2E43A

Crystal structure of c/ebpbeta bzip homodimer k269a mutant bound to a high affinity dna fragment
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
SDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DTP*DAP*DGP*DGP*DAP*DTP*DTP*DGP*DCP*DGP*DCP*DAP*
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2e43A00
2H7HA 3M0AA 4KHXA 5APXA 4C46A 2N9BA 2XU6A 3L36A 3VMYA 5AVTB 2XZRA 2W6AA 1HWTC 3NXSA 3HE5B 2ZFCA 3NFQA 5APYA 3V5BA 1GU4A 2QM7A 1GK4A 1CZQA 1FOSF 2Z5HA 3KDPB 2YNYA 5AW4B 3M91A 5AW7B 5AVXB 3VMZA 5AVVB 4HYTB 5APSA 4DZOA 1OWAA 2YO2A 4GKGA 1DH3A 3P32A 1FOSE 5APUA 1OXZA 3L37A 3SWFA 5AW8B 3I5CA 3L35A 4C7NB 3VYIA 4LC1A 3OAKA 5AW9B 3MD0A 3B8EB 2KP8A 4C7NA 1YYCA 2R32A 3M9HA 2VRSA 2WT7B 2WPQA 5AVWB 2WWWA 5AVZB 2WTYA 3LIEA 2Z5IA 1H89A 1H8AA 3TK1A 1H88A 3TNUA 2R5DA 3MGNA 1S9KD 2BASA 5APTA 5APVA 3LIDA 5AW0B 1SLQA 4RESB 3A3YB 1IO4A 2R5BA 2WPRA 3O8ZA 2R3CA 1JNMA 1GU5A 2E42A 5AVYB 3HE4A 3A5TA 4XE5B 3NMDA 4AUWA 3M06A 2WT7A 3M9BA 1MV8A 2Q7CA 4I6MC 1NWQA 2C9LY 1KQLA 1T2KC 2W27A 2Q3IA 1SP4A 3V4QA 5APQA 5AW1B 5APWA 1CI6A 1GZLA 2QM8A 3A7OA 1GTWA 3IR9A 2IPPA 2ZXEB 3HE5A 1CSBA 3VN0A 1NAFA 5AW2B 1HUCA 1CI6B 1S9KE 4M3LA 5CMZA 5AW5B 4I2LC 3HE4B 3HTKA 5AVSB 3KQGA 3UIAA 4AYCA 3T97A 3A2AA 1X8YA 2P7JA 3VMXA 3TYYA 2P67A 1T2KD 3NTNA 4JYBA 1HBWA 1A02F 3VTPC 4GT1A 5AVRB 1HJBA 2WPSA 1GD2E 2YO3A 3TNUB 2E43A 2Q5UA 3V4WA 5AW3B 1MFZA 1GK6A 1A02J 1JUNA 4EOTA 5AVQB 2P2UA 2JJLA 5AW6B 4B86A 5AVUB 4AQRD 3P8MC 2XV5A 1MUUA 4JYCA 2C9NY 1FAVA 1G2CB 1J2JB 3P7KA 3M0DA
chains in the Genus database with same CATH superfamily
2A06G 3WUUA 2HFED 1Y9BA 2N9YB 1KILD 3CC4P 3FX0A 5APXA 3VMYA 4C46A 1OW7A 3L71E 2RKLA 2YKOA 1PP9G 2W83C 1H0TA 4IL6X 1L0NE 2WSEH 1S1CX 1AJYA 2BCCJ 3H1HE 3L73J 3HE5B 2H88C 2QRXA 3W68A 4W80A 2BEZF 2QM7A 1AQTA 3O6QB 4Y99B 3I55P 2N1TC 5CCGA 5KAFH 1YITP 2C9LY 4YPCA 1SQXJ 3M91A 2E74B 5AW7B 2YXQB 5KKZC 2JP3A 1BDDA 3VMZA 2BCCE 1IJDB 4HYTB 1PPJE 1SQPD 2K9JB 3VP9A 1VF5B 1RE3A 3H1LE 3H6PA 2HR3A 3H1LG 1SQBG 4IFFA 1OXZA 1AVYA 1NTKK 5KLVE 4YXWH 2M3BA 2E76C 1KYOE 1HH0A 5K5GB 1M8OB 3L73G 4R4MA 1E79H 1SS1A 1K8AQ 2HPCB 5AW9B 1HF9A 3B8EB 1K04A 2K37A 1J1EB 1YYCA 1SQQD 3U1AA 1KYOD 1L4AD 2Q3EA 1J1DB 1Z56A 3RBZA 3KXDA 1IK9A 3L71G 2WT7B 3H1KD 2FXPA 3PRJA 4D6TD 5TISH 3L75E 1L0NK 3B71A 5KAFE 1SQBK 3GW6A 4UB8H 3H1HG 2IYPA 1BGYG 1S2EA 3LIEA 1ZV8A 1KV4A 1ZR2A 2N1TD 3TK1A 3R4YA 1KD1Q 1Y47A 2PGDA 1BCCD 3F5HA 1U57A 2IBZI 3BRVB 5APTA 2XNDH 3CPWO 4ASVA 1KB9E 4WY4B 1SLQA 3CWBG 3S9OA 3TDKA 3A0HE 1IK7A 2IBZD 4PD4E 4WB4A 3A3YB 3L75J 4TT3H 2JDIH 3H1IG 5BVZA 1VQ8P 1VQKP 1N7SD 1NTKG 2E5YA 1L0ND 2GUVA 1SQQK 2D2CC 3MP7B 1FC2C 1T3UA 3WMM0 3HE4A 3A5TA 1RF0A 3S1KA 1R5LA 1FDIA 1NKNA 3CXHD 3TGUE 4AUWA 2KNCA 1RE3C 4H13B 1KYOI 4I7ZC 1KQLA 1L4AB 2DW3A 2FBWC 3A0HH 1XTCC 2KB7P 2NPSB 3HD7C 4RKUJ 5H2FE 2Z4EA 1DD3A 1GDTA 1NGMB 2P1JA 4IL6H 4LGDE 1EDIA 2ZJSE 1NTKD 1VQMP 1BDCA 3SFDC 1W2BO 1JO5A 1GZLA 2QM8A 1GTWA 2KZIA 3HE5A 1VQ7P 2OYOA 3CWBD 3FWLA 3WUTA 2FY8A 1SQPK 3C9IA 2OTLP 1HUCA 3V2NA 1ZN5A 2QE7H 2OYHC 1BCCG 5CMZA 1GL2A 1LT9B 1SQVK 3Q5SA 3L73E 1VF5D 4YTPC 3HTKA 1M57D 3UIAA 3CWBE 1VQPP 4JBZA 2QG4A 5EFWB 3P8CE 2KIKA 3RK3D 1OMIA 2E76D 1FZFA 1N7SC 3LW5J 1P84D 3MHVA 4H13C 4EDFA 2QEXP 3NTNA 3H1KG 1NTMD 4JYBA 4PV1B 1HBWA 3B5NB 1NYHA 1A02F 2JWAA 2FXOA 5KAIH 3B5NA 1FJPA 1BGYJ 1AVOA 1ZXGA 2A45I 4GT1A 1HJBA 1FZBA 1RF1C 1KTMA 2YO3A 3VP8A 1SQXD 1YBKA 2WSFJ 3EWKA 2HPCA 3BCCD 2PP6A 2M8RA 3H1KE 2XKMA 2ITAA 1R8EA 1NTZE 4N3YB 4DT0A 2P2UA 1DX7A 2KLUA 1FOSE 4B86A 2WPVB 2KXPB 4AQRD 1USDA 3D71A 1LP1A 3AE5C 1RQUA 1L0LD 4NPEA 4JYCA 1VDFA 4GIFA 1ZP0C 4L74A 2WSFH 4W7ZA 4EIJA 1PGQA 2FXMA 3RK2B 2ZXXA 3GHGB 4YXDC 3M0AA 5KTBA 3C1LA 4KHXA 2N9BA 5AVTB 1SQBJ 1NJIQ 3CX5E 1FZGA 1AV1A 5TJHA 2WSEJ 4WY4A 1PGOA 1J1DC 1OVVA 1PFIA 3F89A 2ZFCA 3NFQA 5APYA 3OJAB 3CLQA 3MZWB 1GK4A 1PP9D 1JY3N 1EDKA 1NVOA 3KDPB 4O9BA 5AW4B 3E1IA 3ZDMA 4GDOA 2E75C 1PPJG 4I1LA 4ZKUA 5APSA 2FFDB 1NTMK 2KNCB 4GKGA 1YQ3C 1W2EA 3P32A 1LTAC 2V7QJ 1QX8A 1NTKE 2LR2A 5KLVK 1X79B 1GL2D 2NPSD 4WY4D 1JTHB 5E79H 4L76A 2FFDC 3PLNA 4U3FG 3RK3C 3CXHH 2IDBA 1SQVD 2ZYAA 3L35A 2N1TA 3L75G 3FWNA 1NTZK 5KLVJ 2IX7C 2N1TB 2Q1KA 3OW2O 3OAKA 3SWYA 1VQOP 1M56D 1NU1K 1SQXG 3JCUH 3RL0D 2O01N 2KP8A 1Y8AA 4EI2A 1S4XA 2BCCD 1NTZJ 2WSCH 3O6QA 2OYIC 1JY2N 1M90Q 2YKPA 3PJSK 3L4FA 2FYZA 2WPQA 2Y0DA 1P84E 1DIPA 1JOCA 1NU1E 3AEBC 1SFCD 5AVWB 3Q1MA 5AVZB 3HTKB 3RK2C 1QVGO 4MN4C 1EZVE 1MFTA 3L74G 4HJGH 1G2CA 3G9RA 5KLVG 4BRYA 3TNUA 1CW5A 1S9KD 3MGNA 3E7KA 1KQGB 2FYUG 5AW0B 1LTIC 4OGQB 3Q3DA 2HODB 4W7YA 4UB6H 2A45H 4OGQC 3MUDC 1IO4A 2WVRA 1N86A 2I1KA 2L5GB 3EFFK 3H1JG 2R5BA 2AEJA 3K5BA 3TSIA 2K3RA 4D6TE 1NKZB 1FZCB 3O8ZA 3CI9A 3BRTB 4BWNA 2R3CA 2HLOA 3N7NA 3AE6C 5B66H 1KC8Q 2O01J 4PJ0E 5L8RJ 2J5UA 2E42A 1BSHA 1BE3G 1ZR4A 1EDJA 1LTSC 4H0LD 4GODA 3L74J 2WT7A 3M9BA 4D6TJ 4I6MC 1NWQA 1EXJA 1P84I 2HYNA 2OYIB 1FDOA 1KB9I 1M1JA 3WU2H 3GHGA 2LKMA 1M1JB 2M5AB 2Q3IA 1L0NG 1NO4A 3EQ2A 5CHXA 2IZ1A 1PP9E 1SFCC 2M5AA 1KORA 1KZUB 3S4RA 3H1ID 1WMKA 2IFNA 3FXEA 3L72J 2IBZG 3PP5A 4HH2A 1SQPE 1PZQA 3B4SA 1NOHA 3D6ZA 2KS1A 3RL0g 3CCMP 1BCCE 2IZ0A 2K9JA 2OARA 4H44D 1S9KE 4M3LA 2POHA 1NTME 3RL0C 5KLVD 3RK2D 3L74D 4I2LC 3HD7A 5GTHH 2KSJA 1FS0E 1IC2A 1URQA 2B89A 2IFMA 3H1HJ 3HD7B 3HE4B 1X9VA 1JMBA 2D2CD 1WRGA 2M0BA 2E75B 3AEFC 3U1CA 1X8YA 1G1JA 1HJ0A 3VMXA 1LJ2A 3IF4A 3TYYA 1SQBE 3LW5H 4D6TG 3L71D 4BXLA 5KLIC 3AE9C 1T6AA 3CXHI 3CMEP 4HB1A 1LGHB 2WPSA 5CCGC 2D2CB 2G3AA 2E43A 1KQSO 2SPZA 2Q5UA 3CCLP 1JMMA 3HUSA 2P10A 5AW3B 5C39A 1N73C 3SWKA 1LNQA 1SQVE 2JJLA 4WY4C 2FYNC 3L72D 4PJ0H 1NU1G 2Y0EA 3A0BH 4DCKA 5B66E 1MUUA 3H1LD 3GG2A 1KMIZ 3AEGC 4RO0A 1L0LK 1BGYE 1SQPG 4H13D 1YJWP 4Z1MH 2WSSH 4U3FJ 1XTGB 3PH0A 2Q6QA 2XU6A 1JCDA 4PD4I 1KQFB 3JCUE 1L0LJ 1OX3A 1M7LA 2KSEA 2LXBA 2XZRA 3JSVC 2KOGA 2ZVOB 2Q9IA 1Q86Q 4DOJA 1SQXK 1S5LX 2HODA 2RH0A 3I56P 4PD4H 2CPSA 4PV1C 4WBAA 1FOSF 1HGZA 3KHUA 3CMAP 1M1KQ 5BU8B 1SQPJ 5AVVB 3M0DC 1BE3E 2ZYGA 5CCGD 2A06D 1DEEG 1RY3A 3IFMA 2K1AA 3G71P 2GM4A 1LP1B 3H1JE 2QVAA 3L70D 2O3JA 5APUA 3RL0B 1DD4A 1JB0J 1OVRA 1OFCX 3SWFA 3L72G 5CCHD 1ZOYC 1LWUA 2C0WA 2IYOA 2Y0CA 2ZVNB 1GMJA 5CJ0A 4LC1A 2WQYC 4HKZH 3V2RA 1SFCB 3MD0A 1N73A 3BCCG 2HG5D 1ZRTE 3CX5H 4C7NA 2R32A 3M9HA 1OIPA 2O1JA 2I8DA 1JM0A 1LTBC 1N7LA 4LLHA 1FE6A 4I7ZB 2QSIA 1S5LH 2VRSA 1D7MA 1NTMG 1IFIA 1U7JA 1GW4A 2WITA 4GOEA 4BRYB 5CCHA 4N78D 1URQB 2YKQA 2Z5IA 3RGUA 1N8RQ 3ABVC 1H8AA 3HRNA 1FZCC 1EQ7A 2QJPC 1GW3A 1PP9J 2R5DA 2BASA 3U59A 4H44C 3LIDA 2FYUJ 1K73Q 1JTHA 2ZT9C 3P8CD 3AECC 3IAOA 4RESB 2FKWB 2YIUC 1LTTC 1JY3O 3TGUD 4XA4A 4KT0J 2QJKC 3CCJP 1K9MQ 1H0TB 3KYQA 1ZMEC 1BCCJ 2LXCB 1OZHA 4WVZA 2Y9ZA 1K05A 3CC7P 3CCSP 1QEXA 1JNMA 1N7SA 1JCCA 1KILE 1GU5A 5CBOA 2O01H 3IN6A 4OWFA 1EZVD 4XE5B 3E1RA 2KZJA 3SFEC 3NMDA 2UWJE 1QL2A 3OA7A 3H1KJ 3QWOC 1IFNA 4TLFA 3D6YA 3AEDC 1YQ4C 3CX5I 2YMKA 4U7JA 2Q7CA 1EZVG 1W5CE 1BE3D 2PAJA 3GLMA 3AEEC 2L91A 3WU2E 1T2KC 1S72P 1VQ6P 2OTKE 1TU3F 1Q7YQ 2W27A 1YIJP 2FYUE 3CC2P 2H43A 1SP4A 3H1JJ 3V4QA 5APWA 3CCUP 1KN7A 1VQLP 3TGUG 2ZXEB 1JY2O 1CSBA 2B87A 2V7QH 2E76B 1MKMA 1HTLC 2W6BA 2B87B 1IFMA 3MUDA 4IL6E 5AW1B 1NAFA 2FYUD 5AW2B 3RK3B 1YHQP 1CI6B 1KILB 1NU1J 3H32A 3PTZA 2FFDA 3G3ZA 3BATA 4RJTA 1N2DC 5AW5B 1LTJC 5GTIH 1FZCA 1X22A 1VF5C 4AYCA 1BGYD 5KJ7C 1RH5B 2K88A 3A2AA 3RBXA 3T97A 1KB9D 3C8VA 4N6JA 2P7JA 2QJYB 2NRGA 2P67A 3Q5RA 3B5ND 1YJNP 3CX5D 2W90A 4R4LA 4Y99C 1UIIA 1FBMA 4U3FE 2KYVA 1NH4A 1S3JA 2PRRA 1Q90D 2Y9YA 1T8ZA 1SQQG 4GOFA 3VTPC 2J59M 4EYYQ 2O1KA 4L75A 2E5TA 4KJMA 3G4SP 3RK3E 1NTKJ 3CCVP 1GK6A 1SFCA 2W6JH 3TGUJ 1OW6A 1OVUA 1SQVG 1A02J 2YIUB 5AVQB 1E5WA 2XNXA 3GHGC 3ITKA 5AW6B 1BE3J 3M9QA 4OGQD 5CJ4A 1LWUC 3AE2C 2WMMA 3P8MC 4JQ0D 1QLED 1SQBD 1ZRTD 2KS1B 2QJPB 3V2QA 1G2CB 3BCCE 2AEMA 1J2JB 1WT6A 2K9YA 4EOTA 3M0DA 2RN0A 1RHZB 3II6A 3Q2YA 1URQC 2H7HA 1LTJA 1PPJD 1RF0C 1T3JA 2KLVA 2KUBA 4ZNCA 1PL5A 1L0NJ 1SVFA 3L36A 4NPDA 5E79E 1FDMA 3H1LJ 1YTZT 4K35A 2AEFA 2JKVA 2NPSA 2J58A 2XDJA 2W6AA 1SQQJ 1S5LE 2H89C 1X0TA 1Q81Q 3NXSA 1RF1B 1HWTC 2KK7A 3V5BA 1SQXE 1AA0A 3CXHE 1GU4A 3B5NC 3R2PA 3AE8C 3BCCJ 4IFMA 1CZQA 3BASA 2Z5HA 3A0BE 2YNYA 3HUSB 1QVFO 1N7SB 1P84H 2E75D 2JR8A 2RMZA 3AE3C 1KFMA 2V4HA 5AVXB 1SQQE 2JO1A 2P58A 1UIXA 2R3SA 3JC22 4DZOA 3GMAA 2IBZE 1FU1A 3PHLA 1HGVA 1GL2B 1LT9A 1L0LE 1OWAA 1LT9C 1RQVA 1LT1A 1L0LG 2YO2A 3H25A 1DH3A 1GL2C 2OYHB 3D70A 3AE1C 1NU1D 1IFPA 1NHLA 2OGUA 2WSCJ 3L37A 1ZW0A 2ZAEB 3MIWA 5AW8B 1Q82Q 2OYHA 1FZEA 1NTZD 1USEA 3I5CA 1KFNA 5KAIE 3KZIH 3USSA 4Y28J 3VYIA 3HUSC 1PGPA 4C7NB 1VQ9P 3V6IA 3FXDA 3CCQP 3SSUA 2FYUK 1RE4C 3CL3D 1U7MA 1URQD 4C7RA 1EC5A 1AFOA 2NPSC 5DJUB 2ZYDA 1G1IA 1L4AC 5GTHE 3CCRP 1IFJA 4OVNF 1VQ4P 2AXTH 2NZ2A 5CBNA 2E74D 1JUNA 4H0LB 1ZLLA 4PD4D 1PIXA 1IFDA 1QGKB 2WWWA 3V2PA 2WTYA 2AXTE 3CCEP 1NAYA 3T97B 2GA1A 3QH9A 4JPZB 1H89A 3L72E 1H88A 1MZ9A 3L70J 1QL1A 2OYIA 5APVA 2CPBA 1LWUB 2PFXA 1YTZI 4ZMDA 2FYNB 3CWBJ 1EXIA 1DEBA 4N78E 1JY2P 4CPGA 4NPFX 1AQ5A 2BEQD 2MKVA 2QIWA 3KZIE 1N73B 3N4XA 1LTGC 2WPRA 4IOIH 4UB6E 1Q2NA 2B9BA 5AVYB 5B5EH 2QA4P 5KLIB 3AEAC 4XFJA 5M1BA 4PV1D 4DJGA 2JWDA 3H1IE 2R44A 2YXRB 3M06A 4H0LC 1MV8A 2WZ7A 2QJYC 3GF3A 2A45G 5KJ7A 2I1JA 1IZNB 4ZKPA 1PV3A 3G6EP 1J1EC 1LTJB 3VOPA 1YI2P 4WWIA 3KQGA 5APQA 3H1IJ 1L4AA 1KILC 1RE4A 3EFGA 3H1JD 1CI6A 1KILA 3A7OA 3H32B 3L70E 1PGJA 3IR9A 2IPPA 3Q5PA 3KPEA 2A06E 1RF1A 1L2PA 2W8ZA 4QMAA 4ASWA 3VN0A 2ZT9D 2C0XA 2B88A 4OH8B 1NTMJ 1M1JC 1FZAA 2G8YA 4K3AA 3VMAA 5KJ7D 3CD6P 3H1HD 5B5EE 1VQNP 2E74C 5KKZB 2H8PD 3L71J 3AE4C 3AE7C 1R5SA 2GUSA 3W67A 1T2KD 2JEEA 1OW8A 1VQ5P 1VPCA 1KYOH 2CK3H 3FGAD 1EZVI 2BCCG 3MTUE 5AVRB 1YJ9P 1GD2E 1EDLA 1FJKA 1VL2A 5H2FH 1KB9H 3TNUB 2M3EA 1JY3P 5AVSB 3V4WA 2OTJP 3GF7A 5GTIE 4L73A 1BSNA 1MFZA 2QJKB 3L74E 5DJTB 3L75D 3HD7D 3L73D 4A7PA 1SQVJ 1NTZG 2YMYA 2MJZA 1HVVA 2ZT9B 2AXCA 4U3FD 5AVUB 3TF5A 3WUVA 4H44B 1JEKA 2XV5A 5BU5A 5CCHC 2OQQA 3L70G 4UB8E 1FAVA 2C9NY 4IFDK 5TISE 2KI7B 4JF7A 3P7KA 3BVHA
chains in the Genus database with same CATH topology
2HFED 1KILD 5APXA 4C46A 3VMYA 2YKOA 2WSEH 3HE5B 4W80A 2QM7A 4Y99B 2N1TC 5CCGA 3M91A 5AW7B 3VMZA 1IJDB 4HYTB 3VP9A 1RE3A 3H6PA 4IFFA 1OXZA 1NTKK 2M3BA 1HH0A 2HPCB 5AW9B 3B8EB 1J1EB 1YYCA 3U1AA 1L4AD 1J1DB 1Z56A 1IK9A 2WT7B 1L0NK 1SQBK 3LIEA 1ZV8A 1ZR2A 2N1TD 3TK1A 3BRVB 5APTA 4WY4B 1SLQA 4WB4A 3A3YB 5BVZA 1N7SD 2GUVA 1SQQK 1T3UA 3WMM0 3HE4A 3A5TA 1RF0A 1NKNA 4AUWA 1RE3C 1L4AB 1KQLA 1XTCC 2KB7P 2NPSB 3HD7C 2Z4EA 1GDTA 2P1JA 4LGDE 1GZLA 2QM8A 1GTWA 3HE5A 1SQPK 3C9IA 1HUCA 3V2NA 1ZN5A 2OYHC 5CMZA 1GL2A 1LT9B 1SQVK 3HTKA 3UIAA 3P8CE 3RK3D 1FZFA 1N7SC 3NTNA 4JYBA 1HBWA 3B5NB 1A02F 1FJPA 3B5NA 2A45I 4GT1A 1HJBA 1FZBA 1RF1C 2YO3A 3VP8A 2HPCA 2PP6A 2M8RA 2XKMA 1JUNA 4N3YB 1DX7A 2P2UA 4B86A 4AQRD 4EIJA 4JYCA 1VDFA 4GIFA 4W7ZA 2WSFH 2FXMA 3RK2B 3GHGB 3M0AA 5KTBA 4KHXA 2N9BA 5AVTB 4WY4A 1J1DC 1PFIA 2ZFCA 3NFQA 5APYA 3OJAB 3CLQA 1GK4A 1JY3N 3KDPB 4O9BA 5AW4B 3E1IA 4I1LA 4ZKUA 5APSA 2FFDB 1NTMK 4GKGA 1W2EA 3P32A 1LTAC 1FOSE 5KLVK 1X79B 1GL2D 2NPSD 4WY4D 1JTHB 2FFDC 3RK3C 3L35A 2N1TA 1NTZK 2IX7C 2N1TB 3OAKA 3SWYA 1NU1K 3RL0D 2KP8A 2WSCH 2OYIC 1JY2N 2YKPA 3L4FA 2FYZA 2WPQA 1JOCA 1SFCD 5AVWB 5AVZB 3HTKB 3RK2C 1G2CA 3TNUA 1CW5A 1S9KD 3MGNA 5AW0B 1LTIC 2HODB 4W7YA 2A45H 1IO4A 1N86A 2I1KA 2L5GB 3TSIA 2R5BA 1NKZB 1FZCB 3O8ZA 3CI9A 3BRTB 2R3CA 2HLOA 3N7NA 2E42A 1ZR4A 1LTSC 2WT7A 3M9BA 4I6MC 1NWQA 2HYNA 2OYIB 1M1JA 3GHGA 2LKMA 1M1JB 2Q3IA 1NO4A 3EQ2A 5CHXA 1SFCC 1KZUB 3PP5A 2IFNA 4HH2A 1NOHA 2OARA 1S9KE 4M3LA 2POHA 3RL0C 3RK2D 4I2LC 3HD7A 2KSJA 1URQA 1IC2A 3HE4B 2IFMA 3HD7B 3KQGA 5AVSB 3U1CA 1X9VA 1WRGA 1X8YA 1G1JA 3VMXA 3TYYA 3LW5H 1LGHB 2WPSA 5CCGC 2E43A 2Q5UA 1JMMA 3HUSA 5AW3B 1N73C 2JJLA 4WY4C 1MUUA 1L0LK 1XTGB 2XU6A 1JCDA 2XZRA 1M7LA 2KOGA 2Q9IA 4DOJA 1SQXK 2HODA 2CPSA 4WBAA 1FOSF 1HGZA 5BU8B 5AVVB 3M0DC 5CCGD 1RY3A 3IFMA 2GM4A 3RL0B 5APUA 3SWFA 5CCHD 1LWUA 2C0WA 5CJ0A 4LC1A 3V2RA 1SFCB 3MD0A 1N73A 2HG5D 4C7NA 2R32A 3M9HA 2O1JA 1N7LA 1LTBC 4LLHA 2VRSA 1IFIA 1GW4A 2WITA 5CCHA 4N78D 1URQB 2YKQA 2Z5IA 1H8AA 3HRNA 1FZCC 1EQ7A 1GW3A 2R5DA 3U59A 2BASA 3LIDA 1JTHA 3P8CD 4RESB 2FKWB 1LTTC 1JY3O 4XA4A 3KYQA 1JNMA 1N7SA 1JCCA 1GU5A 2O01H 4XE5B 3NMDA 1QL2A 3OA7A 1IFNA 1JO5A 2Q7CA 2C9LY 2PAJA 1T2KC 2W27A 2H43A 1SP4A 3V4QA 5APWA 2ZXEB 1JY2O 1CSBA 3MUDA 2W6BA 1HTLC 3RK3B 1IFMA 1FZGA 1NAFA 5AW2B 1CI6B 1KILB 3H32A 2FFDA 3G3ZA 3BATA 1N2DC 5AW5B 1LTJC 1FZCA 4AYCA 5KJ7C 3T97A 3A2AA 4N6JA 2P7JA 2P67A 3B5ND 4Y99C 1FBMA 2KYVA 1NH4A 3VTPC 1T8ZA 2J59M 2O1KA 1GK6A 1SFCA 1A02J 5AVQB 1E5WA 2XNXA 3GHGC 5AW6B 3M9QA 5CJ4A 1LWUC 3P8MC 3V2QA 1G2CB 1J2JB 1WT6A 4EOTA 3M0DA 3II6A 1URQC 2H7HA 1LTJA 1RF0C 2KLVA 1T3JA 1SVFA 3L36A 1FDMA 1YTZT 2NPSA 2J58A 2XDJA 2W6AA 1RF1B 1HWTC 3NXSA 3V5BA 1GU4A 3B5NC 3R2PA 4IFMA 1CZQA 3BASA 2Z5HA 2YNYA 3HUSB 1N7SB 5AVXB 1KFMA 4DZOA 1FU1A 1HGVA 1GL2B 1LT9A 1OWAA 2YO2A 1LT9C 1DH3A 1GL2C 2OYHB 3L37A 1NHLA 3MIWA 2OYHA 5AW8B 1FZEA 3I5CA 1KFNA 4C7NB 3VYIA 3HUSC 2FYUK 1RE4C 3CL3D 1URQD 4C7RA 1AFOA 2NPSC 1G1IA 1L4AC 1IFJA 1ZLLA 2WWWA 1IFDA 3V2PA 2WTYA 1H89A 1H88A 1MZ9A 1QL1A 2OYIA 5APVA 2CPBA 1LWUB 1YTZI 1DEBA 4N78E 1JY2P 1AQ5A 1N73B 3N4XA 1LTGC 2WPRA 5AVYB 3M06A 1MV8A 2WZ7A 2A45G 5KJ7A 2I1JA 4ZKPA 1J1EC 1LTJB 3VOPA 5APQA 1L4AA 1KILC 1RE4A 3EFGA 5AW1B 3H32B 1KILA 1CI6A 3A7OA 3IR9A 2IPPA 3KPEA 1RF1A 3VN0A 2C0XA 4OH8B 1M1JC 1FZAA 5KJ7D 2H8PD 1T2KD 2GUSA 2JEEA 1VPCA 3MTUE 5AVRB 1GD2E 1FJKA 3TNUB 1JY3P 3V4WA 1MFZA 3HD7D 2YMYA 2MJZA 1HVVA 5AVUB 2XV5A 5BU5A 5CCHC 2C9NY 1FAVA 4IFDK 4JF7A 3P7KA 3BVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7H A;  3M0A A;  4KHX A;  5APX A;  4C46 A;  2N9B A;  2XU6 A;  3L36 A;  3VMY A;  5AVT B;  2XZR A;  2W6A A;  1HWT C;  3NXS A;  3HE5 B;  2ZFC A;  3NFQ A;  5APY A;  3V5B A;  1GU4 A;  2QM7 A;  1GK4 A;  1CZQ A;  1FOS F;  2Z5H A;  3KDP B;  2YNY A;  5AW4 B;  3M91 A;  5AW7 B;  5AVX B;  3VMZ A;  5AVV B;  4HYT B;  5APS A;  4DZO A;  1OWA A;  2YO2 A;  4GKG A;  1DH3 A;  3P32 A;  1FOS E;  5APU A;  1OXZ A;  3L37 A;  3SWF A;  5AW8 B;  3I5C A;  3L35 A;  4C7N B;  3VYI A;  4LC1 A;  3OAK A;  5AW9 B;  3MD0 A;  3B8E B;  2KP8 A;  4C7N A;  1YYC A;  2R32 A;  3M9H A;  2VRS A;  2WT7 B;  2WPQ A;  5AVW B;  2WWW A;  5AVZ B;  2WTY A;  3LIE A;  2Z5I A;  1H89 A;  1H8A A;  3TK1 A;  1H88 A;  3TNU A;  2R5D A;  3MGN A;  1S9K D;  2BAS A;  5APT A;  5APV A;  3LID A;  5AW0 B;  1SLQ A;  4RES B;  3A3Y B;  1IO4 A;  2R5B A;  2WPR A;  3O8Z A;  2R3C A;  1JNM A;  1GU5 A;  2E42 A;  5AVY B;  3HE4 A;  3A5T A;  4XE5 B;  3NMD A;  4AUW A;  3M06 A;  2WT7 A;  3M9B A;  1MV8 A;  2Q7C A;  4I6M C;  1NWQ A;  2C9L Y;  1KQL A;  1T2K C;  2W27 A;  2Q3I A;  1SP4 A;  3V4Q A;  5APQ A;  5AW1 B;  5APW A;  1CI6 A;  1GZL A;  2QM8 A;  3A7O A;  1GTW A;  3IR9 A;  2IPP A;  2ZXE B;  3HE5 A;  1CSB A;  3VN0 A;  1NAF A;  5AW2 B;  1HUC A;  1CI6 B;  1S9K E;  4M3L A;  5CMZ A;  5AW5 B;  4I2L C;  3HE4 B;  3HTK A;  5AVS B;  3KQG A;  3UIA A;  4AYC A;  3T97 A;  3A2A A;  1X8Y A;  2P7J A;  3VMX A;  3TYY A;  2P67 A;  1T2K D;  3NTN A;  4JYB A;  1HBW A;  1A02 F;  3VTP C;  4GT1 A;  5AVR B;  1HJB A;  2WPS A;  1GD2 E;  2YO3 A;  3TNU B;  2E43 A;  2Q5U A;  3V4W A;  5AW3 B;  1MFZ A;  1GK6 A;  1A02 J;  1JUN A;  4EOT A;  5AVQ B;  2P2U A;  2JJL A;  5AW6 B;  4B86 A;  5AVU B;  4AQR D;  3P8M C;  2XV5 A;  1MUU A;  4JYC A;  2C9N Y;  1FAV A;  1G2C B;  1J2J B;  3P7K A;  3M0D A; 
#chains in the Genus database with same CATH topology
 2A06 G;  3WUU A;  2HFE D;  1Y9B A;  2N9Y B;  1KIL D;  3CC4 P;  3FX0 A;  5APX A;  3VMY A;  4C46 A;  1OW7 A;  3L71 E;  2RKL A;  2YKO A;  1PP9 G;  2W83 C;  1H0T A;  4IL6 X;  1L0N E;  2WSE H;  1S1C X;  1AJY A;  2BCC J;  3H1H E;  3L73 J;  3HE5 B;  2H88 C;  2QRX A;  3W68 A;  4W80 A;  2BEZ F;  2QM7 A;  1AQT A;  3O6Q B;  4Y99 B;  3I55 P;  2N1T C;  5CCG A;  5KAF H;  1YIT P;  2C9L Y;  4YPC A;  1SQX J;  3M91 A;  2E74 B;  5AW7 B;  2YXQ B;  5KKZ C;  2JP3 A;  1BDD A;  3VMZ A;  2BCC E;  1IJD B;  4HYT B;  1PPJ E;  1SQP D;  2K9J B;  3VP9 A;  1VF5 B;  1RE3 A;  3H1L E;  3H6P A;  2HR3 A;  3H1L G;  1SQB G;  4IFF A;  1OXZ A;  1AVY A;  1NTK K;  5KLV E;  4YXW H;  2M3B A;  2E76 C;  1KYO E;  1HH0 A;  5K5G B;  1M8O B;  3L73 G;  4R4M A;  1E79 H;  1SS1 A;  1K8A Q;  2HPC B;  5AW9 B;  1HF9 A;  3B8E B;  1K04 A;  2K37 A;  1J1E B;  1YYC A;  1SQQ D;  3U1A A;  1KYO D;  1L4A D;  2Q3E A;  1J1D B;  1Z56 A;  3RBZ A;  3KXD A;  1IK9 A;  3L71 G;  2WT7 B;  3H1K D;  2FXP A;  3PRJ A;  4D6T D;  5TIS H;  3L75 E;  1L0N K;  3B71 A;  5KAF E;  1SQB K;  3GW6 A;  4UB8 H;  3H1H G;  2IYP A;  1BGY G;  1S2E A;  3LIE A;  1ZV8 A;  1KV4 A;  1ZR2 A;  2N1T D;  3TK1 A;  3R4Y A;  1KD1 Q;  1Y47 A;  2PGD A;  1BCC D;  3F5H A;  1U57 A;  2IBZ I;  3BRV B;  5APT A;  2XND H;  3CPW O;  4ASV A;  1KB9 E;  4WY4 B;  1SLQ A;  3CWB G;  3S9O A;  3TDK A;  3A0H E;  1IK7 A;  2IBZ D;  4PD4 E;  4WB4 A;  3A3Y B;  3L75 J;  4TT3 H;  2JDI H;  3H1I G;  5BVZ A;  1VQ8 P;  1VQK P;  1N7S D;  1NTK G;  2E5Y A;  1L0N D;  2GUV A;  1SQQ K;  2D2C C;  3MP7 B;  1FC2 C;  1T3U A;  3WMM 0;  3HE4 A;  3A5T A;  1RF0 A;  3S1K A;  1R5L A;  1FDI A;  1NKN A;  3CXH D;  3TGU E;  4AUW A;  2KNC A;  1RE3 C;  4H13 B;  1KYO I;  4I7Z C;  1KQL A;  1L4A B;  2DW3 A;  2FBW C;  3A0H H;  1XTC C;  2KB7 P;  2NPS B;  3HD7 C;  4RKU J;  5H2F E;  2Z4E A;  1DD3 A;  1GDT A;  1NGM B;  2P1J A;  4IL6 H;  4LGD E;  1EDI A;  2ZJS E;  1NTK D;  1VQM P;  1BDC A;  3SFD C;  1W2B O;  1JO5 A;  1GZL A;  2QM8 A;  1GTW A;  2KZI A;  3HE5 A;  1VQ7 P;  2OYO A;  3CWB D;  3FWL A;  3WUT A;  2FY8 A;  1SQP K;  3C9I A;  2OTL P;  1HUC A;  3V2N A;  1ZN5 A;  2QE7 H;  2OYH C;  1BCC G;  5CMZ A;  1GL2 A;  1LT9 B;  1SQV K;  3Q5S A;  3L73 E;  1VF5 D;  4YTP C;  3HTK A;  1M57 D;  3UIA A;  3CWB E;  1VQP P;  4JBZ A;  2QG4 A;  5EFW B;  3P8C E;  2KIK A;  3RK3 D;  1OMI A;  2E76 D;  1FZF A;  1N7S C;  3LW5 J;  1P84 D;  3MHV A;  4H13 C;  4EDF A;  2QEX P;  3NTN A;  3H1K G;  1NTM D;  4JYB A;  4PV1 B;  1HBW A;  3B5N B;  1NYH A;  1A02 F;  2JWA A;  2FXO A;  5KAI H;  3B5N A;  1FJP A;  1BGY J;  1AVO A;  1ZXG A;  2A45 I;  4GT1 A;  1HJB A;  1FZB A;  1RF1 C;  1KTM A;  2YO3 A;  3VP8 A;  1SQX D;  1YBK A;  2WSF J;  3EWK A;  2HPC A;  3BCC D;  2PP6 A;  2M8R A;  3H1K E;  2XKM A;  2ITA A;  1R8E A;  1NTZ E;  4N3Y B;  4DT0 A;  2P2U A;  1DX7 A;  2KLU A;  1FOS E;  4B86 A;  2WPV B;  2KXP B;  4AQR D;  1USD A;  3D71 A;  1LP1 A;  3AE5 C;  1RQU A;  1L0L D;  4NPE A;  4JYC A;  1VDF A;  4GIF A;  1ZP0 C;  4L74 A;  2WSF H;  4W7Z A;  4EIJ A;  1PGQ A;  2FXM A;  3RK2 B;  2ZXX A;  3GHG B;  4YXD C;  3M0A A;  5KTB A;  3C1L A;  4KHX A;  2N9B A;  5AVT B;  1SQB J;  1NJI Q;  3CX5 E;  1FZG A;  1AV1 A;  5TJH A;  2WSE J;  4WY4 A;  1PGO A;  1J1D C;  1OVV A;  1PFI A;  3F89 A;  2ZFC A;  3NFQ A;  5APY A;  3OJA B;  3CLQ A;  3MZW B;  1GK4 A;  1PP9 D;  1JY3 N;  1EDK A;  1NVO A;  3KDP B;  4O9B A;  5AW4 B;  3E1I A;  3ZDM A;  4GDO A;  2E75 C;  1PPJ G;  4I1L A;  4ZKU A;  5APS A;  2FFD B;  1NTM K;  2KNC B;  4GKG A;  1YQ3 C;  1W2E A;  3P32 A;  1LTA C;  2V7Q J;  1QX8 A;  1NTK E;  2LR2 A;  5KLV K;  1X79 B;  1GL2 D;  2NPS D;  4WY4 D;  1JTH B;  5E79 H;  4L76 A;  2FFD C;  3PLN A;  4U3F G;  3RK3 C;  3CXH H;  2IDB A;  1SQV D;  2ZYA A;  3L35 A;  2N1T A;  3L75 G;  3FWN A;  1NTZ K;  5KLV J;  2IX7 C;  2N1T B;  2Q1K A;  3OW2 O;  3OAK A;  3SWY A;  1VQO P;  1M56 D;  1NU1 K;  1SQX G;  3JCU H;  3RL0 D;  2O01 N;  2KP8 A;  1Y8A A;  4EI2 A;  1S4X A;  2BCC D;  1NTZ J;  2WSC H;  3O6Q A;  2OYI C;  1JY2 N;  1M90 Q;  2YKP A;  3PJS K;  3L4F A;  2FYZ A;  2WPQ A;  2Y0D A;  1P84 E;  1DIP A;  1JOC A;  1NU1 E;  3AEB C;  1SFC D;  5AVW B;  3Q1M A;  5AVZ B;  3HTK B;  3RK2 C;  1QVG O;  4MN4 C;  1EZV E;  1MFT A;  3L74 G;  4HJG H;  1G2C A;  3G9R A;  5KLV G;  4BRY A;  3TNU A;  1CW5 A;  1S9K D;  3MGN A;  3E7K A;  1KQG B;  2FYU G;  5AW0 B;  1LTI C;  4OGQ B;  3Q3D A;  2HOD B;  4W7Y A;  4UB6 H;  2A45 H;  4OGQ C;  3MUD C;  1IO4 A;  2WVR A;  1N86 A;  2I1K A;  2L5G B;  3EFF K;  3H1J G;  2R5B A;  2AEJ A;  3K5B A;  3TSI A;  2K3R A;  4D6T E;  1NKZ B;  1FZC B;  3O8Z A;  3CI9 A;  3BRT B;  4BWN A;  2R3C A;  2HLO A;  3N7N A;  3AE6 C;  5B66 H;  1KC8 Q;  2O01 J;  4PJ0 E;  5L8R J;  2J5U A;  2E42 A;  1BSH A;  1BE3 G;  1ZR4 A;  1EDJ A;  1LTS C;  4H0L D;  4GOD A;  3L74 J;  2WT7 A;  3M9B A;  4D6T J;  4I6M C;  1NWQ A;  1EXJ A;  1P84 I;  2HYN A;  2OYI B;  1FDO A;  1KB9 I;  1M1J A;  3WU2 H;  3GHG A;  2LKM A;  1M1J B;  2M5A B;  2Q3I A;  1L0N G;  1NO4 A;  3EQ2 A;  5CHX A;  2IZ1 A;  1PP9 E;  1SFC C;  2M5A A;  1KOR A;  1KZU B;  3S4R A;  3H1I D;  1WMK A;  2IFN A;  3FXE A;  3L72 J;  2IBZ G;  3PP5 A;  4HH2 A;  1SQP E;  1PZQ A;  3B4S A;  1NOH A;  3D6Z A;  2KS1 A;  3RL0 g;  3CCM P;  1BCC E;  2IZ0 A;  2K9J A;  2OAR A;  4H44 D;  1S9K E;  4M3L A;  2POH A;  1NTM E;  3RL0 C;  5KLV D;  3RK2 D;  3L74 D;  4I2L C;  3HD7 A;  5GTH H;  2KSJ A;  1FS0 E;  1IC2 A;  1URQ A;  2B89 A;  2IFM A;  3H1H J;  3HD7 B;  3HE4 B;  1X9V A;  1JMB A;  2D2C D;  1WRG A;  2M0B A;  2E75 B;  3AEF C;  3U1C A;  1X8Y A;  1G1J A;  1HJ0 A;  3VMX A;  1LJ2 A;  3IF4 A;  3TYY A;  1SQB E;  3LW5 H;  4D6T G;  3L71 D;  4BXL A;  5KLI C;  3AE9 C;  1T6A A;  3CXH I;  3CME P;  4HB1 A;  1LGH B;  2WPS A;  5CCG C;  2D2C B;  2G3A A;  2E43 A;  1KQS O;  2SPZ A;  2Q5U A;  3CCL P;  1JMM A;  3HUS A;  2P10 A;  5AW3 B;  5C39 A;  1N73 C;  3SWK A;  1LNQ A;  1SQV E;  2JJL A;  4WY4 C;  2FYN C;  3L72 D;  4PJ0 H;  1NU1 G;  2Y0E A;  3A0B H;  4DCK A;  5B66 E;  1MUU A;  3H1L D;  3GG2 A;  1KMI Z;  3AEG C;  4RO0 A;  1L0L K;  1BGY E;  1SQP G;  4H13 D;  1YJW P;  4Z1M H;  2WSS H;  4U3F J;  1XTG B;  3PH0 A;  2Q6Q A;  2XU6 A;  1JCD A;  4PD4 I;  1KQF B;  3JCU E;  1L0L J;  1OX3 A;  1M7L A;  2KSE A;  2LXB A;  2XZR A;  3JSV C;  2KOG A;  2ZVO B;  2Q9I A;  1Q86 Q;  4DOJ A;  1SQX K;  1S5L X;  2HOD A;  2RH0 A;  3I56 P;  4PD4 H;  2CPS A;  4PV1 C;  4WBA A;  1FOS F;  1HGZ A;  3KHU A;  3CMA P;  1M1K Q;  5BU8 B;  1SQP J;  5AVV B;  3M0D C;  1BE3 E;  2ZYG A;  5CCG D;  2A06 D;  1DEE G;  1RY3 A;  3IFM A;  2K1A A;  3G71 P;  2GM4 A;  1LP1 B;  3H1J E;  2QVA A;  3L70 D;  2O3J A;  5APU A;  3RL0 B;  1DD4 A;  1JB0 J;  1OVR A;  1OFC X;  3SWF A;  3L72 G;  5CCH D;  1ZOY C;  1LWU A;  2C0W A;  2IYO A;  2Y0C A;  2ZVN B;  1GMJ A;  5CJ0 A;  4LC1 A;  2WQY C;  4HKZ H;  3V2R A;  1SFC B;  3MD0 A;  1N73 A;  3BCC G;  2HG5 D;  1ZRT E;  3CX5 H;  4C7N A;  2R32 A;  3M9H A;  1OIP A;  2O1J A;  2I8D A;  1JM0 A;  1LTB C;  1N7L A;  4LLH A;  1FE6 A;  4I7Z B;  2QSI A;  1S5L H;  2VRS A;  1D7M A;  1NTM G;  1IFI A;  1U7J A;  1GW4 A;  2WIT A;  4GOE A;  4BRY B;  5CCH A;  4N78 D;  1URQ B;  2YKQ A;  2Z5I A;  3RGU A;  1N8R Q;  3ABV C;  1H8A A;  3HRN A;  1FZC C;  1EQ7 A;  2QJP C;  1GW3 A;  1PP9 J;  2R5D A;  2BAS A;  3U59 A;  4H44 C;  3LID A;  2FYU J;  1K73 Q;  1JTH A;  2ZT9 C;  3P8C D;  3AEC C;  3IAO A;  4RES B;  2FKW B;  2YIU C;  1LTT C;  1JY3 O;  3TGU D;  4XA4 A;  4KT0 J;  2QJK C;  3CCJ P;  1K9M Q;  1H0T B;  3KYQ A;  1ZME C;  1BCC J;  2LXC B;  1OZH A;  4WVZ A;  2Y9Z A;  1K05 A;  3CC7 P;  3CCS P;  1QEX A;  1JNM A;  1N7S A;  1JCC A;  1KIL E;  1GU5 A;  5CBO A;  2O01 H;  3IN6 A;  4OWF A;  1EZV D;  4XE5 B;  3E1R A;  2KZJ A;  3SFE C;  3NMD A;  2UWJ E;  1QL2 A;  3OA7 A;  3H1K J;  3QWO C;  1IFN A;  4TLF A;  3D6Y A;  3AED C;  1YQ4 C;  3CX5 I;  2YMK A;  4U7J A;  2Q7C A;  1EZV G;  1W5C E;  1BE3 D;  2PAJ A;  3GLM A;  3AEE C;  2L91 A;  3WU2 E;  1T2K C;  1S72 P;  1VQ6 P;  2OTK E;  1TU3 F;  1Q7Y Q;  2W27 A;  1YIJ P;  2FYU E;  3CC2 P;  2H43 A;  1SP4 A;  3H1J J;  3V4Q A;  5APW A;  3CCU P;  1KN7 A;  1VQL P;  3TGU G;  2ZXE B;  1JY2 O;  1CSB A;  2B87 A;  2V7Q H;  2E76 B;  1MKM A;  1HTL C;  2W6B A;  2B87 B;  1IFM A;  3MUD A;  4IL6 E;  5AW1 B;  1NAF A;  2FYU D;  5AW2 B;  3RK3 B;  1YHQ P;  1CI6 B;  1KIL B;  1NU1 J;  3H32 A;  3PTZ A;  2FFD A;  3G3Z A;  3BAT A;  4RJT A;  1N2D C;  5AW5 B;  1LTJ C;  5GTI H;  1FZC A;  1X22 A;  1VF5 C;  4AYC A;  1BGY D;  5KJ7 C;  1RH5 B;  2K88 A;  3A2A A;  3RBX A;  3T97 A;  1KB9 D;  3C8V A;  4N6J A;  2P7J A;  2QJY B;  2NRG A;  2P67 A;  3Q5R A;  3B5N D;  1YJN P;  3CX5 D;  2W90 A;  4R4L A;  4Y99 C;  1UII A;  1FBM A;  4U3F E;  2KYV A;  1NH4 A;  1S3J A;  2PRR A;  1Q90 D;  2Y9Y A;  1T8Z A;  1SQQ G;  4GOF A;  3VTP C;  2J59 M;  4EYY Q;  2O1K A;  4L75 A;  2E5T A;  4KJM A;  3G4S P;  3RK3 E;  1NTK J;  3CCV P;  1GK6 A;  1SFC A;  2W6J H;  3TGU J;  1OW6 A;  1OVU A;  1SQV G;  1A02 J;  2YIU B;  5AVQ B;  1E5W A;  2XNX A;  3GHG C;  3ITK A;  5AW6 B;  1BE3 J;  3M9Q A;  4OGQ D;  5CJ4 A;  1LWU C;  3AE2 C;  2WMM A;  3P8M C;  4JQ0 D;  1QLE D;  1SQB D;  1ZRT D;  2KS1 B;  2QJP B;  3V2Q A;  1G2C B;  3BCC E;  2AEM A;  1J2J B;  1WT6 A;  2K9Y A;  4EOT A;  3M0D A;  2RN0 A;  1RHZ B;  3II6 A;  3Q2Y A;  1URQ C;  2H7H A;  1LTJ A;  1PPJ D;  1RF0 C;  1T3J A;  2KLV A;  2KUB A;  4ZNC A;  1PL5 A;  1L0N J;  1SVF A;  3L36 A;  4NPD A;  5E79 E;  1FDM A;  3H1L J;  1YTZ T;  4K35 A;  2AEF A;  2JKV A;  2NPS A;  2J58 A;  2XDJ A;  2W6A A;  1SQQ J;  1S5L E;  2H89 C;  1X0T A;  1Q81 Q;  3NXS A;  1RF1 B;  1HWT C;  2KK7 A;  3V5B A;  1SQX E;  1AA0 A;  3CXH E;  1GU4 A;  3B5N C;  3R2P A;  3AE8 C;  3BCC J;  4IFM A;  1CZQ A;  3BAS A;  2Z5H A;  3A0B E;  2YNY A;  3HUS B;  1QVF O;  1N7S B;  1P84 H;  2E75 D;  2JR8 A;  2RMZ A;  3AE3 C;  1KFM A;  2V4H A;  5AVX B;  1SQQ E;  2JO1 A;  2P58 A;  1UIX A;  2R3S A;  3JC2 2;  4DZO A;  3GMA A;  2IBZ E;  1FU1 A;  3PHL A;  1HGV A;  1GL2 B;  1LT9 A;  1L0L E;  1OWA A;  1LT9 C;  1RQV A;  1LT1 A;  1L0L G;  2YO2 A;  3H25 A;  1DH3 A;  1GL2 C;  2OYH B;  3D70 A;  3AE1 C;  1NU1 D;  1IFP A;  1NHL A;  2OGU A;  2WSC J;  3L37 A;  1ZW0 A;  2ZAE B;  3MIW A;  5AW8 B;  1Q82 Q;  2OYH A;  1FZE A;  1NTZ D;  1USE A;  3I5C A;  1KFN A;  5KAI E;  3KZI H;  3USS A;  4Y28 J;  3VYI A;  3HUS C;  1PGP A;  4C7N B;  1VQ9 P;  3V6I A;  3FXD A;  3CCQ P;  3SSU A;  2FYU K;  1RE4 C;  3CL3 D;  1U7M A;  1URQ D;  4C7R A;  1EC5 A;  1AFO A;  2NPS C;  5DJU B;  2ZYD A;  1G1I A;  1L4A C;  5GTH E;  3CCR P;  1IFJ A;  4OVN F;  1VQ4 P;  2AXT H;  2NZ2 A;  5CBN A;  2E74 D;  1JUN A;  4H0L B;  1ZLL A;  4PD4 D;  1PIX A;  1IFD A;  1QGK B;  2WWW A;  3V2P A;  2WTY A;  2AXT E;  3CCE P;  1NAY A;  3T97 B;  2GA1 A;  3QH9 A;  4JPZ B;  1H89 A;  3L72 E;  1H88 A;  1MZ9 A;  3L70 J;  1QL1 A;  2OYI A;  5APV A;  2CPB A;  1LWU B;  2PFX A;  1YTZ I;  4ZMD A;  2FYN B;  3CWB J;  1EXI A;  1DEB A;  4N78 E;  1JY2 P;  4CPG A;  4NPF X;  1AQ5 A;  2BEQ D;  2MKV A;  2QIW A;  3KZI E;  1N73 B;  3N4X A;  1LTG C;  2WPR A;  4IOI H;  4UB6 E;  1Q2N A;  2B9B A;  5AVY B;  5B5E H;  2QA4 P;  5KLI B;  3AEA C;  4XFJ A;  5M1B A;  4PV1 D;  4DJG A;  2JWD A;  3H1I E;  2R44 A;  2YXR B;  3M06 A;  4H0L C;  1MV8 A;  2WZ7 A;  2QJY C;  3GF3 A;  2A45 G;  5KJ7 A;  2I1J A;  1IZN B;  4ZKP A;  1PV3 A;  3G6E P;  1J1E C;  1LTJ B;  3VOP A;  1YI2 P;  4WWI A;  3KQG A;  5APQ A;  3H1I J;  1L4A A;  1KIL C;  1RE4 A;  3EFG A;  3H1J D;  1CI6 A;  1KIL A;  3A7O A;  3H32 B;  3L70 E;  1PGJ A;  3IR9 A;  2IPP A;  3Q5P A;  3KPE A;  2A06 E;  1RF1 A;  1L2P A;  2W8Z A;  4QMA A;  4ASW A;  3VN0 A;  2ZT9 D;  2C0X A;  2B88 A;  4OH8 B;  1NTM J;  1M1J C;  1FZA A;  2G8Y A;  4K3A A;  3VMA A;  5KJ7 D;  3CD6 P;  3H1H D;  5B5E E;  1VQN P;  2E74 C;  5KKZ B;  2H8P D;  3L71 J;  3AE4 C;  3AE7 C;  1R5S A;  2GUS A;  3W67 A;  1T2K D;  2JEE A;  1OW8 A;  1VQ5 P;  1VPC A;  1KYO H;  2CK3 H;  3FGA D;  1EZV I;  2BCC G;  3MTU E;  5AVR B;  1YJ9 P;  1GD2 E;  1EDL A;  1FJK A;  1VL2 A;  5H2F H;  1KB9 H;  3TNU B;  2M3E A;  1JY3 P;  5AVS B;  3V4W A;  2OTJ P;  3GF7 A;  5GTI E;  4L73 A;  1BSN A;  1MFZ A;  2QJK B;  3L74 E;  5DJT B;  3L75 D;  3HD7 D;  3L73 D;  4A7P A;  1SQV J;  1NTZ G;  2YMY A;  2MJZ A;  1HVV A;  2ZT9 B;  2AXC A;  4U3F D;  5AVU B;  3TF5 A;  3WUV A;  4H44 B;  1JEK A;  2XV5 A;  5BU5 A;  5CCH C;  2OQQ A;  3L70 G;  4UB8 E;  1FAV A;  2C9N Y;  4IFD K;  5TIS E;  2KI7 B;  4JF7 A;  3P7K A;  3BVH A; 
#chains in the Genus database with same CATH homology
 2HFE D;  1KIL D;  5APX A;  4C46 A;  3VMY A;  2YKO A;  2WSE H;  3HE5 B;  4W80 A;  2QM7 A;  4Y99 B;  2N1T C;  5CCG A;  3M91 A;  5AW7 B;  3VMZ A;  1IJD B;  4HYT B;  3VP9 A;  1RE3 A;  3H6P A;  4IFF A;  1OXZ A;  1NTK K;  2M3B A;  1HH0 A;  2HPC B;  5AW9 B;  3B8E B;  1J1E B;  1YYC A;  3U1A A;  1L4A D;  1J1D B;  1Z56 A;  1IK9 A;  2WT7 B;  1L0N K;  1SQB K;  3LIE A;  1ZV8 A;  1ZR2 A;  2N1T D;  3TK1 A;  3BRV B;  5APT A;  4WY4 B;  1SLQ A;  4WB4 A;  3A3Y B;  5BVZ A;  1N7S D;  2GUV A;  1SQQ K;  1T3U A;  3WMM 0;  3HE4 A;  3A5T A;  1RF0 A;  1NKN A;  4AUW A;  1RE3 C;  1L4A B;  1KQL A;  1XTC C;  2KB7 P;  2NPS B;  3HD7 C;  2Z4E A;  1GDT A;  2P1J A;  4LGD E;  1GZL A;  2QM8 A;  1GTW A;  3HE5 A;  1SQP K;  3C9I A;  1HUC A;  3V2N A;  1ZN5 A;  2OYH C;  5CMZ A;  1GL2 A;  1LT9 B;  1SQV K;  3HTK A;  3UIA A;  3P8C E;  3RK3 D;  1FZF A;  1N7S C;  3NTN A;  4JYB A;  1HBW A;  3B5N B;  1A02 F;  1FJP A;  3B5N A;  2A45 I;  4GT1 A;  1HJB A;  1FZB A;  1RF1 C;  2YO3 A;  3VP8 A;  2HPC A;  2PP6 A;  2M8R A;  2XKM A;  1JUN A;  4N3Y B;  1DX7 A;  2P2U A;  4B86 A;  4AQR D;  4EIJ A;  4JYC A;  1VDF A;  4GIF A;  4W7Z A;  2WSF H;  2FXM A;  3RK2 B;  3GHG B;  3M0A A;  5KTB A;  4KHX A;  2N9B A;  5AVT B;  4WY4 A;  1J1D C;  1PFI A;  2ZFC A;  3NFQ A;  5APY A;  3OJA B;  3CLQ A;  1GK4 A;  1JY3 N;  3KDP B;  4O9B A;  5AW4 B;  3E1I A;  4I1L A;  4ZKU A;  5APS A;  2FFD B;  1NTM K;  4GKG A;  1W2E A;  3P32 A;  1LTA C;  1FOS E;  5KLV K;  1X79 B;  1GL2 D;  2NPS D;  4WY4 D;  1JTH B;  2FFD C;  3RK3 C;  3L35 A;  2N1T A;  1NTZ K;  2IX7 C;  2N1T B;  3OAK A;  3SWY A;  1NU1 K;  3RL0 D;  2KP8 A;  2WSC H;  2OYI C;  1JY2 N;  2YKP A;  3L4F A;  2FYZ A;  2WPQ A;  1JOC A;  1SFC D;  5AVW B;  5AVZ B;  3HTK B;  3RK2 C;  1G2C A;  3TNU A;  1CW5 A;  1S9K D;  3MGN A;  5AW0 B;  1LTI C;  2HOD B;  4W7Y A;  2A45 H;  1IO4 A;  1N86 A;  2I1K A;  2L5G B;  3TSI A;  2R5B A;  1NKZ B;  1FZC B;  3O8Z A;  3CI9 A;  3BRT B;  2R3C A;  2HLO A;  3N7N A;  2E42 A;  1ZR4 A;  1LTS C;  2WT7 A;  3M9B A;  4I6M C;  1NWQ A;  2HYN A;  2OYI B;  1M1J A;  3GHG A;  2LKM A;  1M1J B;  2Q3I A;  1NO4 A;  3EQ2 A;  5CHX A;  1SFC C;  1KZU B;  3PP5 A;  2IFN A;  4HH2 A;  1NOH A;  2OAR A;  1S9K E;  4M3L A;  2POH A;  3RL0 C;  3RK2 D;  4I2L C;  3HD7 A;  2KSJ A;  1URQ A;  1IC2 A;  3HE4 B;  2IFM A;  3HD7 B;  3KQG A;  5AVS B;  3U1C A;  1X9V A;  1WRG A;  1X8Y A;  1G1J A;  3VMX A;  3TYY A;  3LW5 H;  1LGH B;  2WPS A;  5CCG C;  2E43 A;  2Q5U A;  1JMM A;  3HUS A;  5AW3 B;  1N73 C;  2JJL A;  4WY4 C;  1MUU A;  1L0L K;  1XTG B;  2XU6 A;  1JCD A;  2XZR A;  1M7L A;  2KOG A;  2Q9I A;  4DOJ A;  1SQX K;  2HOD A;  2CPS A;  4WBA A;  1FOS F;  1HGZ A;  5BU8 B;  5AVV B;  3M0D C;  5CCG D;  1RY3 A;  3IFM A;  2GM4 A;  3RL0 B;  5APU A;  3SWF A;  5CCH D;  1LWU A;  2C0W A;  5CJ0 A;  4LC1 A;  3V2R A;  1SFC B;  3MD0 A;  1N73 A;  2HG5 D;  4C7N A;  2R32 A;  3M9H A;  2O1J A;  1N7L A;  1LTB C;  4LLH A;  2VRS A;  1IFI A;  1GW4 A;  2WIT A;  5CCH A;  4N78 D;  1URQ B;  2YKQ A;  2Z5I A;  1H8A A;  3HRN A;  1FZC C;  1EQ7 A;  1GW3 A;  2R5D A;  3U59 A;  2BAS A;  3LID A;  1JTH A;  3P8C D;  4RES B;  2FKW B;  1LTT C;  1JY3 O;  4XA4 A;  3KYQ A;  1JNM A;  1N7S A;  1JCC A;  1GU5 A;  2O01 H;  4XE5 B;  3NMD A;  1QL2 A;  3OA7 A;  1IFN A;  1JO5 A;  2Q7C A;  2C9L Y;  2PAJ A;  1T2K C;  2W27 A;  2H43 A;  1SP4 A;  3V4Q A;  5APW A;  2ZXE B;  1JY2 O;  1CSB A;  3MUD A;  2W6B A;  1HTL C;  3RK3 B;  1IFM A;  1FZG A;  1NAF A;  5AW2 B;  1CI6 B;  1KIL B;  3H32 A;  2FFD A;  3G3Z A;  3BAT A;  1N2D C;  5AW5 B;  1LTJ C;  1FZC A;  4AYC A;  5KJ7 C;  3T97 A;  3A2A A;  4N6J A;  2P7J A;  2P67 A;  3B5N D;  4Y99 C;  1FBM A;  2KYV A;  1NH4 A;  3VTP C;  1T8Z A;  2J59 M;  2O1K A;  1GK6 A;  1SFC A;  1A02 J;  5AVQ B;  1E5W A;  2XNX A;  3GHG C;  5AW6 B;  3M9Q A;  5CJ4 A;  1LWU C;  3P8M C;  3V2Q A;  1G2C B;  1J2J B;  1WT6 A;  4EOT A;  3M0D A;  3II6 A;  1URQ C;  2H7H A;  1LTJ A;  1RF0 C;  2KLV A;  1T3J A;  1SVF A;  3L36 A;  1FDM A;  1YTZ T;  2NPS A;  2J58 A;  2XDJ A;  2W6A A;  1RF1 B;  1HWT C;  3NXS A;  3V5B A;  1GU4 A;  3B5N C;  3R2P A;  4IFM A;  1CZQ A;  3BAS A;  2Z5H A;  2YNY A;  3HUS B;  1N7S B;  5AVX B;  1KFM A;  4DZO A;  1FU1 A;  1HGV A;  1GL2 B;  1LT9 A;  1OWA A;  2YO2 A;  1LT9 C;  1DH3 A;  1GL2 C;  2OYH B;  3L37 A;  1NHL A;  3MIW A;  2OYH A;  5AW8 B;  1FZE A;  3I5C A;  1KFN A;  4C7N B;  3VYI A;  3HUS C;  2FYU K;  1RE4 C;  3CL3 D;  1URQ D;  4C7R A;  1AFO A;  2NPS C;  1G1I A;  1L4A C;  1IFJ A;  1ZLL A;  2WWW A;  1IFD A;  3V2P A;  2WTY A;  1H89 A;  1H88 A;  1MZ9 A;  1QL1 A;  2OYI A;  5APV A;  2CPB A;  1LWU B;  1YTZ I;  1DEB A;  4N78 E;  1JY2 P;  1AQ5 A;  1N73 B;  3N4X A;  1LTG C;  2WPR A;  5AVY B;  3M06 A;  1MV8 A;  2WZ7 A;  2A45 G;  5KJ7 A;  2I1J A;  4ZKP A;  1J1E C;  1LTJ B;  3VOP A;  5APQ A;  1L4A A;  1KIL C;  1RE4 A;  3EFG A;  5AW1 B;  3H32 B;  1KIL A;  1CI6 A;  3A7O A;  3IR9 A;  2IPP A;  3KPE A;  1RF1 A;  3VN0 A;  2C0X A;  4OH8 B;  1M1J C;  1FZA A;  5KJ7 D;  2H8P D;  1T2K D;  2GUS A;  2JEE A;  1VPC A;  3MTU E;  5AVR B;  1GD2 E;  1FJK A;  3TNU B;  1JY3 P;  3V4W A;  1MFZ A;  3HD7 D;  2YMY A;  2MJZ A;  1HVV A;  5AVU B;  2XV5 A;  5BU5 A;  5CCH C;  2C9N Y;  1FAV A;  4IFD K;  4JF7 A;  3P7K A;  3BVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...