3H1IG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 20
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1iG00
1SQQG 1EZVG 3L73G 1L0LG 1BCCG 1KYOH 3CX5H 3L72G 1NU1G 1BGYG 1NTKG 1SQBG 3H1LG 1NTZG 5KLVG 1SQVG 1PPJG 2FYUG 3CWBG 1KB9H 3H1IG 3CXHH 1BE3G 3L74G 3TGUG 1P84H 2BCCG 3L71G 2A06G 3H1JG 1L0NG 3H1KG 3BCCG 3L70G 1NTMG 1SQPG 4PD4H 1PP9G 4U3FG 3L75G 1SQXG 3H1HG 4D6TG 2IBZG
chains in the Genus database with same CATH superfamily
1LTAC 1WMKA 5AW0B 2H43A 2W6JH 1FU1A 2I1JA 3AE9C 1LTJC 4IL6E 1H8AA 1SQBG 3GHGC 4JYBA 2Q9IA 3M91A 3M0DA 3PH0A 1VQKP 3A3YB 2BCCE 4PV1C 1BDDA 1N7SC 1S2EA 3B8EB 2OQQA 1Z56A 3E7KA 1S5LH 3Q1MA 5APTA 3HUSB 1LTIC 1Y9BA 2BCCJ 5AVVB 1SFCB 1OZHA 1NH4A 1BE3J 3H1KD 3BCCG 3CCLP 2HODA 1OVRA 4KJMA 1USEA 3RL0B 3L70J 5CCHD 3TK1A 1L0NJ 1OMIA 3A0BE 1IFMA 3H1JE 1IJDB 3AEDC 3I5CA 2OTJP 1PGPA 2V7QJ 1L0NE 4ZNCA 2A45I 3MTUE 1JY3O 4AYCA 3RL0D 1EXJA 1CZQA 1LTJA 2M0BA 2M8RA 2ZJSE 1VQ4P 3TDKA 2XKMA 1EZVI 1IFDA 4EYYQ 1FZCA 1AFOA 2LXBA 2K88A 3L4FA 4XE5B 5KLVJ 5AVSB 1PPJG 1SQVG 3AE8C 4WBAA 2OYHA 1LP1A 2Y0CA 1KB9D 3CX5I 3R2PA 3V4WA 1URQA 2ZVNB 1P84E 2QJKB 4RJTA 2KXPB 5KJ7D 2V7QH 2PFXA 2R3SA 1SQQE 2BCCG 1KQSO 1KQFB 2HLOA 2IFMA 2Q6QA 2NPSA 3CXHI 1OVUA 5GTHH 2IFNA 3B5ND 4YXWH 2PGDA 2KSJA 3VMYA 1YYCA 2WPSA 1RY3A 1FE6A 2VRSA 1QX8A 1OIPA 3CMAP 1JY2O 2OYHB 4I7ZB 1SQPD 1ZRTE 1K05A 5KLIC 1OWAA 3D71A 1DD3A 1J1EC 3RBZA 1JCCA 3V4QA 1L0LJ 4D6TD 1GU4A 2OYIB 2E43A 2KOGA 3SWFA 3D70A 2WSCH 3L73G 3RL0C 5E79H 3Q5RA 2E76D 4QMAA 3G3ZA 5KLVG 2C0WA 2QG4A 4PV1B 3WUVA 1URQC 1ZR4A 1BCCJ 1MFTA 2HODB 1L4AC 3AE5C 2IDBA 3HE5A 3U1CA 1S4XA 4AQRD 3H6PA 5M1BA 1USDA 1AA0A 1SQQD 2G3AA 1RE3C 3GHGB 4ASVA 4EIJA 1FZGA 2PAJA 2Y9YA 3FWNA 2Y0EA 4GDOA 4N78E 4UB8H 4XA4A 2O01J 4EDFA 5APSA 1JY2P 1NYHA 1KB9E 5CCGA 1N7LA 1EDIA 3H1LE 5AVUB 5AW5B 1BGYE 1OXZA 2QJPC 4YPCA 4I2LC 2QIWA 2Y0DA 2RMZA 3L74D 3RK2D 4D6TJ 2FYZA 1IO4A 4H13D 1FAVA 5CBOA 3TF5A 3F89A 3EQ2A 4K35A 1VL2A 2P1JA 3P8MC 3EWKA 3G71P 1H89A 1NTME 1L0ND 1IK9A 3BCCD 2RN0A 5CJ0A 1NTZJ 2N1TC 3HTKB 3L70D 2QE7H 5B66E 4I7ZC 1JNMA 1G1JA 1OW8A 3V2QA 4OGQC 4W80A 3UIAA 2BEQD 3H25A 3K5BA 4EI2A 3HE4A 3OJAB 3I56P 3CC2P 1SQXK 2IYPA 1T8ZA 3O8ZA 2WSEH 1PGJA 1FS0E 1GW4A 1JY3P 1JMBA 1KORA 1PL5A 1YQ4C 1ZW0A 2WSSH 2QRXA 1UIXA 2K9JB 2XNXA 3GF3A 1CSBA 3HD7D 3L74E 2J5UA 4GKGA 3SSUA 2KK7A 1HGVA 2W6BA 3LIDA 1HVVA 2FYNC 4PD4E 2R44A 1YJ9P 2L5GB 1N8RQ 1GL2A 4JYCA 4OGQD 5APYA 2WZ7A 1NU1J 3MUDA 2NPSD 1SQXD 4N6JA 1KD1Q 2M3EA 2N1TD 1J1DC 1HF9A 3RK3D 4RESB 1SQQG 3B71A 1FZBA 1ZOYC 2WSEJ 1PIXA 4H13C 5CJ4A 1FOSF 2GUSA 1KB9I 1ZP0C 2POHA 3CX5D 3VOPA 1D7MA 1SP4A 1NTZG 3LIEA 1M1JA 2ZYAA 3IFMA 2KS1A 1H88A 3CMEP 1NTMK 3M0AA 1QGKB 2ITAA 1OX3A 2WQYC 3H1IG 3H1ID 1L2PA 1QLED 3L73J 3CXHH 4H44B 4NPFX 4XFJA 5CMZA 5E79E 3T97A 1VQ5P 1Y8AA 3L71J 1YITP 3CC7P 1NVOA 3SWKA 1VF5C 3MHVA 3MGNA 2JP3A 1QL2A 1R5SA 3A0BH 1E5WA 3H1KG 3NTNA 1RE3A 2R5DA 2IX7C 4IFMA 1FZFA 2O1KA 3Q5SA 2QJPB 2E74C 3QWOC 5KLVE 2N1TA 3S9OA 1LT9C 3U1AA 1W5CE 1PPJE 1SQVE 2P58A 5CCGC 1QL1A 2R5BA 3MUDC 4WB4A 5AVXB 1JTHA 3L75G 1VQNP 2IBZG 1S5LE 1ZR2A 1LTJB 5AVQB 2N9YB 1SQQJ 5KAFH 1QVFO 2OGUA 1PP9E 5K5GB 1KYOD 1T6AA 2C0XA 1PP9J 3IR9A 3KXDA 4I1LA 3GMAA 1URQB 1EC5A 1VQPP 2I1KA 1LP1B 1AQTA 1BE3G 3EFGA 2KLVA 4I6MC 3TYYA 1NO4A 3VP8A 1EXIA 4JBZA 3F5HA 1BDCA 2H89C 1BCCD 5AVWB 1NAFA 2OYOA 2FKWB 2XV5A 2JEEA 3CCUP 1DEEG 1KFMA 1XTGB 2H88C 1LT9A 2FYUE 3A2AA 3L70G 4TT3H 5B66H 5KLIB 3VTPC 3L70E 3C9IA 2C9NY 1EDJA 1IFIA 1N86A 2CPSA 2FYUJ 4TLFA 1SQPG 5KAIH 5AVZB 4RO0A 1BCCE 2FFDA 3B5NA 3A0HH 4U3FG 5TISH 1GL2B 3L72E 4HB1A 1A02F 1P84I 2YMKA 3B5NB 3NFQA 3VP9A 4L75A 1JM0A 3AEAC 3GF7A 1YTZI 2FFDB 4UB6E 3PTZA 1KFNA 3SFDC 1RE4C 1SQQK 2QVAA 3SWYA 2ZVOB 1SQXE 1SS1A 2NPSC 1KQLA 1GL2D 1NTKG 1NU1G 1SQVJ 3HUSA 4O9BA 4DZOA 2O01N 4GOEA 4C7NA 3Q2YA 3HD7B 3MIWA 3PJSK 4Y99C 2OTKE 3Q3DA 5CCHC 4B86A 1KZUB 1LTSC 4WY4B 4DT0A 1N73A 3AEBC 1BSHA 1IZNB 2QM7A 2L91A 3CPWO 2WTYA 3L72D 3BVHA 2LKMA 1YTZT 1M8OB 1NWQA 1NTZE 1RF1A 4AUWA 1KILB 2GUVA 4GODA 5DJUB 1EDLA 1K9MQ 1CW5A 3GG2A 3B4SA 2JO1A 1VF5B 4H0LC 3VN0A 2WWWA 4D6TG 2K1AA 1HUCA 2YKQA 1QEXA 4D6TE 1G2CA 3AE4C 3KDPB 3WU2E 2WPVB 1K04A 4CPGA 1S3JA 1UIIA 2QJYB 2YKOA 1GD2E 4H44D 1ZLLA 4LC1A 3FX0A 3MP7B 1CI6A 1BGYD 4IOIH 4WVZA 2Z5IA 1EQ7A 3IF4A 3RK3B 1VQ9P 2KLUA 3L72J 3GLMA 2KZJA 5AW2B 5B5EH 3T97B 1H0TB 1LNQA 1OVVA 2IBZE 2D2CD 2ZYDA 1P84D 4Y99B 3PLNA 4NPEA 3VMZA 1Q86Q 2YIUC 3VMXA 3CCEP 1NU1D 1OW7A 1RH5B 3ABVC 4L73A 1PPJD 1SQVD 4OVNF 1S72P 3CCVP 3M9HA 2JR8A 2WPRA 4DJGA 1OW6A 1BGYJ 3FXDA 2E75B 2E76C 2H8PD 3H1HD 2XZRA 3WU2H 4Y28J 2FFDC 3CCRP 4PV1D 5CCHA 1YJNP 2M5AB 4UB6H 1Q82Q 1FZEA 1T3UA 2BASA 3OAKA 3QH9A 2KB7P 3ZDMA 3H1JD 5GTIE 4U3FJ 1RE4A 2Q1KA 5H2FH 4W7YA 3AEEC 2FBWC 3I55P 5KAIE 2OYHC 3AE6C 3H1KE 3TNUB 1W2BO 5H2FE 1LT1A 1NJIQ 3H1KJ 2GA1A 1BSNA 1M7LA 1L0NK 4HYTB 2YXRB 2A06D 3Q5PA 1IFNA 2D2CC 3NXSA 3L74J 3P8CE 1PZQA 3RL0g 3H1LD 1KILA 5TJHA 2OARA 2YIUB 4N78D 5BU8B 4GIFA 2B87A 4PD4D 4W7ZA 3II6A 1SQBE 5APUA 2A06E 2IYOA 3U59A 3LW5J 1GDTA 2YKPA 3BRTB 4IFFA 1IK7A 2E5TA 3S4RA 4ASWA 2AEJA 2CPBA 1KV4A 4BRYB 2Z4EA 4GOFA 3KHUA 2A45H 3RK3C 2K3RA 5AVYB 1LT9B 5KKZB 3BATA 4C7NB 1LWUA 2XU6A 4H0LD 1LTTC 1HH0A 1SQBK 3CWBE 2QJYC 2FYUG 2P67A 2KZIA 2FYUD 3FWLA 3CWBG 1S9KE 4HJGH 3S1KA 1JY2N 1Q7YQ 4YXDC 2MKVA 3HRNA 3BCCE 3L73E 4DCKA 1VQOP 2K9YA 2E42A 3USSA 5AW3B 2CK3H 3RGUA 2WSCJ 1GK4A 3LW5H 5AW4B 1VQ6P 1ZV8A 3HUSC 1VQLP 4BXLA 4U3FE 1KILC 4YTPC 1SQPJ 1L0NG 1ZN5A 5CCGD 1HJBA 4U7JA 1R8EA 1L4AD 1MV8A 2W90A 2P2UA 3D6ZA 1FJKA 2J59M 3AEGC 3L37A 1KTMA 5AVRB 1DX7A 1LGHB 1KYOE 2ZAEB 1NTKE 1M90Q 1PP9D 3V2PA 3A5TA 1JTHB 1KC8Q 1J1DB 1Q90D 1YBKA 2IBZD 1FBMA 3AE7C 3JSVC 2QJKC 3PHLA 3FGAD 4K3AA 2HG5D 2WPQA 4BRYA 1JMMA 1GTWA 1LWUC 1KMIZ 2FXPA 3ITKA 1RF0C 2AXTH 3CX5H 1N2DC 3MZWB 2FYNB 2NPSB 1NTKD 2D2CB 5APQA 5AW7B 4DOJA 1Q81Q 2WMMA 2LR2A 4PJ0E 4ZMDA 1GZLA 2IZ1A 2Y9ZA 2JKVA 3PP5A 3B5NC 3WUTA 1T2KC 2C9LY 1FJPA 2J58A 1OFCX 3R4YA 1JB0J 1EZVD 4OGQB 2QA4P 1JUNA 3KZIH 3H1JG 2NRGA 1RQVA 3N7NA 3AEFC 1ZRTD 2N1TB 2GM4A 1NTZD 5APWA 4KT0J 1S9KD 2RKLA 5AW6B 3H32B 5GTIH 4BWNA 2QM8A 1SQVK 1PV3A 1SFCC 2E76B 3GW6A 4L76A 1BE3D 3BRVB 1FDIA 4OH8B 4HKZH 2BCCD 1PFIA 1HGZA 2M5AA 2HR3A 2A45G 3AE2C 2HPCB 2WVRA 1JOCA 1SQXJ 2PRRA 2NZ2A 5AW1B 1X9VA 1HJ0A 3G4SP 2K9JA 2FXOA 3AECC 3H32A 1AJYA 3V2NA 2O01H 1LTGC 2E5YA 2JWDA 2ZFCA 3KYQA 1KB9H 2UWJE 2E74D 3O6QB 1X8YA 3HE4B 4JPZB 4N3YB 3N4XA 5AW8B 1G2CB 3VYIA 3P8CD 1QVGO 1Q2NA 2KI7B 2ZT9C 5AVTB 2O3JA 2WSFJ 3TGUG 2HYNA 2K37A 3RBXA 3V5BA 3TGUE 1BE3E 1FOSE 1N7SD 3MD0A 3JCUH 3H1IJ 3L36A 5CHXA 1RF1B 2M3BA 3KPEA 1GW3A 5CBNA 1GMJA 1M1KQ 1NTMG 1A02J 1AV1A 1NTMD 2JJLA 4R4MA 1FZAA 3V6IA 4H0LB 1Y47A 3AE1C 3E1IA 4H44C 4WY4A 1MZ9A 1N73B 1EZVE 2G8YA 1JCDA 2WSFH 1U7MA 4IFDK 1EZVG 3CL3D 3P32A 5KKZC 1KN7A 4R4LA 1BCCG 1M56D 3VMAA 2HFED 3L72G 2E75D 1RF0A 2KIKA 3CCQP 3HTKA 1ZMEC 3KQGA 3GHGA 2FY8A 1SFCD 1FDMA 3IN6A 4WY4C 4NPDA 3HE5B 4IL6H 3BASA 2AXTE 4C46A 3OW2O 4RKUJ 1SVFA 1KILD 2DW3A 1JY3N 3E1RA 1VQMP 1K73Q 2RH0A 2A06G 3OA7A 1E79H 4MN4C 3TSIA 2PP6A 2Z5HA 2Q3EA 5TISE 2Q5UA 1U57A 3V2RA 5KTBA 5KLVD 1WRGA 3HD7A 2P7JA 1NKZB 1IC2A 1NHLA 1M57D 1WT6A 3CWBJ 4HH2A 4WY4D 2R32A 5EFWB 2W83C 1RHZB 3KZIE 1VDFA 3CCMP 2Q7CA 3FXEA 4JF7A 3TGUJ 5L8RJ 1L0LE 1YI2P 2LXCB 3CXHE 3L71D 2ZXXA 2W27A 3H1IE 4PJ0H 2O1JA 1SQPE 1S5LX 5KLVK 1FZCC 2JDIH 1AQ5A 3RK2B 1JEKA 4IL6X 2E75C 4OWFA 1IFJA 2Q3IA 3CWBD 1LTBC 1L0LK 1TU3F 3CX5E 1YJWP 2KSEA 1G1IA 4KHXA 2WT7A 4EOTA 1K8AQ 4UB8E 1HBWA 3W67A 5BVZA 4C7RA 2OYIA 2R3CA 3RK3E 3L74G 2H7HA 1X22A 3IAOA 5APVA 2WITA 3NMDA 1VQ7P 1LWUB 1P84H 3AE3C 3C8VA 3W68A 1VF5D 1SQBD 5C39A 5KJ7A 1HWTC 1NKNA 4M3LA 2QSIA 2B9BA 4A7PA 1FC2C 4ZKPA 1VPCA 2B87B 2YXQB 1L4AA 3A7OA 1SQBJ 3L75D 3M9QA 2FXMA 5BU5A 2P10A 1YHQP 1L4AB 1NGMB 1LJ2A 2N9BA 2IPPA 2MJZA 1GK6A 5B5EE 3H1HE 2E74B 1L0LG 1YQ3C 2ZYGA 3G6EP 2FYUK 2YNYA 2KS1B 1M1JB 3M0DC 3M06A 3CLQA 3RK2C 2YO2A 4WWIA 1GU5A 1SQPK 1FZCB 1AVOA 3EFFK 3O6QA 1NAYA 2YMYA 2OYIC 5APXA 2ZXEB 3BCCJ 1S1CX 3CCJP 1J1EB 3CXHD 2I8DA 3M9BA 2WT7B 3H1HJ 3P7KA 3WMM0 3TGUD 1KYOI 1NOHA 2ZT9B 2KP8A 2W8ZA 3L75J 4L74A 4LGDE 2HPCA 3WUUA 5KJ7C 1X0TA 3CC4P 1DIPA 1ZXGA 3L75E 1HTLC 2B89A 3SFEC 4H13B 1FDOA 1DEBA 1PGOA 3HD7C 2ZT9D 4PD4H 1PP9G 1CI6B 1IFPA 1NTKJ 1NU1E 1SFCA 1SLQA 5GTHE 1DH3A 1KILE 2AEFA 1R5LA 1VQ8P 1URQD 2AXCA 5KAFE 3L35A 1YIJP 1T2KD 3A0HE 2YO3A 3C1LA 1KYOH 1PGQA 2OTLP 1NTZK 1MKMA 1BGYG 1MFZA 1NU1K 2SPZA 3H1LG 4PD4I 1KQGB 2B88A 1GL2C 2V4HA 3H1LJ 2QEXP 3D6YA 1H0TA 2AEMA 1MUUA 1U7JA 2IZ0A 4GT1A 5AW9B 1JO5A 3G9RA 2KYVA 1XTCC 4U3FD 2W6AA 3H1JJ 1N73C 3L71E 1EDKA 1N7SA 1DD4A 1L0LD 3L71G 4LLHA 3TNUA 3L73D 3CD6P 1NTMJ 2JWAA 4Z1MH 2XDJA 1X79B 2KNCB 2XNDH 1M1JC 1RF1C 2BEZF 2KNCA 3JCUE 3CCSP 3JC22 5DJTB 4ZKUA 1J2JB 3PRJA 1RQUA 1SQXG 1N7SB 2IBZI 1T3JA 3CI9A 1NTKK 1W2EA 2KUBA 3H1HG 4JQ0D 1AVYA
chains in the Genus database with same CATH topology
1SQQG 1EZVG 3L73G 1L0LG 1BCCG 1KYOH 3CX5H 3L72G 1NU1G 1BGYG 1NTKG 1SQBG 3H1LG 1NTZG 5KLVG 1SQVG 1PPJG 2FYUG 3CWBG 1KB9H 3H1IG 3CXHH 1BE3G 3L74G 3TGUG 1P84H 2BCCG 3L71G 2A06G 3H1JG 1L0NG 3H1KG 3BCCG 3L70G 1NTMG 1SQPG 4PD4H 1PP9G 4U3FG 3L75G 1SQXG 3H1HG 4D6TG 2IBZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  1EZV G;  3L73 G;  1L0L G;  1BCC G;  1KYO H;  3CX5 H;  3L72 G;  1NU1 G;  1BGY G;  1NTK G;  1SQB G;  3H1L G;  1NTZ G;  5KLV G;  1SQV G;  1PPJ G;  2FYU G;  3CWB G;  1KB9 H;  3H1I G;  3CXH H;  1BE3 G;  3L74 G;  3TGU G;  1P84 H;  2BCC G;  3L71 G;  2A06 G;  3H1J G;  1L0N G;  3H1K G;  3BCC G;  3L70 G;  1NTM G;  1SQP G;  4PD4 H;  1PP9 G;  4U3F G;  3L75 G;  1SQX G;  3H1H G;  4D6T G;  2IBZ G; 
#chains in the Genus database with same CATH topology
 1LTA C;  1WMK A;  5AW0 B;  2H43 A;  2W6J H;  1FU1 A;  2I1J A;  3AE9 C;  1LTJ C;  4IL6 E;  1H8A A;  1SQB G;  3GHG C;  4JYB A;  2Q9I A;  3M91 A;  3M0D A;  3PH0 A;  1VQK P;  3A3Y B;  2BCC E;  4PV1 C;  1BDD A;  1N7S C;  1S2E A;  3B8E B;  2OQQ A;  1Z56 A;  3E7K A;  1S5L H;  3Q1M A;  5APT A;  3HUS B;  1LTI C;  1Y9B A;  2BCC J;  5AVV B;  1SFC B;  1OZH A;  1NH4 A;  1BE3 J;  3H1K D;  3BCC G;  3CCL P;  2HOD A;  1OVR A;  4KJM A;  1USE A;  3RL0 B;  3L70 J;  5CCH D;  3TK1 A;  1L0N J;  1OMI A;  3A0B E;  1IFM A;  3H1J E;  1IJD B;  3AED C;  3I5C A;  2OTJ P;  1PGP A;  2V7Q J;  1L0N E;  4ZNC A;  2A45 I;  3MTU E;  1JY3 O;  4AYC A;  3RL0 D;  1EXJ A;  1CZQ A;  1LTJ A;  2M0B A;  2M8R A;  2ZJS E;  1VQ4 P;  3TDK A;  2XKM A;  1EZV I;  1IFD A;  4EYY Q;  1FZC A;  1AFO A;  2LXB A;  2K88 A;  3L4F A;  4XE5 B;  5KLV J;  5AVS B;  1PPJ G;  1SQV G;  3AE8 C;  4WBA A;  2OYH A;  1LP1 A;  2Y0C A;  1KB9 D;  3CX5 I;  3R2P A;  3V4W A;  1URQ A;  2ZVN B;  1P84 E;  2QJK B;  4RJT A;  2KXP B;  5KJ7 D;  2V7Q H;  2PFX A;  2R3S A;  1SQQ E;  2BCC G;  1KQS O;  1KQF B;  2HLO A;  2IFM A;  2Q6Q A;  2NPS A;  3CXH I;  1OVU A;  5GTH H;  2IFN A;  3B5N D;  4YXW H;  2PGD A;  2KSJ A;  3VMY A;  1YYC A;  2WPS A;  1RY3 A;  1FE6 A;  2VRS A;  1QX8 A;  1OIP A;  3CMA P;  1JY2 O;  2OYH B;  4I7Z B;  1SQP D;  1ZRT E;  1K05 A;  5KLI C;  1OWA A;  3D71 A;  1DD3 A;  1J1E C;  3RBZ A;  1JCC A;  3V4Q A;  1L0L J;  4D6T D;  1GU4 A;  2OYI B;  2E43 A;  2KOG A;  3SWF A;  3D70 A;  2WSC H;  3L73 G;  3RL0 C;  5E79 H;  3Q5R A;  2E76 D;  4QMA A;  3G3Z A;  5KLV G;  2C0W A;  2QG4 A;  4PV1 B;  3WUV A;  1URQ C;  1ZR4 A;  1BCC J;  1MFT A;  2HOD B;  1L4A C;  3AE5 C;  2IDB A;  3HE5 A;  3U1C A;  1S4X A;  4AQR D;  3H6P A;  5M1B A;  1USD A;  1AA0 A;  1SQQ D;  2G3A A;  1RE3 C;  3GHG B;  4ASV A;  4EIJ A;  1FZG A;  2PAJ A;  2Y9Y A;  3FWN A;  2Y0E A;  4GDO A;  4N78 E;  4UB8 H;  4XA4 A;  2O01 J;  4EDF A;  5APS A;  1JY2 P;  1NYH A;  1KB9 E;  5CCG A;  1N7L A;  1EDI A;  3H1L E;  5AVU B;  5AW5 B;  1BGY E;  1OXZ A;  2QJP C;  4YPC A;  4I2L C;  2QIW A;  2Y0D A;  2RMZ A;  3L74 D;  3RK2 D;  4D6T J;  2FYZ A;  1IO4 A;  4H13 D;  1FAV A;  5CBO A;  3TF5 A;  3F89 A;  3EQ2 A;  4K35 A;  1VL2 A;  2P1J A;  3P8M C;  3EWK A;  3G71 P;  1H89 A;  1NTM E;  1L0N D;  1IK9 A;  3BCC D;  2RN0 A;  5CJ0 A;  1NTZ J;  2N1T C;  3HTK B;  3L70 D;  2QE7 H;  5B66 E;  4I7Z C;  1JNM A;  1G1J A;  1OW8 A;  3V2Q A;  4OGQ C;  4W80 A;  3UIA A;  2BEQ D;  3H25 A;  3K5B A;  4EI2 A;  3HE4 A;  3OJA B;  3I56 P;  3CC2 P;  1SQX K;  2IYP A;  1T8Z A;  3O8Z A;  2WSE H;  1PGJ A;  1FS0 E;  1GW4 A;  1JY3 P;  1JMB A;  1KOR A;  1PL5 A;  1YQ4 C;  1ZW0 A;  2WSS H;  2QRX A;  1UIX A;  2K9J B;  2XNX A;  3GF3 A;  1CSB A;  3HD7 D;  3L74 E;  2J5U A;  4GKG A;  3SSU A;  2KK7 A;  1HGV A;  2W6B A;  3LID A;  1HVV A;  2FYN C;  4PD4 E;  2R44 A;  1YJ9 P;  2L5G B;  1N8R Q;  1GL2 A;  4JYC A;  4OGQ D;  5APY A;  2WZ7 A;  1NU1 J;  3MUD A;  2NPS D;  1SQX D;  4N6J A;  1KD1 Q;  2M3E A;  2N1T D;  1J1D C;  1HF9 A;  3RK3 D;  4RES B;  1SQQ G;  3B71 A;  1FZB A;  1ZOY C;  2WSE J;  1PIX A;  4H13 C;  5CJ4 A;  1FOS F;  2GUS A;  1KB9 I;  1ZP0 C;  2POH A;  3CX5 D;  3VOP A;  1D7M A;  1SP4 A;  1NTZ G;  3LIE A;  1M1J A;  2ZYA A;  3IFM A;  2KS1 A;  1H88 A;  3CME P;  1NTM K;  3M0A A;  1QGK B;  2ITA A;  1OX3 A;  2WQY C;  3H1I G;  3H1I D;  1L2P A;  1QLE D;  3L73 J;  3CXH H;  4H44 B;  4NPF X;  4XFJ A;  5CMZ A;  5E79 E;  3T97 A;  1VQ5 P;  1Y8A A;  3L71 J;  1YIT P;  3CC7 P;  1NVO A;  3SWK A;  1VF5 C;  3MHV A;  3MGN A;  2JP3 A;  1QL2 A;  1R5S A;  3A0B H;  1E5W A;  3H1K G;  3NTN A;  1RE3 A;  2R5D A;  2IX7 C;  4IFM A;  1FZF A;  2O1K A;  3Q5S A;  2QJP B;  2E74 C;  3QWO C;  5KLV E;  2N1T A;  3S9O A;  1LT9 C;  3U1A A;  1W5C E;  1PPJ E;  1SQV E;  2P58 A;  5CCG C;  1QL1 A;  2R5B A;  3MUD C;  4WB4 A;  5AVX B;  1JTH A;  3L75 G;  1VQN P;  2IBZ G;  1S5L E;  1ZR2 A;  1LTJ B;  5AVQ B;  2N9Y B;  1SQQ J;  5KAF H;  1QVF O;  2OGU A;  1PP9 E;  5K5G B;  1KYO D;  1T6A A;  2C0X A;  1PP9 J;  3IR9 A;  3KXD A;  4I1L A;  3GMA A;  1URQ B;  1EC5 A;  1VQP P;  2I1K A;  1LP1 B;  1AQT A;  1BE3 G;  3EFG A;  2KLV A;  4I6M C;  3TYY A;  1NO4 A;  3VP8 A;  1EXI A;  4JBZ A;  3F5H A;  1BDC A;  2H89 C;  1BCC D;  5AVW B;  1NAF A;  2OYO A;  2FKW B;  2XV5 A;  2JEE A;  3CCU P;  1DEE G;  1KFM A;  1XTG B;  2H88 C;  1LT9 A;  2FYU E;  3A2A A;  3L70 G;  4TT3 H;  5B66 H;  5KLI B;  3VTP C;  3L70 E;  3C9I A;  2C9N Y;  1EDJ A;  1IFI A;  1N86 A;  2CPS A;  2FYU J;  4TLF A;  1SQP G;  5KAI H;  5AVZ B;  4RO0 A;  1BCC E;  2FFD A;  3B5N A;  3A0H H;  4U3F G;  5TIS H;  1GL2 B;  3L72 E;  4HB1 A;  1A02 F;  1P84 I;  2YMK A;  3B5N B;  3NFQ A;  3VP9 A;  4L75 A;  1JM0 A;  3AEA C;  3GF7 A;  1YTZ I;  2FFD B;  4UB6 E;  3PTZ A;  1KFN A;  3SFD C;  1RE4 C;  1SQQ K;  2QVA A;  3SWY A;  2ZVO B;  1SQX E;  1SS1 A;  2NPS C;  1KQL A;  1GL2 D;  1NTK G;  1NU1 G;  1SQV J;  3HUS A;  4O9B A;  4DZO A;  2O01 N;  4GOE A;  4C7N A;  3Q2Y A;  3HD7 B;  3MIW A;  3PJS K;  4Y99 C;  2OTK E;  3Q3D A;  5CCH C;  4B86 A;  1KZU B;  1LTS C;  4WY4 B;  4DT0 A;  1N73 A;  3AEB C;  1BSH A;  1IZN B;  2QM7 A;  2L91 A;  3CPW O;  2WTY A;  3L72 D;  3BVH A;  2LKM A;  1YTZ T;  1M8O B;  1NWQ A;  1NTZ E;  1RF1 A;  4AUW A;  1KIL B;  2GUV A;  4GOD A;  5DJU B;  1EDL A;  1K9M Q;  1CW5 A;  3GG2 A;  3B4S A;  2JO1 A;  1VF5 B;  4H0L C;  3VN0 A;  2WWW A;  4D6T G;  2K1A A;  1HUC A;  2YKQ A;  1QEX A;  4D6T E;  1G2C A;  3AE4 C;  3KDP B;  3WU2 E;  2WPV B;  1K04 A;  4CPG A;  1S3J A;  1UII A;  2QJY B;  2YKO A;  1GD2 E;  4H44 D;  1ZLL A;  4LC1 A;  3FX0 A;  3MP7 B;  1CI6 A;  1BGY D;  4IOI H;  4WVZ A;  2Z5I A;  1EQ7 A;  3IF4 A;  3RK3 B;  1VQ9 P;  2KLU A;  3L72 J;  3GLM A;  2KZJ A;  5AW2 B;  5B5E H;  3T97 B;  1H0T B;  1LNQ A;  1OVV A;  2IBZ E;  2D2C D;  2ZYD A;  1P84 D;  4Y99 B;  3PLN A;  4NPE A;  3VMZ A;  1Q86 Q;  2YIU C;  3VMX A;  3CCE P;  1NU1 D;  1OW7 A;  1RH5 B;  3ABV C;  4L73 A;  1PPJ D;  1SQV D;  4OVN F;  1S72 P;  3CCV P;  3M9H A;  2JR8 A;  2WPR A;  4DJG A;  1OW6 A;  1BGY J;  3FXD A;  2E75 B;  2E76 C;  2H8P D;  3H1H D;  2XZR A;  3WU2 H;  4Y28 J;  2FFD C;  3CCR P;  4PV1 D;  5CCH A;  1YJN P;  2M5A B;  4UB6 H;  1Q82 Q;  1FZE A;  1T3U A;  2BAS A;  3OAK A;  3QH9 A;  2KB7 P;  3ZDM A;  3H1J D;  5GTI E;  4U3F J;  1RE4 A;  2Q1K A;  5H2F H;  4W7Y A;  3AEE C;  2FBW C;  3I55 P;  5KAI E;  2OYH C;  3AE6 C;  3H1K E;  3TNU B;  1W2B O;  5H2F E;  1LT1 A;  1NJI Q;  3H1K J;  2GA1 A;  1BSN A;  1M7L A;  1L0N K;  4HYT B;  2YXR B;  2A06 D;  3Q5P A;  1IFN A;  2D2C C;  3NXS A;  3L74 J;  3P8C E;  1PZQ A;  3RL0 g;  3H1L D;  1KIL A;  5TJH A;  2OAR A;  2YIU B;  4N78 D;  5BU8 B;  4GIF A;  2B87 A;  4PD4 D;  4W7Z A;  3II6 A;  1SQB E;  5APU A;  2A06 E;  2IYO A;  3U59 A;  3LW5 J;  1GDT A;  2YKP A;  3BRT B;  4IFF A;  1IK7 A;  2E5T A;  3S4R A;  4ASW A;  2AEJ A;  2CPB A;  1KV4 A;  4BRY B;  2Z4E A;  4GOF A;  3KHU A;  2A45 H;  3RK3 C;  2K3R A;  5AVY B;  1LT9 B;  5KKZ B;  3BAT A;  4C7N B;  1LWU A;  2XU6 A;  4H0L D;  1LTT C;  1HH0 A;  1SQB K;  3CWB E;  2QJY C;  2FYU G;  2P67 A;  2KZI A;  2FYU D;  3FWL A;  3CWB G;  1S9K E;  4HJG H;  3S1K A;  1JY2 N;  1Q7Y Q;  4YXD C;  2MKV A;  3HRN A;  3BCC E;  3L73 E;  4DCK A;  1VQO P;  2K9Y A;  2E42 A;  3USS A;  5AW3 B;  2CK3 H;  3RGU A;  2WSC J;  1GK4 A;  3LW5 H;  5AW4 B;  1VQ6 P;  1ZV8 A;  3HUS C;  1VQL P;  4BXL A;  4U3F E;  1KIL C;  4YTP C;  1SQP J;  1L0N G;  1ZN5 A;  5CCG D;  1HJB A;  4U7J A;  1R8E A;  1L4A D;  1MV8 A;  2W90 A;  2P2U A;  3D6Z A;  1FJK A;  2J59 M;  3AEG C;  3L37 A;  1KTM A;  5AVR B;  1DX7 A;  1LGH B;  1KYO E;  2ZAE B;  1NTK E;  1M90 Q;  1PP9 D;  3V2P A;  3A5T A;  1JTH B;  1KC8 Q;  1J1D B;  1Q90 D;  1YBK A;  2IBZ D;  1FBM A;  3AE7 C;  3JSV C;  2QJK C;  3PHL A;  3FGA D;  4K3A A;  2HG5 D;  2WPQ A;  4BRY A;  1JMM A;  1GTW A;  1LWU C;  1KMI Z;  2FXP A;  3ITK A;  1RF0 C;  2AXT H;  3CX5 H;  1N2D C;  3MZW B;  2FYN B;  2NPS B;  1NTK D;  2D2C B;  5APQ A;  5AW7 B;  4DOJ A;  1Q81 Q;  2WMM A;  2LR2 A;  4PJ0 E;  4ZMD A;  1GZL A;  2IZ1 A;  2Y9Z A;  2JKV A;  3PP5 A;  3B5N C;  3WUT A;  1T2K C;  2C9L Y;  1FJP A;  2J58 A;  1OFC X;  3R4Y A;  1JB0 J;  1EZV D;  4OGQ B;  2QA4 P;  1JUN A;  3KZI H;  3H1J G;  2NRG A;  1RQV A;  3N7N A;  3AEF C;  1ZRT D;  2N1T B;  2GM4 A;  1NTZ D;  5APW A;  4KT0 J;  1S9K D;  2RKL A;  5AW6 B;  3H32 B;  5GTI H;  4BWN A;  2QM8 A;  1SQV K;  1PV3 A;  1SFC C;  2E76 B;  3GW6 A;  4L76 A;  1BE3 D;  3BRV B;  1FDI A;  4OH8 B;  4HKZ H;  2BCC D;  1PFI A;  1HGZ A;  2M5A A;  2HR3 A;  2A45 G;  3AE2 C;  2HPC B;  2WVR A;  1JOC A;  1SQX J;  2PRR A;  2NZ2 A;  5AW1 B;  1X9V A;  1HJ0 A;  3G4S P;  2K9J A;  2FXO A;  3AEC C;  3H32 A;  1AJY A;  3V2N A;  2O01 H;  1LTG C;  2E5Y A;  2JWD A;  2ZFC A;  3KYQ A;  1KB9 H;  2UWJ E;  2E74 D;  3O6Q B;  1X8Y A;  3HE4 B;  4JPZ B;  4N3Y B;  3N4X A;  5AW8 B;  1G2C B;  3VYI A;  3P8C D;  1QVG O;  1Q2N A;  2KI7 B;  2ZT9 C;  5AVT B;  2O3J A;  2WSF J;  3TGU G;  2HYN A;  2K37 A;  3RBX A;  3V5B A;  3TGU E;  1BE3 E;  1FOS E;  1N7S D;  3MD0 A;  3JCU H;  3H1I J;  3L36 A;  5CHX A;  1RF1 B;  2M3B A;  3KPE A;  1GW3 A;  5CBN A;  1GMJ A;  1M1K Q;  1NTM G;  1A02 J;  1AV1 A;  1NTM D;  2JJL A;  4R4M A;  1FZA A;  3V6I A;  4H0L B;  1Y47 A;  3AE1 C;  3E1I A;  4H44 C;  4WY4 A;  1MZ9 A;  1N73 B;  1EZV E;  2G8Y A;  1JCD A;  2WSF H;  1U7M A;  4IFD K;  1EZV G;  3CL3 D;  3P32 A;  5KKZ C;  1KN7 A;  4R4L A;  1BCC G;  1M56 D;  3VMA A;  2HFE D;  3L72 G;  2E75 D;  1RF0 A;  2KIK A;  3CCQ P;  3HTK A;  1ZME C;  3KQG A;  3GHG A;  2FY8 A;  1SFC D;  1FDM A;  3IN6 A;  4WY4 C;  4NPD A;  3HE5 B;  4IL6 H;  3BAS A;  2AXT E;  4C46 A;  3OW2 O;  4RKU J;  1SVF A;  1KIL D;  2DW3 A;  1JY3 N;  3E1R A;  1VQM P;  1K73 Q;  2RH0 A;  2A06 G;  3OA7 A;  1E79 H;  4MN4 C;  3TSI A;  2PP6 A;  2Z5H A;  2Q3E A;  5TIS E;  2Q5U A;  1U57 A;  3V2R A;  5KTB A;  5KLV D;  1WRG A;  3HD7 A;  2P7J A;  1NKZ B;  1IC2 A;  1NHL A;  1M57 D;  1WT6 A;  3CWB J;  4HH2 A;  4WY4 D;  2R32 A;  5EFW B;  2W83 C;  1RHZ B;  3KZI E;  1VDF A;  3CCM P;  2Q7C A;  3FXE A;  4JF7 A;  3TGU J;  5L8R J;  1L0L E;  1YI2 P;  2LXC B;  3CXH E;  3L71 D;  2ZXX A;  2W27 A;  3H1I E;  4PJ0 H;  2O1J A;  1SQP E;  1S5L X;  5KLV K;  1FZC C;  2JDI H;  1AQ5 A;  3RK2 B;  1JEK A;  4IL6 X;  2E75 C;  4OWF A;  1IFJ A;  2Q3I A;  3CWB D;  1LTB C;  1L0L K;  1TU3 F;  3CX5 E;  1YJW P;  2KSE A;  1G1I A;  4KHX A;  2WT7 A;  4EOT A;  1K8A Q;  4UB8 E;  1HBW A;  3W67 A;  5BVZ A;  4C7R A;  2OYI A;  2R3C A;  3RK3 E;  3L74 G;  2H7H A;  1X22 A;  3IAO A;  5APV A;  2WIT A;  3NMD A;  1VQ7 P;  1LWU B;  1P84 H;  3AE3 C;  3C8V A;  3W68 A;  1VF5 D;  1SQB D;  5C39 A;  5KJ7 A;  1HWT C;  1NKN A;  4M3L A;  2QSI A;  2B9B A;  4A7P A;  1FC2 C;  4ZKP A;  1VPC A;  2B87 B;  2YXQ B;  1L4A A;  3A7O A;  1SQB J;  3L75 D;  3M9Q A;  2FXM A;  5BU5 A;  2P10 A;  1YHQ P;  1L4A B;  1NGM B;  1LJ2 A;  2N9B A;  2IPP A;  2MJZ A;  1GK6 A;  5B5E E;  3H1H E;  2E74 B;  1L0L G;  1YQ3 C;  2ZYG A;  3G6E P;  2FYU K;  2YNY A;  2KS1 B;  1M1J B;  3M0D C;  3M06 A;  3CLQ A;  3RK2 C;  2YO2 A;  4WWI A;  1GU5 A;  1SQP K;  1FZC B;  1AVO A;  3EFF K;  3O6Q A;  1NAY A;  2YMY A;  2OYI C;  5APX A;  2ZXE B;  3BCC J;  1S1C X;  3CCJ P;  1J1E B;  3CXH D;  2I8D A;  3M9B A;  2WT7 B;  3H1H J;  3P7K A;  3WMM 0;  3TGU D;  1KYO I;  1NOH A;  2ZT9 B;  2KP8 A;  2W8Z A;  3L75 J;  4L74 A;  4LGD E;  2HPC A;  3WUU A;  5KJ7 C;  1X0T A;  3CC4 P;  1DIP A;  1ZXG A;  3L75 E;  1HTL C;  2B89 A;  3SFE C;  4H13 B;  1FDO A;  1DEB A;  1PGO A;  3HD7 C;  2ZT9 D;  4PD4 H;  1PP9 G;  1CI6 B;  1IFP A;  1NTK J;  1NU1 E;  1SFC A;  1SLQ A;  5GTH E;  1DH3 A;  1KIL E;  2AEF A;  1R5L A;  1VQ8 P;  1URQ D;  2AXC A;  5KAF E;  3L35 A;  1YIJ P;  1T2K D;  3A0H E;  2YO3 A;  3C1L A;  1KYO H;  1PGQ A;  2OTL P;  1NTZ K;  1MKM A;  1BGY G;  1MFZ A;  1NU1 K;  2SPZ A;  3H1L G;  4PD4 I;  1KQG B;  2B88 A;  1GL2 C;  2V4H A;  3H1L J;  2QEX P;  3D6Y A;  1H0T A;  2AEM A;  1MUU A;  1U7J A;  2IZ0 A;  4GT1 A;  5AW9 B;  1JO5 A;  3G9R A;  2KYV A;  1XTC C;  4U3F D;  2W6A A;  3H1J J;  1N73 C;  3L71 E;  1EDK A;  1N7S A;  1DD4 A;  1L0L D;  3L71 G;  4LLH A;  3TNU A;  3L73 D;  3CD6 P;  1NTM J;  2JWA A;  4Z1M H;  2XDJ A;  1X79 B;  2KNC B;  2XND H;  1M1J C;  1RF1 C;  2BEZ F;  2KNC A;  3JCU E;  3CCS P;  3JC2 2;  5DJT B;  4ZKU A;  1J2J B;  3PRJ A;  1RQU A;  1SQX G;  1N7S B;  2IBZ I;  1T3J A;  3CI9 A;  1NTK K;  1W2E A;  2KUB A;  3H1H G;  4JQ0 D;  1AVY A; 
#chains in the Genus database with same CATH homology
 1SQQ G;  1EZV G;  3L73 G;  1L0L G;  1BCC G;  1KYO H;  3CX5 H;  3L72 G;  1NU1 G;  1BGY G;  1NTK G;  1SQB G;  3H1L G;  1NTZ G;  5KLV G;  1SQV G;  1PPJ G;  2FYU G;  3CWB G;  1KB9 H;  3H1I G;  3CXH H;  1BE3 G;  3L74 G;  3TGU G;  1P84 H;  2BCC G;  3L71 G;  2A06 G;  3H1J G;  1L0N G;  3H1K G;  3BCC G;  3L70 G;  1NTM G;  1SQP G;  4PD4 H;  1PP9 G;  4U3F G;  3L75 G;  1SQX G;  3H1H G;  4D6T G;  2IBZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...