1U7MA

Solution structure of a diiron protein model: due ferri(ii) turn mutant
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
b'MDYLRELYKLEQQAMKLYREASEKARNPEKKSVLQKILEDEEKHIEWLETING'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Four-helix bundle model
publication title Analysis and Design of Turns in alpha-Helical Hairpins
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 17
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1u7mA00
1U7MA 3ZDMA 2HR3A 4ZMDA 2KUBA 2B88A 2K3RA 2KS1B 1JM0A 1SS1A 2UWJE 1ZW0A 2I8DA 3MZWB 1JMBA 1EC5A 2B87A 1OVVA 3FXEA 2WMMA 5DJUB 2LXCB 2P58A 1Y47A 5EFWB 2B87B 1H0TB 2R44A 4NPEA 3MHVA 1EDIA 1EDJA 1ZXGA 1BDCA 4ZNCA 5C39A 4ASVA 2KIKA 2KZIA 2SPZA 4IOIH 4ASWA 4WWIA 2KZJA 1Q2NA 4HJGH 1OVUA 5DJTB 1EDLA 2M5AA 1X0TA 3QWOC 4MN4C 2Q1KA 4HKZH 1LT1A 4GOFA 5CBOA 2M5AB 5K5GB 4KJMA 4GOEA 3S1KA 2RKLA 3PH0A 2JWDA 4NPFX 1LP1A 4K35A 3FXDA 4JBZA 4EYYQ 3RGUA 2KI7B 2QVAA 1FC2C 5CBNA 2QRXA 2M0BA 1NVOA 4CPGA 4NPDA 1BDDA 1LP1B 4K3AA 4HB1A 2B89A 2LXBA 1OVRA 1MFTA 2OTKE 1EDKA 1DEEG 1U7JA 2ZAEB 4GODA 1H0TA 1S3JA 2LR2A 4BXLA
chains in the Genus database with same CATH superfamily
3ITKA 1S5LX 3EQ2A 1NH4A 3UIAA 2E74D 5AW7B 1OW8A 1IFJA 2I1KA 3H1IE 3GMAA 1Y47A 1GL2D 1NTZD 4Y99B 2E74C 2OYOA 1G2CA 1OFCX 1X22A 4WBAA 4PD4D 3TF5A 3AE3C 5KLVE 1PGPA 1GL2C 3LW5J 3M0DA 5AVWB 1IFIA 4I1LA 1Q2NA 1JY3P 2M5AA 4LLHA 4WY4A 3BATA 3B5ND 1JY3N 3O6QA 3WMM0 4GDOA 2YIUB 2KNCA 2QIWA 1ZLLA 3H1JJ 2FFDA 1FC2C 1NVOA 3B5NC 1YITP 1SQQK 3VN0A 2IDBA 1L0LJ 4RKUJ 3L74D 3MUDC 1FS0E 1SQBE 1BCCD 1AQTA 2IBZD 4N3YB 1PPJD 1OWAA 3P32A 1NAFA 5APYA 1M1KQ 3H1HD 2WSCJ 3CLQA 2FYUG 4EOTA 2IFNA 2HPCA 5CCHA 2QJKC 1EC5A 1N7SA 1A02J 3RK3E 1NTKE 1LT9A 3PLNA 3H1KE 1Y8AA 1FBMA 3CCVP 3MHVA 1N73A 1VQMP 4O9BA 3L72E 2A06D 4H13C 3GHGA 3N7NA 1L2PA 2KIKA 2OYIC 1KILD 1M90Q 1ZN5A 1EZVE 1RE4C 1SQBG 3VTPC 2XDJA 2BCCJ 3KQGA 1AV1A 1LJ2A 3HTKA 1RF0C 1GK6A 1KV4A 1KILC 2KS1A 2O01N 1PGJA 1LTIC 5BU8B 2KOGA 3VP8A 3MD0A 5APQA 4AYCA 1R8EA 3Q3DA 1SFCD 3L70J 3L75J 4RESB 4B86A 2YO2A 1AVYA 1PP9J 1NGMB 1YHQP 2PAJA 1H88A 1SFCC 1VPCA 4JQ0D 3L72G 3CC4P 1FE6A 2IX7C 4IFFA 4C7RA 1KD1Q 1IFNA 1FJKA 3WU2H 3T97B 1YIJP 1NU1D 3FXEA 2JJLA 1URQA 2QSIA 3CC2P 1HGVA 2B9BA 4A7PA 5CMZA 2Y0CA 1HWTC 4AQRD 1NTMJ 1JO5A 1LTGC 3EFFK 1FOSF 3HD7A 2Z5IA 1M8OB 1FJPA 3TGUJ 3WU2E 3V2RA 2YIUC 4XFJA 2N9BA 3L73J 3M06A 1SLQA 1BGYJ 5KLIB 1EQ7A 3CWBJ 1SQXE 1FDMA 1FZEA 3CCSP 2W6JH 5KLVK 1BE3J 3AEFC 1QVGO 4BRYB 1QL2A 2C0WA 3FXDA 2IZ0A 4EYYQ 2N1TA 1KB9E 2A45G 1LTBC 1YJNP 1VF5D 4NPDA 1SQPG 2QM8A 2YMKA 3L37A 2P2UA 2FKWB 1AFOA 4EDFA 1JY2O 3II6A 2AEMA 2GUSA 3H1JD 1VF5C 2P1JA 1ZOYC 1OX3A 1GU5A 2R5BA 2HR3A 1L0LD 1SS1A 3C1LA 1CI6A 2XKMA 4RJTA 2H89C 3AE9C 1Q82Q 2NPSA 4OH8B 1SQXG 5KAFH 3AE6C 5KJ7D 2HG5D 1FU1A 3U59A 3AEDC 1SP4A 5TISH 4ASVA 2N9YB 2PRRA 4YTPC 3SWKA 1L4AB 1NTKK 3P8CD 5KJ7C 5DJTB 3M9HA 1HTLC 5H2FH 2OTJP 1KQSO 4HKZH 3A0BH 3CX5H 5KAFE 2ZT9B 3PH0A 3SSUA 3L36A 2BCCD 2E5TA 3F89A 2ZYGA 3BCCG 5TISE 1VQKP 2FYUJ 1LP1B 2W8ZA 1NHLA 5AVRB 2LXBA 1SQQE 1J1EB 5H2FE 4U3FE 2FYZA 3KXDA 2IZ1A 2KK7A 2V7QH 3A0BE 3CX5E 3WUTA 2FXOA 2Q3IA 3B71A 3L75D 3CXHI 2D2CB 1NKNA 1CW5A 4OGQB 3HE5A 3D70A 3M9BA 5AW5B 2B87A 2XNXA 5CJ4A 1GL2A 4I7ZB 1SQBJ 3SWYA 2V4HA 2OYHB 3IAOA 3CMEP 1H0TB 3IFMA 2R44A 2CK3H 2RMZA 1M1JA 3R4YA 1G1IA 1JB0J 4N78E 3HUSB 4TLFA 3BASA 3CXHH 3A3YB 2Q6QA 1JTHA 1AQ5A 3RBZA 1SQQG 1LNQA 2R5DA 1N86A 1FZAA 1NTMD 2YXRB 1R5LA 3B5NA 4DZOA 2E75B 3RL0D 4PV1D 3S1KA 2Q7CA 4LGDE 1L0NE 3TGUD 2L5GB 3IR9A 3MUDA 4L75A 1VQOP 3L73D 1SQVK 3EFGA 3KZIH 2KI7B 3L72J 1RQUA 1PIXA 2IYPA 4PD4I 1LTAC 3CMAP 3CWBD 5GTHH 1D7MA 2QJPB 1HBWA 1BE3D 2B89A 1XTCC 1MFTA 1EDKA 1MV8A 1YTZT 2ZFCA 1AJYA 1KC8Q 1S72P 2IYOA 2B88A 2WSSH 3RBXA 3KDPB 3KZIE 3RK3B 3C8VA 2GA1A 2ZXEB 1NYHA 3SFEC 5KAIH 1P84I 3H1LE 5GTHE 2O01J 3B4SA 2OYIA 1FZCB 2E76D 4IL6E 1YI2P 4M3LA 1KYOI 1JNMA 1KMIZ 2HLOA 1RE4A 2IBZI 3AEEC 1KN7A 1RF0A 1EDJA 1ZMEC 4N6JA 1KILA 2E76C 4D6TE 3TK1A 2CPBA 2E43A 3AE8C 2ZT9C 1VQLP 1OVUA 1VQ9P 4L76A 1RF1A 3IF4A 2OARA 1SQPJ 5KAIE 5L8RJ 2BEZF 3EWKA 4KHXA 3AE1C 2M5AB 5AVUB 3OAKA 4YXWH 2D2CD 4WY4B 5AW2B 2QVAA 4OGQD 1X8YA 1SFCA 3H1LG 2XV5A 1BDDA 1A02F 1R5SA 2D2CC 2FFDB 3KPEA 3WUUA 1OMIA 1Y9BA 2ZAEB 1J1DC 4OGQC 4GODA 2AXCA 1PZQA 1SQXJ 2Q3EA 2WQYC 2KYVA 3GF7A 4OVNF 2FYUD 1P84D 4D6TG 3LIEA 3MP7B 3H1IG 1BCCE 2OYHC 3HRNA 1KYOD 2HPCB 5AVZB 2O3JA 4RO0A 5KLVG 4Z1MH 2E75D 3A5TA 1LT9B 1ZXGA 2M3EA 4YPCA 1PGOA 1IJDB 4ASWA 4H0LB 2RH0A 1SQBD 2E75C 1KFMA 4H13D 1PGQA 3GHGB 3PTZA 4EIJA 1EDLA 3BCCJ 2P67A 2A06E 1LT1A 2W6BA 1KTMA 4DCKA 3V4QA 1LTJC 1KILE 2QJPC 4GOEA 3BVHA 3D6YA 3HTKB 4W80A 1ZRTE 1T2KC 3S4RA 1UIXA 2K9YA 3RK3D 1N2DC 5M1BA 1HJBA 1T3UA 1L0NK 3NFQA 1Z56A 3N4XA 3L72D 3RK3C 3FGAD 3V2QA 2J59M 2XU6A 4L73A 1FZCC 2WPSA 2QM7A 1WT6A 1NTKG 1S9KE 3H1KG 1JY3O 1OXZA 2PFXA 1FAVA 3CCMP 1SQQJ 1PL5A 2KXPB 5DJUB 4H44B 3Q2YA 2H7HA 5KJ7A 2M3BA 2K1AA 1NU1E 1URQB 4C46A 4NPEA 4W7ZA 3AEBC 3ABVC 3RL0g 1EZVG 4Y99C 4WY4D 1OIPA 1DD3A 1FDIA 3P7KA 3LW5H 1KB9I 5CHXA 2R3CA 2QEXP 2WSFH 1YJWP 1K73Q 1G1JA 4WY4C 5AVXB 1KORA 3HD7B 1N8RQ 1RH5B 1AVOA 1GZLA 2M8RA 1S5LH 5CBOA 2WZ7A 1VQ6P 3CCUP 5AVSB 1SVFA 4NPFX 1NTZK 3G9RA 1SQVE 1SQPD 2ZVNB 3T97A 1IK7A 1TU3F 1X79B 1QX8A 4HB1A 4R4LA 3V5BA 2K9JA 1OVRA 2N1TB 2OTKE 1S5LE 3GLMA 1VQNP 2WVRA 1LWUB 2KSEA 2WSCH 5AW1B 4IL6X 1IK9A 2C0XA 1VQ4P 1DH3A 1PFIA 1SQXD 1GK4A 4JF7A 2JEEA 2WSEH 1CI6B 2YXQB 1K8AQ 1RY3A 1KB9D 2H43A 2NPSB 1XTGB 1MFZA 3CC7P 4GT1A 1SQVG 1RE3C 3CCJP 5C39A 2WITA 4GKGA 5AW3B 3FX0A 3TYYA 2J5UA 4UB8H 3SFDC 3L71E 2DW3A 2JR8A 3H1LJ 3QWOC 2J58A 2HODA 3CL3D 1HUCA 4U7JA 2YMYA 1HH0A 3A7OA 4I2LC 3I55P 3P8CE 2WPRA 3BCCD 2C9NY 3AEGC 3E1RA 2W83C 3KHUA 1U57A 4D6TJ 3H1IJ 5B66H 4UB8E 4YXDC 5E79H 5CCGD 2BCCE 5KLVJ 2KUBA 1EXJA 2Y0EA 1NKZB 1S2EA 5CCGC 4H44C 3L71G 3MZWB 4GIFA 1E79H 1KFNA 3TNUA 3L70E 1NO4A 2AXTH 3HE5B 3RK2B 3V2PA 5B66E 1PP9E 2OQQA 2Q5UA 5EFWB 5E79E 2B87B 3AECC 4C7NB 1T3JA 3W67A 2ZVOB 1EDIA 4AUWA 3HD7C 3OW2O 1SQQD 2WPQA 1M1JB 3VMZA 3L4FA 2KSJA 3B8EB 3PJSK 1YYCA 2WWWA 1NU1K 3OA7A 2AXTE 1IC2A 3Q5RA 5KLIC 2FYNB 1Q81Q 2N1TC 1JCCA 4K35A 2ZYDA 3HE4A 3B5NB 2ZYAA 1NTME 1HF9A 4QMAA 2H88C 5CBNA 2QRXA 4Y28J 4LC1A 4U3FG 1LWUC 1VL2A 1NTKJ 1PP9G 5GTIH 2JDIH 1JEKA 3H1KJ 1DEEG 1CSBA 3L73E 1GTWA 1BGYE 4N78D 1H0TA 2YKQA 3AEAC 2NPSD 3CWBE 1CZQA 3VP9A 1K9MQ 4ZMDA 1BE3E 1WMKA 2QJKB 2K3RA 3CXHE 1DEBA 1ZR4A 3H32B 2YNYA 3SWFA 4BWNA 4I6MC 4DOJA 1YTZI 2NPSC 3MTUE 3AE5C 4WVZA 1VQ8P 4DJGA 5GTIE 1M57D 3VYIA 2MKVA 1ZV8A 5APWA 2FXMA 1BDCA 1L4AD 4ZNCA 4PD4H 1LTJA 1FOSE 1L0LK 4HJGH 1GMJA 1KILB 1BGYG 3O8ZA 1L0NG 1L4AC 2ZT9D 2Q1KA 5APUA 2G3AA 3MIWA 1RF1B 5AW0B 1HJ0A 3NXSA 4XA4A 2E42A 3Q5SA 1G2CB 3PRJA 1NTZE 3H1LD 3TSIA 2KB7P 2KP8A 5APVA 4PD4E 1QLED 2WT7A 3M0AA 4K3AA 1P84H 1IO4A 1LTTC 1FZCA 3RK2D 1U7JA 5AVQB 1SFCB 1KYOH 1IFPA 5AW4B 2WTYA 1J1EC 4D6TD 2JWAA 1FZFA 3H1ID 2ZXXA 3O6QB 3RK2C 2QE7H 2KNCB 3A2AA 1SQVJ 2GM4A 2JO1A 1JCDA 2YKOA 4HYTB 1KQFB 2FYUE 5KLVD 1P84E 2QJYB 1GDTA 2WSFJ 1M1JC 2JKVA 1JOCA 1USDA 4I7ZC 1KYOE 3FWLA 3L74E 1Q7YQ 1NTZG 2Y0DA 1PV3A 3WUVA 3F5HA 2IBZE 3V4WA 1PPJE 4XE5B 2HFED 2KZIA 4IOIH 1EZVI 3HUSC 3H1HE 2FYNC 1MZ9A 5KTBA 1GW4A 4HH2A 1NWQA 2OGUA 1N7SB 2YO3A 2Z4EA 1IFDA 5K5GB 4JYCA 2C9LY 2NZ2A 5CJ0A 1JMMA 3GW6A 1N73B 3RGUA 1Q90D 2ITAA 4JYBA 1T2KD 3L71J 1YJ9P 1VF5B 2O1JA 2MJZA 5AW8B 2W6AA 3L74G 2WSEJ 4BXLA 2P10A 1BCCG 1N7LA 2IBZG 2CPSA 1NTMK 1PPJG 1NTKD 1H89A 2KS1B 3H1KD 2A45I 3H1HG 2I8DA 1NJIQ 3AE4C 3CCEP 1RE3A 2O01H 1JY2P 2K88A 2BASA 4L74A 1H8AA 2P58A 1ZRTD 1EXIA 1EZVD 1NOHA 1OW6A 1JY2N 3PP5A 5AVTB 1RQVA 2A06G 1RF1C 3V2NA 2A45H 1KZUB 2O1KA 3G6EP 1QGKB 3G4SP 4U3FJ 4MN4C 1BSNA 3CCRP 3L35A 1OW7A 3IN6A 4KJMA 3M0DC 2RKLA 1S9KD 2OTLP 2G8YA 3GG2A 3G3ZA 2IFMA 2XZRA 5KKZB 1FZBA 3MGNA 2HYNA 5TJHA 1VQPP 5CCGA 1SQPE 1W2EA 1S3JA 1J2JB 1MUUA 2FFDC 2K9JB 3K5BA 3E1IA 2V7QJ 2PGDA 3I56P 2QJYC 1S1CX 4TT3H 2R32A 2Y9YA 1JM0A 1KB9H 3R2PA 3U1AA 1ZW0A 2QG4A 3BRVB 5CCHD 1NU1G 1N7SD 2I1JA 2Y9ZA 1L0NJ 1E5WA 1SQVD 5CCHC 4ZKPA 3JSVC 4H0LD 3OJAB 3H1JE 4OWFA 1N7SC 1X9VA 2FYUK 3CPWO 2NRGA 1LT9C 3V6IA 3H6PA 3G71P 2KZJA 1K04A 1L0LE 3CI9A 4H0LC 3KYQA 2K37A 1N73C 2FY8A 3AE7C 4BRYA 3Q5PA 3CCQP 1VDFA 3GHGC 5BVZA 1GU4A 2KLUA 1LWUA 1K05A 5BU5A 3VOPA 3D6ZA 2BEQD 3Q1MA 3BRTB 3H25A 3W68A 2HODB 3NTNA 4ZKUA 3RL0B 4PV1B 2JP3A 2P7JA 3FWNA 1DIPA 1LGHB 4IFMA 4KT0J 1SQBK 4UB6H 3BCCE 3S9OA 2LR2A 1GW3A 3CX5I 1DD4A 1M56D 4WB4A 3H1JG 2VRSA 3L71D 3VMAA 3I5CA 2W90A 1NTZJ 1ZR2A 4IFDK 1L0LG 1JMBA 1VQ7P 2GUVA 4H44D 1IFMA 2WMMA 2QA4P 1URQD 4UB6E 2KLVA 3D71A 3E7KA 3TNUB 2E76B 1MKMA 1L4AA 2PP6A 3JCUH 2YKPA 3M9QA 1URQC 3AE2C 1DX7A 4WWIA 3LIDA 1GD2E 3HD7D 2E74B 3L75E 3CD6P 1YQ4C 3VMXA 3VMYA 1GL2B 1UIIA 5KKZC 3GF3A 3CCLP 2FXPA 1KQLA 2XNDH 1VQ5P 3L74J 1LP1A 4JBZA 4W7YA 1BCCJ 4U3FD 2E5YA 3JCUE 3L70D 1NAYA 3QH9A 1PP9D 2R3SA 2N1TD 2M0BA 2Q9IA 2IPPA 2BCCG 1ZP0C 3CX5D 4CPGA 1J1DB 1YBKA 3HE4B 2H8PD 3H1HJ 1JTHB 4DT0A 1BSHA 5AVYB 4C7NA 1USEA 1HVVA 4PJ0H 3P8MC 1U7MA 3ZDMA 1KQGB 3NMDA 5APSA 3M91A 2UWJE 2ZJSE 3L70G 3L75G 2L91A 1QL1A 1Q86Q 3TGUE 1YQ3C 3U1CA 1FDOA 1OVVA 1SQPK 5APTA 2OYHA 3TDKA 1T8ZA 5B5EH 1RHZB 2LXCB 1T6AA 1S4XA 3HUSA 2AEFA 1LTSC 4JPZB 5AW9B 1QEXA 1QVFO 4PJ0E 1W5CE 2SPZA 3PHLA 2FBWC 1BGYD 1L0ND 2LKMA 1X0TA 1LTJB 3USSA 3RL0C 4PV1C 3A0HH 4H13B 1SQXK 4GOFA 3JC22 5B5EE 4IL6H 2AEJA 4R4MA 2OYIB 3CXHD 1NTMG 2JWDA 2W27A 1AA0A 3C9IA 3H32A 1JUNA 3TGUG 2POHA 3L73G 2WPVB 1M7LA 5APXA 3CWBG 1WRGA 1HGZA 1FZGA 1BE3G 2WT7B 2RN0A 3A0HE 1NU1J 1W2BO 5AW6B 2Z5HA 1OZHA 1IZNB 4EI2A 5AVVB
chains in the Genus database with same CATH topology
1U7MA 3ZDMA 2HR3A 4ZMDA 2KUBA 2B88A 2K3RA 2KS1B 1JM0A 1SS1A 2UWJE 1ZW0A 2I8DA 3MZWB 1JMBA 1EC5A 2B87A 1OVVA 3FXEA 2WMMA 5DJUB 2LXCB 2P58A 1Y47A 5EFWB 2B87B 1H0TB 2R44A 4NPEA 3MHVA 1EDIA 1EDJA 1ZXGA 1BDCA 4ZNCA 5C39A 4ASVA 2KIKA 2KZIA 2SPZA 4IOIH 4ASWA 4WWIA 2KZJA 1Q2NA 4HJGH 1OVUA 5DJTB 1EDLA 2M5AA 1X0TA 3QWOC 4MN4C 2Q1KA 4HKZH 1LT1A 4GOFA 5CBOA 2M5AB 5K5GB 4KJMA 4GOEA 3S1KA 2RKLA 3PH0A 2JWDA 4NPFX 1LP1A 4K35A 3FXDA 4JBZA 4EYYQ 3RGUA 2KI7B 2QVAA 1FC2C 5CBNA 2QRXA 2M0BA 1NVOA 4CPGA 4NPDA 1BDDA 1LP1B 4K3AA 4HB1A 2B89A 2LXBA 1OVRA 1MFTA 2OTKE 1EDKA 1DEEG 1U7JA 2ZAEB 4GODA 1H0TA 1S3JA 2LR2A 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7M A;  3ZDM A;  2HR3 A;  4ZMD A;  2KUB A;  2B88 A;  2K3R A;  2KS1 B;  1JM0 A;  1SS1 A;  2UWJ E;  1ZW0 A;  2I8D A;  3MZW B;  1JMB A;  1EC5 A;  2B87 A;  1OVV A;  3FXE A;  2WMM A;  5DJU B;  2LXC B;  2P58 A;  1Y47 A;  5EFW B;  2B87 B;  1H0T B;  2R44 A;  4NPE A;  3MHV A;  1EDI A;  1EDJ A;  1ZXG A;  1BDC A;  4ZNC A;  5C39 A;  4ASV A;  2KIK A;  2KZI A;  2SPZ A;  4IOI H;  4ASW A;  4WWI A;  2KZJ A;  1Q2N A;  4HJG H;  1OVU A;  5DJT B;  1EDL A;  2M5A A;  1X0T A;  3QWO C;  4MN4 C;  2Q1K A;  4HKZ H;  1LT1 A;  4GOF A;  5CBO A;  2M5A B;  5K5G B;  4KJM A;  4GOE A;  3S1K A;  2RKL A;  3PH0 A;  2JWD A;  4NPF X;  1LP1 A;  4K35 A;  3FXD A;  4JBZ A;  4EYY Q;  3RGU A;  2KI7 B;  2QVA A;  1FC2 C;  5CBN A;  2QRX A;  2M0B A;  1NVO A;  4CPG A;  4NPD A;  1BDD A;  1LP1 B;  4K3A A;  4HB1 A;  2B89 A;  2LXB A;  1OVR A;  1MFT A;  2OTK E;  1EDK A;  1DEE G;  1U7J A;  2ZAE B;  4GOD A;  1H0T A;  1S3J A;  2LR2 A;  4BXL A; 
#chains in the Genus database with same CATH topology
 3ITK A;  1S5L X;  3EQ2 A;  1NH4 A;  3UIA A;  2E74 D;  5AW7 B;  1OW8 A;  1IFJ A;  2I1K A;  3H1I E;  3GMA A;  1Y47 A;  1GL2 D;  1NTZ D;  4Y99 B;  2E74 C;  2OYO A;  1G2C A;  1OFC X;  1X22 A;  4WBA A;  4PD4 D;  3TF5 A;  3AE3 C;  5KLV E;  1PGP A;  1GL2 C;  3LW5 J;  3M0D A;  5AVW B;  1IFI A;  4I1L A;  1Q2N A;  1JY3 P;  2M5A A;  4LLH A;  4WY4 A;  3BAT A;  3B5N D;  1JY3 N;  3O6Q A;  3WMM 0;  4GDO A;  2YIU B;  2KNC A;  2QIW A;  1ZLL A;  3H1J J;  2FFD A;  1FC2 C;  1NVO A;  3B5N C;  1YIT P;  1SQQ K;  3VN0 A;  2IDB A;  1L0L J;  4RKU J;  3L74 D;  3MUD C;  1FS0 E;  1SQB E;  1BCC D;  1AQT A;  2IBZ D;  4N3Y B;  1PPJ D;  1OWA A;  3P32 A;  1NAF A;  5APY A;  1M1K Q;  3H1H D;  2WSC J;  3CLQ A;  2FYU G;  4EOT A;  2IFN A;  2HPC A;  5CCH A;  2QJK C;  1EC5 A;  1N7S A;  1A02 J;  3RK3 E;  1NTK E;  1LT9 A;  3PLN A;  3H1K E;  1Y8A A;  1FBM A;  3CCV P;  3MHV A;  1N73 A;  1VQM P;  4O9B A;  3L72 E;  2A06 D;  4H13 C;  3GHG A;  3N7N A;  1L2P A;  2KIK A;  2OYI C;  1KIL D;  1M90 Q;  1ZN5 A;  1EZV E;  1RE4 C;  1SQB G;  3VTP C;  2XDJ A;  2BCC J;  3KQG A;  1AV1 A;  1LJ2 A;  3HTK A;  1RF0 C;  1GK6 A;  1KV4 A;  1KIL C;  2KS1 A;  2O01 N;  1PGJ A;  1LTI C;  5BU8 B;  2KOG A;  3VP8 A;  3MD0 A;  5APQ A;  4AYC A;  1R8E A;  3Q3D A;  1SFC D;  3L70 J;  3L75 J;  4RES B;  4B86 A;  2YO2 A;  1AVY A;  1PP9 J;  1NGM B;  1YHQ P;  2PAJ A;  1H88 A;  1SFC C;  1VPC A;  4JQ0 D;  3L72 G;  3CC4 P;  1FE6 A;  2IX7 C;  4IFF A;  4C7R A;  1KD1 Q;  1IFN A;  1FJK A;  3WU2 H;  3T97 B;  1YIJ P;  1NU1 D;  3FXE A;  2JJL A;  1URQ A;  2QSI A;  3CC2 P;  1HGV A;  2B9B A;  4A7P A;  5CMZ A;  2Y0C A;  1HWT C;  4AQR D;  1NTM J;  1JO5 A;  1LTG C;  3EFF K;  1FOS F;  3HD7 A;  2Z5I A;  1M8O B;  1FJP A;  3TGU J;  3WU2 E;  3V2R A;  2YIU C;  4XFJ A;  2N9B A;  3L73 J;  3M06 A;  1SLQ A;  1BGY J;  5KLI B;  1EQ7 A;  3CWB J;  1SQX E;  1FDM A;  1FZE A;  3CCS P;  2W6J H;  5KLV K;  1BE3 J;  3AEF C;  1QVG O;  4BRY B;  1QL2 A;  2C0W A;  3FXD A;  2IZ0 A;  4EYY Q;  2N1T A;  1KB9 E;  2A45 G;  1LTB C;  1YJN P;  1VF5 D;  4NPD A;  1SQP G;  2QM8 A;  2YMK A;  3L37 A;  2P2U A;  2FKW B;  1AFO A;  4EDF A;  1JY2 O;  3II6 A;  2AEM A;  2GUS A;  3H1J D;  1VF5 C;  2P1J A;  1ZOY C;  1OX3 A;  1GU5 A;  2R5B A;  2HR3 A;  1L0L D;  1SS1 A;  3C1L A;  1CI6 A;  2XKM A;  4RJT A;  2H89 C;  3AE9 C;  1Q82 Q;  2NPS A;  4OH8 B;  1SQX G;  5KAF H;  3AE6 C;  5KJ7 D;  2HG5 D;  1FU1 A;  3U59 A;  3AED C;  1SP4 A;  5TIS H;  4ASV A;  2N9Y B;  2PRR A;  4YTP C;  3SWK A;  1L4A B;  1NTK K;  3P8C D;  5KJ7 C;  5DJT B;  3M9H A;  1HTL C;  5H2F H;  2OTJ P;  1KQS O;  4HKZ H;  3A0B H;  3CX5 H;  5KAF E;  2ZT9 B;  3PH0 A;  3SSU A;  3L36 A;  2BCC D;  2E5T A;  3F89 A;  2ZYG A;  3BCC G;  5TIS E;  1VQK P;  2FYU J;  1LP1 B;  2W8Z A;  1NHL A;  5AVR B;  2LXB A;  1SQQ E;  1J1E B;  5H2F E;  4U3F E;  2FYZ A;  3KXD A;  2IZ1 A;  2KK7 A;  2V7Q H;  3A0B E;  3CX5 E;  3WUT A;  2FXO A;  2Q3I A;  3B71 A;  3L75 D;  3CXH I;  2D2C B;  1NKN A;  1CW5 A;  4OGQ B;  3HE5 A;  3D70 A;  3M9B A;  5AW5 B;  2B87 A;  2XNX A;  5CJ4 A;  1GL2 A;  4I7Z B;  1SQB J;  3SWY A;  2V4H A;  2OYH B;  3IAO A;  3CME P;  1H0T B;  3IFM A;  2R44 A;  2CK3 H;  2RMZ A;  1M1J A;  3R4Y A;  1G1I A;  1JB0 J;  4N78 E;  3HUS B;  4TLF A;  3BAS A;  3CXH H;  3A3Y B;  2Q6Q A;  1JTH A;  1AQ5 A;  3RBZ A;  1SQQ G;  1LNQ A;  2R5D A;  1N86 A;  1FZA A;  1NTM D;  2YXR B;  1R5L A;  3B5N A;  4DZO A;  2E75 B;  3RL0 D;  4PV1 D;  3S1K A;  2Q7C A;  4LGD E;  1L0N E;  3TGU D;  2L5G B;  3IR9 A;  3MUD A;  4L75 A;  1VQO P;  3L73 D;  1SQV K;  3EFG A;  3KZI H;  2KI7 B;  3L72 J;  1RQU A;  1PIX A;  2IYP A;  4PD4 I;  1LTA C;  3CMA P;  3CWB D;  5GTH H;  1D7M A;  2QJP B;  1HBW A;  1BE3 D;  2B89 A;  1XTC C;  1MFT A;  1EDK A;  1MV8 A;  1YTZ T;  2ZFC A;  1AJY A;  1KC8 Q;  1S72 P;  2IYO A;  2B88 A;  2WSS H;  3RBX A;  3KDP B;  3KZI E;  3RK3 B;  3C8V A;  2GA1 A;  2ZXE B;  1NYH A;  3SFE C;  5KAI H;  1P84 I;  3H1L E;  5GTH E;  2O01 J;  3B4S A;  2OYI A;  1FZC B;  2E76 D;  4IL6 E;  1YI2 P;  4M3L A;  1KYO I;  1JNM A;  1KMI Z;  2HLO A;  1RE4 A;  2IBZ I;  3AEE C;  1KN7 A;  1RF0 A;  1EDJ A;  1ZME C;  4N6J A;  1KIL A;  2E76 C;  4D6T E;  3TK1 A;  2CPB A;  2E43 A;  3AE8 C;  2ZT9 C;  1VQL P;  1OVU A;  1VQ9 P;  4L76 A;  1RF1 A;  3IF4 A;  2OAR A;  1SQP J;  5KAI E;  5L8R J;  2BEZ F;  3EWK A;  4KHX A;  3AE1 C;  2M5A B;  5AVU B;  3OAK A;  4YXW H;  2D2C D;  4WY4 B;  5AW2 B;  2QVA A;  4OGQ D;  1X8Y A;  1SFC A;  3H1L G;  2XV5 A;  1BDD A;  1A02 F;  1R5S A;  2D2C C;  2FFD B;  3KPE A;  3WUU A;  1OMI A;  1Y9B A;  2ZAE B;  1J1D C;  4OGQ C;  4GOD A;  2AXC A;  1PZQ A;  1SQX J;  2Q3E A;  2WQY C;  2KYV A;  3GF7 A;  4OVN F;  2FYU D;  1P84 D;  4D6T G;  3LIE A;  3MP7 B;  3H1I G;  1BCC E;  2OYH C;  3HRN A;  1KYO D;  2HPC B;  5AVZ B;  2O3J A;  4RO0 A;  5KLV G;  4Z1M H;  2E75 D;  3A5T A;  1LT9 B;  1ZXG A;  2M3E A;  4YPC A;  1PGO A;  1IJD B;  4ASW A;  4H0L B;  2RH0 A;  1SQB D;  2E75 C;  1KFM A;  4H13 D;  1PGQ A;  3GHG B;  3PTZ A;  4EIJ A;  1EDL A;  3BCC J;  2P67 A;  2A06 E;  1LT1 A;  2W6B A;  1KTM A;  4DCK A;  3V4Q A;  1LTJ C;  1KIL E;  2QJP C;  4GOE A;  3BVH A;  3D6Y A;  3HTK B;  4W80 A;  1ZRT E;  1T2K C;  3S4R A;  1UIX A;  2K9Y A;  3RK3 D;  1N2D C;  5M1B A;  1HJB A;  1T3U A;  1L0N K;  3NFQ A;  1Z56 A;  3N4X A;  3L72 D;  3RK3 C;  3FGA D;  3V2Q A;  2J59 M;  2XU6 A;  4L73 A;  1FZC C;  2WPS A;  2QM7 A;  1WT6 A;  1NTK G;  1S9K E;  3H1K G;  1JY3 O;  1OXZ A;  2PFX A;  1FAV A;  3CCM P;  1SQQ J;  1PL5 A;  2KXP B;  5DJU B;  4H44 B;  3Q2Y A;  2H7H A;  5KJ7 A;  2M3B A;  2K1A A;  1NU1 E;  1URQ B;  4C46 A;  4NPE A;  4W7Z A;  3AEB C;  3ABV C;  3RL0 g;  1EZV G;  4Y99 C;  4WY4 D;  1OIP A;  1DD3 A;  1FDI A;  3P7K A;  3LW5 H;  1KB9 I;  5CHX A;  2R3C A;  2QEX P;  2WSF H;  1YJW P;  1K73 Q;  1G1J A;  4WY4 C;  5AVX B;  1KOR A;  3HD7 B;  1N8R Q;  1RH5 B;  1AVO A;  1GZL A;  2M8R A;  1S5L H;  5CBO A;  2WZ7 A;  1VQ6 P;  3CCU P;  5AVS B;  1SVF A;  4NPF X;  1NTZ K;  3G9R A;  1SQV E;  1SQP D;  2ZVN B;  3T97 A;  1IK7 A;  1TU3 F;  1X79 B;  1QX8 A;  4HB1 A;  4R4L A;  3V5B A;  2K9J A;  1OVR A;  2N1T B;  2OTK E;  1S5L E;  3GLM A;  1VQN P;  2WVR A;  1LWU B;  2KSE A;  2WSC H;  5AW1 B;  4IL6 X;  1IK9 A;  2C0X A;  1VQ4 P;  1DH3 A;  1PFI A;  1SQX D;  1GK4 A;  4JF7 A;  2JEE A;  2WSE H;  1CI6 B;  2YXQ B;  1K8A Q;  1RY3 A;  1KB9 D;  2H43 A;  2NPS B;  1XTG B;  1MFZ A;  3CC7 P;  4GT1 A;  1SQV G;  1RE3 C;  3CCJ P;  5C39 A;  2WIT A;  4GKG A;  5AW3 B;  3FX0 A;  3TYY A;  2J5U A;  4UB8 H;  3SFD C;  3L71 E;  2DW3 A;  2JR8 A;  3H1L J;  3QWO C;  2J58 A;  2HOD A;  3CL3 D;  1HUC A;  4U7J A;  2YMY A;  1HH0 A;  3A7O A;  4I2L C;  3I55 P;  3P8C E;  2WPR A;  3BCC D;  2C9N Y;  3AEG C;  3E1R A;  2W83 C;  3KHU A;  1U57 A;  4D6T J;  3H1I J;  5B66 H;  4UB8 E;  4YXD C;  5E79 H;  5CCG D;  2BCC E;  5KLV J;  2KUB A;  1EXJ A;  2Y0E A;  1NKZ B;  1S2E A;  5CCG C;  4H44 C;  3L71 G;  3MZW B;  4GIF A;  1E79 H;  1KFN A;  3TNU A;  3L70 E;  1NO4 A;  2AXT H;  3HE5 B;  3RK2 B;  3V2P A;  5B66 E;  1PP9 E;  2OQQ A;  2Q5U A;  5EFW B;  5E79 E;  2B87 B;  3AEC C;  4C7N B;  1T3J A;  3W67 A;  2ZVO B;  1EDI A;  4AUW A;  3HD7 C;  3OW2 O;  1SQQ D;  2WPQ A;  1M1J B;  3VMZ A;  3L4F A;  2KSJ A;  3B8E B;  3PJS K;  1YYC A;  2WWW A;  1NU1 K;  3OA7 A;  2AXT E;  1IC2 A;  3Q5R A;  5KLI C;  2FYN B;  1Q81 Q;  2N1T C;  1JCC A;  4K35 A;  2ZYD A;  3HE4 A;  3B5N B;  2ZYA A;  1NTM E;  1HF9 A;  4QMA A;  2H88 C;  5CBN A;  2QRX A;  4Y28 J;  4LC1 A;  4U3F G;  1LWU C;  1VL2 A;  1NTK J;  1PP9 G;  5GTI H;  2JDI H;  1JEK A;  3H1K J;  1DEE G;  1CSB A;  3L73 E;  1GTW A;  1BGY E;  4N78 D;  1H0T A;  2YKQ A;  3AEA C;  2NPS D;  3CWB E;  1CZQ A;  3VP9 A;  1K9M Q;  4ZMD A;  1BE3 E;  1WMK A;  2QJK B;  2K3R A;  3CXH E;  1DEB A;  1ZR4 A;  3H32 B;  2YNY A;  3SWF A;  4BWN A;  4I6M C;  4DOJ A;  1YTZ I;  2NPS C;  3MTU E;  3AE5 C;  4WVZ A;  1VQ8 P;  4DJG A;  5GTI E;  1M57 D;  3VYI A;  2MKV A;  1ZV8 A;  5APW A;  2FXM A;  1BDC A;  1L4A D;  4ZNC A;  4PD4 H;  1LTJ A;  1FOS E;  1L0L K;  4HJG H;  1GMJ A;  1KIL B;  1BGY G;  3O8Z A;  1L0N G;  1L4A C;  2ZT9 D;  2Q1K A;  5APU A;  2G3A A;  3MIW A;  1RF1 B;  5AW0 B;  1HJ0 A;  3NXS A;  4XA4 A;  2E42 A;  3Q5S A;  1G2C B;  3PRJ A;  1NTZ E;  3H1L D;  3TSI A;  2KB7 P;  2KP8 A;  5APV A;  4PD4 E;  1QLE D;  2WT7 A;  3M0A A;  4K3A A;  1P84 H;  1IO4 A;  1LTT C;  1FZC A;  3RK2 D;  1U7J A;  5AVQ B;  1SFC B;  1KYO H;  1IFP A;  5AW4 B;  2WTY A;  1J1E C;  4D6T D;  2JWA A;  1FZF A;  3H1I D;  2ZXX A;  3O6Q B;  3RK2 C;  2QE7 H;  2KNC B;  3A2A A;  1SQV J;  2GM4 A;  2JO1 A;  1JCD A;  2YKO A;  4HYT B;  1KQF B;  2FYU E;  5KLV D;  1P84 E;  2QJY B;  1GDT A;  2WSF J;  1M1J C;  2JKV A;  1JOC A;  1USD A;  4I7Z C;  1KYO E;  3FWL A;  3L74 E;  1Q7Y Q;  1NTZ G;  2Y0D A;  1PV3 A;  3WUV A;  3F5H A;  2IBZ E;  3V4W A;  1PPJ E;  4XE5 B;  2HFE D;  2KZI A;  4IOI H;  1EZV I;  3HUS C;  3H1H E;  2FYN C;  1MZ9 A;  5KTB A;  1GW4 A;  4HH2 A;  1NWQ A;  2OGU A;  1N7S B;  2YO3 A;  2Z4E A;  1IFD A;  5K5G B;  4JYC A;  2C9L Y;  2NZ2 A;  5CJ0 A;  1JMM A;  3GW6 A;  1N73 B;  3RGU A;  1Q90 D;  2ITA A;  4JYB A;  1T2K D;  3L71 J;  1YJ9 P;  1VF5 B;  2O1J A;  2MJZ A;  5AW8 B;  2W6A A;  3L74 G;  2WSE J;  4BXL A;  2P10 A;  1BCC G;  1N7L A;  2IBZ G;  2CPS A;  1NTM K;  1PPJ G;  1NTK D;  1H89 A;  2KS1 B;  3H1K D;  2A45 I;  3H1H G;  2I8D A;  1NJI Q;  3AE4 C;  3CCE P;  1RE3 A;  2O01 H;  1JY2 P;  2K88 A;  2BAS A;  4L74 A;  1H8A A;  2P58 A;  1ZRT D;  1EXI A;  1EZV D;  1NOH A;  1OW6 A;  1JY2 N;  3PP5 A;  5AVT B;  1RQV A;  2A06 G;  1RF1 C;  3V2N A;  2A45 H;  1KZU B;  2O1K A;  3G6E P;  1QGK B;  3G4S P;  4U3F J;  4MN4 C;  1BSN A;  3CCR P;  3L35 A;  1OW7 A;  3IN6 A;  4KJM A;  3M0D C;  2RKL A;  1S9K D;  2OTL P;  2G8Y A;  3GG2 A;  3G3Z A;  2IFM A;  2XZR A;  5KKZ B;  1FZB A;  3MGN A;  2HYN A;  5TJH A;  1VQP P;  5CCG A;  1SQP E;  1W2E A;  1S3J A;  1J2J B;  1MUU A;  2FFD C;  2K9J B;  3K5B A;  3E1I A;  2V7Q J;  2PGD A;  3I56 P;  2QJY C;  1S1C X;  4TT3 H;  2R32 A;  2Y9Y A;  1JM0 A;  1KB9 H;  3R2P A;  3U1A A;  1ZW0 A;  2QG4 A;  3BRV B;  5CCH D;  1NU1 G;  1N7S D;  2I1J A;  2Y9Z A;  1L0N J;  1E5W A;  1SQV D;  5CCH C;  4ZKP A;  3JSV C;  4H0L D;  3OJA B;  3H1J E;  4OWF A;  1N7S C;  1X9V A;  2FYU K;  3CPW O;  2NRG A;  1LT9 C;  3V6I A;  3H6P A;  3G71 P;  2KZJ A;  1K04 A;  1L0L E;  3CI9 A;  4H0L C;  3KYQ A;  2K37 A;  1N73 C;  2FY8 A;  3AE7 C;  4BRY A;  3Q5P A;  3CCQ P;  1VDF A;  3GHG C;  5BVZ A;  1GU4 A;  2KLU A;  1LWU A;  1K05 A;  5BU5 A;  3VOP A;  3D6Z A;  2BEQ D;  3Q1M A;  3BRT B;  3H25 A;  3W68 A;  2HOD B;  3NTN A;  4ZKU A;  3RL0 B;  4PV1 B;  2JP3 A;  2P7J A;  3FWN A;  1DIP A;  1LGH B;  4IFM A;  4KT0 J;  1SQB K;  4UB6 H;  3BCC E;  3S9O A;  2LR2 A;  1GW3 A;  3CX5 I;  1DD4 A;  1M56 D;  4WB4 A;  3H1J G;  2VRS A;  3L71 D;  3VMA A;  3I5C A;  2W90 A;  1NTZ J;  1ZR2 A;  4IFD K;  1L0L G;  1JMB A;  1VQ7 P;  2GUV A;  4H44 D;  1IFM A;  2WMM A;  2QA4 P;  1URQ D;  4UB6 E;  2KLV A;  3D71 A;  3E7K A;  3TNU B;  2E76 B;  1MKM A;  1L4A A;  2PP6 A;  3JCU H;  2YKP A;  3M9Q A;  1URQ C;  3AE2 C;  1DX7 A;  4WWI A;  3LID A;  1GD2 E;  3HD7 D;  2E74 B;  3L75 E;  3CD6 P;  1YQ4 C;  3VMX A;  3VMY A;  1GL2 B;  1UII A;  5KKZ C;  3GF3 A;  3CCL P;  2FXP A;  1KQL A;  2XND H;  1VQ5 P;  3L74 J;  1LP1 A;  4JBZ A;  4W7Y A;  1BCC J;  4U3F D;  2E5Y A;  3JCU E;  3L70 D;  1NAY A;  3QH9 A;  1PP9 D;  2R3S A;  2N1T D;  2M0B A;  2Q9I A;  2IPP A;  2BCC G;  1ZP0 C;  3CX5 D;  4CPG A;  1J1D B;  1YBK A;  3HE4 B;  2H8P D;  3H1H J;  1JTH B;  4DT0 A;  1BSH A;  5AVY B;  4C7N A;  1USE A;  1HVV A;  4PJ0 H;  3P8M C;  1U7M A;  3ZDM A;  1KQG B;  3NMD A;  5APS A;  3M91 A;  2UWJ E;  2ZJS E;  3L70 G;  3L75 G;  2L91 A;  1QL1 A;  1Q86 Q;  3TGU E;  1YQ3 C;  3U1C A;  1FDO A;  1OVV A;  1SQP K;  5APT A;  2OYH A;  3TDK A;  1T8Z A;  5B5E H;  1RHZ B;  2LXC B;  1T6A A;  1S4X A;  3HUS A;  2AEF A;  1LTS C;  4JPZ B;  5AW9 B;  1QEX A;  1QVF O;  4PJ0 E;  1W5C E;  2SPZ A;  3PHL A;  2FBW C;  1BGY D;  1L0N D;  2LKM A;  1X0T A;  1LTJ B;  3USS A;  3RL0 C;  4PV1 C;  3A0H H;  4H13 B;  1SQX K;  4GOF A;  3JC2 2;  5B5E E;  4IL6 H;  2AEJ A;  4R4M A;  2OYI B;  3CXH D;  1NTM G;  2JWD A;  2W27 A;  1AA0 A;  3C9I A;  3H32 A;  1JUN A;  3TGU G;  2POH A;  3L73 G;  2WPV B;  1M7L A;  5APX A;  3CWB G;  1WRG A;  1HGZ A;  1FZG A;  1BE3 G;  2WT7 B;  2RN0 A;  3A0H E;  1NU1 J;  1W2B O;  5AW6 B;  2Z5H A;  1OZH A;  1IZN B;  4EI2 A;  5AVV B; 
#chains in the Genus database with same CATH homology
 1U7M A;  3ZDM A;  2HR3 A;  4ZMD A;  2KUB A;  2B88 A;  2K3R A;  2KS1 B;  1JM0 A;  1SS1 A;  2UWJ E;  1ZW0 A;  2I8D A;  3MZW B;  1JMB A;  1EC5 A;  2B87 A;  1OVV A;  3FXE A;  2WMM A;  5DJU B;  2LXC B;  2P58 A;  1Y47 A;  5EFW B;  2B87 B;  1H0T B;  2R44 A;  4NPE A;  3MHV A;  1EDI A;  1EDJ A;  1ZXG A;  1BDC A;  4ZNC A;  5C39 A;  4ASV A;  2KIK A;  2KZI A;  2SPZ A;  4IOI H;  4ASW A;  4WWI A;  2KZJ A;  1Q2N A;  4HJG H;  1OVU A;  5DJT B;  1EDL A;  2M5A A;  1X0T A;  3QWO C;  4MN4 C;  2Q1K A;  4HKZ H;  1LT1 A;  4GOF A;  5CBO A;  2M5A B;  5K5G B;  4KJM A;  4GOE A;  3S1K A;  2RKL A;  3PH0 A;  2JWD A;  4NPF X;  1LP1 A;  4K35 A;  3FXD A;  4JBZ A;  4EYY Q;  3RGU A;  2KI7 B;  2QVA A;  1FC2 C;  5CBN A;  2QRX A;  2M0B A;  1NVO A;  4CPG A;  4NPD A;  1BDD A;  1LP1 B;  4K3A A;  4HB1 A;  2B89 A;  2LXB A;  1OVR A;  1MFT A;  2OTK E;  1EDK A;  1DEE G;  1U7J A;  2ZAE B;  4GOD A;  1H0T A;  1S3J A;  2LR2 A;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...