3H1IG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 20
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1iG00
1PPJG 3H1HG 1SQQG 1NTMG 2FYUG 3L75G 4U3FG 3TGUG 1P84H 1L0LG 1SQBG 2BCCG 1BGYG 1EZVG 3CX5H 3L73G 4PD4H 1NU1G 1NTZG 3H1LG 1L0NG 3CWBG 2IBZG 1BCCG 1SQXG 1NTKG 3L72G 3L74G 3CXHH 1BE3G 3H1IG 4D6TG 1SQVG 2A06G 3H1KG 5KLVG 3L71G 3BCCG 3L70G 1SQPG 3H1JG 1KB9H 1PP9G 1KYOH
chains in the Genus database with same CATH superfamily
2OYHB 3SWKA 1OWAA 3K5BA 2NPSC 1NHLA 2B9BA 4JYBA 3Q3DA 3D70A 1RF0A 4R4LA 2P1JA 3PHLA 4XA4A 1W2BO 1L4AD 2AEJA 3D71A 3AE5C 2WTYA 1X9VA 2CPBA 1L0LK 4HKZH 4L75A 3H1HJ 2C0WA 2J58A 2K9JB 3AE7C 4PD4H 3AE2C 1OX3A 3VYIA 2A06G 4PD4E 4C7NA 3Q5PA 1N7SC 1NTMG 1BE3E 3ZDMA 1OVUA 1JUNA 4DT0A 1N86A 4H13D 2H88C 1MV8A 3L72J 1USEA 3CCSP 2B88A 3HE5B 1EDIA 1GW4A 1EDLA 2KS1A 1DEEG 1FJKA 4GOEA 5CHXA 1PPJG 3C9IA 3L74E 2OYIC 1HVVA 2E74B 3IAOA 2ZT9B 1LTSC 3H32A 1M1JA 3Q5SA 2RN0A 1RE3A 1Q7YQ 2IBZI 4NPEA 3QWOC 3RK3C 1KYOH 3VMAA 1JMBA 3CXHI 3U59A 4ASWA 2KP8A 1HGVA 3CCJP 5TISE 1VF5B 2NZ2A 3FX0A 4WB4A 1KYOE 1KILA 4JPZB 4QMAA 3I55P 3V4QA 3AE3C 1N7LA 4LGDE 1URQC 1SQQG 2QM8A 3MHVA 3HD7B 4BRYA 1QL1A 2RMZA 3L70E 2IFMA 1S9KD 3KHUA 2I1KA 2PGDA 1LT9C 5KAIH 3AE1C 1NU1E 3OAKA 3M91A 1UIXA 2H43A 1TU3F 2ZJSE 2M5AA 4W7YA 1VQ9P 1Q82Q 1CZQA 3AEFC 1SQVE 2XU6A 5APXA 5KAIE 5CCHA 2CPSA 3GMAA 4JF7A 1P84I 3HUSA 2WZ7A 2JEEA 1FJPA 1T2KD 3E7KA 1PP9G 1DD3A 4EI2A 1GL2A 2IPPA 3PLNA 3MTUE 2Z5HA 4IFDK 3QH9A 1LP1A 3VMZA 2WSCJ 4OGQB 1SFCB 4Y28J 3CWBE 1WRGA 3M9HA 4C7NB 3AEBC 1OXZA 3JC22 2W83C 2A06D 1BCCG 2FBWC 2GUSA 3W67A 4N78D 4H13C 4GKGA 1Y9BA 3AE4C 3H1LE 3F5HA 4YTPC 3LW5J 3PJSK 2Y9ZA 4Z1MH 1BGYJ 1E79H 1JY2O 1SQBG 3L73J 3V4WA 5KLVE 1OW6A 4YPCA 1VQ6P 3H6PA 1SQPD 1NJIQ 4Y99C 1KB9E 3H32B 1KQLA 3CCEP 5B5EH 1M1JC 2ZXXA 1BE3D 3A0BH 1M1KQ 5KLIC 1J1EC 2H89C 2QRXA 1EC5A 3BATA 5B5EE 2KUBA 5KKZC 1AVOA 1KILB 1N8RQ 2R3SA 3H1JG 5AVTB 4IFFA 2XV5A 2Z5IA 1LTAC 1NTZG 4EIJA 2AXTE 1M7LA 3H1HE 1FZBA 2E76B 3TNUB 3H25A 2QJYC 2YO2A 1X8YA 2LXCB 2ZXEB 4L76A 1NTMJ 4H44D 1IJDB 2W27A 3L75G 1L0LG 3M0DA 1NKZB 2JO1A 4KJMA 4RO0A 1SQPK 1EZVE 1KYOD 4PJ0H 1RF1C 4WY4D 2Y0DA 1Q81Q 3CX5D 1LWUB 2P58A 1AV1A 2E75D 4GIFA 3GF3A 1T2KC 1GL2B 2HODA 1FBMA 3EFGA 3AEEC 4PJ0E 2OGUA 1PP9D 3WU2E 2FFDB 1GZLA 5AVZB 1LP1B 3B5NA 1YTZI 2QSIA 2WT7B 2YMYA 3CMEP 2K37A 2Q9IA 3HE4A 3NMDA 2P7JA 1NO4A 1NKNA 2K1AA 2G8YA 2FYUD 2R5BA 1VQLP 1SQQK 1LTJA 3TGUJ 2E5YA 3MD0A 3RK2B 1SQQJ 1M56D 2OYHA 1SQXD 1JEKA 5DJTB 3R2PA 1R8EA 2B89A 2KOGA 4KT0J 2V7QJ 3EWKA 4YXWH 5AVSB 1SQBD 3CPWO 4HYTB 1GD2E 3L71D 1YBKA 2OTKE 1VL2A 1IO4A 1YI2P 3CXHH 3O8ZA 1ZRTE 1N7SD 1PP9J 1PGQA 2B87B 2H8PD 2IBZE 1JNMA 2WQYC 3H1KD 1ZXGA 1KB9I 3CXHE 1WMKA 3H1JD 3GHGB 1GU5A 5AW4B 4IFMA 2M3BA 1KILE 2FYUK 2HLOA 3IFMA 1JY3O 5APSA 2XNDH 3CMAP 1N73C 3AE8C 2XKMA 1FZCB 1RE4C 4C7RA 2ZT9D 1BCCJ 4HJGH 3GG2A 1FZGA 2MKVA 3RK3D 3OJAB 3A5TA 2DW3A 1LTTC 4PV1B 1SQBK 4RESB 4NPDA 1SQBJ 3L37A 4ZKUA 1P84H 4M3LA 3MGNA 1BDCA 4DCKA 2IYOA 2E75C 5H2FH 1U57A 2WMMA 1Y47A 1BGYE 3L73E 1URQD 1P84E 3C8VA 1ZR2A 5H2FE 2A45I 3HE4B 1EZVI 2VRSA 1RHZB 1X22A 3OA7A 3RL0B 1IK7A 5KJ7D 4DJGA 2O1KA 4AYCA 1VQKP 1LTJB 4GODA 3CCMP 1QGKB 1NTZK 2UWJE 1NTZJ 3G6EP 2IZ0A 1IFNA 3CI9A 2K3RA 2W6JH 2N9YB 1YJNP 2V4HA 1QX8A 4N3YB 1YYCA 1S2EA 4BWNA 2Z4EA 3L75J 4W80A 2LR2A 2O01H 1L0LJ 1HH0A 1MUUA 4D6TE 3TYYA 3E1RA 4K3AA 3BCCD 1L2PA 1QEXA 1KZUB 1EXJA 1L4AA 2C9LY 1NTME 3AE9C 1DIPA 4OGQD 3NFQA 2D2CD 1LT1A 1SFCA 3CLQA 1L0NE 1FAVA 4C46A 1KTMA 5BU8B 2JWDA 1PPJE 1R5SA 2YNYA 5CJ0A 2BCCD 2XDJA 1GTWA 2KSJA 5E79H 1SQPG 1KC8Q 2QA4P 3I56P 1NVOA 2J5UA 3KZIE 2BEQD 1EDKA 2OTJP 1FU1A 4OWFA 3MUDA 5E79E 3L35A 1BE3G 2ZT9C 2N9BA 5TISH 2MJZA 2W6BA 1X79B 1DX7A 2IFNA 2O1JA 2I1JA 3H1IE 2V7QH 3M06A 1ZV8A 3B71A 3TGUE 3IR9A 2PFXA 1VQMP 4U3FD 4GOFA 1KILD 3TK1A 2WSEJ 4W7ZA 3CC7P 3N4XA 1KV4A 4UB6H 2FYNB 2K9YA 3VP9A 2R5DA 3HD7C 3TNUA 5AW8B 4RJTA 2KLUA 3S1KA 2QJPB 1KD1Q 2IX7C 4UB6E 3V2PA 1KQGB 5KJ7C 4EYYQ 3RGUA 3AEGC 1GW3A 5CCHD 5C39A 3KDPB 2GUVA 1IFDA 1RF0C 4N6JA 2N1TB 1P84D 1GDTA 2Q5UA 3L70G 2WSFJ 4H0LB 3GLMA 4DOJA 1LWUA 1A02F 1ZMEC 5AW6B 1OW8A 3KYQA 2LKMA 4UB8H 1T8ZA 1HTLC 1BDDA 1L4AB 3P8CE 2FFDA 1LTBC 1USDA 2O01N 4XE5B 1BCCE 2WSSH 4OGQC 4UB8E 1T3JA 2RH0A 2KK7A 2D2CC 2FYUG 2WT7A 2IDBA 1G1JA 1YJ9P 1QVGO 1PGJA 1SQXG 1FZEA 2Q1KA 2FXPA 2FY8A 1LJ2A 1KB9H 1S4XA 1JCDA 3A3YB 3U1CA 1NYHA 1YQ4C 4O9BA 4XFJA 2Q7CA 3HTKB 3L36A 2OARA 3L71G 5AVWB 3AE6C 1RE3C 4PD4D 1NTKE 3CD6P 2WWWA 3BASA 3V6IA 4Y99B 4GT1A 1UIIA 2J59M 1NAYA 2JJLA 3H1LG 3E1IA 4IL6X 3WUTA 1QL2A 1SS1A 1KORA 3IF4A 1G1IA 3H1KG 1KMIZ 2AXTH 1FZFA 2B87A 1PV3A 1J1EB 1KILC 1R5LA 3L74D 1FDOA 1CW5A 1SP4A 2ZVNB 5KKZB 3GHGA 2ZYGA 2E42A 1LTIC 1L0LE 1GK6A 1KFNA 1JTHB 2E76C 1MZ9A 2A45H 2K88A 2RKLA 1FZCA 1KN7A 2QJYB 1T6AA 3U1AA 4AQRD 1W5CE 2POHA 5CCHC 4PV1D 1YTZT 1OVRA 1SQPJ 3W68A 2KIKA 3WU2H 1K05A 3TF5A 3HUSC 4A7PA 3H1HG 3L72E 3FXDA 1A02J 3MZWB 2WPRA 3V2QA 1RF1B 2W8ZA 3RBXA 3L70D 2NRGA 5AVYB 1GL2C 1BE3J 1VQ8P 5BVZA 3B5ND 3CX5I 1FE6A 3WMM0 3A7OA 1NU1D 2QEXP 2YIUB 5APUA 1VQNP 1SQVD 3SFDC 4I2LC 1LGHB 2FKWB 3ABVC 1K73Q 3VOPA 1U7MA 1AJYA 5APYA 1J1DB 5AW9B 3FXEA 2WPVB 2JP3A 4I7ZB 4ZKPA 1RH5B 3RK2C 1IK9A 1JMMA 1KFMA 3A0HH 2NPSA 3BCCG 1FZAA 1WT6A 3CWBD 1K9MQ 2GA1A 4WWIA 1JB0J 3A0HE 4JBZA 2KZJA 1HF9A 3BRTB 5DJUB 1KQFB 1JY2P 5TJHA 1QVFO 3NTNA 1U7JA 3H1LD 5AW7B 5APWA 1NU1K 3FWLA 2BCCG 5KLVD 5BU5A 5CJ4A 1SQVK 4TLFA 2Q6QA 3MIWA 2WSCH 1KB9D 1YHQP 2HYNA 4LC1A 1FC2C 2YMKA 4R4MA 2FYUJ 3CCUP 3B8EB 3NXSA 5AW3B 4BXLA 2E74D 1SQXK 2ZFCA 1OZHA 3VMYA 1SQXJ 2IBZG 2KNCB 3EQ2A 1FZCC 3CCVP 2QJKC 3M0DC 1CSBA 1K04A 1NOHA 2OYIA 4IL6H 3LW5H 1MKMA 4H44B 4PV1C 4U3FG 1Q2NA 3TSIA 1DH3A 1LNQA 1CI6B 3VP8A 1QLED 1VF5D 4IL6E 5CCGA 3H1HD 1ZP0C 1AFOA 3L71J 3LIEA 4WY4B 3II6A 3LIDA 3B5NC 3G3ZA 2R44A 3HD7D 1PGOA 2R32A 3H1LJ 4WBAA 5M1BA 2ITAA 1HUCA 5KLVK 1RQVA 1H0TA 1M57D 3H1KJ 1EZVD 1OMIA 3H1JJ 2WITA 4K35A 2H7HA 3PH0A 1LTJC 1BGYG 1LT9A 3L73G 2OYHC 2HR3A 3FWNA 1NAFA 3WUUA 1OW7A 2XZRA 2XNXA 2NPSB 2N1TA 4YXDC 4L73A 1PGPA 3IN6A 3V2NA 3JCUH 3BRVB 2A06E 3VMXA 4N78E 2JDIH 3M9BA 2ZYAA 1FDIA 1SFCD 3JCUE 2FXMA 3PP5A 1SQPE 2ZVOB 2P2UA 2I8DA 1Q90D 4KHXA 4U7JA 3P32A 4AUWA 3A2AA 4D6TG 3HRNA 3KZIH 1N7SB 4DZOA 3PRJA 1HJBA 1VQ4P 1MFZA 1PL5A 3I5CA 2AEMA 1L0NG 1GU4A 1MFTA 3HTKA 2M0BA 2E74C 1IFPA 5KAFH 1ZRTD 2OYIB 3Q2YA 1OIPA 2IBZD 1RY3A 5AVXB 1J2JB 2OYOA 2L91A 3CXHD 2YKOA 5KAFE 3V5BA 5CBNA 1SQQE 2JWAA 1JY3P 3RK3B 3L74G 3BCCJ 1PZQA 1JCCA 1VF5C 5CCGC 1OVVA 1LTGC 2HPCB 4ZNCA 3CX5H 3CC2P 2M3EA 3KXDA 4EDFA 1ZN5A 2E76D 1JY3N 1H0TB 2FYNC 3H1IG 3UIAA 1S5LX 1JTHA 1URQB 3D6ZA 3SWYA 3CX5E 3CC4P 3TGUG 5AVUB 3KPEA 2BCCJ 2QJPC 2QM7A 1AVYA 2Q3IA 1LT9B 3KQGA 2WVRA 2PAJA 2WPSA 1PP9E 5EFWB 1BGYD 1H89A 3L73D 1SVFA 3O6QB 4TT3H 1RQUA 3G4SP 2N1TC 2QVAA 1GL2D 4H0LC 1BSNA 1NU1G 3C1LA 3GW6A 1RF1A 1XTGB 1Y8AA 2FYUE 5K5GB 1SQVG 1L4AC 1IC2A 1NWQA 1BSHA 3RL0g 1SQXE 2Y9YA 4U3FJ 1ZR4A 1SFCC 4EOTA 3OW2O 5AVVB 1HJ0A 1YQ3C 2PP6A 5AW5B 1SQBE 3JSVC 3MP7B 2D2CB 2BEZF 4MN4C 3RK2D 3CCQP 3M9QA 3AEAC 5APVA 3L71E 2Y0EA 2JR8A 4D6TD 3R4YA 3F89A 2M8RA 2YKPA 1H88A 2YXQB 3FGAD 1FS0E 2GM4A 4H13B 4JYCA 1YJWP 3CWBG 2KSEA 1NTMD 2R3CA 2E5TA 2Q3EA 3ITKA 2KS1B 3MUDC 1L0ND 1YITP 1Q86Q 2KB7P 2KLVA 3H1KE 4ASVA 2CK3H 3RBZA 3H1JE 1PPJD 1M1JB 1ZOYC 4PD4I 2JKVA 4HB1A 5KLVG 1VQOP 1S1CX 1NTZE 1FDMA 3CCRP 5L8RJ 5KLIB 1VQPP 1Z56A 1SLQA 1PIXA 1OFCX 2QG4A 5AW0B 3RK3E 3L75E 1NTKG 2OQQA 1E5WA 2KI7B 3AEDC 3A0BE 2P10A 1X0TA 4RKUJ 3EFFK 1VDFA 3CL3D 3S4RA 3H1ID 2P67A 2G3AA 4BRYB 1G2CA 2O3JA 5AW1B 3TGUD 3G9RA 2W90A 2KNCA 4OVNF 1SQQD 4D6TJ 4JQ0D 1VPCA 4GDOA 5APQA 1NTMK 1NGMB 1N73A 2M5AB 1RE4A 1IFIA 5GTHH 2O01J 1L0NK 1ZW0A 4I1LA 1L0NJ 1LWUC 1CI6A 1KYOI 3TDKA 3P7KA 1EXIA 1ZLLA 1HGZA 1EDJA 3HUSB 2OTLP 5GTHE 4WY4A 2FFDC 4CPGA 2FXOA 2A45G 1S5LH 1EZVG 2YIUC 1S72P 2BASA 3T97A 3G71P 3L74J 3RL0D 3L72G 4IOIH 1IFJA 1S5LE 2WSEH 4B86A 2KYVA 1AQTA 2AEFA 1HBWA 1J1DC 3B4SA 3BCCE 2HFED 4I7ZC 2E43A 1D7MA 3N7NA 3H1IJ 3D6YA 1T3UA 3P8CD 2NPSD 5B66H 1GMJA 1HWTC 1BCCD 2HG5D 3Q1MA 5CBOA 5KTBA 3V2RA 5GTIH 3GF7A 1IFMA 5B66E 4LLHA 1PFIA 1AA0A 2BCCE 1KQSO 2WSFH 3L70J 4L74A 2IYPA 3SFEC 2KXPB 2AXCA 5GTIE 2C9NY 2K9JA 4NPFX 1GK4A 2L5GB 2C0XA 1NU1J 3L4FA 2W6AA 1AQ5A 4I6MC 1NH4A 3SWFA 1FOSE 2LXBA 1SQVJ 1YIJP 1JY2N 3VTPC 1N7SA 3GHGC 2YKQA 1IZNB 1VQ5P 2Y0CA 2QIWA 1NTKD 3Q5RA 1G2CB 1N2DC 1VQ7P 2WPQA 3CCLP 4U3FE 3HE5A 3WUVA 3AECC 4OH8B 4WVZA 1NTZD 5APTA 1W2EA 1N73B 3SSUA 5AVRB 1JOCA 1DEBA 1XTCC 2QJKB 4H44C 3CWBJ 1JM0A 2IZ1A 3S9OA 1M8OB 1S9KE 5CCGD 2KZIA 3L75D 1L0LD 2PRRA 2HPCA 4WY4C 2YXRB 2E75B 2HODB 2ZAEB 3VN0A 2YO3A 1JO5A 4ZMDA 1DD4A 2SPZA 3T97B 3B5NB 5KLVJ 5CMZA 1M90Q 1H8AA 1URQA 3P8MC 3USSA 3M0AA 3RL0C 5AVQB 1K8AQ 3HD7A 3L72D 1S3JA 3PTZA 1NTKK 2QE7H 1NTKJ 4HH2A 1EQ7A 5KJ7A 2FYZA 3BVHA 2N1TD 1FOSF 5AW2B 4H0LD 2ZYDA 3O6QA
chains in the Genus database with same CATH topology
1PPJG 3H1HG 1SQQG 1NTMG 2FYUG 3L75G 4U3FG 3TGUG 1P84H 1L0LG 1SQBG 2BCCG 1BGYG 1EZVG 3CX5H 3L73G 4PD4H 1NU1G 1NTZG 3H1LG 1L0NG 3CWBG 2IBZG 1BCCG 1SQXG 1NTKG 3L72G 3L74G 3CXHH 1BE3G 3H1IG 4D6TG 1SQVG 2A06G 3H1KG 5KLVG 3L71G 3BCCG 3L70G 1SQPG 3H1JG 1KB9H 1PP9G 1KYOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ G;  3H1H G;  1SQQ G;  1NTM G;  2FYU G;  3L75 G;  4U3F G;  3TGU G;  1P84 H;  1L0L G;  1SQB G;  2BCC G;  1BGY G;  1EZV G;  3CX5 H;  3L73 G;  4PD4 H;  1NU1 G;  1NTZ G;  3H1L G;  1L0N G;  3CWB G;  2IBZ G;  1BCC G;  1SQX G;  1NTK G;  3L72 G;  3L74 G;  3CXH H;  1BE3 G;  3H1I G;  4D6T G;  1SQV G;  2A06 G;  3H1K G;  5KLV G;  3L71 G;  3BCC G;  3L70 G;  1SQP G;  3H1J G;  1KB9 H;  1PP9 G;  1KYO H; 
#chains in the Genus database with same CATH topology
 2OYH B;  3SWK A;  1OWA A;  3K5B A;  2NPS C;  1NHL A;  2B9B A;  4JYB A;  3Q3D A;  3D70 A;  1RF0 A;  4R4L A;  2P1J A;  3PHL A;  4XA4 A;  1W2B O;  1L4A D;  2AEJ A;  3D71 A;  3AE5 C;  2WTY A;  1X9V A;  2CPB A;  1L0L K;  4HKZ H;  4L75 A;  3H1H J;  2C0W A;  2J58 A;  2K9J B;  3AE7 C;  4PD4 H;  3AE2 C;  1OX3 A;  3VYI A;  2A06 G;  4PD4 E;  4C7N A;  3Q5P A;  1N7S C;  1NTM G;  1BE3 E;  3ZDM A;  1OVU A;  1JUN A;  4DT0 A;  1N86 A;  4H13 D;  2H88 C;  1MV8 A;  3L72 J;  1USE A;  3CCS P;  2B88 A;  3HE5 B;  1EDI A;  1GW4 A;  1EDL A;  2KS1 A;  1DEE G;  1FJK A;  4GOE A;  5CHX A;  1PPJ G;  3C9I A;  3L74 E;  2OYI C;  1HVV A;  2E74 B;  3IAO A;  2ZT9 B;  1LTS C;  3H32 A;  1M1J A;  3Q5S A;  2RN0 A;  1RE3 A;  1Q7Y Q;  2IBZ I;  4NPE A;  3QWO C;  3RK3 C;  1KYO H;  3VMA A;  1JMB A;  3CXH I;  3U59 A;  4ASW A;  2KP8 A;  1HGV A;  3CCJ P;  5TIS E;  1VF5 B;  2NZ2 A;  3FX0 A;  4WB4 A;  1KYO E;  1KIL A;  4JPZ B;  4QMA A;  3I55 P;  3V4Q A;  3AE3 C;  1N7L A;  4LGD E;  1URQ C;  1SQQ G;  2QM8 A;  3MHV A;  3HD7 B;  4BRY A;  1QL1 A;  2RMZ A;  3L70 E;  2IFM A;  1S9K D;  3KHU A;  2I1K A;  2PGD A;  1LT9 C;  5KAI H;  3AE1 C;  1NU1 E;  3OAK A;  3M91 A;  1UIX A;  2H43 A;  1TU3 F;  2ZJS E;  2M5A A;  4W7Y A;  1VQ9 P;  1Q82 Q;  1CZQ A;  3AEF C;  1SQV E;  2XU6 A;  5APX A;  5KAI E;  5CCH A;  2CPS A;  3GMA A;  4JF7 A;  1P84 I;  3HUS A;  2WZ7 A;  2JEE A;  1FJP A;  1T2K D;  3E7K A;  1PP9 G;  1DD3 A;  4EI2 A;  1GL2 A;  2IPP A;  3PLN A;  3MTU E;  2Z5H A;  4IFD K;  3QH9 A;  1LP1 A;  3VMZ A;  2WSC J;  4OGQ B;  1SFC B;  4Y28 J;  3CWB E;  1WRG A;  3M9H A;  4C7N B;  3AEB C;  1OXZ A;  3JC2 2;  2W83 C;  2A06 D;  1BCC G;  2FBW C;  2GUS A;  3W67 A;  4N78 D;  4H13 C;  4GKG A;  1Y9B A;  3AE4 C;  3H1L E;  3F5H A;  4YTP C;  3LW5 J;  3PJS K;  2Y9Z A;  4Z1M H;  1BGY J;  1E79 H;  1JY2 O;  1SQB G;  3L73 J;  3V4W A;  5KLV E;  1OW6 A;  4YPC A;  1VQ6 P;  3H6P A;  1SQP D;  1NJI Q;  4Y99 C;  1KB9 E;  3H32 B;  1KQL A;  3CCE P;  5B5E H;  1M1J C;  2ZXX A;  1BE3 D;  3A0B H;  1M1K Q;  5KLI C;  1J1E C;  2H89 C;  2QRX A;  1EC5 A;  3BAT A;  5B5E E;  2KUB A;  5KKZ C;  1AVO A;  1KIL B;  1N8R Q;  2R3S A;  3H1J G;  5AVT B;  4IFF A;  2XV5 A;  2Z5I A;  1LTA C;  1NTZ G;  4EIJ A;  2AXT E;  1M7L A;  3H1H E;  1FZB A;  2E76 B;  3TNU B;  3H25 A;  2QJY C;  2YO2 A;  1X8Y A;  2LXC B;  2ZXE B;  4L76 A;  1NTM J;  4H44 D;  1IJD B;  2W27 A;  3L75 G;  1L0L G;  3M0D A;  1NKZ B;  2JO1 A;  4KJM A;  4RO0 A;  1SQP K;  1EZV E;  1KYO D;  4PJ0 H;  1RF1 C;  4WY4 D;  2Y0D A;  1Q81 Q;  3CX5 D;  1LWU B;  2P58 A;  1AV1 A;  2E75 D;  4GIF A;  3GF3 A;  1T2K C;  1GL2 B;  2HOD A;  1FBM A;  3EFG A;  3AEE C;  4PJ0 E;  2OGU A;  1PP9 D;  3WU2 E;  2FFD B;  1GZL A;  5AVZ B;  1LP1 B;  3B5N A;  1YTZ I;  2QSI A;  2WT7 B;  2YMY A;  3CME P;  2K37 A;  2Q9I A;  3HE4 A;  3NMD A;  2P7J A;  1NO4 A;  1NKN A;  2K1A A;  2G8Y A;  2FYU D;  2R5B A;  1VQL P;  1SQQ K;  1LTJ A;  3TGU J;  2E5Y A;  3MD0 A;  3RK2 B;  1SQQ J;  1M56 D;  2OYH A;  1SQX D;  1JEK A;  5DJT B;  3R2P A;  1R8E A;  2B89 A;  2KOG A;  4KT0 J;  2V7Q J;  3EWK A;  4YXW H;  5AVS B;  1SQB D;  3CPW O;  4HYT B;  1GD2 E;  3L71 D;  1YBK A;  2OTK E;  1VL2 A;  1IO4 A;  1YI2 P;  3CXH H;  3O8Z A;  1ZRT E;  1N7S D;  1PP9 J;  1PGQ A;  2B87 B;  2H8P D;  2IBZ E;  1JNM A;  2WQY C;  3H1K D;  1ZXG A;  1KB9 I;  3CXH E;  1WMK A;  3H1J D;  3GHG B;  1GU5 A;  5AW4 B;  4IFM A;  2M3B A;  1KIL E;  2FYU K;  2HLO A;  3IFM A;  1JY3 O;  5APS A;  2XND H;  3CMA P;  1N73 C;  3AE8 C;  2XKM A;  1FZC B;  1RE4 C;  4C7R A;  2ZT9 D;  1BCC J;  4HJG H;  3GG2 A;  1FZG A;  2MKV A;  3RK3 D;  3OJA B;  3A5T A;  2DW3 A;  1LTT C;  4PV1 B;  1SQB K;  4RES B;  4NPD A;  1SQB J;  3L37 A;  4ZKU A;  1P84 H;  4M3L A;  3MGN A;  1BDC A;  4DCK A;  2IYO A;  2E75 C;  5H2F H;  1U57 A;  2WMM A;  1Y47 A;  1BGY E;  3L73 E;  1URQ D;  1P84 E;  3C8V A;  1ZR2 A;  5H2F E;  2A45 I;  3HE4 B;  1EZV I;  2VRS A;  1RHZ B;  1X22 A;  3OA7 A;  3RL0 B;  1IK7 A;  5KJ7 D;  4DJG A;  2O1K A;  4AYC A;  1VQK P;  1LTJ B;  4GOD A;  3CCM P;  1QGK B;  1NTZ K;  2UWJ E;  1NTZ J;  3G6E P;  2IZ0 A;  1IFN A;  3CI9 A;  2K3R A;  2W6J H;  2N9Y B;  1YJN P;  2V4H A;  1QX8 A;  4N3Y B;  1YYC A;  1S2E A;  4BWN A;  2Z4E A;  3L75 J;  4W80 A;  2LR2 A;  2O01 H;  1L0L J;  1HH0 A;  1MUU A;  4D6T E;  3TYY A;  3E1R A;  4K3A A;  3BCC D;  1L2P A;  1QEX A;  1KZU B;  1EXJ A;  1L4A A;  2C9L Y;  1NTM E;  3AE9 C;  1DIP A;  4OGQ D;  3NFQ A;  2D2C D;  1LT1 A;  1SFC A;  3CLQ A;  1L0N E;  1FAV A;  4C46 A;  1KTM A;  5BU8 B;  2JWD A;  1PPJ E;  1R5S A;  2YNY A;  5CJ0 A;  2BCC D;  2XDJ A;  1GTW A;  2KSJ A;  5E79 H;  1SQP G;  1KC8 Q;  2QA4 P;  3I56 P;  1NVO A;  2J5U A;  3KZI E;  2BEQ D;  1EDK A;  2OTJ P;  1FU1 A;  4OWF A;  3MUD A;  5E79 E;  3L35 A;  1BE3 G;  2ZT9 C;  2N9B A;  5TIS H;  2MJZ A;  2W6B A;  1X79 B;  1DX7 A;  2IFN A;  2O1J A;  2I1J A;  3H1I E;  2V7Q H;  3M06 A;  1ZV8 A;  3B71 A;  3TGU E;  3IR9 A;  2PFX A;  1VQM P;  4U3F D;  4GOF A;  1KIL D;  3TK1 A;  2WSE J;  4W7Z A;  3CC7 P;  3N4X A;  1KV4 A;  4UB6 H;  2FYN B;  2K9Y A;  3VP9 A;  2R5D A;  3HD7 C;  3TNU A;  5AW8 B;  4RJT A;  2KLU A;  3S1K A;  2QJP B;  1KD1 Q;  2IX7 C;  4UB6 E;  3V2P A;  1KQG B;  5KJ7 C;  4EYY Q;  3RGU A;  3AEG C;  1GW3 A;  5CCH D;  5C39 A;  3KDP B;  2GUV A;  1IFD A;  1RF0 C;  4N6J A;  2N1T B;  1P84 D;  1GDT A;  2Q5U A;  3L70 G;  2WSF J;  4H0L B;  3GLM A;  4DOJ A;  1LWU A;  1A02 F;  1ZME C;  5AW6 B;  1OW8 A;  3KYQ A;  2LKM A;  4UB8 H;  1T8Z A;  1HTL C;  1BDD A;  1L4A B;  3P8C E;  2FFD A;  1LTB C;  1USD A;  2O01 N;  4XE5 B;  1BCC E;  2WSS H;  4OGQ C;  4UB8 E;  1T3J A;  2RH0 A;  2KK7 A;  2D2C C;  2FYU G;  2WT7 A;  2IDB A;  1G1J A;  1YJ9 P;  1QVG O;  1PGJ A;  1SQX G;  1FZE A;  2Q1K A;  2FXP A;  2FY8 A;  1LJ2 A;  1KB9 H;  1S4X A;  1JCD A;  3A3Y B;  3U1C A;  1NYH A;  1YQ4 C;  4O9B A;  4XFJ A;  2Q7C A;  3HTK B;  3L36 A;  2OAR A;  3L71 G;  5AVW B;  3AE6 C;  1RE3 C;  4PD4 D;  1NTK E;  3CD6 P;  2WWW A;  3BAS A;  3V6I A;  4Y99 B;  4GT1 A;  1UII A;  2J59 M;  1NAY A;  2JJL A;  3H1L G;  3E1I A;  4IL6 X;  3WUT A;  1QL2 A;  1SS1 A;  1KOR A;  3IF4 A;  1G1I A;  3H1K G;  1KMI Z;  2AXT H;  1FZF A;  2B87 A;  1PV3 A;  1J1E B;  1KIL C;  1R5L A;  3L74 D;  1FDO A;  1CW5 A;  1SP4 A;  2ZVN B;  5KKZ B;  3GHG A;  2ZYG A;  2E42 A;  1LTI C;  1L0L E;  1GK6 A;  1KFN A;  1JTH B;  2E76 C;  1MZ9 A;  2A45 H;  2K88 A;  2RKL A;  1FZC A;  1KN7 A;  2QJY B;  1T6A A;  3U1A A;  4AQR D;  1W5C E;  2POH A;  5CCH C;  4PV1 D;  1YTZ T;  1OVR A;  1SQP J;  3W68 A;  2KIK A;  3WU2 H;  1K05 A;  3TF5 A;  3HUS C;  4A7P A;  3H1H G;  3L72 E;  3FXD A;  1A02 J;  3MZW B;  2WPR A;  3V2Q A;  1RF1 B;  2W8Z A;  3RBX A;  3L70 D;  2NRG A;  5AVY B;  1GL2 C;  1BE3 J;  1VQ8 P;  5BVZ A;  3B5N D;  3CX5 I;  1FE6 A;  3WMM 0;  3A7O A;  1NU1 D;  2QEX P;  2YIU B;  5APU A;  1VQN P;  1SQV D;  3SFD C;  4I2L C;  1LGH B;  2FKW B;  3ABV C;  1K73 Q;  3VOP A;  1U7M A;  1AJY A;  5APY A;  1J1D B;  5AW9 B;  3FXE A;  2WPV B;  2JP3 A;  4I7Z B;  4ZKP A;  1RH5 B;  3RK2 C;  1IK9 A;  1JMM A;  1KFM A;  3A0H H;  2NPS A;  3BCC G;  1FZA A;  1WT6 A;  3CWB D;  1K9M Q;  2GA1 A;  4WWI A;  1JB0 J;  3A0H E;  4JBZ A;  2KZJ A;  1HF9 A;  3BRT B;  5DJU B;  1KQF B;  1JY2 P;  5TJH A;  1QVF O;  3NTN A;  1U7J A;  3H1L D;  5AW7 B;  5APW A;  1NU1 K;  3FWL A;  2BCC G;  5KLV D;  5BU5 A;  5CJ4 A;  1SQV K;  4TLF A;  2Q6Q A;  3MIW A;  2WSC H;  1KB9 D;  1YHQ P;  2HYN A;  4LC1 A;  1FC2 C;  2YMK A;  4R4M A;  2FYU J;  3CCU P;  3B8E B;  3NXS A;  5AW3 B;  4BXL A;  2E74 D;  1SQX K;  2ZFC A;  1OZH A;  3VMY A;  1SQX J;  2IBZ G;  2KNC B;  3EQ2 A;  1FZC C;  3CCV P;  2QJK C;  3M0D C;  1CSB A;  1K04 A;  1NOH A;  2OYI A;  4IL6 H;  3LW5 H;  1MKM A;  4H44 B;  4PV1 C;  4U3F G;  1Q2N A;  3TSI A;  1DH3 A;  1LNQ A;  1CI6 B;  3VP8 A;  1QLE D;  1VF5 D;  4IL6 E;  5CCG A;  3H1H D;  1ZP0 C;  1AFO A;  3L71 J;  3LIE A;  4WY4 B;  3II6 A;  3LID A;  3B5N C;  3G3Z A;  2R44 A;  3HD7 D;  1PGO A;  2R32 A;  3H1L J;  4WBA A;  5M1B A;  2ITA A;  1HUC A;  5KLV K;  1RQV A;  1H0T A;  1M57 D;  3H1K J;  1EZV D;  1OMI A;  3H1J J;  2WIT A;  4K35 A;  2H7H A;  3PH0 A;  1LTJ C;  1BGY G;  1LT9 A;  3L73 G;  2OYH C;  2HR3 A;  3FWN A;  1NAF A;  3WUU A;  1OW7 A;  2XZR A;  2XNX A;  2NPS B;  2N1T A;  4YXD C;  4L73 A;  1PGP A;  3IN6 A;  3V2N A;  3JCU H;  3BRV B;  2A06 E;  3VMX A;  4N78 E;  2JDI H;  3M9B A;  2ZYA A;  1FDI A;  1SFC D;  3JCU E;  2FXM A;  3PP5 A;  1SQP E;  2ZVO B;  2P2U A;  2I8D A;  1Q90 D;  4KHX A;  4U7J A;  3P32 A;  4AUW A;  3A2A A;  4D6T G;  3HRN A;  3KZI H;  1N7S B;  4DZO A;  3PRJ A;  1HJB A;  1VQ4 P;  1MFZ A;  1PL5 A;  3I5C A;  2AEM A;  1L0N G;  1GU4 A;  1MFT A;  3HTK A;  2M0B A;  2E74 C;  1IFP A;  5KAF H;  1ZRT D;  2OYI B;  3Q2Y A;  1OIP A;  2IBZ D;  1RY3 A;  5AVX B;  1J2J B;  2OYO A;  2L91 A;  3CXH D;  2YKO A;  5KAF E;  3V5B A;  5CBN A;  1SQQ E;  2JWA A;  1JY3 P;  3RK3 B;  3L74 G;  3BCC J;  1PZQ A;  1JCC A;  1VF5 C;  5CCG C;  1OVV A;  1LTG C;  2HPC B;  4ZNC A;  3CX5 H;  3CC2 P;  2M3E A;  3KXD A;  4EDF A;  1ZN5 A;  2E76 D;  1JY3 N;  1H0T B;  2FYN C;  3H1I G;  3UIA A;  1S5L X;  1JTH A;  1URQ B;  3D6Z A;  3SWY A;  3CX5 E;  3CC4 P;  3TGU G;  5AVU B;  3KPE A;  2BCC J;  2QJP C;  2QM7 A;  1AVY A;  2Q3I A;  1LT9 B;  3KQG A;  2WVR A;  2PAJ A;  2WPS A;  1PP9 E;  5EFW B;  1BGY D;  1H89 A;  3L73 D;  1SVF A;  3O6Q B;  4TT3 H;  1RQU A;  3G4S P;  2N1T C;  2QVA A;  1GL2 D;  4H0L C;  1BSN A;  1NU1 G;  3C1L A;  3GW6 A;  1RF1 A;  1XTG B;  1Y8A A;  2FYU E;  5K5G B;  1SQV G;  1L4A C;  1IC2 A;  1NWQ A;  1BSH A;  3RL0 g;  1SQX E;  2Y9Y A;  4U3F J;  1ZR4 A;  1SFC C;  4EOT A;  3OW2 O;  5AVV B;  1HJ0 A;  1YQ3 C;  2PP6 A;  5AW5 B;  1SQB E;  3JSV C;  3MP7 B;  2D2C B;  2BEZ F;  4MN4 C;  3RK2 D;  3CCQ P;  3M9Q A;  3AEA C;  5APV A;  3L71 E;  2Y0E A;  2JR8 A;  4D6T D;  3R4Y A;  3F89 A;  2M8R A;  2YKP A;  1H88 A;  2YXQ B;  3FGA D;  1FS0 E;  2GM4 A;  4H13 B;  4JYC A;  1YJW P;  3CWB G;  2KSE A;  1NTM D;  2R3C A;  2E5T A;  2Q3E A;  3ITK A;  2KS1 B;  3MUD C;  1L0N D;  1YIT P;  1Q86 Q;  2KB7 P;  2KLV A;  3H1K E;  4ASV A;  2CK3 H;  3RBZ A;  3H1J E;  1PPJ D;  1M1J B;  1ZOY C;  4PD4 I;  2JKV A;  4HB1 A;  5KLV G;  1VQO P;  1S1C X;  1NTZ E;  1FDM A;  3CCR P;  5L8R J;  5KLI B;  1VQP P;  1Z56 A;  1SLQ A;  1PIX A;  1OFC X;  2QG4 A;  5AW0 B;  3RK3 E;  3L75 E;  1NTK G;  2OQQ A;  1E5W A;  2KI7 B;  3AED C;  3A0B E;  2P10 A;  1X0T A;  4RKU J;  3EFF K;  1VDF A;  3CL3 D;  3S4R A;  3H1I D;  2P67 A;  2G3A A;  4BRY B;  1G2C A;  2O3J A;  5AW1 B;  3TGU D;  3G9R A;  2W90 A;  2KNC A;  4OVN F;  1SQQ D;  4D6T J;  4JQ0 D;  1VPC A;  4GDO A;  5APQ A;  1NTM K;  1NGM B;  1N73 A;  2M5A B;  1RE4 A;  1IFI A;  5GTH H;  2O01 J;  1L0N K;  1ZW0 A;  4I1L A;  1L0N J;  1LWU C;  1CI6 A;  1KYO I;  3TDK A;  3P7K A;  1EXI A;  1ZLL A;  1HGZ A;  1EDJ A;  3HUS B;  2OTL P;  5GTH E;  4WY4 A;  2FFD C;  4CPG A;  2FXO A;  2A45 G;  1S5L H;  1EZV G;  2YIU C;  1S72 P;  2BAS A;  3T97 A;  3G71 P;  3L74 J;  3RL0 D;  3L72 G;  4IOI H;  1IFJ A;  1S5L E;  2WSE H;  4B86 A;  2KYV A;  1AQT A;  2AEF A;  1HBW A;  1J1D C;  3B4S A;  3BCC E;  2HFE D;  4I7Z C;  2E43 A;  1D7M A;  3N7N A;  3H1I J;  3D6Y A;  1T3U A;  3P8C D;  2NPS D;  5B66 H;  1GMJ A;  1HWT C;  1BCC D;  2HG5 D;  3Q1M A;  5CBO A;  5KTB A;  3V2R A;  5GTI H;  3GF7 A;  1IFM A;  5B66 E;  4LLH A;  1PFI A;  1AA0 A;  2BCC E;  1KQS O;  2WSF H;  3L70 J;  4L74 A;  2IYP A;  3SFE C;  2KXP B;  2AXC A;  5GTI E;  2C9N Y;  2K9J A;  4NPF X;  1GK4 A;  2L5G B;  2C0X A;  1NU1 J;  3L4F A;  2W6A A;  1AQ5 A;  4I6M C;  1NH4 A;  3SWF A;  1FOS E;  2LXB A;  1SQV J;  1YIJ P;  1JY2 N;  3VTP C;  1N7S A;  3GHG C;  2YKQ A;  1IZN B;  1VQ5 P;  2Y0C A;  2QIW A;  1NTK D;  3Q5R A;  1G2C B;  1N2D C;  1VQ7 P;  2WPQ A;  3CCL P;  4U3F E;  3HE5 A;  3WUV A;  3AEC C;  4OH8 B;  4WVZ A;  1NTZ D;  5APT A;  1W2E A;  1N73 B;  3SSU A;  5AVR B;  1JOC A;  1DEB A;  1XTC C;  2QJK B;  4H44 C;  3CWB J;  1JM0 A;  2IZ1 A;  3S9O A;  1M8O B;  1S9K E;  5CCG D;  2KZI A;  3L75 D;  1L0L D;  2PRR A;  2HPC A;  4WY4 C;  2YXR B;  2E75 B;  2HOD B;  2ZAE B;  3VN0 A;  2YO3 A;  1JO5 A;  4ZMD A;  1DD4 A;  2SPZ A;  3T97 B;  3B5N B;  5KLV J;  5CMZ A;  1M90 Q;  1H8A A;  1URQ A;  3P8M C;  3USS A;  3M0A A;  3RL0 C;  5AVQ B;  1K8A Q;  3HD7 A;  3L72 D;  1S3J A;  3PTZ A;  1NTK K;  2QE7 H;  1NTK J;  4HH2 A;  1EQ7 A;  5KJ7 A;  2FYZ A;  3BVH A;  2N1T D;  1FOS F;  5AW2 B;  4H0L D;  2ZYD A;  3O6Q A; 
#chains in the Genus database with same CATH homology
 1PPJ G;  3H1H G;  1SQQ G;  1NTM G;  2FYU G;  3L75 G;  4U3F G;  3TGU G;  1P84 H;  1L0L G;  1SQB G;  2BCC G;  1BGY G;  1EZV G;  3CX5 H;  3L73 G;  4PD4 H;  1NU1 G;  1NTZ G;  3H1L G;  1L0N G;  3CWB G;  2IBZ G;  1BCC G;  1SQX G;  1NTK G;  3L72 G;  3L74 G;  3CXH H;  1BE3 G;  3H1I G;  4D6T G;  1SQV G;  2A06 G;  3H1K G;  5KLV G;  3L71 G;  3BCC G;  3L70 G;  1SQP G;  3H1J G;  1KB9 H;  1PP9 G;  1KYO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...