2E43A

Crystal structure of c/ebpbeta bzip homodimer k269a mutant bound to a high affinity dna fragment
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
SDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*DTP*DAP*DGP*DGP*DAP*DTP*DTP*DGP*DCP*DGP*DCP*DAP*
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2e43A00
3L36A 1SLQA 3M9BA 2XZRA 3TK1A 5AVZB 3HE5A 3MGNA 3P32A 1GK4A 4GKGA 4HYTB 1CI6B 1J2JB 2JJLA 4LC1A 1HJBA 1DH3A 4I2LC 1H8AA 5AVXB 1GZLA 5APYA 3NMDA 5AVVB 3TNUB 1NWQA 2Q3IA 4M3LA 3KDPB 4XE5B 2R32A 2R3CA 1HWTC 5AW2B 1S9KE 4C7NB 2P2UA 2Q7CA 3VMYA 2H7HA 3VYIA 4GT1A 5APSA 4EOTA 1OWAA 2Z5HA 2WPRA 3NXSA 1A02J 2YNYA 3HTKA 1CI6A 1A02F 2WWWA 2R5BA 5APXA 5AW4B 1S9KD 3VMXA 1OXZA 5AW1B 5APTA 5APVA 3V5BA 1YYCA 1GD2E 4C7NA 4B86A 1CZQA 4AQRD 2VRSA 5AVWB 5AW3B 5AVRB 3SWFA 3NFQA 1IO4A 2P67A 3A3YB 2ZXEB 2XV5A 3TYYA 1HUCA 4C46A 3NTNA 3L35A 4JYCA 5AVYB 1T2KC 3A5TA 2WPQA 2QM8A 2QM7A 5AVQB 3A2AA 3A7OA 1MFZA 2N9BA 3P8MC 1MV8A 3LIDA 3TNUA 2E42A 1H88A 1GK6A 1NAFA 3HE4B 5APWA 4AYCA 2YO3A 1FOSF 1CSBA 1KQLA 2XU6A 3I5CA 1HBWA 1GTWA 3IR9A 5AW5B 1SP4A 2C9NY 3B8EB 3M0DA 3M91A 5AW0B 2ZFCA 2W6AA 5AW8B 1GU4A 4DZOA 4JYBA 3UIAA 1JUNA 2E43A 2WTYA 1FOSE 5AW6B 5CMZA 2YO2A 1G2CB 2R5DA 3V4QA 3VTPC 2KP8A 4I6MC 3LIEA 3VN0A 2C9LY 2P7JA 3M06A 2WT7B 1GU5A 2W27A 3HE4A 1JNMA 3KQGA 2IPPA 3HE5B 2WPSA 3V4WA 4RESB 5AW9B 5AW7B 3O8ZA 1X8YA 3MD0A 3VMZA 5AVTB 1MUUA 2Q5UA 1T2KD 2BASA 3OAKA 3P7KA 5APUA 3T97A 1FAVA 3L37A 3M0AA 3M9HA 5AVSB 4AUWA 4KHXA 2Z5IA 5AVUB 5APQA 2WT7A 1H89A
chains in the Genus database with same CATH superfamily
5KAFH 2XZRA 3MUDA 2Q6QA 3HE5A 3CC2P 5BVZA 1J2JB 1Y8AA 3TNUB 3ZDMA 2YIUB 1URQB 2Y0CA 3VMYA 5APSA 3HUSB 2G3AA 2IBZE 2JP3A 3JSVC 2YNYA 1CI6A 2KLVA 1RE4C 4U3FJ 1IJDB 3RK2B 5CJ0A 5K5GB 2KXPB 1GW3A 2XDJA 5TISH 1NU1J 1OW7A 4D6TD 1LJ2A 2QA4P 1PP9D 1BE3J 1KILD 2OARA 1X79B 2GUVA 2ZT9D 2WPQA 5AVQB 4WVZA 1OW6A 3VMAA 5DJTB 3CCLP 2HLOA 3U1CA 2ZYGA 3HE4B 5DJUB 1CSBA 1SP4A 1QX8A 3KHUA 1M1JC 2KP8A 3G71P 1QL1A 1SFCB 1NTMD 3GHGA 3V4WA 2K37A 2E74B 1JY3P 3C1LA 1JY2O 4I7ZB 3L73D 3QWOC 1JOCA 2Q3EA 1H89A 3JCUH 1IC2A 1QL2A 1LTJC 2H43A 1VF5B 1J1EB 1KILE 3P8CE 1NOHA 3L74D 3W67A 3B5ND 4PV1D 2QJPC 1IFNA 3M0DC 4GT1A 2WMMA 3E1IA 2N1TB 4ASWA 3SWKA 3RK3C 3W68A 2ZYDA 4B86A 5KAFE 3NFQA 3N4XA 1NTME 5KAIE 2XV5A 1MZ9A 2J59M 1L0NK 2NPSA 3CXHD 3NTNA 3L75G 1OVUA 2W90A 1K73Q 3A2AA 2QJYB 2E76C 3P8MC 4RKUJ 1L4AC 2KK7A 1ZXGA 1L0LD 5AW5B 5M1BA 3FX0A 3Q5PA 1SQBK 4C7RA 3ABVC 2OQQA 1EDJA 3L74E 5TISE 1DEEG 1YBKA 1QLED 3N7NA 2NZ2A 2K1AA 1U57A 4GOEA 4PD4H 1FU1A 1YQ3C 3CXHI 1IK9A 3EFFK 4KT0J 2GA1A 2C0WA 3CX5E 3GW6A 5CBOA 4EI2A 1JTHB 1EXIA 3L75J 2N9YB 3H1LD 1YJNP 1KB9E 2D2CD 4TLFA 1MFTA 1G2CA 3PP5A 3VYIA 1JCCA 4RO0A 1DEBA 2WPRA 2YMKA 1L0LE 1ZOYC 3M9QA 3CCEP 3H1IE 2B87B 1URQD 1RE3A 5AW1B 1EZVG 5APVA 1L0ND 3SSUA 3A0BE 3RK2D 1N7SC 3A3YB 2A06D 2O3JA 3IAOA 1PL5A 5E79H 1BGYD 3MUDC 1BCCG 1NAFA 2OTJP 5TJHA 1SQBD 1VQ7P 2C9NY 3BCCD 1JY3O 4PD4D 3LW5J 1FOSE 1S4XA 4YTPC 2QEXP 2ITAA 3H1LE 1ZR4A 3RGUA 3CWBG 1NO4A 3HE4A 4OWFA 4RESB 1Q90D 3GG2A 5AW7B 3VMZA 2G8YA 3OW2O 1OVVA 1FJPA 3P7KA 1NTZK 3M9HA 1RY3A 5AVSB 1SFCD 4N78D 2KLUA 1RE4A 4L76A 1WT6A 5GTIH 1OIPA 2E74D 1ZP0C 1HH0A 4GKGA 2A06E 4LC1A 1KILC 3FXEA 2JEEA 4W80A 4PD4I 1BGYE 1M90Q 3H1KG 1BCCJ 2HODA 1NTKG 3GMAA 3ITKA 1SQXJ 1VPCA 3Q1MA 4YXDC 1SQBE 3HTKA 1EDKA 1EDLA 3BCCE 3L71J 1VQOP 1NYHA 3RL0D 1FZCB 1LT9B 3V5BA 3CWBJ 1DX7A 1ZV8A 3GHGC 3CD6P 5AVRB 1PIXA 1M1JA 1NAYA 1YTZI 2N1TA 3R2PA 5KLVG 4JYCA 2QJKC 2BCCD 2O1JA 5KLIC 3HD7B 3L72D 2OYHB 1MV8A 3D70A 4JF7A 1GK6A 2NRGA 1KQLA 1NTKK 2ZT9B 1VQ6P 2ZFCA 5AW8B 3H32A 2K9YA 3CCQP 3H1KJ 1X0TA 2W27A 4PV1C 1FDMA 1NTZD 3CI9A 3G6EP 1KFMA 4WBAA 1LGHB 3O8ZA 5KLVK 4ZKUA 3AE8C 3FGAD 1K04A 1YJWP 4AUWA 2CPBA 1KD1Q 1FZEA 5AVUB 3L70G 2KUBA 3II6A 3RBXA 1KTMA 5KLVJ 4OGQB 3H1HD 4K35A 3H1JG 1SS1A 1BDCA 3L72E 3E1RA 2FYUG 1HF9A 1KN7A 4NPDA 3AEDC 4ASVA 1A02J 3V2NA 1L4AA 1USDA 3B5NB 1M56D 1RF1C 1U7MA 2ZYAA 2C0XA 5GTIE 1KQGB 1JY2P 2B87A 1HUCA 3RL0g 4DOJA 1NTKD 1KYOH 1AVOA 4EIJA 2E42A 3KPEA 2WVRA 3L70J 1AV1A 3H1JJ 5KKZC 3H1HE 3HRNA 1FDIA 2FFDB 5AW6B 2A45G 1LWUB 2R5DA 1LTTC 2FYUJ 2M3EA 2E5TA 1RE3C 3CCJP 2V7QH 1E5WA 2YIUC 1URQC 2H88C 5KJ7D 1LTIC 2LXCB 3M0AA 1N73B 4BWNA 3HUSC 1SQQD 3QH9A 5AVZB 3MGNA 2FYZA 3FWLA 3RK2C 1R5SA 2WSEH 1NU1G 2YMYA 3PLNA 1H8AA 1N7SA 5BU8B 1HWTC 1S9KE 2H7HA 3VP8A 2AXTH 3AE5C 1ZR2A 1PFIA 1KYOD 4DT0A 2D2CB 2RH0A 2RKLA 1ZLLA 4A7PA 2FKWB 4DCKA 5AVWB 2RN0A 3WUVA 1H0TB 1T3JA 1GL2B 1NU1K 4C46A 1QVFO 3L35A 1FZCA 3OA7A 5B66H 2N9BA 1SFCC 3KXDA 5APWA 4AYCA 1SQQE 2XKMA 2E74C 1VQKP 3HD7D 4O9BA 1T6AA 4I7ZC 1DIPA 2R44A 1LP1A 3TGUE 2OYHA 1KYOI 4I6MC 5B5EH 2P7JA 4WWIA 3H1IG 2FBWC 1KILA 3KQGA 5L8RJ 1VF5C 1J1EC 2LR2A 2HG5D 1PPJE 4HB1A 2BEZF 1K05A 1AVYA 1AFOA 3D6YA 2HPCB 1VQ8P 4ZKPA 1KYOE 2E75B 1X22A 3BATA 3CXHH 4NPEA 1FBMA 1SLQA 2N1TC 2PRRA 4UB8E 1N2DC 2I8DA 4MN4C 1ZW0A 3CCMP 1HTLC 1KMIZ 4OGQD 1IFIA 4U3FD 2QJYC 3C8VA 5H2FE 4D6TE 5EFWB 2HR3A 2QSIA 4GOFA 1NU1D 1PP9E 3TDKA 4ZMDA 3H1IJ 3GLMA 1LT1A 2P67A 4H44C 1BE3D 3RL0B 5C39A 3TYYA 2FXMA 3B5NA 2M0BA 1VQMP 4IL6H 2WQYC 1KQFB 1FOSF 2XU6A 2AXTE 5CCHD 4JPZB 1GTWA 1CW5A 2CPSA 4XFJA 2W6AA 2Y9YA 3WU2H 5CCHA 3AE4C 1S3JA 1JUNA 1PZQA 2E43A 2YO2A 2FYNB 3VN0A 3CLQA 1T8ZA 2P10A 3L73E 1U7JA 2WSCJ 4U3FE 2Q5UA 1OZHA 2IFNA 2JO1A 3TK1A 3AE9C 1GK4A 1RF1A 2XNDH 1IFJA 3SFDC 1BE3E 4PJ0H 5APYA 3O6QA 4M3LA 1KC8Q 4IFFA 2KNCB 5AW2B 5B5EE 4C7NB 4TT3H 1GDTA 3G3ZA 3D6ZA 2M5AA 4H0LB 4HKZH 1RHZB 1VQ4P 1W2EA 5CBNA 1OXZA 2POHA 2PGDA 1JB0J 2FXOA 1MKMA 3CXHE 4LGDE 2BEQD 1SQPG 1J1DB 4YXWH 4IFDK 4HJGH 2QM8A 5CCGD 3TNUA 1H88A 1JCDA 1GL2D 1URQA 5GTHH 4GDOA 2OYIB 3JCUE 3HUSA 1GU4A 4IFMA 1EC5A 2AEFA 4BXLA 4WB4A 1FC2C 4IL6X 5CHXA 1W2BO 2KB7P 4H13D 3EWKA 3TSIA 2IZ1A 2LKMA 3WUUA 1XTCC 1SQXG 2PAJA 1VDFA 1FAVA 3CCRP 2Z5IA 3L71G 1OX3A 3M9BA 4IL6E 1SQPJ 3WUTA 3E7KA 3VOPA 3L75D 1FZCC 2E75D 1LT9C 1HJBA 4I2LC 2M3BA 1GZLA 3G9RA 1SQVG 1NWQA 2Y0EA 1Y9BA 1S5LH 3AE7C 3AEBC 2CK3H 1L0NE 1SFCA 3HD7C 3L72J 4Z1MH 2OYHC 1SQXK 3AE1C 3PRJA 5BU5A 2ZT9C 2YKQA 1QEXA 2Y0DA 4BRYB 1PGPA 4WY4B 3AEEC 4PJ0E 3JC22 3Q5SA 4OVNF 1SQVK 4PD4E 1LTGC 2J5UA 2ZXXA 1JEKA 3B8EB 3M91A 1HJ0A 2O01J 1JMBA 4N3YB 3S4RA 1SQVJ 3PJSK 2IZ0A 3BRTB 1AJYA 1GU5A 4OGQC 1HGVA 4UB6H 3BRVB 4N78E 1LTAC 2K9JB 1EZVD 4L74A 2GM4A 4KHXA 1ZN5A 3AE2C 3CC7P 2IBZG 5GTHE 3B5NC 4GIFA 2I1JA 2JJLA 1G1IA 2IYPA 1RH5B 1BCCD 5E79E 3V6IA 1SQXD 1FJKA 5CCHC 2XNXA 1FZGA 1A02F 2R3SA 3TGUG 1P84D 3L71D 2ZVOB 3CCSP 3B4SA 1TU3F 2B89A 5APTA 3A0HH 3CWBD 1S5LX 1EZVI 4H0LD 2KNCA 3PTZA 2O01N 4C7NA 3GF3A 2ZVNB 2W6BA 2VRSA 2BCCE 3SWFA 1IO4A 2H89C 2FFDC 1LWUC 3B71A 4I1LA 1JTHA 1UIIA 1ZRTD 1S5LE 3R4YA 3VP9A 1T3UA 2E76D 2KYVA 1N73C 4JYBA 1NTZE 3T97B 1P84I 5CMZA 3H1KD 3S9OA 3I56P 3VTPC 2OTKE 1KQSO 2K88A 2ZAEB 2WSSH 2IFMA 4D6TG 3TGUJ 2FYUK 2AEMA 3CWBE 5APQA 2WTYA 3CPWO 3L36A 2NPSB 5KLVD 2D2CC 2YKPA 4K3AA 5AVVB 1RF0A 5CCGC 1N86A 4YPCA 3GF7A 1Q82Q 2QIWA 1VQPP 1ZRTE 1GL2C 1E79H 4UB6E 5KJ7A 3NXSA 1NTMG 2WWWA 4L73A 1BSNA 5APXA 2YKOA 2WSFH 2IBZD 4QMAA 1JO5A 3L73G 2DW3A 4AQRD 3MP7B 1NTKE 1Q2NA 1XTGB 2V7QJ 4D6TJ 4IOIH 1PP9J 1JMMA 2L91A 2QM7A 3IN6A 2A45H 2QG4A 3A7OA 1MFZA 1PV3A 3L74G 2P58A 1JM0A 3PHLA 3L70D 4WY4D 1FS0E 2KI7B 3AECC 4BRYA 3I5CA 4XA4A 4WY4A 1VQ5P 3H1JD 1NTMK 5KLVE 2E75C 2OGUA 1Z56A 3A0HE 1G2CB 1WRGA 2FYUD 3LIEA 2C9LY 1IFPA 5KAIH 2Q1KA 1LT9A 2IBZI 2KS1B 2IPPA 4N6JA 1NTMJ 2WPSA 1X8YA 3Q3DA 2I1KA 1T2KD 1FZAA 4Y99B 1VQLP 3L73J 4H13B 3HD7A 2RMZA 1L0LG 4HYTB 1LNQA 2K9JA 3IFMA 2Q3IA 2ZJSE 3L74J 2R32A 1DD3A 1HVVA 3WMM0 4GODA 3AE6C 3RL0C 3L70E 3P8CD 4EOTA 1VL2A 1S1CX 2R5BA 3H1JE 2YXRB 1UIXA 4OH8B 1EQ7A 1YYCA 4LLHA 3CX5H 1GD2E 1USEA 3SFEC 3F89A 2FYUE 1W5CE 1R5LA 2ZXEB 3Q5RA 2HYNA 1L0LK 1KB9H 1NHLA 1HGZA 5AVYB 5KTBA 2FYNC 3A5TA 1FE6A 3H1LG 1AA0A 3V2PA 1NGMB 1EDIA 2E5YA 1L0LJ 2GUSA 2UWJE 2W83C 3KZIH 3OJAB 4DZOA 3CCVP 1KORA 2QRXA 3A0BH 3K5BA 2HODB 1PGOA 2A45I 2WZ7A 3HTKB 1L0NG 3F5HA 1VQNP 1YQ4C 2A06G 3T97A 3EQ2A 1BGYG 1YTZT 3TF5A 4H0LC 1M1JB 2P1JA 3V2QA 1KFNA 1SQBG 3U1AA 2WSCH 1DD4A 4R4LA 3BCCG 3IF4A 3NMDA 1D7MA 1OMIA 3CX5D 3KDPB 4XE5B 3H1LJ 3U59A 1M7LA 2NPSD 1J1DC 4EYYQ 2FFDA 1LWUA 5B66E 2Z5HA 1R8EA 1KB9D 3AEGC 1NU1E 2V4HA 3BVHA 3H32B 3H6PA 1LTJB 2Q9IA 1NJIQ 1KV4A 3L4FA 2K3RA 3H1ID 2OYOA 1L0NJ 1N73A 2OYIC 3D71A 2IYOA 4H44B 2QJPB 1Q81Q 4Y28J 1OFCX 1BGYJ 1WMKA 1M1KQ 1X9VA 3RK3B 3CX5I 3CC4P 2YO3A 3CMAP 4U7JA 1SQBJ 4R4MA 2O1KA 1RF0C 3BCCJ 1NKZB 1NH4A 1KB9I 4W7YA 2JR8A 5KJ7C 1OVRA 2E76B 2QE7H 1L4AB 5CCGA 3MD0A 4HH2A 4L75A 1MUUA 1H0TA 3OAKA 1GL2A 2BCCG 2QVAA 3Q2YA 3L72G 3MTUE 2KS1A 2FY8A 3P32A 2WITA 1DH3A 1SQPK 3KZIE 4JBZA 4W7ZA 2B88A 2P2UA 2Q7CA 3LW5H 1LTBC 4WY4C 1NTZG 2YXQB 5AW4B 2H8PD 2KSEA 3BASA 4KJMA 4DJGA 2PP6A 3WU2E 2HPCA 5AW3B 1M8OB 2KZIA 3EFGA 1JY2N 3H1HG 1T2KC 2BCCJ 2WPVB 3LIDA 1AQ5A 3IR9A 1M57D 2SPZA 1N7SB 1AQTA 1PGJA 1NVOA 3FWNA 1P84H 3M06A 1FZBA 1L2PA 2WT7B 1JNMA 1YIJP 1GW4A 1YHQP 2B9BA 1N8RQ 3HE5B 1NTZJ 2O01H 1KZUB 3AEFC 2FXPA 1VF5D 2IDBA 3L75E 1SQPD 3S1KA 1QVGO 1CI6B 2MJZA 2L5GB 3SWYA 2LXBA 3H1HJ 2N1TD 1YITP 2KIKA 3PH0A 3AE3C 1RQVA 1N7LA 2KOGA 1K9MQ 1GMJA 2Z4EA 3FXDA 1LP1B 1LTSC 4CPGA 4JQ0D 3VMXA 1OW8A 1KILB 1QGKB 1BDDA 3AEAC 1SQQG 2JDIH 2M8RA 1LTJA 1YI2P 1IZNB 1NTKJ 5CJ4A 4H44D 1SVFA 1SQPE 1PPJG 1HBWA 3GHGB 2JWAA 3M0DA 3MZWB 1SQVD 3UIAA 2J58A 3RK3D 3V4QA 2QJKB 5KLIB 2NPSC 4EDFA 1EZVE 1SQQK 2Y9ZA 1Q7YQ 1FZFA 3G4SP 1FDOA 5APUA 3L37A 3V2RA 1IFDA 1S2EA 1L4AD 2AEJA 2JWDA 1SQQJ 4PV1B 3KYQA 1BCCE 2W8ZA 5AVXB 1SQXE 2OYIA 1ZMEC 3CMEP 2R3CA 1JY3N 1PP9G 1P84E 3L71E 1K8AQ 1OWAA 2KZJA 1S9KD 2IX7C 1RQUA 1SQVE 3RK3E 4UB8H 3RBZA 3CCUP 2OTLP 1CZQA 3I55P 4RJTA 3H25A 3MIWA 1IK7A 1YJ9P 1IFMA 2MKVA 1RF1B 2W6JH 5H2FH 1EXJA 3H1KE 1VQ9P 1Y47A 2HFED 1G1JA 5AW0B 4U3FG 1S72P 3O6QB 4Y99C 1Q86Q 4H13C 3C9IA 1NKNA 2M5AB 4NPFX 2KSJA 3CL3D 1N7SD 2AXCA 3TGUD 2WSFJ 3MHVA 1PGQA 2WSEJ 5AW9B 1BE3G 5AVTB 4ZNCA 2PFXA 2BASA 2JKVA 1PPJD 5KKZB 1BSHA 2WT7A 3USSA
chains in the Genus database with same CATH topology
3M9BA 2P1JA 2XZRA 3MUDA 3HE5A 3V2QA 1KFNA 3II6A 3U1AA 5BVZA 2WSCH 3VOPA 1J2JB 1FZCC 1LT9C 1HJBA 4I2LC 2M3BA 1GZLA 3NMDA 3TNUB 1NWQA 3KDPB 4XE5B 3U59A 1M7LA 2NPSD 1URQB 1J1DC 2FFDA 3VMYA 1LWUA 5APSA 3HUSB 2Z5HA 1A02J 3V2NA 2YNYA 1CI6A 3BVHA 2KLVA 1SFCA 1RE4C 3H32B 3H6PA 1L4AA 3HD7C 1IJDB 1LTJB 2Q9IA 3RK2B 3B5NB 2OYHC 1SQXK 5CJ0A 1RF1C 3L4FA 5BU5A 1GW3A 2XDJA 2YKQA 2C0XA 1N73A 2OYIC 4WY4B 1JY2P 1KILD 1HUCA 2OARA 1X79B 2GUVA 4DOJA 2WPQA 5AVQB 1SQVK 4EIJA 1X9VA 2E42A 2HLOA 3RK3B 1LTGC 3U1CA 3KPEA 3HE4B 2YO3A 1CSBA 1SP4A 3B8EB 2O1KA 3M91A 1RF0C 1NKZB 1NH4A 3HRNA 4N3YB 1M1JC 4W7YA 2FFDB 5AW6B 2A45G 1LWUB 2R5DA 3BRTB 1LTTC 2KP8A 1QL1A 1GU5A 5KJ7C 1HGVA 1SFCB 1L4AB 3BRVB 3GHGA 4N78E 3V4WA 1RE3C 5CCGA 3MD0A 4HH2A 1LTAC 1MUUA 1E5WA 3OAKA 1URQC 5KJ7D 1GL2A 1JY3P 1LTIC 3M0AA 2GM4A 4KHXA 1JY2O 1N73B 3MTUE 1ZN5A 1JOCA 3HUSC 1H89A 5AVZB 3MGNA 1IC2A 1QL2A 2WITA 3P32A 2FYZA 1LTJC 3RK2C 3B5NC 2WSEH 2YMYA 4GIFA 2H43A 2I1JA 1J1EB 2JJLA 1G1IA 1DH3A 1H8AA 1SQPK 3P8CE 1NOHA 4W7ZA 1N7SA 5BU8B 1HWTC 3B5ND 1S9KE 1IFNA 2P2UA 2Q7CA 3LW5H 1LTBC 4WY4C 2H7HA 3M0DC 1FJKA 4GT1A 3VP8A 3E1IA 5CCHC 2XNXA 1FZGA 1A02F 2N1TB 1ZR2A 1PFIA 5AW4B 2H8PD 5APTA 3RK3C 3BASA 1ZLLA 2PP6A 2HPCA 4C7NA 2FKWB 4B86A 2W6BA 2VRSA 5AVWB 5AW3B 3SWFA 3NFQA 1IO4A 3EFGA 3N4XA 1JY2N 2XV5A 1GL2B 1MZ9A 1T3JA 1NU1K 2J59M 2FFDC 4C46A 1L0NK 2NPSA 3NTNA 1LWUC 3L35A 4I1LA 1T2KC 1FZCA 1JTHA 3OA7A 3A2AA 2N9BA 3P8MC 1SFCC 1L4AC 3LIDA 1AQ5A 5APWA 4AYCA 2XKMA 3IR9A 5AW5B 3VP9A 1T3UA 3HD7D 4O9BA 1N7SB 2KYVA 1N73C 4JYBA 1SQBK 4C7RA 5CMZA 2OYHA 3VTPC 4I6MC 2P7JA 3M06A 1FZBA 2WT7B 1JNMA 1KILA 3KQGA 1J1EC 1GW4A 2HG5D 3HE5B 2IFMA 2FYUK 3N7NA 2O01H 1KZUB 1AFOA 2HPCB 4ZKPA 1FU1A 1IK9A 3BATA 5APQA 2WTYA 1FBMA 1SLQA 3L36A 2C0WA 2N1TC 1N2DC 2NPSB 2YKPA 1CI6B 1JTHB 2L5GB 2MJZA 3SWYA 1HTLC 5AVVB 1RF0A 2N1TD 5CCGC 1N86A 1N7LA 2KOGA 1G2CA 3PP5A 1GL2C 1IFIA 3VYIA 1JCCA 1DEBA 5KJ7A 2WPRA 2Z4EA 3NXSA 3M9QA 2WWWA 1LTSC 2YKOA 5APXA 1URQD 3VMXA 2WSFH 1RE3A 5AW1B 5APVA 1KILB 1JO5A 4AQRD 1XTGB 2M8RA 3RK2D 2P67A 1N7SC 3A3YB 3RL0B 3TYYA 1LTJA 2FXMA 1JMMA 3B5NA 2QM7A 2A45H 3A7OA 1MFZA 5CJ4A 1SVFA 4WY4D 1NAFA 1FOSF 2XU6A 3I5CA 4XA4A 5CCHD 1HBWA 1GTWA 3GHGB 4WY4A 1CW5A 2C9NY 2CPSA 1JY3O 3M0DA 1NTMK 2W6AA 5CCHA 1Z56A 3UIAA 2J58A 3RK3D 1JUNA 2E43A 1FOSE 2YO2A 1G2CB 3V4QA 1ZR4A 1WRGA 3LIEA 3VN0A 2C9LY 2NPSC 1NO4A 1LT9A 3HE4A 3CLQA 2IPPA 1T8ZA 1SQQK 4N6JA 2WPSA 4RESB 5AW7B 3VMZA 1X8YA 1FZFA 2I1KA 1T2KD 2Q5UA 1FZAA 3P7KA 1FJPA 1NTZK 5APUA 3M9HA 3L37A 1RY3A 5AVSB 3V2RA 1SFCD 1IFDA 4Y99B 1L4AD 2IFNA 4N78D 3HD7A 1RE4A 1WT6A 3TK1A 1GK4A 1RF1A 1HH0A 3KYQA 4GKGA 4HYTB 1IFJA 4LC1A 1KILC 5AVXB 5APYA 3IFMA 2JEEA 2OYIA 2Q3IA 4M3LA 4W80A 2R32A 2R3CA 1JY3N 1HVVA 4IFFA 3WMM0 5AW2B 4C7NB 3RL0C 1GDTA 2HODA 3G3ZA 3P8CD 1VPCA 4EOTA 1OWAA 3HTKA 1W2EA 2R5BA 1S9KD 1OXZA 4OH8B 2IX7C 2POHA 3RL0D 1FZCB 1LT9B 1EQ7A 3V5BA 1YYCA 4LLHA 1GD2E 1DX7A 1CZQA 1ZV8A 4LGDE 3GHGC 5AVRB 1J1DB 1M1JA 2ZXEB 1YTZI 2N1TA 2HYNA 3R2PA 1L0LK 4IFDK 1NHLA 3MIWA 1HGZA 4JYCA 5AVYB 5KTBA 3A5TA 2O1JA 3HD7B 2QM8A 5CCGD 2OYHB 1IFMA 1MV8A 3TNUA 1H88A 1RF1B 1JCDA 1GK6A 4JF7A 1GL2D 3V2PA 1KQLA 1NTKK 1URQA 2GUSA 2HFED 2OYIB 1G1JA 5AW0B 2ZFCA 5AW8B 3HUSA 3OJAB 4Y99C 4DZOA 1GU4A 4IFMA 3H32A 4WB4A 2HODB 3C9IA 1NKNA 5CHXA 2A45I 2WZ7A 2W27A 2KSJA 3HTKB 1FDMA 3CL3D 3CI9A 1N7SD 1KFMA 2KB7P 4WBAA 1LGHB 3TSIA 5AW9B 2LKMA 3O8ZA 5KLVK 1XTCC 5AVTB 2PAJA 2BASA 4ZKUA 1VDFA 3T97A 1FAVA 3EQ2A 4AUWA 2CPBA 1FZEA 2Z5IA 1YTZT 1M1JB 5AVUB 2WT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L36 A;  1SLQ A;  3M9B A;  2XZR A;  3TK1 A;  5AVZ B;  3HE5 A;  3MGN A;  3P32 A;  1GK4 A;  4GKG A;  4HYT B;  1CI6 B;  1J2J B;  2JJL A;  4LC1 A;  1HJB A;  1DH3 A;  4I2L C;  1H8A A;  5AVX B;  1GZL A;  5APY A;  3NMD A;  5AVV B;  3TNU B;  1NWQ A;  2Q3I A;  4M3L A;  3KDP B;  4XE5 B;  2R32 A;  2R3C A;  1HWT C;  5AW2 B;  1S9K E;  4C7N B;  2P2U A;  2Q7C A;  3VMY A;  2H7H A;  3VYI A;  4GT1 A;  5APS A;  4EOT A;  1OWA A;  2Z5H A;  2WPR A;  3NXS A;  1A02 J;  2YNY A;  3HTK A;  1CI6 A;  1A02 F;  2WWW A;  2R5B A;  5APX A;  5AW4 B;  1S9K D;  3VMX A;  1OXZ A;  5AW1 B;  5APT A;  5APV A;  3V5B A;  1YYC A;  1GD2 E;  4C7N A;  4B86 A;  1CZQ A;  4AQR D;  2VRS A;  5AVW B;  5AW3 B;  5AVR B;  3SWF A;  3NFQ A;  1IO4 A;  2P67 A;  3A3Y B;  2ZXE B;  2XV5 A;  3TYY A;  1HUC A;  4C46 A;  3NTN A;  3L35 A;  4JYC A;  5AVY B;  1T2K C;  3A5T A;  2WPQ A;  2QM8 A;  2QM7 A;  5AVQ B;  3A2A A;  3A7O A;  1MFZ A;  2N9B A;  3P8M C;  1MV8 A;  3LID A;  3TNU A;  2E42 A;  1H88 A;  1GK6 A;  1NAF A;  3HE4 B;  5APW A;  4AYC A;  2YO3 A;  1FOS F;  1CSB A;  1KQL A;  2XU6 A;  3I5C A;  1HBW A;  1GTW A;  3IR9 A;  5AW5 B;  1SP4 A;  2C9N Y;  3B8E B;  3M0D A;  3M91 A;  5AW0 B;  2ZFC A;  2W6A A;  5AW8 B;  1GU4 A;  4DZO A;  4JYB A;  3UIA A;  1JUN A;  2E43 A;  2WTY A;  1FOS E;  5AW6 B;  5CMZ A;  2YO2 A;  1G2C B;  2R5D A;  3V4Q A;  3VTP C;  2KP8 A;  4I6M C;  3LIE A;  3VN0 A;  2C9L Y;  2P7J A;  3M06 A;  2WT7 B;  1GU5 A;  2W27 A;  3HE4 A;  1JNM A;  3KQG A;  2IPP A;  3HE5 B;  2WPS A;  3V4W A;  4RES B;  5AW9 B;  5AW7 B;  3O8Z A;  1X8Y A;  3MD0 A;  3VMZ A;  5AVT B;  1MUU A;  2Q5U A;  1T2K D;  2BAS A;  3OAK A;  3P7K A;  5APU A;  3T97 A;  1FAV A;  3L37 A;  3M0A A;  3M9H A;  5AVS B;  4AUW A;  4KHX A;  2Z5I A;  5AVU B;  5APQ A;  2WT7 A;  1H89 A; 
#chains in the Genus database with same CATH topology
 5KAF H;  2XZR A;  3MUD A;  2Q6Q A;  3HE5 A;  3CC2 P;  5BVZ A;  1J2J B;  1Y8A A;  3TNU B;  3ZDM A;  2YIU B;  1URQ B;  2Y0C A;  3VMY A;  5APS A;  3HUS B;  2G3A A;  2IBZ E;  2JP3 A;  3JSV C;  2YNY A;  1CI6 A;  2KLV A;  1RE4 C;  4U3F J;  1IJD B;  3RK2 B;  5CJ0 A;  5K5G B;  2KXP B;  1GW3 A;  2XDJ A;  5TIS H;  1NU1 J;  1OW7 A;  4D6T D;  1LJ2 A;  2QA4 P;  1PP9 D;  1BE3 J;  1KIL D;  2OAR A;  1X79 B;  2GUV A;  2ZT9 D;  2WPQ A;  5AVQ B;  4WVZ A;  1OW6 A;  3VMA A;  5DJT B;  3CCL P;  2HLO A;  3U1C A;  2ZYG A;  3HE4 B;  5DJU B;  1CSB A;  1SP4 A;  1QX8 A;  3KHU A;  1M1J C;  2KP8 A;  3G71 P;  1QL1 A;  1SFC B;  1NTM D;  3GHG A;  3V4W A;  2K37 A;  2E74 B;  1JY3 P;  3C1L A;  1JY2 O;  4I7Z B;  3L73 D;  3QWO C;  1JOC A;  2Q3E A;  1H89 A;  3JCU H;  1IC2 A;  1QL2 A;  1LTJ C;  2H43 A;  1VF5 B;  1J1E B;  1KIL E;  3P8C E;  1NOH A;  3L74 D;  3W67 A;  3B5N D;  4PV1 D;  2QJP C;  1IFN A;  3M0D C;  4GT1 A;  2WMM A;  3E1I A;  2N1T B;  4ASW A;  3SWK A;  3RK3 C;  3W68 A;  2ZYD A;  4B86 A;  5KAF E;  3NFQ A;  3N4X A;  1NTM E;  5KAI E;  2XV5 A;  1MZ9 A;  2J59 M;  1L0N K;  2NPS A;  3CXH D;  3NTN A;  3L75 G;  1OVU A;  2W90 A;  1K73 Q;  3A2A A;  2QJY B;  2E76 C;  3P8M C;  4RKU J;  1L4A C;  2KK7 A;  1ZXG A;  1L0L D;  5AW5 B;  5M1B A;  3FX0 A;  3Q5P A;  1SQB K;  4C7R A;  3ABV C;  2OQQ A;  1EDJ A;  3L74 E;  5TIS E;  1DEE G;  1YBK A;  1QLE D;  3N7N A;  2NZ2 A;  2K1A A;  1U57 A;  4GOE A;  4PD4 H;  1FU1 A;  1YQ3 C;  3CXH I;  1IK9 A;  3EFF K;  4KT0 J;  2GA1 A;  2C0W A;  3CX5 E;  3GW6 A;  5CBO A;  4EI2 A;  1JTH B;  1EXI A;  3L75 J;  2N9Y B;  3H1L D;  1YJN P;  1KB9 E;  2D2C D;  4TLF A;  1MFT A;  1G2C A;  3PP5 A;  3VYI A;  1JCC A;  4RO0 A;  1DEB A;  2WPR A;  2YMK A;  1L0L E;  1ZOY C;  3M9Q A;  3CCE P;  3H1I E;  2B87 B;  1URQ D;  1RE3 A;  5AW1 B;  1EZV G;  5APV A;  1L0N D;  3SSU A;  3A0B E;  3RK2 D;  1N7S C;  3A3Y B;  2A06 D;  2O3J A;  3IAO A;  1PL5 A;  5E79 H;  1BGY D;  3MUD C;  1BCC G;  1NAF A;  2OTJ P;  5TJH A;  1SQB D;  1VQ7 P;  2C9N Y;  3BCC D;  1JY3 O;  4PD4 D;  3LW5 J;  1FOS E;  1S4X A;  4YTP C;  2QEX P;  2ITA A;  3H1L E;  1ZR4 A;  3RGU A;  3CWB G;  1NO4 A;  3HE4 A;  4OWF A;  4RES B;  1Q90 D;  3GG2 A;  5AW7 B;  3VMZ A;  2G8Y A;  3OW2 O;  1OVV A;  1FJP A;  3P7K A;  1NTZ K;  3M9H A;  1RY3 A;  5AVS B;  1SFC D;  4N78 D;  2KLU A;  1RE4 A;  4L76 A;  1WT6 A;  5GTI H;  1OIP A;  2E74 D;  1ZP0 C;  1HH0 A;  4GKG A;  2A06 E;  4LC1 A;  1KIL C;  3FXE A;  2JEE A;  4W80 A;  4PD4 I;  1BGY E;  1M90 Q;  3H1K G;  1BCC J;  2HOD A;  1NTK G;  3GMA A;  3ITK A;  1SQX J;  1VPC A;  3Q1M A;  4YXD C;  1SQB E;  3HTK A;  1EDK A;  1EDL A;  3BCC E;  3L71 J;  1VQO P;  1NYH A;  3RL0 D;  1FZC B;  1LT9 B;  3V5B A;  3CWB J;  1DX7 A;  1ZV8 A;  3GHG C;  3CD6 P;  5AVR B;  1PIX A;  1M1J A;  1NAY A;  1YTZ I;  2N1T A;  3R2P A;  5KLV G;  4JYC A;  2QJK C;  2BCC D;  2O1J A;  5KLI C;  3HD7 B;  3L72 D;  2OYH B;  1MV8 A;  3D70 A;  4JF7 A;  1GK6 A;  2NRG A;  1KQL A;  1NTK K;  2ZT9 B;  1VQ6 P;  2ZFC A;  5AW8 B;  3H32 A;  2K9Y A;  3CCQ P;  3H1K J;  1X0T A;  2W27 A;  4PV1 C;  1FDM A;  1NTZ D;  3CI9 A;  3G6E P;  1KFM A;  4WBA A;  1LGH B;  3O8Z A;  5KLV K;  4ZKU A;  3AE8 C;  3FGA D;  1K04 A;  1YJW P;  4AUW A;  2CPB A;  1KD1 Q;  1FZE A;  5AVU B;  3L70 G;  2KUB A;  3II6 A;  3RBX A;  1KTM A;  5KLV J;  4OGQ B;  3H1H D;  4K35 A;  3H1J G;  1SS1 A;  1BDC A;  3L72 E;  3E1R A;  2FYU G;  1HF9 A;  1KN7 A;  4NPD A;  3AED C;  4ASV A;  1A02 J;  3V2N A;  1L4A A;  1USD A;  3B5N B;  1M56 D;  1RF1 C;  1U7M A;  2ZYA A;  2C0X A;  5GTI E;  1KQG B;  1JY2 P;  2B87 A;  1HUC A;  3RL0 g;  4DOJ A;  1NTK D;  1KYO H;  1AVO A;  4EIJ A;  2E42 A;  3KPE A;  2WVR A;  3L70 J;  1AV1 A;  3H1J J;  5KKZ C;  3H1H E;  3HRN A;  1FDI A;  2FFD B;  5AW6 B;  2A45 G;  1LWU B;  2R5D A;  1LTT C;  2FYU J;  2M3E A;  2E5T A;  1RE3 C;  3CCJ P;  2V7Q H;  1E5W A;  2YIU C;  1URQ C;  2H88 C;  5KJ7 D;  1LTI C;  2LXC B;  3M0A A;  1N73 B;  4BWN A;  3HUS C;  1SQQ D;  3QH9 A;  5AVZ B;  3MGN A;  2FYZ A;  3FWL A;  3RK2 C;  1R5S A;  2WSE H;  1NU1 G;  2YMY A;  3PLN A;  1H8A A;  1N7S A;  5BU8 B;  1HWT C;  1S9K E;  2H7H A;  3VP8 A;  2AXT H;  3AE5 C;  1ZR2 A;  1PFI A;  1KYO D;  4DT0 A;  2D2C B;  2RH0 A;  2RKL A;  1ZLL A;  4A7P A;  2FKW B;  4DCK A;  5AVW B;  2RN0 A;  3WUV A;  1H0T B;  1T3J A;  1GL2 B;  1NU1 K;  4C46 A;  1QVF O;  3L35 A;  1FZC A;  3OA7 A;  5B66 H;  2N9B A;  1SFC C;  3KXD A;  5APW A;  4AYC A;  1SQQ E;  2XKM A;  2E74 C;  1VQK P;  3HD7 D;  4O9B A;  1T6A A;  4I7Z C;  1DIP A;  2R44 A;  1LP1 A;  3TGU E;  2OYH A;  1KYO I;  4I6M C;  5B5E H;  2P7J A;  4WWI A;  3H1I G;  2FBW C;  1KIL A;  3KQG A;  5L8R J;  1VF5 C;  1J1E C;  2LR2 A;  2HG5 D;  1PPJ E;  4HB1 A;  2BEZ F;  1K05 A;  1AVY A;  1AFO A;  3D6Y A;  2HPC B;  1VQ8 P;  4ZKP A;  1KYO E;  2E75 B;  1X22 A;  3BAT A;  3CXH H;  4NPE A;  1FBM A;  1SLQ A;  2N1T C;  2PRR A;  4UB8 E;  1N2D C;  2I8D A;  4MN4 C;  1ZW0 A;  3CCM P;  1HTL C;  1KMI Z;  4OGQ D;  1IFI A;  4U3F D;  2QJY C;  3C8V A;  5H2F E;  4D6T E;  5EFW B;  2HR3 A;  2QSI A;  4GOF A;  1NU1 D;  1PP9 E;  3TDK A;  4ZMD A;  3H1I J;  3GLM A;  1LT1 A;  2P67 A;  4H44 C;  1BE3 D;  3RL0 B;  5C39 A;  3TYY A;  2FXM A;  3B5N A;  2M0B A;  1VQM P;  4IL6 H;  2WQY C;  1KQF B;  1FOS F;  2XU6 A;  2AXT E;  5CCH D;  4JPZ B;  1GTW A;  1CW5 A;  2CPS A;  4XFJ A;  2W6A A;  2Y9Y A;  3WU2 H;  5CCH A;  3AE4 C;  1S3J A;  1JUN A;  1PZQ A;  2E43 A;  2YO2 A;  2FYN B;  3VN0 A;  3CLQ A;  1T8Z A;  2P10 A;  3L73 E;  1U7J A;  2WSC J;  4U3F E;  2Q5U A;  1OZH A;  2IFN A;  2JO1 A;  3TK1 A;  3AE9 C;  1GK4 A;  1RF1 A;  2XND H;  1IFJ A;  3SFD C;  1BE3 E;  4PJ0 H;  5APY A;  3O6Q A;  4M3L A;  1KC8 Q;  4IFF A;  2KNC B;  5AW2 B;  5B5E E;  4C7N B;  4TT3 H;  1GDT A;  3G3Z A;  3D6Z A;  2M5A A;  4H0L B;  4HKZ H;  1RHZ B;  1VQ4 P;  1W2E A;  5CBN A;  1OXZ A;  2POH A;  2PGD A;  1JB0 J;  2FXO A;  1MKM A;  3CXH E;  4LGD E;  2BEQ D;  1SQP G;  1J1D B;  4YXW H;  4IFD K;  4HJG H;  2QM8 A;  5CCG D;  3TNU A;  1H88 A;  1JCD A;  1GL2 D;  1URQ A;  5GTH H;  4GDO A;  2OYI B;  3JCU E;  3HUS A;  1GU4 A;  4IFM A;  1EC5 A;  2AEF A;  4BXL A;  4WB4 A;  1FC2 C;  4IL6 X;  5CHX A;  1W2B O;  2KB7 P;  4H13 D;  3EWK A;  3TSI A;  2IZ1 A;  2LKM A;  3WUU A;  1XTC C;  1SQX G;  2PAJ A;  1VDF A;  1FAV A;  3CCR P;  2Z5I A;  3L71 G;  1OX3 A;  3M9B A;  4IL6 E;  1SQP J;  3WUT A;  3E7K A;  3VOP A;  3L75 D;  1FZC C;  2E75 D;  1LT9 C;  1HJB A;  4I2L C;  2M3B A;  1GZL A;  3G9R A;  1SQV G;  1NWQ A;  2Y0E A;  1Y9B A;  1S5L H;  3AE7 C;  3AEB C;  2CK3 H;  1L0N E;  1SFC A;  3HD7 C;  3L72 J;  4Z1M H;  2OYH C;  1SQX K;  3AE1 C;  3PRJ A;  5BU5 A;  2ZT9 C;  2YKQ A;  1QEX A;  2Y0D A;  4BRY B;  1PGP A;  4WY4 B;  3AEE C;  4PJ0 E;  3JC2 2;  3Q5S A;  4OVN F;  1SQV K;  4PD4 E;  1LTG C;  2J5U A;  2ZXX A;  1JEK A;  3B8E B;  3M91 A;  1HJ0 A;  2O01 J;  1JMB A;  4N3Y B;  3S4R A;  1SQV J;  3PJS K;  2IZ0 A;  3BRT B;  1AJY A;  1GU5 A;  4OGQ C;  1HGV A;  4UB6 H;  3BRV B;  4N78 E;  1LTA C;  2K9J B;  1EZV D;  4L74 A;  2GM4 A;  4KHX A;  1ZN5 A;  3AE2 C;  3CC7 P;  2IBZ G;  5GTH E;  3B5N C;  4GIF A;  2I1J A;  2JJL A;  1G1I A;  2IYP A;  1RH5 B;  1BCC D;  5E79 E;  3V6I A;  1SQX D;  1FJK A;  5CCH C;  2XNX A;  1FZG A;  1A02 F;  2R3S A;  3TGU G;  1P84 D;  3L71 D;  2ZVO B;  3CCS P;  3B4S A;  1TU3 F;  2B89 A;  5APT A;  3A0H H;  3CWB D;  1S5L X;  1EZV I;  4H0L D;  2KNC A;  3PTZ A;  2O01 N;  4C7N A;  3GF3 A;  2ZVN B;  2W6B A;  2VRS A;  2BCC E;  3SWF A;  1IO4 A;  2H89 C;  2FFD C;  1LWU C;  3B71 A;  4I1L A;  1JTH A;  1UII A;  1ZRT D;  1S5L E;  3R4Y A;  3VP9 A;  1T3U A;  2E76 D;  2KYV A;  1N73 C;  4JYB A;  1NTZ E;  3T97 B;  1P84 I;  5CMZ A;  3H1K D;  3S9O A;  3I56 P;  3VTP C;  2OTK E;  1KQS O;  2K88 A;  2ZAE B;  2WSS H;  2IFM A;  4D6T G;  3TGU J;  2FYU K;  2AEM A;  3CWB E;  5APQ A;  2WTY A;  3CPW O;  3L36 A;  2NPS B;  5KLV D;  2D2C C;  2YKP A;  4K3A A;  5AVV B;  1RF0 A;  5CCG C;  1N86 A;  4YPC A;  3GF7 A;  1Q82 Q;  2QIW A;  1VQP P;  1ZRT E;  1GL2 C;  1E79 H;  4UB6 E;  5KJ7 A;  3NXS A;  1NTM G;  2WWW A;  4L73 A;  1BSN A;  5APX A;  2YKO A;  2WSF H;  2IBZ D;  4QMA A;  1JO5 A;  3L73 G;  2DW3 A;  4AQR D;  3MP7 B;  1NTK E;  1Q2N A;  1XTG B;  2V7Q J;  4D6T J;  4IOI H;  1PP9 J;  1JMM A;  2L91 A;  2QM7 A;  3IN6 A;  2A45 H;  2QG4 A;  3A7O A;  1MFZ A;  1PV3 A;  3L74 G;  2P58 A;  1JM0 A;  3PHL A;  3L70 D;  4WY4 D;  1FS0 E;  2KI7 B;  3AEC C;  4BRY A;  3I5C A;  4XA4 A;  4WY4 A;  1VQ5 P;  3H1J D;  1NTM K;  5KLV E;  2E75 C;  2OGU A;  1Z56 A;  3A0H E;  1G2C B;  1WRG A;  2FYU D;  3LIE A;  2C9L Y;  1IFP A;  5KAI H;  2Q1K A;  1LT9 A;  2IBZ I;  2KS1 B;  2IPP A;  4N6J A;  1NTM J;  2WPS A;  1X8Y A;  3Q3D A;  2I1K A;  1T2K D;  1FZA A;  4Y99 B;  1VQL P;  3L73 J;  4H13 B;  3HD7 A;  2RMZ A;  1L0L G;  4HYT B;  1LNQ A;  2K9J A;  3IFM A;  2Q3I A;  2ZJS E;  3L74 J;  2R32 A;  1DD3 A;  1HVV A;  3WMM 0;  4GOD A;  3AE6 C;  3RL0 C;  3L70 E;  3P8C D;  4EOT A;  1VL2 A;  1S1C X;  2R5B A;  3H1J E;  2YXR B;  1UIX A;  4OH8 B;  1EQ7 A;  1YYC A;  4LLH A;  3CX5 H;  1GD2 E;  1USE A;  3SFE C;  3F89 A;  2FYU E;  1W5C E;  1R5L A;  2ZXE B;  3Q5R A;  2HYN A;  1L0L K;  1KB9 H;  1NHL A;  1HGZ A;  5AVY B;  5KTB A;  2FYN C;  3A5T A;  1FE6 A;  3H1L G;  1AA0 A;  3V2P A;  1NGM B;  1EDI A;  2E5Y A;  1L0L J;  2GUS A;  2UWJ E;  2W83 C;  3KZI H;  3OJA B;  4DZO A;  3CCV P;  1KOR A;  2QRX A;  3A0B H;  3K5B A;  2HOD B;  1PGO A;  2A45 I;  2WZ7 A;  3HTK B;  1L0N G;  3F5H A;  1VQN P;  1YQ4 C;  2A06 G;  3T97 A;  3EQ2 A;  1BGY G;  1YTZ T;  3TF5 A;  4H0L C;  1M1J B;  2P1J A;  3V2Q A;  1KFN A;  1SQB G;  3U1A A;  2WSC H;  1DD4 A;  4R4L A;  3BCC G;  3IF4 A;  3NMD A;  1D7M A;  1OMI A;  3CX5 D;  3KDP B;  4XE5 B;  3H1L J;  3U59 A;  1M7L A;  2NPS D;  1J1D C;  4EYY Q;  2FFD A;  1LWU A;  5B66 E;  2Z5H A;  1R8E A;  1KB9 D;  3AEG C;  1NU1 E;  2V4H A;  3BVH A;  3H32 B;  3H6P A;  1LTJ B;  2Q9I A;  1NJI Q;  1KV4 A;  3L4F A;  2K3R A;  3H1I D;  2OYO A;  1L0N J;  1N73 A;  2OYI C;  3D71 A;  2IYO A;  4H44 B;  2QJP B;  1Q81 Q;  4Y28 J;  1OFC X;  1BGY J;  1WMK A;  1M1K Q;  1X9V A;  3RK3 B;  3CX5 I;  3CC4 P;  2YO3 A;  3CMA P;  4U7J A;  1SQB J;  4R4M A;  2O1K A;  1RF0 C;  3BCC J;  1NKZ B;  1NH4 A;  1KB9 I;  4W7Y A;  2JR8 A;  5KJ7 C;  1OVR A;  2E76 B;  2QE7 H;  1L4A B;  5CCG A;  3MD0 A;  4HH2 A;  4L75 A;  1MUU A;  1H0T A;  3OAK A;  1GL2 A;  2BCC G;  2QVA A;  3Q2Y A;  3L72 G;  3MTU E;  2KS1 A;  2FY8 A;  3P32 A;  2WIT A;  1DH3 A;  1SQP K;  3KZI E;  4JBZ A;  4W7Z A;  2B88 A;  2P2U A;  2Q7C A;  3LW5 H;  1LTB C;  4WY4 C;  1NTZ G;  2YXQ B;  5AW4 B;  2H8P D;  2KSE A;  3BAS A;  4KJM A;  4DJG A;  2PP6 A;  3WU2 E;  2HPC A;  5AW3 B;  1M8O B;  2KZI A;  3EFG A;  1JY2 N;  3H1H G;  1T2K C;  2BCC J;  2WPV B;  3LID A;  1AQ5 A;  3IR9 A;  1M57 D;  2SPZ A;  1N7S B;  1AQT A;  1PGJ A;  1NVO A;  3FWN A;  1P84 H;  3M06 A;  1FZB A;  1L2P A;  2WT7 B;  1JNM A;  1YIJ P;  1GW4 A;  1YHQ P;  2B9B A;  1N8R Q;  3HE5 B;  1NTZ J;  2O01 H;  1KZU B;  3AEF C;  2FXP A;  1VF5 D;  2IDB A;  3L75 E;  1SQP D;  3S1K A;  1QVG O;  1CI6 B;  2MJZ A;  2L5G B;  3SWY A;  2LXB A;  3H1H J;  2N1T D;  1YIT P;  2KIK A;  3PH0 A;  3AE3 C;  1RQV A;  1N7L A;  2KOG A;  1K9M Q;  1GMJ A;  2Z4E A;  3FXD A;  1LP1 B;  1LTS C;  4CPG A;  4JQ0 D;  3VMX A;  1OW8 A;  1KIL B;  1QGK B;  1BDD A;  3AEA C;  1SQQ G;  2JDI H;  2M8R A;  1LTJ A;  1YI2 P;  1IZN B;  1NTK J;  5CJ4 A;  4H44 D;  1SVF A;  1SQP E;  1PPJ G;  1HBW A;  3GHG B;  2JWA A;  3M0D A;  3MZW B;  1SQV D;  3UIA A;  2J58 A;  3RK3 D;  3V4Q A;  2QJK B;  5KLI B;  2NPS C;  4EDF A;  1EZV E;  1SQQ K;  2Y9Z A;  1Q7Y Q;  1FZF A;  3G4S P;  1FDO A;  5APU A;  3L37 A;  3V2R A;  1IFD A;  1S2E A;  1L4A D;  2AEJ A;  2JWD A;  1SQQ J;  4PV1 B;  3KYQ A;  1BCC E;  2W8Z A;  5AVX B;  1SQX E;  2OYI A;  1ZME C;  3CME P;  2R3C A;  1JY3 N;  1PP9 G;  1P84 E;  3L71 E;  1K8A Q;  1OWA A;  2KZJ A;  1S9K D;  2IX7 C;  1RQU A;  1SQV E;  3RK3 E;  4UB8 H;  3RBZ A;  3CCU P;  2OTL P;  1CZQ A;  3I55 P;  4RJT A;  3H25 A;  3MIW A;  1IK7 A;  1YJ9 P;  1IFM A;  2MKV A;  1RF1 B;  2W6J H;  5H2F H;  1EXJ A;  3H1K E;  1VQ9 P;  1Y47 A;  2HFE D;  1G1J A;  5AW0 B;  4U3F G;  1S72 P;  3O6Q B;  4Y99 C;  1Q86 Q;  4H13 C;  3C9I A;  1NKN A;  2M5A B;  4NPF X;  2KSJ A;  3CL3 D;  1N7S D;  2AXC A;  3TGU D;  2WSF J;  3MHV A;  1PGQ A;  2WSE J;  5AW9 B;  1BE3 G;  5AVT B;  4ZNC A;  2PFX A;  2BAS A;  2JKV A;  1PPJ D;  5KKZ B;  1BSH A;  2WT7 A;  3USS A; 
#chains in the Genus database with same CATH homology
 3M9B A;  2P1J A;  2XZR A;  3MUD A;  3HE5 A;  3V2Q A;  1KFN A;  3II6 A;  3U1A A;  5BVZ A;  2WSC H;  3VOP A;  1J2J B;  1FZC C;  1LT9 C;  1HJB A;  4I2L C;  2M3B A;  1GZL A;  3NMD A;  3TNU B;  1NWQ A;  3KDP B;  4XE5 B;  3U59 A;  1M7L A;  2NPS D;  1URQ B;  1J1D C;  2FFD A;  3VMY A;  1LWU A;  5APS A;  3HUS B;  2Z5H A;  1A02 J;  3V2N A;  2YNY A;  1CI6 A;  3BVH A;  2KLV A;  1SFC A;  1RE4 C;  3H32 B;  3H6P A;  1L4A A;  3HD7 C;  1IJD B;  1LTJ B;  2Q9I A;  3RK2 B;  3B5N B;  2OYH C;  1SQX K;  5CJ0 A;  1RF1 C;  3L4F A;  5BU5 A;  1GW3 A;  2XDJ A;  2YKQ A;  2C0X A;  1N73 A;  2OYI C;  4WY4 B;  1JY2 P;  1KIL D;  1HUC A;  2OAR A;  1X79 B;  2GUV A;  4DOJ A;  2WPQ A;  5AVQ B;  1SQV K;  4EIJ A;  1X9V A;  2E42 A;  2HLO A;  3RK3 B;  1LTG C;  3U1C A;  3KPE A;  3HE4 B;  2YO3 A;  1CSB A;  1SP4 A;  3B8E B;  2O1K A;  3M91 A;  1RF0 C;  1NKZ B;  1NH4 A;  3HRN A;  4N3Y B;  1M1J C;  4W7Y A;  2FFD B;  5AW6 B;  2A45 G;  1LWU B;  2R5D A;  3BRT B;  1LTT C;  2KP8 A;  1QL1 A;  1GU5 A;  5KJ7 C;  1HGV A;  1SFC B;  1L4A B;  3BRV B;  3GHG A;  4N78 E;  3V4W A;  1RE3 C;  5CCG A;  3MD0 A;  4HH2 A;  1LTA C;  1MUU A;  1E5W A;  3OAK A;  1URQ C;  5KJ7 D;  1GL2 A;  1JY3 P;  1LTI C;  3M0A A;  2GM4 A;  4KHX A;  1JY2 O;  1N73 B;  3MTU E;  1ZN5 A;  1JOC A;  3HUS C;  1H89 A;  5AVZ B;  3MGN A;  1IC2 A;  1QL2 A;  2WIT A;  3P32 A;  2FYZ A;  1LTJ C;  3RK2 C;  3B5N C;  2WSE H;  2YMY A;  4GIF A;  2H43 A;  2I1J A;  1J1E B;  2JJL A;  1G1I A;  1DH3 A;  1H8A A;  1SQP K;  3P8C E;  1NOH A;  4W7Z A;  1N7S A;  5BU8 B;  1HWT C;  3B5N D;  1S9K E;  1IFN A;  2P2U A;  2Q7C A;  3LW5 H;  1LTB C;  4WY4 C;  2H7H A;  3M0D C;  1FJK A;  4GT1 A;  3VP8 A;  3E1I A;  5CCH C;  2XNX A;  1FZG A;  1A02 F;  2N1T B;  1ZR2 A;  1PFI A;  5AW4 B;  2H8P D;  5APT A;  3RK3 C;  3BAS A;  1ZLL A;  2PP6 A;  2HPC A;  4C7N A;  2FKW B;  4B86 A;  2W6B A;  2VRS A;  5AVW B;  5AW3 B;  3SWF A;  3NFQ A;  1IO4 A;  3EFG A;  3N4X A;  1JY2 N;  2XV5 A;  1GL2 B;  1MZ9 A;  1T3J A;  1NU1 K;  2J59 M;  2FFD C;  4C46 A;  1L0N K;  2NPS A;  3NTN A;  1LWU C;  3L35 A;  4I1L A;  1T2K C;  1FZC A;  1JTH A;  3OA7 A;  3A2A A;  2N9B A;  3P8M C;  1SFC C;  1L4A C;  3LID A;  1AQ5 A;  5APW A;  4AYC A;  2XKM A;  3IR9 A;  5AW5 B;  3VP9 A;  1T3U A;  3HD7 D;  4O9B A;  1N7S B;  2KYV A;  1N73 C;  4JYB A;  1SQB K;  4C7R A;  5CMZ A;  2OYH A;  3VTP C;  4I6M C;  2P7J A;  3M06 A;  1FZB A;  2WT7 B;  1JNM A;  1KIL A;  3KQG A;  1J1E C;  1GW4 A;  2HG5 D;  3HE5 B;  2IFM A;  2FYU K;  3N7N A;  2O01 H;  1KZU B;  1AFO A;  2HPC B;  4ZKP A;  1FU1 A;  1IK9 A;  3BAT A;  5APQ A;  2WTY A;  1FBM A;  1SLQ A;  3L36 A;  2C0W A;  2N1T C;  1N2D C;  2NPS B;  2YKP A;  1CI6 B;  1JTH B;  2L5G B;  2MJZ A;  3SWY A;  1HTL C;  5AVV B;  1RF0 A;  2N1T D;  5CCG C;  1N86 A;  1N7L A;  2KOG A;  1G2C A;  3PP5 A;  1GL2 C;  1IFI A;  3VYI A;  1JCC A;  1DEB A;  5KJ7 A;  2WPR A;  2Z4E A;  3NXS A;  3M9Q A;  2WWW A;  1LTS C;  2YKO A;  5APX A;  1URQ D;  3VMX A;  2WSF H;  1RE3 A;  5AW1 B;  5APV A;  1KIL B;  1JO5 A;  4AQR D;  1XTG B;  2M8R A;  3RK2 D;  2P67 A;  1N7S C;  3A3Y B;  3RL0 B;  3TYY A;  1LTJ A;  2FXM A;  1JMM A;  3B5N A;  2QM7 A;  2A45 H;  3A7O A;  1MFZ A;  5CJ4 A;  1SVF A;  4WY4 D;  1NAF A;  1FOS F;  2XU6 A;  3I5C A;  4XA4 A;  5CCH D;  1HBW A;  1GTW A;  3GHG B;  4WY4 A;  1CW5 A;  2C9N Y;  2CPS A;  1JY3 O;  3M0D A;  1NTM K;  2W6A A;  5CCH A;  1Z56 A;  3UIA A;  2J58 A;  3RK3 D;  1JUN A;  2E43 A;  1FOS E;  2YO2 A;  1G2C B;  3V4Q A;  1ZR4 A;  1WRG A;  3LIE A;  3VN0 A;  2C9L Y;  2NPS C;  1NO4 A;  1LT9 A;  3HE4 A;  3CLQ A;  2IPP A;  1T8Z A;  1SQQ K;  4N6J A;  2WPS A;  4RES B;  5AW7 B;  3VMZ A;  1X8Y A;  1FZF A;  2I1K A;  1T2K D;  2Q5U A;  1FZA A;  3P7K A;  1FJP A;  1NTZ K;  5APU A;  3M9H A;  3L37 A;  1RY3 A;  5AVS B;  3V2R A;  1SFC D;  1IFD A;  4Y99 B;  1L4A D;  2IFN A;  4N78 D;  3HD7 A;  1RE4 A;  1WT6 A;  3TK1 A;  1GK4 A;  1RF1 A;  1HH0 A;  3KYQ A;  4GKG A;  4HYT B;  1IFJ A;  4LC1 A;  1KIL C;  5AVX B;  5APY A;  3IFM A;  2JEE A;  2OYI A;  2Q3I A;  4M3L A;  4W80 A;  2R32 A;  2R3C A;  1JY3 N;  1HVV A;  4IFF A;  3WMM 0;  5AW2 B;  4C7N B;  3RL0 C;  1GDT A;  2HOD A;  3G3Z A;  3P8C D;  1VPC A;  4EOT A;  1OWA A;  3HTK A;  1W2E A;  2R5B A;  1S9K D;  1OXZ A;  4OH8 B;  2IX7 C;  2POH A;  3RL0 D;  1FZC B;  1LT9 B;  1EQ7 A;  3V5B A;  1YYC A;  4LLH A;  1GD2 E;  1DX7 A;  1CZQ A;  1ZV8 A;  4LGD E;  3GHG C;  5AVR B;  1J1D B;  1M1J A;  2ZXE B;  1YTZ I;  2N1T A;  2HYN A;  3R2P A;  1L0L K;  4IFD K;  1NHL A;  3MIW A;  1HGZ A;  4JYC A;  5AVY B;  5KTB A;  3A5T A;  2O1J A;  3HD7 B;  2QM8 A;  5CCG D;  2OYH B;  1IFM A;  1MV8 A;  3TNU A;  1H88 A;  1RF1 B;  1JCD A;  1GK6 A;  4JF7 A;  1GL2 D;  3V2P A;  1KQL A;  1NTK K;  1URQ A;  2GUS A;  2HFE D;  2OYI B;  1G1J A;  5AW0 B;  2ZFC A;  5AW8 B;  3HUS A;  3OJA B;  4Y99 C;  4DZO A;  1GU4 A;  4IFM A;  3H32 A;  4WB4 A;  2HOD B;  3C9I A;  1NKN A;  5CHX A;  2A45 I;  2WZ7 A;  2W27 A;  2KSJ A;  3HTK B;  1FDM A;  3CL3 D;  3CI9 A;  1N7S D;  1KFM A;  2KB7 P;  4WBA A;  1LGH B;  3TSI A;  5AW9 B;  2LKM A;  3O8Z A;  5KLV K;  1XTC C;  5AVT B;  2PAJ A;  2BAS A;  4ZKU A;  1VDF A;  3T97 A;  1FAV A;  3EQ2 A;  4AUW A;  2CPB A;  1FZE A;  2Z5I A;  1YTZ T;  1M1J B;  5AVU B;  2WT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...