1U7MA

Solution structure of a diiron protein model: due ferri(ii) turn mutant
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
MDYLRELYKLEQQAMKLYREASEKARNPEKKSVLQKILEDEEKHIEWLETING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Four-helix bundle model
publication title Analysis and Design of Turns in alpha-Helical Hairpins
pubmed doi rcsb
source organism Escherichia coli
total genus 17
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1u7mA00
1OVUA 4ASVA 1FC2C 2P58A 2KS1B 1U7JA 2HR3A 2KIKA 3RGUA 1OVRA 2LR2A 4HJGH 2R44A 2LXCB 1LP1A 2RKLA 4MN4C 4NPEA 1BDDA 4ASWA 1ZW0A 2QVAA 5DJUB 4EYYQ 4NPFX 2B89A 4HKZH 5DJTB 2LXBA 1LP1B 3FXEA 4NPDA 2QRXA 5C39A 1BDCA 1JMBA 3FXDA 2B88A 2SPZA 4GOEA 1MFTA 4ZMDA 2WMMA 5CBNA 4JBZA 2K3RA 1EDIA 3MHVA 1EDJA 3S1KA 3PH0A 2UWJE 4GOFA 4BXLA 2KZIA 4KJMA 2JWDA 5CBOA 1NVOA 2I8DA 2M5AB 1Q2NA 4IOIH 2KZJA 4K3AA 1EDLA 3MZWB 2M0BA 1X0TA 1DEEG 2M5AA 3ZDMA 1SS1A 4CPGA 3QWOC 1OVVA 2B87A 4HB1A 1JM0A 1S3JA 1Y47A 1ZXGA 2ZAEB 1EC5A 1H0TA 2KI7B 4WWIA 2OTKE 4K35A 2Q1KA 2B87B 4ZNCA 5K5GB 1EDKA 1LT1A 4GODA 1U7MA 2KUBA 5EFWB 1H0TB
chains in the Genus database with same CATH superfamily
3HD7A 1M7LA 1FJKA 1LT9C 1FZGA 1H89A 2QE7H 2KIKA 2ZYGA 3TF5A 1LTJA 4H0LC 4DT0A 2ZJSE 2E74B 5CCGD 3VMYA 4ASWA 3CC4P 1PP9G 1KQLA 2V7QJ 2IZ1A 5B66H 4JPZB 4ZKPA 1SFCC 2E75C 3SWYA 3TNUA 2QM8A 3HRNA 1SP4A 1KILE 1KN7A 1RE3C 2FYUD 2WSCJ 3BCCE 3T97B 3L72E 3L72J 5AW6B 3TGUJ 1UIIA 4RJTA 1BSHA 1NO4A 2KZJA 2P67A 1LTTC 1DEEG 1ZP0C 1EZVD 4OH8B 2O1KA 1OVVA 2I1JA 3BCCD 3KZIE 1VQPP 4W80A 1VQMP 3N4XA 1N7SA 1GZLA 2OYHB 5H2FE 3U1CA 1K05A 1A02J 5B5EE 1SQQG 1VQOP 1HWTC 3RK2D 2R3SA 2N1TA 1IC2A 5KKZC 1GD2E 1Y9BA 3L75D 2GM4A 1VQ6P 3F5HA 1Q86Q 3L74E 4PD4D 3GMAA 3CCJP 1RHZB 3L74J 1QL1A 3VMAA 4DZOA 3L70D 4Z1MH 1NTZK 4L73A 1WMKA 1BE3J 1KV4A 1NAYA 2O01N 4IL6E 3KPEA 1Q2NA 2O3JA 2A06G 3L75G 1ZRTD 5AVSB 1PFIA 4UB6H 3CXHH 4C7RA 4W7YA 3VOPA 5CMZA 3GHGB 1ZLLA 3QWOC 4WY4B 3PRJA 1X8YA 4HB1A 3RL0g 3Q5PA 2ITAA 5APWA 2RMZA 1CI6A 2WPQA 1ZR4A 1T6AA 2WSFJ 3U1AA 2FYNB 1YBKA 1LT9A 2J59M 1KQFB 2J5UA 2E43A 1GL2B 3GF3A 2KS1B 3H32B 3HD7B 4PJ0E 2OYHC 1YJWP 5KJ7D 1L2PA 2LXCB 3ABVC 2KSEA 1SFCA 1LGHB 2ZYAA 1LTJB 4IFFA 5AW2B 3WMM0 1RE3A 1LTGC 2V7QH 2K9YA 1PGJA 1CSBA 3V2PA 5AVYB 1A02F 1YIJP 2WQYC 3C1LA 2QJKB 5KLIB 4Y99B 3KXDA 1IFMA 4N3YB 1NTZE 3H1JG 2XU6A 3MZWB 5AVRB 1T8ZA 1G1IA 1VDFA 3FWLA 1NTKE 4R4MA 1KFMA 2ZFCA 1VQ5P 1PL5A 2Z5IA 3ITKA 2XDJA 3TSIA 1SQBK 1IFJA 3RK3B 2KI7B 2WWWA 3JCUE 1T2KD 4LC1A 1EDKA 1URQC 4D6TD 1BCCJ 3CWBE 1VQ4P 2WSEJ 3CWBJ 1NTMD 3G3ZA 2IBZE 3BATA 1N7SB 3GHGC 2HYNA 1LTIC 1FC2C 1NTKD 3AE1C 4WY4C 2KNCB 1S2EA 2OTJP 1L0NK 2P7JA 1SQXG 3Q1MA 1N73B 1MUUA 2PGDA 1MKMA 2N1TB 2YXRB 2FYNC 3L73E 5TISH 4RKUJ 3L73J 2OARA 2IBZD 2B89A 3LIDA 1CZQA 5KLVK 2FY8A 1L0LG 1MFTA 2WITA 1NKNA 1K8AQ 3AEDC 4HH2A 1RY3A 3CCVP 2H88C 1FAVA 5CBOA 2I8DA 2M5AB 5B66E 3AE4C 2XV5A 2IX7C 3T97A 2AXTH 3E1RA 1YTZT 2NPSC 2YKPA 2HLOA 2QJKC 5KLIC 4CPGA 2FBWC 3O8ZA 2E76C 4Y99C 1DD3A 3OAKA 1BGYJ 3P32A 1G2CB 2KYVA 1OXZA 3M06A 1EC5A 5AW4B 2Q1KA 4TLFA 5GTHH 3G71P 2MJZA 1P84H 2WSFH 4IL6X 3H1IG 3B5ND 1LTSC 2CPSA 1KQSO 2OYHA 3H1KJ 3AEFC 1SQBE 3V4QA 4I7ZB 1SQBJ 1KYOD 1NU1J 1LT9B 2QG4A 3V2RA 1ZMEC 2H7HA 1OFCX 2JDIH 5APSA 3RK3C 4PJ0H 5AVXB 1GU4A 1PPJG 1YJ9P 3PLNA 2IYPA 1FZFA 2QVAA 4H44B 1M8OB 1L0NE 1FU1A 4AYCA 4GKGA 3AE9C 1NYHA 2E75B 1OW8A 2ZXXA 1OWAA 1S72P 1R5SA 3H1LE 1N73C 3H1LJ 4C46A 1SQPJ 4DCKA 2N1TC 1YI2P 2IZ0A 1JOCA 1FOSF 1JCCA 5KLVJ 5AW0B 2BEZF 1L0ND 1EZVI 1U57A 1HUCA 3CCUP 2BASA 1EDLA 2PFXA 5BU8B 3VTPC 2BCCJ 1J1DB 3D6ZA 2C9NY 2Z5HA 1IK7A 2IDBA 2E74D 4EIJA 3E1IA 1K04A 2YIUC 1URQA 3F89A 1S3JA 3GHGA 1OX3A 2QA4P 2OTKE 3JCUH 4WY4A 3B4SA 4U3FD 4UB6E 3CXHE 4JYCA 2WSEH 2KUBA 2OGUA 1PP9E 3MGNA 1KORA 3WUUA 1PP9J 2K1AA 5APUA 1N2DC 2FFDB 1YYCA 2Q6QA 3HE4A 2FXMA 3H1HD 1HBWA 4PD4I 3BVHA 1SQVD 3AE6C 1N8RQ 3D6YA 3PJSK 1RF1B 3H32A 2E5TA 3CX5E 3C8VA 1FZAA 4I7ZC 1S1CX 2QRXA 4W7ZA 2B88A 1AFOA 4YTPC 1H88A 2WMMA 3BRVB 3L71G 2ZXEB 2L5GB 1J1EB 1VF5D 2FXPA 4H44C 1KQGB 1KB9H 4KT0J 3AEAC 2NPSA 1PV3A 3LW5J 3TYYA 1X0TA 3PP5A 3A7OA 1OMIA 4R4LA 3AE8C 1GK4A 2AEJA 1DD4A 1SQQJ 3OJAB 4OGQB 4PV1B 1NOHA 1L4AD 3TGUE 2Q5UA 4OVNF 1AVYA 4WWIA 2I1KA 1EXIA 3V2QA 1J1DC 1HH0A 3IFMA 3IN6A 3I56P 3NTNA 1FZCC 1KILD 3EQ2A 2FXOA 1X79B 2R5DA 3D70A 5CHXA 1WT6A 1GDTA 3L72D 3TGUD 2WT7B 2R3CA 1T3UA 5AVVB 2K37A 1OVRA 3L4FA 3TK1A 1K9MQ 2FYUG 2CK3H 2W6AA 1VQNP 4BRYB 5KAIE 1LP1A 2KP8A 4MN4C 5CCHD 2KNCA 2C0WA 3B8EB 2M3EA 4U7JA 3HUSB 1OZHA 3GLMA 4DOJA 1N73A 2A06E 1M1KQ 1JMBA 3RBXA 2FFDC 2WPVB 3L75J 2YO2A 4GIFA 2QJYB 1EZVG 1EDJA 2M8RA 3BCCG 3VMZA 3VP8A 1RF1C 5TISE 3S1KA 3CLQA 3C9IA 3CD6P 4YPCA 2JWDA 2FKWB 1GL2D 5E79H 4XA4A 4XE5B 1DEBA 2B9BA 3HD7D 1SQXK 2WPSA 3AE7C 2G3AA 2M5AA 1BE3E 1PGPA 5APXA 2Y0DA 1J1EC 2D2CD 2JR8A 1HJ0A 2C9LY 3S9OA 3H25A 2GUVA 3L74D 3A2AA 3RL0B 4K35A 2AXTE 2A45G 3CCRP 1URQB 2KSJA 4YXWH 1G2CA 4OGQC 4PV1C 1BE3D 1VPCA 3RK3E 2W83C 2NZ2A 3L70G 5AVWB 1LTAC 2IBZI 5GTHE 4HJGH 2W6BA 1P84E 2YKQA 1GU5A 3HE4B 2O01J 1ZW0A 1J2JB 3M0DC 3RK2B 4HKZH 3CX5H 3V6IA 1W5CE 3FXEA 3H1JE 3H1JJ 1R5LA 1N86A 2SPZA 3RK3D 3PTZA 1FJPA 2E42A 1KD1Q 1P84D 1N7SD 2KB7P 1LTBC 3V4WA 2JJLA 4WVZA 3CI9A 3HUSC 3MTUE 3II6A 3LW5H 3MUDC 3G9RA 5CCGC 2QJYC 2NPSB 1XTGB 2V4HA 3ZDMA 2N1TD 1FDOA 1SS1A 1DX7A 1R8EA 2B87A 2E76B 3Q2YA 5KTBA 1IZNB 1XTCC 1IFIA 1SQXJ 1FDIA 1FZCA 4JYBA 5K5GB 3D71A 1KYOI 3RBZA 3CC2P 2YO3A 4RESB 3CCLP 1S5LE 3E7KA 4DJGA 3P8MC 1QL2A 1L0LJ 1NU1K 3EFFK 3RGUA 3RL0C 1HF9A 3NFQA 5AW5B 1NGMB 1DIPA 2R44A 1BCCE 1NTZD 2C0XA 5KAIH 1BDDA 2FFDA 1NJIQ 4A7PA 2ZT9D 4NPFX 3Q5SA 5DJTB 1LP1B 1FOSE 1GW3A 1RF1A 1G1JA 3FGAD 2A45H 4ZMDA 1QLED 1Q7YQ 2Q3EA 1HGZA 2JKVA 4PD4H 1BSNA 1S9KE 1BCCD 1JCDA 2UWJE 3CWBD 2HFED 1SQPK 3RK2C 2K88A 3EFGA 3I55P 1NTZG 4D6TG 1M90Q 1NTMG 4H0LD 1MFZA 1JNMA 2IYOA 1FDMA 3H1IJ 3USSA 1NTKG 2H89C 2RN0A 2YIUB 3L37A 1HVVA 1KB9E 3L73D 4AQRD 3CCEP 4N78E 1AV1A 1SFCD 2E75D 1LWUB 2Q3IA 3L35A 1PPJE 3M9QA 2POHA 1W2EA 5EFWB 2IBZG 1K73Q 1FZEA 1Q90D 1BGYE 2OYIB 1KB9D 3M0DA 3VMXA 4N78D 1QEXA 2WPRA 4I6MC 2O1JA 4H13B 2WT7A 3G4SP 2O01H 2Y9YA 3CCQP 2AXCA 3H1KE 2QEXP 2E5YA 1AQTA 1NU1E 4BRYA 1BGYD 1IK9A 1JY2P 2MKVA 3HUSA 3MIWA 1VQ8P 2KXPB 2CPBA 3MUDA 5CJ4A 1W2BO 3GF7A 4KJMA 2HODA 5CCGA 1FS0E 3HTKB 3H1KD 3NMDA 2N9YB 2OTLP 1SQBD 1UIXA 5KJ7C 3M0AA 2W90A 2FYUK 1M1JB 1SQPE 2JWAA 2JO1A 3CCMP 1RQUA 3MP7B 1IFDA 2PRRA 5KLVE 1SQQK 1Y47A 1ZXGA 3CL3D 3CPWO 5E79E 1H0TA 2N9BA 5KAFH 2YXQB 5L8RJ 2W27A 2B87B 2BCCE 1ZN5A 1N7LA 4B86A 3P8CE 1FZCB 3H1LD 1S5LH 3CMEP 1SQPD 1JTHB 1YJNP 2QSIA 2WSSH 1LJ2A 4U3FJ 5KLVD 2HR3A 4GT1A 3WUTA 2HPCB 1LWUC 3K5BA 3H6PA 3L71E 3B5NB 2BCCD 3L71J 1NKZB 1USDA 4OGQD 1YQ3C 3AE5C 1NHLA 4TT3H 1L0NG 3H1HJ 5C39A 5GTIH 2OYIC 1T2KC 1S5LX 1ZOYC 2JEEA 1IO4A 4JBZA 1OW7A 2ZVOB 2QJPB 1JEKA 1KTMA 4OWFA 4H13C 3CXHD 3W67A 4JF7A 1PP9D 2K9JB 3R2PA 4WB4A 1LNQA 5AVZB 3FX0A 1NAFA 4U3FG 5AVQB 5M1BA 4Y28J 3IAOA 2H43A 4YXDC 3H1HG 5APQA 2R32A 2AEMA 3CX5D 2FYUE 1JY3P 2FYUJ 1SQVG 1AJYA 4ZNCA 3VN0A 4GODA 4C7NB 1MV8A 1M1JC 1SQQE 3HE5B 1YITP 1AQ5A 2GUSA 3LIEA 2Y0CA 2NRGA 1EZVE 3CMAP 1E79H 2RKLA 4LGDE 1VQ7P 3BCCJ 2QIWA 1QVGO 1KYOH 3AECC 5DJUB 3JC22 1SQQD 3GG2A 1PZQA 3AEEC 1P84I 2M3BA 3JSVC 3RL0D 1T3JA 5CBNA 1URQD 1EDIA 1NWQA 4O9BA 1JO5A 3B5NC 3AE2C 4BXLA 4GOFA 5KJ7A 1SVFA 1RF0C 4GDOA 4WY4D 3BRTB 2KOGA 3AE3C 3L75E 2IPPA 2YKOA 2HODB 3GW6A 4PD4E 2Q9IA 2KLUA 1VF5B 2QJPC 2W8ZA 3M91A 3L72G 1YQ4C 3TGUG 2ZAEB 3L70E 3O6QB 3L70J 1JUNA 4M3LA 1PGQA 2WZ7A 2A06D 2VRSA 3G6EP 1TU3F 1H0TB 3IF4A 1L4AB 1OVUA 3A3YB 4I2LC 4WBAA 1LWUA 1HGVA 1IFPA 1ZRTE 3CC7P 2YMKA 2KK7A 2W6JH 2ZVNB 5AVUB 2Y0EA 2LR2A 1DH3A 4LLHA 1D7MA 1L0LK 1EXJA 1NTMK 2E74C 4NPEA 2OYOA 3OW2O 1KILB 2NPSD 1OIPA 1GMJA 1QX8A 4L75A 5APYA 2OYIA 3Q5RA 1NTKK 2E76D 3EWKA 3NXSA 3WU2H 5AVTB 2J58A 1JB0J 1GTWA 4EDFA 2RH0A 1HTLC 4UB8H 1Y8AA 1GW4A 2JP3A 5APTA 3PH0A 3WUVA 3U59A 2L91A 2KZIA 1MZ9A 3PHLA 3L74G 1FE6A 1NVOA 2AEFA 3A0BH 2PAJA 2XZRA 1X22A 2YMYA 1S4XA 3HTKA 5BVZA 1BE3G 1QGKB 1M1JA 2BEQD 3H1JD 1KB9I 3VYIA 5AW3B 3OA7A 1VF5C 2WVRA 1HJBA 2XNXA 2D2CB 1RH5B 3V2NA 3L36A 2IFNA 3SFEC 2YNYA 1SQXE 2P58A 5KAFE 1U7JA 3A5TA 1VQ9P 1JTHA 2WSCH 2LKMA 2KLVA 2P10A 3TNUB 1L4AC 2HPCA 2P1JA 1KC8Q 4D6TE 3B5NA 1NTZJ 3Q3DA 1L0LE 3QH9A 4D6TJ 2XNDH 1NTME 3VP9A 1NTMJ 1USEA 1SQXD 1RF0A 2K3RA 3MHVA 1NTKJ 1GK6A 1KILC 5AW8B 4ZKUA 3KZIH 1Z56A 3N7NA 1JY2N 1ZV8A 5GTIE 5H2FH 2M0BA 2H8PD 1JY2O 1L0LD 3KYQA 5CCHC 2K9JA 4H13D 5AW1B 5B5EH 3BASA 2R5BA 1KMIZ 2QM7A 3A0HE 1H8AA 1KFNA 1Q81Q 1KZUB 3H1IE 1EQ7A 1OW6A 1IFNA 1RE4C 4H44D 1S9KD 3S4RA 3R4YA 4C7NA 1GL2C 2Z4EA 3HD7C 3HE5A 3SWFA 1AVOA 4I1LA 1BCCG 2GA1A 1NH4A 3CWBG 1IJDB 2ZYDA 1WRGA 4EYYQ 1LTJC 4N6JA 3B71A 3H1ID 3UIAA 2D2CC 4IL6H 2LXBA 4NPDA 1ZR2A 1BDCA 3FXDA 3CXHI 1E5WA 3M9HA 1JMMA 1SQVK 4EOTA 1RQVA 2ZT9B 2IFMA 1KYOE 3AEBC 1PPJD 3L73G 2HG5D 1X9VA 1YTZI 3M9BA 1QVFO 3I5CA 2Q7CA 1M56D 4AUWA 3CX5I 1PIXA 1CI6B 1AA0A 2WTYA 3SWKA 2OQQA 1M57D 4XFJA 1VQLP 3KDPB 4IFMA 3MD0A 4H0LB 1NU1D 3IR9A 1LT1A 1FBMA 1N7SC 3O6QA 2PP6A 3V5BA 4ASVA 2FYZA 3AEGC 4BWNA 4JQ0D 1L0NJ 1JY3N 1YHQP 2G8YA 1BGYG 1SFCB 1CW5A 3KQGA 3SSUA 1L4AA 4RO0A 1JY3O 4L76A 4L74A 3H1KG 5TJHA 5BU5A 1SQBG 1NU1G 3FWNA 4HYTB 4U3FE 3KHUA 1KILA 1VL2A 4GOEA 5CJ0A 1SLQA 3W68A 3TDKA 2DW3A 3SFDC 3H1HE 4PV1D 3WU2E 2P2UA 1FZBA 5CCHA 3P8CD 3P7KA 4IOIH 1SQVE 4K3AA 1SQVJ 4EI2A 3H1LG 4KHXA 4UB8E 1Q82Q 1SQPG 5AW7B 2ZT9C 3L71D 4IFDK 2A45I 1JM0A 5KLVG 3A0BE 1PGOA 5AW9B 5KKZB 3A0HH 4QMAA 2BCCG 1RE4A 1U7MA 5APVA 3CCSP 1GL2A 2Y9ZA 1VQKP 2KS1A 2XKMA
chains in the Genus database with same CATH topology
1OVUA 4ASVA 1FC2C 2P58A 2KS1B 1U7JA 2HR3A 2KIKA 3RGUA 1OVRA 2LR2A 4HJGH 2R44A 2LXCB 1LP1A 2RKLA 4MN4C 4NPEA 1BDDA 4ASWA 1ZW0A 2QVAA 5DJUB 4EYYQ 4NPFX 2B89A 4HKZH 5DJTB 2LXBA 1LP1B 3FXEA 4NPDA 2QRXA 5C39A 1BDCA 1JMBA 3FXDA 2B88A 2SPZA 4GOEA 1MFTA 4ZMDA 2WMMA 5CBNA 4JBZA 2K3RA 1EDIA 3MHVA 1EDJA 3S1KA 3PH0A 2UWJE 4GOFA 4BXLA 2KZIA 4KJMA 2JWDA 5CBOA 1NVOA 2I8DA 2M5AB 1Q2NA 4IOIH 2KZJA 4K3AA 1EDLA 3MZWB 2M0BA 1X0TA 1DEEG 2M5AA 3ZDMA 1SS1A 4CPGA 3QWOC 1OVVA 2B87A 4HB1A 1JM0A 1S3JA 1Y47A 1ZXGA 2ZAEB 1EC5A 1H0TA 2KI7B 4WWIA 2OTKE 4K35A 2Q1KA 2B87B 4ZNCA 5K5GB 1EDKA 1LT1A 4GODA 1U7MA 2KUBA 5EFWB 1H0TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVU A;  4ASV A;  1FC2 C;  2P58 A;  2KS1 B;  1U7J A;  2HR3 A;  2KIK A;  3RGU A;  1OVR A;  2LR2 A;  4HJG H;  2R44 A;  2LXC B;  1LP1 A;  2RKL A;  4MN4 C;  4NPE A;  1BDD A;  4ASW A;  1ZW0 A;  2QVA A;  5DJU B;  4EYY Q;  4NPF X;  2B89 A;  4HKZ H;  5DJT B;  2LXB A;  1LP1 B;  3FXE A;  4NPD A;  2QRX A;  5C39 A;  1BDC A;  1JMB A;  3FXD A;  2B88 A;  2SPZ A;  4GOE A;  1MFT A;  4ZMD A;  2WMM A;  5CBN A;  4JBZ A;  2K3R A;  1EDI A;  3MHV A;  1EDJ A;  3S1K A;  3PH0 A;  2UWJ E;  4GOF A;  4BXL A;  2KZI A;  4KJM A;  2JWD A;  5CBO A;  1NVO A;  2I8D A;  2M5A B;  1Q2N A;  4IOI H;  2KZJ A;  4K3A A;  1EDL A;  3MZW B;  2M0B A;  1X0T A;  1DEE G;  2M5A A;  3ZDM A;  1SS1 A;  4CPG A;  3QWO C;  1OVV A;  2B87 A;  4HB1 A;  1JM0 A;  1S3J A;  1Y47 A;  1ZXG A;  2ZAE B;  1EC5 A;  1H0T A;  2KI7 B;  4WWI A;  2OTK E;  4K35 A;  2Q1K A;  2B87 B;  4ZNC A;  5K5G B;  1EDK A;  1LT1 A;  4GOD A;  1U7M A;  2KUB A;  5EFW B;  1H0T B; 
#chains in the Genus database with same CATH topology
 3HD7 A;  1M7L A;  1FJK A;  1LT9 C;  1FZG A;  1H89 A;  2QE7 H;  2KIK A;  2ZYG A;  3TF5 A;  1LTJ A;  4H0L C;  4DT0 A;  2ZJS E;  2E74 B;  5CCG D;  3VMY A;  4ASW A;  3CC4 P;  1PP9 G;  1KQL A;  2V7Q J;  2IZ1 A;  5B66 H;  4JPZ B;  4ZKP A;  1SFC C;  2E75 C;  3SWY A;  3TNU A;  2QM8 A;  3HRN A;  1SP4 A;  1KIL E;  1KN7 A;  1RE3 C;  2FYU D;  2WSC J;  3BCC E;  3T97 B;  3L72 E;  3L72 J;  5AW6 B;  3TGU J;  1UII A;  4RJT A;  1BSH A;  1NO4 A;  2KZJ A;  2P67 A;  1LTT C;  1DEE G;  1ZP0 C;  1EZV D;  4OH8 B;  2O1K A;  1OVV A;  2I1J A;  3BCC D;  3KZI E;  1VQP P;  4W80 A;  1VQM P;  3N4X A;  1N7S A;  1GZL A;  2OYH B;  5H2F E;  3U1C A;  1K05 A;  1A02 J;  5B5E E;  1SQQ G;  1VQO P;  1HWT C;  3RK2 D;  2R3S A;  2N1T A;  1IC2 A;  5KKZ C;  1GD2 E;  1Y9B A;  3L75 D;  2GM4 A;  1VQ6 P;  3F5H A;  1Q86 Q;  3L74 E;  4PD4 D;  3GMA A;  3CCJ P;  1RHZ B;  3L74 J;  1QL1 A;  3VMA A;  4DZO A;  3L70 D;  4Z1M H;  1NTZ K;  4L73 A;  1WMK A;  1BE3 J;  1KV4 A;  1NAY A;  2O01 N;  4IL6 E;  3KPE A;  1Q2N A;  2O3J A;  2A06 G;  3L75 G;  1ZRT D;  5AVS B;  1PFI A;  4UB6 H;  3CXH H;  4C7R A;  4W7Y A;  3VOP A;  5CMZ A;  3GHG B;  1ZLL A;  3QWO C;  4WY4 B;  3PRJ A;  1X8Y A;  4HB1 A;  3RL0 g;  3Q5P A;  2ITA A;  5APW A;  2RMZ A;  1CI6 A;  2WPQ A;  1ZR4 A;  1T6A A;  2WSF J;  3U1A A;  2FYN B;  1YBK A;  1LT9 A;  2J59 M;  1KQF B;  2J5U A;  2E43 A;  1GL2 B;  3GF3 A;  2KS1 B;  3H32 B;  3HD7 B;  4PJ0 E;  2OYH C;  1YJW P;  5KJ7 D;  1L2P A;  2LXC B;  3ABV C;  2KSE A;  1SFC A;  1LGH B;  2ZYA A;  1LTJ B;  4IFF A;  5AW2 B;  3WMM 0;  1RE3 A;  1LTG C;  2V7Q H;  2K9Y A;  1PGJ A;  1CSB A;  3V2P A;  5AVY B;  1A02 F;  1YIJ P;  2WQY C;  3C1L A;  2QJK B;  5KLI B;  4Y99 B;  3KXD A;  1IFM A;  4N3Y B;  1NTZ E;  3H1J G;  2XU6 A;  3MZW B;  5AVR B;  1T8Z A;  1G1I A;  1VDF A;  3FWL A;  1NTK E;  4R4M A;  1KFM A;  2ZFC A;  1VQ5 P;  1PL5 A;  2Z5I A;  3ITK A;  2XDJ A;  3TSI A;  1SQB K;  1IFJ A;  3RK3 B;  2KI7 B;  2WWW A;  3JCU E;  1T2K D;  4LC1 A;  1EDK A;  1URQ C;  4D6T D;  1BCC J;  3CWB E;  1VQ4 P;  2WSE J;  3CWB J;  1NTM D;  3G3Z A;  2IBZ E;  3BAT A;  1N7S B;  3GHG C;  2HYN A;  1LTI C;  1FC2 C;  1NTK D;  3AE1 C;  4WY4 C;  2KNC B;  1S2E A;  2OTJ P;  1L0N K;  2P7J A;  1SQX G;  3Q1M A;  1N73 B;  1MUU A;  2PGD A;  1MKM A;  2N1T B;  2YXR B;  2FYN C;  3L73 E;  5TIS H;  4RKU J;  3L73 J;  2OAR A;  2IBZ D;  2B89 A;  3LID A;  1CZQ A;  5KLV K;  2FY8 A;  1L0L G;  1MFT A;  2WIT A;  1NKN A;  1K8A Q;  3AED C;  4HH2 A;  1RY3 A;  3CCV P;  2H88 C;  1FAV A;  5CBO A;  2I8D A;  2M5A B;  5B66 E;  3AE4 C;  2XV5 A;  2IX7 C;  3T97 A;  2AXT H;  3E1R A;  1YTZ T;  2NPS C;  2YKP A;  2HLO A;  2QJK C;  5KLI C;  4CPG A;  2FBW C;  3O8Z A;  2E76 C;  4Y99 C;  1DD3 A;  3OAK A;  1BGY J;  3P32 A;  1G2C B;  2KYV A;  1OXZ A;  3M06 A;  1EC5 A;  5AW4 B;  2Q1K A;  4TLF A;  5GTH H;  3G71 P;  2MJZ A;  1P84 H;  2WSF H;  4IL6 X;  3H1I G;  3B5N D;  1LTS C;  2CPS A;  1KQS O;  2OYH A;  3H1K J;  3AEF C;  1SQB E;  3V4Q A;  4I7Z B;  1SQB J;  1KYO D;  1NU1 J;  1LT9 B;  2QG4 A;  3V2R A;  1ZME C;  2H7H A;  1OFC X;  2JDI H;  5APS A;  3RK3 C;  4PJ0 H;  5AVX B;  1GU4 A;  1PPJ G;  1YJ9 P;  3PLN A;  2IYP A;  1FZF A;  2QVA A;  4H44 B;  1M8O B;  1L0N E;  1FU1 A;  4AYC A;  4GKG A;  3AE9 C;  1NYH A;  2E75 B;  1OW8 A;  2ZXX A;  1OWA A;  1S72 P;  1R5S A;  3H1L E;  1N73 C;  3H1L J;  4C46 A;  1SQP J;  4DCK A;  2N1T C;  1YI2 P;  2IZ0 A;  1JOC A;  1FOS F;  1JCC A;  5KLV J;  5AW0 B;  2BEZ F;  1L0N D;  1EZV I;  1U57 A;  1HUC A;  3CCU P;  2BAS A;  1EDL A;  2PFX A;  5BU8 B;  3VTP C;  2BCC J;  1J1D B;  3D6Z A;  2C9N Y;  2Z5H A;  1IK7 A;  2IDB A;  2E74 D;  4EIJ A;  3E1I A;  1K04 A;  2YIU C;  1URQ A;  3F89 A;  1S3J A;  3GHG A;  1OX3 A;  2QA4 P;  2OTK E;  3JCU H;  4WY4 A;  3B4S A;  4U3F D;  4UB6 E;  3CXH E;  4JYC A;  2WSE H;  2KUB A;  2OGU A;  1PP9 E;  3MGN A;  1KOR A;  3WUU A;  1PP9 J;  2K1A A;  5APU A;  1N2D C;  2FFD B;  1YYC A;  2Q6Q A;  3HE4 A;  2FXM A;  3H1H D;  1HBW A;  4PD4 I;  3BVH A;  1SQV D;  3AE6 C;  1N8R Q;  3D6Y A;  3PJS K;  1RF1 B;  3H32 A;  2E5T A;  3CX5 E;  3C8V A;  1FZA A;  4I7Z C;  1S1C X;  2QRX A;  4W7Z A;  2B88 A;  1AFO A;  4YTP C;  1H88 A;  2WMM A;  3BRV B;  3L71 G;  2ZXE B;  2L5G B;  1J1E B;  1VF5 D;  2FXP A;  4H44 C;  1KQG B;  1KB9 H;  4KT0 J;  3AEA C;  2NPS A;  1PV3 A;  3LW5 J;  3TYY A;  1X0T A;  3PP5 A;  3A7O A;  1OMI A;  4R4L A;  3AE8 C;  1GK4 A;  2AEJ A;  1DD4 A;  1SQQ J;  3OJA B;  4OGQ B;  4PV1 B;  1NOH A;  1L4A D;  3TGU E;  2Q5U A;  4OVN F;  1AVY A;  4WWI A;  2I1K A;  1EXI A;  3V2Q A;  1J1D C;  1HH0 A;  3IFM A;  3IN6 A;  3I56 P;  3NTN A;  1FZC C;  1KIL D;  3EQ2 A;  2FXO A;  1X79 B;  2R5D A;  3D70 A;  5CHX A;  1WT6 A;  1GDT A;  3L72 D;  3TGU D;  2WT7 B;  2R3C A;  1T3U A;  5AVV B;  2K37 A;  1OVR A;  3L4F A;  3TK1 A;  1K9M Q;  2FYU G;  2CK3 H;  2W6A A;  1VQN P;  4BRY B;  5KAI E;  1LP1 A;  2KP8 A;  4MN4 C;  5CCH D;  2KNC A;  2C0W A;  3B8E B;  2M3E A;  4U7J A;  3HUS B;  1OZH A;  3GLM A;  4DOJ A;  1N73 A;  2A06 E;  1M1K Q;  1JMB A;  3RBX A;  2FFD C;  2WPV B;  3L75 J;  2YO2 A;  4GIF A;  2QJY B;  1EZV G;  1EDJ A;  2M8R A;  3BCC G;  3VMZ A;  3VP8 A;  1RF1 C;  5TIS E;  3S1K A;  3CLQ A;  3C9I A;  3CD6 P;  4YPC A;  2JWD A;  2FKW B;  1GL2 D;  5E79 H;  4XA4 A;  4XE5 B;  1DEB A;  2B9B A;  3HD7 D;  1SQX K;  2WPS A;  3AE7 C;  2G3A A;  2M5A A;  1BE3 E;  1PGP A;  5APX A;  2Y0D A;  1J1E C;  2D2C D;  2JR8 A;  1HJ0 A;  2C9L Y;  3S9O A;  3H25 A;  2GUV A;  3L74 D;  3A2A A;  3RL0 B;  4K35 A;  2AXT E;  2A45 G;  3CCR P;  1URQ B;  2KSJ A;  4YXW H;  1G2C A;  4OGQ C;  4PV1 C;  1BE3 D;  1VPC A;  3RK3 E;  2W83 C;  2NZ2 A;  3L70 G;  5AVW B;  1LTA C;  2IBZ I;  5GTH E;  4HJG H;  2W6B A;  1P84 E;  2YKQ A;  1GU5 A;  3HE4 B;  2O01 J;  1ZW0 A;  1J2J B;  3M0D C;  3RK2 B;  4HKZ H;  3CX5 H;  3V6I A;  1W5C E;  3FXE A;  3H1J E;  3H1J J;  1R5L A;  1N86 A;  2SPZ A;  3RK3 D;  3PTZ A;  1FJP A;  2E42 A;  1KD1 Q;  1P84 D;  1N7S D;  2KB7 P;  1LTB C;  3V4W A;  2JJL A;  4WVZ A;  3CI9 A;  3HUS C;  3MTU E;  3II6 A;  3LW5 H;  3MUD C;  3G9R A;  5CCG C;  2QJY C;  2NPS B;  1XTG B;  2V4H A;  3ZDM A;  2N1T D;  1FDO A;  1SS1 A;  1DX7 A;  1R8E A;  2B87 A;  2E76 B;  3Q2Y A;  5KTB A;  1IZN B;  1XTC C;  1IFI A;  1SQX J;  1FDI A;  1FZC A;  4JYB A;  5K5G B;  3D71 A;  1KYO I;  3RBZ A;  3CC2 P;  2YO3 A;  4RES B;  3CCL P;  1S5L E;  3E7K A;  4DJG A;  3P8M C;  1QL2 A;  1L0L J;  1NU1 K;  3EFF K;  3RGU A;  3RL0 C;  1HF9 A;  3NFQ A;  5AW5 B;  1NGM B;  1DIP A;  2R44 A;  1BCC E;  1NTZ D;  2C0X A;  5KAI H;  1BDD A;  2FFD A;  1NJI Q;  4A7P A;  2ZT9 D;  4NPF X;  3Q5S A;  5DJT B;  1LP1 B;  1FOS E;  1GW3 A;  1RF1 A;  1G1J A;  3FGA D;  2A45 H;  4ZMD A;  1QLE D;  1Q7Y Q;  2Q3E A;  1HGZ A;  2JKV A;  4PD4 H;  1BSN A;  1S9K E;  1BCC D;  1JCD A;  2UWJ E;  3CWB D;  2HFE D;  1SQP K;  3RK2 C;  2K88 A;  3EFG A;  3I55 P;  1NTZ G;  4D6T G;  1M90 Q;  1NTM G;  4H0L D;  1MFZ A;  1JNM A;  2IYO A;  1FDM A;  3H1I J;  3USS A;  1NTK G;  2H89 C;  2RN0 A;  2YIU B;  3L37 A;  1HVV A;  1KB9 E;  3L73 D;  4AQR D;  3CCE P;  4N78 E;  1AV1 A;  1SFC D;  2E75 D;  1LWU B;  2Q3I A;  3L35 A;  1PPJ E;  3M9Q A;  2POH A;  1W2E A;  5EFW B;  2IBZ G;  1K73 Q;  1FZE A;  1Q90 D;  1BGY E;  2OYI B;  1KB9 D;  3M0D A;  3VMX A;  4N78 D;  1QEX A;  2WPR A;  4I6M C;  2O1J A;  4H13 B;  2WT7 A;  3G4S P;  2O01 H;  2Y9Y A;  3CCQ P;  2AXC A;  3H1K E;  2QEX P;  2E5Y A;  1AQT A;  1NU1 E;  4BRY A;  1BGY D;  1IK9 A;  1JY2 P;  2MKV A;  3HUS A;  3MIW A;  1VQ8 P;  2KXP B;  2CPB A;  3MUD A;  5CJ4 A;  1W2B O;  3GF7 A;  4KJM A;  2HOD A;  5CCG A;  1FS0 E;  3HTK B;  3H1K D;  3NMD A;  2N9Y B;  2OTL P;  1SQB D;  1UIX A;  5KJ7 C;  3M0A A;  2W90 A;  2FYU K;  1M1J B;  1SQP E;  2JWA A;  2JO1 A;  3CCM P;  1RQU A;  3MP7 B;  1IFD A;  2PRR A;  5KLV E;  1SQQ K;  1Y47 A;  1ZXG A;  3CL3 D;  3CPW O;  5E79 E;  1H0T A;  2N9B A;  5KAF H;  2YXQ B;  5L8R J;  2W27 A;  2B87 B;  2BCC E;  1ZN5 A;  1N7L A;  4B86 A;  3P8C E;  1FZC B;  3H1L D;  1S5L H;  3CME P;  1SQP D;  1JTH B;  1YJN P;  2QSI A;  2WSS H;  1LJ2 A;  4U3F J;  5KLV D;  2HR3 A;  4GT1 A;  3WUT A;  2HPC B;  1LWU C;  3K5B A;  3H6P A;  3L71 E;  3B5N B;  2BCC D;  3L71 J;  1NKZ B;  1USD A;  4OGQ D;  1YQ3 C;  3AE5 C;  1NHL A;  4TT3 H;  1L0N G;  3H1H J;  5C39 A;  5GTI H;  2OYI C;  1T2K C;  1S5L X;  1ZOY C;  2JEE A;  1IO4 A;  4JBZ A;  1OW7 A;  2ZVO B;  2QJP B;  1JEK A;  1KTM A;  4OWF A;  4H13 C;  3CXH D;  3W67 A;  4JF7 A;  1PP9 D;  2K9J B;  3R2P A;  4WB4 A;  1LNQ A;  5AVZ B;  3FX0 A;  1NAF A;  4U3F G;  5AVQ B;  5M1B A;  4Y28 J;  3IAO A;  2H43 A;  4YXD C;  3H1H G;  5APQ A;  2R32 A;  2AEM A;  3CX5 D;  2FYU E;  1JY3 P;  2FYU J;  1SQV G;  1AJY A;  4ZNC A;  3VN0 A;  4GOD A;  4C7N B;  1MV8 A;  1M1J C;  1SQQ E;  3HE5 B;  1YIT P;  1AQ5 A;  2GUS A;  3LIE A;  2Y0C A;  2NRG A;  1EZV E;  3CMA P;  1E79 H;  2RKL A;  4LGD E;  1VQ7 P;  3BCC J;  2QIW A;  1QVG O;  1KYO H;  3AEC C;  5DJU B;  3JC2 2;  1SQQ D;  3GG2 A;  1PZQ A;  3AEE C;  1P84 I;  2M3B A;  3JSV C;  3RL0 D;  1T3J A;  5CBN A;  1URQ D;  1EDI A;  1NWQ A;  4O9B A;  1JO5 A;  3B5N C;  3AE2 C;  4BXL A;  4GOF A;  5KJ7 A;  1SVF A;  1RF0 C;  4GDO A;  4WY4 D;  3BRT B;  2KOG A;  3AE3 C;  3L75 E;  2IPP A;  2YKO A;  2HOD B;  3GW6 A;  4PD4 E;  2Q9I A;  2KLU A;  1VF5 B;  2QJP C;  2W8Z A;  3M91 A;  3L72 G;  1YQ4 C;  3TGU G;  2ZAE B;  3L70 E;  3O6Q B;  3L70 J;  1JUN A;  4M3L A;  1PGQ A;  2WZ7 A;  2A06 D;  2VRS A;  3G6E P;  1TU3 F;  1H0T B;  3IF4 A;  1L4A B;  1OVU A;  3A3Y B;  4I2L C;  4WBA A;  1LWU A;  1HGV A;  1IFP A;  1ZRT E;  3CC7 P;  2YMK A;  2KK7 A;  2W6J H;  2ZVN B;  5AVU B;  2Y0E A;  2LR2 A;  1DH3 A;  4LLH A;  1D7M A;  1L0L K;  1EXJ A;  1NTM K;  2E74 C;  4NPE A;  2OYO A;  3OW2 O;  1KIL B;  2NPS D;  1OIP A;  1GMJ A;  1QX8 A;  4L75 A;  5APY A;  2OYI A;  3Q5R A;  1NTK K;  2E76 D;  3EWK A;  3NXS A;  3WU2 H;  5AVT B;  2J58 A;  1JB0 J;  1GTW A;  4EDF A;  2RH0 A;  1HTL C;  4UB8 H;  1Y8A A;  1GW4 A;  2JP3 A;  5APT A;  3PH0 A;  3WUV A;  3U59 A;  2L91 A;  2KZI A;  1MZ9 A;  3PHL A;  3L74 G;  1FE6 A;  1NVO A;  2AEF A;  3A0B H;  2PAJ A;  2XZR A;  1X22 A;  2YMY A;  1S4X A;  3HTK A;  5BVZ A;  1BE3 G;  1QGK B;  1M1J A;  2BEQ D;  3H1J D;  1KB9 I;  3VYI A;  5AW3 B;  3OA7 A;  1VF5 C;  2WVR A;  1HJB A;  2XNX A;  2D2C B;  1RH5 B;  3V2N A;  3L36 A;  2IFN A;  3SFE C;  2YNY A;  1SQX E;  2P58 A;  5KAF E;  1U7J A;  3A5T A;  1VQ9 P;  1JTH A;  2WSC H;  2LKM A;  2KLV A;  2P10 A;  3TNU B;  1L4A C;  2HPC A;  2P1J A;  1KC8 Q;  4D6T E;  3B5N A;  1NTZ J;  3Q3D A;  1L0L E;  3QH9 A;  4D6T J;  2XND H;  1NTM E;  3VP9 A;  1NTM J;  1USE A;  1SQX D;  1RF0 A;  2K3R A;  3MHV A;  1NTK J;  1GK6 A;  1KIL C;  5AW8 B;  4ZKU A;  3KZI H;  1Z56 A;  3N7N A;  1JY2 N;  1ZV8 A;  5GTI E;  5H2F H;  2M0B A;  2H8P D;  1JY2 O;  1L0L D;  3KYQ A;  5CCH C;  2K9J A;  4H13 D;  5AW1 B;  5B5E H;  3BAS A;  2R5B A;  1KMI Z;  2QM7 A;  3A0H E;  1H8A A;  1KFN A;  1Q81 Q;  1KZU B;  3H1I E;  1EQ7 A;  1OW6 A;  1IFN A;  1RE4 C;  4H44 D;  1S9K D;  3S4R A;  3R4Y A;  4C7N A;  1GL2 C;  2Z4E A;  3HD7 C;  3HE5 A;  3SWF A;  1AVO A;  4I1L A;  1BCC G;  2GA1 A;  1NH4 A;  3CWB G;  1IJD B;  2ZYD A;  1WRG A;  4EYY Q;  1LTJ C;  4N6J A;  3B71 A;  3H1I D;  3UIA A;  2D2C C;  4IL6 H;  2LXB A;  4NPD A;  1ZR2 A;  1BDC A;  3FXD A;  3CXH I;  1E5W A;  3M9H A;  1JMM A;  1SQV K;  4EOT A;  1RQV A;  2ZT9 B;  2IFM A;  1KYO E;  3AEB C;  1PPJ D;  3L73 G;  2HG5 D;  1X9V A;  1YTZ I;  3M9B A;  1QVF O;  3I5C A;  2Q7C A;  1M56 D;  4AUW A;  3CX5 I;  1PIX A;  1CI6 B;  1AA0 A;  2WTY A;  3SWK A;  2OQQ A;  1M57 D;  4XFJ A;  1VQL P;  3KDP B;  4IFM A;  3MD0 A;  4H0L B;  1NU1 D;  3IR9 A;  1LT1 A;  1FBM A;  1N7S C;  3O6Q A;  2PP6 A;  3V5B A;  4ASV A;  2FYZ A;  3AEG C;  4BWN A;  4JQ0 D;  1L0N J;  1JY3 N;  1YHQ P;  2G8Y A;  1BGY G;  1SFC B;  1CW5 A;  3KQG A;  3SSU A;  1L4A A;  4RO0 A;  1JY3 O;  4L76 A;  4L74 A;  3H1K G;  5TJH A;  5BU5 A;  1SQB G;  1NU1 G;  3FWN A;  4HYT B;  4U3F E;  3KHU A;  1KIL A;  1VL2 A;  4GOE A;  5CJ0 A;  1SLQ A;  3W68 A;  3TDK A;  2DW3 A;  3SFD C;  3H1H E;  4PV1 D;  3WU2 E;  2P2U A;  1FZB A;  5CCH A;  3P8C D;  3P7K A;  4IOI H;  1SQV E;  4K3A A;  1SQV J;  4EI2 A;  3H1L G;  4KHX A;  4UB8 E;  1Q82 Q;  1SQP G;  5AW7 B;  2ZT9 C;  3L71 D;  4IFD K;  2A45 I;  1JM0 A;  5KLV G;  3A0B E;  1PGO A;  5AW9 B;  5KKZ B;  3A0H H;  4QMA A;  2BCC G;  1RE4 A;  1U7M A;  5APV A;  3CCS P;  1GL2 A;  2Y9Z A;  1VQK P;  2KS1 A;  2XKM A; 
#chains in the Genus database with same CATH homology
 1OVU A;  4ASV A;  1FC2 C;  2P58 A;  2KS1 B;  1U7J A;  2HR3 A;  2KIK A;  3RGU A;  1OVR A;  2LR2 A;  4HJG H;  2R44 A;  2LXC B;  1LP1 A;  2RKL A;  4MN4 C;  4NPE A;  1BDD A;  4ASW A;  1ZW0 A;  2QVA A;  5DJU B;  4EYY Q;  4NPF X;  2B89 A;  4HKZ H;  5DJT B;  2LXB A;  1LP1 B;  3FXE A;  4NPD A;  2QRX A;  5C39 A;  1BDC A;  1JMB A;  3FXD A;  2B88 A;  2SPZ A;  4GOE A;  1MFT A;  4ZMD A;  2WMM A;  5CBN A;  4JBZ A;  2K3R A;  1EDI A;  3MHV A;  1EDJ A;  3S1K A;  3PH0 A;  2UWJ E;  4GOF A;  4BXL A;  2KZI A;  4KJM A;  2JWD A;  5CBO A;  1NVO A;  2I8D A;  2M5A B;  1Q2N A;  4IOI H;  2KZJ A;  4K3A A;  1EDL A;  3MZW B;  2M0B A;  1X0T A;  1DEE G;  2M5A A;  3ZDM A;  1SS1 A;  4CPG A;  3QWO C;  1OVV A;  2B87 A;  4HB1 A;  1JM0 A;  1S3J A;  1Y47 A;  1ZXG A;  2ZAE B;  1EC5 A;  1H0T A;  2KI7 B;  4WWI A;  2OTK E;  4K35 A;  2Q1K A;  2B87 B;  4ZNC A;  5K5G B;  1EDK A;  1LT1 A;  4GOD A;  1U7M A;  2KUB A;  5EFW B;  1H0T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...