2E43A

Crystal structure of c/ebpbeta bzip homodimer k269a mutant bound to a high affinity dna fragment
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
62
structure length
62
Chain Sequence
SDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DTP*DAP*DGP*DGP*DAP*DTP*DTP*DGP*DCP*DGP*DCP*DAP*
total genus 30
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2e43A00
3SWFA 3IR9A 3OAKA 3T97A 5CMZA 1DH3A 3M0AA 2WPRA 3MGNA 5APQA 5AVZB 3LIDA 5APUA 3M06A 4M3LA 2QM7A 1S9KE 5AW1B 1OWAA 1SP4A 2KP8A 1GK6A 1MFZA 5AVSB 3MD0A 4LC1A 1CSBA 1GK4A 2E42A 3A7OA 2Q7CA 3VYIA 5AVYB 3NFQA 1MV8A 1YYCA 1SLQA 2WPSA 5AVRB 5AW4B 4RESB 1GTWA 2WPQA 2JJLA 2ZXEB 4GKGA 2XZRA 5AW0B 1T2KC 5APWA 1H88A 3LIEA 3KQGA 4JYCA 1KQLA 2R5DA 1CI6B 3M0DA 4GT1A 3B8EB 1FOSE 5AVWB 2Z5HA 1MUUA 5AW8B 2N9BA 1G2CB 4EOTA 1FAVA 3V4WA 3P32A 4KHXA 2P2UA 3UIAA 2R5BA 3TNUB 1HWTC 5APSA 1CI6A 3VMYA 2XV5A 4C46A 1H8AA 4XE5B 1JNMA 1HJBA 1GU5A 1GZLA 5APYA 5AW3B 2YO2A 5AW5B 5AW6B 3O8ZA 3L36A 5APXA 3KDPB 2IPPA 2W6AA 3M91A 3TK1A 3I5CA 3NTNA 2BASA 2P7JA 2ZFCA 5AW2B 4B86A 2C9LY 3VTPC 1JUNA 1CZQA 1NAFA 5APTA 3P7KA 4C7NB 3VMZA 4DZOA 3A3YB 3V4QA 2WTYA 5AW7B 1NWQA 4JYBA 5AVUB 2W27A 1A02J 2WT7B 5APVA 2QM8A 4AYCA 3NMDA 4AQRD 1A02F 3HE4B 1FOSF 2XU6A 1GD2E 1J2JB 5AVQB 1HBWA 3HE4A 2WWWA 2Z5IA 4HYTB 2YNYA 3A2AA 3VN0A 5AVVB 1HUCA 3L37A 3TNUA 4C7NA 1H89A 2C9NY 2R32A 3A5TA 3M9BA 3HE5B 2E43A 5AW9B 2WT7A 2P67A 3M9HA 1T2KD 1OXZA 3V5BA 1X8YA 2R3CA 2Q5UA 2VRSA 1S9KD 3L35A 4AUWA 4I6MC 2H7HA 3HTKA 4I2LC 2YO3A 3NXSA 1GU4A 2Q3IA 5AVTB 3TYYA 3VMXA 5AVXB 1IO4A 3P8MC 3HE5A
chains in the Genus database with same CATH superfamily
1JEKA 3IF4A 4C7RA 3L4FA 2I1KA 2QIWA 2QG4A 1NTZK 1ZR2A 3T97A 3V6IA 1M57D 1DH3A 2WPRA 2WSSH 2QJPB 1S1CX 2E74B 3U59A 1Q81Q 3B5ND 3BRTB 1H0TA 4ZKPA 1S9KE 2QM7A 5AW1B 2NPSD 4PJ0E 2Q1KA 1MFZA 4O9BA 2K3RA 2FKWB 1FDOA 5AVSB 4D6TG 1EZVD 1L0NJ 1CSBA 2KLUA 2FYUD 4H13D 4N78E 5GTIE 1LP1A 3KHUA 3B4SA 2ZYDA 4U3FG 1QL2A 1UIXA 1MZ9A 3L73G 4L74A 1OFCX 4OGQD 1PL5A 1MKMA 2XDJA 2IBZD 2K37A 1Y47A 3AEFC 3KZIE 1RE4A 1M7LA 4U3FE 1L0LD 1ZN5A 2BCCE 3G4SP 2Z4EA 3KZIH 2D2CD 2W8ZA 3RL0C 3G6EP 2H88C 2QJKB 1P84D 2JJLA 4GODA 2ZXEB 1LJ2A 4GKGA 4HJGH 1RHZB 2XZRA 1LP1B 3AE1C 3CI9A 4ASWA 1IK7A 3KPEA 1L0NE 4OWFA 2AXTH 2GUVA 3H1LG 1L2PA 3JSVC 3B8EB 4WY4B 3L74E 3L72G 5H2FE 1VQ8P 1EC5A 1BE3D 4XFJA 5KLVJ 2B88A 1SQBK 3AE4C 3H1KD 3H1HJ 2YXRB 2GUSA 3A0HH 3RK3E 5CBNA 4U7JA 1VQ7P 3SSUA 4RJTA 3P8CE 5CCHD 1KILB 2IX7C 5KAIH 3V4WA 2WSFH 2P2UA 4BRYA 1QGKB 5DJTB 3GHGB 1IJDB 2WVRA 3H1JG 1N8RQ 2ZT9D 1TU3F 2O1KA 2K9JA 2KXPB 1PIXA 1VDFA 1PZQA 1H88A 2XV5A 2AEMA 3L75J 1L0NG 2KB7P 3FWLA 3H1JE 1M1JA 4XE5B 4H44B 1L0LG 1YQ3C 3RK3B 2OARA 2LKMA 2GA1A 1P84E 2YO2A 2KZJA 4NPDA 1EDJA 5GTIH 1SQPE 3O8ZA 1OVVA 3L36A 3H1KE 2IPPA 3KDPB 4TLFA 1HVVA 3WUUA 1KZUB 4N6JA 1DIPA 3GLMA 3HUSC 1SQXG 1Y8AA 1KYOH 2KOGA 2ZFCA 3JCUH 2E76D 3V2RA 1PP9D 2JKVA 3CX5D 1SQQD 3VTPC 1SQQJ 3M0DC 2OYIC 1JUNA 5KKZB 3VMZA 1KFNA 1M1JC 3A3YB 2KYVA 1NWQA 5AW7B 2QJPC 2C0XA 2M5AA 4WY4C 2B9BA 1USDA 2WT7B 3TSIA 3CCJP 4DJGA 2N1TD 3WMM0 1NTKG 1GMJA 1SQPG 2MKVA 1IFMA 5EFWB 1FOSF 1PP9G 2OGUA 3M9QA 2IFMA 2HYNA 1LWUA 3HE4A 3KXDA 4PD4D 2WWWA 4U3FJ 1JMBA 1PP9E 3OW2O 1HUCA 1L4AA 1NKNA 2B89A 2BCCG 3GF7A 3TNUA 2C9NY 3A5TA 3PLNA 1LTGC 5KAIE 1EDIA 1NHLA 2RN0A 2WMMA 1YTZI 4K35A 1FBMA 2E43A 1FJPA 2WT7A 3M9HA 2FFDB 2Q3EA 3CXHI 4H44C 5CCHC 2NZ2A 1ZMEC 3D70A 4HB1A 3MP7B 1URQB 1LWUB 1T8ZA 3BCCG 3BCCD 4L75A 1N2DC 2ZVOB 4CPGA 2H7HA 4N78D 1DEBA 1L0LE 2YKOA 1L4AB 2PP6A 2AXCA 1SVFA 3F5HA 1VQOP 1VQ4P 3CWBD 4WB4A 5B5EE 2KLVA 1HGZA 3H1KG 2CK3H 1NU1E 1ZXGA 2G8YA 2NPSC 4QMAA 3BASA 4H0LD 3IR9A 3RK2B 1VF5D 5DJUB 1KC8Q 3TGUE 1KN7A 3MGNA 5APQA 5AVZB 1DX7A 3D6YA 1CW5A 3H1JJ 1X9VA 3GHGC 1JTHB 1OWAA 1AVYA 1RF0A 3FX0A 3MD0A 3MTUE 2BEZF 4LC1A 4RO0A 3CCQP 1K73Q 2E42A 1LTTC 3RK3C 1GW3A 3A7OA 3W68A 4KT0J 3PP5A 1L4AD 3IAOA 4RKUJ 3VYIA 3CX5I 3FXEA 1JCCA 1NTME 1UIIA 2A06D 4PJ0H 3L70G 4I1LA 1NU1G 3A0HE 1HJ0A 1YJ9P 2FYZA 3BVHA 3CWBJ 1BE3J 1NU1K 1YYCA 2IBZI 2J5UA 3L70E 3AE8C 5K5GB 1G1IA 1SQVJ 5KAFH 1Q82Q 1FZCA 4BWNA 3Q2YA 1S72P 1LTJA 5KJ7D 1JY2P 1PGOA 1OW6A 5C39A 3HTKB 5CBOA 1NO4A 5APWA 3LIEA 3V2QA 3QH9A 1AV1A 2ZYAA 3JCUE 1BGYG 1OVUA 2HFED 1BGYJ 1S2EA 1WRGA 1CI6B 2PAJA 2R5DA 4GT1A 1DD4A 2WSCH 2WZ7A 1NTMJ 3VP9A 1N73B 2BEQD 4OH8B 5AVWB 3CXHH 3OA7A 5KLVG 2YKPA 1HTLC 4WBAA 3USSA 2NPSB 2W90A 1NOHA 2ZXXA 2JWAA 3AE5C 3GF3A 3L72E 3L74G 2Y9ZA 3AEBC 2N9BA 1HH0A 1S9KD 1G2CB 2C0WA 1FAVA 5BVZA 4GOEA 3CCRP 3A0BE 4A7PA 3V2PA 1E79H 1LTAC 1NKZB 3H1IJ 1YJNP 2IBZE 1YQ4C 1HWTC 3A0BH 1CI6A 1RY3A 2DW3A 2FFDC 2E76B 1BGYE 2KIKA 4EI2A 1DD3A 1JY2N 2WPVB 4ASVA 5AW3B 4BXLA 1GU5A 2QJYB 2Y0CA 5AW5B 5H2FH 5AW6B 3MUDA 1AQ5A 5APXA 2A45I 3M91A 4H13C 3KYQA 3L73D 3FWNA 1ZP0C 1PPJG 5KAFE 1L4AC 2PGDA 2NRGA 4B86A 4MN4C 4EYYQ 1H8AA 1K8AQ 3EFFK 3CCVP 1VQ6P 1URQD 1VQ5P 1LT9A 3S1KA 4PV1B 2KI7B 1VQKP 3P7KA 2ZVNB 1SQBJ 1OX3A 3WUTA 1NYHA 2B87A 1Q90D 2D2CC 2XNXA 1BCCD 1PGJA 3RL0D 1LGHB 5CCHA 1OMIA 4JYBA 1AVOA 2WSEJ 2OYHC 1KYOD 1FU1A 2FYNC 2QM8A 3EWKA 4D6TJ 1N7SC 1PP9J 1FZFA 2XU6A 1EDKA 1QEXA 2HLOA 1HBWA 3Q3DA 1SQXE 4GIFA 2Z5IA 4HYTB 2YNYA 3E1IA 1J1DC 1KORA 1FDIA 2IDBA 5AVVB 3VN0A 4HH2A 1AQTA 1FE6A 1J1EB 1LTIC 1PGQA 1SQPD 2YMKA 3IN6A 1NTZE 1JB0J 1KB9E 3ABVC 1S5LH 4PV1D 4DOJA 3CX5H 3PHLA 5B66E 1RE3C 3TGUD 4HKZH 1WMKA 1NTMK 2E74C 1RE4C 1BDDA 3L75G 3G9RA 4JQ0D 1KYOE 1USEA 3CX5E 4YXDC 1SFCC 2R3CA 3H25A 4LGDE 1EDLA 3WU2E 2XNDH 4H0LB 1ZRTE 1YIJP 2OYHA 3CC4P 1K04A 1M8OB 2OTJP 4I6MC 1XTCC 1EZVE 1G2CA 3E1RA 1BCCE 1GL2A 1SQXD 5CJ4A 1FS0E 1RF1C 3PJSK 5AVTB 3EQ2A 3H1KJ 1VQNP 2N1TA 3B5NC 1BCCG 1SQVD 3BRVB 1NTZJ 4NPEA 1SS1A 1BSNA 2V7QH 1R5SA 3PH0A 2R44A 1BDCA 2Y0EA 5CJ0A 3H32A 1JY3O 1QX8A 2E75D 1L0ND 3H1IE 2ITAA 2KK7A 1LTJC 1NH4A 2BCCD 3ITKA 3M0AA 5APUA 3HRNA 5CCGA 2OYHB 1GW4A 1RE3A 1LTSC 1KILA 2ZT9B 2M3BA 2CPBA 1SP4A 1IFIA 1U57A 1ZRTD 3H1IG 5CCGD 3CMEP 1LWUC 1KTMA 3CD6P 3I56P 1D7MA 2JP3A 3BCCE 4OGQC 1EZVG 2IZ1A 3RK3D 1GK4A 2M8RA 2E76C 2IZ0A 3RK2D 3VMAA 1FZBA 2FYUK 1EXIA 4PD4H 2AEJA 3HD7C 2HODB 3L74D 5AVYB 1Z56A 3L70J 3TDKA 1J1EC 3HD7D 3H32B 1BE3G 3CWBG 1XTGB 1VQPP 3L72D 3RK2C 3D6ZA 2J58A 2WPSA 4UB6H 2FXOA 4W7ZA 3FGAD 4RESB 1BGYD 5AVRB 1GTWA 3W67A 2W6JH 2WPQA 4R4LA 1L0LK 3CWBE 3HUSA 1G1JA 2E5YA 2O01N 4PV1C 1IFDA 3FXDA 2WSFJ 1YBKA 1YI2P 2QE7H 2IYOA 3BCCJ 2KSEA 1VQMP 2Y0DA 2GM4A 3CCLP 5TJHA 3Q1MA 1SQPJ 4IL6H 4WY4A 1X79B 1K05A 1PPJE 1KMIZ 1N7LA 1MUUA 2Z5HA 4IL6E 2KSJA 3I55P 3HUSB 1KQSO 3O6QB 4EOTA 2FYUG 5BU8B 5M1BA 1M90Q 3P32A 4D6TD 1ZOYC 3RBXA 3CC7P 2ZT9C 2E74D 3II6A 2H89C 1IFJA 1S4XA 1VF5C 1T3JA 1KQFB 3TNUB 4UB8E 3C9IA 3CMAP 2RKLA 3AEGC 1GL2B 2OTLP 3VMYA 4PD4E 3MIWA 3VOPA 1RQUA 3C1LA 4C46A 2LXBA 1ZV8A 2K9JB 2QRXA 4JPZB 1R8EA 2N1TB 1SQVK 1L0NK 5CHXA 4TT3H 1NGMB 3AEDC 2H8PD 4GOFA 4UB6E 5KLVE 3CCEP 3TK1A 1PGPA 4Y99C 2YIUC 4GDOA 1QVFO 1AFOA 2BASA 1JY2O 1SQQK 2CPSA 5AW2B 2L91A 1HF9A 2WSEH 1CZQA 1KB9H 1S5LE 1NAFA 1NTZG 1SQQG 1BE3E 2ZAEB 5APTA 2XKMA 3V2NA 3C8VA 1SQBG 2HPCB 2IBZG 1EZVI 3AE2C 3L71D 4DZOA 3L75E 3V4QA 1NJIQ 3R2PA 5AVUB 3L71G 4IFMA 3CCMP 2IFNA 3RBZA 4IL6X 1LT1A 2LXCB 3AEEC 3MZWB 2HPCA 2Q6QA 4WVZA 4W80A 1JY3P 3HE4B 2N9YB 1FZAA 3WU2H 3GW6A 1J2JB 5AVQB 2O01H 4YXWH 4R4MA 3WUVA 3H1JD 3CCUP 3A2AA 4Z1MH 1LT9C 1QL1A 3L73J 2ZJSE 2OYOA 1SQQE 4K3AA 3VP8A 1NAYA 2FY8A 2OTKE 3AECC 1KILD 3L37A 5E79H 2R32A 4Y28J 1SFCD 1IC2A 1VF5B 2A45G 2I1JA 2PFXA 3M9BA 3MUDC 5KJ7C 3HE5B 5KKZC 1IZNB 1M1JB 2FYUE 5E79E 5AW9B 2P67A 3SFEC 1T2KD 1VQLP 2A06G 5KLIB 3K5BA 2W6BA 4UB8H 3D71A 3MHVA 3V5BA 1RQVA 3PRJA 1MFTA 1IFNA 2FYNB 2VRSA 1ZLLA 3L35A 5BU5A 1A02F 4AUWA 1N7SB 1FZEA 5KTBA 4LLHA 4YTPC 1EQ7A 3HTKA 4ZNCA 3O6QA 2YO3A 3G3ZA 2J59M 5GTHH 3NXSA 1NTMG 3Q5PA 1J1DB 1BSHA 4EDFA 3TYYA 2JO1A 4IFFA 2O3JA 3P8MC 2HR3A 3AE9C 3HE5A 1FZGA 3H1HG 4NPFX 4PD4I 3SWFA 2E75C 2KUBA 1K9MQ 3OAKA 2M5AB 3S4RA 5CMZA 1AJYA 2ZYGA 2H43A 1JTHA 1M56D 2FBWC 3CLQA 3LIDA 3GMAA 4JBZA 3M06A 1T3UA 1HGVA 4M3LA 1SQBE 2KP8A 1GK6A 4H0LC 1PPJD 1URQC 1KB9D 1NTKJ 1RH5B 3OJAB 1W2BO 1IFPA 2AXTE 2IYPA 2FXPA 2R3SA 1WT6A 3CXHD 3H6PA 2N1TC 2Q7CA 3JC22 1LNQA 3NFQA 3H1HD 1S3JA 1JCDA 3B5NB 1N73C 1NU1J 1NU1D 1MV8A 2BCCJ 3CPWO 4JF7A 4Y99B 2YIUB 2FFDA 3E7KA 3AE3C 1SLQA 1W2EA 2RH0A 1VQ9P 5AW4B 2L5GB 1LTJB 4ZKUA 1KILC 4KJMA 3SWYA 4EIJA 1URQA 1ZW0A 2Y9YA 2QSIA 3PTZA 4L76A 1Q86Q 1OZHA 2WITA 5AW0B 1QLED 2K9YA 2RMZA 4OGQB 1KYOI 5GTHE 1KB9I 3KQGA 1T2KC 3CC2P 3CCSP 4JYCA 1KQLA 2G3AA 1ZR4A 2JWDA 2M3EA 3B5NA 1PFIA 3M0DA 3LW5H 3H1LJ 3U1AA 1FOSE 2NPSA 1JO5A 2QJYC 1Y9BA 2K88A 4IFDK 5KLVD 1P84I 1BCCJ 3AEAC 1N73A 2I8DA 4U3FD 5AW8B 3L74J 4I7ZB 2QA4P 5B66H 3CXHE 2KS1A 3AE6C 3G71P 1U7JA 2FYUJ 2YMYA 4KHXA 3H1HE 3N7NA 3U1CA 2A06E 1N7SA 3HD7A 3UIAA 2R5BA 2FXMA 1OVRA 2OYIA 5L8RJ 2Q9IA 1NTKK 5APSA 2WSCJ 3RL0g 3SFDC 3L71E 2W83C 1X0TA 3L70D 1KV4A 5KLIC 3QWOC 5TISH 1JNMA 2O1JA 1L0LJ 1GZLA 1X22A 2MJZA 5APYA 1HJBA 1H0TB 1JMMA 3H1LE 2QEXP 2LR2A 4DCKA 2UWJE 2POHA 1NTZD 1W5CE 3TGUG 1SFCA 2W6AA 1FZCB 1EXJA 2KS1B 3IFMA 3I5CA 2HG5D 3NTNA 1GL2D 2P7JA 2JR8A 1SQXJ 2C9LY 1E5WA 1M1KQ 1KFMA 2A45H 1P84H 1QVGO 4WY4D 2B87B 2WQYC 2KNCB 1Q7YQ 3B71A 3EFGA 4C7NB 2E75B 2AEFA 1RF1A 1GL2C 4WWIA 1FDMA 2O01J 2WTYA 1FC2C 1NTKE 1DEEG 4IOIH 1RF1B 3L71J 3P8CD 2W27A 4W7YA 2KZIA 1A02J 1KD1Q 4ZMDA 1R5LA 1JM0A 1FJKA 1SFCB 3AE7C 1AA0A 3H1LD 3NMDA 2YXQB 5APVA 1OW7A 4H13B 4AYCA 2P58A 4AQRD 3L73E 3SWKA 1YJWP 1GD2E 3Q5RA 4I7ZC 1YTZT 1JOCA 1RF0C 5CCGC 5B5EH 3H1ID 1YHQP 4D6TE 3RGUA 2M0BA 3S9OA 2KNCA 1VPCA 1T6AA 1N7SD 2JEEA 4H44D 4YPCA 1OW8A 4C7NA 1SQVE 2HODA 3GG2A 1H89A 1IK9A 2JDIH 1VL2A 2V4HA 3BATA 4DT0A 1S5LX 1SQPK 2YKQA 4L73A 2P1JA 2D2CB 3L75D 5KLVK 1SQVG 3Q5SA 1N86A 1U7MA 2V7QJ 3ZDMA 3RL0B 3T97B 1OXZA 1JY3N 1PV3A 2QJKC 1YITP 1X8YA 1NTMD 1LTBC 1SQBD 2Q5UA 2SPZA 3R4YA 4N3YB 4BRYB 3F89A 3TF5A 3GHGA 2K1AA 1NVOA 1FZCC 1KQGB 3CL3D 1GDTA 1Q2NA 2QVAA 2P10A 4I2LC 1NTKD 3L72J 3N4XA 1GU4A 1LT9B 2Q3IA 2PRRA 3LW5J 4OVNF 1SQXK 1OIPA 3HD7B 5TISE 3VMXA 1KILE 5AVXB 3TGUJ 2OQQA 2OYIB 5KJ7A 2E5TA 1IO4A 4XA4A
chains in the Genus database with same CATH topology
1ZR2A 4C7RA 3L4FA 2I1KA 1NTZK 3T97A 1DH3A 2WPRA 3U59A 3B5ND 3BRTB 4ZKPA 1S9KE 2QM7A 5AW1B 2NPSD 1MFZA 4O9BA 2FKWB 5AVSB 1CSBA 4N78E 1QL2A 1MZ9A 2XDJA 1RE4A 1M7LA 1ZN5A 2Z4EA 3RL0C 2JJLA 2ZXEB 4GKGA 2XZRA 3CI9A 3KPEA 4WY4B 2GUVA 3B8EB 1SQBK 2GUSA 5CCHD 3P8CE 1KILB 2IX7C 3V4WA 2WSFH 2P2UA 3GHGB 1IJDB 2O1KA 1VDFA 2XV5A 4XE5B 2KB7P 3RK3B 1M1JA 2OARA 2LKMA 2YO2A 3O8ZA 3L36A 3KDPB 2IPPA 1HVVA 1KZUB 4N6JA 3HUSC 2ZFCA 2KOGA 3V2RA 3VTPC 1JUNA 3M0DC 2OYIC 3VMZA 1KFNA 1M1JC 3A3YB 2KYVA 1NWQA 5AW7B 2C0XA 4WY4C 2WT7B 3TSIA 2N1TD 3WMM0 1IFMA 1FOSF 3M9QA 2IFMA 2HYNA 1LWUA 3HE4A 2WWWA 1HUCA 1L4AA 1NKNA 2C9NY 3TNUA 3A5TA 1LTGC 1NHLA 1FJPA 1YTZI 1FBMA 2E43A 2WT7A 3M9HA 2FFDB 5CCHC 1URQB 1LWUB 1T8ZA 1N2DC 2H7HA 4N78D 1DEBA 2YKOA 1L4AB 2PP6A 1SVFA 4WB4A 2KLVA 1HGZA 2NPSC 3BASA 3IR9A 3RK2B 3MGNA 5APQA 5AVZB 1DX7A 1CW5A 1X9VA 3GHGC 1JTHB 1OWAA 1RF0A 3MD0A 3MTUE 4LC1A 2E42A 1LTTC 3RK3C 1GW3A 3A7OA 3PP5A 1L4AD 3VYIA 1JCCA 4I1LA 3BVHA 2FYZA 1YYCA 1NU1K 1G1IA 1LTJA 5KJ7D 1JY2P 3HTKB 1NO4A 5APWA 3LIEA 3V2QA 1RF1B 2HFED 2PAJA 2R5DA 1WRGA 1CI6B 4GT1A 3VP9A 2WZ7A 2WSCH 1N73B 4OH8B 5AVWB 3OA7A 2YKPA 1HTLC 4WBAA 2NPSB 1NOHA 2N9BA 1HH0A 1G2CB 2C0WA 1FAVA 5BVZA 3V2PA 1LTAC 1NKZB 1HWTC 1CI6A 1RY3A 2FFDC 1GU5A 1JY2N 5AW3B 1AQ5A 5AW5B 5AW6B 3MUDA 5APXA 2A45I 3M91A 3KYQA 1L4AC 4B86A 1URQD 1LT9A 3P7KA 3RL0D 2XNXA 5CCHA 1LGHB 4JYBA 2OYHC 1FU1A 2QM8A 1N7SC 1FZFA 2XU6A 2HLOA 1HBWA 4GIFA 2Z5IA 4HYTB 2YNYA 3E1IA 1J1DC 5AVVB 3VN0A 4HH2A 1J1EB 1LTIC 4DOJA 1RE3C 1NTMK 1RE4C 1SFCC 2R3CA 4LGDE 2OYHA 4I6MC 1XTCC 1G2CA 1RF1C 1GL2A 5CJ4A 5AVTB 3EQ2A 2N1TA 3B5NC 3BRVB 5CJ0A 3H32A 1JY3O 3M0AA 5CCGA 1LTJC 1NH4A 5APUA 3HRNA 2OYHB 1GW4A 1RE3A 1LTSC 1KILA 3OJAB 2M3BA 2CPBA 1SP4A 1IFIA 1LWUC 3RK3D 1GK4A 2M8RA 3RK2D 1FZBA 2FYUK 3HD7C 2HODB 5AVYB 1Z56A 1J1EC 3HD7D 3H32B 1XTGB 3RK2C 2J58A 2WPSA 4W7ZA 5AVRB 4RESB 1GTWA 2WPQA 1L0LK 3HUSA 1G1JA 1IFDA 2GM4A 4WY4A 1X79B 1N7LA 1MUUA 2Z5HA 2KSJA 3HUSB 4EOTA 5BU8B 3P32A 3II6A 1IFJA 1T3JA 3TNUB 3C9IA 1GL2B 3VMYA 4C46A 3MIWA 3VOPA 1H8AA 2HPCA 1ZV8A 2N1TB 1SQVK 1L0NK 5CHXA 2H8PD 3TK1A 4Y99C 1AFOA 2BASA 1JY2O 1SQQK 2CPSA 5AW2B 2WSEH 1CZQA 1NAFA 5APTA 2XKMA 3V2NA 2HPCB 4DZOA 3V4QA 3R2PA 5AVUB 4IFMA 2IFNA 4W80A 1JY3P 3HE4B 1FZAA 1J2JB 5AVQB 2O01H 3A2AA 5CCGD 1LT9C 1QL1A 3VP8A 3L37A 1KILD 2R32A 1SFCD 1IC2A 2A45G 2I1JA 3M9BA 5KJ7C 3HE5B 1M1JB 5AW9B 2P67A 1T2KD 2W6BA 3V5BA 2VRSA 1IFNA 5BU5A 1ZLLA 3L35A 4AUWA 1N7SB 1FZEA 5KTBA 4LLHA 1EQ7A 3HTKA 2YO3A 3G3ZA 2J59M 3NXSA 1J1DB 3TYYA 4IFFA 3P8MC 3HE5A 1FZGA 3SWFA 3OAKA 5CMZA 2H43A 1JTHA 3LIDA 3CLQA 3M06A 1T3UA 1HGVA 4M3LA 2KP8A 1GK6A 1URQC 1WT6A 3H6PA 2N1TC 2Q7CA 3NFQA 1JCDA 1N73C 3B5NB 1MV8A 4JF7A 4Y99B 2FFDA 1SLQA 1W2EA 5AW4B 2L5GB 1LTJB 4ZKUA 1KILC 3SWYA 4EIJA 1URQA 2WITA 5AW0B 1H88A 1T2KC 3KQGA 4JYCA 1KQLA 1ZR4A 1PFIA 3B5NA 3M0DA 3LW5H 3U1AA 1FOSE 2NPSA 1JO5A 4IFDK 1N73A 5AW8B 2YMYA 4KHXA 3N7NA 3U1CA 1N7SA 3HD7A 3UIAA 2R5BA 2FXMA 2OYIA 2Q9IA 1NTKK 5APSA 1JNMA 1HJBA 2O1JA 1GZLA 2MJZA 5APYA 1JMMA 2POHA 1SFCA 2W6AA 1FZCB 3IFMA 3I5CA 2HG5D 3NTNA 1GL2D 2P7JA 2C9LY 1E5WA 1KFMA 2A45H 4WY4D 3EFGA 4C7NB 1RF1A 1GL2C 1FDMA 2WTYA 4W7YA 3P8CD 2W27A 1A02J 1SFCB 1FJKA 5CCGC 5APVA 4AYCA 4AQRD 3NMDA 1FZCA 1A02F 1GD2E 1YTZT 1JOCA 1RF0C 1VPCA 1N7SD 2JEEA 4C7NA 1H89A 2HODA 1IK9A 3BATA 1SQPK 5KLVK 2YKQA 2P1JA 1N86A 3RL0B 1OXZA 1JY3N 1X8YA 1S9KD 1LTBC 2Q5UA 4N3YB 3GHGA 1FZCC 3CL3D 1GDTA 4I2LC 3N4XA 1GU4A 1LT9B 2Q3IA 1SQXK 3HD7B 3VMXA 5AVXB 2OYIB 1IO4A 5KJ7A 4XA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWF A;  3IR9 A;  3OAK A;  3T97 A;  5CMZ A;  1DH3 A;  3M0A A;  2WPR A;  3MGN A;  5APQ A;  5AVZ B;  3LID A;  5APU A;  3M06 A;  4M3L A;  2QM7 A;  1S9K E;  5AW1 B;  1OWA A;  1SP4 A;  2KP8 A;  1GK6 A;  1MFZ A;  5AVS B;  3MD0 A;  4LC1 A;  1CSB A;  1GK4 A;  2E42 A;  3A7O A;  2Q7C A;  3VYI A;  5AVY B;  3NFQ A;  1MV8 A;  1YYC A;  1SLQ A;  2WPS A;  5AVR B;  5AW4 B;  4RES B;  1GTW A;  2WPQ A;  2JJL A;  2ZXE B;  4GKG A;  2XZR A;  5AW0 B;  1T2K C;  5APW A;  1H88 A;  3LIE A;  3KQG A;  4JYC A;  1KQL A;  2R5D A;  1CI6 B;  3M0D A;  4GT1 A;  3B8E B;  1FOS E;  5AVW B;  2Z5H A;  1MUU A;  5AW8 B;  2N9B A;  1G2C B;  4EOT A;  1FAV A;  3V4W A;  3P32 A;  4KHX A;  2P2U A;  3UIA A;  2R5B A;  3TNU B;  1HWT C;  5APS A;  1CI6 A;  3VMY A;  2XV5 A;  4C46 A;  1H8A A;  4XE5 B;  1JNM A;  1HJB A;  1GU5 A;  1GZL A;  5APY A;  5AW3 B;  2YO2 A;  5AW5 B;  5AW6 B;  3O8Z A;  3L36 A;  5APX A;  3KDP B;  2IPP A;  2W6A A;  3M91 A;  3TK1 A;  3I5C A;  3NTN A;  2BAS A;  2P7J A;  2ZFC A;  5AW2 B;  4B86 A;  2C9L Y;  3VTP C;  1JUN A;  1CZQ A;  1NAF A;  5APT A;  3P7K A;  4C7N B;  3VMZ A;  4DZO A;  3A3Y B;  3V4Q A;  2WTY A;  5AW7 B;  1NWQ A;  4JYB A;  5AVU B;  2W27 A;  1A02 J;  2WT7 B;  5APV A;  2QM8 A;  4AYC A;  3NMD A;  4AQR D;  1A02 F;  3HE4 B;  1FOS F;  2XU6 A;  1GD2 E;  1J2J B;  5AVQ B;  1HBW A;  3HE4 A;  2WWW A;  2Z5I A;  4HYT B;  2YNY A;  3A2A A;  3VN0 A;  5AVV B;  1HUC A;  3L37 A;  3TNU A;  4C7N A;  1H89 A;  2C9N Y;  2R32 A;  3A5T A;  3M9B A;  3HE5 B;  2E43 A;  5AW9 B;  2WT7 A;  2P67 A;  3M9H A;  1T2K D;  1OXZ A;  3V5B A;  1X8Y A;  2R3C A;  2Q5U A;  2VRS A;  1S9K D;  3L35 A;  4AUW A;  4I6M C;  2H7H A;  3HTK A;  4I2L C;  2YO3 A;  3NXS A;  1GU4 A;  2Q3I A;  5AVT B;  3TYY A;  3VMX A;  5AVX B;  1IO4 A;  3P8M C;  3HE5 A; 
#chains in the Genus database with same CATH topology
 1JEK A;  3IF4 A;  4C7R A;  3L4F A;  2I1K A;  2QIW A;  2QG4 A;  1NTZ K;  1ZR2 A;  3T97 A;  3V6I A;  1M57 D;  1DH3 A;  2WPR A;  2WSS H;  2QJP B;  1S1C X;  2E74 B;  3U59 A;  1Q81 Q;  3B5N D;  3BRT B;  1H0T A;  4ZKP A;  1S9K E;  2QM7 A;  5AW1 B;  2NPS D;  4PJ0 E;  2Q1K A;  1MFZ A;  4O9B A;  2K3R A;  2FKW B;  1FDO A;  5AVS B;  4D6T G;  1EZV D;  1L0N J;  1CSB A;  2KLU A;  2FYU D;  4H13 D;  4N78 E;  5GTI E;  1LP1 A;  3KHU A;  3B4S A;  2ZYD A;  4U3F G;  1QL2 A;  1UIX A;  1MZ9 A;  3L73 G;  4L74 A;  1OFC X;  4OGQ D;  1PL5 A;  1MKM A;  2XDJ A;  2IBZ D;  2K37 A;  1Y47 A;  3AEF C;  3KZI E;  1RE4 A;  1M7L A;  4U3F E;  1L0L D;  1ZN5 A;  2BCC E;  3G4S P;  2Z4E A;  3KZI H;  2D2C D;  2W8Z A;  3RL0 C;  3G6E P;  2H88 C;  2QJK B;  1P84 D;  2JJL A;  4GOD A;  2ZXE B;  1LJ2 A;  4GKG A;  4HJG H;  1RHZ B;  2XZR A;  1LP1 B;  3AE1 C;  3CI9 A;  4ASW A;  1IK7 A;  3KPE A;  1L0N E;  4OWF A;  2AXT H;  2GUV A;  3H1L G;  1L2P A;  3JSV C;  3B8E B;  4WY4 B;  3L74 E;  3L72 G;  5H2F E;  1VQ8 P;  1EC5 A;  1BE3 D;  4XFJ A;  5KLV J;  2B88 A;  1SQB K;  3AE4 C;  3H1K D;  3H1H J;  2YXR B;  2GUS A;  3A0H H;  3RK3 E;  5CBN A;  4U7J A;  1VQ7 P;  3SSU A;  4RJT A;  3P8C E;  5CCH D;  1KIL B;  2IX7 C;  5KAI H;  3V4W A;  2WSF H;  2P2U A;  4BRY A;  1QGK B;  5DJT B;  3GHG B;  1IJD B;  2WVR A;  3H1J G;  1N8R Q;  2ZT9 D;  1TU3 F;  2O1K A;  2K9J A;  2KXP B;  1PIX A;  1VDF A;  1PZQ A;  1H88 A;  2XV5 A;  2AEM A;  3L75 J;  1L0N G;  2KB7 P;  3FWL A;  3H1J E;  1M1J A;  4XE5 B;  4H44 B;  1L0L G;  1YQ3 C;  3RK3 B;  2OAR A;  2LKM A;  2GA1 A;  1P84 E;  2YO2 A;  2KZJ A;  4NPD A;  1EDJ A;  5GTI H;  1SQP E;  3O8Z A;  1OVV A;  3L36 A;  3H1K E;  2IPP A;  3KDP B;  4TLF A;  1HVV A;  3WUU A;  1KZU B;  4N6J A;  1DIP A;  3GLM A;  3HUS C;  1SQX G;  1Y8A A;  1KYO H;  2KOG A;  2ZFC A;  3JCU H;  2E76 D;  3V2R A;  1PP9 D;  2JKV A;  3CX5 D;  1SQQ D;  3VTP C;  1SQQ J;  3M0D C;  2OYI C;  1JUN A;  5KKZ B;  3VMZ A;  1KFN A;  1M1J C;  3A3Y B;  2KYV A;  1NWQ A;  5AW7 B;  2QJP C;  2C0X A;  2M5A A;  4WY4 C;  2B9B A;  1USD A;  2WT7 B;  3TSI A;  3CCJ P;  4DJG A;  2N1T D;  3WMM 0;  1NTK G;  1GMJ A;  1SQP G;  2MKV A;  1IFM A;  5EFW B;  1FOS F;  1PP9 G;  2OGU A;  3M9Q A;  2IFM A;  2HYN A;  1LWU A;  3HE4 A;  3KXD A;  4PD4 D;  2WWW A;  4U3F J;  1JMB A;  1PP9 E;  3OW2 O;  1HUC A;  1L4A A;  1NKN A;  2B89 A;  2BCC G;  3GF7 A;  3TNU A;  2C9N Y;  3A5T A;  3PLN A;  1LTG C;  5KAI E;  1EDI A;  1NHL A;  2RN0 A;  2WMM A;  1YTZ I;  4K35 A;  1FBM A;  2E43 A;  1FJP A;  2WT7 A;  3M9H A;  2FFD B;  2Q3E A;  3CXH I;  4H44 C;  5CCH C;  2NZ2 A;  1ZME C;  3D70 A;  4HB1 A;  3MP7 B;  1URQ B;  1LWU B;  1T8Z A;  3BCC G;  3BCC D;  4L75 A;  1N2D C;  2ZVO B;  4CPG A;  2H7H A;  4N78 D;  1DEB A;  1L0L E;  2YKO A;  1L4A B;  2PP6 A;  2AXC A;  1SVF A;  3F5H A;  1VQO P;  1VQ4 P;  3CWB D;  4WB4 A;  5B5E E;  2KLV A;  1HGZ A;  3H1K G;  2CK3 H;  1NU1 E;  1ZXG A;  2G8Y A;  2NPS C;  4QMA A;  3BAS A;  4H0L D;  3IR9 A;  3RK2 B;  1VF5 D;  5DJU B;  1KC8 Q;  3TGU E;  1KN7 A;  3MGN A;  5APQ A;  5AVZ B;  1DX7 A;  3D6Y A;  1CW5 A;  3H1J J;  1X9V A;  3GHG C;  1JTH B;  1OWA A;  1AVY A;  1RF0 A;  3FX0 A;  3MD0 A;  3MTU E;  2BEZ F;  4LC1 A;  4RO0 A;  3CCQ P;  1K73 Q;  2E42 A;  1LTT C;  3RK3 C;  1GW3 A;  3A7O A;  3W68 A;  4KT0 J;  3PP5 A;  1L4A D;  3IAO A;  4RKU J;  3VYI A;  3CX5 I;  3FXE A;  1JCC A;  1NTM E;  1UII A;  2A06 D;  4PJ0 H;  3L70 G;  4I1L A;  1NU1 G;  3A0H E;  1HJ0 A;  1YJ9 P;  2FYZ A;  3BVH A;  3CWB J;  1BE3 J;  1NU1 K;  1YYC A;  2IBZ I;  2J5U A;  3L70 E;  3AE8 C;  5K5G B;  1G1I A;  1SQV J;  5KAF H;  1Q82 Q;  1FZC A;  4BWN A;  3Q2Y A;  1S72 P;  1LTJ A;  5KJ7 D;  1JY2 P;  1PGO A;  1OW6 A;  5C39 A;  3HTK B;  5CBO A;  1NO4 A;  5APW A;  3LIE A;  3V2Q A;  3QH9 A;  1AV1 A;  2ZYA A;  3JCU E;  1BGY G;  1OVU A;  2HFE D;  1BGY J;  1S2E A;  1WRG A;  1CI6 B;  2PAJ A;  2R5D A;  4GT1 A;  1DD4 A;  2WSC H;  2WZ7 A;  1NTM J;  3VP9 A;  1N73 B;  2BEQ D;  4OH8 B;  5AVW B;  3CXH H;  3OA7 A;  5KLV G;  2YKP A;  1HTL C;  4WBA A;  3USS A;  2NPS B;  2W90 A;  1NOH A;  2ZXX A;  2JWA A;  3AE5 C;  3GF3 A;  3L72 E;  3L74 G;  2Y9Z A;  3AEB C;  2N9B A;  1HH0 A;  1S9K D;  1G2C B;  2C0W A;  1FAV A;  5BVZ A;  4GOE A;  3CCR P;  3A0B E;  4A7P A;  3V2P A;  1E79 H;  1LTA C;  1NKZ B;  3H1I J;  1YJN P;  2IBZ E;  1YQ4 C;  1HWT C;  3A0B H;  1CI6 A;  1RY3 A;  2DW3 A;  2FFD C;  2E76 B;  1BGY E;  2KIK A;  4EI2 A;  1DD3 A;  1JY2 N;  2WPV B;  4ASV A;  5AW3 B;  4BXL A;  1GU5 A;  2QJY B;  2Y0C A;  5AW5 B;  5H2F H;  5AW6 B;  3MUD A;  1AQ5 A;  5APX A;  2A45 I;  3M91 A;  4H13 C;  3KYQ A;  3L73 D;  3FWN A;  1ZP0 C;  1PPJ G;  5KAF E;  1L4A C;  2PGD A;  2NRG A;  4B86 A;  4MN4 C;  4EYY Q;  1H8A A;  1K8A Q;  3EFF K;  3CCV P;  1VQ6 P;  1URQ D;  1VQ5 P;  1LT9 A;  3S1K A;  4PV1 B;  2KI7 B;  1VQK P;  3P7K A;  2ZVN B;  1SQB J;  1OX3 A;  3WUT A;  1NYH A;  2B87 A;  1Q90 D;  2D2C C;  2XNX A;  1BCC D;  1PGJ A;  3RL0 D;  1LGH B;  5CCH A;  1OMI A;  4JYB A;  1AVO A;  2WSE J;  2OYH C;  1KYO D;  1FU1 A;  2FYN C;  2QM8 A;  3EWK A;  4D6T J;  1N7S C;  1PP9 J;  1FZF A;  2XU6 A;  1EDK A;  1QEX A;  2HLO A;  1HBW A;  3Q3D A;  1SQX E;  4GIF A;  2Z5I A;  4HYT B;  2YNY A;  3E1I A;  1J1D C;  1KOR A;  1FDI A;  2IDB A;  5AVV B;  3VN0 A;  4HH2 A;  1AQT A;  1FE6 A;  1J1E B;  1LTI C;  1PGQ A;  1SQP D;  2YMK A;  3IN6 A;  1NTZ E;  1JB0 J;  1KB9 E;  3ABV C;  1S5L H;  4PV1 D;  4DOJ A;  3CX5 H;  3PHL A;  5B66 E;  1RE3 C;  3TGU D;  4HKZ H;  1WMK A;  1NTM K;  2E74 C;  1RE4 C;  1BDD A;  3L75 G;  3G9R A;  4JQ0 D;  1KYO E;  1USE A;  3CX5 E;  4YXD C;  1SFC C;  2R3C A;  3H25 A;  4LGD E;  1EDL A;  3WU2 E;  2XND H;  4H0L B;  1ZRT E;  1YIJ P;  2OYH A;  3CC4 P;  1K04 A;  1M8O B;  2OTJ P;  4I6M C;  1XTC C;  1EZV E;  1G2C A;  3E1R A;  1BCC E;  1GL2 A;  1SQX D;  5CJ4 A;  1FS0 E;  1RF1 C;  3PJS K;  5AVT B;  3EQ2 A;  3H1K J;  1VQN P;  2N1T A;  3B5N C;  1BCC G;  1SQV D;  3BRV B;  1NTZ J;  4NPE A;  1SS1 A;  1BSN A;  2V7Q H;  1R5S A;  3PH0 A;  2R44 A;  1BDC A;  2Y0E A;  5CJ0 A;  3H32 A;  1JY3 O;  1QX8 A;  2E75 D;  1L0N D;  3H1I E;  2ITA A;  2KK7 A;  1LTJ C;  1NH4 A;  2BCC D;  3ITK A;  3M0A A;  5APU A;  3HRN A;  5CCG A;  2OYH B;  1GW4 A;  1RE3 A;  1LTS C;  1KIL A;  2ZT9 B;  2M3B A;  2CPB A;  1SP4 A;  1IFI A;  1U57 A;  1ZRT D;  3H1I G;  5CCG D;  3CME P;  1LWU C;  1KTM A;  3CD6 P;  3I56 P;  1D7M A;  2JP3 A;  3BCC E;  4OGQ C;  1EZV G;  2IZ1 A;  3RK3 D;  1GK4 A;  2M8R A;  2E76 C;  2IZ0 A;  3RK2 D;  3VMA A;  1FZB A;  2FYU K;  1EXI A;  4PD4 H;  2AEJ A;  3HD7 C;  2HOD B;  3L74 D;  5AVY B;  1Z56 A;  3L70 J;  3TDK A;  1J1E C;  3HD7 D;  3H32 B;  1BE3 G;  3CWB G;  1XTG B;  1VQP P;  3L72 D;  3RK2 C;  3D6Z A;  2J58 A;  2WPS A;  4UB6 H;  2FXO A;  4W7Z A;  3FGA D;  4RES B;  1BGY D;  5AVR B;  1GTW A;  3W67 A;  2W6J H;  2WPQ A;  4R4L A;  1L0L K;  3CWB E;  3HUS A;  1G1J A;  2E5Y A;  2O01 N;  4PV1 C;  1IFD A;  3FXD A;  2WSF J;  1YBK A;  1YI2 P;  2QE7 H;  2IYO A;  3BCC J;  2KSE A;  1VQM P;  2Y0D A;  2GM4 A;  3CCL P;  5TJH A;  3Q1M A;  1SQP J;  4IL6 H;  4WY4 A;  1X79 B;  1K05 A;  1PPJ E;  1KMI Z;  1N7L A;  1MUU A;  2Z5H A;  4IL6 E;  2KSJ A;  3I55 P;  3HUS B;  1KQS O;  3O6Q B;  4EOT A;  2FYU G;  5BU8 B;  5M1B A;  1M90 Q;  3P32 A;  4D6T D;  1ZOY C;  3RBX A;  3CC7 P;  2ZT9 C;  2E74 D;  3II6 A;  2H89 C;  1IFJ A;  1S4X A;  1VF5 C;  1T3J A;  1KQF B;  3TNU B;  4UB8 E;  3C9I A;  3CMA P;  2RKL A;  3AEG C;  1GL2 B;  2OTL P;  3VMY A;  4PD4 E;  3MIW A;  3VOP A;  1RQU A;  3C1L A;  4C46 A;  2LXB A;  1ZV8 A;  2K9J B;  2QRX A;  4JPZ B;  1R8E A;  2N1T B;  1SQV K;  1L0N K;  5CHX A;  4TT3 H;  1NGM B;  3AED C;  2H8P D;  4GOF A;  4UB6 E;  5KLV E;  3CCE P;  3TK1 A;  1PGP A;  4Y99 C;  2YIU C;  4GDO A;  1QVF O;  1AFO A;  2BAS A;  1JY2 O;  1SQQ K;  2CPS A;  5AW2 B;  2L91 A;  1HF9 A;  2WSE H;  1CZQ A;  1KB9 H;  1S5L E;  1NAF A;  1NTZ G;  1SQQ G;  1BE3 E;  2ZAE B;  5APT A;  2XKM A;  3V2N A;  3C8V A;  1SQB G;  2HPC B;  2IBZ G;  1EZV I;  3AE2 C;  3L71 D;  4DZO A;  3L75 E;  3V4Q A;  1NJI Q;  3R2P A;  5AVU B;  3L71 G;  4IFM A;  3CCM P;  2IFN A;  3RBZ A;  4IL6 X;  1LT1 A;  2LXC B;  3AEE C;  3MZW B;  2HPC A;  2Q6Q A;  4WVZ A;  4W80 A;  1JY3 P;  3HE4 B;  2N9Y B;  1FZA A;  3WU2 H;  3GW6 A;  1J2J B;  5AVQ B;  2O01 H;  4YXW H;  4R4M A;  3WUV A;  3H1J D;  3CCU P;  3A2A A;  4Z1M H;  1LT9 C;  1QL1 A;  3L73 J;  2ZJS E;  2OYO A;  1SQQ E;  4K3A A;  3VP8 A;  1NAY A;  2FY8 A;  2OTK E;  3AEC C;  1KIL D;  3L37 A;  5E79 H;  2R32 A;  4Y28 J;  1SFC D;  1IC2 A;  1VF5 B;  2A45 G;  2I1J A;  2PFX A;  3M9B A;  3MUD C;  5KJ7 C;  3HE5 B;  5KKZ C;  1IZN B;  1M1J B;  2FYU E;  5E79 E;  5AW9 B;  2P67 A;  3SFE C;  1T2K D;  1VQL P;  2A06 G;  5KLI B;  3K5B A;  2W6B A;  4UB8 H;  3D71 A;  3MHV A;  3V5B A;  1RQV A;  3PRJ A;  1MFT A;  1IFN A;  2FYN B;  2VRS A;  1ZLL A;  3L35 A;  5BU5 A;  1A02 F;  4AUW A;  1N7S B;  1FZE A;  5KTB A;  4LLH A;  4YTP C;  1EQ7 A;  3HTK A;  4ZNC A;  3O6Q A;  2YO3 A;  3G3Z A;  2J59 M;  5GTH H;  3NXS A;  1NTM G;  3Q5P A;  1J1D B;  1BSH A;  4EDF A;  3TYY A;  2JO1 A;  4IFF A;  2O3J A;  3P8M C;  2HR3 A;  3AE9 C;  3HE5 A;  1FZG A;  3H1H G;  4NPF X;  4PD4 I;  3SWF A;  2E75 C;  2KUB A;  1K9M Q;  3OAK A;  2M5A B;  3S4R A;  5CMZ A;  1AJY A;  2ZYG A;  2H43 A;  1JTH A;  1M56 D;  2FBW C;  3CLQ A;  3LID A;  3GMA A;  4JBZ A;  3M06 A;  1T3U A;  1HGV A;  4M3L A;  1SQB E;  2KP8 A;  1GK6 A;  4H0L C;  1PPJ D;  1URQ C;  1KB9 D;  1NTK J;  1RH5 B;  3OJA B;  1W2B O;  1IFP A;  2AXT E;  2IYP A;  2FXP A;  2R3S A;  1WT6 A;  3CXH D;  3H6P A;  2N1T C;  2Q7C A;  3JC2 2;  1LNQ A;  3NFQ A;  3H1H D;  1S3J A;  1JCD A;  3B5N B;  1N73 C;  1NU1 J;  1NU1 D;  1MV8 A;  2BCC J;  3CPW O;  4JF7 A;  4Y99 B;  2YIU B;  2FFD A;  3E7K A;  3AE3 C;  1SLQ A;  1W2E A;  2RH0 A;  1VQ9 P;  5AW4 B;  2L5G B;  1LTJ B;  4ZKU A;  1KIL C;  4KJM A;  3SWY A;  4EIJ A;  1URQ A;  1ZW0 A;  2Y9Y A;  2QSI A;  3PTZ A;  4L76 A;  1Q86 Q;  1OZH A;  2WIT A;  5AW0 B;  1QLE D;  2K9Y A;  2RMZ A;  4OGQ B;  1KYO I;  5GTH E;  1KB9 I;  3KQG A;  1T2K C;  3CC2 P;  3CCS P;  4JYC A;  1KQL A;  2G3A A;  1ZR4 A;  2JWD A;  2M3E A;  3B5N A;  1PFI A;  3M0D A;  3LW5 H;  3H1L J;  3U1A A;  1FOS E;  2NPS A;  1JO5 A;  2QJY C;  1Y9B A;  2K88 A;  4IFD K;  5KLV D;  1P84 I;  1BCC J;  3AEA C;  1N73 A;  2I8D A;  4U3F D;  5AW8 B;  3L74 J;  4I7Z B;  2QA4 P;  5B66 H;  3CXH E;  2KS1 A;  3AE6 C;  3G71 P;  1U7J A;  2FYU J;  2YMY A;  4KHX A;  3H1H E;  3N7N A;  3U1C A;  2A06 E;  1N7S A;  3HD7 A;  3UIA A;  2R5B A;  2FXM A;  1OVR A;  2OYI A;  5L8R J;  2Q9I A;  1NTK K;  5APS A;  2WSC J;  3RL0 g;  3SFD C;  3L71 E;  2W83 C;  1X0T A;  3L70 D;  1KV4 A;  5KLI C;  3QWO C;  5TIS H;  1JNM A;  2O1J A;  1L0L J;  1GZL A;  1X22 A;  2MJZ A;  5APY A;  1HJB A;  1H0T B;  1JMM A;  3H1L E;  2QEX P;  2LR2 A;  4DCK A;  2UWJ E;  2POH A;  1NTZ D;  1W5C E;  3TGU G;  1SFC A;  2W6A A;  1FZC B;  1EXJ A;  2KS1 B;  3IFM A;  3I5C A;  2HG5 D;  3NTN A;  1GL2 D;  2P7J A;  2JR8 A;  1SQX J;  2C9L Y;  1E5W A;  1M1K Q;  1KFM A;  2A45 H;  1P84 H;  1QVG O;  4WY4 D;  2B87 B;  2WQY C;  2KNC B;  1Q7Y Q;  3B71 A;  3EFG A;  4C7N B;  2E75 B;  2AEF A;  1RF1 A;  1GL2 C;  4WWI A;  1FDM A;  2O01 J;  2WTY A;  1FC2 C;  1NTK E;  1DEE G;  4IOI H;  1RF1 B;  3L71 J;  3P8C D;  2W27 A;  4W7Y A;  2KZI A;  1A02 J;  1KD1 Q;  4ZMD A;  1R5L A;  1JM0 A;  1FJK A;  1SFC B;  3AE7 C;  1AA0 A;  3H1L D;  3NMD A;  2YXQ B;  5APV A;  1OW7 A;  4H13 B;  4AYC A;  2P58 A;  4AQR D;  3L73 E;  3SWK A;  1YJW P;  1GD2 E;  3Q5R A;  4I7Z C;  1YTZ T;  1JOC A;  1RF0 C;  5CCG C;  5B5E H;  3H1I D;  1YHQ P;  4D6T E;  3RGU A;  2M0B A;  3S9O A;  2KNC A;  1VPC A;  1T6A A;  1N7S D;  2JEE A;  4H44 D;  4YPC A;  1OW8 A;  4C7N A;  1SQV E;  2HOD A;  3GG2 A;  1H89 A;  1IK9 A;  2JDI H;  1VL2 A;  2V4H A;  3BAT A;  4DT0 A;  1S5L X;  1SQP K;  2YKQ A;  4L73 A;  2P1J A;  2D2C B;  3L75 D;  5KLV K;  1SQV G;  3Q5S A;  1N86 A;  1U7M A;  2V7Q J;  3ZDM A;  3RL0 B;  3T97 B;  1OXZ A;  1JY3 N;  1PV3 A;  2QJK C;  1YIT P;  1X8Y A;  1NTM D;  1LTB C;  1SQB D;  2Q5U A;  2SPZ A;  3R4Y A;  4N3Y B;  4BRY B;  3F89 A;  3TF5 A;  3GHG A;  2K1A A;  1NVO A;  1FZC C;  1KQG B;  3CL3 D;  1GDT A;  1Q2N A;  2QVA A;  2P10 A;  4I2L C;  1NTK D;  3L72 J;  3N4X A;  1GU4 A;  1LT9 B;  2Q3I A;  2PRR A;  3LW5 J;  4OVN F;  1SQX K;  1OIP A;  3HD7 B;  5TIS E;  3VMX A;  1KIL E;  5AVX B;  3TGU J;  2OQQ A;  2OYI B;  5KJ7 A;  2E5T A;  1IO4 A;  4XA4 A; 
#chains in the Genus database with same CATH homology
 1ZR2 A;  4C7R A;  3L4F A;  2I1K A;  1NTZ K;  3T97 A;  1DH3 A;  2WPR A;  3U59 A;  3B5N D;  3BRT B;  4ZKP A;  1S9K E;  2QM7 A;  5AW1 B;  2NPS D;  1MFZ A;  4O9B A;  2FKW B;  5AVS B;  1CSB A;  4N78 E;  1QL2 A;  1MZ9 A;  2XDJ A;  1RE4 A;  1M7L A;  1ZN5 A;  2Z4E A;  3RL0 C;  2JJL A;  2ZXE B;  4GKG A;  2XZR A;  3CI9 A;  3KPE A;  4WY4 B;  2GUV A;  3B8E B;  1SQB K;  2GUS A;  5CCH D;  3P8C E;  1KIL B;  2IX7 C;  3V4W A;  2WSF H;  2P2U A;  3GHG B;  1IJD B;  2O1K A;  1VDF A;  2XV5 A;  4XE5 B;  2KB7 P;  3RK3 B;  1M1J A;  2OAR A;  2LKM A;  2YO2 A;  3O8Z A;  3L36 A;  3KDP B;  2IPP A;  1HVV A;  1KZU B;  4N6J A;  3HUS C;  2ZFC A;  2KOG A;  3V2R A;  3VTP C;  1JUN A;  3M0D C;  2OYI C;  3VMZ A;  1KFN A;  1M1J C;  3A3Y B;  2KYV A;  1NWQ A;  5AW7 B;  2C0X A;  4WY4 C;  2WT7 B;  3TSI A;  2N1T D;  3WMM 0;  1IFM A;  1FOS F;  3M9Q A;  2IFM A;  2HYN A;  1LWU A;  3HE4 A;  2WWW A;  1HUC A;  1L4A A;  1NKN A;  2C9N Y;  3TNU A;  3A5T A;  1LTG C;  1NHL A;  1FJP A;  1YTZ I;  1FBM A;  2E43 A;  2WT7 A;  3M9H A;  2FFD B;  5CCH C;  1URQ B;  1LWU B;  1T8Z A;  1N2D C;  2H7H A;  4N78 D;  1DEB A;  2YKO A;  1L4A B;  2PP6 A;  1SVF A;  4WB4 A;  2KLV A;  1HGZ A;  2NPS C;  3BAS A;  3IR9 A;  3RK2 B;  3MGN A;  5APQ A;  5AVZ B;  1DX7 A;  1CW5 A;  1X9V A;  3GHG C;  1JTH B;  1OWA A;  1RF0 A;  3MD0 A;  3MTU E;  4LC1 A;  2E42 A;  1LTT C;  3RK3 C;  1GW3 A;  3A7O A;  3PP5 A;  1L4A D;  3VYI A;  1JCC A;  4I1L A;  3BVH A;  2FYZ A;  1YYC A;  1NU1 K;  1G1I A;  1LTJ A;  5KJ7 D;  1JY2 P;  3HTK B;  1NO4 A;  5APW A;  3LIE A;  3V2Q A;  1RF1 B;  2HFE D;  2PAJ A;  2R5D A;  1WRG A;  1CI6 B;  4GT1 A;  3VP9 A;  2WZ7 A;  2WSC H;  1N73 B;  4OH8 B;  5AVW B;  3OA7 A;  2YKP A;  1HTL C;  4WBA A;  2NPS B;  1NOH A;  2N9B A;  1HH0 A;  1G2C B;  2C0W A;  1FAV A;  5BVZ A;  3V2P A;  1LTA C;  1NKZ B;  1HWT C;  1CI6 A;  1RY3 A;  2FFD C;  1GU5 A;  1JY2 N;  5AW3 B;  1AQ5 A;  5AW5 B;  5AW6 B;  3MUD A;  5APX A;  2A45 I;  3M91 A;  3KYQ A;  1L4A C;  4B86 A;  1URQ D;  1LT9 A;  3P7K A;  3RL0 D;  2XNX A;  5CCH A;  1LGH B;  4JYB A;  2OYH C;  1FU1 A;  2QM8 A;  1N7S C;  1FZF A;  2XU6 A;  2HLO A;  1HBW A;  4GIF A;  2Z5I A;  4HYT B;  2YNY A;  3E1I A;  1J1D C;  5AVV B;  3VN0 A;  4HH2 A;  1J1E B;  1LTI C;  4DOJ A;  1RE3 C;  1NTM K;  1RE4 C;  1SFC C;  2R3C A;  4LGD E;  2OYH A;  4I6M C;  1XTC C;  1G2C A;  1RF1 C;  1GL2 A;  5CJ4 A;  5AVT B;  3EQ2 A;  2N1T A;  3B5N C;  3BRV B;  5CJ0 A;  3H32 A;  1JY3 O;  3M0A A;  5CCG A;  1LTJ C;  1NH4 A;  5APU A;  3HRN A;  2OYH B;  1GW4 A;  1RE3 A;  1LTS C;  1KIL A;  3OJA B;  2M3B A;  2CPB A;  1SP4 A;  1IFI A;  1LWU C;  3RK3 D;  1GK4 A;  2M8R A;  3RK2 D;  1FZB A;  2FYU K;  3HD7 C;  2HOD B;  5AVY B;  1Z56 A;  1J1E C;  3HD7 D;  3H32 B;  1XTG B;  3RK2 C;  2J58 A;  2WPS A;  4W7Z A;  5AVR B;  4RES B;  1GTW A;  2WPQ A;  1L0L K;  3HUS A;  1G1J A;  1IFD A;  2GM4 A;  4WY4 A;  1X79 B;  1N7L A;  1MUU A;  2Z5H A;  2KSJ A;  3HUS B;  4EOT A;  5BU8 B;  3P32 A;  3II6 A;  1IFJ A;  1T3J A;  3TNU B;  3C9I A;  1GL2 B;  3VMY A;  4C46 A;  3MIW A;  3VOP A;  1H8A A;  2HPC A;  1ZV8 A;  2N1T B;  1SQV K;  1L0N K;  5CHX A;  2H8P D;  3TK1 A;  4Y99 C;  1AFO A;  2BAS A;  1JY2 O;  1SQQ K;  2CPS A;  5AW2 B;  2WSE H;  1CZQ A;  1NAF A;  5APT A;  2XKM A;  3V2N A;  2HPC B;  4DZO A;  3V4Q A;  3R2P A;  5AVU B;  4IFM A;  2IFN A;  4W80 A;  1JY3 P;  3HE4 B;  1FZA A;  1J2J B;  5AVQ B;  2O01 H;  3A2A A;  5CCG D;  1LT9 C;  1QL1 A;  3VP8 A;  3L37 A;  1KIL D;  2R32 A;  1SFC D;  1IC2 A;  2A45 G;  2I1J A;  3M9B A;  5KJ7 C;  3HE5 B;  1M1J B;  5AW9 B;  2P67 A;  1T2K D;  2W6B A;  3V5B A;  2VRS A;  1IFN A;  5BU5 A;  1ZLL A;  3L35 A;  4AUW A;  1N7S B;  1FZE A;  5KTB A;  4LLH A;  1EQ7 A;  3HTK A;  2YO3 A;  3G3Z A;  2J59 M;  3NXS A;  1J1D B;  3TYY A;  4IFF A;  3P8M C;  3HE5 A;  1FZG A;  3SWF A;  3OAK A;  5CMZ A;  2H43 A;  1JTH A;  3LID A;  3CLQ A;  3M06 A;  1T3U A;  1HGV A;  4M3L A;  2KP8 A;  1GK6 A;  1URQ C;  1WT6 A;  3H6P A;  2N1T C;  2Q7C A;  3NFQ A;  1JCD A;  1N73 C;  3B5N B;  1MV8 A;  4JF7 A;  4Y99 B;  2FFD A;  1SLQ A;  1W2E A;  5AW4 B;  2L5G B;  1LTJ B;  4ZKU A;  1KIL C;  3SWY A;  4EIJ A;  1URQ A;  2WIT A;  5AW0 B;  1H88 A;  1T2K C;  3KQG A;  4JYC A;  1KQL A;  1ZR4 A;  1PFI A;  3B5N A;  3M0D A;  3LW5 H;  3U1A A;  1FOS E;  2NPS A;  1JO5 A;  4IFD K;  1N73 A;  5AW8 B;  2YMY A;  4KHX A;  3N7N A;  3U1C A;  1N7S A;  3HD7 A;  3UIA A;  2R5B A;  2FXM A;  2OYI A;  2Q9I A;  1NTK K;  5APS A;  1JNM A;  1HJB A;  2O1J A;  1GZL A;  2MJZ A;  5APY A;  1JMM A;  2POH A;  1SFC A;  2W6A A;  1FZC B;  3IFM A;  3I5C A;  2HG5 D;  3NTN A;  1GL2 D;  2P7J A;  2C9L Y;  1E5W A;  1KFM A;  2A45 H;  4WY4 D;  3EFG A;  4C7N B;  1RF1 A;  1GL2 C;  1FDM A;  2WTY A;  4W7Y A;  3P8C D;  2W27 A;  1A02 J;  1SFC B;  1FJK A;  5CCG C;  5APV A;  4AYC A;  4AQR D;  3NMD A;  1FZC A;  1A02 F;  1GD2 E;  1YTZ T;  1JOC A;  1RF0 C;  1VPC A;  1N7S D;  2JEE A;  4C7N A;  1H89 A;  2HOD A;  1IK9 A;  3BAT A;  1SQP K;  5KLV K;  2YKQ A;  2P1J A;  1N86 A;  3RL0 B;  1OXZ A;  1JY3 N;  1X8Y A;  1S9K D;  1LTB C;  2Q5U A;  4N3Y B;  3GHG A;  1FZC C;  3CL3 D;  1GDT A;  4I2L C;  3N4X A;  1GU4 A;  1LT9 B;  2Q3I A;  1SQX K;  3HD7 B;  3VMX A;  5AVX B;  2OYI B;  1IO4 A;  5KJ7 A;  4XA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...