1U7MA

Solution structure of a diiron protein model: due ferri(ii) turn mutant
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
MDYLRELYKLEQQAMKLYREASEKARNPEKKSVLQKILEDEEKHIEWLETING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Four-helix bundle model
publication title Analysis and Design of Turns in alpha-Helical Hairpins
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 17
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1u7mA00
2B89A 2M5AA 4HKZH 2M5AB 2QRXA 1EDJA 1MFTA 4ZMDA 2R44A 1SS1A 1OVVA 4NPEA 1Q2NA 2ZAEB 3MZWB 1DEEG 2HR3A 1JM0A 2KZIA 2WMMA 2KIKA 1OVUA 4WWIA 2M0BA 1BDCA 5DJTB 2K3RA 1ZW0A 3FXEA 2RKLA 3ZDMA 1BDDA 2QVAA 4ZNCA 2KS1B 4BXLA 4IOIH 2UWJE 5DJUB 4KJMA 4JBZA 4HJGH 2Q1KA 3PH0A 4ASWA 4EYYQ 4NPFX 2B87A 5K5GB 2LR2A 3QWOC 1JMBA 2B87B 1FC2C 2LXCB 2SPZA 5CBNA 2KZJA 3RGUA 2LXBA 4HB1A 4CPGA 1LT1A 1NVOA 1OVRA 3FXDA 3MHVA 4GODA 4K3AA 5CBOA 4NPDA 1H0TA 1H0TB 2KUBA 2B88A 2I8DA 1X0TA 1EDKA 2KI7B 4GOFA 1Y47A 1S3JA 2OTKE 4GOEA 4MN4C 2JWDA 1EC5A 5C39A 2P58A 4K35A 1ZXGA 1EDLA 3S1KA 1LP1A 1LP1B 1U7JA 4ASVA 1EDIA 1U7MA 5EFWB
chains in the Genus database with same CATH superfamily
3CD6P 1KYOH 4LLHA 3TF5A 3CCQP 1G2CA 4HKZH 1BCCG 1KQFB 4H0LC 5AVTB 4ZMDA 4WB4A 4AUWA 1SQQK 4WY4D 1U57A 2C0XA 1ZOYC 2H43A 2E42A 3EFFK 2O01H 3LW5J 1G1JA 1BSNA 2FKWB 1IO4A 1ZN5A 3FXEA 3MIWA 4UB6E 1A02J 4H13C 1L2PA 1LJ2A 4L75A 5H2FE 3T97B 2B9BA 1FZCA 4KT0J 1JB0J 2A45H 1S5LH 4LGDE 3KHUA 3HE4A 2QA4P 1KYOD 3OW2O 4I7ZC 1T6AA 2XU6A 2R5BA 3PTZA 4CPGA 1RE4C 1Q82Q 1NTMJ 2XV5A 1USDA 1KB9D 3BCCD 3L36A 3VP9A 1PPJD 1ZRTD 2P2UA 1EDKA 1NOHA 1KILD 2D2CB 3TGUJ 1Y47A 2OYIC 1VL2A 5AW2B 5AVUB 3L70D 4N3YB 1KB9E 2JWDA 3V2RA 2P58A 1PPJE 3KXDA 1JMMA 3L70E 5APVA 1EZVD 2E75B 4YXDC 1HTLC 2QEXP 3V4QA 1OZHA 3M0DC 1YI2P 1EZVE 1AA0A 1DEEG 2FFDB 5AW0B 3MP7B 2YIUB 3AE1C 5CCHA 3GW6A 5AVZB 1GL2B 1FDOA 2PFXA 4ZNCA 1SFCB 1PIXA 1RQVA 1T3JA 1VQ6P 5TISE 4A7PA 2I1KA 1FZBA 4HJGH 1J1DB 1QGKB 2Q1KA 2KLUA 3A2AA 5CBNA 1MFZA 3RK3D 2A06D 1SQBD 3P7KA 3BCCJ 3SWYA 2N1TA 2JWAA 1NTKJ 5CHXA 2KUBA 4H44B 1WMKA 3CXHH 1BSHA 3OA7A 1M90Q 3B5NB 1SQBE 1DD4A 3L70J 4GOFA 1S4XA 4MN4C 2P67A 2G8YA 4WY4B 5C39A 5KLVG 3F5HA 3D6YA 3M9QA 1L0LG 1LP1B 1YBKA 5BU8B 2Y0EA 3A0HH 3EQ2A 1M1KQ 2KOGA 3S9OA 5KLVK 1EXJA 1HUCA 4C7NA 5GTIH 1L0LK 3VP8A 4R4LA 1N2DC 2ZAEB 1JCCA 2WMMA 1LTTC 2K3RA 3FWLA 2PGDA 3M06A 1GW4A 1A02F 1DIPA 1BDDA 4Y99B 3PHLA 1SQXG 2ZFCA 2ZXXA 1KQGB 1LT9A 1N8RQ 1S72P 3C8VA 1BGYE 3PH0A 1H88A 1MZ9A 3AEBC 5B5EE 1SQXK 2IBZG 2ZT9B 2H89C 1VQLP 2N9BA 1RF1A 2NPSA 3L75D 1URQA 3H1LD 1OW7A 2WTYA 3U1AA 1Q86Q 1W5CE 1H0TB 1LTIC 3AE5C 1M7LA 3L74D 5L8RJ 3L75E 2QG4A 3H1LE 2L5GB 3CPWO 1EQ7A 3NXSA 4GOEA 1BE3J 4PD4I 1EXIA 5AW6B 3L74E 4LC1A 5CCGD 1L0ND 1JNMA 4EIJA 3WU2H 2YXRB 2E74D 3WUUA 1L0NE 1LWUA 5KKZB 3CMEP 2XZRA 4AQRD 3MUDA 3A0BE 5GTHE 2BCCD 2HYNA 1RF0A 2G3AA 1YITP 1YQ4C 3A3YB 2WPRA 5APXA 1FBMA 2W90A 2PAJA 3HE5B 1KN7A 5KTBA 2OTJP 4HH2A 4IL6E 3AEAC 1RH5B 2ZXEB 3RL0D 4NPFX 3H1JG 2B87B 3L75J 1Q7YQ 1E5WA 2WSEH 3H1LJ 2LXBA 3H1KE 1IFIA 2NRGA 3MHVA 1GU4A 1VF5B 4L73A 2Q6QA 2N1TD 3A5TA 1N7SD 2I1JA 2WSCH 1IC2A 2JP3A 1LNQA 2M3BA 1R8EA 1JTHB 1AFOA 2YMYA 3H1ID 1QVFO 4PJ0H 1USEA 2OYHB 3C9IA 1AJYA 1NWQA 1GU5A 3HD7D 1P84E 1HJ0A 2W6JH 2IYOA 1KORA 1M57D 2R44A 1DEBA 1RE4A 2BCCJ 1OVVA 4EOTA 2WWWA 2QJPC 2HODA 3BVHA 1LT9C 2QSIA 4JYBA 2P10A 4PD4H 1Z56A 2ZYAA 1M8OB 1LTBC 2JR8A 2D2CC 4PV1D 2KS1A 2OYIA 5APQA 1CW5A 2QJKB 4Z1MH 2E76B 2CPBA 1PGPA 1MUUA 3L72J 5AVVB 1PPJG 1RHZB 2QE7H 1VQ7P 2E75C 3GMAA 2HFED 3CCVP 2M3EA 2NPSD 3IFMA 2LKMA 1URQD 3M0DA 1WRGA 1M1JA 5B66H 2FFDC 5BU5A 4DCKA 4IFDK 2YIUC 4PD4D 1EZVG 4IFFA 4DZOA 2DW3A 1S9KD 4OGQD 3R4YA 1GL2C 1QEXA 1S9KE 3H1IJ 3S1KA 3GG2A 2AEFA 3AEEC 2B89A 4U7JA 2M5AA 2WSEJ 2QRXA 2ZYGA 3TGUD 1NTME 1FJPA 3G6EP 1JM0A 4H44C 2KIKA 4GIFA 2QJYB 3RL0B 3B5NC 3TGUE 2W6AA 2WSCJ 2FBWC 3HUSB 2RKLA 3PP5A 5AVRB 2WPVB 4WY4C 1SQBG 2UWJE 3JCUE 2JKVA 2Q5UA 3ITKA 3VMXA 3P8CD 5AW5B 1TU3F 1J2JB 2FYUJ 1SQBK 1N7SB 1SQPD 5CMZA 3HTKA 1NU1J 1MKMA 3P8CE 4O9BA 1NJIQ 2W6BA 4XA4A 3CXHI 1SQPE 3KPEA 4UB8E 2K9JB 4EI2A 4DJGA 1YIJP 4W80A 2AXTE 3HD7B 3LIDA 2KNCA 3C1LA 1GD2E 1QX8A 3VMAA 3KZIE 2CPSA 3AE3C 3PRJA 1JOCA 3B4SA 4H13D 3V6IA 2Q9IA 1U7JA 1KYOE 3I55P 1BGYG 2GA1A 4PV1B 1NTKD 2ZT9C 3WUVA 1FU1A 1SQVD 2YXQB 3GHGB 4D6TD 2P1JA 1MFTA 3BCCE 2FYZA 1NTKE 1ZRTE 1PP9D 1X8YA 1KILE 3H1HD 4RO0A 2M8RA 1BDCA 4XFJA 2OYOA 3L71G 2ITAA 4M3LA 1GK6A 2QVAA 1PP9E 3TDKA 4BXLA 4I6MC 2HPCA 3PJSK 3NMDA 1NTZD 3TNUB 1JO5A 1FDIA 1M1JC 3G71P 1OW8A 2FXPA 1S5LE 3L74G 5AVYB 1SQPJ 1R5LA 4OGQB 1HGVA 3QH9A 4BRYA 1CSBA 5KKZC 2IZ0A 2FXMA 1LTJB 3H32A 1L0NG 4GDOA 5CBOA 5AVSB 3JSVC 4KHXA 5AW1B 1KTMA 1GMJA 1LTSC 5KAFH 1L0NK 1FAVA 2W27A 2XNXA 3V2PA 4N6JA 1QL2A 2WT7A 1N86A 3TSIA 3A7OA 2O01J 1YHQP 5EFWB 2BASA 3E1IA 3RK3E 1SQVJ 1L4AB 2A06E 1OMIA 2Y0DA 4D6TJ 1DD3A 5TJHA 2JJLA 3FX0A 2AEMA 3OAKA 1N73B 2H8PD 1PP9J 4NPEA 4RKUJ 1BE3D 1Q2NA 3H1HJ 1VF5C 3VN0A 3MZWB 3H1KG 4C46A 2H88C 4EDFA 3M9HA 1OVUA 4WWIA 1KFNA 5DJTB 1FOSE 3AE7C 1BE3E 2IDBA 1NTZJ 1SLQA 3SFDC 2K37A 2V4HA 3CMAP 3IN6A 2Q7CA 3CL3D 4ZKPA 3T97A 4TT3H 1FZFA 1KZUB 3TYYA 3CXHD 1PGQA 1SP4A 1VQ9P 2PP6A 4I2LC 3CXHE 2IBZI 4K3AA 4W7ZA 4NPDA 1IFMA 1XTGB 3L73J 1CI6B 2YKQA 3O6QB 3RBXA 5KLIC 2KXPB 1X0TA 1KILB 4W7YA 1GW3A 5KAIH 3KYQA 3AEDC 1NGMB 4C7RA 3CWBD 3CCRP 2E76C 3A0HE 4XE5B 2POHA 3CLQA 3W68A 2E5YA 1U7MA 3RBZA 5GTIE 4B86A 3CWBE 1BCCJ 1OX3A 1OW6A 1MV8A 4L74A 5CCGC 1SS1A 1YJWP 1NH4A 2FFDA 3AEGC 1HGZA 1OXZA 4IL6X 3O8ZA 3GF7A 1IFDA 2M0BA 2XNDH 1R5SA 2OQQA 1GL2A 2IFMA 1SFCA 2HLOA 4IOIH 3V4WA 5KJ7C 2JEEA 2BEQD 2QIWA 3CX5H 1KV4A 2IFNA 1GZLA 3GF3A 3MD0A 1IZNB 2LR2A 2SPZA 4RJTA 2P7JA 4OVNF 3RK3B 2BCCE 5CCHD 1ZR2A 1NTMG 3RL0C 1VDFA 2B88A 1VQ8P 3B5NA 5AW8B 1K05A 1KC8Q 5APYA 2OTLP 1LGHB 3L72D 3HUSC 3E1RA 1S3JA 3TGUG 1CZQA 2IX7C 3CWBJ 4WY4A 1NTMK 1EC5A 1ZP0C 1NKZB 2Z4EA 3L72E 1LP1A 4BWNA 3V2NA 1JUNA 2R32A 3GLMA 2Q3EA 3WU2E 4JQ0D 2HG5D 5APWA 2JO1A 1G2CB 2V7QH 3D70A 5CJ4A 3Q1MA 1PGOA 1KQSO 2QM7A 5AW4B 3D71A 1N7LA 4GT1A 1SQPG 3I5CA 3HD7C 1OIPA 1VQKP 1ZLLA 2WSFH 5DJUB 3H1IE 3PLNA 1SQXD 4KJMA 1SQPK 5AW9B 1CI6A 3R2PA 2MJZA 5AVWB 4EYYQ 2YKOA 1FZCB 1QLED 3WMM0 3QWOC 2Y0CA 3AE4C 1K8AQ 1OFCX 2IBZD 3HE4B 3S4RA 3GHGC 3VOPA 1NHLA 3RGUA 1YQ3C 1S1CX 2K1AA 1OVRA 1FE6A 3BCCG 2R3CA 1H0TA 2ZYDA 3L4FA 4YTPC 3IAOA 1NTKG 1FS0E 2FYNB 1IFNA 3F89A 4U3FD 2FYUD 2D2CD 3L70G 5E79H 3AEFC 3VMYA 1NU1D 4RESB 1PP9G 1NTKK 4PJ0E 4K35A 1L0LJ 4OH8B 1SQVK 4U3FE 2FYUE 4DOJA 4ASVA 4OGQC 1EDIA 1FOSF 1NU1E 2A45G 2J58A 1KD1Q 2E74B 1LTJC 1SFCC 1EDJA 3KQGA 4PD4E 1VQNP 1JEKA 1PGJA 4L76A 1J1DC 1HBWA 3BATA 3RK2D 2Y9YA 3LIEA 1LTGC 2YO2A 1NTZK 1ZW0A 5AVXB 1SQXJ 5AW3B 3HE5A 2VRSA 4I1LA 3L35A 1AVYA 1RY3A 2W8ZA 4UB6H 1L4AC 5H2FH 3VYIA 1ZMEC 5M1BA 2B87A 2O1JA 3H1JD 2V7QJ 2A06G 1N73C 4HYTB 3RL0g 5B66E 1T2KD 2YNYA 4WBAA 1NVOA 3B71A 1VQOP 2N1TB 4U3FJ 3V2QA 3B5ND 1IK7A 2OTKE 2WSFJ 2KB7P 2Y9ZA 1BE3G 4H0LD 1KB9H 1JTHA 3G4SP 2WVRA 1DX7A 1PV3A 2OYHA 1D7MA 3I56P 1Q90D 3CI9A 1ZR4A 4Y99C 4C7NB 1JY2P 5AVQB 2WITA 4R4MA 3CC2P 3IR9A 3FWNA 4JF7A 3G9RA 1S5LX 2NZ2A 2BEZF 1YTZI 3P8MC 1PFIA 1KILC 1RQUA 3L37A 1WT6A 1QL1A 5APUA 2E5TA 1VQMP 3K5BA 2QJPB 3Q2YA 1LT9B 1GTWA 3EWKA 5TISH 3SFEC 1SQVE 4ASWA 1X79B 3H1JJ 4D6TE 1FZGA 2ZVNB 2ZT9D 3L75G 1JY3N 2KZJA 3CWBG 1RF1B 2YMKA 3P32A 2K9YA 2NPSB 3H1HE 4HB1A 5CCGA 3H1LG 1URQB 1NAFA 2R5DA 4DT0A 5APTA 1DH3A 3CCLP 2KI7B 2C0WA 1KFMA 1NTZE 3Q5RA 1Q81Q 1HWTC 1OWAA 5KJ7A 1IFPA 1ZXGA 3Q3DA 1JY2O 2O1KA 1J1EB 3RK2B 3ABVC 2Q3IA 3L73D 3JC22 3CCMP 3RK3C 2WQYC 2KLVA 1T8ZA 1LWUB 3CCSP 3M9BA 3D6ZA 3H6PA 2BCCG 3L73E 2XKMA 2MKVA 1SQQD 1XTCC 2J59M 2R3SA 3HUSA 3CX5I 1X9VA 1YTZT 1BCCD 1IK9A 3SWFA 4GKGA 1SQQE 4JBZA 2KP8A 1AV1A 2YKPA 3L72G 1RE3C 1N7SA 1BCCE 3VTPC 2KK7A 5B5EH 3CCUP 1LT1A 4H0LB 1H89A 2Z5HA 2C9LY 3NFQA 1VF5D 2K9JA 1VQPP 2OYHC 4TLFA 5KAFE 2I8DA 1P84I 1YJ9P 3HD7A 2N9YB 2O3JA 3N7NA 1JCDA 2QM8A 2C9NY 1NKNA 3UIAA 4H13B 3H1IG 1K9MQ 1VQ5P 1KQLA 3KDPB 3TK1A 2KYVA 1FZCC 4YXWH 1BGYD 3CC7P 2AEJA 1YYCA 3GHGA 3U59A 2YO3A 4I7ZB 2QJKC 4IFMA 2HODB 1PL5A 1SQQJ 3A0BH 2FYNC 5GTHH 1FJKA 3E7KA 3L71D 1SQBJ 3BRVB 2KS1B 2OYIB 3HRNA 1S2EA 2AXCA 3TNUA 2PRRA 3WUTA 3V5BA 1KMIZ 2E76D 2W83C 2OARA 3L71E 1NYHA 1W2EA 3SWKA 3MGNA 4U3FG 4ZKUA 2FYUG 5K5GB 2E74C 1FC2C 1FDMA 2LXCB 4IL6H 1NU1G 1LTJA 3AECC 1JY2N 3EFGA 3USSA 2JDIH 3CCEP 1AVOA 2FYUK 3FXDA 1M1JB 2OGUA 2WSSH 5KAIE 3MTUE 1NU1K 3B8EB 5CCHC 2GUVA 1FZEA 1IFJA 5APSA 5KJ7D 1E79H 1VQ4P 1EDLA 3G3ZA 4JPZB 3M0AA 1LTAC 2QJYC 2WPSA 1BGYJ 1ZV8A 1L4AA 2K88A 2RMZA 1AQTA 2M5AB 1N73A 1HH0A 1P84H 1K04A 2ZJSE 5BVZA 5KLVD 3CX5D 2N1TC 2WZ7A 2KZIA 3H1KD 1L0LD 1N7SC 2KSJA 3L71J 1Y9BA 3ZDMA 4YPCA 5KLVE 3CX5E 2ZVOB 2XDJA 2KSEA 1AQ5A 1JY3P 3FGAD 2E43A 1L0LE 3L74J 2H7HA 1W2BO 1JMBA 3HTKB 2O01N 1L0NJ 1K73Q 1H8AA 1P84D 3AE6C 4QMAA 1KYOI 3O6QA 3LW5H 4PV1C 1KILA 1SQXE 2IPPA 1KB9I 3Q5SA 2KNCB 3CCJP 1UIXA 3U1CA 1HJBA 1YJNP 4JYCA 1PZQA 2IBZE 4N78D 2IYPA 5KLIB 1HVVA 2FXOA 2Z5IA 1SQVG 4WVZA 3SSUA 4D6TG 1RF1C 1GK4A 2NPSC 1URQC 5KLVJ 1QVGO 4N78E 1EZVI 2A45I 3II6A 2CK3H 3H1KJ 2GM4A 2HR3A 3H1HG 2FY8A 1JY3O 2L91A 2RN0A 1M56D 2RH0A 3AE9C 2GUSA 3W67A 3H25A 2E75D 1IJDB 1FZAA 1NTZG 2HPCB 1UIIA 1J1EC 3JCUH 3RK2C 4Y28J 1T3UA 3N4XA 3Q5PA 2J5UA 1SVFA 3AE8C 3BRTB 4BRYB 1LWUC 3AE2C 1GL2D 4AYCA 1SFCD 3IF4A 3MUDC 3NTNA 3H32B 3BASA 1X22A 4GODA 1NAYA 1RF0C 1NTMD 3L73G 2IZ1A 4OWFA 5E79E 4UB8H 3M91A 1HF9A 1G1IA 1T2KC 1NO4A 1VPCA 2AXTH 1Y8AA 3CC4P 3OJAB 5CJ0A 5AW7B 2WT7B 1GDTA 3VMZA 3KZIH 3H1JE 1SQQG 2WPQA 1RE3A 4H44D 1L4AD
chains in the Genus database with same CATH topology
2B89A 2M5AA 4HKZH 2M5AB 2QRXA 1EDJA 1MFTA 4ZMDA 2R44A 1SS1A 1OVVA 4NPEA 1Q2NA 2ZAEB 3MZWB 1DEEG 2HR3A 1JM0A 2KZIA 2WMMA 2KIKA 1OVUA 4WWIA 2M0BA 1BDCA 5DJTB 2K3RA 1ZW0A 3FXEA 2RKLA 3ZDMA 1BDDA 2QVAA 4ZNCA 2KS1B 4BXLA 4IOIH 2UWJE 5DJUB 4KJMA 4JBZA 4HJGH 2Q1KA 3PH0A 4ASWA 4EYYQ 4NPFX 2B87A 5K5GB 2LR2A 3QWOC 1JMBA 2B87B 1FC2C 2LXCB 2SPZA 5CBNA 2KZJA 3RGUA 2LXBA 4HB1A 4CPGA 1LT1A 1NVOA 1OVRA 3FXDA 3MHVA 4GODA 4K3AA 5CBOA 4NPDA 1H0TA 1H0TB 2KUBA 2B88A 2I8DA 1X0TA 1EDKA 2KI7B 4GOFA 1Y47A 1S3JA 2OTKE 4GOEA 4MN4C 2JWDA 1EC5A 5C39A 2P58A 4K35A 1ZXGA 1EDLA 3S1KA 1LP1A 1LP1B 1U7JA 4ASVA 1EDIA 1U7MA 5EFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B89 A;  2M5A A;  4HKZ H;  2M5A B;  2QRX A;  1EDJ A;  1MFT A;  4ZMD A;  2R44 A;  1SS1 A;  1OVV A;  4NPE A;  1Q2N A;  2ZAE B;  3MZW B;  1DEE G;  2HR3 A;  1JM0 A;  2KZI A;  2WMM A;  2KIK A;  1OVU A;  4WWI A;  2M0B A;  1BDC A;  5DJT B;  2K3R A;  1ZW0 A;  3FXE A;  2RKL A;  3ZDM A;  1BDD A;  2QVA A;  4ZNC A;  2KS1 B;  4BXL A;  4IOI H;  2UWJ E;  5DJU B;  4KJM A;  4JBZ A;  4HJG H;  2Q1K A;  3PH0 A;  4ASW A;  4EYY Q;  4NPF X;  2B87 A;  5K5G B;  2LR2 A;  3QWO C;  1JMB A;  2B87 B;  1FC2 C;  2LXC B;  2SPZ A;  5CBN A;  2KZJ A;  3RGU A;  2LXB A;  4HB1 A;  4CPG A;  1LT1 A;  1NVO A;  1OVR A;  3FXD A;  3MHV A;  4GOD A;  4K3A A;  5CBO A;  4NPD A;  1H0T A;  1H0T B;  2KUB A;  2B88 A;  2I8D A;  1X0T A;  1EDK A;  2KI7 B;  4GOF A;  1Y47 A;  1S3J A;  2OTK E;  4GOE A;  4MN4 C;  2JWD A;  1EC5 A;  5C39 A;  2P58 A;  4K35 A;  1ZXG A;  1EDL A;  3S1K A;  1LP1 A;  1LP1 B;  1U7J A;  4ASV A;  1EDI A;  1U7M A;  5EFW B; 
#chains in the Genus database with same CATH topology
 3CD6 P;  1KYO H;  4LLH A;  3TF5 A;  3CCQ P;  1G2C A;  4HKZ H;  1BCC G;  1KQF B;  4H0L C;  5AVT B;  4ZMD A;  4WB4 A;  4AUW A;  1SQQ K;  4WY4 D;  1U57 A;  2C0X A;  1ZOY C;  2H43 A;  2E42 A;  3EFF K;  2O01 H;  3LW5 J;  1G1J A;  1BSN A;  2FKW B;  1IO4 A;  1ZN5 A;  3FXE A;  3MIW A;  4UB6 E;  1A02 J;  4H13 C;  1L2P A;  1LJ2 A;  4L75 A;  5H2F E;  3T97 B;  2B9B A;  1FZC A;  4KT0 J;  1JB0 J;  2A45 H;  1S5L H;  4LGD E;  3KHU A;  3HE4 A;  2QA4 P;  1KYO D;  3OW2 O;  4I7Z C;  1T6A A;  2XU6 A;  2R5B A;  3PTZ A;  4CPG A;  1RE4 C;  1Q82 Q;  1NTM J;  2XV5 A;  1USD A;  1KB9 D;  3BCC D;  3L36 A;  3VP9 A;  1PPJ D;  1ZRT D;  2P2U A;  1EDK A;  1NOH A;  1KIL D;  2D2C B;  3TGU J;  1Y47 A;  2OYI C;  1VL2 A;  5AW2 B;  5AVU B;  3L70 D;  4N3Y B;  1KB9 E;  2JWD A;  3V2R A;  2P58 A;  1PPJ E;  3KXD A;  1JMM A;  3L70 E;  5APV A;  1EZV D;  2E75 B;  4YXD C;  1HTL C;  2QEX P;  3V4Q A;  1OZH A;  3M0D C;  1YI2 P;  1EZV E;  1AA0 A;  1DEE G;  2FFD B;  5AW0 B;  3MP7 B;  2YIU B;  3AE1 C;  5CCH A;  3GW6 A;  5AVZ B;  1GL2 B;  1FDO A;  2PFX A;  4ZNC A;  1SFC B;  1PIX A;  1RQV A;  1T3J A;  1VQ6 P;  5TIS E;  4A7P A;  2I1K A;  1FZB A;  4HJG H;  1J1D B;  1QGK B;  2Q1K A;  2KLU A;  3A2A A;  5CBN A;  1MFZ A;  3RK3 D;  2A06 D;  1SQB D;  3P7K A;  3BCC J;  3SWY A;  2N1T A;  2JWA A;  1NTK J;  5CHX A;  2KUB A;  4H44 B;  1WMK A;  3CXH H;  1BSH A;  3OA7 A;  1M90 Q;  3B5N B;  1SQB E;  1DD4 A;  3L70 J;  4GOF A;  1S4X A;  4MN4 C;  2P67 A;  2G8Y A;  4WY4 B;  5C39 A;  5KLV G;  3F5H A;  3D6Y A;  3M9Q A;  1L0L G;  1LP1 B;  1YBK A;  5BU8 B;  2Y0E A;  3A0H H;  3EQ2 A;  1M1K Q;  2KOG A;  3S9O A;  5KLV K;  1EXJ A;  1HUC A;  4C7N A;  5GTI H;  1L0L K;  3VP8 A;  4R4L A;  1N2D C;  2ZAE B;  1JCC A;  2WMM A;  1LTT C;  2K3R A;  3FWL A;  2PGD A;  3M06 A;  1GW4 A;  1A02 F;  1DIP A;  1BDD A;  4Y99 B;  3PHL A;  1SQX G;  2ZFC A;  2ZXX A;  1KQG B;  1LT9 A;  1N8R Q;  1S72 P;  3C8V A;  1BGY E;  3PH0 A;  1H88 A;  1MZ9 A;  3AEB C;  5B5E E;  1SQX K;  2IBZ G;  2ZT9 B;  2H89 C;  1VQL P;  2N9B A;  1RF1 A;  2NPS A;  3L75 D;  1URQ A;  3H1L D;  1OW7 A;  2WTY A;  3U1A A;  1Q86 Q;  1W5C E;  1H0T B;  1LTI C;  3AE5 C;  1M7L A;  3L74 D;  5L8R J;  3L75 E;  2QG4 A;  3H1L E;  2L5G B;  3CPW O;  1EQ7 A;  3NXS A;  4GOE A;  1BE3 J;  4PD4 I;  1EXI A;  5AW6 B;  3L74 E;  4LC1 A;  5CCG D;  1L0N D;  1JNM A;  4EIJ A;  3WU2 H;  2YXR B;  2E74 D;  3WUU A;  1L0N E;  1LWU A;  5KKZ B;  3CME P;  2XZR A;  4AQR D;  3MUD A;  3A0B E;  5GTH E;  2BCC D;  2HYN A;  1RF0 A;  2G3A A;  1YIT P;  1YQ4 C;  3A3Y B;  2WPR A;  5APX A;  1FBM A;  2W90 A;  2PAJ A;  3HE5 B;  1KN7 A;  5KTB A;  2OTJ P;  4HH2 A;  4IL6 E;  3AEA C;  1RH5 B;  2ZXE B;  3RL0 D;  4NPF X;  3H1J G;  2B87 B;  3L75 J;  1Q7Y Q;  1E5W A;  2WSE H;  3H1L J;  2LXB A;  3H1K E;  1IFI A;  2NRG A;  3MHV A;  1GU4 A;  1VF5 B;  4L73 A;  2Q6Q A;  2N1T D;  3A5T A;  1N7S D;  2I1J A;  2WSC H;  1IC2 A;  2JP3 A;  1LNQ A;  2M3B A;  1R8E A;  1JTH B;  1AFO A;  2YMY A;  3H1I D;  1QVF O;  4PJ0 H;  1USE A;  2OYH B;  3C9I A;  1AJY A;  1NWQ A;  1GU5 A;  3HD7 D;  1P84 E;  1HJ0 A;  2W6J H;  2IYO A;  1KOR A;  1M57 D;  2R44 A;  1DEB A;  1RE4 A;  2BCC J;  1OVV A;  4EOT A;  2WWW A;  2QJP C;  2HOD A;  3BVH A;  1LT9 C;  2QSI A;  4JYB A;  2P10 A;  4PD4 H;  1Z56 A;  2ZYA A;  1M8O B;  1LTB C;  2JR8 A;  2D2C C;  4PV1 D;  2KS1 A;  2OYI A;  5APQ A;  1CW5 A;  2QJK B;  4Z1M H;  2E76 B;  2CPB A;  1PGP A;  1MUU A;  3L72 J;  5AVV B;  1PPJ G;  1RHZ B;  2QE7 H;  1VQ7 P;  2E75 C;  3GMA A;  2HFE D;  3CCV P;  2M3E A;  2NPS D;  3IFM A;  2LKM A;  1URQ D;  3M0D A;  1WRG A;  1M1J A;  5B66 H;  2FFD C;  5BU5 A;  4DCK A;  4IFD K;  2YIU C;  4PD4 D;  1EZV G;  4IFF A;  4DZO A;  2DW3 A;  1S9K D;  4OGQ D;  3R4Y A;  1GL2 C;  1QEX A;  1S9K E;  3H1I J;  3S1K A;  3GG2 A;  2AEF A;  3AEE C;  2B89 A;  4U7J A;  2M5A A;  2WSE J;  2QRX A;  2ZYG A;  3TGU D;  1NTM E;  1FJP A;  3G6E P;  1JM0 A;  4H44 C;  2KIK A;  4GIF A;  2QJY B;  3RL0 B;  3B5N C;  3TGU E;  2W6A A;  2WSC J;  2FBW C;  3HUS B;  2RKL A;  3PP5 A;  5AVR B;  2WPV B;  4WY4 C;  1SQB G;  2UWJ E;  3JCU E;  2JKV A;  2Q5U A;  3ITK A;  3VMX A;  3P8C D;  5AW5 B;  1TU3 F;  1J2J B;  2FYU J;  1SQB K;  1N7S B;  1SQP D;  5CMZ A;  3HTK A;  1NU1 J;  1MKM A;  3P8C E;  4O9B A;  1NJI Q;  2W6B A;  4XA4 A;  3CXH I;  1SQP E;  3KPE A;  4UB8 E;  2K9J B;  4EI2 A;  4DJG A;  1YIJ P;  4W80 A;  2AXT E;  3HD7 B;  3LID A;  2KNC A;  3C1L A;  1GD2 E;  1QX8 A;  3VMA A;  3KZI E;  2CPS A;  3AE3 C;  3PRJ A;  1JOC A;  3B4S A;  4H13 D;  3V6I A;  2Q9I A;  1U7J A;  1KYO E;  3I55 P;  1BGY G;  2GA1 A;  4PV1 B;  1NTK D;  2ZT9 C;  3WUV A;  1FU1 A;  1SQV D;  2YXQ B;  3GHG B;  4D6T D;  2P1J A;  1MFT A;  3BCC E;  2FYZ A;  1NTK E;  1ZRT E;  1PP9 D;  1X8Y A;  1KIL E;  3H1H D;  4RO0 A;  2M8R A;  1BDC A;  4XFJ A;  2OYO A;  3L71 G;  2ITA A;  4M3L A;  1GK6 A;  2QVA A;  1PP9 E;  3TDK A;  4BXL A;  4I6M C;  2HPC A;  3PJS K;  3NMD A;  1NTZ D;  3TNU B;  1JO5 A;  1FDI A;  1M1J C;  3G71 P;  1OW8 A;  2FXP A;  1S5L E;  3L74 G;  5AVY B;  1SQP J;  1R5L A;  4OGQ B;  1HGV A;  3QH9 A;  4BRY A;  1CSB A;  5KKZ C;  2IZ0 A;  2FXM A;  1LTJ B;  3H32 A;  1L0N G;  4GDO A;  5CBO A;  5AVS B;  3JSV C;  4KHX A;  5AW1 B;  1KTM A;  1GMJ A;  1LTS C;  5KAF H;  1L0N K;  1FAV A;  2W27 A;  2XNX A;  3V2P A;  4N6J A;  1QL2 A;  2WT7 A;  1N86 A;  3TSI A;  3A7O A;  2O01 J;  1YHQ P;  5EFW B;  2BAS A;  3E1I A;  3RK3 E;  1SQV J;  1L4A B;  2A06 E;  1OMI A;  2Y0D A;  4D6T J;  1DD3 A;  5TJH A;  2JJL A;  3FX0 A;  2AEM A;  3OAK A;  1N73 B;  2H8P D;  1PP9 J;  4NPE A;  4RKU J;  1BE3 D;  1Q2N A;  3H1H J;  1VF5 C;  3VN0 A;  3MZW B;  3H1K G;  4C46 A;  2H88 C;  4EDF A;  3M9H A;  1OVU A;  4WWI A;  1KFN A;  5DJT B;  1FOS E;  3AE7 C;  1BE3 E;  2IDB A;  1NTZ J;  1SLQ A;  3SFD C;  2K37 A;  2V4H A;  3CMA P;  3IN6 A;  2Q7C A;  3CL3 D;  4ZKP A;  3T97 A;  4TT3 H;  1FZF A;  1KZU B;  3TYY A;  3CXH D;  1PGQ A;  1SP4 A;  1VQ9 P;  2PP6 A;  4I2L C;  3CXH E;  2IBZ I;  4K3A A;  4W7Z A;  4NPD A;  1IFM A;  1XTG B;  3L73 J;  1CI6 B;  2YKQ A;  3O6Q B;  3RBX A;  5KLI C;  2KXP B;  1X0T A;  1KIL B;  4W7Y A;  1GW3 A;  5KAI H;  3KYQ A;  3AED C;  1NGM B;  4C7R A;  3CWB D;  3CCR P;  2E76 C;  3A0H E;  4XE5 B;  2POH A;  3CLQ A;  3W68 A;  2E5Y A;  1U7M A;  3RBZ A;  5GTI E;  4B86 A;  3CWB E;  1BCC J;  1OX3 A;  1OW6 A;  1MV8 A;  4L74 A;  5CCG C;  1SS1 A;  1YJW P;  1NH4 A;  2FFD A;  3AEG C;  1HGZ A;  1OXZ A;  4IL6 X;  3O8Z A;  3GF7 A;  1IFD A;  2M0B A;  2XND H;  1R5S A;  2OQQ A;  1GL2 A;  2IFM A;  1SFC A;  2HLO A;  4IOI H;  3V4W A;  5KJ7 C;  2JEE A;  2BEQ D;  2QIW A;  3CX5 H;  1KV4 A;  2IFN A;  1GZL A;  3GF3 A;  3MD0 A;  1IZN B;  2LR2 A;  2SPZ A;  4RJT A;  2P7J A;  4OVN F;  3RK3 B;  2BCC E;  5CCH D;  1ZR2 A;  1NTM G;  3RL0 C;  1VDF A;  2B88 A;  1VQ8 P;  3B5N A;  5AW8 B;  1K05 A;  1KC8 Q;  5APY A;  2OTL P;  1LGH B;  3L72 D;  3HUS C;  3E1R A;  1S3J A;  3TGU G;  1CZQ A;  2IX7 C;  3CWB J;  4WY4 A;  1NTM K;  1EC5 A;  1ZP0 C;  1NKZ B;  2Z4E A;  3L72 E;  1LP1 A;  4BWN A;  3V2N A;  1JUN A;  2R32 A;  3GLM A;  2Q3E A;  3WU2 E;  4JQ0 D;  2HG5 D;  5APW A;  2JO1 A;  1G2C B;  2V7Q H;  3D70 A;  5CJ4 A;  3Q1M A;  1PGO A;  1KQS O;  2QM7 A;  5AW4 B;  3D71 A;  1N7L A;  4GT1 A;  1SQP G;  3I5C A;  3HD7 C;  1OIP A;  1VQK P;  1ZLL A;  2WSF H;  5DJU B;  3H1I E;  3PLN A;  1SQX D;  4KJM A;  1SQP K;  5AW9 B;  1CI6 A;  3R2P A;  2MJZ A;  5AVW B;  4EYY Q;  2YKO A;  1FZC B;  1QLE D;  3WMM 0;  3QWO C;  2Y0C A;  3AE4 C;  1K8A Q;  1OFC X;  2IBZ D;  3HE4 B;  3S4R A;  3GHG C;  3VOP A;  1NHL A;  3RGU A;  1YQ3 C;  1S1C X;  2K1A A;  1OVR A;  1FE6 A;  3BCC G;  2R3C A;  1H0T A;  2ZYD A;  3L4F A;  4YTP C;  3IAO A;  1NTK G;  1FS0 E;  2FYN B;  1IFN A;  3F89 A;  4U3F D;  2FYU D;  2D2C D;  3L70 G;  5E79 H;  3AEF C;  3VMY A;  1NU1 D;  4RES B;  1PP9 G;  1NTK K;  4PJ0 E;  4K35 A;  1L0L J;  4OH8 B;  1SQV K;  4U3F E;  2FYU E;  4DOJ A;  4ASV A;  4OGQ C;  1EDI A;  1FOS F;  1NU1 E;  2A45 G;  2J58 A;  1KD1 Q;  2E74 B;  1LTJ C;  1SFC C;  1EDJ A;  3KQG A;  4PD4 E;  1VQN P;  1JEK A;  1PGJ A;  4L76 A;  1J1D C;  1HBW A;  3BAT A;  3RK2 D;  2Y9Y A;  3LIE A;  1LTG C;  2YO2 A;  1NTZ K;  1ZW0 A;  5AVX B;  1SQX J;  5AW3 B;  3HE5 A;  2VRS A;  4I1L A;  3L35 A;  1AVY A;  1RY3 A;  2W8Z A;  4UB6 H;  1L4A C;  5H2F H;  3VYI A;  1ZME C;  5M1B A;  2B87 A;  2O1J A;  3H1J D;  2V7Q J;  2A06 G;  1N73 C;  4HYT B;  3RL0 g;  5B66 E;  1T2K D;  2YNY A;  4WBA A;  1NVO A;  3B71 A;  1VQO P;  2N1T B;  4U3F J;  3V2Q A;  3B5N D;  1IK7 A;  2OTK E;  2WSF J;  2KB7 P;  2Y9Z A;  1BE3 G;  4H0L D;  1KB9 H;  1JTH A;  3G4S P;  2WVR A;  1DX7 A;  1PV3 A;  2OYH A;  1D7M A;  3I56 P;  1Q90 D;  3CI9 A;  1ZR4 A;  4Y99 C;  4C7N B;  1JY2 P;  5AVQ B;  2WIT A;  4R4M A;  3CC2 P;  3IR9 A;  3FWN A;  4JF7 A;  3G9R A;  1S5L X;  2NZ2 A;  2BEZ F;  1YTZ I;  3P8M C;  1PFI A;  1KIL C;  1RQU A;  3L37 A;  1WT6 A;  1QL1 A;  5APU A;  2E5T A;  1VQM P;  3K5B A;  2QJP B;  3Q2Y A;  1LT9 B;  1GTW A;  3EWK A;  5TIS H;  3SFE C;  1SQV E;  4ASW A;  1X79 B;  3H1J J;  4D6T E;  1FZG A;  2ZVN B;  2ZT9 D;  3L75 G;  1JY3 N;  2KZJ A;  3CWB G;  1RF1 B;  2YMK A;  3P32 A;  2K9Y A;  2NPS B;  3H1H E;  4HB1 A;  5CCG A;  3H1L G;  1URQ B;  1NAF A;  2R5D A;  4DT0 A;  5APT A;  1DH3 A;  3CCL P;  2KI7 B;  2C0W A;  1KFM A;  1NTZ E;  3Q5R A;  1Q81 Q;  1HWT C;  1OWA A;  5KJ7 A;  1IFP A;  1ZXG A;  3Q3D A;  1JY2 O;  2O1K A;  1J1E B;  3RK2 B;  3ABV C;  2Q3I A;  3L73 D;  3JC2 2;  3CCM P;  3RK3 C;  2WQY C;  2KLV A;  1T8Z A;  1LWU B;  3CCS P;  3M9B A;  3D6Z A;  3H6P A;  2BCC G;  3L73 E;  2XKM A;  2MKV A;  1SQQ D;  1XTC C;  2J59 M;  2R3S A;  3HUS A;  3CX5 I;  1X9V A;  1YTZ T;  1BCC D;  1IK9 A;  3SWF A;  4GKG A;  1SQQ E;  4JBZ A;  2KP8 A;  1AV1 A;  2YKP A;  3L72 G;  1RE3 C;  1N7S A;  1BCC E;  3VTP C;  2KK7 A;  5B5E H;  3CCU P;  1LT1 A;  4H0L B;  1H89 A;  2Z5H A;  2C9L Y;  3NFQ A;  1VF5 D;  2K9J A;  1VQP P;  2OYH C;  4TLF A;  5KAF E;  2I8D A;  1P84 I;  1YJ9 P;  3HD7 A;  2N9Y B;  2O3J A;  3N7N A;  1JCD A;  2QM8 A;  2C9N Y;  1NKN A;  3UIA A;  4H13 B;  3H1I G;  1K9M Q;  1VQ5 P;  1KQL A;  3KDP B;  3TK1 A;  2KYV A;  1FZC C;  4YXW H;  1BGY D;  3CC7 P;  2AEJ A;  1YYC A;  3GHG A;  3U59 A;  2YO3 A;  4I7Z B;  2QJK C;  4IFM A;  2HOD B;  1PL5 A;  1SQQ J;  3A0B H;  2FYN C;  5GTH H;  1FJK A;  3E7K A;  3L71 D;  1SQB J;  3BRV B;  2KS1 B;  2OYI B;  3HRN A;  1S2E A;  2AXC A;  3TNU A;  2PRR A;  3WUT A;  3V5B A;  1KMI Z;  2E76 D;  2W83 C;  2OAR A;  3L71 E;  1NYH A;  1W2E A;  3SWK A;  3MGN A;  4U3F G;  4ZKU A;  2FYU G;  5K5G B;  2E74 C;  1FC2 C;  1FDM A;  2LXC B;  4IL6 H;  1NU1 G;  1LTJ A;  3AEC C;  1JY2 N;  3EFG A;  3USS A;  2JDI H;  3CCE P;  1AVO A;  2FYU K;  3FXD A;  1M1J B;  2OGU A;  2WSS H;  5KAI E;  3MTU E;  1NU1 K;  3B8E B;  5CCH C;  2GUV A;  1FZE A;  1IFJ A;  5APS A;  5KJ7 D;  1E79 H;  1VQ4 P;  1EDL A;  3G3Z A;  4JPZ B;  3M0A A;  1LTA C;  2QJY C;  2WPS A;  1BGY J;  1ZV8 A;  1L4A A;  2K88 A;  2RMZ A;  1AQT A;  2M5A B;  1N73 A;  1HH0 A;  1P84 H;  1K04 A;  2ZJS E;  5BVZ A;  5KLV D;  3CX5 D;  2N1T C;  2WZ7 A;  2KZI A;  3H1K D;  1L0L D;  1N7S C;  2KSJ A;  3L71 J;  1Y9B A;  3ZDM A;  4YPC A;  5KLV E;  3CX5 E;  2ZVO B;  2XDJ A;  2KSE A;  1AQ5 A;  1JY3 P;  3FGA D;  2E43 A;  1L0L E;  3L74 J;  2H7H A;  1W2B O;  1JMB A;  3HTK B;  2O01 N;  1L0N J;  1K73 Q;  1H8A A;  1P84 D;  3AE6 C;  4QMA A;  1KYO I;  3O6Q A;  3LW5 H;  4PV1 C;  1KIL A;  1SQX E;  2IPP A;  1KB9 I;  3Q5S A;  2KNC B;  3CCJ P;  1UIX A;  3U1C A;  1HJB A;  1YJN P;  4JYC A;  1PZQ A;  2IBZ E;  4N78 D;  2IYP A;  5KLI B;  1HVV A;  2FXO A;  2Z5I A;  1SQV G;  4WVZ A;  3SSU A;  4D6T G;  1RF1 C;  1GK4 A;  2NPS C;  1URQ C;  5KLV J;  1QVG O;  4N78 E;  1EZV I;  2A45 I;  3II6 A;  2CK3 H;  3H1K J;  2GM4 A;  2HR3 A;  3H1H G;  2FY8 A;  1JY3 O;  2L91 A;  2RN0 A;  1M56 D;  2RH0 A;  3AE9 C;  2GUS A;  3W67 A;  3H25 A;  2E75 D;  1IJD B;  1FZA A;  1NTZ G;  2HPC B;  1UII A;  1J1E C;  3JCU H;  3RK2 C;  4Y28 J;  1T3U A;  3N4X A;  3Q5P A;  2J5U A;  1SVF A;  3AE8 C;  3BRT B;  4BRY B;  1LWU C;  3AE2 C;  1GL2 D;  4AYC A;  1SFC D;  3IF4 A;  3MUD C;  3NTN A;  3H32 B;  3BAS A;  1X22 A;  4GOD A;  1NAY A;  1RF0 C;  1NTM D;  3L73 G;  2IZ1 A;  4OWF A;  5E79 E;  4UB8 H;  3M91 A;  1HF9 A;  1G1I A;  1T2K C;  1NO4 A;  1VPC A;  2AXT H;  1Y8A A;  3CC4 P;  3OJA B;  5CJ0 A;  5AW7 B;  2WT7 B;  1GDT A;  3VMZ A;  3KZI H;  3H1J E;  1SQQ G;  2WPQ A;  1RE3 A;  4H44 D;  1L4A D; 
#chains in the Genus database with same CATH homology
 2B89 A;  2M5A A;  4HKZ H;  2M5A B;  2QRX A;  1EDJ A;  1MFT A;  4ZMD A;  2R44 A;  1SS1 A;  1OVV A;  4NPE A;  1Q2N A;  2ZAE B;  3MZW B;  1DEE G;  2HR3 A;  1JM0 A;  2KZI A;  2WMM A;  2KIK A;  1OVU A;  4WWI A;  2M0B A;  1BDC A;  5DJT B;  2K3R A;  1ZW0 A;  3FXE A;  2RKL A;  3ZDM A;  1BDD A;  2QVA A;  4ZNC A;  2KS1 B;  4BXL A;  4IOI H;  2UWJ E;  5DJU B;  4KJM A;  4JBZ A;  4HJG H;  2Q1K A;  3PH0 A;  4ASW A;  4EYY Q;  4NPF X;  2B87 A;  5K5G B;  2LR2 A;  3QWO C;  1JMB A;  2B87 B;  1FC2 C;  2LXC B;  2SPZ A;  5CBN A;  2KZJ A;  3RGU A;  2LXB A;  4HB1 A;  4CPG A;  1LT1 A;  1NVO A;  1OVR A;  3FXD A;  3MHV A;  4GOD A;  4K3A A;  5CBO A;  4NPD A;  1H0T A;  1H0T B;  2KUB A;  2B88 A;  2I8D A;  1X0T A;  1EDK A;  2KI7 B;  4GOF A;  1Y47 A;  1S3J A;  2OTK E;  4GOE A;  4MN4 C;  2JWD A;  1EC5 A;  5C39 A;  2P58 A;  4K35 A;  1ZXG A;  1EDL A;  3S1K A;  1LP1 A;  1LP1 B;  1U7J A;  4ASV A;  1EDI A;  1U7M A;  5EFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...