2E43A

Crystal structure of c/ebpbeta bzip homodimer k269a mutant bound to a high affinity dna fragment
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
b'SDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*DTP*DAP*DGP*DGP*DAP*DTP*DTP*DGP*DCP*DGP*DCP*DAP*
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2e43A00
1GK4A 3NMDA 1GK6A 1A02J 3VMXA 2R5BA 3TNUA 1GU5A 1OWAA 4JYBA 5APTA 5AVTB 3TYYA 5CMZA 2Z5HA 3M0AA 3NTNA 4HYTB 2VRSA 2E43A 3TNUB 1SLQA 4DZOA 4AYCA 2R3CA 2R32A 2YO3A 2WTYA 1GD2E 1MV8A 1H8AA 2KP8A 3NFQA 3OAKA 3M91A 1HBWA 3L37A 3VYIA 1FOSE 2QM8A 4JYCA 1JNMA 3M0DA 1HJBA 2BASA 3L35A 5APXA 5AVZB 5AW4B 3HE4A 2XZRA 3A3YB 2WPQA 5AW0B 3P8MC 1FOSF 1FAVA 2E42A 2WWWA 3M9HA 3HE4B 3LIDA 3MD0A 3MGNA 1H89A 1CZQA 1T2KD 2WPSA 2Q3IA 3HE5A 5AVWB 2ZXEB 1NWQA 4EOTA 2WT7A 5AVQB 3LIEA 3V4QA 3M9BA 2Q7CA 1S9KE 5APSA 3SWFA 4GT1A 3HE5B 2YO2A 5APYA 3A7OA 3A5TA 2C9NY 3T97A 2WT7B 3I5CA 1GTWA 5AVXB 3KDPB 4RESB 5APWA 4AUWA 2IPPA 5AW2B 3VN0A 4GKGA 3A2AA 1GZLA 5AW6B 5AW8B 5AVVB 5AW9B 5AVSB 1NAFA 3P7KA 1IO4A 2Z5IA 2H7HA 4M3LA 3VTPC 3IR9A 2R5DA 1YYCA 5APUA 2ZFCA 3P32A 1CSBA 5APVA 3V4WA 4AQRD 2P2UA 1A02F 2W27A 5AW3B 1G2CB 4LC1A 3M06A 1J2JB 5AVUB 3B8EB 2XV5A 4I6MC 3VMYA 3V5BA 1OXZA 2WPRA 4KHXA 2Q5UA 1CI6A 1SP4A 3NXSA 1KQLA 2N9BA 1HUCA 2QM7A 3O8ZA 1CI6B 3KQGA 5AVYB 1GU4A 2XU6A 5APQA 1S9KD 1HWTC 2C9LY 3HTKA 1H88A 3L36A 5AVRB 1MFZA 1T2KC 5AW1B 3VMZA 1MUUA 2P7JA 3TK1A 1DH3A 4XE5B 2P67A 4I2LC 4C7NA 2W6AA 5AW5B 4B86A 5AW7B 1JUNA 1X8YA 4C7NB 3UIAA 2JJLA 2YNYA 4C46A
chains in the Genus database with same CATH superfamily
4LLHA 1OWAA 1KILD 1IJDB 2KZIA 3CMEP 2VRSA 4AYCA 1KILA 1H0TB 2AEFA 3D6ZA 5APXA 1NTZJ 5AVZB 1NU1D 3CCJP 1YTZT 1FAVA 2Y0EA 3HD7B 1PZQA 3AE8C 5AVQB 3CCSP 3VMAA 3A0BE 3L71G 1W2EA 3RL0B 4AUWA 1NO4A 5CJ4A 5KLVK 4UB6H 3L71E 3CMAP 1IO4A 3P8CD 5E79E 3L70G 1VPCA 4Z1MH 4WWIA 1SS1A 4R4MA 4EYYQ 1KB9H 3L70E 1G2CB 3L4FA 4IFDK 3H1HJ 3VMYA 1G1JA 2HPCA 4KHXA 3RK2D 2FXPA 2PFXA 4EDFA 2Q6QA 2MKVA 5GTIH 5AW1B 3CXHD 3SFDC 3CCRP 2W6AA 5KJ7D 3MUDC 3CX5H 1ZMEC 1YJ9P 2QJYC 5KJ7A 1A02J 2JR8A 1NU1J 1NKZB 3K5BA 3H32A 1BGYD 2IBZI 4DZOA 2R32A 1GD2E 1MV8A 3JSVC 2HR3A 1NTME 2ZAEB 2XZRA 4RKUJ 4I1LA 2J5UA 2WSCJ 1LNQA 1RQUA 4PJ0E 3MD0A 1SFCD 1RY3A 1R8EA 2W6JH 1R5LA 1T2KD 1OW7A 5CBNA 2A45I 1VQNP 2KNCB 3CPWO 3RGUA 1M1JC 5APWA 3AE9C 3RBZA 2WSCH 1U7JA 1NOHA 3H1JG 3CCQP 2FFDB 2Q3EA 3O6QA 1FU1A 2KLUA 5APUA 3H1JE 3OJAB 3KZIH 3U59A 1LJ2A 1N7SA 2OARA 1SVFA 1LTIC 1RF0A 4YXWH 5CCGA 3F89A 1OXZA 4OGQC 2ZT9C 4BWNA 3QWOC 3NXSA 1KQLA 2N9BA 3H1LG 5K5GB 1WT6A 3KQGA 2XU6A 1ZXGA 2YMYA 1H88A 3H1LE 3GF3A 1BGYJ 3CCVP 3CL3D 2QEXP 1S5LH 3CXHH 4ZKPA 5M1BA 2JDIH 1NKNA 1KYOD 1EZVD 3QH9A 1IFMA 1JCDA 5APTA 2IFNA 5CBOA 1BDCA 2WTYA 2KP8A 3WUUA 3VYIA 1VQLP 1JNMA 3L71D 1VQ9P 2Y9YA 3G71P 1ZN5A 2PRRA 4K3AA 2OTLP 1FZCA 3U1CA 3L70D 1CZQA 2E75B 1PP9J 4DOJA 2WT7A 1URQA 1ZOYC 5B5EH 1DD3A 3G3ZA 1RF1A 3H1ID 1SQVE 1P84D 1OZHA 1JY2P 1Q7YQ 3PH0A 5AVSB 4WY4C 1S1CX 5GTHH 1L0LE 2P1JA 3P32A 3CC4P 1KQSO 1BE3G 2W27A 1LTJB 1J2JB 4EI2A 1IK7A 2FYUK 1BE3E 1LT9C 1RE3A 1JOCA 2MJZA 3I56P 1SQQG 2C9LY 2KZJA 3WMM0 2P7JA 3GHGA 4NPEA 2P67A 3B5NB 2FYNC 1Q2NA 1KYOH 1LTTC 3L71J 4C46A 1JO5A 3RK3E 1KFMA 2KS1B 3CI9A 2H8PD 1FS0E 3L70J 2OYIA 4OGQD 4Y99B 1PGQA 2ZT9D 1KB9E 3RK3C 3H1IJ 3ABVC 5E79H 1S4XA 3H1JD 1T8ZA 2PAJA 2AXTE 4I7ZB 3N4XA 5CHXA 1KQFB 3L72G 3SWFA 1DEEG 3T97A 1YITP 3I5CA 1MZ9A 2N1TC 2LR2A 3Q5SA 1P84H 3CLQA 1U57A 1IFJA 2GUVA 2J58A 1WMKA 3HRNA 3CX5E 3SFEC 1LWUB 1Y47A 2G3AA 1KFNA 1EXJA 3TF5A 1FBMA 1L0NG 1NTKK 2R44A 1YTZI 2L91A 1FDIA 1JY2N 1L0NE 1AVYA 1JMMA 1VDFA 2QM7A 5KLIC 3C9IA 1AQ5A 1HWTC 3WU2H 3L73G 3Q2YA 3HTKB 3B4SA 4H0LC 1N86A 3HUSC 1OVRA 5AW5B 3JCUE 1X8YA 4PJ0H 2JJLA 1JY3P 4WY4D 2KOGA 4H13C 4WY4A 5DJUB 2OYHB 2B87A 3S4RA 3PJSK 3P8CE 1LGHB 2JO1A 3KZIE 1SQPK 2JP3A 1Z56A 3MZWB 2NPSA 3P8MC 2KI7B 2JWAA 3BASA 2FYZA 1LTBC 3M9BA 2C9NY 1BE3D 4JQ0D 3HD7C 1S5LE 3CXHE 3AE1C 1OW8A 5AW9B 2WSEJ 2K3RA 3P7KA 1YBKA 1SQQD 2Z4EA 3RL0C 2K9JA 1N73B 2GUSA 2WSFJ 1BGYE 2RH0A 1S72P 4I6MC 3RK3D 1IFNA 2WSEH 5CCHA 3FGAD 3USSA 2M3EA 3AE6C 2KLVA 1S9KD 4O9BA 2WSFH 3I55P 3TK1A 1E79H 2N1TD 3CCUP 3S1KA 2Y9ZA 1GK6A 1L4AC 5L8RJ 5AVTB 3FXDA 1PP9G 3Q5RA 4HYTB 1OFCX 1IK9A 1QL2A 1NTMK 2Q1KA 2YO3A 1PP9E 3L72D 2LKMA 1KILB 4DCKA 1BE3J 3KYQA 4R4LA 4HB1A 2OTJP 4PV1B 1FOSF 2WWWA 5C39A 2JWDA 4XA4A 1LT1A 2OQQA 2IYPA 4CPGA 1SQQJ 2ZXEB 1UIXA 4H0LD 3M0DC 1L0ND 1Q86Q 1OVVA 1CW5A 1EZVG 5AW6B 4C7RA 4IL6H 4H13D 3V6IA 1KYOE 1EZVE 4OWFA 5BU5A 4HJGH 3VP8A 3L73D 2P2UA 4IFFA 1J1DC 2FFDC 1OVUA 3H1KG 1SQXG 4TLFA 2Q5UA 2HPCB 1VQ6P 3H1KE 1SQXE 3GLMA 4UB8H 1OIPA 1JTHA 1ZV8A 3RK2B 1L2PA 4L73A 4XE5B 1HF9A 2H43A 3HD7D 3L72J 3H1IG 3CD6P 4IL6X 1FDMA 2AXTH 1RE4C 1XTGB 4YTPC 3H1IE 4DJGA 3M9QA 1N2DC 2M8RA 1GU5A 1P84E 3NTNA 3RL0D 2HLOA 5TJHA 3H32B 1T6AA 3OAKA 1IFPA 1IC2A 1L0NJ 3L35A 3L74G 3HE4A 4BRYA 1SQBG 2RKLA 1YIJP 3M9HA 1QVFO 3W67A 2IBZG 3HE5A 1SQVK 3V4QA 1BSNA 4L76A 3L73J 4WBAA 4ASWA 2QG4A 2IBZE 3GF7A 3AE3C 3VOPA 3WU2E 2IPPA 1LP1A 1KTMA 1L0LK 1GZLA 1RQVA 1L4AD 1W2BO 4TT3H 1L4AA 3O6QB 1SFCA 1TU3F 3KPEA 3JCUH 4AQRD 2LXCB 1R5SA 3SSUA 4PD4D 5AVUB 5KAFE 3C1LA 1N7SB 1PGPA 1M1KQ 3AEGC 1PL5A 1NJIQ 1HUCA 4XFJA 1GU4A 1PP9D 2KSEA 1LTJC 2Y0CA 2CK3H 1MUUA 1NTZK 1Q82Q 3CC7P 1J1EB 2AEMA 2IZ0A 2RMZA 2IYOA 1PPJG 2KIKA 2OTKE 5KTBA 1PPJE 3H6PA 4Y28J 2JKVA 2XDJA 5KLVG 4H44B 1FZCB 2KYVA 2WPSA 4Y99C 3CCMP 2HFED 3AEFC 2FKWB 1FE6A 2QA4P 2WT7B 1M7LA 1URQB 4I7ZC 3H1KD 1SQXD 1RF1B 2W83C 3PHLA 3VTPC 1S5LX 2ZVOB 3G9RA 3MTUE 4PD4H 3FWNA 1NU1K 2E74B 3MUDA 1LWUC 1ZW0A 5BVZA 1PGOA 3GMAA 2B9BA 4IFMA 2FXMA 1MFTA 2M3BA 1HGVA 2J59M 3GHGB 1DEBA 3L74D 4ASVA 1SQBD 3D70A 1KV4A 4NPDA 1PFIA 1JM0A 2R5BA 2P58A 4KJMA 4LGDE 4IL6E 3AEAC 2IBZD 1EQ7A 2IDBA 3IAOA 1SQQE 1Y8AA 1M1JA 2OYHC 2OYIB 3OW2O 3MIWA 3H1KJ 1SQXJ 1GDTA 4HKZH 3S9OA 1VL2A 2XNXA 1IZNB 4UB8E 1RH5B 1S9KE 5APYA 3A7OA 4YPCA 1BCCG 1ZP0C 3II6A 1JCCA 2E5YA 4EIJA 3T97B 1NHLA 5KAIE 1IFDA 1NAFA 1KD1Q 3IR9A 1YYCA 3FX0A 1AQTA 1KB9I 1GW3A 3CWBG 3F5HA 3CWBE 3L72E 1CI6A 2K37A 1N73C 2HYNA 3L74J 3O8ZA 1K05A 1SQBJ 5AVYB 2G8YA 1IFIA 1PPJD 5AVRB 4GDOA 1K9MQ 2SPZA 2M5AA 3CX5I 2P10A 5KLVD 3VMXA 2PGDA 3TNUA 2E76B 4W7YA 2KSJA 3RL0g 2YXQB 1DIPA 5KKZB 3NFQA 1VQMP 2B87B 3L73E 1VQ8P 2L5GB 1FJPA 2NPSB 3MP7B 5BU8B 2H88C 5KAFH 2A45H 4GT1A 4PV1C 2YMKA 1GW4A 4YXDC 4GOFA 3AEDC 2FYUG 2YIUB 4KT0J 5DJTB 3W68A 2B89A 2B88A 1QVGO 5AW8B 2FYNB 4U7JA 1LT9A 2FYUE 2XKMA 3U1AA 5CJ0A 1A02F 4JPZB 1VF5B 2K9JB 3A0HH 3B8EB 3KHUA 3V5BA 1VQ4P 2W8ZA 1JEKA 5KLVJ 1G1IA 1JY3O 2E5TA 2I8DA 2K9YA 3L75G 3CXHI 5B66E 1NAYA 2BCCG 3L75E 1JUNA 2QJKB 1KMIZ 2BCCE 3RK2C 1GK4A 1GL2B 3TYYA 2XNDH 2R3CA 3N7NA 2A06G 3OA7A 1FOSE 1BCCD 1HJBA 2H89C 3BRTB 1ZRTD 1VQKP 2N1TA 3A3YB 1T3JA 2WPQA 4PD4E 1RHZB 3IF4A 2D2CB 2JEEA 4N3YB 1YJWP 3CWBD 4N78E 3V2RA 2Q7CA 1OX3A 1NTKG 2HODA 1KN7A 2BEZF 1K8AQ 1NTKE 2CPBA 5AVVB 2AXCA 1QGKB 2V4HA 1M57D 4GODA 3D71A 1X22A 2FBWC 1Q81Q 3R4YA 2N9YB 3AE5C 1OW6A 4LC1A 2M0BA 4OVNF 2QIWA 2QJPB 3HUSA 1SP4A 3PP5A 2WPVB 1XTCC 3E7KA 3V2NA 1MFZA 1VQ5P 1N7SC 2UWJE 1JTHB 1RF0C 4PV1D 5CCGC 4C7NA 1S2EA 1KYOI 1EZVI 4B86A 1SQPG 1BCCJ 4DT0A 1SQPE 1OMIA 1YJNP 2K1AA 1H0TA 2O1KA 3SWYA 1BSHA 2NZ2A 1J1EC 3LW5J 3M91A 3CWBJ 3AECC 5KAIH 3TGUD 3HD7A 5AW4B 2FYUD 1HTLC 3HE4B 3LIDA 4BRYB 1H89A 1WRGA 2ZYGA 3LW5H 2I1KA 3VP9A 1Y9BA 5APSA 4D6TD 3HE5B 4BXLA 5AVXB 1P84I 3FWLA 3GG2A 3KXDA 4H44C 1FZCC 1AVOA 1LP1B 1KC8Q 1HVVA 3EFFK 2W6BA 4M3LA 2R5DA 3L74E 1SQBE 1G2CA 1URQC 1L4AB 3L75D 1FJKA 3BRVB 4MN4C 1RF1C 3AE4C 1SFCB 3M06A 2BCCD 4RO0A 2XV5A 1VQPP 3AE7C 1T3UA 2E75C 1LTGC 5APQA 1NTMG 2A06D 2E74C 2A45G 1ZLLA 5AW7B 3Q3DA 1RE3C 1X79B 2ZYAA 3TGUJ 1EDJA 3JC22 4W80A 3NMDA 2FYUJ 1SQQK 2KXPB 2Z5HA 3M0AA 4N78D 3PTZA 2E43A 1MKMA 1LTAC 3GHGC 4K35A 3SWKA 3L37A 2QM8A 1NTKD 4D6TJ 1M56D 3M0DA 2PP6A 1ZR2A 1J1DB 3A0HE 2O3JA 2W90A 2CPSA 2QVAA 4N6JA 2KNCA 1N7SD 3B5NC 4EOTA 1USDA 5CCGD 1U7MA 1QL1A 2OYIC 3L75J 4WVZA 2KK7A 1GMJA 1GTWA 3KDPB 4RESB 1EDIA 2BCCJ 3VN0A 2KB7P 3TSIA 2FFDA 2YXRB 3CC2P 3A2AA 2ZXXA 1DD4A 4GOEA 3EWKA 3C8VA 3TDKA 1PGJA 1EXIA 5B66H 5KLVE 2ZFCA 2NRGA 3EQ2A 4ZKUA 2WPRA 1SQPD 1AV1A 2DW3A 2WMMA 1RE4A 2QJYB 2QE7H 2O1JA 2Y0DA 1D7MA 3H25A 1L0NK 1AA0A 2ZJSE 2QRXA 2ZVNB 1NTKJ 4H44D 3D6YA 3UIAA 3AEBC 3GW6A 3B71A 1URQD 1VQ7P 4U3FG 1SQVG 1JMBA 1H8AA 1HBWA 1KQGB 4U3FE 5TISH 1JB0J 2BASA 4W7ZA 2E76C 1HGZA 2C0XA 2E75D 1QLED 1L0LG 1M1JB 2FXOA 3MGNA 5KKZC 2FY8A 3V2QA 3CCLP 2I1JA 4OH8B 2IFMA 2HG5D 3FXEA 2E74D 1NWQA 5H2FH 3BCCG 3LIEA 1BDDA 3BCCE 2NPSC 1Q90D 2IZ1A 1SQPJ 1PV3A 3Q5PA 2Z5IA 4OGQB 1KZUB 2ZT9B 1JY2O 1NTMD 1AFOA 1LTJA 1QEXA 5APVA 2WSSH 1FZBA 2YIUC 3V4WA 2KUBA 1NTZG 3WUTA 1EDLA 2R3SA 1FZFA 4L74A 2BEQD 2RN0A 3WUVA 5EFWB 1NTZE 1BCCE 3PRJA 1CI6B 1ZRTE 1K73Q 4QMAA 1VF5C 4UB6E 3B5ND 3A0BH 2WITA 1NH4A 3B5NA 1KORA 1NYHA 4I2LC 2YKQA 1YQ3C 1NVOA 1K04A 2IX7C 5CCHC 1HJ0A 3PLNA 2M5AB 4JF7A 2KS1A 1FDOA 3V2PA 4JYBA 5CMZA 3TNUB 1SLQA 1S3JA 2K88A 2QJKC 5GTIE 3H1HG 4JYCA 1GL2C 3H1HE 3G6EP 3H1LD 3R2PA 2Q3IA 1E5WA 2AEJA 4WY4B 5AVWB 1KILE 1PIXA 1NTMJ 1VQOP 3IFMA 3A5TA 2YO2A 2GA1A 3E1IA 5AW2B 4GKGA 1NU1G 1FZAA 2D2CC 4ZNCA 1FC2C 1UIIA 1LWUA 2OGUA 2QSIA 2H7HA 1NU1E 3EFGA 1NGMB 1KILC 1LT9B 4IOIH 1X9VA 1EDKA 2C0WA 4ZMDA 1X0TA 2OYOA 1FZGA 1N8RQ 1DX7A 2E76D 3TGUG 4WB4A 4HH2A 1YI2P 2ITAA 2WZ7A 3TGUE 3H1JJ 3RBXA 1FZEA 3HTKA 2WQYC 3L36A 4U3FD 2QJPC 1SQVD 4D6TG 2GM4A 2NPSD 1SQXK 2YNYA 4D6TE 1HH0A 2OYHA 1L0LD 2WVRA 3H1LJ 2YKOA 3RK3B 3ITKA 1EC5A 3CCEP 3BCCD 2Q9IA 1QX8A 4JBZA 2V7QJ 1ZR4A 3AEEC 3AE2C 5AW0B 2E42A 2N1TB 1VF5D 1BGYG 2O01N 3ZDMA 2LXBA 2V7QH 1NTZD 5CCHD 2A06E 4RJTA 5KJ7C 2HODB 1SQBK 3Q1MA 1N73A 3MHVA 1M90Q 4A7PA 1W5CE 1M8OB 5KLIB 1CSBA 1KB9D 4U3FJ 5AW3B 4PD4I 1SQVJ 1AJYA 2O01J 1GL2D 2ZYDA 3E1RA 4L75A 3G4SP 2YKPA 1GL2A 5B5EE 4H0LB 1N7LA 4NPFX 3HUSB 5TISE 1L0LJ 4GIFA 3BVHA 1SFCC 3IN6A 1YHQP 1T2KC 1USEA 3VMZA 1DH3A 4H13B 1YQ4C 3H1HD 2O01H 5GTHE 1LTSC 3BCCJ 5H2FE 3CX5D 2D2CD 1JY3N 2POHA 4C7NB 3BATA
chains in the Genus database with same CATH topology
4WY4D 3NMDA 2KOGA 1PFIA 4LLHA 2R5BA 1OWAA 4WY4A 1SQQK 4LGDE 1KILD 2OYHB 2Z5HA 3M0AA 4N78D 1IJDB 2VRSA 2E43A 4AYCA 1LTAC 1KILA 3GHGC 1EQ7A 3P8CE 1LGHB 3L37A 2QM8A 3M0DA 1SQPK 5APXA 1M1JA 5AVZB 2PP6A 2OYHC 1ZR2A 1Z56A 2OYIB 1J1DB 2NPSA 3MIWA 1YTZT 1GDTA 3P8MC 1FAVA 3HD7B 2CPSA 4N6JA 3BASA 1N7SD 2XNXA 3B5NC 2FYZA 4EOTA 5AVQB 1LTBC 5CCGD 1QL1A 3M9BA 1S9KE 2OYIC 5APYA 2C9NY 3A7OA 3II6A 1W2EA 3HD7C 1JCCA 3RL0B 3KDPB 4RESB 1GTWA 4AUWA 1NO4A 3VN0A 2KB7P 3TSIA 2FFDA 4EIJA 5CJ4A 3A2AA 5KLVK 1NHLA 5AW9B 1IFDA 1NAFA 3P7KA 1IO4A 3P8CD 3IR9A 1VPCA 1YYCA 2Z4EA 2ZFCA 3RL0C 1N73B 2GUSA 1GW3A 3EQ2A 1G2CB 3L4FA 4IFDK 4I6MC 3RK3D 3VMYA 1G1JA 2HPCA 4ZKUA 2WPRA 1IFNA 4KHXA 1CI6A 3RK2D 2WSEH 5CCHA 1N73C 2HYNA 3O8ZA 1RE4A 5AVYB 2KLVA 1S9KD 1IFIA 4O9BA 2O1JA 5AVRB 2WSFH 5AW1B 3TK1A 1L0NK 2W6AA 2N1TD 5KJ7D 5KJ7A 3UIAA 1GK6A 1A02J 3VMXA 1NKZB 3TNUA 1L4AC 5AVTB 4W7YA 2KSJA 3H32A 4HYTB 1URQD 1IK9A 1QL2A 1NTMK 4DZOA 2R32A 2YO3A 1GD2E 1MV8A 1H8AA 3NFQA 2LKMA 1HBWA 1KILB 2BASA 4W7ZA 1HGZA 3KYQA 2L5GB 2C0XA 2XZRA 4I1LA 1FOSF 1FJPA 1M1JB 2WWWA 3MD0A 3MGNA 4XA4A 1SFCD 2NPSB 1RY3A 3V2QA 5BU8B 2I1JA 1T2KD 4OH8B 4W80A 2IFMA 2HG5D 1NWQA 2ZXEB 2A45I 3LIEA 2A45H 4GT1A 3M0DC 1M1JC 5APWA 1CW5A 1GW4A 2NPSC 2WSCH 5AW6B 1NOHA 5AW8B 4C7RA 2FFDB 1LT9A 2Z5IA 1KZUB 5BU5A 1FU1A 1JY2O 5APUA 3OJAB 3VP8A 2XKMA 1AFOA 1LTJA 3U1AA 3U59A 5APVA 1FZBA 3V4WA 1N7SA 2OARA 2P2UA 5CJ0A 1A02F 4IFFA 1SVFA 1LTIC 1J1DC 1RF0A 5CCGA 2FFDC 3B8EB 3V5BA 1FZFA 1OXZA 2Q5UA 3NXSA 1KQLA 2N9BA 2HPCB 1WT6A 1CI6B 3KQGA 2XU6A 1JTHA 1G1IA 1JY3O 1ZV8A 2YMYA 3B5ND 3RK2B 1H88A 2WITA 1NH4A 3CL3D 3B5NA 4ZKPA 4XE5B 2H43A 3HD7D 4I2LC 2YKQA 1NKNA 1JUNA 2IX7C 5CCHC 1FDMA 4JF7A 3RK2C 1RE4C 1GK4A 1IFMA 1JCDA 1XTGB 3M9QA 1N2DC 2M8RA 3V2PA 1GU5A 5APTA 1GL2B 4JYBA 3TYYA 5CMZA 2IFNA 3NTNA 3RL0D 2HLOA 3TNUB 1SLQA 2R3CA 3N7NA 2WTYA 3H32B 2KP8A 3OA7A 3OAKA 3VYIA 1IC2A 1FOSE 4JYCA 1JNMA 1HJBA 3BRTB 1GL2C 3L35A 1ZN5A 3HE4A 2N1TA 3A3YB 1T3JA 2WPQA 1FZCA 3M9HA 3U1CA 1CZQA 2JEEA 3R2PA 4N3YB 4DOJA 2Q3IA 1E5WA 3HE5A 1SQVK 4WY4B 5AVWB 2WT7A 1URQA 4N78E 3V2RA 3V4QA 2Q7CA 3IFMA 3A5TA 2YO2A 4WBAA 2HODA 3G3ZA 1RF1A 3VOPA 2IPPA 3E1IA 5AW2B 4GKGA 1FZAA 1JY2P 1GZLA 1L0LK 2CPBA 1L4AD 5AVSB 5AVVB 1LWUA 4WY4C 2H7HA 3EFGA 1L4AA 1KILC 1LT9B 2P1JA 1SFCA 1X9VA 3P32A 3KPEA 4AQRD 2C0WA 1FZGA 2W27A 4LC1A 1LTJB 1DX7A 1J2JB 5AVUB 1N7SB 3HUSA 2FYUK 4WB4A 4HH2A 1SP4A 1LT9C 1RE3A 3PP5A 2WZ7A 1HUCA 1JOCA 2MJZA 1GU4A 2C9LY 1FZEA 3HTKA 1LTJC 1XTCC 3L36A 3V2NA 1MFZA 1N7SC 3WMM0 1MUUA 2P7JA 1JTHB 1RF0C 3GHGA 5CCGC 2GM4A 2P67A 4C7NA 3B5NB 1NTZK 2NPSD 4B86A 1SQXK 1J1EB 1LTTC 2YNYA 1HH0A 4C46A 1JO5A 2OYHA 2YKOA 3RK3B 1KFMA 3CI9A 2O1KA 2H8PD 3SWYA 1J1EC 5KTBA 2Q9IA 3M91A 2OYIA 4Y99B 3H6PA 3HD7A 3RK3C 1ZR4A 5AW4B 2XDJA 1HTLC 5AW0B 2E42A 3HE4B 3LIDA 2N1TB 1T8ZA 2PAJA 1H89A 1WRGA 3N4XA 5CHXA 1FZCB 2KYVA 2WPSA 4Y99C 3LW5H 2I1KA 2HFED 3VP9A 5APSA 3SWFA 2FKWB 3HE5B 3T97A 2WT7B 3I5CA 1M7LA 1MZ9A 1URQB 5AVXB 5CCHD 2N1TC 5KJ7C 3CLQA 2HODB 1IFJA 1SQBK 2GUVA 1RF1B 1FZCC 2J58A 1HVVA 3HRNA 1N73A 2W6BA 4M3LA 3VTPC 2R5DA 1LWUB 1KFNA 1G2CA 1URQC 1L4AB 1CSBA 1FJKA 1FBMA 3BRVB 5AW3B 1RF1C 1NTKK 1SFCB 3MTUE 3M06A 1GL2D 2XV5A 1YTZI 1JY2N 1NU1K 3MUDA 2YKPA 1GL2A 1T3UA 1N7LA 1LWUC 1JMMA 3HUSB 1VDFA 2QM7A 5BVZA 1LTGC 3C9IA 4GIFA 5APQA 3BVHA 1AQ5A 1HWTC 1SFCC 4IFMA 1T2KC 2FXMA 3VMZA 2M3BA 1DH3A 3HTKB 2A45G 1HGVA 2O01H 1N86A 1LTSC 3HUSC 2J59M 5AW5B 1ZLLA 5AW7B 3GHGB 1JY3N 2POHA 1X8YA 4C7NB 1RE3C 1X79B 1DEBA 2JJLA 1JY3P 3BATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK4 A;  3NMD A;  1GK6 A;  1A02 J;  3VMX A;  2R5B A;  3TNU A;  1GU5 A;  1OWA A;  4JYB A;  5APT A;  5AVT B;  3TYY A;  5CMZ A;  2Z5H A;  3M0A A;  3NTN A;  4HYT B;  2VRS A;  2E43 A;  3TNU B;  1SLQ A;  4DZO A;  4AYC A;  2R3C A;  2R32 A;  2YO3 A;  2WTY A;  1GD2 E;  1MV8 A;  1H8A A;  2KP8 A;  3NFQ A;  3OAK A;  3M91 A;  1HBW A;  3L37 A;  3VYI A;  1FOS E;  2QM8 A;  4JYC A;  1JNM A;  3M0D A;  1HJB A;  2BAS A;  3L35 A;  5APX A;  5AVZ B;  5AW4 B;  3HE4 A;  2XZR A;  3A3Y B;  2WPQ A;  5AW0 B;  3P8M C;  1FOS F;  1FAV A;  2E42 A;  2WWW A;  3M9H A;  3HE4 B;  3LID A;  3MD0 A;  3MGN A;  1H89 A;  1CZQ A;  1T2K D;  2WPS A;  2Q3I A;  3HE5 A;  5AVW B;  2ZXE B;  1NWQ A;  4EOT A;  2WT7 A;  5AVQ B;  3LIE A;  3V4Q A;  3M9B A;  2Q7C A;  1S9K E;  5APS A;  3SWF A;  4GT1 A;  3HE5 B;  2YO2 A;  5APY A;  3A7O A;  3A5T A;  2C9N Y;  3T97 A;  2WT7 B;  3I5C A;  1GTW A;  5AVX B;  3KDP B;  4RES B;  5APW A;  4AUW A;  2IPP A;  5AW2 B;  3VN0 A;  4GKG A;  3A2A A;  1GZL A;  5AW6 B;  5AW8 B;  5AVV B;  5AW9 B;  5AVS B;  1NAF A;  3P7K A;  1IO4 A;  2Z5I A;  2H7H A;  4M3L A;  3VTP C;  3IR9 A;  2R5D A;  1YYC A;  5APU A;  2ZFC A;  3P32 A;  1CSB A;  5APV A;  3V4W A;  4AQR D;  2P2U A;  1A02 F;  2W27 A;  5AW3 B;  1G2C B;  4LC1 A;  3M06 A;  1J2J B;  5AVU B;  3B8E B;  2XV5 A;  4I6M C;  3VMY A;  3V5B A;  1OXZ A;  2WPR A;  4KHX A;  2Q5U A;  1CI6 A;  1SP4 A;  3NXS A;  1KQL A;  2N9B A;  1HUC A;  2QM7 A;  3O8Z A;  1CI6 B;  3KQG A;  5AVY B;  1GU4 A;  2XU6 A;  5APQ A;  1S9K D;  1HWT C;  2C9L Y;  3HTK A;  1H88 A;  3L36 A;  5AVR B;  1MFZ A;  1T2K C;  5AW1 B;  3VMZ A;  1MUU A;  2P7J A;  3TK1 A;  1DH3 A;  4XE5 B;  2P67 A;  4I2L C;  4C7N A;  2W6A A;  5AW5 B;  4B86 A;  5AW7 B;  1JUN A;  1X8Y A;  4C7N B;  3UIA A;  2JJL A;  2YNY A;  4C46 A; 
#chains in the Genus database with same CATH topology
 4LLH A;  1OWA A;  1KIL D;  1IJD B;  2KZI A;  3CME P;  2VRS A;  4AYC A;  1KIL A;  1H0T B;  2AEF A;  3D6Z A;  5APX A;  1NTZ J;  5AVZ B;  1NU1 D;  3CCJ P;  1YTZ T;  1FAV A;  2Y0E A;  3HD7 B;  1PZQ A;  3AE8 C;  5AVQ B;  3CCS P;  3VMA A;  3A0B E;  3L71 G;  1W2E A;  3RL0 B;  4AUW A;  1NO4 A;  5CJ4 A;  5KLV K;  4UB6 H;  3L71 E;  3CMA P;  1IO4 A;  3P8C D;  5E79 E;  3L70 G;  1VPC A;  4Z1M H;  4WWI A;  1SS1 A;  4R4M A;  4EYY Q;  1KB9 H;  3L70 E;  1G2C B;  3L4F A;  4IFD K;  3H1H J;  3VMY A;  1G1J A;  2HPC A;  4KHX A;  3RK2 D;  2FXP A;  2PFX A;  4EDF A;  2Q6Q A;  2MKV A;  5GTI H;  5AW1 B;  3CXH D;  3SFD C;  3CCR P;  2W6A A;  5KJ7 D;  3MUD C;  3CX5 H;  1ZME C;  1YJ9 P;  2QJY C;  5KJ7 A;  1A02 J;  2JR8 A;  1NU1 J;  1NKZ B;  3K5B A;  3H32 A;  1BGY D;  2IBZ I;  4DZO A;  2R32 A;  1GD2 E;  1MV8 A;  3JSV C;  2HR3 A;  1NTM E;  2ZAE B;  2XZR A;  4RKU J;  4I1L A;  2J5U A;  2WSC J;  1LNQ A;  1RQU A;  4PJ0 E;  3MD0 A;  1SFC D;  1RY3 A;  1R8E A;  2W6J H;  1R5L A;  1T2K D;  1OW7 A;  5CBN A;  2A45 I;  1VQN P;  2KNC B;  3CPW O;  3RGU A;  1M1J C;  5APW A;  3AE9 C;  3RBZ A;  2WSC H;  1U7J A;  1NOH A;  3H1J G;  3CCQ P;  2FFD B;  2Q3E A;  3O6Q A;  1FU1 A;  2KLU A;  5APU A;  3H1J E;  3OJA B;  3KZI H;  3U59 A;  1LJ2 A;  1N7S A;  2OAR A;  1SVF A;  1LTI C;  1RF0 A;  4YXW H;  5CCG A;  3F89 A;  1OXZ A;  4OGQ C;  2ZT9 C;  4BWN A;  3QWO C;  3NXS A;  1KQL A;  2N9B A;  3H1L G;  5K5G B;  1WT6 A;  3KQG A;  2XU6 A;  1ZXG A;  2YMY A;  1H88 A;  3H1L E;  3GF3 A;  1BGY J;  3CCV P;  3CL3 D;  2QEX P;  1S5L H;  3CXH H;  4ZKP A;  5M1B A;  2JDI H;  1NKN A;  1KYO D;  1EZV D;  3QH9 A;  1IFM A;  1JCD A;  5APT A;  2IFN A;  5CBO A;  1BDC A;  2WTY A;  2KP8 A;  3WUU A;  3VYI A;  1VQL P;  1JNM A;  3L71 D;  1VQ9 P;  2Y9Y A;  3G71 P;  1ZN5 A;  2PRR A;  4K3A A;  2OTL P;  1FZC A;  3U1C A;  3L70 D;  1CZQ A;  2E75 B;  1PP9 J;  4DOJ A;  2WT7 A;  1URQ A;  1ZOY C;  5B5E H;  1DD3 A;  3G3Z A;  1RF1 A;  3H1I D;  1SQV E;  1P84 D;  1OZH A;  1JY2 P;  1Q7Y Q;  3PH0 A;  5AVS B;  4WY4 C;  1S1C X;  5GTH H;  1L0L E;  2P1J A;  3P32 A;  3CC4 P;  1KQS O;  1BE3 G;  2W27 A;  1LTJ B;  1J2J B;  4EI2 A;  1IK7 A;  2FYU K;  1BE3 E;  1LT9 C;  1RE3 A;  1JOC A;  2MJZ A;  3I56 P;  1SQQ G;  2C9L Y;  2KZJ A;  3WMM 0;  2P7J A;  3GHG A;  4NPE A;  2P67 A;  3B5N B;  2FYN C;  1Q2N A;  1KYO H;  1LTT C;  3L71 J;  4C46 A;  1JO5 A;  3RK3 E;  1KFM A;  2KS1 B;  3CI9 A;  2H8P D;  1FS0 E;  3L70 J;  2OYI A;  4OGQ D;  4Y99 B;  1PGQ A;  2ZT9 D;  1KB9 E;  3RK3 C;  3H1I J;  3ABV C;  5E79 H;  1S4X A;  3H1J D;  1T8Z A;  2PAJ A;  2AXT E;  4I7Z B;  3N4X A;  5CHX A;  1KQF B;  3L72 G;  3SWF A;  1DEE G;  3T97 A;  1YIT P;  3I5C A;  1MZ9 A;  2N1T C;  2LR2 A;  3Q5S A;  1P84 H;  3CLQ A;  1U57 A;  1IFJ A;  2GUV A;  2J58 A;  1WMK A;  3HRN A;  3CX5 E;  3SFE C;  1LWU B;  1Y47 A;  2G3A A;  1KFN A;  1EXJ A;  3TF5 A;  1FBM A;  1L0N G;  1NTK K;  2R44 A;  1YTZ I;  2L91 A;  1FDI A;  1JY2 N;  1L0N E;  1AVY A;  1JMM A;  1VDF A;  2QM7 A;  5KLI C;  3C9I A;  1AQ5 A;  1HWT C;  3WU2 H;  3L73 G;  3Q2Y A;  3HTK B;  3B4S A;  4H0L C;  1N86 A;  3HUS C;  1OVR A;  5AW5 B;  3JCU E;  1X8Y A;  4PJ0 H;  2JJL A;  1JY3 P;  4WY4 D;  2KOG A;  4H13 C;  4WY4 A;  5DJU B;  2OYH B;  2B87 A;  3S4R A;  3PJS K;  3P8C E;  1LGH B;  2JO1 A;  3KZI E;  1SQP K;  2JP3 A;  1Z56 A;  3MZW B;  2NPS A;  3P8M C;  2KI7 B;  2JWA A;  3BAS A;  2FYZ A;  1LTB C;  3M9B A;  2C9N Y;  1BE3 D;  4JQ0 D;  3HD7 C;  1S5L E;  3CXH E;  3AE1 C;  1OW8 A;  5AW9 B;  2WSE J;  2K3R A;  3P7K A;  1YBK A;  1SQQ D;  2Z4E A;  3RL0 C;  2K9J A;  1N73 B;  2GUS A;  2WSF J;  1BGY E;  2RH0 A;  1S72 P;  4I6M C;  3RK3 D;  1IFN A;  2WSE H;  5CCH A;  3FGA D;  3USS A;  2M3E A;  3AE6 C;  2KLV A;  1S9K D;  4O9B A;  2WSF H;  3I55 P;  3TK1 A;  1E79 H;  2N1T D;  3CCU P;  3S1K A;  2Y9Z A;  1GK6 A;  1L4A C;  5L8R J;  5AVT B;  3FXD A;  1PP9 G;  3Q5R A;  4HYT B;  1OFC X;  1IK9 A;  1QL2 A;  1NTM K;  2Q1K A;  2YO3 A;  1PP9 E;  3L72 D;  2LKM A;  1KIL B;  4DCK A;  1BE3 J;  3KYQ A;  4R4L A;  4HB1 A;  2OTJ P;  4PV1 B;  1FOS F;  2WWW A;  5C39 A;  2JWD A;  4XA4 A;  1LT1 A;  2OQQ A;  2IYP A;  4CPG A;  1SQQ J;  2ZXE B;  1UIX A;  4H0L D;  3M0D C;  1L0N D;  1Q86 Q;  1OVV A;  1CW5 A;  1EZV G;  5AW6 B;  4C7R A;  4IL6 H;  4H13 D;  3V6I A;  1KYO E;  1EZV E;  4OWF A;  5BU5 A;  4HJG H;  3VP8 A;  3L73 D;  2P2U A;  4IFF A;  1J1D C;  2FFD C;  1OVU A;  3H1K G;  1SQX G;  4TLF A;  2Q5U A;  2HPC B;  1VQ6 P;  3H1K E;  1SQX E;  3GLM A;  4UB8 H;  1OIP A;  1JTH A;  1ZV8 A;  3RK2 B;  1L2P A;  4L73 A;  4XE5 B;  1HF9 A;  2H43 A;  3HD7 D;  3L72 J;  3H1I G;  3CD6 P;  4IL6 X;  1FDM A;  2AXT H;  1RE4 C;  1XTG B;  4YTP C;  3H1I E;  4DJG A;  3M9Q A;  1N2D C;  2M8R A;  1GU5 A;  1P84 E;  3NTN A;  3RL0 D;  2HLO A;  5TJH A;  3H32 B;  1T6A A;  3OAK A;  1IFP A;  1IC2 A;  1L0N J;  3L35 A;  3L74 G;  3HE4 A;  4BRY A;  1SQB G;  2RKL A;  1YIJ P;  3M9H A;  1QVF O;  3W67 A;  2IBZ G;  3HE5 A;  1SQV K;  3V4Q A;  1BSN A;  4L76 A;  3L73 J;  4WBA A;  4ASW A;  2QG4 A;  2IBZ E;  3GF7 A;  3AE3 C;  3VOP A;  3WU2 E;  2IPP A;  1LP1 A;  1KTM A;  1L0L K;  1GZL A;  1RQV A;  1L4A D;  1W2B O;  4TT3 H;  1L4A A;  3O6Q B;  1SFC A;  1TU3 F;  3KPE A;  3JCU H;  4AQR D;  2LXC B;  1R5S A;  3SSU A;  4PD4 D;  5AVU B;  5KAF E;  3C1L A;  1N7S B;  1PGP A;  1M1K Q;  3AEG C;  1PL5 A;  1NJI Q;  1HUC A;  4XFJ A;  1GU4 A;  1PP9 D;  2KSE A;  1LTJ C;  2Y0C A;  2CK3 H;  1MUU A;  1NTZ K;  1Q82 Q;  3CC7 P;  1J1E B;  2AEM A;  2IZ0 A;  2RMZ A;  2IYO A;  1PPJ G;  2KIK A;  2OTK E;  5KTB A;  1PPJ E;  3H6P A;  4Y28 J;  2JKV A;  2XDJ A;  5KLV G;  4H44 B;  1FZC B;  2KYV A;  2WPS A;  4Y99 C;  3CCM P;  2HFE D;  3AEF C;  2FKW B;  1FE6 A;  2QA4 P;  2WT7 B;  1M7L A;  1URQ B;  4I7Z C;  3H1K D;  1SQX D;  1RF1 B;  2W83 C;  3PHL A;  3VTP C;  1S5L X;  2ZVO B;  3G9R A;  3MTU E;  4PD4 H;  3FWN A;  1NU1 K;  2E74 B;  3MUD A;  1LWU C;  1ZW0 A;  5BVZ A;  1PGO A;  3GMA A;  2B9B A;  4IFM A;  2FXM A;  1MFT A;  2M3B A;  1HGV A;  2J59 M;  3GHG B;  1DEB A;  3L74 D;  4ASV A;  1SQB D;  3D70 A;  1KV4 A;  4NPD A;  1PFI A;  1JM0 A;  2R5B A;  2P58 A;  4KJM A;  4LGD E;  4IL6 E;  3AEA C;  2IBZ D;  1EQ7 A;  2IDB A;  3IAO A;  1SQQ E;  1Y8A A;  1M1J A;  2OYH C;  2OYI B;  3OW2 O;  3MIW A;  3H1K J;  1SQX J;  1GDT A;  4HKZ H;  3S9O A;  1VL2 A;  2XNX A;  1IZN B;  4UB8 E;  1RH5 B;  1S9K E;  5APY A;  3A7O A;  4YPC A;  1BCC G;  1ZP0 C;  3II6 A;  1JCC A;  2E5Y A;  4EIJ A;  3T97 B;  1NHL A;  5KAI E;  1IFD A;  1NAF A;  1KD1 Q;  3IR9 A;  1YYC A;  3FX0 A;  1AQT A;  1KB9 I;  1GW3 A;  3CWB G;  3F5H A;  3CWB E;  3L72 E;  1CI6 A;  2K37 A;  1N73 C;  2HYN A;  3L74 J;  3O8Z A;  1K05 A;  1SQB J;  5AVY B;  2G8Y A;  1IFI A;  1PPJ D;  5AVR B;  4GDO A;  1K9M Q;  2SPZ A;  2M5A A;  3CX5 I;  2P10 A;  5KLV D;  3VMX A;  2PGD A;  3TNU A;  2E76 B;  4W7Y A;  2KSJ A;  3RL0 g;  2YXQ B;  1DIP A;  5KKZ B;  3NFQ A;  1VQM P;  2B87 B;  3L73 E;  1VQ8 P;  2L5G B;  1FJP A;  2NPS B;  3MP7 B;  5BU8 B;  2H88 C;  5KAF H;  2A45 H;  4GT1 A;  4PV1 C;  2YMK A;  1GW4 A;  4YXD C;  4GOF A;  3AED C;  2FYU G;  2YIU B;  4KT0 J;  5DJT B;  3W68 A;  2B89 A;  2B88 A;  1QVG O;  5AW8 B;  2FYN B;  4U7J A;  1LT9 A;  2FYU E;  2XKM A;  3U1A A;  5CJ0 A;  1A02 F;  4JPZ B;  1VF5 B;  2K9J B;  3A0H H;  3B8E B;  3KHU A;  3V5B A;  1VQ4 P;  2W8Z A;  1JEK A;  5KLV J;  1G1I A;  1JY3 O;  2E5T A;  2I8D A;  2K9Y A;  3L75 G;  3CXH I;  5B66 E;  1NAY A;  2BCC G;  3L75 E;  1JUN A;  2QJK B;  1KMI Z;  2BCC E;  3RK2 C;  1GK4 A;  1GL2 B;  3TYY A;  2XND H;  2R3C A;  3N7N A;  2A06 G;  3OA7 A;  1FOS E;  1BCC D;  1HJB A;  2H89 C;  3BRT B;  1ZRT D;  1VQK P;  2N1T A;  3A3Y B;  1T3J A;  2WPQ A;  4PD4 E;  1RHZ B;  3IF4 A;  2D2C B;  2JEE A;  4N3Y B;  1YJW P;  3CWB D;  4N78 E;  3V2R A;  2Q7C A;  1OX3 A;  1NTK G;  2HOD A;  1KN7 A;  2BEZ F;  1K8A Q;  1NTK E;  2CPB A;  5AVV B;  2AXC A;  1QGK B;  2V4H A;  1M57 D;  4GOD A;  3D71 A;  1X22 A;  2FBW C;  1Q81 Q;  3R4Y A;  2N9Y B;  3AE5 C;  1OW6 A;  4LC1 A;  2M0B A;  4OVN F;  2QIW A;  2QJP B;  3HUS A;  1SP4 A;  3PP5 A;  2WPV B;  1XTC C;  3E7K A;  3V2N A;  1MFZ A;  1VQ5 P;  1N7S C;  2UWJ E;  1JTH B;  1RF0 C;  4PV1 D;  5CCG C;  4C7N A;  1S2E A;  1KYO I;  1EZV I;  4B86 A;  1SQP G;  1BCC J;  4DT0 A;  1SQP E;  1OMI A;  1YJN P;  2K1A A;  1H0T A;  2O1K A;  3SWY A;  1BSH A;  2NZ2 A;  1J1E C;  3LW5 J;  3M91 A;  3CWB J;  3AEC C;  5KAI H;  3TGU D;  3HD7 A;  5AW4 B;  2FYU D;  1HTL C;  3HE4 B;  3LID A;  4BRY B;  1H89 A;  1WRG A;  2ZYG A;  3LW5 H;  2I1K A;  3VP9 A;  1Y9B A;  5APS A;  4D6T D;  3HE5 B;  4BXL A;  5AVX B;  1P84 I;  3FWL A;  3GG2 A;  3KXD A;  4H44 C;  1FZC C;  1AVO A;  1LP1 B;  1KC8 Q;  1HVV A;  3EFF K;  2W6B A;  4M3L A;  2R5D A;  3L74 E;  1SQB E;  1G2C A;  1URQ C;  1L4A B;  3L75 D;  1FJK A;  3BRV B;  4MN4 C;  1RF1 C;  3AE4 C;  1SFC B;  3M06 A;  2BCC D;  4RO0 A;  2XV5 A;  1VQP P;  3AE7 C;  1T3U A;  2E75 C;  1LTG C;  5APQ A;  1NTM G;  2A06 D;  2E74 C;  2A45 G;  1ZLL A;  5AW7 B;  3Q3D A;  1RE3 C;  1X79 B;  2ZYA A;  3TGU J;  1EDJ A;  3JC2 2;  4W80 A;  3NMD A;  2FYU J;  1SQQ K;  2KXP B;  2Z5H A;  3M0A A;  4N78 D;  3PTZ A;  2E43 A;  1MKM A;  1LTA C;  3GHG C;  4K35 A;  3SWK A;  3L37 A;  2QM8 A;  1NTK D;  4D6T J;  1M56 D;  3M0D A;  2PP6 A;  1ZR2 A;  1J1D B;  3A0H E;  2O3J A;  2W90 A;  2CPS A;  2QVA A;  4N6J A;  2KNC A;  1N7S D;  3B5N C;  4EOT A;  1USD A;  5CCG D;  1U7M A;  1QL1 A;  2OYI C;  3L75 J;  4WVZ A;  2KK7 A;  1GMJ A;  1GTW A;  3KDP B;  4RES B;  1EDI A;  2BCC J;  3VN0 A;  2KB7 P;  3TSI A;  2FFD A;  2YXR B;  3CC2 P;  3A2A A;  2ZXX A;  1DD4 A;  4GOE A;  3EWK A;  3C8V A;  3TDK A;  1PGJ A;  1EXI A;  5B66 H;  5KLV E;  2ZFC A;  2NRG A;  3EQ2 A;  4ZKU A;  2WPR A;  1SQP D;  1AV1 A;  2DW3 A;  2WMM A;  1RE4 A;  2QJY B;  2QE7 H;  2O1J A;  2Y0D A;  1D7M A;  3H25 A;  1L0N K;  1AA0 A;  2ZJS E;  2QRX A;  2ZVN B;  1NTK J;  4H44 D;  3D6Y A;  3UIA A;  3AEB C;  3GW6 A;  3B71 A;  1URQ D;  1VQ7 P;  4U3F G;  1SQV G;  1JMB A;  1H8A A;  1HBW A;  1KQG B;  4U3F E;  5TIS H;  1JB0 J;  2BAS A;  4W7Z A;  2E76 C;  1HGZ A;  2C0X A;  2E75 D;  1QLE D;  1L0L G;  1M1J B;  2FXO A;  3MGN A;  5KKZ C;  2FY8 A;  3V2Q A;  3CCL P;  2I1J A;  4OH8 B;  2IFM A;  2HG5 D;  3FXE A;  2E74 D;  1NWQ A;  5H2F H;  3BCC G;  3LIE A;  1BDD A;  3BCC E;  2NPS C;  1Q90 D;  2IZ1 A;  1SQP J;  1PV3 A;  3Q5P A;  2Z5I A;  4OGQ B;  1KZU B;  2ZT9 B;  1JY2 O;  1NTM D;  1AFO A;  1LTJ A;  1QEX A;  5APV A;  2WSS H;  1FZB A;  2YIU C;  3V4W A;  2KUB A;  1NTZ G;  3WUT A;  1EDL A;  2R3S A;  1FZF A;  4L74 A;  2BEQ D;  2RN0 A;  3WUV A;  5EFW B;  1NTZ E;  1BCC E;  3PRJ A;  1CI6 B;  1ZRT E;  1K73 Q;  4QMA A;  1VF5 C;  4UB6 E;  3B5N D;  3A0B H;  2WIT A;  1NH4 A;  3B5N A;  1KOR A;  1NYH A;  4I2L C;  2YKQ A;  1YQ3 C;  1NVO A;  1K04 A;  2IX7 C;  5CCH C;  1HJ0 A;  3PLN A;  2M5A B;  4JF7 A;  2KS1 A;  1FDO A;  3V2P A;  4JYB A;  5CMZ A;  3TNU B;  1SLQ A;  1S3J A;  2K88 A;  2QJK C;  5GTI E;  3H1H G;  4JYC A;  1GL2 C;  3H1H E;  3G6E P;  3H1L D;  3R2P A;  2Q3I A;  1E5W A;  2AEJ A;  4WY4 B;  5AVW B;  1KIL E;  1PIX A;  1NTM J;  1VQO P;  3IFM A;  3A5T A;  2YO2 A;  2GA1 A;  3E1I A;  5AW2 B;  4GKG A;  1NU1 G;  1FZA A;  2D2C C;  4ZNC A;  1FC2 C;  1UII A;  1LWU A;  2OGU A;  2QSI A;  2H7H A;  1NU1 E;  3EFG A;  1NGM B;  1KIL C;  1LT9 B;  4IOI H;  1X9V A;  1EDK A;  2C0W A;  4ZMD A;  1X0T A;  2OYO A;  1FZG A;  1N8R Q;  1DX7 A;  2E76 D;  3TGU G;  4WB4 A;  4HH2 A;  1YI2 P;  2ITA A;  2WZ7 A;  3TGU E;  3H1J J;  3RBX A;  1FZE A;  3HTK A;  2WQY C;  3L36 A;  4U3F D;  2QJP C;  1SQV D;  4D6T G;  2GM4 A;  2NPS D;  1SQX K;  2YNY A;  4D6T E;  1HH0 A;  2OYH A;  1L0L D;  2WVR A;  3H1L J;  2YKO A;  3RK3 B;  3ITK A;  1EC5 A;  3CCE P;  3BCC D;  2Q9I A;  1QX8 A;  4JBZ A;  2V7Q J;  1ZR4 A;  3AEE C;  3AE2 C;  5AW0 B;  2E42 A;  2N1T B;  1VF5 D;  1BGY G;  2O01 N;  3ZDM A;  2LXB A;  2V7Q H;  1NTZ D;  5CCH D;  2A06 E;  4RJT A;  5KJ7 C;  2HOD B;  1SQB K;  3Q1M A;  1N73 A;  3MHV A;  1M90 Q;  4A7P A;  1W5C E;  1M8O B;  5KLI B;  1CSB A;  1KB9 D;  4U3F J;  5AW3 B;  4PD4 I;  1SQV J;  1AJY A;  2O01 J;  1GL2 D;  2ZYD A;  3E1R A;  4L75 A;  3G4S P;  2YKP A;  1GL2 A;  5B5E E;  4H0L B;  1N7L A;  4NPF X;  3HUS B;  5TIS E;  1L0L J;  4GIF A;  3BVH A;  1SFC C;  3IN6 A;  1YHQ P;  1T2K C;  1USE A;  3VMZ A;  1DH3 A;  4H13 B;  1YQ4 C;  3H1H D;  2O01 H;  5GTH E;  1LTS C;  3BCC J;  5H2F E;  3CX5 D;  2D2C D;  1JY3 N;  2POH A;  4C7N B;  3BAT A; 
#chains in the Genus database with same CATH homology
 4WY4 D;  3NMD A;  2KOG A;  1PFI A;  4LLH A;  2R5B A;  1OWA A;  4WY4 A;  1SQQ K;  4LGD E;  1KIL D;  2OYH B;  2Z5H A;  3M0A A;  4N78 D;  1IJD B;  2VRS A;  2E43 A;  4AYC A;  1LTA C;  1KIL A;  3GHG C;  1EQ7 A;  3P8C E;  1LGH B;  3L37 A;  2QM8 A;  3M0D A;  1SQP K;  5APX A;  1M1J A;  5AVZ B;  2PP6 A;  2OYH C;  1ZR2 A;  1Z56 A;  2OYI B;  1J1D B;  2NPS A;  3MIW A;  1YTZ T;  1GDT A;  3P8M C;  1FAV A;  3HD7 B;  2CPS A;  4N6J A;  3BAS A;  1N7S D;  2XNX A;  3B5N C;  2FYZ A;  4EOT A;  5AVQ B;  1LTB C;  5CCG D;  1QL1 A;  3M9B A;  1S9K E;  2OYI C;  5APY A;  2C9N Y;  3A7O A;  3II6 A;  1W2E A;  3HD7 C;  1JCC A;  3RL0 B;  3KDP B;  4RES B;  1GTW A;  4AUW A;  1NO4 A;  3VN0 A;  2KB7 P;  3TSI A;  2FFD A;  4EIJ A;  5CJ4 A;  3A2A A;  5KLV K;  1NHL A;  5AW9 B;  1IFD A;  1NAF A;  3P7K A;  1IO4 A;  3P8C D;  3IR9 A;  1VPC A;  1YYC A;  2Z4E A;  2ZFC A;  3RL0 C;  1N73 B;  2GUS A;  1GW3 A;  3EQ2 A;  1G2C B;  3L4F A;  4IFD K;  4I6M C;  3RK3 D;  3VMY A;  1G1J A;  2HPC A;  4ZKU A;  2WPR A;  1IFN A;  4KHX A;  1CI6 A;  3RK2 D;  2WSE H;  5CCH A;  1N73 C;  2HYN A;  3O8Z A;  1RE4 A;  5AVY B;  2KLV A;  1S9K D;  1IFI A;  4O9B A;  2O1J A;  5AVR B;  2WSF H;  5AW1 B;  3TK1 A;  1L0N K;  2W6A A;  2N1T D;  5KJ7 D;  5KJ7 A;  3UIA A;  1GK6 A;  1A02 J;  3VMX A;  1NKZ B;  3TNU A;  1L4A C;  5AVT B;  4W7Y A;  2KSJ A;  3H32 A;  4HYT B;  1URQ D;  1IK9 A;  1QL2 A;  1NTM K;  4DZO A;  2R32 A;  2YO3 A;  1GD2 E;  1MV8 A;  1H8A A;  3NFQ A;  2LKM A;  1HBW A;  1KIL B;  2BAS A;  4W7Z A;  1HGZ A;  3KYQ A;  2L5G B;  2C0X A;  2XZR A;  4I1L A;  1FOS F;  1FJP A;  1M1J B;  2WWW A;  3MD0 A;  3MGN A;  4XA4 A;  1SFC D;  2NPS B;  1RY3 A;  3V2Q A;  5BU8 B;  2I1J A;  1T2K D;  4OH8 B;  4W80 A;  2IFM A;  2HG5 D;  1NWQ A;  2ZXE B;  2A45 I;  3LIE A;  2A45 H;  4GT1 A;  3M0D C;  1M1J C;  5APW A;  1CW5 A;  1GW4 A;  2NPS C;  2WSC H;  5AW6 B;  1NOH A;  5AW8 B;  4C7R A;  2FFD B;  1LT9 A;  2Z5I A;  1KZU B;  5BU5 A;  1FU1 A;  1JY2 O;  5APU A;  3OJA B;  3VP8 A;  2XKM A;  1AFO A;  1LTJ A;  3U1A A;  3U59 A;  5APV A;  1FZB A;  3V4W A;  1N7S A;  2OAR A;  2P2U A;  5CJ0 A;  1A02 F;  4IFF A;  1SVF A;  1LTI C;  1J1D C;  1RF0 A;  5CCG A;  2FFD C;  3B8E B;  3V5B A;  1FZF A;  1OXZ A;  2Q5U A;  3NXS A;  1KQL A;  2N9B A;  2HPC B;  1WT6 A;  1CI6 B;  3KQG A;  2XU6 A;  1JTH A;  1G1I A;  1JY3 O;  1ZV8 A;  2YMY A;  3B5N D;  3RK2 B;  1H88 A;  2WIT A;  1NH4 A;  3CL3 D;  3B5N A;  4ZKP A;  4XE5 B;  2H43 A;  3HD7 D;  4I2L C;  2YKQ A;  1NKN A;  1JUN A;  2IX7 C;  5CCH C;  1FDM A;  4JF7 A;  3RK2 C;  1RE4 C;  1GK4 A;  1IFM A;  1JCD A;  1XTG B;  3M9Q A;  1N2D C;  2M8R A;  3V2P A;  1GU5 A;  5APT A;  1GL2 B;  4JYB A;  3TYY A;  5CMZ A;  2IFN A;  3NTN A;  3RL0 D;  2HLO A;  3TNU B;  1SLQ A;  2R3C A;  3N7N A;  2WTY A;  3H32 B;  2KP8 A;  3OA7 A;  3OAK A;  3VYI A;  1IC2 A;  1FOS E;  4JYC A;  1JNM A;  1HJB A;  3BRT B;  1GL2 C;  3L35 A;  1ZN5 A;  3HE4 A;  2N1T A;  3A3Y B;  1T3J A;  2WPQ A;  1FZC A;  3M9H A;  3U1C A;  1CZQ A;  2JEE A;  3R2P A;  4N3Y B;  4DOJ A;  2Q3I A;  1E5W A;  3HE5 A;  1SQV K;  4WY4 B;  5AVW B;  2WT7 A;  1URQ A;  4N78 E;  3V2R A;  3V4Q A;  2Q7C A;  3IFM A;  3A5T A;  2YO2 A;  4WBA A;  2HOD A;  3G3Z A;  1RF1 A;  3VOP A;  2IPP A;  3E1I A;  5AW2 B;  4GKG A;  1FZA A;  1JY2 P;  1GZL A;  1L0L K;  2CPB A;  1L4A D;  5AVS B;  5AVV B;  1LWU A;  4WY4 C;  2H7H A;  3EFG A;  1L4A A;  1KIL C;  1LT9 B;  2P1J A;  1SFC A;  1X9V A;  3P32 A;  3KPE A;  4AQR D;  2C0W A;  1FZG A;  2W27 A;  4LC1 A;  1LTJ B;  1DX7 A;  1J2J B;  5AVU B;  1N7S B;  3HUS A;  2FYU K;  4WB4 A;  4HH2 A;  1SP4 A;  1LT9 C;  1RE3 A;  3PP5 A;  2WZ7 A;  1HUC A;  1JOC A;  2MJZ A;  1GU4 A;  2C9L Y;  1FZE A;  3HTK A;  1LTJ C;  1XTC C;  3L36 A;  3V2N A;  1MFZ A;  1N7S C;  3WMM 0;  1MUU A;  2P7J A;  1JTH B;  1RF0 C;  3GHG A;  5CCG C;  2GM4 A;  2P67 A;  4C7N A;  3B5N B;  1NTZ K;  2NPS D;  4B86 A;  1SQX K;  1J1E B;  1LTT C;  2YNY A;  1HH0 A;  4C46 A;  1JO5 A;  2OYH A;  2YKO A;  3RK3 B;  1KFM A;  3CI9 A;  2O1K A;  2H8P D;  3SWY A;  1J1E C;  5KTB A;  2Q9I A;  3M91 A;  2OYI A;  4Y99 B;  3H6P A;  3HD7 A;  3RK3 C;  1ZR4 A;  5AW4 B;  2XDJ A;  1HTL C;  5AW0 B;  2E42 A;  3HE4 B;  3LID A;  2N1T B;  1T8Z A;  2PAJ A;  1H89 A;  1WRG A;  3N4X A;  5CHX A;  1FZC B;  2KYV A;  2WPS A;  4Y99 C;  3LW5 H;  2I1K A;  2HFE D;  3VP9 A;  5APS A;  3SWF A;  2FKW B;  3HE5 B;  3T97 A;  2WT7 B;  3I5C A;  1M7L A;  1MZ9 A;  1URQ B;  5AVX B;  5CCH D;  2N1T C;  5KJ7 C;  3CLQ A;  2HOD B;  1IFJ A;  1SQB K;  2GUV A;  1RF1 B;  1FZC C;  2J58 A;  1HVV A;  3HRN A;  1N73 A;  2W6B A;  4M3L A;  3VTP C;  2R5D A;  1LWU B;  1KFN A;  1G2C A;  1URQ C;  1L4A B;  1CSB A;  1FJK A;  1FBM A;  3BRV B;  5AW3 B;  1RF1 C;  1NTK K;  1SFC B;  3MTU E;  3M06 A;  1GL2 D;  2XV5 A;  1YTZ I;  1JY2 N;  1NU1 K;  3MUD A;  2YKP A;  1GL2 A;  1T3U A;  1N7L A;  1LWU C;  1JMM A;  3HUS B;  1VDF A;  2QM7 A;  5BVZ A;  1LTG C;  3C9I A;  4GIF A;  5APQ A;  3BVH A;  1AQ5 A;  1HWT C;  1SFC C;  4IFM A;  1T2K C;  2FXM A;  3VMZ A;  2M3B A;  1DH3 A;  3HTK B;  2A45 G;  1HGV A;  2O01 H;  1N86 A;  1LTS C;  3HUS C;  2J59 M;  5AW5 B;  1ZLL A;  5AW7 B;  3GHG B;  1JY3 N;  2POH A;  1X8Y A;  4C7N B;  1RE3 C;  1X79 B;  1DEB A;  2JJL A;  1JY3 P;  3BAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...