2A45I

Crystal structure of the complex between thrombin and the central "e" region of fibrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
DNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Thrombin light chain
publication title Structural basis for sequential cleavage of fibrinopeptides upon fibrin assembly.
pubmed doi rcsb
total genus 12
structure length 40
sequence length 40
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2a45I00
1LT9B 1N73B 1M1JB 1RE3C 2A45H 3GHGC 3HUSB 3BVHA 2HPCA 1LT9A 2FFDC 1JY3O 1M1JA 1FZCC 3E1IA 2OYIB 1RF0C 1N73A 3HUSA 2H43A 2Z4EA 1LWUC 1FZEA 1FZFA 2OYIA 2OYHB 1LTJB 1LTJA 3H32B 1LT9C 2OYHA 2Q9IA 1RF1B 1N73C 1JY3P 1M1JC 1JY3N 3H32A 1RF1A 3HUSC 1JY2O 1RE4A 2A45G 2OYIC 1FZCB 1FZBA 1N86A 2HLOA 2HODB 1W2EA 1LTJC 1FZGA 3GHGB 2OYHC 1FZCA 1T3UA 2FFDB 2HODA 1RE3A 3GHGA 1JY2P 1RE4C 1JY2N 2XNXA 1RF1C 1LWUB 2FFDA 1RF0A 1LWUA 2A45I 1FZAA 2HPCB
chains in the Genus database with same CATH superfamily
3GW6A 3CX5I 3VMAA 4GODA 1K9MQ 1T2KC 1KORA 2QJPC 2BCCE 1YIJP 1KTMA 1GW4A 3CCUP 3L35A 2YKQA 3CCRP 2FXPA 1SQXJ 3VTPC 2KNCA 1OVRA 5AW4B 3H1HE 4L76A 2QIWA 1ZV8A 1ZW0A 1SLQA 1RF0A 2Y0CA 3CC7P 1YJ9P 4AQRD 2BEZF 1LTGC 5GTIE 2WSFH 3RBZA 2KXPB 3R2PA 2P1JA 2KI7B 1SQXK 4RO0A 3L75E 3TGUJ 2R32A 3B8EB 4IOIH 5AW9B 2WPRA 3I55P 5AW6B 1GZLA 1EXIA 5AW5B 3RK2B 2OYHA 2BEQD 2E76B 2ZXXA 2AXTE 2Y0EA 3OW2O 4ASVA 2B88A 3HD7B 1WRGA 2KS1B 5AVVB 1P84E 4EI2A 1R8EA 4Y28J 1YYCA 3E1IA 5APTA 2KP8A 2OYIA 5APYA 5CCHA 1SQPD 3CX5D 1S2EA 1ZRTE 1S5LX 1X0TA 4DCKA 3L74E 2PP6A 4H13C 4U3FE 2FYNC 5EFWB 1JB0J 2P67A 2IPPA 1RF0C 3KYQA 4OH8B 3GLMA 3M9HA 1E79H 2QJKC 1JOCA 4L74A 3H1KD 3CXHI 3AEBC 1L0ND 4YTPC 3C1LA 1MUUA 1SQXG 5KKZB 3CPWO 5B5EE 3O8ZA 1IK7A 3AE7C 4HJGH 3AEEC 3KDPB 5KLVE 1QVFO 2OYHC 1AA0A 2OTKE 1KILB 3GG2A 1N2DC 4OGQD 2QE7H 1KFNA 1WT6A 1L4AD 3AEAC 2W6BA 3CCJP 1JNMA 1UIIA 1HH0A 2K9JA 1HJ0A 2LXCB 5GTIH 3VYIA 3TGUG 1NYHA 1T8ZA 2IFNA 3IR9A 1SQPJ 1NTMD 4PJ0E 1NTKD 3B5ND 1BGYD 4HYTB 1VF5B 3H32B 4IL6X 2H88C 4CPGA 3SWFA 2O01J 1M56D 4N3YB 1GDTA 1U57A 3O6QB 2R3SA 1NWQA 2OYOA 2IZ1A 1GL2D 1S5LE 1KQLA 1Z56A 2QEXP 2I8DA 2CPBA 3WUVA 2YMYA 3H1KJ 2RN0A 1L0NJ 1KYOI 1G1JA 1FDIA 3HD7A 4LLHA 2KS1A 3CWBD 1EZVI 3KZIH 1SQQK 4GT1A 1DEEG 1SFCB 3NXSA 3CXHD 3KPEA 1KD1Q 3HUSC 2WSEH 2O01N 3IFMA 1K8AQ 1L0NK 1Q82Q 2ZXEB 3V4QA 3SWYA 1KB9I 2Y9YA 3PLNA 4DJGA 1NTMJ 3V2PA 1GK4A 1NTKJ 3PRJA 5APVA 2AEMA 1BGYJ 1AFOA 1JY2N 2E74B 3Q2YA 1AQ5A 2BASA 2C9NY 2R44A 2KUBA 3S4RA 2YMKA 5M1BA 2Q7CA 3S1KA 1IFJA 4WY4B 2NPSD 1JY2O 1SQPG 1NKNA 5CCGD 1NTMK 3T97B 2H7HA 3G6EP 5AVTB 1NTKK 2E76C 3M0DA 2H8PD 1K04A 1YHQP 5E79E 1JTHB 2D2CB 4DT0A 4Y99B 1KILE 3HD7C 3H1LD 1M8OB 3L36A 5APUA 3P32A 3CWBJ 2E43A 2RH0A 5DJTB 2K88A 1Y47A 1Q90D 1BSNA 1SQXE 5AVWB 1SQBD 1LP1A 1Y9BA 1KYOD 3QH9A 1OVUA 4I2LC 1L0NG 1FZEA 1EZVD 1A02J 3H32A 4LGDE 1PZQA 1OW6A 1T3UA 2WT7B 1K73Q 2JJLA 3B4SA 2RKLA 4ZKPA 3TGUE 2OGUA 5KAIH 1Q7YQ 2CPSA 1FZGA 2YKOA 1KB9D 3RL0D 1RH5B 3A5TA 3C8VA 1EXJA 1KILC 2IX7C 3M0DC 1NTKG 3CCLP 3V4WA 1VL2A 3GF7A 2RMZA 1BGYG 2ITAA 1SS1A 1KZUB 4W7ZA 2AEJA 2WPQA 3MP7B 3V2NA 3H1LJ 3WU2H 2Q6QA 1USEA 1VQ6P 1J1EB 2Z5HA 1N7SD 3RK3B 3F5HA 2P58A 2ZYAA 4IFMA 4PD4I 1SQBJ 2WSCH 3B5NB 1NH4A 1ZP0C 1H0TA 4IFDK 3NMDA 1VQMP 1VF5C 1M57D 1JY2P 1YQ4C 2FXMA 2MKVA 3CWBG 3P7KA 3M06A 3TSIA 1JCCA 1W5CE 2FBWC 3IAOA 5KAFE 1PPJD 4U7JA 3PH0A 4C7RA 3W67A 1HBWA 3T97A 1LNQA 2AEFA 1QVGO 5BU5A 2OYIB 1JTHA 2Z4EA 2WQYC 1IFNA 2R5DA 2O1KA 1NU1D 2PGDA 5AVZB 4R4MA 1IFMA 1SFCC 3RL0g 1LWUB 3MGNA 3H1ID 3WUUA 1NVOA 1SQPE 3A7OA 3CX5E 3LW5J 3L71D 3D6ZA 1NTZK 1NJIQ 4BWNA 1VQ7P 1BCCD 1PIXA 3UIAA 1OZHA 1ZR2A 2WT7A 1VQNP 1T6AA 1M1JA 5H2FH 1KC8Q 3CC4P 2E74C 4GOFA 1EC5A 1S3JA 4PD4D 1L0NE 4WY4C 2NPSB 1H8AA 2NRGA 3A0HE 1SQBG 4GOEA 3D6YA 2ZT9D 1YTZT 1DIPA 3R4YA 4W80A 2K9JB 3BCCD 3MZWB 4WB4A 2D2CC 4Y99C 1RF1A 3WUTA 2K3RA 1HUCA 2IZ0A 1VQPP 1AJYA 1NHLA 1SQVD 2A45I 3GMAA 1AVYA 1LTIC 1BE3D 4IFFA 3BVHA 2L91A 1NU1J 1JY3O 1VQ5P 3RK3E 1S72P 2N1TD 4YPCA 3H1IJ 5CBNA 1JMMA 2YXQB 1RY3A 3B5NA 3V2RA 5KAFH 5APSA 1OXZA 3K5BA 3L71J 1NTKE 3FWNA 4UB6H 4M3LA 4WWIA 1BGYE 2B89A 1LT9B 1BCCJ 5APWA 1VPCA 2KOGA 3E7KA 1E5WA 5AVYB 1HJBA 1NU1K 1T2KD 3P8MC 3IN6A 2Z5IA 1OW8A 2YXRB 1RHZB 1HGVA 1SVFA 3RL0B 3F89A 3II6A 2YKPA 4MN4C 1OX3A 1NAYA 1PP9G 1FC2C 3M0AA 3AEFC 3CWBE 2IDBA 2Q1KA 3BCCJ 3NTNA 2A06D 2O01H 1LWUA 5AW0B 4H44D 3CXHE 1J1EC 4Z1MH 1SQQD 4EIJA 3RK3C 1QEXA 1SQVJ 3GF3A 1L2PA 2GA1A 3AE4C 4K35A 1BE3J 1RE4A 1QX8A 1IFIA 4YXWH 1XTGB 3A0HH 3B5NC 4PV1B 3JCUE 3FGAD 2V7QH 1RQVA 1URQB 3H6PA 3Q5PA 1SQVK 2BCCD 1OVVA 1NU1G 2M5AA 3QWOC 2NPSA 1S9KE 2E75B 2XV5A 5CCGA 3FXEA 1R5LA 4KT0J 2WSFJ 1Y8AA 3BATA 3L71G 4NPEA 3L70D 2OYIC 2KK7A 4I1LA 2C9LY 3FX0A 2E5YA 5CCHC 1BCCG 1LP1B 1HWTC 4L75A 4B86A 4LC1A 3H1HD 2CK3H 1LWUC 1LTJA 1SQBE 2WWWA 1EDLA 1K05A 3G9RA 3HE5B 1EDIA 3EFGA 4QMAA 1KYOE 1W2EA 2P2UA 2AXTH 3AE9C 1SQQJ 1RE4C 2R5BA 5B66E 1NOHA 2W83C 4DOJA 3V2QA 5KTBA 1P84H 3CCVP 1N73B 1LT9A 3HTKB 3D71A 1VDFA 3BCCG 1N86A 2SPZA 1KV4A 4HKZH 2XNXA 3CCMP 1CSBA 1QLED 1NGMB 1SQVG 2UWJE 1MV8A 2NPSC 2BCCJ 1YJWP 1BE3G 2VRSA 2XDJA 4I6MC 2ZT9B 5GTHE 3L72D 1LT1A 1XTCC 3Q1MA 1N7LA 5CHXA 1FS0E 4EDFA 2QJYB 3ABVC 1GK6A 5CMZA 1KFMA 2WVRA 1X22A 3L70J 3WMM0 3L74D 3JCUH 2LXBA 4U3FD 5B5EH 1N7SA 1H0TB 2YO3A 3H1HJ 1FZCB 2N1TB 3PJSK 2JDIH 4DZOA 1ZN5A 1PP9E 4W7YA 4O9BA 2G8YA 4XE5B 4ZNCA 1ZXGA 4EOTA 4ZKUA 3P8CE 1LT9C 2M3BA 5KJ7D 3G4SP 1URQA 3V5BA 1DX7A 1RE3A 3RK2C 2B9BA 4RJTA 3Q5RA 2QJPB 4PJ0H 2ZAEB 2FYUD 2IBZI 2MJZA 4KJMA 4IL6E 3RL0C 1SQQG 1SP4A 3OJAB 4D6TD 1KYOH 1PGOA 1VQ8P 4TT3H 3L72J 2IYPA 3Q5SA 3H1KG 1YI2P 1NU1E 4H44B 1M90Q 1S5LH 3VMXA 2A45G 3H1IE 1U7JA 3MUDA 4L73A 3HE5A 4U3FJ 2FFDB 2ZYGA 3VMYA 1QGKB 4EYYQ 3L71E 5KLIB 1H88A 1J2JB 1M1JB 1N73A 5CBOA 2KIKA 3VMZA 1BCCE 1IO4A 3HTKA 4PV1C 5GTHH 2WSEJ 1FOSE 3CMAP 3L70G 5KKZC 1TU3F 1NTZD 3JC22 1URQC 2H89C 1FU1A 3MHVA 4NPDA 2B87B 1NTMG 2E76D 3L73D 1M7LA 4OGQB 4PD4E 2K37A 2E75C 1RF1B 2W8ZA 1L4AB 2LR2A 2FYUJ 1AV1A 4C46A 1Q86Q 2N9BA 4D6TJ 3BCCE 3VN0A 1J1DB 2PFXA 3VP8A 3LIEA 1SQVE 2IBZD 4JPZB 1FZCA 1BE3E 1G1IA 3AEGC 3GHGA 2N1TA 2QA4P 1LGHB 3MUDC 4XA4A 4WBAA 2FYUK 3CC2P 2JWAA 5E79H 1L0LD 3IF4A 3AE6C 3SFDC 3KHUA 4IL6H 1N73C 2W6AA 3L72G 1GL2B 3BASA 1EDJA 3TNUB 4H0LD 3FWLA 1WMKA 1EQ7A 3AE8C 2W90A 2J58A 1DEBA 1NTZJ 3A2AA 1KILD 2WMMA 3KXDA 3CMEP 2WSSH 2KB7P 3MIWA 2KLVA 2HODB 3L73J 1DH3A 2ZT9C 1KQGB 2J59M 2ZJSE 1AVOA 1PL5A 4UB8E 1OFCX 2QJYC 4RKUJ 4ZMDA 1YITP 2XZRA 3ZDMA 3MD0A 1AQTA 3U59A 1PV3A 1G2CB 2FFDA 2GUSA 5TISE 1A02F 1SQQE 2FKWB 1FZCC 1VF5D 2N1TC 1HGZA 3L4FA 2J5UA 5AVUB 3RBXA 4PD4H 1JCDA 3W68A 2FYUG 4RESB 3C9IA 3HE4B 3H1LG 3PTZA 2Y9ZA 1PGQA 1YQ3C 1L0LJ 3H1KE 4D6TG 3USSA 2M5AB 3U1AA 5AW1B 1FZAA 2GUVA 2M3EA 2WSCJ 2HG5D 2B87A 2ZVOB 1VQ9P 2Q9IA 1JY3N 3H25A 1EZVG 1BDCA 2HLOA 1L4AA 3TF5A 2JWDA 3VP9A 1LTTC 1L0LK 3N7NA 4TLFA 3RGUA 3N4XA 3HUSB 1SFCD 1YBKA 1MKMA 3L70E 4BXLA 2KLUA 1YJNP 1KQSO 1LTJB 1GU5A 1R5SA 1H89A 3BRVB 1NTME 3BRTB 4H44C 3B71A 3SSUA 5BVZA 1FDOA 1NTZG 4OVNF 2XU6A 1HF9A 2O3JA 1FJPA 1VQOP 3U1CA 2FFDC 2C0XA 2H43A 2JP3A 3L73G 5KLIC 5L8RJ 5DJUB 1M1JC 1RQUA 2E74D 4XFJA 3H1JD 1QL2A 1GL2A 3M9BA 3CLQA 3I5CA 3TNUA 3CD6P 2ZVNB 4WY4D 1T3JA 4UB8H 1ZMEC 3CX5H 1LTBC 1YTZI 2LKMA 3D70A 4OGQC 2D2CD 2HODA 2IBZG 1RF1C 3A3YB 1L4AC 1D7MA 5TISH 3L72E 3CCEP 5AVRB 4R4LA 4N78D 1N7SB 2W27A 3AE5C 1L0LG 1LTSC 2JEEA 1J1DC 2YNYA 2WITA 3V6IA 1Q2NA 2WZ7A 1P84I 1PPJG 3KZIE 1JEKA 1IZNB 1G2CA 2HPCB 2A45H 3TK1A 1QL1A 3PHLA 1FE6A 3AEDC 4KHXA 1IC2A 4C7NB 3HE4A 2YIUB 5KJ7A 1GL2C 2IYOA 5TJHA 5APQA 4H0LB 1JUNA 3H1JJ 3H1IG 1MFZA 1FBMA 1FJKA 3PP5A 1JY3P 2OARA 3A0BE 2FYUE 4AYCA 3ITKA 2WPVB 3H1LE 2P7JA 4A7PA 3MTUE 2Q3IA 3HUSA 4D6TE 4H13D 3CL3D 1FZFA 2KZJA 5CJ4A 2G3AA 5APXA 5AVQB 3RK3D 1VQ4P 1EZVE 2KSJA 3L75D 1VQKP 4OWFA 2E42A 3G3ZA 1ZOYC 3NFQA 1FZBA 3AE1C 1LTAC 1KN7A 3EWKA 1FOSF 2FY8A 1CI6B 5KJ7C 1SQPK 3CXHH 3M91A 1UIXA 1P84D 4HB1A 4I7ZB 1OMIA 5CCGC 1NTZE 1KB9E 2XNDH 1GU4A 1BSHA 2JO1A 2AXCA 3S9OA 1U7MA 3OA7A 3L73E 2ZFCA 4JYCA 2QM7A 1ZRTD 5CCHD 3VOPA 2V7QJ 1JO5A 2ZYDA 2QSIA 5KAIE 2FYZA 1FAVA 5AW7B 1LTJC 3GHGB 3HRNA 3H1JG 3M9QA 2C0WA 2HPCA 2IBZE 2K9YA 2JKVA 4C7NA 3WU2E 1Q81Q 3L75J 1CW5A 2R3CA 3A0BH 1OW7A 2HFED 1L0LE 5KLVD 2IFMA 2KZIA 4WVZA 2A06G 3CCSP 1PGJA 1S9KD 1PPJE 3OAKA 2WTYA 1LJ2A 4N6JA 4BRYB 1X79B 2M0BA 2Q5UA 1KILA 4AUWA 5B66H 2V4HA 4GDOA 4JBZA 1NKZB 3L37A 3I56P 3KQGA 3CI9A 1GTWA 3LIDA 3L74J 2W6JH 1N7SC 1ZR4A 2POHA 1KMIZ 1CZQA 2BCCG 5C39A 1JMBA 1GD2E 4YXDC 3EFFK 2Q3EA 3SFEC 1BDDA 4GIFA 1KB9H 2HYNA 1GW3A 2KSEA 3E1RA 1N8RQ 2K1AA 1X8YA 2M8RA 2JR8A 1JM0A 2QVAA 1EDKA 5AW3B 2HR3A 2QG4A 1RE3C 3O6QA 1HVVA 3RK2D 2OTJP 4NPFX 5AVXB 1CI6A 2YIUC 3H1HG 5KLVJ 2PRRA 3LW5H 4H0LC 3HD7D 1VQLP 1FDMA 1ZLLA 1GMJA 3TDKA 2I1KA 1USDA 2O1JA 1KQFB 4JYBA 2E5TA 5H2FE 3CCQP 1DD4A 2PAJA 4ASWA 2GM4A 3FXDA 3SWKA 2KNCB 3L75G 1SFCA 4H13B 2FYNB 3AE2C 5CJ0A 5KLVK 1NAFA 5K5GB 2QM8A 1PP9D 1IK9A 1PGPA 2P10A 3G71P 2QJKB 1NO4A 3P8CD 4PV1D 2OTLP 2OQQA 3EQ2A 4HH2A 4JQ0D 3JSVC 2NZ2A 1URQD 1OWAA 1MZ9A 3L74G 2OYHB 3H1JE 1OIPA 4U3FG 4WY4A 1SQBK 5AW2B 1IFPA 1IJDB 3Q3DA 4UB6E 2E75D 4I7ZC 4BRYA 5AVSB 1S4XA 1SQXD 5BU8B 1S1CX 1M1KQ 2QRXA 1X9VA 5AW8B 2I1JA 2KYVA 1HTLC 2A06E 4GKGA 2FXOA 3AE3C 4JF7A 4N78E 2N9YB 4K3AA 3TYYA 2XKMA 2L5GB 3GHGC 1IFDA 5KLVG 2YO2A 3AECC 3TGUD 2Y0DA 2WPSA 1PP9J 2DW3A 1W2BO 1MFTA 1DD3A 1PFIA
chains in the Genus database with same CATH topology
2A45H 3TK1A 1QL1A 1KILC 2IX7C 3M0DC 1T2KC 3V4WA 4KHXA 1IC2A 1N7SA 2YO3A 4C7NB 3HE4A 1FZCB 1KZUB 4W7ZA 2WPQA 3V2NA 2N1TB 4DZOA 1ZN5A 5KJ7A 1J1EB 4W7YA 2Z5HA 1N7SD 3RK3B 1GL2C 1GW4A 4O9BA 5APQA 4XE5B 4IFMA 1JUNA 3L35A 1MFZA 1FBMA 2YKQA 4EOTA 4ZKUA 3P8CE 1FJKA 1LT9C 2M3BA 2WSCH 3PP5A 5KJ7D 1JY3P 3B5NB 1NH4A 3VTPC 2OARA 1URQA 3V5BA 3NMDA 4IFDK 1DX7A 1RE3A 5AW4B 3RK2C 1JY2P 4AYCA 1ZV8A 1SLQA 1RF0A 2P7JA 2FXMA 3MTUE 2Q3IA 3P7KA 3M06A 3TSIA 3HUSA 1FZFA 3CL3D 2MJZA 1JCCA 4AQRD 1LTGC 3RL0C 5CJ4A 1SP4A 3OJAB 5APXA 2WSFH 5AVQB 3RK3D 3R2PA 2P1JA 4C7RA 1SQXK 3WMM0 1HBWA 3T97A 2R32A 3B8EB 5BU5A 5AW9B 2WPRA 5AW6B 2OYIB 1JTHA 1GZLA 2Z4EA 2KSJA 5AW5B 1IFNA 2E42A 3RK2B 3G3ZA 2OYHA 3NFQA 3VMXA 2R5DA 2O1KA 2A45G 1FZBA 3MUDA 3HE5A 5AVZB 1IFMA 1LTAC 2FFDB 3VMYA 3HD7B 1SFCC 1WRGA 1FOSF 1LWUB 5AVVB 3MGNA 1H88A 1J2JB 1CI6B 1M1JB 5KJ7C 1YYCA 3A7OA 1SQPK 3E1IA 5APTA 3M91A 1N73A 2KP8A 3VMZA 5APYA 2OYIA 1IO4A 3HTKA 5CCHA 5CCGC 1NTZK 1GU4A 1FOSE 3UIAA 1ZR2A 3OA7A 1URQC 2PP6A 2ZFCA 2WT7A 4JYCA 2QM7A 5CCHD 1FU1A 3VOPA 2P67A 1JO5A 2IPPA 1M1JA 1RF0C 1M7LA 3KYQA 4OH8B 2FYZA 1FAVA 1RF1B 3M9HA 1L4AB 5AW7B 1LTJC 3GHGB 1JOCA 3HRNA 4WY4C 4C46A 2NPSB 1H8AA 3M9QA 2N9BA 2C0WA 3VN0A 2HPCA 1MUUA 1YTZT 1J1DB 3O8ZA 4W80A 4WB4A 3VP8A 3LIEA 4Y99C 1RF1A 1HUCA 4C7NA 3KDPB 2OYHC 1FZCA 1G1IA 1KILB 3GHGA 2N1TA 2R3CA 1CW5A 1NHLA 2HFED 1N2DC 1LGHB 4XA4A 4WBAA 2FYUK 2A45I 1LTIC 4IFFA 2IFMA 3BVHA 1KFNA 1JY3O 1WT6A 1L4AD 2W6BA 1S9KD 1JNMA 2N1TD 3OAKA 2WTYA 1HH0A 1N73C 2W6AA 1JMMA 3VYIA 1GL2B 3BASA 1RY3A 4N6JA 3B5NA 3V2RA 5APSA 1OXZA 1X79B 1T8ZA 3TNUB 2IFNA 2Q5UA 1KILA 4M3LA 3IR9A 4AUWA 1EQ7A 1LT9B 1NKZB 2J58A 5APWA 3L37A 1VPCA 1DEBA 2KOGA 3B5ND 3KQGA 3A2AA 4HYTB 3CI9A 1E5WA 5AVYB 3H32B 1HJBA 1KILD 1NU1K 1GTWA 1T2KD 3P8MC 3LIDA 2KB7P 3MIWA 2KLVA 1N7SC 2HODB 1ZR4A 3SWFA 1DH3A 2Z5IA 2POHA 4N3YB 1CZQA 2J59M 1HGVA 1SVFA 1GDTA 3RL0B 3II6A 1NWQA 1GD2E 2YKPA 1GL2D 1KQLA 1Z56A 2CPBA 4GIFA 2HYNA 1GW3A 2YMYA 2XZRA 1X8YA 3M0AA 1G1JA 2M8RA 3MD0A 3U59A 1G2CB 2FFDA 2GUSA 3HD7A 4LLHA 3NTNA 1A02F 2FKWB 2O01H 1LWUA 5AW0B 5AW3B 1FZCC 1SQQK 2N1TC 4GT1A 1RE3C 3RK2D 1HVVA 1HGZA 3L4FA 5AVXB 1CI6A 5AVUB 1J1EC 4EIJA 1JCDA 3RK3C 4RESB 3C9IA 3HE4B 1SFCB 3NXSA 3KPEA 3LW5H 3HD7D 3HUSC 1FDMA 1RE4A 1ZLLA 2WSEH 2I1KA 3IFMA 1IFIA 3U1AA 2O1JA 1L0NK 1XTGB 3B5NC 5AW1B 4JYBA 1FZAA 2GUVA 2ZXEB 2HG5D 3V4QA 3SWYA 2PAJA 2GM4A 2Q9IA 1URQB 1JY3N 3V2PA 1SFCA 3H6PA 1GK4A 1SQVK 2HLOA 5CJ0A 1L4AA 5APVA 5KLVK 1AFOA 1NAFA 1JY2N 3VP9A 2BASA 2NPSA 1AQ5A 1LTTC 2C9NY 1L0LK 3N7NA 1S9KE 2XV5A 3N4XA 2QM8A 5CCGA 3HUSB 1SFCD 1IK9A 2Q7CA 1LTJB 1IFJA 3BATA 4WY4B 1GU5A 1H89A 2NPSD 1NO4A 3BRVB 1JY2O 2OYIC 4I1LA 3P8CD 2C9LY 1NKNA 5CCGD 3BRTB 5CCHC 1NTMK 5BVZA 2H7HA 5AVTB 1NTKK 1HWTC 3M0DA 2XU6A 2H8PD 3EQ2A 4LC1A 4B86A 4HH2A 1FJPA 1JTHB 1URQD 4Y99B 3U1CA 2FFDC 3HD7C 1OWAA 2C0XA 1MZ9A 3L36A 2H43A 1LWUC 5APUA 2OYHB 1LTJA 3P32A 2E43A 4WY4A 1M1JC 1SQBK 2WWWA 5AW2B 3HE5B 3EFGA 1IJDB 1W2EA 1QL2A 1GL2A 2P2UA 5AVWB 3M9BA 1RE4C 3CLQA 2R5BA 3I5CA 5AVSB 1NOHA 4DOJA 3TNUA 3V2QA 5KTBA 4WY4D 1N73B 1T3JA 1LT9A 5BU8B 3HTKB 4I2LC 1FZEA 1LTBC 1VDFA 1A02J 1YTZI 1X9VA 3H32A 2LKMA 4LGDE 5AW8B 2I1JA 1N86A 2KYVA 1HTLC 1T3UA 2WT7B 2HODA 2JJLA 4GKGA 2XNXA 4JF7A 1RF1C 3A3YB 4N78E 1CSBA 1L4AC 3TYYA 2XKMA 2L5GB 3GHGC 4ZKPA 1IFDA 2YO2A 1MV8A 2NPSC 5AVRB 4N78D 1N7SB 2VRSA 2W27A 2XDJA 4I6MC 1XTCC 1N7LA 2WPSA 1LTSC 2JEEA 1J1DC 2YNYA 2CPSA 5CHXA 1FZGA 2WITA 2YKOA 3RL0D 2WZ7A 1GK6A 5CMZA 1KFMA 3A5TA 1G2CA 2HPCB 1PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 B;  1N73 B;  1M1J B;  1RE3 C;  2A45 H;  3GHG C;  3HUS B;  3BVH A;  2HPC A;  1LT9 A;  2FFD C;  1JY3 O;  1M1J A;  1FZC C;  3E1I A;  2OYI B;  1RF0 C;  1N73 A;  3HUS A;  2H43 A;  2Z4E A;  1LWU C;  1FZE A;  1FZF A;  2OYI A;  2OYH B;  1LTJ B;  1LTJ A;  3H32 B;  1LT9 C;  2OYH A;  2Q9I A;  1RF1 B;  1N73 C;  1JY3 P;  1M1J C;  1JY3 N;  3H32 A;  1RF1 A;  3HUS C;  1JY2 O;  1RE4 A;  2A45 G;  2OYI C;  1FZC B;  1FZB A;  1N86 A;  2HLO A;  2HOD B;  1W2E A;  1LTJ C;  1FZG A;  3GHG B;  2OYH C;  1FZC A;  1T3U A;  2FFD B;  2HOD A;  1RE3 A;  3GHG A;  1JY2 P;  1RE4 C;  1JY2 N;  2XNX A;  1RF1 C;  1LWU B;  2FFD A;  1RF0 A;  1LWU A;  2A45 I;  1FZA A;  2HPC B; 
#chains in the Genus database with same CATH topology
 3GW6 A;  3CX5 I;  3VMA A;  4GOD A;  1K9M Q;  1T2K C;  1KOR A;  2QJP C;  2BCC E;  1YIJ P;  1KTM A;  1GW4 A;  3CCU P;  3L35 A;  2YKQ A;  3CCR P;  2FXP A;  1SQX J;  3VTP C;  2KNC A;  1OVR A;  5AW4 B;  3H1H E;  4L76 A;  2QIW A;  1ZV8 A;  1ZW0 A;  1SLQ A;  1RF0 A;  2Y0C A;  3CC7 P;  1YJ9 P;  4AQR D;  2BEZ F;  1LTG C;  5GTI E;  2WSF H;  3RBZ A;  2KXP B;  3R2P A;  2P1J A;  2KI7 B;  1SQX K;  4RO0 A;  3L75 E;  3TGU J;  2R32 A;  3B8E B;  4IOI H;  5AW9 B;  2WPR A;  3I55 P;  5AW6 B;  1GZL A;  1EXI A;  5AW5 B;  3RK2 B;  2OYH A;  2BEQ D;  2E76 B;  2ZXX A;  2AXT E;  2Y0E A;  3OW2 O;  4ASV A;  2B88 A;  3HD7 B;  1WRG A;  2KS1 B;  5AVV B;  1P84 E;  4EI2 A;  1R8E A;  4Y28 J;  1YYC A;  3E1I A;  5APT A;  2KP8 A;  2OYI A;  5APY A;  5CCH A;  1SQP D;  3CX5 D;  1S2E A;  1ZRT E;  1S5L X;  1X0T A;  4DCK A;  3L74 E;  2PP6 A;  4H13 C;  4U3F E;  2FYN C;  5EFW B;  1JB0 J;  2P67 A;  2IPP A;  1RF0 C;  3KYQ A;  4OH8 B;  3GLM A;  3M9H A;  1E79 H;  2QJK C;  1JOC A;  4L74 A;  3H1K D;  3CXH I;  3AEB C;  1L0N D;  4YTP C;  3C1L A;  1MUU A;  1SQX G;  5KKZ B;  3CPW O;  5B5E E;  3O8Z A;  1IK7 A;  3AE7 C;  4HJG H;  3AEE C;  3KDP B;  5KLV E;  1QVF O;  2OYH C;  1AA0 A;  2OTK E;  1KIL B;  3GG2 A;  1N2D C;  4OGQ D;  2QE7 H;  1KFN A;  1WT6 A;  1L4A D;  3AEA C;  2W6B A;  3CCJ P;  1JNM A;  1UII A;  1HH0 A;  2K9J A;  1HJ0 A;  2LXC B;  5GTI H;  3VYI A;  3TGU G;  1NYH A;  1T8Z A;  2IFN A;  3IR9 A;  1SQP J;  1NTM D;  4PJ0 E;  1NTK D;  3B5N D;  1BGY D;  4HYT B;  1VF5 B;  3H32 B;  4IL6 X;  2H88 C;  4CPG A;  3SWF A;  2O01 J;  1M56 D;  4N3Y B;  1GDT A;  1U57 A;  3O6Q B;  2R3S A;  1NWQ A;  2OYO A;  2IZ1 A;  1GL2 D;  1S5L E;  1KQL A;  1Z56 A;  2QEX P;  2I8D A;  2CPB A;  3WUV A;  2YMY A;  3H1K J;  2RN0 A;  1L0N J;  1KYO I;  1G1J A;  1FDI A;  3HD7 A;  4LLH A;  2KS1 A;  3CWB D;  1EZV I;  3KZI H;  1SQQ K;  4GT1 A;  1DEE G;  1SFC B;  3NXS A;  3CXH D;  3KPE A;  1KD1 Q;  3HUS C;  2WSE H;  2O01 N;  3IFM A;  1K8A Q;  1L0N K;  1Q82 Q;  2ZXE B;  3V4Q A;  3SWY A;  1KB9 I;  2Y9Y A;  3PLN A;  4DJG A;  1NTM J;  3V2P A;  1GK4 A;  1NTK J;  3PRJ A;  5APV A;  2AEM A;  1BGY J;  1AFO A;  1JY2 N;  2E74 B;  3Q2Y A;  1AQ5 A;  2BAS A;  2C9N Y;  2R44 A;  2KUB A;  3S4R A;  2YMK A;  5M1B A;  2Q7C A;  3S1K A;  1IFJ A;  4WY4 B;  2NPS D;  1JY2 O;  1SQP G;  1NKN A;  5CCG D;  1NTM K;  3T97 B;  2H7H A;  3G6E P;  5AVT B;  1NTK K;  2E76 C;  3M0D A;  2H8P D;  1K04 A;  1YHQ P;  5E79 E;  1JTH B;  2D2C B;  4DT0 A;  4Y99 B;  1KIL E;  3HD7 C;  3H1L D;  1M8O B;  3L36 A;  5APU A;  3P32 A;  3CWB J;  2E43 A;  2RH0 A;  5DJT B;  2K88 A;  1Y47 A;  1Q90 D;  1BSN A;  1SQX E;  5AVW B;  1SQB D;  1LP1 A;  1Y9B A;  1KYO D;  3QH9 A;  1OVU A;  4I2L C;  1L0N G;  1FZE A;  1EZV D;  1A02 J;  3H32 A;  4LGD E;  1PZQ A;  1OW6 A;  1T3U A;  2WT7 B;  1K73 Q;  2JJL A;  3B4S A;  2RKL A;  4ZKP A;  3TGU E;  2OGU A;  5KAI H;  1Q7Y Q;  2CPS A;  1FZG A;  2YKO A;  1KB9 D;  3RL0 D;  1RH5 B;  3A5T A;  3C8V A;  1EXJ A;  1KIL C;  2IX7 C;  3M0D C;  1NTK G;  3CCL P;  3V4W A;  1VL2 A;  3GF7 A;  2RMZ A;  1BGY G;  2ITA A;  1SS1 A;  1KZU B;  4W7Z A;  2AEJ A;  2WPQ A;  3MP7 B;  3V2N A;  3H1L J;  3WU2 H;  2Q6Q A;  1USE A;  1VQ6 P;  1J1E B;  2Z5H A;  1N7S D;  3RK3 B;  3F5H A;  2P58 A;  2ZYA A;  4IFM A;  4PD4 I;  1SQB J;  2WSC H;  3B5N B;  1NH4 A;  1ZP0 C;  1H0T A;  4IFD K;  3NMD A;  1VQM P;  1VF5 C;  1M57 D;  1JY2 P;  1YQ4 C;  2FXM A;  2MKV A;  3CWB G;  3P7K A;  3M06 A;  3TSI A;  1JCC A;  1W5C E;  2FBW C;  3IAO A;  5KAF E;  1PPJ D;  4U7J A;  3PH0 A;  4C7R A;  3W67 A;  1HBW A;  3T97 A;  1LNQ A;  2AEF A;  1QVG O;  5BU5 A;  2OYI B;  1JTH A;  2Z4E A;  2WQY C;  1IFN A;  2R5D A;  2O1K A;  1NU1 D;  2PGD A;  5AVZ B;  4R4M A;  1IFM A;  1SFC C;  3RL0 g;  1LWU B;  3MGN A;  3H1I D;  3WUU A;  1NVO A;  1SQP E;  3A7O A;  3CX5 E;  3LW5 J;  3L71 D;  3D6Z A;  1NTZ K;  1NJI Q;  4BWN A;  1VQ7 P;  1BCC D;  1PIX A;  3UIA A;  1OZH A;  1ZR2 A;  2WT7 A;  1VQN P;  1T6A A;  1M1J A;  5H2F H;  1KC8 Q;  3CC4 P;  2E74 C;  4GOF A;  1EC5 A;  1S3J A;  4PD4 D;  1L0N E;  4WY4 C;  2NPS B;  1H8A A;  2NRG A;  3A0H E;  1SQB G;  4GOE A;  3D6Y A;  2ZT9 D;  1YTZ T;  1DIP A;  3R4Y A;  4W80 A;  2K9J B;  3BCC D;  3MZW B;  4WB4 A;  2D2C C;  4Y99 C;  1RF1 A;  3WUT A;  2K3R A;  1HUC A;  2IZ0 A;  1VQP P;  1AJY A;  1NHL A;  1SQV D;  2A45 I;  3GMA A;  1AVY A;  1LTI C;  1BE3 D;  4IFF A;  3BVH A;  2L91 A;  1NU1 J;  1JY3 O;  1VQ5 P;  3RK3 E;  1S72 P;  2N1T D;  4YPC A;  3H1I J;  5CBN A;  1JMM A;  2YXQ B;  1RY3 A;  3B5N A;  3V2R A;  5KAF H;  5APS A;  1OXZ A;  3K5B A;  3L71 J;  1NTK E;  3FWN A;  4UB6 H;  4M3L A;  4WWI A;  1BGY E;  2B89 A;  1LT9 B;  1BCC J;  5APW A;  1VPC A;  2KOG A;  3E7K A;  1E5W A;  5AVY B;  1HJB A;  1NU1 K;  1T2K D;  3P8M C;  3IN6 A;  2Z5I A;  1OW8 A;  2YXR B;  1RHZ B;  1HGV A;  1SVF A;  3RL0 B;  3F89 A;  3II6 A;  2YKP A;  4MN4 C;  1OX3 A;  1NAY A;  1PP9 G;  1FC2 C;  3M0A A;  3AEF C;  3CWB E;  2IDB A;  2Q1K A;  3BCC J;  3NTN A;  2A06 D;  2O01 H;  1LWU A;  5AW0 B;  4H44 D;  3CXH E;  1J1E C;  4Z1M H;  1SQQ D;  4EIJ A;  3RK3 C;  1QEX A;  1SQV J;  3GF3 A;  1L2P A;  2GA1 A;  3AE4 C;  4K35 A;  1BE3 J;  1RE4 A;  1QX8 A;  1IFI A;  4YXW H;  1XTG B;  3A0H H;  3B5N C;  4PV1 B;  3JCU E;  3FGA D;  2V7Q H;  1RQV A;  1URQ B;  3H6P A;  3Q5P A;  1SQV K;  2BCC D;  1OVV A;  1NU1 G;  2M5A A;  3QWO C;  2NPS A;  1S9K E;  2E75 B;  2XV5 A;  5CCG A;  3FXE A;  1R5L A;  4KT0 J;  2WSF J;  1Y8A A;  3BAT A;  3L71 G;  4NPE A;  3L70 D;  2OYI C;  2KK7 A;  4I1L A;  2C9L Y;  3FX0 A;  2E5Y A;  5CCH C;  1BCC G;  1LP1 B;  1HWT C;  4L75 A;  4B86 A;  4LC1 A;  3H1H D;  2CK3 H;  1LWU C;  1LTJ A;  1SQB E;  2WWW A;  1EDL A;  1K05 A;  3G9R A;  3HE5 B;  1EDI A;  3EFG A;  4QMA A;  1KYO E;  1W2E A;  2P2U A;  2AXT H;  3AE9 C;  1SQQ J;  1RE4 C;  2R5B A;  5B66 E;  1NOH A;  2W83 C;  4DOJ A;  3V2Q A;  5KTB A;  1P84 H;  3CCV P;  1N73 B;  1LT9 A;  3HTK B;  3D71 A;  1VDF A;  3BCC G;  1N86 A;  2SPZ A;  1KV4 A;  4HKZ H;  2XNX A;  3CCM P;  1CSB A;  1QLE D;  1NGM B;  1SQV G;  2UWJ E;  1MV8 A;  2NPS C;  2BCC J;  1YJW P;  1BE3 G;  2VRS A;  2XDJ A;  4I6M C;  2ZT9 B;  5GTH E;  3L72 D;  1LT1 A;  1XTC C;  3Q1M A;  1N7L A;  5CHX A;  1FS0 E;  4EDF A;  2QJY B;  3ABV C;  1GK6 A;  5CMZ A;  1KFM A;  2WVR A;  1X22 A;  3L70 J;  3WMM 0;  3L74 D;  3JCU H;  2LXB A;  4U3F D;  5B5E H;  1N7S A;  1H0T B;  2YO3 A;  3H1H J;  1FZC B;  2N1T B;  3PJS K;  2JDI H;  4DZO A;  1ZN5 A;  1PP9 E;  4W7Y A;  4O9B A;  2G8Y A;  4XE5 B;  4ZNC A;  1ZXG A;  4EOT A;  4ZKU A;  3P8C E;  1LT9 C;  2M3B A;  5KJ7 D;  3G4S P;  1URQ A;  3V5B A;  1DX7 A;  1RE3 A;  3RK2 C;  2B9B A;  4RJT A;  3Q5R A;  2QJP B;  4PJ0 H;  2ZAE B;  2FYU D;  2IBZ I;  2MJZ A;  4KJM A;  4IL6 E;  3RL0 C;  1SQQ G;  1SP4 A;  3OJA B;  4D6T D;  1KYO H;  1PGO A;  1VQ8 P;  4TT3 H;  3L72 J;  2IYP A;  3Q5S A;  3H1K G;  1YI2 P;  1NU1 E;  4H44 B;  1M90 Q;  1S5L H;  3VMX A;  2A45 G;  3H1I E;  1U7J A;  3MUD A;  4L73 A;  3HE5 A;  4U3F J;  2FFD B;  2ZYG A;  3VMY A;  1QGK B;  4EYY Q;  3L71 E;  5KLI B;  1H88 A;  1J2J B;  1M1J B;  1N73 A;  5CBO A;  2KIK A;  3VMZ A;  1BCC E;  1IO4 A;  3HTK A;  4PV1 C;  5GTH H;  2WSE J;  1FOS E;  3CMA P;  3L70 G;  5KKZ C;  1TU3 F;  1NTZ D;  3JC2 2;  1URQ C;  2H89 C;  1FU1 A;  3MHV A;  4NPD A;  2B87 B;  1NTM G;  2E76 D;  3L73 D;  1M7L A;  4OGQ B;  4PD4 E;  2K37 A;  2E75 C;  1RF1 B;  2W8Z A;  1L4A B;  2LR2 A;  2FYU J;  1AV1 A;  4C46 A;  1Q86 Q;  2N9B A;  4D6T J;  3BCC E;  3VN0 A;  1J1D B;  2PFX A;  3VP8 A;  3LIE A;  1SQV E;  2IBZ D;  4JPZ B;  1FZC A;  1BE3 E;  1G1I A;  3AEG C;  3GHG A;  2N1T A;  2QA4 P;  1LGH B;  3MUD C;  4XA4 A;  4WBA A;  2FYU K;  3CC2 P;  2JWA A;  5E79 H;  1L0L D;  3IF4 A;  3AE6 C;  3SFD C;  3KHU A;  4IL6 H;  1N73 C;  2W6A A;  3L72 G;  1GL2 B;  3BAS A;  1EDJ A;  3TNU B;  4H0L D;  3FWL A;  1WMK A;  1EQ7 A;  3AE8 C;  2W90 A;  2J58 A;  1DEB A;  1NTZ J;  3A2A A;  1KIL D;  2WMM A;  3KXD A;  3CME P;  2WSS H;  2KB7 P;  3MIW A;  2KLV A;  2HOD B;  3L73 J;  1DH3 A;  2ZT9 C;  1KQG B;  2J59 M;  2ZJS E;  1AVO A;  1PL5 A;  4UB8 E;  1OFC X;  2QJY C;  4RKU J;  4ZMD A;  1YIT P;  2XZR A;  3ZDM A;  3MD0 A;  1AQT A;  3U59 A;  1PV3 A;  1G2C B;  2FFD A;  2GUS A;  5TIS E;  1A02 F;  1SQQ E;  2FKW B;  1FZC C;  1VF5 D;  2N1T C;  1HGZ A;  3L4F A;  2J5U A;  5AVU B;  3RBX A;  4PD4 H;  1JCD A;  3W68 A;  2FYU G;  4RES B;  3C9I A;  3HE4 B;  3H1L G;  3PTZ A;  2Y9Z A;  1PGQ A;  1YQ3 C;  1L0L J;  3H1K E;  4D6T G;  3USS A;  2M5A B;  3U1A A;  5AW1 B;  1FZA A;  2GUV A;  2M3E A;  2WSC J;  2HG5 D;  2B87 A;  2ZVO B;  1VQ9 P;  2Q9I A;  1JY3 N;  3H25 A;  1EZV G;  1BDC A;  2HLO A;  1L4A A;  3TF5 A;  2JWD A;  3VP9 A;  1LTT C;  1L0L K;  3N7N A;  4TLF A;  3RGU A;  3N4X A;  3HUS B;  1SFC D;  1YBK A;  1MKM A;  3L70 E;  4BXL A;  2KLU A;  1YJN P;  1KQS O;  1LTJ B;  1GU5 A;  1R5S A;  1H89 A;  3BRV B;  1NTM E;  3BRT B;  4H44 C;  3B71 A;  3SSU A;  5BVZ A;  1FDO A;  1NTZ G;  4OVN F;  2XU6 A;  1HF9 A;  2O3J A;  1FJP A;  1VQO P;  3U1C A;  2FFD C;  2C0X A;  2H43 A;  2JP3 A;  3L73 G;  5KLI C;  5L8R J;  5DJU B;  1M1J C;  1RQU A;  2E74 D;  4XFJ A;  3H1J D;  1QL2 A;  1GL2 A;  3M9B A;  3CLQ A;  3I5C A;  3TNU A;  3CD6 P;  2ZVN B;  4WY4 D;  1T3J A;  4UB8 H;  1ZME C;  3CX5 H;  1LTB C;  1YTZ I;  2LKM A;  3D70 A;  4OGQ C;  2D2C D;  2HOD A;  2IBZ G;  1RF1 C;  3A3Y B;  1L4A C;  1D7M A;  5TIS H;  3L72 E;  3CCE P;  5AVR B;  4R4L A;  4N78 D;  1N7S B;  2W27 A;  3AE5 C;  1L0L G;  1LTS C;  2JEE A;  1J1D C;  2YNY A;  2WIT A;  3V6I A;  1Q2N A;  2WZ7 A;  1P84 I;  1PPJ G;  3KZI E;  1JEK A;  1IZN B;  1G2C A;  2HPC B;  2A45 H;  3TK1 A;  1QL1 A;  3PHL A;  1FE6 A;  3AED C;  4KHX A;  1IC2 A;  4C7N B;  3HE4 A;  2YIU B;  5KJ7 A;  1GL2 C;  2IYO A;  5TJH A;  5APQ A;  4H0L B;  1JUN A;  3H1J J;  3H1I G;  1MFZ A;  1FBM A;  1FJK A;  3PP5 A;  1JY3 P;  2OAR A;  3A0B E;  2FYU E;  4AYC A;  3ITK A;  2WPV B;  3H1L E;  2P7J A;  4A7P A;  3MTU E;  2Q3I A;  3HUS A;  4D6T E;  4H13 D;  3CL3 D;  1FZF A;  2KZJ A;  5CJ4 A;  2G3A A;  5APX A;  5AVQ B;  3RK3 D;  1VQ4 P;  1EZV E;  2KSJ A;  3L75 D;  1VQK P;  4OWF A;  2E42 A;  3G3Z A;  1ZOY C;  3NFQ A;  1FZB A;  3AE1 C;  1LTA C;  1KN7 A;  3EWK A;  1FOS F;  2FY8 A;  1CI6 B;  5KJ7 C;  1SQP K;  3CXH H;  3M91 A;  1UIX A;  1P84 D;  4HB1 A;  4I7Z B;  1OMI A;  5CCG C;  1NTZ E;  1KB9 E;  2XND H;  1GU4 A;  1BSH A;  2JO1 A;  2AXC A;  3S9O A;  1U7M A;  3OA7 A;  3L73 E;  2ZFC A;  4JYC A;  2QM7 A;  1ZRT D;  5CCH D;  3VOP A;  2V7Q J;  1JO5 A;  2ZYD A;  2QSI A;  5KAI E;  2FYZ A;  1FAV A;  5AW7 B;  1LTJ C;  3GHG B;  3HRN A;  3H1J G;  3M9Q A;  2C0W A;  2HPC A;  2IBZ E;  2K9Y A;  2JKV A;  4C7N A;  3WU2 E;  1Q81 Q;  3L75 J;  1CW5 A;  2R3C A;  3A0B H;  1OW7 A;  2HFE D;  1L0L E;  5KLV D;  2IFM A;  2KZI A;  4WVZ A;  2A06 G;  3CCS P;  1PGJ A;  1S9K D;  1PPJ E;  3OAK A;  2WTY A;  1LJ2 A;  4N6J A;  4BRY B;  1X79 B;  2M0B A;  2Q5U A;  1KIL A;  4AUW A;  5B66 H;  2V4H A;  4GDO A;  4JBZ A;  1NKZ B;  3L37 A;  3I56 P;  3KQG A;  3CI9 A;  1GTW A;  3LID A;  3L74 J;  2W6J H;  1N7S C;  1ZR4 A;  2POH A;  1KMI Z;  1CZQ A;  2BCC G;  5C39 A;  1JMB A;  1GD2 E;  4YXD C;  3EFF K;  2Q3E A;  3SFE C;  1BDD A;  4GIF A;  1KB9 H;  2HYN A;  1GW3 A;  2KSE A;  3E1R A;  1N8R Q;  2K1A A;  1X8Y A;  2M8R A;  2JR8 A;  1JM0 A;  2QVA A;  1EDK A;  5AW3 B;  2HR3 A;  2QG4 A;  1RE3 C;  3O6Q A;  1HVV A;  3RK2 D;  2OTJ P;  4NPF X;  5AVX B;  1CI6 A;  2YIU C;  3H1H G;  5KLV J;  2PRR A;  3LW5 H;  4H0L C;  3HD7 D;  1VQL P;  1FDM A;  1ZLL A;  1GMJ A;  3TDK A;  2I1K A;  1USD A;  2O1J A;  1KQF B;  4JYB A;  2E5T A;  5H2F E;  3CCQ P;  1DD4 A;  2PAJ A;  4ASW A;  2GM4 A;  3FXD A;  3SWK A;  2KNC B;  3L75 G;  1SFC A;  4H13 B;  2FYN B;  3AE2 C;  5CJ0 A;  5KLV K;  1NAF A;  5K5G B;  2QM8 A;  1PP9 D;  1IK9 A;  1PGP A;  2P10 A;  3G71 P;  2QJK B;  1NO4 A;  3P8C D;  4PV1 D;  2OTL P;  2OQQ A;  3EQ2 A;  4HH2 A;  4JQ0 D;  3JSV C;  2NZ2 A;  1URQ D;  1OWA A;  1MZ9 A;  3L74 G;  2OYH B;  3H1J E;  1OIP A;  4U3F G;  4WY4 A;  1SQB K;  5AW2 B;  1IFP A;  1IJD B;  3Q3D A;  4UB6 E;  2E75 D;  4I7Z C;  4BRY A;  5AVS B;  1S4X A;  1SQX D;  5BU8 B;  1S1C X;  1M1K Q;  2QRX A;  1X9V A;  5AW8 B;  2I1J A;  2KYV A;  1HTL C;  2A06 E;  4GKG A;  2FXO A;  3AE3 C;  4JF7 A;  4N78 E;  2N9Y B;  4K3A A;  3TYY A;  2XKM A;  2L5G B;  3GHG C;  1IFD A;  5KLV G;  2YO2 A;  3AEC C;  3TGU D;  2Y0D A;  2WPS A;  1PP9 J;  2DW3 A;  1W2B O;  1MFT A;  1DD3 A;  1PFI A; 
#chains in the Genus database with same CATH homology
 2A45 H;  3TK1 A;  1QL1 A;  1KIL C;  2IX7 C;  3M0D C;  1T2K C;  3V4W A;  4KHX A;  1IC2 A;  1N7S A;  2YO3 A;  4C7N B;  3HE4 A;  1FZC B;  1KZU B;  4W7Z A;  2WPQ A;  3V2N A;  2N1T B;  4DZO A;  1ZN5 A;  5KJ7 A;  1J1E B;  4W7Y A;  2Z5H A;  1N7S D;  3RK3 B;  1GL2 C;  1GW4 A;  4O9B A;  5APQ A;  4XE5 B;  4IFM A;  1JUN A;  3L35 A;  1MFZ A;  1FBM A;  2YKQ A;  4EOT A;  4ZKU A;  3P8C E;  1FJK A;  1LT9 C;  2M3B A;  2WSC H;  3PP5 A;  5KJ7 D;  1JY3 P;  3B5N B;  1NH4 A;  3VTP C;  2OAR A;  1URQ A;  3V5B A;  3NMD A;  4IFD K;  1DX7 A;  1RE3 A;  5AW4 B;  3RK2 C;  1JY2 P;  4AYC A;  1ZV8 A;  1SLQ A;  1RF0 A;  2P7J A;  2FXM A;  3MTU E;  2Q3I A;  3P7K A;  3M06 A;  3TSI A;  3HUS A;  1FZF A;  3CL3 D;  2MJZ A;  1JCC A;  4AQR D;  1LTG C;  3RL0 C;  5CJ4 A;  1SP4 A;  3OJA B;  5APX A;  2WSF H;  5AVQ B;  3RK3 D;  3R2P A;  2P1J A;  4C7R A;  1SQX K;  3WMM 0;  1HBW A;  3T97 A;  2R32 A;  3B8E B;  5BU5 A;  5AW9 B;  2WPR A;  5AW6 B;  2OYI B;  1JTH A;  1GZL A;  2Z4E A;  2KSJ A;  5AW5 B;  1IFN A;  2E42 A;  3RK2 B;  3G3Z A;  2OYH A;  3NFQ A;  3VMX A;  2R5D A;  2O1K A;  2A45 G;  1FZB A;  3MUD A;  3HE5 A;  5AVZ B;  1IFM A;  1LTA C;  2FFD B;  3VMY A;  3HD7 B;  1SFC C;  1WRG A;  1FOS F;  1LWU B;  5AVV B;  3MGN A;  1H88 A;  1J2J B;  1CI6 B;  1M1J B;  5KJ7 C;  1YYC A;  3A7O A;  1SQP K;  3E1I A;  5APT A;  3M91 A;  1N73 A;  2KP8 A;  3VMZ A;  5APY A;  2OYI A;  1IO4 A;  3HTK A;  5CCH A;  5CCG C;  1NTZ K;  1GU4 A;  1FOS E;  3UIA A;  1ZR2 A;  3OA7 A;  1URQ C;  2PP6 A;  2ZFC A;  2WT7 A;  4JYC A;  2QM7 A;  5CCH D;  1FU1 A;  3VOP A;  2P67 A;  1JO5 A;  2IPP A;  1M1J A;  1RF0 C;  1M7L A;  3KYQ A;  4OH8 B;  2FYZ A;  1FAV A;  1RF1 B;  3M9H A;  1L4A B;  5AW7 B;  1LTJ C;  3GHG B;  1JOC A;  3HRN A;  4WY4 C;  4C46 A;  2NPS B;  1H8A A;  3M9Q A;  2N9B A;  2C0W A;  3VN0 A;  2HPC A;  1MUU A;  1YTZ T;  1J1D B;  3O8Z A;  4W80 A;  4WB4 A;  3VP8 A;  3LIE A;  4Y99 C;  1RF1 A;  1HUC A;  4C7N A;  3KDP B;  2OYH C;  1FZC A;  1G1I A;  1KIL B;  3GHG A;  2N1T A;  2R3C A;  1CW5 A;  1NHL A;  2HFE D;  1N2D C;  1LGH B;  4XA4 A;  4WBA A;  2FYU K;  2A45 I;  1LTI C;  4IFF A;  2IFM A;  3BVH A;  1KFN A;  1JY3 O;  1WT6 A;  1L4A D;  2W6B A;  1S9K D;  1JNM A;  2N1T D;  3OAK A;  2WTY A;  1HH0 A;  1N73 C;  2W6A A;  1JMM A;  3VYI A;  1GL2 B;  3BAS A;  1RY3 A;  4N6J A;  3B5N A;  3V2R A;  5APS A;  1OXZ A;  1X79 B;  1T8Z A;  3TNU B;  2IFN A;  2Q5U A;  1KIL A;  4M3L A;  3IR9 A;  4AUW A;  1EQ7 A;  1LT9 B;  1NKZ B;  2J58 A;  5APW A;  3L37 A;  1VPC A;  1DEB A;  2KOG A;  3B5N D;  3KQG A;  3A2A A;  4HYT B;  3CI9 A;  1E5W A;  5AVY B;  3H32 B;  1HJB A;  1KIL D;  1NU1 K;  1GTW A;  1T2K D;  3P8M C;  3LID A;  2KB7 P;  3MIW A;  2KLV A;  1N7S C;  2HOD B;  1ZR4 A;  3SWF A;  1DH3 A;  2Z5I A;  2POH A;  4N3Y B;  1CZQ A;  2J59 M;  1HGV A;  1SVF A;  1GDT A;  3RL0 B;  3II6 A;  1NWQ A;  1GD2 E;  2YKP A;  1GL2 D;  1KQL A;  1Z56 A;  2CPB A;  4GIF A;  2HYN A;  1GW3 A;  2YMY A;  2XZR A;  1X8Y A;  3M0A A;  1G1J A;  2M8R A;  3MD0 A;  3U59 A;  1G2C B;  2FFD A;  2GUS A;  3HD7 A;  4LLH A;  3NTN A;  1A02 F;  2FKW B;  2O01 H;  1LWU A;  5AW0 B;  5AW3 B;  1FZC C;  1SQQ K;  2N1T C;  4GT1 A;  1RE3 C;  3RK2 D;  1HVV A;  1HGZ A;  3L4F A;  5AVX B;  1CI6 A;  5AVU B;  1J1E C;  4EIJ A;  1JCD A;  3RK3 C;  4RES B;  3C9I A;  3HE4 B;  1SFC B;  3NXS A;  3KPE A;  3LW5 H;  3HD7 D;  3HUS C;  1FDM A;  1RE4 A;  1ZLL A;  2WSE H;  2I1K A;  3IFM A;  1IFI A;  3U1A A;  2O1J A;  1L0N K;  1XTG B;  3B5N C;  5AW1 B;  4JYB A;  1FZA A;  2GUV A;  2ZXE B;  2HG5 D;  3V4Q A;  3SWY A;  2PAJ A;  2GM4 A;  2Q9I A;  1URQ B;  1JY3 N;  3V2P A;  1SFC A;  3H6P A;  1GK4 A;  1SQV K;  2HLO A;  5CJ0 A;  1L4A A;  5APV A;  5KLV K;  1AFO A;  1NAF A;  1JY2 N;  3VP9 A;  2BAS A;  2NPS A;  1AQ5 A;  1LTT C;  2C9N Y;  1L0L K;  3N7N A;  1S9K E;  2XV5 A;  3N4X A;  2QM8 A;  5CCG A;  3HUS B;  1SFC D;  1IK9 A;  2Q7C A;  1LTJ B;  1IFJ A;  3BAT A;  4WY4 B;  1GU5 A;  1H89 A;  2NPS D;  1NO4 A;  3BRV B;  1JY2 O;  2OYI C;  4I1L A;  3P8C D;  2C9L Y;  1NKN A;  5CCG D;  3BRT B;  5CCH C;  1NTM K;  5BVZ A;  2H7H A;  5AVT B;  1NTK K;  1HWT C;  3M0D A;  2XU6 A;  2H8P D;  3EQ2 A;  4LC1 A;  4B86 A;  4HH2 A;  1FJP A;  1JTH B;  1URQ D;  4Y99 B;  3U1C A;  2FFD C;  3HD7 C;  1OWA A;  2C0X A;  1MZ9 A;  3L36 A;  2H43 A;  1LWU C;  5APU A;  2OYH B;  1LTJ A;  3P32 A;  2E43 A;  4WY4 A;  1M1J C;  1SQB K;  2WWW A;  5AW2 B;  3HE5 B;  3EFG A;  1IJD B;  1W2E A;  1QL2 A;  1GL2 A;  2P2U A;  5AVW B;  3M9B A;  1RE4 C;  3CLQ A;  2R5B A;  3I5C A;  5AVS B;  1NOH A;  4DOJ A;  3TNU A;  3V2Q A;  5KTB A;  4WY4 D;  1N73 B;  1T3J A;  1LT9 A;  5BU8 B;  3HTK B;  4I2L C;  1FZE A;  1LTB C;  1VDF A;  1A02 J;  1YTZ I;  1X9V A;  3H32 A;  2LKM A;  4LGD E;  5AW8 B;  2I1J A;  1N86 A;  2KYV A;  1HTL C;  1T3U A;  2WT7 B;  2HOD A;  2JJL A;  4GKG A;  2XNX A;  4JF7 A;  1RF1 C;  3A3Y B;  4N78 E;  1CSB A;  1L4A C;  3TYY A;  2XKM A;  2L5G B;  3GHG C;  4ZKP A;  1IFD A;  2YO2 A;  1MV8 A;  2NPS C;  5AVR B;  4N78 D;  1N7S B;  2VRS A;  2W27 A;  2XDJ A;  4I6M C;  1XTC C;  1N7L A;  2WPS A;  1LTS C;  2JEE A;  1J1D C;  2YNY A;  2CPS A;  5CHX A;  1FZG A;  2WIT A;  2YKO A;  3RL0 D;  2WZ7 A;  1GK6 A;  5CMZ A;  1KFM A;  3A5T A;  1G2C A;  2HPC B;  1PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...