1U7MA

Solution structure of a diiron protein model: due ferri(ii) turn mutant
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
MDYLRELYKLEQQAMKLYREASEKARNPEKKSVLQKILEDEEKHIEWLETING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis and Design of Turns in alpha-Helical Hairpins
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
molecule keywords Four-helix bundle model
total genus 17
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1u7mA00
1X0TA 2P58A 2I8DA 1SS1A 2KS1B 3MZWB 3QWOC 4KJMA 5C39A 2ZAEB 2KZJA 1S3JA 4IOIH 2QRXA 4GODA 4K35A 4CPGA 1DEEG 1MFTA 1H0TB 2RKLA 1EDIA 5K5GB 2SPZA 4ZMDA 3S1KA 2B87B 4EYYQ 4MN4C 5DJUB 2B88A 2UWJE 2LXBA 1ZXGA 4NPDA 1BDDA 1FC2C 2HR3A 4ASVA 2Q1KA 2OTKE 1LP1A 4HKZH 4K3AA 1ZW0A 2LR2A 1OVVA 2KUBA 1JMBA 2LXCB 4HJGH 3FXEA 1BDCA 4HB1A 3FXDA 2K3RA 1EDLA 1EC5A 2KI7B 1EDJA 1OVUA 3ZDMA 4NPFX 2R44A 1LP1B 5CBNA 1OVRA 5EFWB 2WMMA 1Q2NA 4WWIA 4GOFA 2QVAA 1U7MA 1EDKA 4JBZA 2JWDA 4ZNCA 2KZIA 2M5AA 2B89A 4BXLA 1Y47A 2B87A 2KIKA 1U7JA 1JM0A 4GOEA 3PH0A 1H0TA 2M0BA 4ASWA 3RGUA 5CBOA 3MHVA 4NPEA 1LT1A 1NVOA 2M5AB 5DJTB
chains in the Genus database with same CATH superfamily
2H89C 2OARA 3CC4P 2K9YA 1NU1D 3H1IG 1AQTA 1N7SB 2GM4A 2AEMA 3L73E 1JCCA 1JY3P 3O6QA 1SLQA 2ZYGA 3CCEP 3RL0B 1N7SD 2ZYAA 5AVXB 3P7KA 5KJ7A 3TF5A 4GKGA 4AUWA 3CWBG 3BATA 1NTZK 1NU1G 2FYNB 4I6MC 1VL2A 3VOPA 1KV4A 2QRXA 2WZ7A 1RH5B 3AE6C 1EXIA 4CPGA 1PZQA 2QM7A 2QG4A 3H32A 3RK3C 2BCCG 1N73C 1W2EA 2G3AA 3SWKA 1MZ9A 3IN6A 3AEAC 5K5GB 3AE5C 1HJBA 2AEFA 4WY4A 1NTZD 4PV1C 3BCCD 3V6IA 4I1LA 1YJNP 2WSEJ 1EZVD 2B87B 3NTNA 1LTTC 2L5GB 4MN4C 2WPQA 1SQPK 2PGDA 3B8EB 1M57D 2O1KA 3H6PA 5KJ7D 2JKVA 2HPCA 3L74G 1NKZB 2QJPB 2ZXEB 5CCHD 2LXBA 3L72D 3RL0g 2QA4P 3D6YA 1ZXGA 3LW5J 5TISH 3HUSA 1JTHA 1GD2E 1RF0A 3RK3E 1QLED 3GLMA 3KZIE 2WSFJ 1RF1B 2RMZA 4UB8H 1SQBG 3JC22 4OGQD 4OWFA 1BDDA 4H44D 2KB7P 1K04A 2P67A 5AVWB 4BRYB 5L8RJ 3RL0D 5CCGD 3W68A 1OWAA 4GIFA 3K5BA 3CCJP 3H1HD 1RF1C 1URQA 4KT0J 2O01N 3HE5B 3V5BA 1PGQA 3VN0A 1LP1A 3O8ZA 2Z5IA 4RO0A 3KPEA 1N7SC 3L70J 5KLVD 3V4WA 1Y9BA 4BRYA 3G4SP 1KQGB 2LR2A 3JCUE 1FZCB 3FXEA 1N86A 5AVVB 1OFCX 4H0LD 1X22A 2ZT9C 1DIPA 1OW6A 4RESB 2C9LY 4HH2A 5GTHH 3FXDA 1VQNP 1GDTA 1SFCD 1NTKJ 3GMAA 1S9KD 1XTCC 1NOHA 1RE3A 4AQRD 1Q82Q 2AXTH 3II6A 4H13D 2KI7B 1NAYA 1GTWA 3L74D 1EDJA 2QJYC 3GHGA 1KILA 3G6EP 5B66E 2JP3A 3PHLA 1BE3G 2JEEA 2OYIA 1OVUA 1BSNA 1ZLLA 5AW4B 1LP1B 2RH0A 3R4YA 4WY4B 5CBNA 4C46A 1KB9E 1NTMK 5KLVJ 1IJDB 1XTGB 1FJKA 1NWQA 2K9JA 2FFDC 5KJ7C 2NRGA 1S4XA 1SQQD 5CCHC 3L35A 3TSIA 5APTA 2I1KA 3OAKA 3VYIA 1NO4A 1E79H 4EIJA 2FBWC 2IPPA 3P8CE 1VQ8P 2V7QJ 4I2LC 2WPVB 2YXRB 1NTMG 4LGDE 4ZNCA 1KYOD 1BE3E 1D7MA 2IFNA 4OGQC 2HFED 2W6JH 2WSFH 3D71A 3L75E 5KTBA 4DCKA 5AW8B 1OX3A 2OYOA 1R5LA 1JY2O 2KK7A 2D2CC 2W27A 3LW5H 3I56P 2B87A 3JCUH 2N1TA 1KFMA 1J1DB 2Y0DA 1U7JA 4LLHA 1ZMEC 1L0LD 1KN7A 3PP5A 2D2CB 4C7NB 4YXDC 2W8ZA 4TT3H 1NTZE 4UB6H 1J1DC 4GOEA 1SQXE 2AXCA 2E42A 1KORA 4H0LC 1BE3J 2Y0EA 1FZCC 1A02J 1KTMA 5AW3B 2FXPA 3CCMP 1PFIA 3AEGC 2HLOA 1GW4A 5AW5B 4EOTA 5CCGA 1VQ5P 2O01H 2BEQD 3L75G 2R3CA 2YMYA 1BCCG 1LTGC 1LT1A 1M1JA 3MHVA 2WTYA 1LNQA 3EQ2A 5KLIC 3Q3DA 1FOSE 1VQLP 3M9BA 1ZOYC 1T6AA 3H1IJ 1R5SA 4RJTA 2IDBA 2I8DA 1NYHA 1SS1A 3C9IA 3L37A 5H2FE 3MZWB 1CI6A 1BCCJ 1PP9G 2BCCD 2YKQA 1NKNA 3GF3A 5KAFH 4KJMA 3H1KE 2ZAEB 3M0DC 4ZKPA 1Q81Q 3IAOA 3CMEP 3L71G 1T2KD 1AJYA 3CD6P 2FFDB 4R4MA 2KZJA 2YMKA 4WVZA 3BCCE 4OH8B 1LT9C 3CCVP 2FY8A 3VMAA 1LTBC 1GZLA 3EFGA 2V7QH 5APUA 5E79E 3HUSB 3L71J 4N3YB 3MP7B 2JWAA 5CJ4A 4EDFA 2Q9IA 3NFQA 4N78D 1IZNB 3MUDC 1EDIA 1RQVA 1NH4A 1URQC 2IX7C 1YI2P 2YO3A 5TJHA 3AEFC 5AW2B 2JJLA 1CI6B 2P1JA 4L76A 3U59A 1N7SA 3L70E 3H1JE 3TGUD 4IL6H 4JPZB 2WT7B 3SWYA 1G2CB 4YPCA 1U57A 5AVSB 1DD4A 1PP9E 5APWA 3TYYA 2IBZG 2Q6QA 1PL5A 3A0HH 4L74A 2B88A 4Y99C 1VQMP 1IO4A 3WU2E 1RY3A 2A06G 3CCSP 1M90Q 1FDMA 2YIUC 1FE6A 3PJSK 1L0NG 1YITP 3CC2P 1S5LE 3IR9A 3PLNA 1VQ6P 2ZFCA 1YBKA 1K8AQ 2PP6A 3MUDA 3B4SA 1NGMB 4NPDA 2H43A 3L75D 2XV5A 1FZEA 1KILC 1KQLA 1UIIA 4U3FG 1S72P 1VF5B 3FX0A 3L73G 3CWBD 1YJ9P 2IZ0A 4XFJA 2NPSB 1AA0A 2KSJA 2WPSA 3CX5E 5AW6B 1KILB 2GUSA 4ASVA 1DEBA 3RK2C 1N73A 2P7JA 1SQVD 2NPSD 1YHQP 2Q1KA 1VDFA 3H1HJ 1FAVA 1Q7YQ 1KQSO 1NU1E 1L4AD 3IFMA 4K3AA 3T97B 1OVVA 5AW1B 4D6TJ 1BGYG 3MTUE 1FZAA 2VRSA 2BASA 3PRJA 2KYVA 1M1JB 1SQVK 3L72E 4UB8E 1JMMA 4R4LA 2E5YA 4TLFA 2K3RA 5GTHE 2E5TA 1EDLA 2FYUG 2L91A 1JCDA 1M1JC 2HPCB 1QGKB 3AE7C 3U1AA 4U3FE 1M8OB 1S1CX 1URQD 1WT6A 1KQFB 1BSHA 2XU6A 1L0ND 4DOJA 3ZDMA 2N1TC 1JEKA 1L0NJ 3B5NA 2H8PD 2R44A 4O9BA 2OYHA 1RQUA 2C9NY 3NXSA 5AVZB 2M3EA 1AV1A 1OZHA 3CI9A 4Y99B 2N9YB 1PGPA 1QL1A 3A7OA 3I5CA 5GTIH 1T8ZA 1S2EA 2FYUE 3MGNA 4PD4E 1JO5A 1VF5D 3BVHA 2WSSH 1T3UA 4PD4H 5CHXA 1R8EA 3CX5H 1KILD 3AEBC 3RBZA 1GU5A 1J1EB 1ZP0C 2IBZD 3USSA 5AVTB 1FJPA 2KZIA 3UIAA 2W6AA 3B5NC 2M5AA 2YKOA 3RK2D 1L4AB 4BXLA 5M1BA 2NPSC 1Y47A 3VMXA 3CWBE 1YQ3C 3A5TA 1VQPP 2KS1A 1L4AC 2W83C 1N7LA 2ZYDA 3VMZA 4WY4D 2FYUJ 3P8CD 3P32A 1LWUC 3CMAP 5AW7B 2ZVOB 3H1LG 1LTSC 3KZIH 4IL6E 1KFNA 3TNUA 1ZR4A 1H89A 3EFFK 2POHA 1EZVE 1X9VA 3KHUA 1LTJB 1IFJA 1Z56A 3L4FA 4PD4D 1M1KQ 1K05A 3HD7B 3PTZA 3L71D 1SQBJ 5CBOA 2XNXA 1HF9A 4H44B 1IFMA 1JY2N 2HG5D 1RE3C 2NPSA 4LC1A 1S5LH 2Q5UA 3CL3D 1VQKP 1SP4A 1GK6A 1VPCA 4BWNA 1X0TA 4H44C 1GW3A 2P58A 3E7KA 3L74E 3MIWA 3A0BH 1HBWA 3RL0C 3T97A 2N1TB 2PRRA 3LIDA 5B5EH 3A0BE 1PP9J 3O6QB 4XE5B 1A02F 2YKPA 1VQ9P 2E43A 1SQPG 2ZVNB 5B5EE 2QSIA 2FXMA 2ITAA 2KSEA 3FWNA 1BCCD 2BCCJ 2CPSA 2E74C 5AW9B 5C39A 5KAFE 1FU1A 1SQBE 2ZT9B 1QVGO 1DH3A 1JY3O 1LTAC 1DX7A 1ZN5A 2R5BA 1SFCB 4RKUJ 2LKMA 2ZT9D 5E79H 3V2RA 3L36A 1KB9H 4K35A 2RN0A 1SFCC 2QM8A 1MFTA 3B5ND 3CCQP 4JQ0D 5APXA 2XNDH 3D70A 1H0TB 1RF0C 1IC2A 2RKLA 4DJGA 1AQ5A 3CCRP 1NTZG 1NU1K 2SPZA 2WWWA 1NU1J 1JY3N 1WMKA 5APYA 3AE1C 4WY4C 1FDOA 1IFIA 1NHLA 3H1LD 1SQPE 3V2QA 2E76C 1JOCA 2J5UA 3BRVB 3P8MC 2Q3EA 1NJIQ 3L72J 3EWKA 3M91A 2E76B 2K9JB 3TGUE 2GUVA 1NTKD 1SQQK 1LTJC 5AVRB 3FWLA 1S9KE 1CSBA 4PJ0E 1N2DC 1KYOH 2AEJA 4U3FJ 3VMYA 1GU4A 1P84E 3WUTA 5AVYB 2MKVA 1K9MQ 5AW0B 4L73A 2HR3A 2N9BA 1YQ4C 2OYHC 3H32B 3Q5PA 2D2CD 3M06A 4HKZH 1LWUA 2WSEH 1QX8A 2OYHB 1YTZT 1CZQA 3CXHI 2E74D 1IFNA 1ZW0A 2FXOA 1JMBA 2QE7H 1QEXA 2LXCB 2E74B 3AE2C 1MUUA 2PAJA 1JY2P 3B71A 4HJGH 3W67A 3WUUA 4C7NA 1G2CA 3AE8C 3NMDA 2KOGA 3BRTB 4IFDK 5CCHA 1SVFA 4HYTB 3S9OA 1NAFA 1KB9D 2A45H 2W6BA 1GL2D 3RK3D 1SQXJ 3L70G 1YJWP 1HUCA 1M7LA 3RK3B 3KYQA 3CWBJ 1N73B 1HVVA 3OJAB 2H88C 1PV3A 2Z4EA 3CCLP 2W90A 3CPWO 3GF7A 2IFMA 4W7ZA 2WT7A 2IBZI 5KAIH 1FBMA 1L0LJ 3H1HG 2NZ2A 1NTMJ 5KLVK 2WPRA 3TDKA 1JUNA 2E76D 3L70D 2KLUA 3AE9C 3KQGA 2WMMA 3H1IE 1RHZB 4WWIA 1LT9B 3TNUB 2QJKC 2AXTE 1E5WA 2E75B 3HRNA 3L73D 1OW7A 4GOFA 4H13B 1U7MA 4I7ZB 5B66H 2A45G 2QJKB 4YTPC 2E75D 1EDKA 3CXHH 3A0HE 2K88A 3G3ZA 3H1KJ 2JWDA 3M0AA 2WVRA 4JBZA 1SQXD 1P84H 2KNCA 3N7NA 3WU2H 5CCGC 2YNYA 3L74J 2B89A 4EI2A 1FZFA 1USDA 5TISE 1GMJA 2CK3H 3BCCG 3OW2O 3C8VA 1SQPD 2WSCH 5APSA 2BCCE 2KIKA 4N78E 1YIJP 1SQBK 1PGJA 1ZV8A 3H1HE 1EXJA 3ABVC 1KZUB 3SFEC 1SQXK 1FZCA 1JM0A 2O3JA 1HGVA 2XKMA 3BASA 5CMZA 3AEEC 1VQ7P 1GL2B 2Y9YA 1LJ2A 5AVQB 2OTLP 1PIXA 2JDIH 2ZJSE 3HTKA 1L2PA 3M9QA 2M0BA 4Y28J 2QEXP 1VQ4P 3A3YB 1GL2C 3CXHD 4JF7A 3H1JG 5KLIB 4PJ0H 1S5LX 1FS0E 1IFDA 2FYUK 1GL2A 2O01J 3H1KD 1PPJD 3VP8A 4NPEA 1NVOA 2M5AB 3V2PA 1RF1A 3RK2B 2QJYB 1IFPA 2ZXXA 4D6TG 4Z1MH 1RE4C 2Y9ZA 3QWOC 3H1ID 2KS1B 4IL6X 1SQPJ 1L0NE 3VP9A 1IK9A 1OXZA 3R2PA 3N4XA 2FYUD 1QL2A 1KMIZ 1L4AA 1P84I 1HH0A 1USEA 2JR8A 1KB9I 2M8RA 2XZRA 2YO2A 3A2AA 3HTKB 4GDOA 2I1JA 1MV8A 4XA4A 2Q7CA 1JNMA 1YYCA 3HUSC 1W5CE 1S3JA 1NTKE 4GODA 4IFFA 1UIXA 2E75C 4H13C 4I7ZC 4IOIH 2B9BA 3IF4A 4AYCA 3D6ZA 1JTHB 1MKMA 1CW5A 2A45I 5AVUB 1URQB 1DEEG 2Z5HA 1ZR2A 4D6TE 1RE4A 2A06D 3E1IA 1AVOA 1PPJE 2K37A 2IYOA 3CX5D 4OGQB 5H2FH 2GA1A 1NTZJ 1G1IA 1BGYE 2R32A 3AE3C 3TGUJ 4M3LA 4ZMDA 2FKWB 2N1TD 1EQ7A 1ZRTD 4WBAA 3S1KA 1Q86Q 1H88A 1Y8AA 4EYYQ 1AFOA 1T3JA 3H25A 5DJUB 2YIUB 3L73J 4A7PA 3CXHE 3Q5SA 4D6TD 2OTJP 1KYOI 4H0LB 2UWJE 3Q5RA 1KC8Q 3HD7A 1SQVG 3JSVC 1H8AA 2K1AA 4ZKUA 3QH9A 1NTKG 1VF5C 1PPJG 1J1EC 2PFXA 3FGAD 3H1JD 3KDPB 4UB6E 3RBXA 2MJZA 3H1KG 3ITKA 3MD0A 3WUVA 3SWFA 3B5NB 4U3FD 1FOSF 1VQOP 1SFCA 3L75J 3LIEA 4DZOA 2J58A 1FC2C 2H7HA 5KKZB 3OA7A 1QVFO 1SQVJ 2OYIB 1L0LK 2P2UA 3Q2YA 3HE4B 1L0LE 1NTME 3BCCJ 2YXQB 3GG2A 2IZ1A 3HE5A 2OTKE 5APQA 4N6JA 3H1LJ 3CC7P 1T2KC 2KUBA 1IK7A 1OW8A 4YXWH 5BVZA 1BDCA 2C0XA 4HB1A 1PGOA 3V2NA 1K73Q 1MFZA 3TK1A 3TGUG 1N8RQ 1HTLC 3HD7D 2BEZF 3KXDA 1SQVE 2JO1A 1SQXG 3AECC 3H1JJ 2IYPA 1DD3A 1EC5A 2IBZE 2O1JA 1LTJA 3Q1MA 1HWTC 1SQQE 3U1CA 4W7YA 2KNCB 3CX5I 3F89A 3H1LE 1X79B 5KAIE 5GTIE 4KHXA 1G1JA 1LTIC 2WITA 3CLQA 1EZVG 1OIPA 4NPFX 1J2JB 2OQQA 1L0LG 1X8YA 2C0WA 2J59M 1BCCE 3SFDC 1KILE 2KLVA 2WQYC 3WMM0 1W2BO 2HODB 2Y0CA 3M0DA 3F5HA 1ZRTE 1OVRA 1M56D 5EFWB 5KLVG 2CPBA 1Q2NA 3V4QA 2FYNC 1LGHB 1P84D 1SQQJ 2HODA 4IFMA 1EZVI 5CJ0A 3C1LA 5BU5A 2P10A 2OGUA 2QVAA 2DW3A 4OVNF 1KD1Q 3VTPC 3AEDC 2G8YA 1SQBD 3L71E 4GT1A 3S4RA 3G9RA 3M9HA 5BU8B 4L75A 3GHGB 1GK4A 4JYCA 1JB0J 1SQQG 4QMAA 1L0NK 4PV1B 5KKZC 3CCUP 2KP8A 3GHGC 1FZBA 3L72G 1LWUB 2OYIC 2Q3IA 1FZGA 1FDIA 1PP9D 4PV1D 3I55P 3E1RA 2WSCJ 2XDJA 3G71P 1OMIA 1NTMD 3HE4A 4WB4A 3AE4C 1Q90D 1WRGA 2FYZA 2R3SA 2R5DA 1BE3D 1KYOE 1HJ0A 1YTZI 2KXPB 5APVA 1LT9A 1NTKK 2QJPC 5KLVE 2V4HA 1HGZA 3PH0A 4PD4I 2QIWA 2FFDA 3HD7C 4C7RA 1H0TA 4ASWA 1AVYA 3RGUA 2HYNA 4DT0A 4JYBA 2M3BA 4W80A 2A06E 4B86A 3GW6A 1BGYJ 4U7JA 5DJTB 1TU3F 1BGYD 3SSUA
chains in the Genus database with same CATH topology
1X0TA 2P58A 2I8DA 1SS1A 2KS1B 3MZWB 3QWOC 4KJMA 5C39A 2ZAEB 2KZJA 1S3JA 4IOIH 2QRXA 4GODA 4K35A 4CPGA 1DEEG 1MFTA 1H0TB 2RKLA 1EDIA 5K5GB 2SPZA 4ZMDA 3S1KA 2B87B 4EYYQ 4MN4C 5DJUB 2B88A 2UWJE 2LXBA 1ZXGA 4NPDA 1BDDA 1FC2C 2HR3A 4ASVA 2Q1KA 2OTKE 1LP1A 4HKZH 4K3AA 1ZW0A 2LR2A 1OVVA 2KUBA 1JMBA 2LXCB 4HJGH 3FXEA 1BDCA 4HB1A 3FXDA 2K3RA 1EDLA 1EC5A 2KI7B 1EDJA 1OVUA 3ZDMA 4NPFX 2R44A 1LP1B 5CBNA 1OVRA 5EFWB 2WMMA 1Q2NA 4WWIA 4GOFA 2QVAA 1U7MA 1EDKA 4JBZA 2JWDA 4ZNCA 2KZIA 2M5AA 2B89A 4BXLA 1Y47A 2B87A 2KIKA 1U7JA 1JM0A 4GOEA 3PH0A 1H0TA 2M0BA 4ASWA 3RGUA 5CBOA 3MHVA 4NPEA 1LT1A 1NVOA 2M5AB 5DJTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0T A;  2P58 A;  2I8D A;  1SS1 A;  2KS1 B;  3MZW B;  3QWO C;  4KJM A;  5C39 A;  2ZAE B;  2KZJ A;  1S3J A;  4IOI H;  2QRX A;  4GOD A;  4K35 A;  4CPG A;  1DEE G;  1MFT A;  1H0T B;  2RKL A;  1EDI A;  5K5G B;  2SPZ A;  4ZMD A;  3S1K A;  2B87 B;  4EYY Q;  4MN4 C;  5DJU B;  2B88 A;  2UWJ E;  2LXB A;  1ZXG A;  4NPD A;  1BDD A;  1FC2 C;  2HR3 A;  4ASV A;  2Q1K A;  2OTK E;  1LP1 A;  4HKZ H;  4K3A A;  1ZW0 A;  2LR2 A;  1OVV A;  2KUB A;  1JMB A;  2LXC B;  4HJG H;  3FXE A;  1BDC A;  4HB1 A;  3FXD A;  2K3R A;  1EDL A;  1EC5 A;  2KI7 B;  1EDJ A;  1OVU A;  3ZDM A;  4NPF X;  2R44 A;  1LP1 B;  5CBN A;  1OVR A;  5EFW B;  2WMM A;  1Q2N A;  4WWI A;  4GOF A;  2QVA A;  1U7M A;  1EDK A;  4JBZ A;  2JWD A;  4ZNC A;  2KZI A;  2M5A A;  2B89 A;  4BXL A;  1Y47 A;  2B87 A;  2KIK A;  1U7J A;  1JM0 A;  4GOE A;  3PH0 A;  1H0T A;  2M0B A;  4ASW A;  3RGU A;  5CBO A;  3MHV A;  4NPE A;  1LT1 A;  1NVO A;  2M5A B;  5DJT B; 
#chains in the Genus database with same CATH topology
 2H89 C;  2OAR A;  3CC4 P;  2K9Y A;  1NU1 D;  3H1I G;  1AQT A;  1N7S B;  2GM4 A;  2AEM A;  3L73 E;  1JCC A;  1JY3 P;  3O6Q A;  1SLQ A;  2ZYG A;  3CCE P;  3RL0 B;  1N7S D;  2ZYA A;  5AVX B;  3P7K A;  5KJ7 A;  3TF5 A;  4GKG A;  4AUW A;  3CWB G;  3BAT A;  1NTZ K;  1NU1 G;  2FYN B;  4I6M C;  1VL2 A;  3VOP A;  1KV4 A;  2QRX A;  2WZ7 A;  1RH5 B;  3AE6 C;  1EXI A;  4CPG A;  1PZQ A;  2QM7 A;  2QG4 A;  3H32 A;  3RK3 C;  2BCC G;  1N73 C;  1W2E A;  2G3A A;  3SWK A;  1MZ9 A;  3IN6 A;  3AEA C;  5K5G B;  3AE5 C;  1HJB A;  2AEF A;  4WY4 A;  1NTZ D;  4PV1 C;  3BCC D;  3V6I A;  4I1L A;  1YJN P;  2WSE J;  1EZV D;  2B87 B;  3NTN A;  1LTT C;  2L5G B;  4MN4 C;  2WPQ A;  1SQP K;  2PGD A;  3B8E B;  1M57 D;  2O1K A;  3H6P A;  5KJ7 D;  2JKV A;  2HPC A;  3L74 G;  1NKZ B;  2QJP B;  2ZXE B;  5CCH D;  2LXB A;  3L72 D;  3RL0 g;  2QA4 P;  3D6Y A;  1ZXG A;  3LW5 J;  5TIS H;  3HUS A;  1JTH A;  1GD2 E;  1RF0 A;  3RK3 E;  1QLE D;  3GLM A;  3KZI E;  2WSF J;  1RF1 B;  2RMZ A;  4UB8 H;  1SQB G;  3JC2 2;  4OGQ D;  4OWF A;  1BDD A;  4H44 D;  2KB7 P;  1K04 A;  2P67 A;  5AVW B;  4BRY B;  5L8R J;  3RL0 D;  5CCG D;  3W68 A;  1OWA A;  4GIF A;  3K5B A;  3CCJ P;  3H1H D;  1RF1 C;  1URQ A;  4KT0 J;  2O01 N;  3HE5 B;  3V5B A;  1PGQ A;  3VN0 A;  1LP1 A;  3O8Z A;  2Z5I A;  4RO0 A;  3KPE A;  1N7S C;  3L70 J;  5KLV D;  3V4W A;  1Y9B A;  4BRY A;  3G4S P;  1KQG B;  2LR2 A;  3JCU E;  1FZC B;  3FXE A;  1N86 A;  5AVV B;  1OFC X;  4H0L D;  1X22 A;  2ZT9 C;  1DIP A;  1OW6 A;  4RES B;  2C9L Y;  4HH2 A;  5GTH H;  3FXD A;  1VQN P;  1GDT A;  1SFC D;  1NTK J;  3GMA A;  1S9K D;  1XTC C;  1NOH A;  1RE3 A;  4AQR D;  1Q82 Q;  2AXT H;  3II6 A;  4H13 D;  2KI7 B;  1NAY A;  1GTW A;  3L74 D;  1EDJ A;  2QJY C;  3GHG A;  1KIL A;  3G6E P;  5B66 E;  2JP3 A;  3PHL A;  1BE3 G;  2JEE A;  2OYI A;  1OVU A;  1BSN A;  1ZLL A;  5AW4 B;  1LP1 B;  2RH0 A;  3R4Y A;  4WY4 B;  5CBN A;  4C46 A;  1KB9 E;  1NTM K;  5KLV J;  1IJD B;  1XTG B;  1FJK A;  1NWQ A;  2K9J A;  2FFD C;  5KJ7 C;  2NRG A;  1S4X A;  1SQQ D;  5CCH C;  3L35 A;  3TSI A;  5APT A;  2I1K A;  3OAK A;  3VYI A;  1NO4 A;  1E79 H;  4EIJ A;  2FBW C;  2IPP A;  3P8C E;  1VQ8 P;  2V7Q J;  4I2L C;  2WPV B;  2YXR B;  1NTM G;  4LGD E;  4ZNC A;  1KYO D;  1BE3 E;  1D7M A;  2IFN A;  4OGQ C;  2HFE D;  2W6J H;  2WSF H;  3D71 A;  3L75 E;  5KTB A;  4DCK A;  5AW8 B;  1OX3 A;  2OYO A;  1R5L A;  1JY2 O;  2KK7 A;  2D2C C;  2W27 A;  3LW5 H;  3I56 P;  2B87 A;  3JCU H;  2N1T A;  1KFM A;  1J1D B;  2Y0D A;  1U7J A;  4LLH A;  1ZME C;  1L0L D;  1KN7 A;  3PP5 A;  2D2C B;  4C7N B;  4YXD C;  2W8Z A;  4TT3 H;  1NTZ E;  4UB6 H;  1J1D C;  4GOE A;  1SQX E;  2AXC A;  2E42 A;  1KOR A;  4H0L C;  1BE3 J;  2Y0E A;  1FZC C;  1A02 J;  1KTM A;  5AW3 B;  2FXP A;  3CCM P;  1PFI A;  3AEG C;  2HLO A;  1GW4 A;  5AW5 B;  4EOT A;  5CCG A;  1VQ5 P;  2O01 H;  2BEQ D;  3L75 G;  2R3C A;  2YMY A;  1BCC G;  1LTG C;  1LT1 A;  1M1J A;  3MHV A;  2WTY A;  1LNQ A;  3EQ2 A;  5KLI C;  3Q3D A;  1FOS E;  1VQL P;  3M9B A;  1ZOY C;  1T6A A;  3H1I J;  1R5S A;  4RJT A;  2IDB A;  2I8D A;  1NYH A;  1SS1 A;  3C9I A;  3L37 A;  5H2F E;  3MZW B;  1CI6 A;  1BCC J;  1PP9 G;  2BCC D;  2YKQ A;  1NKN A;  3GF3 A;  5KAF H;  4KJM A;  3H1K E;  2ZAE B;  3M0D C;  4ZKP A;  1Q81 Q;  3IAO A;  3CME P;  3L71 G;  1T2K D;  1AJY A;  3CD6 P;  2FFD B;  4R4M A;  2KZJ A;  2YMK A;  4WVZ A;  3BCC E;  4OH8 B;  1LT9 C;  3CCV P;  2FY8 A;  3VMA A;  1LTB C;  1GZL A;  3EFG A;  2V7Q H;  5APU A;  5E79 E;  3HUS B;  3L71 J;  4N3Y B;  3MP7 B;  2JWA A;  5CJ4 A;  4EDF A;  2Q9I A;  3NFQ A;  4N78 D;  1IZN B;  3MUD C;  1EDI A;  1RQV A;  1NH4 A;  1URQ C;  2IX7 C;  1YI2 P;  2YO3 A;  5TJH A;  3AEF C;  5AW2 B;  2JJL A;  1CI6 B;  2P1J A;  4L76 A;  3U59 A;  1N7S A;  3L70 E;  3H1J E;  3TGU D;  4IL6 H;  4JPZ B;  2WT7 B;  3SWY A;  1G2C B;  4YPC A;  1U57 A;  5AVS B;  1DD4 A;  1PP9 E;  5APW A;  3TYY A;  2IBZ G;  2Q6Q A;  1PL5 A;  3A0H H;  4L74 A;  2B88 A;  4Y99 C;  1VQM P;  1IO4 A;  3WU2 E;  1RY3 A;  2A06 G;  3CCS P;  1M90 Q;  1FDM A;  2YIU C;  1FE6 A;  3PJS K;  1L0N G;  1YIT P;  3CC2 P;  1S5L E;  3IR9 A;  3PLN A;  1VQ6 P;  2ZFC A;  1YBK A;  1K8A Q;  2PP6 A;  3MUD A;  3B4S A;  1NGM B;  4NPD A;  2H43 A;  3L75 D;  2XV5 A;  1FZE A;  1KIL C;  1KQL A;  1UII A;  4U3F G;  1S72 P;  1VF5 B;  3FX0 A;  3L73 G;  3CWB D;  1YJ9 P;  2IZ0 A;  4XFJ A;  2NPS B;  1AA0 A;  2KSJ A;  2WPS A;  3CX5 E;  5AW6 B;  1KIL B;  2GUS A;  4ASV A;  1DEB A;  3RK2 C;  1N73 A;  2P7J A;  1SQV D;  2NPS D;  1YHQ P;  2Q1K A;  1VDF A;  3H1H J;  1FAV A;  1Q7Y Q;  1KQS O;  1NU1 E;  1L4A D;  3IFM A;  4K3A A;  3T97 B;  1OVV A;  5AW1 B;  4D6T J;  1BGY G;  3MTU E;  1FZA A;  2VRS A;  2BAS A;  3PRJ A;  2KYV A;  1M1J B;  1SQV K;  3L72 E;  4UB8 E;  1JMM A;  4R4L A;  2E5Y A;  4TLF A;  2K3R A;  5GTH E;  2E5T A;  1EDL A;  2FYU G;  2L91 A;  1JCD A;  1M1J C;  2HPC B;  1QGK B;  3AE7 C;  3U1A A;  4U3F E;  1M8O B;  1S1C X;  1URQ D;  1WT6 A;  1KQF B;  1BSH A;  2XU6 A;  1L0N D;  4DOJ A;  3ZDM A;  2N1T C;  1JEK A;  1L0N J;  3B5N A;  2H8P D;  2R44 A;  4O9B A;  2OYH A;  1RQU A;  2C9N Y;  3NXS A;  5AVZ B;  2M3E A;  1AV1 A;  1OZH A;  3CI9 A;  4Y99 B;  2N9Y B;  1PGP A;  1QL1 A;  3A7O A;  3I5C A;  5GTI H;  1T8Z A;  1S2E A;  2FYU E;  3MGN A;  4PD4 E;  1JO5 A;  1VF5 D;  3BVH A;  2WSS H;  1T3U A;  4PD4 H;  5CHX A;  1R8E A;  3CX5 H;  1KIL D;  3AEB C;  3RBZ A;  1GU5 A;  1J1E B;  1ZP0 C;  2IBZ D;  3USS A;  5AVT B;  1FJP A;  2KZI A;  3UIA A;  2W6A A;  3B5N C;  2M5A A;  2YKO A;  3RK2 D;  1L4A B;  4BXL A;  5M1B A;  2NPS C;  1Y47 A;  3VMX A;  3CWB E;  1YQ3 C;  3A5T A;  1VQP P;  2KS1 A;  1L4A C;  2W83 C;  1N7L A;  2ZYD A;  3VMZ A;  4WY4 D;  2FYU J;  3P8C D;  3P32 A;  1LWU C;  3CMA P;  5AW7 B;  2ZVO B;  3H1L G;  1LTS C;  3KZI H;  4IL6 E;  1KFN A;  3TNU A;  1ZR4 A;  1H89 A;  3EFF K;  2POH A;  1EZV E;  1X9V A;  3KHU A;  1LTJ B;  1IFJ A;  1Z56 A;  3L4F A;  4PD4 D;  1M1K Q;  1K05 A;  3HD7 B;  3PTZ A;  3L71 D;  1SQB J;  5CBO A;  2XNX A;  1HF9 A;  4H44 B;  1IFM A;  1JY2 N;  2HG5 D;  1RE3 C;  2NPS A;  4LC1 A;  1S5L H;  2Q5U A;  3CL3 D;  1VQK P;  1SP4 A;  1GK6 A;  1VPC A;  4BWN A;  1X0T A;  4H44 C;  1GW3 A;  2P58 A;  3E7K A;  3L74 E;  3MIW A;  3A0B H;  1HBW A;  3RL0 C;  3T97 A;  2N1T B;  2PRR A;  3LID A;  5B5E H;  3A0B E;  1PP9 J;  3O6Q B;  4XE5 B;  1A02 F;  2YKP A;  1VQ9 P;  2E43 A;  1SQP G;  2ZVN B;  5B5E E;  2QSI A;  2FXM A;  2ITA A;  2KSE A;  3FWN A;  1BCC D;  2BCC J;  2CPS A;  2E74 C;  5AW9 B;  5C39 A;  5KAF E;  1FU1 A;  1SQB E;  2ZT9 B;  1QVG O;  1DH3 A;  1JY3 O;  1LTA C;  1DX7 A;  1ZN5 A;  2R5B A;  1SFC B;  4RKU J;  2LKM A;  2ZT9 D;  5E79 H;  3V2R A;  3L36 A;  1KB9 H;  4K35 A;  2RN0 A;  1SFC C;  2QM8 A;  1MFT A;  3B5N D;  3CCQ P;  4JQ0 D;  5APX A;  2XND H;  3D70 A;  1H0T B;  1RF0 C;  1IC2 A;  2RKL A;  4DJG A;  1AQ5 A;  3CCR P;  1NTZ G;  1NU1 K;  2SPZ A;  2WWW A;  1NU1 J;  1JY3 N;  1WMK A;  5APY A;  3AE1 C;  4WY4 C;  1FDO A;  1IFI A;  1NHL A;  3H1L D;  1SQP E;  3V2Q A;  2E76 C;  1JOC A;  2J5U A;  3BRV B;  3P8M C;  2Q3E A;  1NJI Q;  3L72 J;  3EWK A;  3M91 A;  2E76 B;  2K9J B;  3TGU E;  2GUV A;  1NTK D;  1SQQ K;  1LTJ C;  5AVR B;  3FWL A;  1S9K E;  1CSB A;  4PJ0 E;  1N2D C;  1KYO H;  2AEJ A;  4U3F J;  3VMY A;  1GU4 A;  1P84 E;  3WUT A;  5AVY B;  2MKV A;  1K9M Q;  5AW0 B;  4L73 A;  2HR3 A;  2N9B A;  1YQ4 C;  2OYH C;  3H32 B;  3Q5P A;  2D2C D;  3M06 A;  4HKZ H;  1LWU A;  2WSE H;  1QX8 A;  2OYH B;  1YTZ T;  1CZQ A;  3CXH I;  2E74 D;  1IFN A;  1ZW0 A;  2FXO A;  1JMB A;  2QE7 H;  1QEX A;  2LXC B;  2E74 B;  3AE2 C;  1MUU A;  2PAJ A;  1JY2 P;  3B71 A;  4HJG H;  3W67 A;  3WUU A;  4C7N A;  1G2C A;  3AE8 C;  3NMD A;  2KOG A;  3BRT B;  4IFD K;  5CCH A;  1SVF A;  4HYT B;  3S9O A;  1NAF A;  1KB9 D;  2A45 H;  2W6B A;  1GL2 D;  3RK3 D;  1SQX J;  3L70 G;  1YJW P;  1HUC A;  1M7L A;  3RK3 B;  3KYQ A;  3CWB J;  1N73 B;  1HVV A;  3OJA B;  2H88 C;  1PV3 A;  2Z4E A;  3CCL P;  2W90 A;  3CPW O;  3GF7 A;  2IFM A;  4W7Z A;  2WT7 A;  2IBZ I;  5KAI H;  1FBM A;  1L0L J;  3H1H G;  2NZ2 A;  1NTM J;  5KLV K;  2WPR A;  3TDK A;  1JUN A;  2E76 D;  3L70 D;  2KLU A;  3AE9 C;  3KQG A;  2WMM A;  3H1I E;  1RHZ B;  4WWI A;  1LT9 B;  3TNU B;  2QJK C;  2AXT E;  1E5W A;  2E75 B;  3HRN A;  3L73 D;  1OW7 A;  4GOF A;  4H13 B;  1U7M A;  4I7Z B;  5B66 H;  2A45 G;  2QJK B;  4YTP C;  2E75 D;  1EDK A;  3CXH H;  3A0H E;  2K88 A;  3G3Z A;  3H1K J;  2JWD A;  3M0A A;  2WVR A;  4JBZ A;  1SQX D;  1P84 H;  2KNC A;  3N7N A;  3WU2 H;  5CCG C;  2YNY A;  3L74 J;  2B89 A;  4EI2 A;  1FZF A;  1USD A;  5TIS E;  1GMJ A;  2CK3 H;  3BCC G;  3OW2 O;  3C8V A;  1SQP D;  2WSC H;  5APS A;  2BCC E;  2KIK A;  4N78 E;  1YIJ P;  1SQB K;  1PGJ A;  1ZV8 A;  3H1H E;  1EXJ A;  3ABV C;  1KZU B;  3SFE C;  1SQX K;  1FZC A;  1JM0 A;  2O3J A;  1HGV A;  2XKM A;  3BAS A;  5CMZ A;  3AEE C;  1VQ7 P;  1GL2 B;  2Y9Y A;  1LJ2 A;  5AVQ B;  2OTL P;  1PIX A;  2JDI H;  2ZJS E;  3HTK A;  1L2P A;  3M9Q A;  2M0B A;  4Y28 J;  2QEX P;  1VQ4 P;  3A3Y B;  1GL2 C;  3CXH D;  4JF7 A;  3H1J G;  5KLI B;  4PJ0 H;  1S5L X;  1FS0 E;  1IFD A;  2FYU K;  1GL2 A;  2O01 J;  3H1K D;  1PPJ D;  3VP8 A;  4NPE A;  1NVO A;  2M5A B;  3V2P A;  1RF1 A;  3RK2 B;  2QJY B;  1IFP A;  2ZXX A;  4D6T G;  4Z1M H;  1RE4 C;  2Y9Z A;  3QWO C;  3H1I D;  2KS1 B;  4IL6 X;  1SQP J;  1L0N E;  3VP9 A;  1IK9 A;  1OXZ A;  3R2P A;  3N4X A;  2FYU D;  1QL2 A;  1KMI Z;  1L4A A;  1P84 I;  1HH0 A;  1USE A;  2JR8 A;  1KB9 I;  2M8R A;  2XZR A;  2YO2 A;  3A2A A;  3HTK B;  4GDO A;  2I1J A;  1MV8 A;  4XA4 A;  2Q7C A;  1JNM A;  1YYC A;  3HUS C;  1W5C E;  1S3J A;  1NTK E;  4GOD A;  4IFF A;  1UIX A;  2E75 C;  4H13 C;  4I7Z C;  4IOI H;  2B9B A;  3IF4 A;  4AYC A;  3D6Z A;  1JTH B;  1MKM A;  1CW5 A;  2A45 I;  5AVU B;  1URQ B;  1DEE G;  2Z5H A;  1ZR2 A;  4D6T E;  1RE4 A;  2A06 D;  3E1I A;  1AVO A;  1PPJ E;  2K37 A;  2IYO A;  3CX5 D;  4OGQ B;  5H2F H;  2GA1 A;  1NTZ J;  1G1I A;  1BGY E;  2R32 A;  3AE3 C;  3TGU J;  4M3L A;  4ZMD A;  2FKW B;  2N1T D;  1EQ7 A;  1ZRT D;  4WBA A;  3S1K A;  1Q86 Q;  1H88 A;  1Y8A A;  4EYY Q;  1AFO A;  1T3J A;  3H25 A;  5DJU B;  2YIU B;  3L73 J;  4A7P A;  3CXH E;  3Q5S A;  4D6T D;  2OTJ P;  1KYO I;  4H0L B;  2UWJ E;  3Q5R A;  1KC8 Q;  3HD7 A;  1SQV G;  3JSV C;  1H8A A;  2K1A A;  4ZKU A;  3QH9 A;  1NTK G;  1VF5 C;  1PPJ G;  1J1E C;  2PFX A;  3FGA D;  3H1J D;  3KDP B;  4UB6 E;  3RBX A;  2MJZ A;  3H1K G;  3ITK A;  3MD0 A;  3WUV A;  3SWF A;  3B5N B;  4U3F D;  1FOS F;  1VQO P;  1SFC A;  3L75 J;  3LIE A;  4DZO A;  2J58 A;  1FC2 C;  2H7H A;  5KKZ B;  3OA7 A;  1QVF O;  1SQV J;  2OYI B;  1L0L K;  2P2U A;  3Q2Y A;  3HE4 B;  1L0L E;  1NTM E;  3BCC J;  2YXQ B;  3GG2 A;  2IZ1 A;  3HE5 A;  2OTK E;  5APQ A;  4N6J A;  3H1L J;  3CC7 P;  1T2K C;  2KUB A;  1IK7 A;  1OW8 A;  4YXW H;  5BVZ A;  1BDC A;  2C0X A;  4HB1 A;  1PGO A;  3V2N A;  1K73 Q;  1MFZ A;  3TK1 A;  3TGU G;  1N8R Q;  1HTL C;  3HD7 D;  2BEZ F;  3KXD A;  1SQV E;  2JO1 A;  1SQX G;  3AEC C;  3H1J J;  2IYP A;  1DD3 A;  1EC5 A;  2IBZ E;  2O1J A;  1LTJ A;  3Q1M A;  1HWT C;  1SQQ E;  3U1C A;  4W7Y A;  2KNC B;  3CX5 I;  3F89 A;  3H1L E;  1X79 B;  5KAI E;  5GTI E;  4KHX A;  1G1J A;  1LTI C;  2WIT A;  3CLQ A;  1EZV G;  1OIP A;  4NPF X;  1J2J B;  2OQQ A;  1L0L G;  1X8Y A;  2C0W A;  2J59 M;  1BCC E;  3SFD C;  1KIL E;  2KLV A;  2WQY C;  3WMM 0;  1W2B O;  2HOD B;  2Y0C A;  3M0D A;  3F5H A;  1ZRT E;  1OVR A;  1M56 D;  5EFW B;  5KLV G;  2CPB A;  1Q2N A;  3V4Q A;  2FYN C;  1LGH B;  1P84 D;  1SQQ J;  2HOD A;  4IFM A;  1EZV I;  5CJ0 A;  3C1L A;  5BU5 A;  2P10 A;  2OGU A;  2QVA A;  2DW3 A;  4OVN F;  1KD1 Q;  3VTP C;  3AED C;  2G8Y A;  1SQB D;  3L71 E;  4GT1 A;  3S4R A;  3G9R A;  3M9H A;  5BU8 B;  4L75 A;  3GHG B;  1GK4 A;  4JYC A;  1JB0 J;  1SQQ G;  4QMA A;  1L0N K;  4PV1 B;  5KKZ C;  3CCU P;  2KP8 A;  3GHG C;  1FZB A;  3L72 G;  1LWU B;  2OYI C;  2Q3I A;  1FZG A;  1FDI A;  1PP9 D;  4PV1 D;  3I55 P;  3E1R A;  2WSC J;  2XDJ A;  3G71 P;  1OMI A;  1NTM D;  3HE4 A;  4WB4 A;  3AE4 C;  1Q90 D;  1WRG A;  2FYZ A;  2R3S A;  2R5D A;  1BE3 D;  1KYO E;  1HJ0 A;  1YTZ I;  2KXP B;  5APV A;  1LT9 A;  1NTK K;  2QJP C;  5KLV E;  2V4H A;  1HGZ A;  3PH0 A;  4PD4 I;  2QIW A;  2FFD A;  3HD7 C;  4C7R A;  1H0T A;  4ASW A;  1AVY A;  3RGU A;  2HYN A;  4DT0 A;  4JYB A;  2M3B A;  4W80 A;  2A06 E;  4B86 A;  3GW6 A;  1BGY J;  4U7J A;  5DJT B;  1TU3 F;  1BGY D;  3SSU A; 
#chains in the Genus database with same CATH homology
 1X0T A;  2P58 A;  2I8D A;  1SS1 A;  2KS1 B;  3MZW B;  3QWO C;  4KJM A;  5C39 A;  2ZAE B;  2KZJ A;  1S3J A;  4IOI H;  2QRX A;  4GOD A;  4K35 A;  4CPG A;  1DEE G;  1MFT A;  1H0T B;  2RKL A;  1EDI A;  5K5G B;  2SPZ A;  4ZMD A;  3S1K A;  2B87 B;  4EYY Q;  4MN4 C;  5DJU B;  2B88 A;  2UWJ E;  2LXB A;  1ZXG A;  4NPD A;  1BDD A;  1FC2 C;  2HR3 A;  4ASV A;  2Q1K A;  2OTK E;  1LP1 A;  4HKZ H;  4K3A A;  1ZW0 A;  2LR2 A;  1OVV A;  2KUB A;  1JMB A;  2LXC B;  4HJG H;  3FXE A;  1BDC A;  4HB1 A;  3FXD A;  2K3R A;  1EDL A;  1EC5 A;  2KI7 B;  1EDJ A;  1OVU A;  3ZDM A;  4NPF X;  2R44 A;  1LP1 B;  5CBN A;  1OVR A;  5EFW B;  2WMM A;  1Q2N A;  4WWI A;  4GOF A;  2QVA A;  1U7M A;  1EDK A;  4JBZ A;  2JWD A;  4ZNC A;  2KZI A;  2M5A A;  2B89 A;  4BXL A;  1Y47 A;  2B87 A;  2KIK A;  1U7J A;  1JM0 A;  4GOE A;  3PH0 A;  1H0T A;  2M0B A;  4ASW A;  3RGU A;  5CBO A;  3MHV A;  4NPE A;  1LT1 A;  1NVO A;  2M5A B;  5DJT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...