1MZ9A

Storage function of comp:the crystal structure of the coiled-coil domain in complex with vitamin d3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords cartilage oligomeric matrix protein
publication title Storage function of cartilage oligomeric matrix protein: the crystal structure of the coiled-coil domain in complex with vitamin D(3).
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2002-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1mz9A00
1MZ9A 3V2NA 3V2QA 1VDFA 3V2PA 1DEBA 1FBMA 3V2RA
chains in the Genus database with same CATH superfamily
1SQQG 1AFOA 5H2FH 2V4HA 5KKZB 1HTLC 4UB6H 3M9BA 1AA0A 3VMXA 1LT9B 1NKNA 3MP7B 1HH0A 1Z56A 2D2CC 1NHLA 1T3UA 1GW4A 3SWFA 1DH3A 4IL6X 4WY4B 3HUSA 2WSEH 2J5UA 1OXZA 3HUSC 2IBZD 1PP9D 3U59A 4OWFA 2I1KA 4WY4D 1RQVA 1S3JA 3CMAP 5C39A 1N7SB 5KLVJ 3AECC 5GTIE 1SQBD 2YIUC 1GTWA 3GMAA 1LTTC 2GM4A 1N7SD 3L75J 1LTGC 3GLMA 2JWDA 2NRGA 3OA7A 5H2FE 3CC2P 1BGYJ 3TGUD 2WITA 4UB6E 4I2LC 2H43A 2FYUD 1QLED 1FZGA 1ZOYC 2LR2A 1NKZB 3CX5D 1JY2N 5AW3B 5M1BA 1NTKK 3AE6C 3P32A 2BCCD 1JOCA 1VQLP 3FX0A 1IFMA 1ZXGA 3CCSP 3N4XA 3RK3B 1L2PA 1NU1K 3FWNA 1UIXA 3BCCE 2ZYAA 5CCHA 4Y99C 3RK3D 2HLOA 3M9QA 4N78D 4HJGH 5CCHC 1OWAA 1PPJE 2QSIA 1G2CB 4OGQB 3L75G 2LXBA 1EZVI 5AW2B 2KI7B 4L73A 5AW6B 3HE4B 4RJTA 3EWKA 2XDJA 1BGYG 4C7NB 1MKMA 2BEQD 1IZNB 5AW5B 2ZXXA 1N86A 3CL3D 2AEMA 1PP9E 3RGUA 4H0LC 1FZEA 1DEBA 1SQPD 1YYCA 1QX8A 3L74E 2KZIA 1CSBA 3F5HA 3ITKA 3BATA 1VF5B 2K1AA 3OAKA 5DJTB 1P84I 2J59M 1JTHB 4QMAA 4TLFA 4XA4A 3RK2B 2HFED 2A45I 1VF5D 3TF5A 2JDIH 3B5NA 1J1EC 4ZKUA 4C46A 3M91A 3B5NC 5AW4B 2M3EA 3PRJA 2E74D 3D71A 1LTJA 1WMKA 4B86A 4IFDK 1LTJC 1N73B 4IFMA 3OJAB 1K05A 1SQVK 2FYZA 1NTKJ 4JF7A 1HGVA 3VOPA 4W7ZA 2POHA 1Q90D 3V2QA 2Y0CA 2Y9ZA 1J1DB 3TK1A 3RK3E 1S2EA 4M3LA 2ZVOB 1FDIA 5KKZC 2RH0A 3CD6P 3L72J 3CXHD 1LT9A 5APSA 2KXPB 2Q5UA 1LT9C 1YJWP 1Y47A 4WY4A 5DJUB 3CWBD 3H1IJ 4LLHA 2ZYGA 4WY4C 2KK7A 3V2RA 1KZUB 3H1KJ 1LJ2A 1N7SA 1NJIQ 1T2KD 4ASWA 1N7SC 2LKMA 3NTNA 2KB7P 3TYYA 4ZNCA 1M7LA 2M8RA 2P10A 1VQ7P 2QA4P 3AE3C 2PAJA 4K3AA 2P2UA 3FGAD 1NTKG 3H6PA 2ZT9B 2KS1B 2QVAA 4EI2A 1YITP 5CBOA 2BEZF 2Q3EA 2FFDB 3W67A 2ZT9D 1LWUB 1NU1G 2PFXA 2KOGA 4PD4D 1EZVD 2Z4EA 3H1JD 3H1IG 3LIEA 3JCUE 3PLNA 4BRYA 2H8PD 1NTZD 3L71J 4JQ0D 4U3FJ 2W6BA 1VQPP 1BCCD 1BE3J 3H1KG 1IO4A 2V7QH 3Q5PA 1EDKA 3H1HD 1L0LD 3MIWA 1JY3P 1FU1A 1Y8AA 1P84D 4KJMA 1G2CA 1LTAC 1CI6A 1NAFA 1GL2B 3HE4A 4OGQC 4Y28J 3T97A 5KTBA 4C7NA 1R5SA 1XTCC 1YIJP 3MTUE 2YNYA 1GL2D 3RL0g 2IDBA 3B4SA 1DEEG 2QIWA 1PGPA 1PL5A 1SP4A 4C7RA 3KQGA 1L0NK 4ZKPA 1PGOA 2O3JA 1FDOA 3L73E 3I5CA 1HWTC 3G4SP 1RY3A 3D6ZA 3V4QA 1DD3A 3RK2C 3FWLA 3L71G 4U3FG 1SQVG 3BRTB 1EQ7A 5AVZB 1BE3G 2ZYDA 1OX3A 2C9LY 2B89A 3CCJP 2WSFH 1AQ5A 2C0XA 3CLQA 2GUSA 1HBWA 2W27A 2W8ZA 1EZVE 1FC2C 4HYTB 1H89A 1N73A 5AVWB 2UWJE 1N73C 5AW7B 2CK3H 3CCLP 2PP6A 2KNCB 1W2BO 1KN7A 2ZVNB 5CBNA 1U7MA 3H1LE 1KORA 2R5BA 1JMMA 3P8CE 4D6TE 3GF7A 1OW7A 2Y0DA 4UB8H 1RF0A 1HF9A 4JPZB 3FXEA 1L0LE 3SSUA 2HR3A 2GUVA 1S9KE 4WB4A 1RF0C 1P84E 1N2DC 1JY2O 1AJYA 2N1TB 1GMJA 3FXDA 4GIFA 3VYIA 1OIPA 1NTME 5KAIH 2N1TD 3RBZA 4CPGA 3S1KA 1T2KC 1VQ9P 2XNXA 1OW8A 2DW3A 5KLVD 1SQQE 1L0NJ 1HUCA 3II6A 4UB8E 1VQ5P 2A06G 2Q6QA 1KILA 1FZBA 2KS1A 3BCCD 1GZLA 3QH9A 2ZT9C 3WUUA 5APYA 2E75B 1S72P 2QRXA 2MKVA 4LC1A 4WVZA 1N8RQ 1PPJD 5BU5A 4WBAA 3L70J 1IFJA 2E75D 1KFMA 1KFNA 3CI9A 2E43A 2G8YA 3ZDMA 3SWYA 4I1LA 1JCCA 4KT0J 4ASVA 2FYUK 3CCVP 3KDPB 2H89C 1BSHA 3L74D 3PP5A 1S5LH 1GDTA 1YTZT 1RHZB 1GU5A 1T3JA 2P7JA 4EDFA 2YKPA 1YHQP 4H13D 1QL1A 2WPSA 3AE9C 1L0NG 1JEKA 4YPCA 4GODA 1ZMEC 3C8VA 2YKQA 2KLUA 3TNUB 1DD4A 1YI2P 2H88C 1NYHA 1LGHB 2FXMA 1H8AA 2E76B 3C9IA 3L70G 5KLVE 1RE4A 2KIKA 1PFIA 1KB9H 2E76D 1S5LE 1RE4C 2NPSA 3A3YB 1KV4A 2ZXEB 3L75E 4HKZH 2NPSC 4AQRD 1SQPK 1G1JA 1BGYE 1IFIA 2IYPA 3V4WA 3L35A 2AEJA 1WRGA 2WTYA 1RQUA 4RKUJ 5KLIB 2J58A 1SQBJ 4NPEA 1X79B 3JSVC 1NO4A 1OZHA 3R4YA 4JYBA 1QEXA 2IPPA 2KNCA 1YJNP 2B87B 3AEFC 3L37A 3TGUJ 1YQ4C 4JYCA 1KTMA 2QJYB 3UIAA 3V2PA 3M9HA 1IK7A 1ZW0A 2FYUJ 1FZFA 3IAOA 4NPDA 4L76A 2WSCJ 4H44B 2N1TA 2BCCJ 3AE5C 2IX7C 1NH4A 2N1TC 5KJ7D 1FJKA 3TSIA 2KSEA 2FYNB 2E74B 3HD7D 4H44D 2OYIB 3GW6A 5E79H 1A02J 2IBZG 1PP9G 3CC7P 2M0BA 3A2AA 1VQOP 3MZWB 1AVYA 1M1JA 1SQBG 1VDFA 1M1JC 3M0AA 3V6IA 3NXSA 2R32A 3M06A 2JR8A 4R4MA 1WT6A 2QM7A 1JY3N 1FZCB 1URQB 1KQLA 2JKVA 3TGUG 2WPVB 4GDOA 3VN0A 1T8ZA 3F89A 1NU1J 2K88A 4EYYQ 4HH2A 4DOJA 1IK9A 2E75C 1URQD 2FYUG 1SQPJ 2FY8A 3HRNA 2K9YA 1AQTA 3HTKB 2WQYC 3PJSK 1PGJA 3Q2YA 1ZR2A 2BCCG 1OVVA 3AE8C 5KAFH 1FS0E 2P58A 2E5YA 1CZQA 2O01N 1TU3F 1JB0J 1EDIA 5APVA 2YMKA 2WVRA 1KMIZ 1NTKE 2K37A 1JM0A 1KYOH 2AEFA 1GK6A 3RL0B 1LT1A 2ITAA 1VQ4P 4U7JA 1MUUA 2LXCB 3WUTA 2QJKB 3RL0D 3L73D 3IF4A 3Q1MA 1E79H 2GA1A 1L4AB 1NTZK 2OYOA 3L72E 4EOTA 3TNUA 3VMAA 1HGZA 3ABVC 2NZ2A 1L4AD 1FJPA 3H1IE 3Q5SA 1L0LK 3H32B 1M1KQ 3KZIH 2KUBA 2OYHB 2XKMA 3H1KE 1SQPG 4TT3H 3MD0A 2P1JA 2M3BA 3AE2C 2K9JB 1FBMA 3BASA 4N3YB 2ZAEB 3SWKA 3G71P 1SFCB 4RESB 2WWWA 3RK3C 3H1LD 1SQVJ 3CWBJ 3P8CD 4D6TD 2D2CD 3U1CA 1SFCD 3WMM0 3USSA 4I7ZB 1SQXD 2OGUA 2AXCA 1S9KD 3U1AA 5KLIC 2MJZA 1M56D 3EFFK 1HJ0A 1ZP0C 1ZV8A 3KZIE 3GG2A 3VMZA 4YXWH 1NTMD 1Q7YQ 2OTKE 1KB9I 3PTZA 1NOHA 1QVFO 2QJYC 3L71E 4U3FE 1BE3E 1BDDA 1SQQD 1NVOA 1EC5A 3P8MC 3R2PA 5AW0B 3K5BA 1JTHA 2O01J 1VF5C 3IFMA 1YTZI 2WPQA 2OQQA 1GU4A 2AXTH 1DIPA 4H44C 1LTBC 3H1JJ 3CWBG 2OYIA 2FYNC 2E74C 1NTZJ 1PGQA 3LW5J 2OYIC 1BCCJ 1LTSC 1OFCX 1USDA 3N7NA 3IR9A 4L74A 3H1HJ 1L0LJ 1E5WA 1YQ3C 3E7KA 1USEA 1ZLLA 1KILE 3CX5I 1IJDB 5CCHD 1JCDA 2Q9IA 1QL2A 1FZCA 1NWQA 1X9VA 2YO3A 1JMBA 1K8AQ 1FZCC 2AXTE 1LP1B 1J1DC 2IYOA 1SQXE 3VMYA 5KLVK 3HTKA 4OVNF 1UIIA 1XTGB 2E5TA 4EIJA 4H0LD 1EZVG 3IN6A 3CCUP 3KXDA 3H1JG 1MV8A 2W83C 4XE5B 2A06E 2Q7CA 1NTZG 2HYNA 1BCCG 2B9BA 1FZAA 3MUDA 2G3AA 1Q86Q 1PIXA 3H1HG 1L0LG 4Z1MH 3MUDC 2QJKC 1K9MQ 4PV1B 4L75A 3L75D 1VL2A 1CW5A 2WMMA 2B88A 4WWIA 5APUA 2A45G 2QG4A 3D70A 1BGYD 4NPFX 2HPCB 2FFDA 4PV1D 1LWUA 5APWA 2FFDC 3H32A 1AV1A 1VQNP 2WZ7A 5APQA 1LWUC 1M90Q 5KAIE 1GW3A 5AVYB 3CCMP 1X0TA 1KYOI 3GF3A 1RF1B 3SFEC 3JC22 3W68A 2K9JA 2QJPB 3BRVB 2IFNA 3A0HH 1L0NE 1SFCA 3HE5B 5AW1B 1A02F 1KB9D 3M0DA 1SFCC 3M0DC 4H13B 2R3SA 3MGNA 1ZRTE 2C0WA 2WSEJ 1EXIA 2XV5A 4I7ZC 1G1IA 4OH8B 2E42A 2L91A 3AE4C 1GL2A 3L70E 2KSJA 1GL2C 1FOSF 1IC2A 3EQ2A 5GTHH 3O6QB 5CCGD 3CXHI 4W80A 3BCCJ 2O1KA 2JP3A 2YMYA 2ZJSE 3QWOC 3WU2H 1JY3O 3A0HE 1M8OB 3AEGC 1YJ9P 1ZR4A 4RO0A 1R8EA 2PGDA 2FKWB 3B71A 2WT7B 3CCRP 1U7JA 3AEAC 4W7YA 1EDLA 5APTA 1PP9J 3C1LA 4LGDE 4BXLA 4BRYB 3L74J 1GD2E 4IOIH 1RH5B 2KLVA 2RKLA 5GTHE 1BDCA 5TJHA 3AEEC 5B66H 5KLVG 3OW2O 1EDJA 1H0TB 3WU2E 3VP8A 2R5DA 5AW8B 1X8YA 1NTKD 1CI6B 4PD4I 1KB9E 2Y9YA 4A7PA 2Q3IA 1OMIA 3BCCG 3T97B 2R44A 1LP1A 3CX5H 3Q3DA 4OGQD 2IBZE 1NU1D 1PPJG 2WSCH 1M57D 4DCKA 3RBXA 1Y9BA 3HD7B 4IFFA 1BSNA 4PJ0H 4ZMDA 2YKOA 3GHGB 3L72D 1SQBE 3B8EB 2W6JH 2Q1KA 5AVTB 2KP8A 3H1ID 4IL6H 3KYQA 5B66E 1J2JB 3TDKA 2JEEA 3TGUE 1T6AA 3H1KD 2I1JA 3L74G 1KYOD 3KHUA 3RK2D 3KPEA 2FYUE 4N6JA 3CX5E 5AVSB 5AVUB 3I55P 2FXOA 1VQKP 3VP9A 4PV1C 4JBZA 2JJLA 2BCCE 2HPCA 4PJ0E 1JY2P 1SVFA 2FBWC 5CJ4A 5AVQB 1JO5A 2HODB 2M5AB 2KZJA 3AE7C 1NAYA 4XFJA 4O9BA 5CHXA 5E79E 4IL6E 1RF1A 2HG5D 2CPBA 2RMZA 4N78E 4DZOA 1X22A 4AUWA 1RF1C 1K73Q 5AVVB 2QJPC 3HE5A 1KQGB 2VRSA 2IZ1A 2XZRA 3PHLA 3L71D 1LTIC 4U3FD 1SQVD 2YXQB 3NFQA 1BE3D 1FOSE 5K5GB 4H13C 5AVXB 2ZFCA 4K35A 1NU1E 3E1RA 1EXJA 4KHXA 1SQPE 1IFDA 2IFMA 1W5CE 3CCQP 5CCGA 3JCUH 1Q82Q 5CCGC 3O6QA 1SQXK 1SS1A 1W2EA 5AW9B 5KAFE 1VQ8P 1KILB 1GK4A 3VTPC 1RE3A 3SFDC 1ZN5A 2E76C 3Q5RA 1KYOE 1YBKA 5BVZA 2OARA 2PRRA 3CXHH 3BVHA 1RE3C 2BASA 3A5TA 5APXA 1FE6A 1KILD 3LIDA 3WUVA 2RN0A 1NTMK 1KQFB 2WPRA 1NGMB 4GOFA 2D2CB 1OVUA 2WT7A 1LNQA 1S4XA 1KQSO 3AEBC 1Q81Q 1OW6A 3L72G 1IFPA 3P7KA 1QGKB 2Z5IA 3HUSB 1IFNA 4DT0A 1VQ6P 1SQQK 3G3ZA 1MFZA 2QEXP 3CC4P 3V2NA 4YXDC 1VPCA 5TISH 1K04A 2YIUB 1HJBA 1U57A 2SPZA 2W90A 3L73J 2WSSH 1H0TA 3H25A 2V7QJ 4HB1A 2B87A 2XU6A 5AVRB 2A06D 3E1IA 3CXHE 1S1CX 3AEDC 4I6MC 1SQVE 3CWBE 2O01H 2H7HA 2IBZI 2JO1A 4PD4H 5KJ7A 3HD7A 2Z5HA 3A0BH 5KJ7C 2CPSA 3V5BA 3GHGA 3HD7C 2YXRB 3S9OA 3GHGC 1D7MA 2KYVA 5TISE 3LW5H 3A7OA 1H88A 2NPSB 3H1LJ 1S5LX 2N9BA 4R4LA 3CCEP 4D6TJ 4Y99B 2C9NY 4GKGA 2R3CA 5BU8B 1SQXJ 1P84H 2NPSD 3CPWO 2N9YB 3CMEP 5CMZA 1FDMA 2OTLP 3I56P 2A45H 1JNMA 3L73G 4GT1A 1L0ND 2WSFJ 1JUNA 4PD4E 1URQA 3NMDA 1AVOA 3L36A 3D6YA 3A0BE 1NTMJ 1Q2NA 1URQC 3O8ZA 1R5LA 2P67A 2HODA 2M5AA 3H1JE 2XNDH 1ZRTD 2W6AA 5CJ0A 5L8RJ 4H0LB 1QVGO 3MHVA 1NTZE 3G9RA 1FAVA 1BCCE 3L70D 1SQQJ 1VQMP 3PH0A 1N7LA 5B5EH 3H1HE 4DJGA 1DX7A 2OTJP 2K3RA 2L5GB 4YTPC 1PV3A 1MZ9A 3H1LG 2FXPA 1MFTA 2QM8A 3S4RA 3RL0C 1J1EB 4MN4C 4D6TG 3B5NB 2YO2A 2IZ0A 1SQXG 4AYCA 3G6EP 3B5ND 1L4AA 5EFWB 1PZQA 1KD1Q 1LTJB 1M1JB 1L4AC 4GOEA 3L4FA 1KC8Q 1SLQA 1NTMG 3EFGA 5B5EE 5GTIH 2Y0EA 2OYHA 2O1JA 2I8DA 3AE1C 1HVVA 2OYHC 4BWNA 2QE7H 1KILC 2JWAA 1OVRA 1SQBK
chains in the Genus database with same CATH topology
1RY3A 1AFOA 2Q3IA 3V4QA 1HTLC 3RL0D 3RK2C 3M9BA 3BRTB 1EQ7A 5AVZB 3VMXA 1LT9B 1NKNA 1HH0A 1Z56A 1L4AB 1NTZK 1NHLA 1T3UA 4EOTA 2C9LY 2WSCH 3TNUA 1GW4A 3SWFA 1DH3A 1HGZA 2WSFH 1AQ5A 2C0XA 3CLQA 3HD7B 4WY4B 2GUSA 3HUSA 4IFFA 2WSEH 1HBWA 2YKOA 1L4AD 2W27A 1FJPA 3GHGB 1OXZA 3HUSC 4HYTB 1H89A 1L0LK 3U59A 3H32B 5AVWB 1N73A 3B8EB 5AVTB 2I1KA 4WY4D 2OYHB 2XKMA 1N73C 5AW7B 1N7SB 2KP8A 2PP6A 3MD0A 2P1JA 2M3BA 3KYQA 1J2JB 1GTWA 2JEEA 1FBMA 1LTTC 2GM4A 1N7SD 2R5BA 1JMMA 3P8CE 1LTGC 2I1JA 3BASA 4N3YB 1RF0A 1SFCB 3OA7A 3RK2D 4RESB 2WWWA 3KPEA 3RK3C 2GUVA 2WITA 4N6JA 4WB4A 1S9KE 1RF0C 3P8CD 1N2DC 4I2LC 5AVSB 3U1CA 1SFCD 3WMM0 1JY2O 5AVUB 2N1TB 2H43A 3VP9A 1FZGA 1S9KD 1NKZB 2JJLA 4GIFA 3U1AA 2HPCA 1JY2N 1JY2P 1SVFA 3VYIA 5CJ4A 5AW3B 2MJZA 5AVQB 1JO5A 2N1TD 2HODB 1NTKK 1ZV8A 3P32A 1T2KC 1JOCA 3VMZA 4O9BA 5CHXA 1IFMA 2XNXA 1RF1A 3N4XA 3RK3B 2HG5D 2CPBA 1NU1K 4N78E 4DZOA 4AUWA 1RF1C 1NOHA 5AVVB 1HUCA 3II6A 5CCHA 4Y99C 3HE5A 3RK3D 2VRSA 2HLOA 3M9QA 4N78D 3P8MC 5CCHC 1OWAA 3R2PA 1KILA 1FZBA 5AW0B 2XZRA 1GZLA 1JTHA 1LTIC 3IFMA 1YTZI 3NFQA 2WPQA 1GU4A 1G2CB 5APYA 1FOSE 5AVXB 2ZFCA 4LC1A 5AW2B 5AW6B 3HE4B 1LTBC 5BU5A 4WBAA 4KHXA 1IFJA 2XDJA 4C7NB 2OYIA 1KFMA 1IFDA 1KFNA 5AW5B 2IFMA 1N86A 3CL3D 3CI9A 2OYIC 5CCGA 2E43A 1LTSC 1FZEA 1DEBA 5CCGC 3SWYA 4I1LA 1JCCA 1YYCA 3N7NA 3IR9A 1SQXK 1E5WA 1W2EA 5AW9B 2FYUK 1CSBA 3KDPB 3BATA 1ZLLA 3OAKA 1KILB 1GK4A 3PP5A 3VTPC 2J59M 1JTHB 1GDTA 1RE3A 1YTZT 1ZN5A 1IJDB 5CCHD 1GU5A 1JCDA 5BVZA 4XA4A 2OARA 3RK2B 3BVHA 2Q9IA 1QL2A 1RE3C 1T3JA 2BASA 2HFED 3A5TA 5APXA 2A45I 1FZCA 1NWQA 1X9VA 2P7JA 2YKPA 1KILD 3LIDA 2YO3A 1FZCC 1NTMK 1QL1A 3B5NA 2WPRA 2WPSA 1J1DC 2WT7A 1J1EC 4ZKUA 4C46A 3M91A 3B5NC 5AW4B 3VMYA 5KLVK 2YKQA 3TNUB 3HTKA 3P7KA 2Z5IA 1XTGB 3HUSB 1IFNA 1LTJA 4EIJA 1SQQK 4B86A 3G3ZA 1MFZA 4IFDK 1LTJC 1N73B 4IFMA 3V2NA 1VPCA 3OJAB 1LGHB 2FXMA 1SQVK 3C9IA 2FYZA 1H8AA 4JF7A 1HGVA 1HJBA 1MV8A 3VOPA 4XE5B 4W7ZA 2POHA 2Q7CA 3V2QA 1RE4A 1PFIA 2HYNA 1RE4C 2NPSA 1J1DB 2XU6A 3A3YB 5AVRB 3TK1A 2ZXEB 1FZAA 3E1IA 3MUDA 2NPSC 4M3LA 4AQRD 4I6MC 1SQPK 1G1JA 1IFIA 5APSA 1LT9A 1CW5A 3V4WA 2Q5UA 3L35A 2O01H 1WRGA 2WTYA 2H7HA 1LT9C 5APUA 2A45G 5KJ7A 3HD7A 4WY4A 2Z5HA 2HPCB 2FFDA 2J58A 4LLHA 5KJ7C 2CPSA 3V5BA 3GHGA 3HD7C 1X79B 4WY4C 3V2RA 1LWUA 1NO4A 5APWA 2FFDC 3H32A 1KZUB 2WZ7A 3GHGC 5APQA 2KYVA 4JYBA 1LWUC 3LW5H 1N7SA 2IPPA 1GW3A 3A7OA 5AVYB 1H88A 2NPSB 1T2KD 3L37A 1N7SC 2LKMA 2N9BA 1RF1B 4JYCA 3NTNA 2KB7P 3TYYA 1M7LA 2M8RA 3UIAA 3V2PA 4Y99B 3BRVB 2C9NY 2IFNA 4GKGA 2R3CA 5BU8B 3M9HA 2NPSD 1SFCA 2PAJA 2P2UA 3HE5B 5CMZA 5AW1B 1FZFA 1A02F 3M0DA 3H6PA 1FDMA 1SFCC 2A45H 1JNMA 3M0DC 4GT1A 2FFDB 1JUNA 2N1TA 1URQA 3MGNA 2C0WA 3NMDA 2IX7C 2XV5A 3L36A 1LWUB 1G1IA 1NH4A 2N1TC 5KJ7D 1URQC 1FJKA 4OH8B 3TSIA 2E42A 3O8ZA 3HD7D 2KOGA 2P67A 1GL2A 2OYIB 2KSJA 2HODA 2W6AA 5CJ0A 1A02J 1GL2C 3A2AA 2Z4EA 1FAVA 1FOSF 1IC2A 3EQ2A 1M1JA 3LIEA 1N7LA 5CCGD 2H8PD 1VDFA 4W80A 2O1KA 1M1JC 3M0AA 2YMYA 2W6BA 1DX7A 1JY3O 3NXSA 1IO4A 2R32A 3M06A 1WT6A 2QM7A 1JY3N 3MIWA 1JY3P 1FU1A 2L5GB 1URQB 1KQLA 1ZR4A 1MZ9A 1FZCB 2QM8A 3VN0A 1T8ZA 1G2CA 3RL0C 1J1EB 1LTAC 2FKWB 3B5NB 1CI6A 2YO2A 4HH2A 1NAFA 2WT7B 1GL2B 4DOJA 1IK9A 3HE4A 1URQD 4AYCA 3T97A 5KTBA 3HRNA 4C7NA 1XTCC 4W7YA 3HTKB 3MTUE 5APTA 3B5ND 2YNYA 1L4AA 1GL2D 1LTJB 1M1JB 1ZR2A 1L4AC 4LGDE 3L4FA 1GD2E 1CZQA 2KLVA 1SP4A 1SLQA 4C7RA 3KQGA 1L0NK 3EFGA 5APVA 4ZKPA 2OYHA 3VP8A 2R5DA 1GK6A 5AW8B 2O1JA 3RL0B 1HVVA 2OYHC 3I5CA 1HWTC 1KILC 1X8YA 1SQBK 1MUUA 1CI6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZ9 A;  3V2N A;  3V2Q A;  1VDF A;  3V2P A;  1DEB A;  1FBM A;  3V2R A; 
#chains in the Genus database with same CATH topology
 1SQQ G;  1AFO A;  5H2F H;  2V4H A;  5KKZ B;  1HTL C;  4UB6 H;  3M9B A;  1AA0 A;  3VMX A;  1LT9 B;  1NKN A;  3MP7 B;  1HH0 A;  1Z56 A;  2D2C C;  1NHL A;  1T3U A;  1GW4 A;  3SWF A;  1DH3 A;  4IL6 X;  4WY4 B;  3HUS A;  2WSE H;  2J5U A;  1OXZ A;  3HUS C;  2IBZ D;  1PP9 D;  3U59 A;  4OWF A;  2I1K A;  4WY4 D;  1RQV A;  1S3J A;  3CMA P;  5C39 A;  1N7S B;  5KLV J;  3AEC C;  5GTI E;  1SQB D;  2YIU C;  1GTW A;  3GMA A;  1LTT C;  2GM4 A;  1N7S D;  3L75 J;  1LTG C;  3GLM A;  2JWD A;  2NRG A;  3OA7 A;  5H2F E;  3CC2 P;  1BGY J;  3TGU D;  2WIT A;  4UB6 E;  4I2L C;  2H43 A;  2FYU D;  1QLE D;  1FZG A;  1ZOY C;  2LR2 A;  1NKZ B;  3CX5 D;  1JY2 N;  5AW3 B;  5M1B A;  1NTK K;  3AE6 C;  3P32 A;  2BCC D;  1JOC A;  1VQL P;  3FX0 A;  1IFM A;  1ZXG A;  3CCS P;  3N4X A;  3RK3 B;  1L2P A;  1NU1 K;  3FWN A;  1UIX A;  3BCC E;  2ZYA A;  5CCH A;  4Y99 C;  3RK3 D;  2HLO A;  3M9Q A;  4N78 D;  4HJG H;  5CCH C;  1OWA A;  1PPJ E;  2QSI A;  1G2C B;  4OGQ B;  3L75 G;  2LXB A;  1EZV I;  5AW2 B;  2KI7 B;  4L73 A;  5AW6 B;  3HE4 B;  4RJT A;  3EWK A;  2XDJ A;  1BGY G;  4C7N B;  1MKM A;  2BEQ D;  1IZN B;  5AW5 B;  2ZXX A;  1N86 A;  3CL3 D;  2AEM A;  1PP9 E;  3RGU A;  4H0L C;  1FZE A;  1DEB A;  1SQP D;  1YYC A;  1QX8 A;  3L74 E;  2KZI A;  1CSB A;  3F5H A;  3ITK A;  3BAT A;  1VF5 B;  2K1A A;  3OAK A;  5DJT B;  1P84 I;  2J59 M;  1JTH B;  4QMA A;  4TLF A;  4XA4 A;  3RK2 B;  2HFE D;  2A45 I;  1VF5 D;  3TF5 A;  2JDI H;  3B5N A;  1J1E C;  4ZKU A;  4C46 A;  3M91 A;  3B5N C;  5AW4 B;  2M3E A;  3PRJ A;  2E74 D;  3D71 A;  1LTJ A;  1WMK A;  4B86 A;  4IFD K;  1LTJ C;  1N73 B;  4IFM A;  3OJA B;  1K05 A;  1SQV K;  2FYZ A;  1NTK J;  4JF7 A;  1HGV A;  3VOP A;  4W7Z A;  2POH A;  1Q90 D;  3V2Q A;  2Y0C A;  2Y9Z A;  1J1D B;  3TK1 A;  3RK3 E;  1S2E A;  4M3L A;  2ZVO B;  1FDI A;  5KKZ C;  2RH0 A;  3CD6 P;  3L72 J;  3CXH D;  1LT9 A;  5APS A;  2KXP B;  2Q5U A;  1LT9 C;  1YJW P;  1Y47 A;  4WY4 A;  5DJU B;  3CWB D;  3H1I J;  4LLH A;  2ZYG A;  4WY4 C;  2KK7 A;  3V2R A;  1KZU B;  3H1K J;  1LJ2 A;  1N7S A;  1NJI Q;  1T2K D;  4ASW A;  1N7S C;  2LKM A;  3NTN A;  2KB7 P;  3TYY A;  4ZNC A;  1M7L A;  2M8R A;  2P10 A;  1VQ7 P;  2QA4 P;  3AE3 C;  2PAJ A;  4K3A A;  2P2U A;  3FGA D;  1NTK G;  3H6P A;  2ZT9 B;  2KS1 B;  2QVA A;  4EI2 A;  1YIT P;  5CBO A;  2BEZ F;  2Q3E A;  2FFD B;  3W67 A;  2ZT9 D;  1LWU B;  1NU1 G;  2PFX A;  2KOG A;  4PD4 D;  1EZV D;  2Z4E A;  3H1J D;  3H1I G;  3LIE A;  3JCU E;  3PLN A;  4BRY A;  2H8P D;  1NTZ D;  3L71 J;  4JQ0 D;  4U3F J;  2W6B A;  1VQP P;  1BCC D;  1BE3 J;  3H1K G;  1IO4 A;  2V7Q H;  3Q5P A;  1EDK A;  3H1H D;  1L0L D;  3MIW A;  1JY3 P;  1FU1 A;  1Y8A A;  1P84 D;  4KJM A;  1G2C A;  1LTA C;  1CI6 A;  1NAF A;  1GL2 B;  3HE4 A;  4OGQ C;  4Y28 J;  3T97 A;  5KTB A;  4C7N A;  1R5S A;  1XTC C;  1YIJ P;  3MTU E;  2YNY A;  1GL2 D;  3RL0 g;  2IDB A;  3B4S A;  1DEE G;  2QIW A;  1PGP A;  1PL5 A;  1SP4 A;  4C7R A;  3KQG A;  1L0N K;  4ZKP A;  1PGO A;  2O3J A;  1FDO A;  3L73 E;  3I5C A;  1HWT C;  3G4S P;  1RY3 A;  3D6Z A;  3V4Q A;  1DD3 A;  3RK2 C;  3FWL A;  3L71 G;  4U3F G;  1SQV G;  3BRT B;  1EQ7 A;  5AVZ B;  1BE3 G;  2ZYD A;  1OX3 A;  2C9L Y;  2B89 A;  3CCJ P;  2WSF H;  1AQ5 A;  2C0X A;  3CLQ A;  2GUS A;  1HBW A;  2W27 A;  2W8Z A;  1EZV E;  1FC2 C;  4HYT B;  1H89 A;  1N73 A;  5AVW B;  2UWJ E;  1N73 C;  5AW7 B;  2CK3 H;  3CCL P;  2PP6 A;  2KNC B;  1W2B O;  1KN7 A;  2ZVN B;  5CBN A;  1U7M A;  3H1L E;  1KOR A;  2R5B A;  1JMM A;  3P8C E;  4D6T E;  3GF7 A;  1OW7 A;  2Y0D A;  4UB8 H;  1RF0 A;  1HF9 A;  4JPZ B;  3FXE A;  1L0L E;  3SSU A;  2HR3 A;  2GUV A;  1S9K E;  4WB4 A;  1RF0 C;  1P84 E;  1N2D C;  1JY2 O;  1AJY A;  2N1T B;  1GMJ A;  3FXD A;  4GIF A;  3VYI A;  1OIP A;  1NTM E;  5KAI H;  2N1T D;  3RBZ A;  4CPG A;  3S1K A;  1T2K C;  1VQ9 P;  2XNX A;  1OW8 A;  2DW3 A;  5KLV D;  1SQQ E;  1L0N J;  1HUC A;  3II6 A;  4UB8 E;  1VQ5 P;  2A06 G;  2Q6Q A;  1KIL A;  1FZB A;  2KS1 A;  3BCC D;  1GZL A;  3QH9 A;  2ZT9 C;  3WUU A;  5APY A;  2E75 B;  1S72 P;  2QRX A;  2MKV A;  4LC1 A;  4WVZ A;  1N8R Q;  1PPJ D;  5BU5 A;  4WBA A;  3L70 J;  1IFJ A;  2E75 D;  1KFM A;  1KFN A;  3CI9 A;  2E43 A;  2G8Y A;  3ZDM A;  3SWY A;  4I1L A;  1JCC A;  4KT0 J;  4ASV A;  2FYU K;  3CCV P;  3KDP B;  2H89 C;  1BSH A;  3L74 D;  3PP5 A;  1S5L H;  1GDT A;  1YTZ T;  1RHZ B;  1GU5 A;  1T3J A;  2P7J A;  4EDF A;  2YKP A;  1YHQ P;  4H13 D;  1QL1 A;  2WPS A;  3AE9 C;  1L0N G;  1JEK A;  4YPC A;  4GOD A;  1ZME C;  3C8V A;  2YKQ A;  2KLU A;  3TNU B;  1DD4 A;  1YI2 P;  2H88 C;  1NYH A;  1LGH B;  2FXM A;  1H8A A;  2E76 B;  3C9I A;  3L70 G;  5KLV E;  1RE4 A;  2KIK A;  1PFI A;  1KB9 H;  2E76 D;  1S5L E;  1RE4 C;  2NPS A;  3A3Y B;  1KV4 A;  2ZXE B;  3L75 E;  4HKZ H;  2NPS C;  4AQR D;  1SQP K;  1G1J A;  1BGY E;  1IFI A;  2IYP A;  3V4W A;  3L35 A;  2AEJ A;  1WRG A;  2WTY A;  1RQU A;  4RKU J;  5KLI B;  2J58 A;  1SQB J;  4NPE A;  1X79 B;  3JSV C;  1NO4 A;  1OZH A;  3R4Y A;  4JYB A;  1QEX A;  2IPP A;  2KNC A;  1YJN P;  2B87 B;  3AEF C;  3L37 A;  3TGU J;  1YQ4 C;  4JYC A;  1KTM A;  2QJY B;  3UIA A;  3V2P A;  3M9H A;  1IK7 A;  1ZW0 A;  2FYU J;  1FZF A;  3IAO A;  4NPD A;  4L76 A;  2WSC J;  4H44 B;  2N1T A;  2BCC J;  3AE5 C;  2IX7 C;  1NH4 A;  2N1T C;  5KJ7 D;  1FJK A;  3TSI A;  2KSE A;  2FYN B;  2E74 B;  3HD7 D;  4H44 D;  2OYI B;  3GW6 A;  5E79 H;  1A02 J;  2IBZ G;  1PP9 G;  3CC7 P;  2M0B A;  3A2A A;  1VQO P;  3MZW B;  1AVY A;  1M1J A;  1SQB G;  1VDF A;  1M1J C;  3M0A A;  3V6I A;  3NXS A;  2R32 A;  3M06 A;  2JR8 A;  4R4M A;  1WT6 A;  2QM7 A;  1JY3 N;  1FZC B;  1URQ B;  1KQL A;  2JKV A;  3TGU G;  2WPV B;  4GDO A;  3VN0 A;  1T8Z A;  3F89 A;  1NU1 J;  2K88 A;  4EYY Q;  4HH2 A;  4DOJ A;  1IK9 A;  2E75 C;  1URQ D;  2FYU G;  1SQP J;  2FY8 A;  3HRN A;  2K9Y A;  1AQT A;  3HTK B;  2WQY C;  3PJS K;  1PGJ A;  3Q2Y A;  1ZR2 A;  2BCC G;  1OVV A;  3AE8 C;  5KAF H;  1FS0 E;  2P58 A;  2E5Y A;  1CZQ A;  2O01 N;  1TU3 F;  1JB0 J;  1EDI A;  5APV A;  2YMK A;  2WVR A;  1KMI Z;  1NTK E;  2K37 A;  1JM0 A;  1KYO H;  2AEF A;  1GK6 A;  3RL0 B;  1LT1 A;  2ITA A;  1VQ4 P;  4U7J A;  1MUU A;  2LXC B;  3WUT A;  2QJK B;  3RL0 D;  3L73 D;  3IF4 A;  3Q1M A;  1E79 H;  2GA1 A;  1L4A B;  1NTZ K;  2OYO A;  3L72 E;  4EOT A;  3TNU A;  3VMA A;  1HGZ A;  3ABV C;  2NZ2 A;  1L4A D;  1FJP A;  3H1I E;  3Q5S A;  1L0L K;  3H32 B;  1M1K Q;  3KZI H;  2KUB A;  2OYH B;  2XKM A;  3H1K E;  1SQP G;  4TT3 H;  3MD0 A;  2P1J A;  2M3B A;  3AE2 C;  2K9J B;  1FBM A;  3BAS A;  4N3Y B;  2ZAE B;  3SWK A;  3G71 P;  1SFC B;  4RES B;  2WWW A;  3RK3 C;  3H1L D;  1SQV J;  3CWB J;  3P8C D;  4D6T D;  2D2C D;  3U1C A;  1SFC D;  3WMM 0;  3USS A;  4I7Z B;  1SQX D;  2OGU A;  2AXC A;  1S9K D;  3U1A A;  5KLI C;  2MJZ A;  1M56 D;  3EFF K;  1HJ0 A;  1ZP0 C;  1ZV8 A;  3KZI E;  3GG2 A;  3VMZ A;  4YXW H;  1NTM D;  1Q7Y Q;  2OTK E;  1KB9 I;  3PTZ A;  1NOH A;  1QVF O;  2QJY C;  3L71 E;  4U3F E;  1BE3 E;  1BDD A;  1SQQ D;  1NVO A;  1EC5 A;  3P8M C;  3R2P A;  5AW0 B;  3K5B A;  1JTH A;  2O01 J;  1VF5 C;  3IFM A;  1YTZ I;  2WPQ A;  2OQQ A;  1GU4 A;  2AXT H;  1DIP A;  4H44 C;  1LTB C;  3H1J J;  3CWB G;  2OYI A;  2FYN C;  2E74 C;  1NTZ J;  1PGQ A;  3LW5 J;  2OYI C;  1BCC J;  1LTS C;  1OFC X;  1USD A;  3N7N A;  3IR9 A;  4L74 A;  3H1H J;  1L0L J;  1E5W A;  1YQ3 C;  3E7K A;  1USE A;  1ZLL A;  1KIL E;  3CX5 I;  1IJD B;  5CCH D;  1JCD A;  2Q9I A;  1QL2 A;  1FZC A;  1NWQ A;  1X9V A;  2YO3 A;  1JMB A;  1K8A Q;  1FZC C;  2AXT E;  1LP1 B;  1J1D C;  2IYO A;  1SQX E;  3VMY A;  5KLV K;  3HTK A;  4OVN F;  1UII A;  1XTG B;  2E5T A;  4EIJ A;  4H0L D;  1EZV G;  3IN6 A;  3CCU P;  3KXD A;  3H1J G;  1MV8 A;  2W83 C;  4XE5 B;  2A06 E;  2Q7C A;  1NTZ G;  2HYN A;  1BCC G;  2B9B A;  1FZA A;  3MUD A;  2G3A A;  1Q86 Q;  1PIX A;  3H1H G;  1L0L G;  4Z1M H;  3MUD C;  2QJK C;  1K9M Q;  4PV1 B;  4L75 A;  3L75 D;  1VL2 A;  1CW5 A;  2WMM A;  2B88 A;  4WWI A;  5APU A;  2A45 G;  2QG4 A;  3D70 A;  1BGY D;  4NPF X;  2HPC B;  2FFD A;  4PV1 D;  1LWU A;  5APW A;  2FFD C;  3H32 A;  1AV1 A;  1VQN P;  2WZ7 A;  5APQ A;  1LWU C;  1M90 Q;  5KAI E;  1GW3 A;  5AVY B;  3CCM P;  1X0T A;  1KYO I;  3GF3 A;  1RF1 B;  3SFE C;  3JC2 2;  3W68 A;  2K9J A;  2QJP B;  3BRV B;  2IFN A;  3A0H H;  1L0N E;  1SFC A;  3HE5 B;  5AW1 B;  1A02 F;  1KB9 D;  3M0D A;  1SFC C;  3M0D C;  4H13 B;  2R3S A;  3MGN A;  1ZRT E;  2C0W A;  2WSE J;  1EXI A;  2XV5 A;  4I7Z C;  1G1I A;  4OH8 B;  2E42 A;  2L91 A;  3AE4 C;  1GL2 A;  3L70 E;  2KSJ A;  1GL2 C;  1FOS F;  1IC2 A;  3EQ2 A;  5GTH H;  3O6Q B;  5CCG D;  3CXH I;  4W80 A;  3BCC J;  2O1K A;  2JP3 A;  2YMY A;  2ZJS E;  3QWO C;  3WU2 H;  1JY3 O;  3A0H E;  1M8O B;  3AEG C;  1YJ9 P;  1ZR4 A;  4RO0 A;  1R8E A;  2PGD A;  2FKW B;  3B71 A;  2WT7 B;  3CCR P;  1U7J A;  3AEA C;  4W7Y A;  1EDL A;  5APT A;  1PP9 J;  3C1L A;  4LGD E;  4BXL A;  4BRY B;  3L74 J;  1GD2 E;  4IOI H;  1RH5 B;  2KLV A;  2RKL A;  5GTH E;  1BDC A;  5TJH A;  3AEE C;  5B66 H;  5KLV G;  3OW2 O;  1EDJ A;  1H0T B;  3WU2 E;  3VP8 A;  2R5D A;  5AW8 B;  1X8Y A;  1NTK D;  1CI6 B;  4PD4 I;  1KB9 E;  2Y9Y A;  4A7P A;  2Q3I A;  1OMI A;  3BCC G;  3T97 B;  2R44 A;  1LP1 A;  3CX5 H;  3Q3D A;  4OGQ D;  2IBZ E;  1NU1 D;  1PPJ G;  2WSC H;  1M57 D;  4DCK A;  3RBX A;  1Y9B A;  3HD7 B;  4IFF A;  1BSN A;  4PJ0 H;  4ZMD A;  2YKO A;  3GHG B;  3L72 D;  1SQB E;  3B8E B;  2W6J H;  2Q1K A;  5AVT B;  2KP8 A;  3H1I D;  4IL6 H;  3KYQ A;  5B66 E;  1J2J B;  3TDK A;  2JEE A;  3TGU E;  1T6A A;  3H1K D;  2I1J A;  3L74 G;  1KYO D;  3KHU A;  3RK2 D;  3KPE A;  2FYU E;  4N6J A;  3CX5 E;  5AVS B;  5AVU B;  3I55 P;  2FXO A;  1VQK P;  3VP9 A;  4PV1 C;  4JBZ A;  2JJL A;  2BCC E;  2HPC A;  4PJ0 E;  1JY2 P;  1SVF A;  2FBW C;  5CJ4 A;  5AVQ B;  1JO5 A;  2HOD B;  2M5A B;  2KZJ A;  3AE7 C;  1NAY A;  4XFJ A;  4O9B A;  5CHX A;  5E79 E;  4IL6 E;  1RF1 A;  2HG5 D;  2CPB A;  2RMZ A;  4N78 E;  4DZO A;  1X22 A;  4AUW A;  1RF1 C;  1K73 Q;  5AVV B;  2QJP C;  3HE5 A;  1KQG B;  2VRS A;  2IZ1 A;  2XZR A;  3PHL A;  3L71 D;  1LTI C;  4U3F D;  1SQV D;  2YXQ B;  3NFQ A;  1BE3 D;  1FOS E;  5K5G B;  4H13 C;  5AVX B;  2ZFC A;  4K35 A;  1NU1 E;  3E1R A;  1EXJ A;  4KHX A;  1SQP E;  1IFD A;  2IFM A;  1W5C E;  3CCQ P;  5CCG A;  3JCU H;  1Q82 Q;  5CCG C;  3O6Q A;  1SQX K;  1SS1 A;  1W2E A;  5AW9 B;  5KAF E;  1VQ8 P;  1KIL B;  1GK4 A;  3VTP C;  1RE3 A;  3SFD C;  1ZN5 A;  2E76 C;  3Q5R A;  1KYO E;  1YBK A;  5BVZ A;  2OAR A;  2PRR A;  3CXH H;  3BVH A;  1RE3 C;  2BAS A;  3A5T A;  5APX A;  1FE6 A;  1KIL D;  3LID A;  3WUV A;  2RN0 A;  1NTM K;  1KQF B;  2WPR A;  1NGM B;  4GOF A;  2D2C B;  1OVU A;  2WT7 A;  1LNQ A;  1S4X A;  1KQS O;  3AEB C;  1Q81 Q;  1OW6 A;  3L72 G;  1IFP A;  3P7K A;  1QGK B;  2Z5I A;  3HUS B;  1IFN A;  4DT0 A;  1VQ6 P;  1SQQ K;  3G3Z A;  1MFZ A;  2QEX P;  3CC4 P;  3V2N A;  4YXD C;  1VPC A;  5TIS H;  1K04 A;  2YIU B;  1HJB A;  1U57 A;  2SPZ A;  2W90 A;  3L73 J;  2WSS H;  1H0T A;  3H25 A;  2V7Q J;  4HB1 A;  2B87 A;  2XU6 A;  5AVR B;  2A06 D;  3E1I A;  3CXH E;  1S1C X;  3AED C;  4I6M C;  1SQV E;  3CWB E;  2O01 H;  2H7H A;  2IBZ I;  2JO1 A;  4PD4 H;  5KJ7 A;  3HD7 A;  2Z5H A;  3A0B H;  5KJ7 C;  2CPS A;  3V5B A;  3GHG A;  3HD7 C;  2YXR B;  3S9O A;  3GHG C;  1D7M A;  2KYV A;  5TIS E;  3LW5 H;  3A7O A;  1H88 A;  2NPS B;  3H1L J;  1S5L X;  2N9B A;  4R4L A;  3CCE P;  4D6T J;  4Y99 B;  2C9N Y;  4GKG A;  2R3C A;  5BU8 B;  1SQX J;  1P84 H;  2NPS D;  3CPW O;  2N9Y B;  3CME P;  5CMZ A;  1FDM A;  2OTL P;  3I56 P;  2A45 H;  1JNM A;  3L73 G;  4GT1 A;  1L0N D;  2WSF J;  1JUN A;  4PD4 E;  1URQ A;  3NMD A;  1AVO A;  3L36 A;  3D6Y A;  3A0B E;  1NTM J;  1Q2N A;  1URQ C;  3O8Z A;  1R5L A;  2P67 A;  2HOD A;  2M5A A;  3H1J E;  2XND H;  1ZRT D;  2W6A A;  5CJ0 A;  5L8R J;  4H0L B;  1QVG O;  3MHV A;  1NTZ E;  3G9R A;  1FAV A;  1BCC E;  3L70 D;  1SQQ J;  1VQM P;  3PH0 A;  1N7L A;  5B5E H;  3H1H E;  4DJG A;  1DX7 A;  2OTJ P;  2K3R A;  2L5G B;  4YTP C;  1PV3 A;  1MZ9 A;  3H1L G;  2FXP A;  1MFT A;  2QM8 A;  3S4R A;  3RL0 C;  1J1E B;  4MN4 C;  4D6T G;  3B5N B;  2YO2 A;  2IZ0 A;  1SQX G;  4AYC A;  3G6E P;  3B5N D;  1L4A A;  5EFW B;  1PZQ A;  1KD1 Q;  1LTJ B;  1M1J B;  1L4A C;  4GOE A;  3L4F A;  1KC8 Q;  1SLQ A;  1NTM G;  3EFG A;  5B5E E;  5GTI H;  2Y0E A;  2OYH A;  2O1J A;  2I8D A;  3AE1 C;  1HVV A;  2OYH C;  4BWN A;  2QE7 H;  1KIL C;  2JWA A;  1OVR A;  1SQB K; 
#chains in the Genus database with same CATH homology
 1RY3 A;  1AFO A;  2Q3I A;  3V4Q A;  1HTL C;  3RL0 D;  3RK2 C;  3M9B A;  3BRT B;  1EQ7 A;  5AVZ B;  3VMX A;  1LT9 B;  1NKN A;  1HH0 A;  1Z56 A;  1L4A B;  1NTZ K;  1NHL A;  1T3U A;  4EOT A;  2C9L Y;  2WSC H;  3TNU A;  1GW4 A;  3SWF A;  1DH3 A;  1HGZ A;  2WSF H;  1AQ5 A;  2C0X A;  3CLQ A;  3HD7 B;  4WY4 B;  2GUS A;  3HUS A;  4IFF A;  2WSE H;  1HBW A;  2YKO A;  1L4A D;  2W27 A;  1FJP A;  3GHG B;  1OXZ A;  3HUS C;  4HYT B;  1H89 A;  1L0L K;  3U59 A;  3H32 B;  5AVW B;  1N73 A;  3B8E B;  5AVT B;  2I1K A;  4WY4 D;  2OYH B;  2XKM A;  1N73 C;  5AW7 B;  1N7S B;  2KP8 A;  2PP6 A;  3MD0 A;  2P1J A;  2M3B A;  3KYQ A;  1J2J B;  1GTW A;  2JEE A;  1FBM A;  1LTT C;  2GM4 A;  1N7S D;  2R5B A;  1JMM A;  3P8C E;  1LTG C;  2I1J A;  3BAS A;  4N3Y B;  1RF0 A;  1SFC B;  3OA7 A;  3RK2 D;  4RES B;  2WWW A;  3KPE A;  3RK3 C;  2GUV A;  2WIT A;  4N6J A;  4WB4 A;  1S9K E;  1RF0 C;  3P8C D;  1N2D C;  4I2L C;  5AVS B;  3U1C A;  1SFC D;  3WMM 0;  1JY2 O;  5AVU B;  2N1T B;  2H43 A;  3VP9 A;  1FZG A;  1S9K D;  1NKZ B;  2JJL A;  4GIF A;  3U1A A;  2HPC A;  1JY2 N;  1JY2 P;  1SVF A;  3VYI A;  5CJ4 A;  5AW3 B;  2MJZ A;  5AVQ B;  1JO5 A;  2N1T D;  2HOD B;  1NTK K;  1ZV8 A;  3P32 A;  1T2K C;  1JOC A;  3VMZ A;  4O9B A;  5CHX A;  1IFM A;  2XNX A;  1RF1 A;  3N4X A;  3RK3 B;  2HG5 D;  2CPB A;  1NU1 K;  4N78 E;  4DZO A;  4AUW A;  1RF1 C;  1NOH A;  5AVV B;  1HUC A;  3II6 A;  5CCH A;  4Y99 C;  3HE5 A;  3RK3 D;  2VRS A;  2HLO A;  3M9Q A;  4N78 D;  3P8M C;  5CCH C;  1OWA A;  3R2P A;  1KIL A;  1FZB A;  5AW0 B;  2XZR A;  1GZL A;  1JTH A;  1LTI C;  3IFM A;  1YTZ I;  3NFQ A;  2WPQ A;  1GU4 A;  1G2C B;  5APY A;  1FOS E;  5AVX B;  2ZFC A;  4LC1 A;  5AW2 B;  5AW6 B;  3HE4 B;  1LTB C;  5BU5 A;  4WBA A;  4KHX A;  1IFJ A;  2XDJ A;  4C7N B;  2OYI A;  1KFM A;  1IFD A;  1KFN A;  5AW5 B;  2IFM A;  1N86 A;  3CL3 D;  3CI9 A;  2OYI C;  5CCG A;  2E43 A;  1LTS C;  1FZE A;  1DEB A;  5CCG C;  3SWY A;  4I1L A;  1JCC A;  1YYC A;  3N7N A;  3IR9 A;  1SQX K;  1E5W A;  1W2E A;  5AW9 B;  2FYU K;  1CSB A;  3KDP B;  3BAT A;  1ZLL A;  3OAK A;  1KIL B;  1GK4 A;  3PP5 A;  3VTP C;  2J59 M;  1JTH B;  1GDT A;  1RE3 A;  1YTZ T;  1ZN5 A;  1IJD B;  5CCH D;  1GU5 A;  1JCD A;  5BVZ A;  4XA4 A;  2OAR A;  3RK2 B;  3BVH A;  2Q9I A;  1QL2 A;  1RE3 C;  1T3J A;  2BAS A;  2HFE D;  3A5T A;  5APX A;  2A45 I;  1FZC A;  1NWQ A;  1X9V A;  2P7J A;  2YKP A;  1KIL D;  3LID A;  2YO3 A;  1FZC C;  1NTM K;  1QL1 A;  3B5N A;  2WPR A;  2WPS A;  1J1D C;  2WT7 A;  1J1E C;  4ZKU A;  4C46 A;  3M91 A;  3B5N C;  5AW4 B;  3VMY A;  5KLV K;  2YKQ A;  3TNU B;  3HTK A;  3P7K A;  2Z5I A;  1XTG B;  3HUS B;  1IFN A;  1LTJ A;  4EIJ A;  1SQQ K;  4B86 A;  3G3Z A;  1MFZ A;  4IFD K;  1LTJ C;  1N73 B;  4IFM A;  3V2N A;  1VPC A;  3OJA B;  1LGH B;  2FXM A;  1SQV K;  3C9I A;  2FYZ A;  1H8A A;  4JF7 A;  1HGV A;  1HJB A;  1MV8 A;  3VOP A;  4XE5 B;  4W7Z A;  2POH A;  2Q7C A;  3V2Q A;  1RE4 A;  1PFI A;  2HYN A;  1RE4 C;  2NPS A;  1J1D B;  2XU6 A;  3A3Y B;  5AVR B;  3TK1 A;  2ZXE B;  1FZA A;  3E1I A;  3MUD A;  2NPS C;  4M3L A;  4AQR D;  4I6M C;  1SQP K;  1G1J A;  1IFI A;  5APS A;  1LT9 A;  1CW5 A;  3V4W A;  2Q5U A;  3L35 A;  2O01 H;  1WRG A;  2WTY A;  2H7H A;  1LT9 C;  5APU A;  2A45 G;  5KJ7 A;  3HD7 A;  4WY4 A;  2Z5H A;  2HPC B;  2FFD A;  2J58 A;  4LLH A;  5KJ7 C;  2CPS A;  3V5B A;  3GHG A;  3HD7 C;  1X79 B;  4WY4 C;  3V2R A;  1LWU A;  1NO4 A;  5APW A;  2FFD C;  3H32 A;  1KZU B;  2WZ7 A;  3GHG C;  5APQ A;  2KYV A;  4JYB A;  1LWU C;  3LW5 H;  1N7S A;  2IPP A;  1GW3 A;  3A7O A;  5AVY B;  1H88 A;  2NPS B;  1T2K D;  3L37 A;  1N7S C;  2LKM A;  2N9B A;  1RF1 B;  4JYC A;  3NTN A;  2KB7 P;  3TYY A;  1M7L A;  2M8R A;  3UIA A;  3V2P A;  4Y99 B;  3BRV B;  2C9N Y;  2IFN A;  4GKG A;  2R3C A;  5BU8 B;  3M9H A;  2NPS D;  1SFC A;  2PAJ A;  2P2U A;  3HE5 B;  5CMZ A;  5AW1 B;  1FZF A;  1A02 F;  3M0D A;  3H6P A;  1FDM A;  1SFC C;  2A45 H;  1JNM A;  3M0D C;  4GT1 A;  2FFD B;  1JUN A;  2N1T A;  1URQ A;  3MGN A;  2C0W A;  3NMD A;  2IX7 C;  2XV5 A;  3L36 A;  1LWU B;  1G1I A;  1NH4 A;  2N1T C;  5KJ7 D;  1URQ C;  1FJK A;  4OH8 B;  3TSI A;  2E42 A;  3O8Z A;  3HD7 D;  2KOG A;  2P67 A;  1GL2 A;  2OYI B;  2KSJ A;  2HOD A;  2W6A A;  5CJ0 A;  1A02 J;  1GL2 C;  3A2A A;  2Z4E A;  1FAV A;  1FOS F;  1IC2 A;  3EQ2 A;  1M1J A;  3LIE A;  1N7L A;  5CCG D;  2H8P D;  1VDF A;  4W80 A;  2O1K A;  1M1J C;  3M0A A;  2YMY A;  2W6B A;  1DX7 A;  1JY3 O;  3NXS A;  1IO4 A;  2R32 A;  3M06 A;  1WT6 A;  2QM7 A;  1JY3 N;  3MIW A;  1JY3 P;  1FU1 A;  2L5G B;  1URQ B;  1KQL A;  1ZR4 A;  1MZ9 A;  1FZC B;  2QM8 A;  3VN0 A;  1T8Z A;  1G2C A;  3RL0 C;  1J1E B;  1LTA C;  2FKW B;  3B5N B;  1CI6 A;  2YO2 A;  4HH2 A;  1NAF A;  2WT7 B;  1GL2 B;  4DOJ A;  1IK9 A;  3HE4 A;  1URQ D;  4AYC A;  3T97 A;  5KTB A;  3HRN A;  4C7N A;  1XTC C;  4W7Y A;  3HTK B;  3MTU E;  5APT A;  3B5N D;  2YNY A;  1L4A A;  1GL2 D;  1LTJ B;  1M1J B;  1ZR2 A;  1L4A C;  4LGD E;  3L4F A;  1GD2 E;  1CZQ A;  2KLV A;  1SP4 A;  1SLQ A;  4C7R A;  3KQG A;  1L0N K;  3EFG A;  5APV A;  4ZKP A;  2OYH A;  3VP8 A;  2R5D A;  1GK6 A;  5AW8 B;  2O1J A;  3RL0 B;  1HVV A;  2OYH C;  3I5C A;  1HWT C;  1KIL C;  1X8Y A;  1SQB K;  1MUU A;  1CI6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...