3H1IG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 20
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1iG00
1KYOH 1BGYG 2IBZG 1L0LG 3L73G 3CX5H 3H1JG 3L75G 2A06G 1KB9H 1NTKG 3L71G 1SQPG 1NTZG 1SQQG 1P84H 1NTMG 1SQXG 2FYUG 3H1HG 1PPJG 1NU1G 5KLVG 3L70G 1BCCG 1L0NG 4U3FG 3H1LG 3CXHH 3H1IG 3H1KG 1SQBG 3TGUG 2BCCG 1SQVG 1BE3G 3CWBG 3L72G 4D6TG 3L74G 4PD4H 3BCCG 1EZVG 1PP9G
chains in the Genus database with same CATH superfamily
1J1EC 5AW0B 1DX7A 4PD4I 1SQBJ 3KZIH 5AVSB 3K5BA 1FJPA 1W5CE 1IK7A 3TSIA 4K3AA 4KJMA 1G2CB 3A7OA 1PGPA 3CL3D 1J2JB 1FAVA 4MN4C 2E74C 1SQPD 1BCCG 2ZJSE 3H1LD 1LT1A 1OZHA 3B5NB 1FZCB 2NPSA 2HPCB 4QMAA 3L74G 4ZNCA 3L73D 2WITA 5CCHA 1RE3A 1PL5A 2E75C 2Y0DA 4L74A 5M1BA 1IZNB 1CI6B 4D6TD 3G3ZA 2ZVOB 3BCCD 2XZRA 1ZLLA 1L0LE 1URQC 3BVHA 1L4AA 3RBXA 2HR3A 2K9YA 3FX0A 2M8RA 1L0NE 1KB9I 3HE4B 1JOCA 5AVTB 1VDFA 2WSCH 3Q1MA 1AFOA 1YQ4C 1SQPJ 4C7RA 4AQRD 5APVA 1NHLA 3HTKB 4HH2A 3AE7C 1AVOA 3H1LJ 2WT7B 1MKMA 4JF7A 2QJKB 1DIPA 1YTZT 2Y9ZA 3IN6A 3HUSB 2GUSA 2CK3H 3L73J 1SQVG 2N9YB 3L72D 2OYHC 1OVVA 1PP9D 1VQLP 1NYHA 2ZYDA 1NU1K 1RF0A 3GG2A 3GHGA 2Q3EA 4C7NB 1Q86Q 3BCCJ 1HVVA 1H8AA 1FZCC 1EC5A 3RK3E 2AEFA 5AVVB 1FU1A 2YKPA 3A2AA 1BGYE 2E5TA 3MGNA 1IFNA 1NTKG 4JBZA 3OW2O 4GIFA 4UB6H 1NU1D 2J58A 2AEMA 1CW5A 2G8YA 3IR9A 3CI9A 3CCVP 1VQMP 3C1LA 1KQGB 4Y99C 1NTMG 2JKVA 1QVFO 3NXSA 2N1TD 4RKUJ 2Z4EA 2FXMA 2ZYGA 3CWBG 1KC8Q 2D2CD 4AUWA 1EZVD 5APXA 1VQ7P 2IBZG 1FS0E 3HUSC 5KLVG 1D7MA 2YNYA 1M57D 3S1KA 2VRSA 1MFTA 3B8EB 2NPSC 1FJKA 3Q5RA 2YIUB 1IFJA 4PD4E 1QVGO 1NU1J 4W7ZA 5C39A 1FOSE 4IFFA 3I5CA 2BASA 3VMZA 1RE3C 1RQUA 3PLNA 4ZMDA 2Q3IA 1YJWP 4H0LD 2K88A 3RK2D 1GW3A 1BGYJ 3VN0A 3H1JE 1M1JB 4EI2A 4GOEA 2QM8A 3A5TA 2W83C 3A0BH 1L4AC 3SSUA 5AW3B 3CC4P 5AW4B 4JQ0D 4U3FE 1OMIA 2OYIB 3AEDC 1BE3D 1MFZA 5TJHA 3SWKA 4H13D 1HWTC 3NTNA 1N73A 3LW5J 1VL2A 3AE8C 1LTJB 2M5AA 1SS1A 3L70D 1GD2E 2WSFH 2MKVA 3TGUG 1JB0J 1Z56A 4BWNA 1JY2O 3HE5B 2JJLA 1KILA 2A06E 3L75D 2Z5HA 3WMM0 5H2FH 2UWJE 2C9NY 1KB9E 1PGJA 3O6QB 2XDJA 4GDOA 1VQ9P 1W2EA 1GU4A 3RK3B 1PFIA 3T97B 3CCMP 1M1KQ 1ZR2A 1JY2P 1RE4A 1LWUA 2KI7B 2JP3A 1H88A 2YMYA 3D6YA 4N78D 1IC2A 1BE3J 4WY4D 2BCCJ 1GL2A 3H1IE 2WTYA 2IZ1A 2YXRB 3HD7D 1YI2P 1LT9A 4I7ZC 2LXBA 1Q81Q 1LP1A 3U59A 2FYUK 3L70J 1BDDA 1ZRTD 1HGZA 1FZEA 2OYIC 2B87A 3Q3DA 2FXOA 3M91A 1URQD 3H1KE 2HG5D 3H32B 3L75J 2K9JA 3CWBE 2KP8A 2WPSA 1T2KD 1LTBC 2AXCA 1LTJC 1VQ6P 1VPCA 3G71P 2YKQA 1RH5B 2FYUD 3Q5SA 2C9LY 3RK2B 2GA1A 2O01H 1GU5A 4WY4A 1H0TA 3OA7A 1U7MA 1K8AQ 2M0BA 3HD7A 5EFWB 1OX3A 4TT3H 1OVUA 1PPJD 3V5BA 2KSEA 5B66H 1YIJP 1JTHA 3EQ2A 1FZFA 2B89A 4HKZH 2KOGA 3CCJP 1SQQK 3AECC 2FBWC 2IBZD 1L0LG 2N1TC 2H7HA 1J1EB 4XFJA 3UIAA 3P32A 2FXPA 2D2CC 3MP7B 1LTTC 3WUTA 1L0NG 1S72P 1SQBE 1E5WA 1HH0A 2L91A 1R5SA 1KV4A 4OGQD 2FYUJ 5AVUB 4IFDK 3E1RA 1IFMA 3JCUE 1SQQD 3N7NA 4GODA 2E74B 1PGQA 3S4RA 5GTIE 2Y0EA 2WPQA 2BEQD 3V6IA 2FFDA 1NH4A 2ZFCA 3AEGC 1EZVI 2E5YA 1NWQA 1ZV8A 1KILC 4LLHA 4H0LC 3RK2C 4DCKA 2RKLA 1LTGC 3FWLA 3F89A 4ZKUA 3WU2E 2E75B 2I1JA 3NFQA 2KK7A 2QVAA 1PZQA 3Q2YA 2QEXP 1RE4C 1LWUC 1BGYG 1U7JA 3R2PA 1AJYA 3AE6C 1URQB 4IFMA 2J5UA 4H13C 5AVWB 1GL2C 5KKZC 3CXHH 2QIWA 3A0HE 2YO3A 2R5DA 5APSA 5CCHD 1SQQJ 1FDIA 1LT9C 1SQPE 1NJIQ 1CI6A 3ITKA 4RJTA 3VMYA 5APQA 1YYCA 1AQTA 3H1LE 2XU6A 1ZP0C 2W6BA 2PFXA 1S4XA 5CHXA 1L4AD 1N2DC 4DOJA 3KYQA 1AQ5A 3L73E 2OYHB 1HUCA 2K3RA 2HODA 2GM4A 4RO0A 2WSCJ 3HTKA 2W6AA 1JUNA 1JM0A 4D6TE 4BRYB 3BCCE 3D71A 2QJPB 1NTZK 4WY4C 2YMKA 3PTZA 2A45H 1QEXA 1XTGB 3HD7C 1S3JA 1YJNP 2H8PD 2BCCG 4YPCA 5GTHH 3RGUA 3H1JG 1QLED 1NTZD 2Y9YA 4YXDC 1T3JA 1SQXD 2AXTH 3H1HD 4Y99B 5AW8B 4GKGA 5KAIH 4U3FG 3AE9C 5APUA 4TLFA 1N8RQ 1T2KC 2FY8A 3L72E 4BXLA 1PP9E 2V7QH 1WMKA 3VP9A 1KYOH 2OYOA 4ASWA 3MUDA 5DJUB 2K1AA 3ZDMA 4UB8E 1EDIA 3I56P 2KS1A 2QE7H 2WQYC 1AA0A 1T6AA 1H89A 1PV3A 2FFDC 3CX5H 2NPSB 2A06G 5AVXB 1NU1E 3RBZA 3CPWO 4R4LA 4D6TJ 4W7YA 2ITAA 1DH3A 2OTLP 2QJPC 1NTZJ 2NZ2A 2KNCB 5CJ4A 3H1HJ 4Z1MH 1BSHA 4WWIA 4U7JA 3JSVC 4K35A 1M56D 2OGUA 4OGQC 1L4AB 2POHA 3H1IG 1GW4A 1W2BO 1FE6A 1SFCD 3AEBC 3OAKA 1YJ9P 3EFFK 1EZVE 1S5LH 1USEA 1USDA 3KQGA 2IBZI 2OQQA 3N4XA 3L71D 1IFIA 2MJZA 3V4WA 3L72J 2KUBA 2WPVB 3H1KG 3VOPA 1ZXGA 1M1JA 1PP9J 2HFED 1K73Q 1WT6A 3U1AA 2Q5UA 1U57A 3Q5PA 1KZUB 2HLOA 1VQ8P 3EFGA 3L36A 3GF7A 4LGDE 5APTA 4H44D 2A45I 3HRNA 3SWYA 1M7LA 4L73A 3KDPB 3TYYA 1RF1A 4EYYQ 1SFCA 1X22A 3TK1A 1GZLA 4HYTB 1VQKP 2WSFJ 5CCHC 4N6JA 1E79H 1S9KD 4PJ0E 1KILD 1BE3E 2BCCE 3R4YA 3L71J 2XKMA 3FWNA 1NKZB 1NO4A 2Q7CA 4IL6E 3CCRP 1KN7A 3MHVA 4I7ZB 1M8OB 2G3AA 1HJ0A 3L70E 2FYZA 4NPDA 2OTJP 1BCCD 1SQBG 4NPFX 5B66E 1OW8A 1YBKA 2Y0CA 3O8ZA 5CCGD 3L74D 1RHZB 2P7JA 1GL2D 4RESB 2Q6QA 3RL0C 3L75E 1YITP 4OVNF 3G6EP 1FZBA 4GT1A 3TNUB 1JY3P 4IOIH 2R32A 3CMEP 1VQPP 1R5LA 3CMAP 3USSA 3CC2P 1FBMA 2B9BA 4N78E 3G9RA 1Y47A 1ZW0A 1RF0C 1N7SA 3GHGC 1T3UA 2YKOA 1KFNA 2W6JH 2R3SA 3WUUA 3C9IA 3SWFA 1JCCA 2Z5IA 1BCCJ 1VQ5P 2GUVA 1FDOA 1ZRTE 5CMZA 5CCGA 3CLQA 2N9BA 2C0XA 5AVQB 2N1TB 3CCQP 2IYOA 3TDKA 2O01J 2D2CB 1X79B 3RL0g 2CPBA 1SQVD 2WVRA 5AW7B 2WSSH 3V2QA 4EIJA 1GK4A 1KQLA 2QM7A 2P1JA 1SQPG 2FYUE 4OH8B 3H25A 1N73B 1P84D 3H1LG 2DW3A 2M5AB 2LXCB 4JPZB 3SFDC 3QH9A 1NTMK 3L73G 1NTKD 3VMXA 1PPJE 3GF3A 1CZQA 1KFMA 1KILB 3AEEC 4OWFA 3KZIE 4H0LB 1DEBA 5B5EH 1JY3N 1QL2A 1JMBA 3CXHD 3IAOA 4D6TG 4PD4H 3BCCG 5L8RJ 1RF1C 2M3BA 5KLIC 1SFCC 1LWUB 1NTMD 1X8YA 3LIDA 5KAFH 3H1KD 1FC2C 5BU8B 1EDJA 4H13B 1GL2B 5KKZB 4L75A 4WVZA 3CWBD 3PH0A 4DT0A 2L5GB 1SQQE 1LT9B 1SLQA 4PV1D 2WWWA 3M0AA 1LP1B 2KYVA 1VF5C 5KLVD 4JYBA 2B87B 3AE3C 3W68A 3L72G 3M06A 3B5ND 4H44C 1PP9G 2K9JB 1Y8AA 2P58A 2KXPB 1N73C 2JR8A 2M3EA 2ZXEB 3KHUA 4KT0J 4DJGA 1ZR4A 2JDIH 1FDMA 1NTMJ 1DD3A 3EWKA 1ZN5A 1Q2NA 1KB9H 4WY4B 1H0TB 1A02F 1P84H 5KJ7D 3P8CD 1NU1G 1OWAA 1G2CA 1N7SC 3HD7B 1OXZA 4R4MA 4A7PA 1HF9A 1SVFA 2ZVNB 2YXQB 2OYHA 1DD4A 1JTHB 2NRGA 1OIPA 2QSIA 1M90Q 1KYOD 3G4SP 5CCGC 1RQVA 3B5NA 1FZCA 4BRYA 2HPCA 3MTUE 1KQFB 4O9BA 3D70A 3AE4C 3WUVA 2LKMA 3TGUD 3E1IA 2W90A 1EZVG 2SPZA 2C0WA 3CX5D 3C8VA 4UB6E 2IX7C 2WSEH 5KJ7A 1DEEG 1JO5A 1S5LE 3D6ZA 3PRJA 2AEJA 2FFDB 1IK9A 3HE4A 1BDCA 3CCSP 4JYCA 2KZIA 3RL0D 4DZOA 3P7KA 2V7QJ 3P8MC 4I1LA 2WT7A 2JEEA 3E7KA 4PV1B 1SQXK 2E76D 1NTZE 3A3YB 2QJYC 1SQXE 3HUSA 3H1HE 1ZOYC 2H88C 3TGUJ 2QG4A 1JMMA 1LTSC 1PGOA 2JWDA 1RY3A 3PHLA 2KIKA 1HBWA 2R44A 4OGQB 1BE3G 4ASVA 5AW1B 1WRGA 3OJAB 1IO4A 2W8ZA 3VMAA 4C7NA 5TISH 2YO2A 1OFCX 4IL6X 3L70G 2KNCA 5E79H 4ZKPA 1L0LK 3B71A 3V2RA 4I2LC 3KXDA 5AVZB 2I8DA 1X9VA 4N3YB 3JCUH 3L75G 2Q9IA 1L0NK 5GTIH 3F5HA 5DJTB 3A0BE 2I1KA 1P84I 2W27A 4EDFA 3AE2C 1IFPA 2HODB 1K04A 3VTPC 2ZYAA 2ZXXA 1LGHB 1N7LA 1HJBA 1LTAC 1NVOA 4EOTA 3TF5A 1L0LD 2FYNB 4CPGA 1NKNA 1UIXA 3BRVB 3PJSK 1NGMB 1EDLA 4XA4A 5AW6B 3WU2H 1L0ND 3M0DA 1A02J 5BU5A 2RMZA 3CXHI 4PV1C 2O1KA 2ZT9D 1SQXJ 3L71E 2XNXA 3MIWA 5AW2B 3U1CA 1L2PA 2O1JA 5H2FE 3A0HH 3ABVC 3B5NC 2IYPA 1FOSF 1QX8A 1LTIC 5CBNA 3BRTB 2WMMA 2OARA 2PRRA 3IFMA 2PGDA 1K9MQ 1Y9BA 1GK6A 3RL0B 1VQNP 2FYUG 1HGVA 3M9HA 1IFDA 1L0LJ 3RK3D 1KORA 5KJ7C 2KS1B 2E76B 1VF5D 1KTMA 2RN0A 1BGYD 1L0NJ 4L76A 2OYIA 3BASA 1G1JA 1PPJG 1S9KE 4YXWH 1KILE 2KB7P 3GHGB 1QGKB 2CPSA 3TNUA 2KSJA 2FYNC 3S9OA 1LTJA 1JNMA 2QJKC 1GTWA 2QA4P 1FZAA 1OW7A 1BCCE 3HE5A 5KTBA 3CD6P 5B5EE 3MD0A 1MV8A 2P10A 5K5GB 3L74E 1N7SD 4AYCA 3O6QA 2P67A 1SQQG 3T97A 2XNDH 2A45G 1KYOI 5AW5B 1LJ2A 1LNQA 3W67A 3AE1C 1JY3O 4NPEA 5KAFE 2BEZF 3CC7P 2KLVA 3M9QA 5CJ0A 2V4HA 2E42A 5CBOA 2N1TA 2PP6A 2KLUA 2Q1KA 4PD4D 1S1CX 3MZWB 4UB8H 1OVRA 1SP4A 5AVYB 3MUDC 3CX5I 2OTKE 1XTCC 2IFMA 1GDTA 2PAJA 2ZT9B 2E76C 2BCCD 1KD1Q 2IZ0A 3NMDA 3H1JD 1Q82Q 3GMAA 2LR2A 3H32A 1RF1B 3FXDA 5KLIB 1SFCB 4U3FD 1EDKA 1SQVK 2H43A 3V2NA 3IF4A 1SQVE 4M3LA 3M0DC 2XV5A 2J59M 2O3JA 3AEFC 3QWOC 1MUUA 1K05A 2R3CA 1P84E 3V4QA 2E74D 2JO1A 3L74J 1VF5B 2YIUC 4I6MC 1KQSO 1NTKK 4KHXA 1NTKE 2A06D 4H44B 2QRXA 1J1DB 5BVZA 3LW5H 1Q7YQ 3I55P 4WBAA 1KB9D 3B4SA 1EXJA 3V2PA 4XE5B 3CXHE 3H1JJ 3L35A 2E75D 1M1JC 1BSNA 1AVYA 2E43A 2RH0A 4U3FJ 3AE5C 1NTME 1EXIA 4YTPC 1JEKA 1S5LX 3FXEA 3VYIA 2ZT9C 3H1ID 1YHQP 3VP8A 1N86A 1N7SB 2WZ7A 3GLMA 4GOFA 1UIIA 2B88A 2IBZE 1PIXA 1X0TA 1NTZG 3FGAD 5KLVK 2K37A 1SQXG 3H1HG 1G1IA 3CCUP 5KLVE 4PJ0H 1SQVJ 4WB4A 1S2EA 2H89C 4IL6H 1MZ9A 1ZMEC 2WPRA 1R8EA 1FZGA 1CSBA 2FKWB 3GW6A 3RK3C 3BATA 1GMJA 3SFEC 5AW9B 2IDBA 1NTKJ 1URQA 4Y28J 1J1DC 5GTHE 1JY2N 2O01N 3H1IJ 3P8CE 5AVRB 1HTLC 5TISE 1SQBK 2P2UA 2AXTE 3AEAC 3KPEA 5KAIE 1VQ4P 2IPPA 4LC1A 5E79E 3CCEP 1Q90D 3L4FA 1NAFA 1KMIZ 1KYOE 1VQOP 2JWAA 3H1KJ 2KZJA 2QJYB 3L37A 3H6PA 3CWBJ 2WSEJ 1SQBD 3TGUE 3PP5A 4HB1A 2ZAEB 2R5BA 5APYA 1NOHA 4HJGH 1NAYA 4W80A 4C46A 1YTZI 1IJDB 5KLVJ 3L71G 3CX5E 1T8ZA 4B86A 1YQ3C 1TU3F 3II6A 3LIEA 5APWA 1EQ7A 1JCDA 2NPSD 2IFNA 3JC22 1AV1A 3CCLP 2HYNA 3M9BA 1QL1A 1SQPK 1OW6A
chains in the Genus database with same CATH topology
1KYOH 1BGYG 2IBZG 1L0LG 3L73G 3CX5H 3H1JG 3L75G 2A06G 1KB9H 1NTKG 3L71G 1SQPG 1NTZG 1SQQG 1P84H 1NTMG 1SQXG 2FYUG 3H1HG 1PPJG 1NU1G 5KLVG 3L70G 1BCCG 1L0NG 4U3FG 3H1LG 3CXHH 3H1IG 3H1KG 1SQBG 3TGUG 2BCCG 1SQVG 1BE3G 3CWBG 3L72G 4D6TG 3L74G 4PD4H 3BCCG 1EZVG 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO H;  1BGY G;  2IBZ G;  1L0L G;  3L73 G;  3CX5 H;  3H1J G;  3L75 G;  2A06 G;  1KB9 H;  1NTK G;  3L71 G;  1SQP G;  1NTZ G;  1SQQ G;  1P84 H;  1NTM G;  1SQX G;  2FYU G;  3H1H G;  1PPJ G;  1NU1 G;  5KLV G;  3L70 G;  1BCC G;  1L0N G;  4U3F G;  3H1L G;  3CXH H;  3H1I G;  3H1K G;  1SQB G;  3TGU G;  2BCC G;  1SQV G;  1BE3 G;  3CWB G;  3L72 G;  4D6T G;  3L74 G;  4PD4 H;  3BCC G;  1EZV G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 1J1E C;  5AW0 B;  1DX7 A;  4PD4 I;  1SQB J;  3KZI H;  5AVS B;  3K5B A;  1FJP A;  1W5C E;  1IK7 A;  3TSI A;  4K3A A;  4KJM A;  1G2C B;  3A7O A;  1PGP A;  3CL3 D;  1J2J B;  1FAV A;  4MN4 C;  2E74 C;  1SQP D;  1BCC G;  2ZJS E;  3H1L D;  1LT1 A;  1OZH A;  3B5N B;  1FZC B;  2NPS A;  2HPC B;  4QMA A;  3L74 G;  4ZNC A;  3L73 D;  2WIT A;  5CCH A;  1RE3 A;  1PL5 A;  2E75 C;  2Y0D A;  4L74 A;  5M1B A;  1IZN B;  1CI6 B;  4D6T D;  3G3Z A;  2ZVO B;  3BCC D;  2XZR A;  1ZLL A;  1L0L E;  1URQ C;  3BVH A;  1L4A A;  3RBX A;  2HR3 A;  2K9Y A;  3FX0 A;  2M8R A;  1L0N E;  1KB9 I;  3HE4 B;  1JOC A;  5AVT B;  1VDF A;  2WSC H;  3Q1M A;  1AFO A;  1YQ4 C;  1SQP J;  4C7R A;  4AQR D;  5APV A;  1NHL A;  3HTK B;  4HH2 A;  3AE7 C;  1AVO A;  3H1L J;  2WT7 B;  1MKM A;  4JF7 A;  2QJK B;  1DIP A;  1YTZ T;  2Y9Z A;  3IN6 A;  3HUS B;  2GUS A;  2CK3 H;  3L73 J;  1SQV G;  2N9Y B;  3L72 D;  2OYH C;  1OVV A;  1PP9 D;  1VQL P;  1NYH A;  2ZYD A;  1NU1 K;  1RF0 A;  3GG2 A;  3GHG A;  2Q3E A;  4C7N B;  1Q86 Q;  3BCC J;  1HVV A;  1H8A A;  1FZC C;  1EC5 A;  3RK3 E;  2AEF A;  5AVV B;  1FU1 A;  2YKP A;  3A2A A;  1BGY E;  2E5T A;  3MGN A;  1IFN A;  1NTK G;  4JBZ A;  3OW2 O;  4GIF A;  4UB6 H;  1NU1 D;  2J58 A;  2AEM A;  1CW5 A;  2G8Y A;  3IR9 A;  3CI9 A;  3CCV P;  1VQM P;  3C1L A;  1KQG B;  4Y99 C;  1NTM G;  2JKV A;  1QVF O;  3NXS A;  2N1T D;  4RKU J;  2Z4E A;  2FXM A;  2ZYG A;  3CWB G;  1KC8 Q;  2D2C D;  4AUW A;  1EZV D;  5APX A;  1VQ7 P;  2IBZ G;  1FS0 E;  3HUS C;  5KLV G;  1D7M A;  2YNY A;  1M57 D;  3S1K A;  2VRS A;  1MFT A;  3B8E B;  2NPS C;  1FJK A;  3Q5R A;  2YIU B;  1IFJ A;  4PD4 E;  1QVG O;  1NU1 J;  4W7Z A;  5C39 A;  1FOS E;  4IFF A;  3I5C A;  2BAS A;  3VMZ A;  1RE3 C;  1RQU A;  3PLN A;  4ZMD A;  2Q3I A;  1YJW P;  4H0L D;  2K88 A;  3RK2 D;  1GW3 A;  1BGY J;  3VN0 A;  3H1J E;  1M1J B;  4EI2 A;  4GOE A;  2QM8 A;  3A5T A;  2W83 C;  3A0B H;  1L4A C;  3SSU A;  5AW3 B;  3CC4 P;  5AW4 B;  4JQ0 D;  4U3F E;  1OMI A;  2OYI B;  3AED C;  1BE3 D;  1MFZ A;  5TJH A;  3SWK A;  4H13 D;  1HWT C;  3NTN A;  1N73 A;  3LW5 J;  1VL2 A;  3AE8 C;  1LTJ B;  2M5A A;  1SS1 A;  3L70 D;  1GD2 E;  2WSF H;  2MKV A;  3TGU G;  1JB0 J;  1Z56 A;  4BWN A;  1JY2 O;  3HE5 B;  2JJL A;  1KIL A;  2A06 E;  3L75 D;  2Z5H A;  3WMM 0;  5H2F H;  2UWJ E;  2C9N Y;  1KB9 E;  1PGJ A;  3O6Q B;  2XDJ A;  4GDO A;  1VQ9 P;  1W2E A;  1GU4 A;  3RK3 B;  1PFI A;  3T97 B;  3CCM P;  1M1K Q;  1ZR2 A;  1JY2 P;  1RE4 A;  1LWU A;  2KI7 B;  2JP3 A;  1H88 A;  2YMY A;  3D6Y A;  4N78 D;  1IC2 A;  1BE3 J;  4WY4 D;  2BCC J;  1GL2 A;  3H1I E;  2WTY A;  2IZ1 A;  2YXR B;  3HD7 D;  1YI2 P;  1LT9 A;  4I7Z C;  2LXB A;  1Q81 Q;  1LP1 A;  3U59 A;  2FYU K;  3L70 J;  1BDD A;  1ZRT D;  1HGZ A;  1FZE A;  2OYI C;  2B87 A;  3Q3D A;  2FXO A;  3M91 A;  1URQ D;  3H1K E;  2HG5 D;  3H32 B;  3L75 J;  2K9J A;  3CWB E;  2KP8 A;  2WPS A;  1T2K D;  1LTB C;  2AXC A;  1LTJ C;  1VQ6 P;  1VPC A;  3G71 P;  2YKQ A;  1RH5 B;  2FYU D;  3Q5S A;  2C9L Y;  3RK2 B;  2GA1 A;  2O01 H;  1GU5 A;  4WY4 A;  1H0T A;  3OA7 A;  1U7M A;  1K8A Q;  2M0B A;  3HD7 A;  5EFW B;  1OX3 A;  4TT3 H;  1OVU A;  1PPJ D;  3V5B A;  2KSE A;  5B66 H;  1YIJ P;  1JTH A;  3EQ2 A;  1FZF A;  2B89 A;  4HKZ H;  2KOG A;  3CCJ P;  1SQQ K;  3AEC C;  2FBW C;  2IBZ D;  1L0L G;  2N1T C;  2H7H A;  1J1E B;  4XFJ A;  3UIA A;  3P32 A;  2FXP A;  2D2C C;  3MP7 B;  1LTT C;  3WUT A;  1L0N G;  1S72 P;  1SQB E;  1E5W A;  1HH0 A;  2L91 A;  1R5S A;  1KV4 A;  4OGQ D;  2FYU J;  5AVU B;  4IFD K;  3E1R A;  1IFM A;  3JCU E;  1SQQ D;  3N7N A;  4GOD A;  2E74 B;  1PGQ A;  3S4R A;  5GTI E;  2Y0E A;  2WPQ A;  2BEQ D;  3V6I A;  2FFD A;  1NH4 A;  2ZFC A;  3AEG C;  1EZV I;  2E5Y A;  1NWQ A;  1ZV8 A;  1KIL C;  4LLH A;  4H0L C;  3RK2 C;  4DCK A;  2RKL A;  1LTG C;  3FWL A;  3F89 A;  4ZKU A;  3WU2 E;  2E75 B;  2I1J A;  3NFQ A;  2KK7 A;  2QVA A;  1PZQ A;  3Q2Y A;  2QEX P;  1RE4 C;  1LWU C;  1BGY G;  1U7J A;  3R2P A;  1AJY A;  3AE6 C;  1URQ B;  4IFM A;  2J5U A;  4H13 C;  5AVW B;  1GL2 C;  5KKZ C;  3CXH H;  2QIW A;  3A0H E;  2YO3 A;  2R5D A;  5APS A;  5CCH D;  1SQQ J;  1FDI A;  1LT9 C;  1SQP E;  1NJI Q;  1CI6 A;  3ITK A;  4RJT A;  3VMY A;  5APQ A;  1YYC A;  1AQT A;  3H1L E;  2XU6 A;  1ZP0 C;  2W6B A;  2PFX A;  1S4X A;  5CHX A;  1L4A D;  1N2D C;  4DOJ A;  3KYQ A;  1AQ5 A;  3L73 E;  2OYH B;  1HUC A;  2K3R A;  2HOD A;  2GM4 A;  4RO0 A;  2WSC J;  3HTK A;  2W6A A;  1JUN A;  1JM0 A;  4D6T E;  4BRY B;  3BCC E;  3D71 A;  2QJP B;  1NTZ K;  4WY4 C;  2YMK A;  3PTZ A;  2A45 H;  1QEX A;  1XTG B;  3HD7 C;  1S3J A;  1YJN P;  2H8P D;  2BCC G;  4YPC A;  5GTH H;  3RGU A;  3H1J G;  1QLE D;  1NTZ D;  2Y9Y A;  4YXD C;  1T3J A;  1SQX D;  2AXT H;  3H1H D;  4Y99 B;  5AW8 B;  4GKG A;  5KAI H;  4U3F G;  3AE9 C;  5APU A;  4TLF A;  1N8R Q;  1T2K C;  2FY8 A;  3L72 E;  4BXL A;  1PP9 E;  2V7Q H;  1WMK A;  3VP9 A;  1KYO H;  2OYO A;  4ASW A;  3MUD A;  5DJU B;  2K1A A;  3ZDM A;  4UB8 E;  1EDI A;  3I56 P;  2KS1 A;  2QE7 H;  2WQY C;  1AA0 A;  1T6A A;  1H89 A;  1PV3 A;  2FFD C;  3CX5 H;  2NPS B;  2A06 G;  5AVX B;  1NU1 E;  3RBZ A;  3CPW O;  4R4L A;  4D6T J;  4W7Y A;  2ITA A;  1DH3 A;  2OTL P;  2QJP C;  1NTZ J;  2NZ2 A;  2KNC B;  5CJ4 A;  3H1H J;  4Z1M H;  1BSH A;  4WWI A;  4U7J A;  3JSV C;  4K35 A;  1M56 D;  2OGU A;  4OGQ C;  1L4A B;  2POH A;  3H1I G;  1GW4 A;  1W2B O;  1FE6 A;  1SFC D;  3AEB C;  3OAK A;  1YJ9 P;  3EFF K;  1EZV E;  1S5L H;  1USE A;  1USD A;  3KQG A;  2IBZ I;  2OQQ A;  3N4X A;  3L71 D;  1IFI A;  2MJZ A;  3V4W A;  3L72 J;  2KUB A;  2WPV B;  3H1K G;  3VOP A;  1ZXG A;  1M1J A;  1PP9 J;  2HFE D;  1K73 Q;  1WT6 A;  3U1A A;  2Q5U A;  1U57 A;  3Q5P A;  1KZU B;  2HLO A;  1VQ8 P;  3EFG A;  3L36 A;  3GF7 A;  4LGD E;  5APT A;  4H44 D;  2A45 I;  3HRN A;  3SWY A;  1M7L A;  4L73 A;  3KDP B;  3TYY A;  1RF1 A;  4EYY Q;  1SFC A;  1X22 A;  3TK1 A;  1GZL A;  4HYT B;  1VQK P;  2WSF J;  5CCH C;  4N6J A;  1E79 H;  1S9K D;  4PJ0 E;  1KIL D;  1BE3 E;  2BCC E;  3R4Y A;  3L71 J;  2XKM A;  3FWN A;  1NKZ B;  1NO4 A;  2Q7C A;  4IL6 E;  3CCR P;  1KN7 A;  3MHV A;  4I7Z B;  1M8O B;  2G3A A;  1HJ0 A;  3L70 E;  2FYZ A;  4NPD A;  2OTJ P;  1BCC D;  1SQB G;  4NPF X;  5B66 E;  1OW8 A;  1YBK A;  2Y0C A;  3O8Z A;  5CCG D;  3L74 D;  1RHZ B;  2P7J A;  1GL2 D;  4RES B;  2Q6Q A;  3RL0 C;  3L75 E;  1YIT P;  4OVN F;  3G6E P;  1FZB A;  4GT1 A;  3TNU B;  1JY3 P;  4IOI H;  2R32 A;  3CME P;  1VQP P;  1R5L A;  3CMA P;  3USS A;  3CC2 P;  1FBM A;  2B9B A;  4N78 E;  3G9R A;  1Y47 A;  1ZW0 A;  1RF0 C;  1N7S A;  3GHG C;  1T3U A;  2YKO A;  1KFN A;  2W6J H;  2R3S A;  3WUU A;  3C9I A;  3SWF A;  1JCC A;  2Z5I A;  1BCC J;  1VQ5 P;  2GUV A;  1FDO A;  1ZRT E;  5CMZ A;  5CCG A;  3CLQ A;  2N9B A;  2C0X A;  5AVQ B;  2N1T B;  3CCQ P;  2IYO A;  3TDK A;  2O01 J;  2D2C B;  1X79 B;  3RL0 g;  2CPB A;  1SQV D;  2WVR A;  5AW7 B;  2WSS H;  3V2Q A;  4EIJ A;  1GK4 A;  1KQL A;  2QM7 A;  2P1J A;  1SQP G;  2FYU E;  4OH8 B;  3H25 A;  1N73 B;  1P84 D;  3H1L G;  2DW3 A;  2M5A B;  2LXC B;  4JPZ B;  3SFD C;  3QH9 A;  1NTM K;  3L73 G;  1NTK D;  3VMX A;  1PPJ E;  3GF3 A;  1CZQ A;  1KFM A;  1KIL B;  3AEE C;  4OWF A;  3KZI E;  4H0L B;  1DEB A;  5B5E H;  1JY3 N;  1QL2 A;  1JMB A;  3CXH D;  3IAO A;  4D6T G;  4PD4 H;  3BCC G;  5L8R J;  1RF1 C;  2M3B A;  5KLI C;  1SFC C;  1LWU B;  1NTM D;  1X8Y A;  3LID A;  5KAF H;  3H1K D;  1FC2 C;  5BU8 B;  1EDJ A;  4H13 B;  1GL2 B;  5KKZ B;  4L75 A;  4WVZ A;  3CWB D;  3PH0 A;  4DT0 A;  2L5G B;  1SQQ E;  1LT9 B;  1SLQ A;  4PV1 D;  2WWW A;  3M0A A;  1LP1 B;  2KYV A;  1VF5 C;  5KLV D;  4JYB A;  2B87 B;  3AE3 C;  3W68 A;  3L72 G;  3M06 A;  3B5N D;  4H44 C;  1PP9 G;  2K9J B;  1Y8A A;  2P58 A;  2KXP B;  1N73 C;  2JR8 A;  2M3E A;  2ZXE B;  3KHU A;  4KT0 J;  4DJG A;  1ZR4 A;  2JDI H;  1FDM A;  1NTM J;  1DD3 A;  3EWK A;  1ZN5 A;  1Q2N A;  1KB9 H;  4WY4 B;  1H0T B;  1A02 F;  1P84 H;  5KJ7 D;  3P8C D;  1NU1 G;  1OWA A;  1G2C A;  1N7S C;  3HD7 B;  1OXZ A;  4R4M A;  4A7P A;  1HF9 A;  1SVF A;  2ZVN B;  2YXQ B;  2OYH A;  1DD4 A;  1JTH B;  2NRG A;  1OIP A;  2QSI A;  1M90 Q;  1KYO D;  3G4S P;  5CCG C;  1RQV A;  3B5N A;  1FZC A;  4BRY A;  2HPC A;  3MTU E;  1KQF B;  4O9B A;  3D70 A;  3AE4 C;  3WUV A;  2LKM A;  3TGU D;  3E1I A;  2W90 A;  1EZV G;  2SPZ A;  2C0W A;  3CX5 D;  3C8V A;  4UB6 E;  2IX7 C;  2WSE H;  5KJ7 A;  1DEE G;  1JO5 A;  1S5L E;  3D6Z A;  3PRJ A;  2AEJ A;  2FFD B;  1IK9 A;  3HE4 A;  1BDC A;  3CCS P;  4JYC A;  2KZI A;  3RL0 D;  4DZO A;  3P7K A;  2V7Q J;  3P8M C;  4I1L A;  2WT7 A;  2JEE A;  3E7K A;  4PV1 B;  1SQX K;  2E76 D;  1NTZ E;  3A3Y B;  2QJY C;  1SQX E;  3HUS A;  3H1H E;  1ZOY C;  2H88 C;  3TGU J;  2QG4 A;  1JMM A;  1LTS C;  1PGO A;  2JWD A;  1RY3 A;  3PHL A;  2KIK A;  1HBW A;  2R44 A;  4OGQ B;  1BE3 G;  4ASV A;  5AW1 B;  1WRG A;  3OJA B;  1IO4 A;  2W8Z A;  3VMA A;  4C7N A;  5TIS H;  2YO2 A;  1OFC X;  4IL6 X;  3L70 G;  2KNC A;  5E79 H;  4ZKP A;  1L0L K;  3B71 A;  3V2R A;  4I2L C;  3KXD A;  5AVZ B;  2I8D A;  1X9V A;  4N3Y B;  3JCU H;  3L75 G;  2Q9I A;  1L0N K;  5GTI H;  3F5H A;  5DJT B;  3A0B E;  2I1K A;  1P84 I;  2W27 A;  4EDF A;  3AE2 C;  1IFP A;  2HOD B;  1K04 A;  3VTP C;  2ZYA A;  2ZXX A;  1LGH B;  1N7L A;  1HJB A;  1LTA C;  1NVO A;  4EOT A;  3TF5 A;  1L0L D;  2FYN B;  4CPG A;  1NKN A;  1UIX A;  3BRV B;  3PJS K;  1NGM B;  1EDL A;  4XA4 A;  5AW6 B;  3WU2 H;  1L0N D;  3M0D A;  1A02 J;  5BU5 A;  2RMZ A;  3CXH I;  4PV1 C;  2O1K A;  2ZT9 D;  1SQX J;  3L71 E;  2XNX A;  3MIW A;  5AW2 B;  3U1C A;  1L2P A;  2O1J A;  5H2F E;  3A0H H;  3ABV C;  3B5N C;  2IYP A;  1FOS F;  1QX8 A;  1LTI C;  5CBN A;  3BRT B;  2WMM A;  2OAR A;  2PRR A;  3IFM A;  2PGD A;  1K9M Q;  1Y9B A;  1GK6 A;  3RL0 B;  1VQN P;  2FYU G;  1HGV A;  3M9H A;  1IFD A;  1L0L J;  3RK3 D;  1KOR A;  5KJ7 C;  2KS1 B;  2E76 B;  1VF5 D;  1KTM A;  2RN0 A;  1BGY D;  1L0N J;  4L76 A;  2OYI A;  3BAS A;  1G1J A;  1PPJ G;  1S9K E;  4YXW H;  1KIL E;  2KB7 P;  3GHG B;  1QGK B;  2CPS A;  3TNU A;  2KSJ A;  2FYN C;  3S9O A;  1LTJ A;  1JNM A;  2QJK C;  1GTW A;  2QA4 P;  1FZA A;  1OW7 A;  1BCC E;  3HE5 A;  5KTB A;  3CD6 P;  5B5E E;  3MD0 A;  1MV8 A;  2P10 A;  5K5G B;  3L74 E;  1N7S D;  4AYC A;  3O6Q A;  2P67 A;  1SQQ G;  3T97 A;  2XND H;  2A45 G;  1KYO I;  5AW5 B;  1LJ2 A;  1LNQ A;  3W67 A;  3AE1 C;  1JY3 O;  4NPE A;  5KAF E;  2BEZ F;  3CC7 P;  2KLV A;  3M9Q A;  5CJ0 A;  2V4H A;  2E42 A;  5CBO A;  2N1T A;  2PP6 A;  2KLU A;  2Q1K A;  4PD4 D;  1S1C X;  3MZW B;  4UB8 H;  1OVR A;  1SP4 A;  5AVY B;  3MUD C;  3CX5 I;  2OTK E;  1XTC C;  2IFM A;  1GDT A;  2PAJ A;  2ZT9 B;  2E76 C;  2BCC D;  1KD1 Q;  2IZ0 A;  3NMD A;  3H1J D;  1Q82 Q;  3GMA A;  2LR2 A;  3H32 A;  1RF1 B;  3FXD A;  5KLI B;  1SFC B;  4U3F D;  1EDK A;  1SQV K;  2H43 A;  3V2N A;  3IF4 A;  1SQV E;  4M3L A;  3M0D C;  2XV5 A;  2J59 M;  2O3J A;  3AEF C;  3QWO C;  1MUU A;  1K05 A;  2R3C A;  1P84 E;  3V4Q A;  2E74 D;  2JO1 A;  3L74 J;  1VF5 B;  2YIU C;  4I6M C;  1KQS O;  1NTK K;  4KHX A;  1NTK E;  2A06 D;  4H44 B;  2QRX A;  1J1D B;  5BVZ A;  3LW5 H;  1Q7Y Q;  3I55 P;  4WBA A;  1KB9 D;  3B4S A;  1EXJ A;  3V2P A;  4XE5 B;  3CXH E;  3H1J J;  3L35 A;  2E75 D;  1M1J C;  1BSN A;  1AVY A;  2E43 A;  2RH0 A;  4U3F J;  3AE5 C;  1NTM E;  1EXI A;  4YTP C;  1JEK A;  1S5L X;  3FXE A;  3VYI A;  2ZT9 C;  3H1I D;  1YHQ P;  3VP8 A;  1N86 A;  1N7S B;  2WZ7 A;  3GLM A;  4GOF A;  1UII A;  2B88 A;  2IBZ E;  1PIX A;  1X0T A;  1NTZ G;  3FGA D;  5KLV K;  2K37 A;  1SQX G;  3H1H G;  1G1I A;  3CCU P;  5KLV E;  4PJ0 H;  1SQV J;  4WB4 A;  1S2E A;  2H89 C;  4IL6 H;  1MZ9 A;  1ZME C;  2WPR A;  1R8E A;  1FZG A;  1CSB A;  2FKW B;  3GW6 A;  3RK3 C;  3BAT A;  1GMJ A;  3SFE C;  5AW9 B;  2IDB A;  1NTK J;  1URQ A;  4Y28 J;  1J1D C;  5GTH E;  1JY2 N;  2O01 N;  3H1I J;  3P8C E;  5AVR B;  1HTL C;  5TIS E;  1SQB K;  2P2U A;  2AXT E;  3AEA C;  3KPE A;  5KAI E;  1VQ4 P;  2IPP A;  4LC1 A;  5E79 E;  3CCE P;  1Q90 D;  3L4F A;  1NAF A;  1KMI Z;  1KYO E;  1VQO P;  2JWA A;  3H1K J;  2KZJ A;  2QJY B;  3L37 A;  3H6P A;  3CWB J;  2WSE J;  1SQB D;  3TGU E;  3PP5 A;  4HB1 A;  2ZAE B;  2R5B A;  5APY A;  1NOH A;  4HJG H;  1NAY A;  4W80 A;  4C46 A;  1YTZ I;  1IJD B;  5KLV J;  3L71 G;  3CX5 E;  1T8Z A;  4B86 A;  1YQ3 C;  1TU3 F;  3II6 A;  3LIE A;  5APW A;  1EQ7 A;  1JCD A;  2NPS D;  2IFN A;  3JC2 2;  1AV1 A;  3CCL P;  2HYN A;  3M9B A;  1QL1 A;  1SQP K;  1OW6 A; 
#chains in the Genus database with same CATH homology
 1KYO H;  1BGY G;  2IBZ G;  1L0L G;  3L73 G;  3CX5 H;  3H1J G;  3L75 G;  2A06 G;  1KB9 H;  1NTK G;  3L71 G;  1SQP G;  1NTZ G;  1SQQ G;  1P84 H;  1NTM G;  1SQX G;  2FYU G;  3H1H G;  1PPJ G;  1NU1 G;  5KLV G;  3L70 G;  1BCC G;  1L0N G;  4U3F G;  3H1L G;  3CXH H;  3H1I G;  3H1K G;  1SQB G;  3TGU G;  2BCC G;  1SQV G;  1BE3 G;  3CWB G;  3L72 G;  4D6T G;  3L74 G;  4PD4 H;  3BCC G;  1EZV G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...