H1I D;  1G2C B;  1D7M A;  4L75 A;  4I2L C;  4NPE A;  2O3J A;  1PP9 G;  2FXM A;  1JM0 A;  3RK3 B;  5BU8 B;  3VMY A;  1G1I A;  4GKG A;  2E5Y A;  1KB9 E;  2YIU C;  1ZR2 A;  1P84 H;  1EDL A;  4R4L A;  3JC2 2;  3KQG A;  1E5W A;  2KSJ A;  1E79 H;  2WPQ A;  5GTH H;  2FYU G;  2WMM A;  2N9B A;  1M56 D;  5AVX B;  2BEZ F;  4YPC A;  3A0B H;  3EWK A;  2QJK C;  3H1L D;  3V4Q A;  1K9M Q;  1IJD B;  1G1J A;  1NU1 K;  1BDC A;  1LJ2 A;  5KKZ C;  1OMI A;  2KYV A;  1RF1 B;  2OTL P;  2JO1 A;  3B5N C;  4IL6 E;  2HLO A;  2R5B A;  2WSF H;  2JWA A;  1N2D C;  1T3J A;  5AW3 B;  2A06 E;  3HRN A;  1M7L A;  3CX5 E;  1Q86 Q;  1IFJ A;  1QL1 A;  3C8V A;  1L0N J;  5KAF H;  3F5H A;  2OQQ A;  3L71 G;  3V2Q A;  4AUW A;  4DZO A;  1MFZ A;  2W90 A;  1SQQ G;  2OYH A;  2FYZ A;  3F89 A;  3W67 A;  1AV1 A;  1Y47 A;  3GF7 A;  2QA4 P;  4R4M A;  3G3Z A;  1J1E C;  2R3C A;  1LP1 A;  1VQN P;  4KT0 J;  3IF4 A;  3QWO C;  5AVZ B;  4C7N A;  4U3F E;  3CWB E;  2RN0 A;  1RE3 C;  5KJ7 A;  4PV1 B;  3WU2 H;  3H1H G;  1M1J C;  2NPS B;  3GHG B;  5B5E E;  1FZC B;  1L0L E;  1PP9 D;  4D6T E;  1L0N G;  3VTP C;  1FJP A;  1J1D B;  5DJU B;  1VF5 D;  3VP9 A;  2FYN C;  1L2P A;  4H0L D;  2ZXX A;  1YTZ T;  5APT A;  1L4A A;  4NPF X;  1ZOY C;  2B9B A;  2FYU D;  3SFD C;  3ITK A;  4WY4 B;  2ZJS E;  1Q81 Q;  3LIE A;  1ZN5 A;  2QG4 A;  2C9N Y;  1AVO A;  2E74 D;  1BSH A;  3CCV P;  3L74 E;  1GD2 E;  1NTM G;  3AE8 C;  5CMZ A;  1SQP K;  1K05 A;  1BE3 E;  1BGY J;  1KYO D;  3TNU B;  2KNC A;  1NKN A;  4IFD K;  4U7J A;  5CCG A;  1S4X A;  1S9K E;  4W7Y A;  3RL0 D;  1YJ9 P;  3HUS B;  3G71 P;  2K9J B;  3BAS A;  4HKZ H;  3GMA A;  1J2J B;  5H2F E;  1SQB J;  1OIP A;  1OVR A;  2ZYA A;  3BRV B;  1FZG A;  3RK3 C;  1NTZ G;  3OA7 A;  3AE9 C;  3SWF A;  3AE1 C;  1HJB A;  3CXH H;  3LW5 J;  1OW7 A;  1GK6 A;  4JYB A;  1S5L X;  1U57 A;  3L71 D;  1VPC A;  4I7Z C;  3CLQ A;  1KIL B;  1SQQ D;  1NHL A;  1P84 E;  1IFI A;  1M57 D;  1URQ A;  3KDP B;  4DCK A;  5GTH E;  5E79 H;  3HD7 A;  1MV8 A;  3L72 J;  5M1B A;  2XND H;  3R2P A;  1GU5 A;  3A0B E;  2E42 A;  1A02 J;  3TGU G;  1JY3 P;  1VF5 C;  1LTG C;  3CI9 A;  3II6 A;  3KYQ A;  1VQ9 P;  1NVO A;  4YXD C;  1WMK A;  4H0L C;  3H1H D;  3HE4 B;  3USS A;  1T2K D;  4AYC A;  3H1K J;  1JTH A;  4OGQ B;  1N7S B;  2N1T B;  2JJL A;  4ZMD A;  2V4H A;  2I8D A;  2E74 C;  1GZL A;  2UWJ E;  3U1C A;  3G4S P;  3WMM 0;  3T97 B;  2YMY A;  1N7L A;  3GLM A;  4BRY B;  3L75 J;  3CCE P;  1JMM A;  1PPJ G;  3H1I J;  2D2C D;  5KAF E;  1WRG A;  5KLI B;  1R5S A;  3RL0 C;  1OVU A;  3L72 G;  1GMJ A;  2WPV B;  1URQ D;  2KI7 B;  1YBK A;  3AEC C;  1SQX G;  1NTM D;  2A45 H;  1VQ4 P;  3A2A A;  3S4R A;  4ASW A;  3KPE A;  4ZKU A;  1W2E A;  2VRS A;  3Q5S A;  3VMZ A;  1OFC X;  3OJA B;  1FZC C;  1BCC E;  2HPC B;  3RK2 D;  3MP7 B;  3H25 A;  1NTZ D;  3WUU A;  1EZV E;  3H1L J;  3WU2 E;  4UB8 H;  1QVG O;  2ZT9 B;  1ZRT D;  2QJP B;  2KUB A;  4N6J A;  2B87 B;  3P7K A;  1KN7 A;  2KSE A;  1SP4 A;  1CI6 B;  3AEF C;  2OYI C;  4Y28 J;  3L4F A;  3TK1 A;  1T2K C;  2C0W A;  1FZB A;  2IYP A;  3Q3D A;  1N86 A;  1L0N K;  3M0A A;  1FJK A;  2M5A A;  3TGU D;  2V7Q H;  1K73 Q;  1LTJ B;  1KMI Z;  4OH8 B;  3V2P A;  2FXO A;  4HB1 A;  1Q7Y Q;  1EC5 A;  2KS1 B;  4OVN F;  1NTK E;  2WSS H;  2QVA A;  4I1L A;  4L73 A;  1VQM P;  4WBA A;  5AW5 B;  2LR2 A;  2D2C C;  3L70 E;  4TLF A;  2L5G B;  2YNY A;  3TYY A;  1KC8 Q;  3TDK A;  5KLV E;  1HF9 A;  2YKQ A;  3O6Q B;  1S72 P;  1BGY E;  1SQV G;  5APY A;  3CXH E;  4DT0 A;  3V2N A;  1PGJ A;  1RY3 A;  2W6B A;  2QM8 A;  1BSN A;  4XFJ A;  1H8A A;  3CCU P;  2BCC G;  3BCC G;  1PP9 J;  3MD0 A;  1SQX D;  3RK2 C;  2POH A;  4UB6 E;  5APX A;  3SWY A;  4EYY Q;  2WPR A;  2E76 D;  2Y0E A;  3CWB G;  4H44 D;  1QLE D;  2E75 B;  2HYN A;  2FYU J;  2GA1 A;  3M91 A;  2WPS A;  1VQ8 P;  2O01 H;  4YTP C;  1L0L G;  4N78 E;  2Z4E A;  4PD4 I;  1SFC D;  2IBZ E;  3AE2 C;  3CD6 P;  1JCD A;  2B88 A;  1DD3 A;  1NU1 E;  3L36 A;  3WUT A;  1KB9 D;  1DH3 A;  3P8C E;  1JY2 O;  3B71 A;  1LWU B;  1PGQ A;  2WVR A;  1OZH A;  1GW3 A;  1LTS C;  1SQB K;  5AVQ B;  3CCM P;  2OYO A;  5CJ0 A;  1LGH B;  1FOS F;  4PD4 E;  5L8R J;  1IK9 A;  5APS A;  1ZXG A;  1HUC A;  2IDB A;  1GTW A;  1R8E A;  4NPD A;  1SVF A;  3L71 J;  2KZJ A;  2WSC J;  2Q7C A;  1SQQ J;  4LC1 A;  5CHX A;  1KZU B;  2RMZ A;  1QGK B;  2FFD C;  2A06 D;  3CCR P;  4GOE A;  2R32 A;  3CX5 D;  1LTB C;  5EFW B;  1HTL C;  4C46 A;  1S2E A;  1JMB A;  4Y99 C;  2QJY C;  3U1A A;  1SQV D;  1Q90 D;  3M9B A;  2H88 C;  3NTN A;  4UB8 E;  3N4X A;  3GG2 A;  2E76 C;  3H1H J;  4H44 C;  5APV A;  3S9O A;  2KOG A;  2BCC D;  2AXT H;  1GL2 B;  3BCC D;  1HGZ A;  2SPZ A;  3U59 A;  1N73 B;  3D70 A;  3H1L E;  2M0B A;  1SFC C;  2Q9I A;  3H1J E;  3AEE C;  1HH0 A;  1Q2N A;  3MUD C;  1NGM B;  2OYH B;  5BU5 A;  3CWB D;  4RES B;  3CME P;  3FGA D;  3RK3 D;  2K37 A;  1Y9B A;  2PP6 A;  1L0L D;  2KLU A;  3B4S A;  3MHV A;  2WIT A;  4WB4 A;  3W68 A;  3V6I A;  5APW A;  3M0D C;  4D6T D;  3OAK A;  1LP1 B;  5B66 H;  1HBW A;  1NTM J;  4L74 A;  1PFI A;  5APQ A;  1SQP E;  1H88 A;  1TU3 F;  5AW0 B; 
#chains in the Genus database with same CATH homology
 1G2C A;  1JY3 P;  1VDF A;  1LTG C;  3CI9 A;  3II6 A;  2A45 I;  3KYQ A;  5AVR B;  5BVZ A;  2XZR A;  5AW7 B;  1X79 B;  5CJ4 A;  1GK4 A;  1ZR4 A;  4XE5 B;  1SFC B;  3BAT A;  1NH4 A;  3HE4 B;  1T2K D;  3MGN A;  4N3Y B;  1LTJ A;  4AYC A;  1FZE A;  3HE5 A;  2YKP A;  2NPS A;  1JTH A;  5AW2 B;  1FZC A;  1YYC A;  2KLV A;  1N7S B;  1LT9 C;  4DOJ A;  2N1T B;  1Z56 A;  2J58 A;  2JJL A;  1L4A B;  1LTT C;  1GZL A;  1T3U A;  3U1C A;  1JNM A;  4O9B A;  3WMM 0;  1S9K D;  2YMY A;  1FOS E;  1N7L A;  4EIJ A;  2I1K A;  1SQX K;  2IPP A;  2OAR A;  4LGD E;  4AQR D;  2WSC H;  1JMM A;  1URQ C;  1MUU A;  2HFE D;  2P2U A;  1IC2 A;  2M3B A;  1DX7 A;  2IFM A;  1WRG A;  3NFQ A;  3HD7 C;  3RL0 C;  2ZXE B;  5AVS B;  4N78 D;  1URQ D;  1KQL A;  2OYI A;  1AQ5 A;  1RE4 A;  1RF1 A;  3UIA A;  1X9V A;  1MZ9 A;  5AVY B;  1EQ7 A;  3V2R A;  2A45 H;  2JEE A;  3A2A A;  1JY2 N;  1SLQ A;  1RE3 A;  3B5N D;  1IFN A;  1JY3 N;  3KPE A;  3MTU E;  4ZKU A;  4W80 A;  5APU A;  1W2E A;  2VRS A;  1M1J A;  3VMX A;  1LTJ C;  3VMZ A;  1A02 F;  3M06 A;  1GW4 A;  2XKM A;  1LT9 B;  3OJA B;  2O1K A;  1FZC C;  2O1J A;  2C9L Y;  3V5B A;  1HWT C;  2HPC B;  1GL2 A;  3RK2 D;  1IFD A;  1NTK K;  2Z5H A;  3VOP A;  3NXS A;  2NPS D;  4HYT B;  3A5T A;  4JYC A;  1N73 A;  1FAV A;  2CPS A;  1CZQ A;  2KP8 A;  3H32 A;  4I6M C;  4KHX A;  3LW5 H;  4C7N B;  4N6J A;  1YTZ I;  1LTI C;  3HD7 B;  5KLV K;  3RL0 B;  3P7K A;  2GUS A;  1NAF A;  1JO5 A;  2W6A A;  1T8Z A;  2H7H A;  1SP4 A;  1CI6 B;  1RF0 A;  1KIL A;  2C0X A;  3L37 A;  3EFG A;  3M9H A;  2YKO A;  2OYI C;  1H89 A;  3L4F A;  1RF1 C;  3PP5 A;  1G2C B;  1LTA C;  3NMD A;  3TK1 A;  1GDT A;  1T2K C;  2Q3I A;  2C0W A;  3O8Z A;  4WY4 D;  1FZA A;  2GM4 A;  1HVV A;  5CCH D;  1FDM A;  1FZB A;  2WWW A;  1N86 A;  1L0N K;  4I2L C;  1XTG B;  3M0A A;  2FYU K;  1FJK A;  2FXM A;  3RK3 B;  5BU8 B;  1LTJ B;  3VMY A;  1G1I A;  4GKG A;  3HE5 B;  4OH8 B;  3V2P A;  1HGV A;  1JTH B;  3GHG A;  4B86 A;  1ZR2 A;  1ZV8 A;  1XTC C;  1OXZ A;  1GL2 C;  3KQG A;  1E5W A;  2KSJ A;  2XDJ A;  4I1L A;  4WBA A;  2WPQ A;  5AW5 B;  3B8E B;  1SQV K;  2N9B A;  1ZLL A;  5AVX B;  1GL2 D;  3N7N A;  1CSB A;  2ZFC A;  1DEB A;  2L5G B;  2YNY A;  1N7S A;  3TYY A;  3V4Q A;  1NOH A;  4W7Z A;  1IJD B;  3P32 A;  2YKQ A;  1G1J A;  1NU1 K;  4WY4 A;  4GIF A;  5CCH A;  3IR9 A;  2W27 A;  3CL3 D;  5APY A;  4EOT A;  5AVW B;  3T97 A;  4ZKP A;  2OYI B;  3I5C A;  2H43 A;  2KYV A;  1RF1 B;  3V2N A;  1LWU C;  4LLH A;  3A7O A;  3B5N C;  5AW9 B;  2HLO A;  1RY3 A;  2W6B A;  2R5B A;  2QM8 A;  1KIL D;  1H8A A;  1JUN A;  2WSF H;  4JF7 A;  2XU6 A;  3EQ2 A;  3MD0 A;  1N2D C;  3HTK A;  3RK2 C;  1T3J A;  2POH A;  3TNU A;  5AW3 B;  5APX A;  3HRN A;  1L0L K;  3SWY A;  2NPS C;  3GHG C;  1SQQ K;  1M7L A;  2WPR A;  1IFJ A;  3HUS A;  2IX7 C;  1QL1 A;  5KJ7 D;  3L35 A;  1NKZ B;  2P1J A;  3E1I A;  2HYN A;  1J1D C;  3M91 A;  1WT6 A;  5AW8 B;  2WPS A;  3V2Q A;  4AUW A;  4DZO A;  1MFZ A;  2O01 H;  3H32 B;  4N78 E;  2Z4E A;  2OYH A;  1URQ B;  4GT1 A;  2FYZ A;  2PAJ A;  1SFC D;  3H6P A;  2Q5U A;  1JCD A;  2FFD A;  2BAS A;  3L36 A;  4WY4 C;  1N7S D;  5CCH C;  2N1T D;  1DH3 A;  1L4A D;  3G3Z A;  3IFM A;  2WT7 B;  3P8C E;  1JY2 O;  1J1E C;  2R3C A;  2XNX A;  1LWU B;  1RE4 C;  3B5N B;  1JCC A;  3BVH A;  2A45 G;  1JY3 O;  5AVZ B;  1GW3 A;  4C7N A;  4HH2 A;  1LTS C;  1SQB K;  5AVQ B;  5CJ0 A;  1RE3 C;  3RK2 B;  1LGH B;  2WZ7 A;  2FKW B;  5KJ7 A;  1FOS F;  2HOD A;  1M1J C;  2NPS B;  3C9I A;  3GHG B;  3M9Q A;  1FZC B;  1NWQ A;  1IK9 A;  2IFN A;  3HUS C;  5APS A;  1HUC A;  1GTW A;  2M8R A;  3VTP C;  1FJP A;  1J1D B;  5CCG D;  1SFC A;  1N73 C;  3HE4 A;  1SVF A;  3VP9 A;  2I1J A;  2Q7C A;  3MUD A;  3P8M C;  4M3L A;  4LC1 A;  5CHX A;  1JOC A;  2OYH C;  1KZU B;  2N1T A;  1YTZ T;  5APT A;  1L4A A;  2E43 A;  1NTM K;  1OWA A;  5AVU B;  2FFD C;  4WY4 B;  2MJZ A;  2WTY A;  2P7J A;  3LIE A;  1ZN5 A;  1RF0 C;  2R32 A;  1KIL C;  1LTB C;  1HTL C;  4XA4 A;  1J1E B;  4C46 A;  2C9N Y;  3TSI A;  3M0D A;  4Y99 C;  1FBM A;  1NO4 A;  4IFF A;  5AW6 B;  3VP8 A;  3U1A A;  1GD2 E;  5AW1 B;  1KFN A;  2Z5I A;  3M9B A;  5CMZ A;  3NTN A;  2WSE H;  5AVV B;  1SQP K;  2HG5 D;  3N4X A;  3HTK B;  3TNU B;  5KJ7 C;  1M1J B;  1NKN A;  1NTZ K;  3A3Y B;  3MIW A;  4IFD K;  1IFM A;  2H8P D;  5CCG A;  5APV A;  3LID A;  3HD7 D;  4IFM A;  1S9K E;  4W7Y A;  3RL0 D;  2GUV A;  2KOG A;  3HUS B;  1GL2 B;  3BAS A;  3BRT B;  1HGZ A;  3U59 A;  3VN0 A;  1J2J B;  1AFO A;  5AVT B;  1FZF A;  1KFM A;  3P8C D;  4C7R A;  1N73 B;  2XV5 A;  1SFC C;  1IO4 A;  2Q9I A;  3BRV B;  1FZG A;  3RK3 C;  3OA7 A;  3SWF A;  1HH0 A;  1X8Y A;  1HJB A;  2OYH B;  1FU1 A;  1LT9 A;  1QL2 A;  1GK6 A;  5BU5 A;  1N7S C;  4JYB A;  4RES B;  2N1T C;  2HPC A;  1L4A C;  1CW5 A;  2KB7 P;  3RK3 D;  2FFD B;  2YO3 A;  5KTB A;  1VPC A;  2PP6 A;  3CLQ A;  2YO2 A;  1KIL B;  3VYI A;  2WIT A;  4WB4 A;  1NHL A;  2P67 A;  3V4W A;  2R5D A;  4Y99 B;  5APW A;  3M0D C;  1IFI A;  2J59 M;  3OAK A;  1URQ A;  1HBW A;  2LKM A;  3KDP B;  3HD7 A;  1PFI A;  1GU4 A;  1MV8 A;  3R2P A;  5APQ A;  1H88 A;  1GU5 A;  1CI6 A;  2HOD B;  2QM7 A;  2CPB A;  1JY2 P;  2WT7 A;  5AW0 B;  2E42 A;  1LWU A;  5CCG C;  3B5N A;  1A02 J;  5AW4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...