3H1IG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 20
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1iG00
2FYUG 4U3FG 1BE3G 3H1IG 3CX5H 1EZVG 1NTMG 3L75G 2BCCG 3L70G 1KB9H 4PD4H 1KYOH 3CXHH 3TGUG 1NU1G 2IBZG 1L0LG 1BGYG 3L73G 1SQBG 1SQPG 1SQXG 3H1HG 1L0NG 1PPJG 1BCCG 1NTKG 3L74G 1NTZG 3L72G 1SQVG 3H1KG 3L71G 3H1LG 3CWBG 3H1JG 5KLVG 1P84H 3BCCG 1SQQG 4D6TG 1PP9G 2A06G
chains in the Genus database with same CATH superfamily
3CWBE 2QJKC 2KYVA 1SQPD 1EZVG 1K05A 1N7SB 2C0XA 3FWNA 4U3FE 2K9JA 1PZQA 1GL2C 5CBOA 3MHVA 3I5CA 1ZV8A 2YO3A 1NTKG 3L74G 4TT3H 2W6BA 2WITA 4UB8E 3CCSP 2OYIA 1ZLLA 1ZP0C 2B87B 1NKNA 1SQPJ 1JB0J 3D6YA 2AEFA 3SWKA 3T97A 4UB6E 1VF5C 3RGUA 1EZVI 2O01J 5AVUB 1Y47A 2NPSA 1A02F 3L71E 2E74C 2E75B 1QX8A 1SQQE 1CZQA 1KYOH 2KK7A 2BCCE 5M1BA 1KB9D 2C9NY 3M06A 1N7LA 3L73E 3GHGC 3ABVC 1FZBA 1S4XA 2OYHB 3AE7C 1SQXD 5GTHE 3L75G 2GUSA 4L75A 1M1JA 3L4FA 4U7JA 1EZVE 1SQBK 3TSIA 3L72G 2H43A 2OGUA 1NTKE 3L74E 1L0LD 2Q7CA 4IL6H 2ZT9C 2K9YA 1U57A 2IX7C 1GDTA 2HODB 3CC7P 1SQXJ 4L74A 2AXTH 2E75C 2ZJSE 5AW8B 2WMMA 1JY3N 4LC1A 3L36A 4LGDE 1K04A 2R32A 4GOFA 5TISH 4RJTA 4JBZA 3U1AA 3AE4C 3CX5H 2N1TB 1JEKA 3HD7D 2Y9YA 5APSA 2OYHC 3C8VA 1FS0E 1G2CB 1SQPG 1FAVA 1J1EB 3MUDA 4AQRD 2WPSA 2W8ZA 3JCUH 4O9BA 2E5TA 1S9KD 2ZYGA 1S3JA 4HYTB 1OX3A 3L75E 2K9JB 3HUSC 1WMKA 1SVFA 3P32A 2JWDA 3H6PA 1RE3C 3M0DA 3L72E 4MN4C 4I7ZC 2IBZD 2QG4A 2KP8A 4Y99C 2WSEJ 2KSEA 2N9BA 2E76B 4WVZA 1OVVA 1FZGA 1GL2D 3T97B 1UIXA 1EQ7A 4KJMA 2ZYAA 1W5CE 1HGZA 1P84D 4YXWH 2NPSB 2FY8A 5AW0B 1VQ4P 3BCCD 1SQXG 4I1LA 2KB7P 1DEBA 1SQPE 2JDIH 2R5DA 1VF5D 2D2CC 3SWFA 2BASA 3RL0C 1L0LG 1M1JB 2E74D 2C9LY 3ITKA 1PPJG 3G71P 1SQVK 1KB9I 1BDCA 1Q81Q 1LTJB 1EDLA 3LIDA 2GA1A 2E76C 3GW6A 2HG5D 1FDMA 2QJYB 2JP3A 3B71A 1LT9C 4EIJA 1NAFA 2GUVA 4OWFA 4WY4B 3CMEP 2OYOA 1E5WA 3V4WA 2QA4P 4HJGH 5CJ0A 2N9YB 1FZEA 1HBWA 5APYA 5APWA 1NTMJ 2Z5HA 2I1JA 1KB9E 2GM4A 3EFFK 3H1JD 3RBZA 2V4HA 1ZW0A 2ZT9D 5AW6B 1PGJA 4L73A 1SQXE 4N3YB 1ZRTD 1JY3O 1VDFA 2YKOA 3FXEA 1LTJC 4H13B 1LTSC 2IBZG 1URQA 2XDJA 4QMAA 3R4YA 3CXHD 4WY4C 2R44A 1T3UA 1L0LE 1RHZB 5C39A 3OA7A 1PGQA 3HE5B 5E79E 4GT1A 5L8RJ 1JTHA 1YHQP 3PRJA 3CC4P 1ZN5A 3SFEC 2WPQA 3B5ND 2LKMA 1USEA 3CCUP 2L91A 1H88A 1RY3A 5KTBA 2MJZA 1Q2NA 5CCGD 5B5EH 3V4QA 3BCCG 1JY3P 3IFMA 1JMMA 2IBZI 2P67A 5GTHH 1MV8A 2WSCH 3A0HH 4D6TD 1HH0A 2NRGA 4H13C 2QJPB 1MFTA 2WSSH 1S9KE 3E7KA 1HUCA 4PV1D 3RK3B 1X22A 1KMIZ 3WU2E 3G9RA 2IBZE 2XKMA 3RK2C 3U1CA 1IFDA 2MKVA 3S1KA 2BCCJ 1YI2P 1KILC 4PD4H 1PGPA 4AYCA 3FGAD 4IFDK 3L73J 3UIAA 2D2CD 1HTLC 3N4XA 1T2KC 3MTUE 5AW5B 2YIUB 3H1JG 5KKZB 1P84E 4BWNA 1X0TA 3BCCE 4R4LA 4JF7A 1GU4A 2V7QJ 1KQLA 1NTKJ 3L74J 3M9HA 1QLED 1MZ9A 5AVQB 1MKMA 1PV3A 5AVWB 2FYNB 4YTPC 2IZ0A 2R3CA 5GTIE 1URQB 2FBWC 3R2PA 3CC2P 3PJSK 4BXLA 1KQFB 4ASVA 3B5NA 2SPZA 1JTHB 5KLIB 3TK1A 3MZWB 5KLVD 3CLQA 4WWIA 1M90Q 5CCGA 4EYYQ 1RQVA 2PAJA 3CXHI 3CCQP 1U7MA 2KNCA 4D6TG 3RBXA 1JNMA 3H1JE 3AEAC 2Q6QA 1N86A 4HH2A 3CCEP 2KLUA 2O01H 1PIXA 1PP9D 1ZRTE 2HR3A 5KLVJ 3RL0g 1KD1Q 5APTA 1AJYA 1LNQA 1L4AA 3VMYA 3CI9A 3CCLP 3CXHE 2OTLP 1SFCC 2CPSA 3EWKA 2FFDA 1S5LH 1NTZK 2FYUD 2NZ2A 2JJLA 1LWUC 1PP9J 2YXRB 1AA0A 1SQQK 1A02J 5B66H 1KORA 5AVSB 1NU1D 1BGYD 1RF0C 1FZCA 3FXDA 4ASWA 2G8YA 1Y9BA 3VMXA 1S2EA 2P7JA 2H7HA 4TLFA 1OIPA 2W6AA 2FYUJ 2Z4EA 1OZHA 3MD0A 1J2JB 3PTZA 4GKGA 4D6TE 3RK2D 1NU1J 1BGYJ 2OTKE 1OXZA 4IFFA 3AEBC 1KILD 5DJUB 1IC2A 4NPDA 1N7SC 2BEQD 2WPRA 3V2RA 3U59A 4CPGA 4XA4A 4PJ0E 1IFMA 3AEEC 1VQMP 1M8OB 4GDOA 2L5GB 1XTCC 1MFZA 2W83C 4H44B 3HE4A 4OH8B 1FOSF 5KJ7C 5KLVG 3CPWO 1JCCA 2P58A 1CI6A 3AEFC 3IAOA 3H1HD 2R5BA 1PPJD 1IFIA 3G6EP 3V5BA 1RQUA 2K37A 5AVYB 2WSEH 5CCHC 3IN6A 1RF1A 3TNUA 1PP9G 3WUVA 1DIPA 2KNCB 3M91A 4DT0A 5AVTB 1L0LJ 3CCRP 1YQ3C 1VQLP 3G3ZA 1VQ7P 1GMJA 1VQKP 2WZ7A 2FYUG 1T8ZA 2XZRA 1L0ND 1L4AB 3HRNA 1JY2N 2QE7H 3H1LD 1NU1G 5CBNA 1BGYG 3PHLA 5TJHA 2JEEA 3KDPB 1VQOP 1H89A 1IFJA 5AW9B 1ZR4A 3D70A 2ZFCA 5KLVE 1YJWP 2ITAA 2Y0CA 2WWWA 4OGQB 3H1KD 2OYIB 1IFPA 3IR9A 2CK3H 1L0NJ 1FZCB 1SQPK 1EDKA 3CX5D 2XNDH 2N1TC 3ZDMA 1AQTA 1EDJA 1SFCD 3A0BH 1OW6A 3TDKA 1FDOA 1EDIA 4WBAA 1NOHA 1PP9E 1J1EC 1VQNP 2FXMA 5BU5A 3GMAA 1FC2C 2IYPA 1RH5B 4C46A 5AW3B 4JYCA 3JC22 3KHUA 2FYUE 2AEMA 1NHLA 3H1HG 2M8RA 3AE6C 1NU1E 2OYIC 1BGYE 3BCCJ 3HE4B 1YTZT 1N7SD 4H0LB 3GF7A 1DX7A 1RE4A 1SQXK 3W68A 3K5BA 4EDFA 2A06D 5KAIH 2OARA 2NPSC 4M3LA 1RF1B 3TNUB 3NFQA 2KS1A 3VN0A 1YITP 1N73A 1KILE 3C9IA 4W80A 3HD7A 1AQ5A 3L37A 1S72P 1ZR2A 2QEXP 2A45H 1L0NG 2CPBA 2QIWA 2JKVA 1DD3A 3BATA 3H1LG 4GIFA 4UB8H 3KPEA 1M1JC 2E75D 2LR2A 5CCHD 4NPFX 1VPCA 4ZNCA 1GK6A 2QJYC 3G4SP 3F5HA 4H0LC 2XNXA 1EXJA 2Z5IA 3H1JJ 2YMYA 3H1KG 4UB6H 1FDIA 2Q9IA 3H1HE 3Q5SA 1X8YA 1BDDA 1PPJE 2Q3EA 1KV4A 2K88A 2KI7B 3GF3A 5AW1B 4AUWA 4N78D 2KIKA 3FWLA 1GL2A 2KZJA 5APXA 1OFCX 3L70D 4WB4A 1KN7A 5AVRB 1W2BO 1PFIA 1KC8Q 1BCCD 2RKLA 3MUDC 1YTZI 2YKPA 3CX5I 1S1CX 4YXDC 4K3AA 4HB1A 1L0NE 2V7QH 3USSA 3VP9A 1FJKA 2YXQB 2UWJE 2FKWB 3OJAB 3H1LE 2N1TD 4IL6E 2PFXA 1OVUA 1NTZD 3WUUA 1P84I 1GW4A 1BCCJ 3IF4A 1JY2P 2AXTE 3M0DC 3AE3C 1YIJP 5H2FE 1N8RQ 3Q1MA 4D6TJ 1CSBA 1HVVA 3NXSA 1PGOA 3H1KE 5TISE 2A06G 2P10A 3GHGA 3CX5E 3GG2A 2IFMA 3KXDA 2WPVB 2RMZA 3BASA 1W2EA 3M9BA 3AEDC 3I55P 3RL0D 4Y28J 3H32A 5CHXA 3A2AA 3JCUE 1NTMK 1LT1A 5AW4B 2E76D 2QJPC 2KS1B 1N73B 2XV5A 3HD7B 2RH0A 3PP5A 3RK3C 2B89A 1LGHB 2KZIA 3JSVC 4B86A 2H89C 4XFJA 2NPSD 3L35A 1SQBD 1OVRA 1FU1A 5K5GB 1NYHA 1D7MA 3CCVP 4PD4D 1M57D 2OYHA 1K73Q 1FZFA 2FXPA 1H8AA 2W90A 1JMBA 3TGUD 1R8EA 3LW5J 3L70G 2A06E 4RO0A 2YIUC 1L2PA 5KKZC 1DD4A 1SQBJ 4RESB 4KT0J 2O1KA 2DW3A 2JR8A 1BCCG 2QJKB 2ZVNB 1BE3D 3V2NA 3W67A 2H88C 1GL2B 1VL2A 2O3JA 3HUSA 4IL6X 4JPZB 1NGMB 4NPEA 2HODA 3SSUA 4WY4D 1RE3A 2KOGA 2R3SA 2FYNC 3KZIE 1NTZG 2C0WA 1AV1A 3L71G 4C7RA 5KAFE 1YYCA 1FJPA 1SQQG 1BE3J 4XE5B 2E43A 1URQC 1VF5B 2P2UA 2YO2A 4GOEA 2HFED 2WSFJ 5APVA 1R5LA 3FX0A 2E74B 5KLIC 1SLQA 2J59M 3TF5A 4ZKPA 4N78E 2ZVOB 4H13D 1KB9H 1CW5A 2IFNA 3CL3D 3GHGB 1NO4A 1M56D 1JOCA 3L70E 3Q3DA 2WT7A 1XTGB 3BRVB 3MP7B 1HWTC 1LP1A 1BCCE 1FE6A 1LTGC 3AE8C 2IPPA 1AFOA 3H32B 4DOJA 2FXOA 3OW2O 1IJDB 1ZMEC 1USDA 1LT9A 3NTNA 4BRYA 1SQBG 1NTKK 2ZXEB 3BRTB 5DJTB 2Y9ZA 3H1ID 2ZT9B 5AW2B 1Q90D 1NTZE 5E79H 4KHXA 1T2KD 3VMZA 4A7PA 1SQVD 1QGKB 2XU6A 3TGUG 4C7NA 2I8DA 2O1JA 5B5EE 3H1IJ 3RK3D 4EI2A 3I56P 1BE3G 3KYQA 3A3YB 2WVRA 1QL2A 1JM0A 2RN0A 3D71A 3B5NB 1LTJA 3A0HE 1SQVJ 1N2DC 3P8MC 4PD4I 4K35A 5AVVB 1KYOD 1OWAA 3CCJP 3M0AA 4WY4A 4DCKA 3HUSB 1GW3A 1Q7YQ 3Q2YA 4IFMA 1QEXA 3H1HJ 4I7ZB 3WU2H 5H2FH 4Y99B 5KLVK 1SQBE 2PRRA 3V2PA 3PLNA 4H44C 1GK4A 4PV1B 4PD4E 2M5AA 1BSNA 1SP4A 1AVYA 1GZLA 1UIIA 2W6JH 1AVOA 2KLVA 1MUUA 3TGUE 3P8CD 2FFDB 1P84H 3OAKA 3B5NC 2IZ1A 1ZOYC 1NH4A 2VRSA 5APQA 2JO1A 5CCGC 1U7JA 1BE3E 1HF9A 2JWAA 1E79H 2PGDA 1URQD 2AEJA 3LIEA 2E42A 3H1LJ 3HE5A 3VP8A 2D2CB 2WT7B 2H8PD 1Q82Q 3MGNA 1LTBC 1NJIQ 4EOTA 2LXBA 3RL0B 1LP1B 2FYUK 1VQ9P 3VYIA 3H1IG 3VTPC 3S9OA 1NU1K 1KILA 1HGVA 3H1KJ 5GTIH 1VQ6P 1LT9B 2Y0DA 4PV1C 1L4AC 4BRYB 1SQVG 1JUNA 3A5TA 4W7YA 3AECC 1QL1A 1QVFO 3BVHA 2FFDC 2YNYA 2E5YA 3QH9A 4C7NB 2HLOA 4ZMDA 1GTWA 4OGQC 1HJ0A 1FZCC 3C1LA 1IK7A 3TYYA 4I2LC 4IOIH 1VQ5P 2QSIA 1FOSE 1M7LA 3EFGA 2K1AA 3F89A 2ZXXA 3O6QA 1X79B 2YKQA 1CI6B 2Y0EA 2WTYA 3Q5PA 3KZIH 2QVAA 3B8EB 2IDBA 1VQPP 5KAFH 4JQ0D 1T6AA 1NTMD 3WUTA 1KFMA 1GU5A 1J1DB 3HTKA 1NVOA 5BVZA 1K8AQ 1TU3F 5EFWB 2HPCA 3AE9C 2M3EA 5KJ7D 3H1IE 3CXHH 1L0LK 1LJ2A 3CCMP 1S5LE 3PH0A 3CMAP 1KYOI 3E1IA 5B66E 3P7KA 1SQVE 2B88A 1KTMA 1WT6A 2WQYC 2M3BA 1WRGA 2M5AB 2PP6A 1YJ9P 1DEEG 1IZNB 3RK3E 2POHA 2B9BA 5AVZB 1NKZB 3WMM0 2O01N 2HYNA 1H0TA 1DH3A 1J1DC 1KYOE 4W7ZA 3CWBD 4H44D 1L0NK 2W27A 1RF1C 1JY2O 2YMKA 1LTTC 2KSJA 4U3FD 3SWYA 1SFCA 1NAYA 4OVNF 2QM8A 1FZAA 1SS1A 4YPCA 1LWUA 2OQQA 4PJ0H 3MIWA 1JCDA 4HKZH 3RK2B 1RF0A 3VOPA 3CWBJ 2QM7A 1KILB 3Q5RA 2K3RA 3N7NA 1G1JA 3EQ2A 3V2QA 1YQ4C 4U3FJ 3AEGC 1OW8A 3L70J 2Q1KA 1G1IA 3L71D 3P8CE 1YBKA 1LTIC 4DZOA 3S4RA 1SQQD 4R4MA 4I6MC 2BCCD 2Q5UA 2ZAEB 3AE2C 3H25A 1N7SA 1IFNA 1L4AD 3O8ZA 3L73D 1T3JA 1NTMG 1YJNP 4RKUJ 1JO5A 1VQ8P 3O6QB 1S5LX 2BEZF 4Z1MH 3LW5H 1NTZJ 1Q86Q 3L71J 1EC5A 1EZVD 1SQQJ 1IO4A 2KXPB 3VMAA 4L76A 1HJBA 3QWOC 3HTKB 2B87A 2IYOA 4OGQD 5KJ7A 1FBMA 1NTKD 3L74D 2OTJP 3AE1C 1R5SA 2HPCB 5BU8B 2G3AA 1KFNA 1Y8AA 1GD2E 3D6ZA 3NMDA 2LXCB 3M9QA 2WSCJ 5CCHA 2Q3IA 2M0BA 2J58A 2J5UA 3II6A 1OMIA 1OW7A 1M1KQ 1KQGB 4JYBA 3A0BE 3CWBG 2WSFH 5APUA 1LTAC 1RE4C 4U3FG 2A45G 3CD6P 1H0TB 1NTME 2ZYDA 1ZXGA 2P1JA 3SFDC 3V6IA 1BSHA 2QRXA 1NWQA 2FYZA 2AXCA 3L75D 1QVGO 1N73C 3HD7C 1SFCB 4H0LD 1KQSO 1KZUB 1Z56A 3GLMA 4DJGA 1LWUB 3L72D 3TGUJ 4N6JA 3B4SA 1EXIA 1PL5A 4ZKUA 1X9VA 5AVXB 2A45I 3A7OA 3L75J 4LLHA 2N1TA 3KQGA 2BCCG 1IK9A 1G2CA 5AW7B 2I1KA 3L72J 3L73G 5CMZA 5KAIE 4GODA 3E1RA 5CJ4A 2KUBA 3AE5C 1K9MQ
chains in the Genus database with same CATH topology
2FYUG 4U3FG 1BE3G 3H1IG 3CX5H 1EZVG 1NTMG 3L75G 2BCCG 3L70G 1KB9H 4PD4H 1KYOH 3CXHH 3TGUG 1NU1G 2IBZG 1L0LG 1BGYG 3L73G 1SQBG 1SQPG 1SQXG 3H1HG 1L0NG 1PPJG 1BCCG 1NTKG 3L74G 1NTZG 3L72G 1SQVG 3H1KG 3L71G 3H1LG 3CWBG 3H1JG 5KLVG 1P84H 3BCCG 1SQQG 4D6TG 1PP9G 2A06G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  4U3F G;  1BE3 G;  3H1I G;  3CX5 H;  1EZV G;  1NTM G;  3L75 G;  2BCC G;  3L70 G;  1KB9 H;  4PD4 H;  1KYO H;  3CXH H;  3TGU G;  1NU1 G;  2IBZ G;  1L0L G;  1BGY G;  3L73 G;  1SQB G;  1SQP G;  1SQX G;  3H1H G;  1L0N G;  1PPJ G;  1BCC G;  1NTK G;  3L74 G;  1NTZ G;  3L72 G;  1SQV G;  3H1K G;  3L71 G;  3H1L G;  3CWB G;  3H1J G;  5KLV G;  1P84 H;  3BCC G;  1SQQ G;  4D6T G;  1PP9 G;  2A06 G; 
#chains in the Genus database with same CATH topology
 3CWB E;  2QJK C;  2KYV A;  1SQP D;  1EZV G;  1K05 A;  1N7S B;  2C0X A;  3FWN A;  4U3F E;  2K9J A;  1PZQ A;  1GL2 C;  5CBO A;  3MHV A;  3I5C A;  1ZV8 A;  2YO3 A;  1NTK G;  3L74 G;  4TT3 H;  2W6B A;  2WIT A;  4UB8 E;  3CCS P;  2OYI A;  1ZLL A;  1ZP0 C;  2B87 B;  1NKN A;  1SQP J;  1JB0 J;  3D6Y A;  2AEF A;  3SWK A;  3T97 A;  4UB6 E;  1VF5 C;  3RGU A;  1EZV I;  2O01 J;  5AVU B;  1Y47 A;  2NPS A;  1A02 F;  3L71 E;  2E74 C;  2E75 B;  1QX8 A;  1SQQ E;  1CZQ A;  1KYO H;  2KK7 A;  2BCC E;  5M1B A;  1KB9 D;  2C9N Y;  3M06 A;  1N7L A;  3L73 E;  3GHG C;  3ABV C;  1FZB A;  1S4X A;  2OYH B;  3AE7 C;  1SQX D;  5GTH E;  3L75 G;  2GUS A;  4L75 A;  1M1J A;  3L4F A;  4U7J A;  1EZV E;  1SQB K;  3TSI A;  3L72 G;  2H43 A;  2OGU A;  1NTK E;  3L74 E;  1L0L D;  2Q7C A;  4IL6 H;  2ZT9 C;  2K9Y A;  1U57 A;  2IX7 C;  1GDT A;  2HOD B;  3CC7 P;  1SQX J;  4L74 A;  2AXT H;  2E75 C;  2ZJS E;  5AW8 B;  2WMM A;  1JY3 N;  4LC1 A;  3L36 A;  4LGD E;  1K04 A;  2R32 A;  4GOF A;  5TIS H;  4RJT A;  4JBZ A;  3U1A A;  3AE4 C;  3CX5 H;  2N1T B;  1JEK A;  3HD7 D;  2Y9Y A;  5APS A;  2OYH C;  3C8V A;  1FS0 E;  1G2C B;  1SQP G;  1FAV A;  1J1E B;  3MUD A;  4AQR D;  2WPS A;  2W8Z A;  3JCU H;  4O9B A;  2E5T A;  1S9K D;  2ZYG A;  1S3J A;  4HYT B;  1OX3 A;  3L75 E;  2K9J B;  3HUS C;  1WMK A;  1SVF A;  3P32 A;  2JWD A;  3H6P A;  1RE3 C;  3M0D A;  3L72 E;  4MN4 C;  4I7Z C;  2IBZ D;  2QG4 A;  2KP8 A;  4Y99 C;  2WSE J;  2KSE A;  2N9B A;  2E76 B;  4WVZ A;  1OVV A;  1FZG A;  1GL2 D;  3T97 B;  1UIX A;  1EQ7 A;  4KJM A;  2ZYA A;  1W5C E;  1HGZ A;  1P84 D;  4YXW H;  2NPS B;  2FY8 A;  5AW0 B;  1VQ4 P;  3BCC D;  1SQX G;  4I1L A;  2KB7 P;  1DEB A;  1SQP E;  2JDI H;  2R5D A;  1VF5 D;  2D2C C;  3SWF A;  2BAS A;  3RL0 C;  1L0L G;  1M1J B;  2E74 D;  2C9L Y;  3ITK A;  1PPJ G;  3G71 P;  1SQV K;  1KB9 I;  1BDC A;  1Q81 Q;  1LTJ B;  1EDL A;  3LID A;  2GA1 A;  2E76 C;  3GW6 A;  2HG5 D;  1FDM A;  2QJY B;  2JP3 A;  3B71 A;  1LT9 C;  4EIJ A;  1NAF A;  2GUV A;  4OWF A;  4WY4 B;  3CME P;  2OYO A;  1E5W A;  3V4W A;  2QA4 P;  4HJG H;  5CJ0 A;  2N9Y B;  1FZE A;  1HBW A;  5APY A;  5APW A;  1NTM J;  2Z5H A;  2I1J A;  1KB9 E;  2GM4 A;  3EFF K;  3H1J D;  3RBZ A;  2V4H A;  1ZW0 A;  2ZT9 D;  5AW6 B;  1PGJ A;  4L73 A;  1SQX E;  4N3Y B;  1ZRT D;  1JY3 O;  1VDF A;  2YKO A;  3FXE A;  1LTJ C;  4H13 B;  1LTS C;  2IBZ G;  1URQ A;  2XDJ A;  4QMA A;  3R4Y A;  3CXH D;  4WY4 C;  2R44 A;  1T3U A;  1L0L E;  1RHZ B;  5C39 A;  3OA7 A;  1PGQ A;  3HE5 B;  5E79 E;  4GT1 A;  5L8R J;  1JTH A;  1YHQ P;  3PRJ A;  3CC4 P;  1ZN5 A;  3SFE C;  2WPQ A;  3B5N D;  2LKM A;  1USE A;  3CCU P;  2L91 A;  1H88 A;  1RY3 A;  5KTB A;  2MJZ A;  1Q2N A;  5CCG D;  5B5E H;  3V4Q A;  3BCC G;  1JY3 P;  3IFM A;  1JMM A;  2IBZ I;  2P67 A;  5GTH H;  1MV8 A;  2WSC H;  3A0H H;  4D6T D;  1HH0 A;  2NRG A;  4H13 C;  2QJP B;  1MFT A;  2WSS H;  1S9K E;  3E7K A;  1HUC A;  4PV1 D;  3RK3 B;  1X22 A;  1KMI Z;  3WU2 E;  3G9R A;  2IBZ E;  2XKM A;  3RK2 C;  3U1C A;  1IFD A;  2MKV A;  3S1K A;  2BCC J;  1YI2 P;  1KIL C;  4PD4 H;  1PGP A;  4AYC A;  3FGA D;  4IFD K;  3L73 J;  3UIA A;  2D2C D;  1HTL C;  3N4X A;  1T2K C;  3MTU E;  5AW5 B;  2YIU B;  3H1J G;  5KKZ B;  1P84 E;  4BWN A;  1X0T A;  3BCC E;  4R4L A;  4JF7 A;  1GU4 A;  2V7Q J;  1KQL A;  1NTK J;  3L74 J;  3M9H A;  1QLE D;  1MZ9 A;  5AVQ B;  1MKM A;  1PV3 A;  5AVW B;  2FYN B;  4YTP C;  2IZ0 A;  2R3C A;  5GTI E;  1URQ B;  2FBW C;  3R2P A;  3CC2 P;  3PJS K;  4BXL A;  1KQF B;  4ASV A;  3B5N A;  2SPZ A;  1JTH B;  5KLI B;  3TK1 A;  3MZW B;  5KLV D;  3CLQ A;  4WWI A;  1M90 Q;  5CCG A;  4EYY Q;  1RQV A;  2PAJ A;  3CXH I;  3CCQ P;  1U7M A;  2KNC A;  4D6T G;  3RBX A;  1JNM A;  3H1J E;  3AEA C;  2Q6Q A;  1N86 A;  4HH2 A;  3CCE P;  2KLU A;  2O01 H;  1PIX A;  1PP9 D;  1ZRT E;  2HR3 A;  5KLV J;  3RL0 g;  1KD1 Q;  5APT A;  1AJY A;  1LNQ A;  1L4A A;  3VMY A;  3CI9 A;  3CCL P;  3CXH E;  2OTL P;  1SFC C;  2CPS A;  3EWK A;  2FFD A;  1S5L H;  1NTZ K;  2FYU D;  2NZ2 A;  2JJL A;  1LWU C;  1PP9 J;  2YXR B;  1AA0 A;  1SQQ K;  1A02 J;  5B66 H;  1KOR A;  5AVS B;  1NU1 D;  1BGY D;  1RF0 C;  1FZC A;  3FXD A;  4ASW A;  2G8Y A;  1Y9B A;  3VMX A;  1S2E A;  2P7J A;  2H7H A;  4TLF A;  1OIP A;  2W6A A;  2FYU J;  2Z4E A;  1OZH A;  3MD0 A;  1J2J B;  3PTZ A;  4GKG A;  4D6T E;  3RK2 D;  1NU1 J;  1BGY J;  2OTK E;  1OXZ A;  4IFF A;  3AEB C;  1KIL D;  5DJU B;  1IC2 A;  4NPD A;  1N7S C;  2BEQ D;  2WPR A;  3V2R A;  3U59 A;  4CPG A;  4XA4 A;  4PJ0 E;  1IFM A;  3AEE C;  1VQM P;  1M8O B;  4GDO A;  2L5G B;  1XTC C;  1MFZ A;  2W83 C;  4H44 B;  3HE4 A;  4OH8 B;  1FOS F;  5KJ7 C;  5KLV G;  3CPW O;  1JCC A;  2P58 A;  1CI6 A;  3AEF C;  3IAO A;  3H1H D;  2R5B A;  1PPJ D;  1IFI A;  3G6E P;  3V5B A;  1RQU A;  2K37 A;  5AVY B;  2WSE H;  5CCH C;  3IN6 A;  1RF1 A;  3TNU A;  1PP9 G;  3WUV A;  1DIP A;  2KNC B;  3M91 A;  4DT0 A;  5AVT B;  1L0L J;  3CCR P;  1YQ3 C;  1VQL P;  3G3Z A;  1VQ7 P;  1GMJ A;  1VQK P;  2WZ7 A;  2FYU G;  1T8Z A;  2XZR A;  1L0N D;  1L4A B;  3HRN A;  1JY2 N;  2QE7 H;  3H1L D;  1NU1 G;  5CBN A;  1BGY G;  3PHL A;  5TJH A;  2JEE A;  3KDP B;  1VQO P;  1H89 A;  1IFJ A;  5AW9 B;  1ZR4 A;  3D70 A;  2ZFC A;  5KLV E;  1YJW P;  2ITA A;  2Y0C A;  2WWW A;  4OGQ B;  3H1K D;  2OYI B;  1IFP A;  3IR9 A;  2CK3 H;  1L0N J;  1FZC B;  1SQP K;  1EDK A;  3CX5 D;  2XND H;  2N1T C;  3ZDM A;  1AQT A;  1EDJ A;  1SFC D;  3A0B H;  1OW6 A;  3TDK A;  1FDO A;  1EDI A;  4WBA A;  1NOH A;  1PP9 E;  1J1E C;  1VQN P;  2FXM A;  5BU5 A;  3GMA A;  1FC2 C;  2IYP A;  1RH5 B;  4C46 A;  5AW3 B;  4JYC A;  3JC2 2;  3KHU A;  2FYU E;  2AEM A;  1NHL A;  3H1H G;  2M8R A;  3AE6 C;  1NU1 E;  2OYI C;  1BGY E;  3BCC J;  3HE4 B;  1YTZ T;  1N7S D;  4H0L B;  3GF7 A;  1DX7 A;  1RE4 A;  1SQX K;  3W68 A;  3K5B A;  4EDF A;  2A06 D;  5KAI H;  2OAR A;  2NPS C;  4M3L A;  1RF1 B;  3TNU B;  3NFQ A;  2KS1 A;  3VN0 A;  1YIT P;  1N73 A;  1KIL E;  3C9I A;  4W80 A;  3HD7 A;  1AQ5 A;  3L37 A;  1S72 P;  1ZR2 A;  2QEX P;  2A45 H;  1L0N G;  2CPB A;  2QIW A;  2JKV A;  1DD3 A;  3BAT A;  3H1L G;  4GIF A;  4UB8 H;  3KPE A;  1M1J C;  2E75 D;  2LR2 A;  5CCH D;  4NPF X;  1VPC A;  4ZNC A;  1GK6 A;  2QJY C;  3G4S P;  3F5H A;  4H0L C;  2XNX A;  1EXJ A;  2Z5I A;  3H1J J;  2YMY A;  3H1K G;  4UB6 H;  1FDI A;  2Q9I A;  3H1H E;  3Q5S A;  1X8Y A;  1BDD A;  1PPJ E;  2Q3E A;  1KV4 A;  2K88 A;  2KI7 B;  3GF3 A;  5AW1 B;  4AUW A;  4N78 D;  2KIK A;  3FWL A;  1GL2 A;  2KZJ A;  5APX A;  1OFC X;  3L70 D;  4WB4 A;  1KN7 A;  5AVR B;  1W2B O;  1PFI A;  1KC8 Q;  1BCC D;  2RKL A;  3MUD C;  1YTZ I;  2YKP A;  3CX5 I;  1S1C X;  4YXD C;  4K3A A;  4HB1 A;  1L0N E;  2V7Q H;  3USS A;  3VP9 A;  1FJK A;  2YXQ B;  2UWJ E;  2FKW B;  3OJA B;  3H1L E;  2N1T D;  4IL6 E;  2PFX A;  1OVU A;  1NTZ D;  3WUU A;  1P84 I;  1GW4 A;  1BCC J;  3IF4 A;  1JY2 P;  2AXT E;  3M0D C;  3AE3 C;  1YIJ P;  5H2F E;  1N8R Q;  3Q1M A;  4D6T J;  1CSB A;  1HVV A;  3NXS A;  1PGO A;  3H1K E;  5TIS E;  2A06 G;  2P10 A;  3GHG A;  3CX5 E;  3GG2 A;  2IFM A;  3KXD A;  2WPV B;  2RMZ A;  3BAS A;  1W2E A;  3M9B A;  3AED C;  3I55 P;  3RL0 D;  4Y28 J;  3H32 A;  5CHX A;  3A2A A;  3JCU E;  1NTM K;  1LT1 A;  5AW4 B;  2E76 D;  2QJP C;  2KS1 B;  1N73 B;  2XV5 A;  3HD7 B;  2RH0 A;  3PP5 A;  3RK3 C;  2B89 A;  1LGH B;  2KZI A;  3JSV C;  4B86 A;  2H89 C;  4XFJ A;  2NPS D;  3L35 A;  1SQB D;  1OVR A;  1FU1 A;  5K5G B;  1NYH A;  1D7M A;  3CCV P;  4PD4 D;  1M57 D;  2OYH A;  1K73 Q;  1FZF A;  2FXP A;  1H8A A;  2W90 A;  1JMB A;  3TGU D;  1R8E A;  3LW5 J;  3L70 G;  2A06 E;  4RO0 A;  2YIU C;  1L2P A;  5KKZ C;  1DD4 A;  1SQB J;  4RES B;  4KT0 J;  2O1K A;  2DW3 A;  2JR8 A;  1BCC G;  2QJK B;  2ZVN B;  1BE3 D;  3V2N A;  3W67 A;  2H88 C;  1GL2 B;  1VL2 A;  2O3J A;  3HUS A;  4IL6 X;  4JPZ B;  1NGM B;  4NPE A;  2HOD A;  3SSU A;  4WY4 D;  1RE3 A;  2KOG A;  2R3S A;  2FYN C;  3KZI E;  1NTZ G;  2C0W A;  1AV1 A;  3L71 G;  4C7R A;  5KAF E;  1YYC A;  1FJP A;  1SQQ G;  1BE3 J;  4XE5 B;  2E43 A;  1URQ C;  1VF5 B;  2P2U A;  2YO2 A;  4GOE A;  2HFE D;  2WSF J;  5APV A;  1R5L A;  3FX0 A;  2E74 B;  5KLI C;  1SLQ A;  2J59 M;  3TF5 A;  4ZKP A;  4N78 E;  2ZVO B;  4H13 D;  1KB9 H;  1CW5 A;  2IFN A;  3CL3 D;  3GHG B;  1NO4 A;  1M56 D;  1JOC A;  3L70 E;  3Q3D A;  2WT7 A;  1XTG B;  3BRV B;  3MP7 B;  1HWT C;  1LP1 A;  1BCC E;  1FE6 A;  1LTG C;  3AE8 C;  2IPP A;  1AFO A;  3H32 B;  4DOJ A;  2FXO A;  3OW2 O;  1IJD B;  1ZME C;  1USD A;  1LT9 A;  3NTN A;  4BRY A;  1SQB G;  1NTK K;  2ZXE B;  3BRT B;  5DJT B;  2Y9Z A;  3H1I D;  2ZT9 B;  5AW2 B;  1Q90 D;  1NTZ E;  5E79 H;  4KHX A;  1T2K D;  3VMZ A;  4A7P A;  1SQV D;  1QGK B;  2XU6 A;  3TGU G;  4C7N A;  2I8D A;  2O1J A;  5B5E E;  3H1I J;  3RK3 D;  4EI2 A;  3I56 P;  1BE3 G;  3KYQ A;  3A3Y B;  2WVR A;  1QL2 A;  1JM0 A;  2RN0 A;  3D71 A;  3B5N B;  1LTJ A;  3A0H E;  1SQV J;  1N2D C;  3P8M C;  4PD4 I;  4K35 A;  5AVV B;  1KYO D;  1OWA A;  3CCJ P;  3M0A A;  4WY4 A;  4DCK A;  3HUS B;  1GW3 A;  1Q7Y Q;  3Q2Y A;  4IFM A;  1QEX A;  3H1H J;  4I7Z B;  3WU2 H;  5H2F H;  4Y99 B;  5KLV K;  1SQB E;  2PRR A;  3V2P A;  3PLN A;  4H44 C;  1GK4 A;  4PV1 B;  4PD4 E;  2M5A A;  1BSN A;  1SP4 A;  1AVY A;  1GZL A;  1UII A;  2W6J H;  1AVO A;  2KLV A;  1MUU A;  3TGU E;  3P8C D;  2FFD B;  1P84 H;  3OAK A;  3B5N C;  2IZ1 A;  1ZOY C;  1NH4 A;  2VRS A;  5APQ A;  2JO1 A;  5CCG C;  1U7J A;  1BE3 E;  1HF9 A;  2JWA A;  1E79 H;  2PGD A;  1URQ D;  2AEJ A;  3LIE A;  2E42 A;  3H1L J;  3HE5 A;  3VP8 A;  2D2C B;  2WT7 B;  2H8P D;  1Q82 Q;  3MGN A;  1LTB C;  1NJI Q;  4EOT A;  2LXB A;  3RL0 B;  1LP1 B;  2FYU K;  1VQ9 P;  3VYI A;  3H1I G;  3VTP C;  3S9O A;  1NU1 K;  1KIL A;  1HGV A;  3H1K J;  5GTI H;  1VQ6 P;  1LT9 B;  2Y0D A;  4PV1 C;  1L4A C;  4BRY B;  1SQV G;  1JUN A;  3A5T A;  4W7Y A;  3AEC C;  1QL1 A;  1QVF O;  3BVH A;  2FFD C;  2YNY A;  2E5Y A;  3QH9 A;  4C7N B;  2HLO A;  4ZMD A;  1GTW A;  4OGQ C;  1HJ0 A;  1FZC C;  3C1L A;  1IK7 A;  3TYY A;  4I2L C;  4IOI H;  1VQ5 P;  2QSI A;  1FOS E;  1M7L A;  3EFG A;  2K1A A;  3F89 A;  2ZXX A;  3O6Q A;  1X79 B;  2YKQ A;  1CI6 B;  2Y0E A;  2WTY A;  3Q5P A;  3KZI H;  2QVA A;  3B8E B;  2IDB A;  1VQP P;  5KAF H;  4JQ0 D;  1T6A A;  1NTM D;  3WUT A;  1KFM A;  1GU5 A;  1J1D B;  3HTK A;  1NVO A;  5BVZ A;  1K8A Q;  1TU3 F;  5EFW B;  2HPC A;  3AE9 C;  2M3E A;  5KJ7 D;  3H1I E;  3CXH H;  1L0L K;  1LJ2 A;  3CCM P;  1S5L E;  3PH0 A;  3CMA P;  1KYO I;  3E1I A;  5B66 E;  3P7K A;  1SQV E;  2B88 A;  1KTM A;  1WT6 A;  2WQY C;  2M3B A;  1WRG A;  2M5A B;  2PP6 A;  1YJ9 P;  1DEE G;  1IZN B;  3RK3 E;  2POH A;  2B9B A;  5AVZ B;  1NKZ B;  3WMM 0;  2O01 N;  2HYN A;  1H0T A;  1DH3 A;  1J1D C;  1KYO E;  4W7Z A;  3CWB D;  4H44 D;  1L0N K;  2W27 A;  1RF1 C;  1JY2 O;  2YMK A;  1LTT C;  2KSJ A;  4U3F D;  3SWY A;  1SFC A;  1NAY A;  4OVN F;  2QM8 A;  1FZA A;  1SS1 A;  4YPC A;  1LWU A;  2OQQ A;  4PJ0 H;  3MIW A;  1JCD A;  4HKZ H;  3RK2 B;  1RF0 A;  3VOP A;  3CWB J;  2QM7 A;  1KIL B;  3Q5R A;  2K3R A;  3N7N A;  1G1J A;  3EQ2 A;  3V2Q A;  1YQ4 C;  4U3F J;  3AEG C;  1OW8 A;  3L70 J;  2Q1K A;  1G1I A;  3L71 D;  3P8C E;  1YBK A;  1LTI C;  4DZO A;  3S4R A;  1SQQ D;  4R4M A;  4I6M C;  2BCC D;  2Q5U A;  2ZAE B;  3AE2 C;  3H25 A;  1N7S A;  1IFN A;  1L4A D;  3O8Z A;  3L73 D;  1T3J A;  1NTM G;  1YJN P;  4RKU J;  1JO5 A;  1VQ8 P;  3O6Q B;  1S5L X;  2BEZ F;  4Z1M H;  3LW5 H;  1NTZ J;  1Q86 Q;  3L71 J;  1EC5 A;  1EZV D;  1SQQ J;  1IO4 A;  2KXP B;  3VMA A;  4L76 A;  1HJB A;  3QWO C;  3HTK B;  2B87 A;  2IYO A;  4OGQ D;  5KJ7 A;  1FBM A;  1NTK D;  3L74 D;  2OTJ P;  3AE1 C;  1R5S A;  2HPC B;  5BU8 B;  2G3A A;  1KFN A;  1Y8A A;  1GD2 E;  3D6Z A;  3NMD A;  2LXC B;  3M9Q A;  2WSC J;  5CCH A;  2Q3I A;  2M0B A;  2J58 A;  2J5U A;  3II6 A;  1OMI A;  1OW7 A;  1M1K Q;  1KQG B;  4JYB A;  3A0B E;  3CWB G;  2WSF H;  5APU A;  1LTA C;  1RE4 C;  4U3F G;  2A45 G;  3CD6 P;  1H0T B;  1NTM E;  2ZYD A;  1ZXG A;  2P1J A;  3SFD C;  3V6I A;  1BSH A;  2QRX A;  1NWQ A;  2FYZ A;  2AXC A;  3L75 D;  1QVG O;  1N73 C;  3HD7 C;  1SFC B;  4H0L D;  1KQS O;  1KZU B;  1Z56 A;  3GLM A;  4DJG A;  1LWU B;  3L72 D;  3TGU J;  4N6J A;  3B4S A;  1EXI A;  1PL5 A;  4ZKU A;  1X9V A;  5AVX B;  2A45 I;  3A7O A;  3L75 J;  4LLH A;  2N1T A;  3KQG A;  2BCC G;  1IK9 A;  1G2C A;  5AW7 B;  2I1K A;  3L72 J;  3L73 G;  5CMZ A;  5KAI E;  4GOD A;  3E1R A;  5CJ4 A;  2KUB A;  3AE5 C;  1K9M Q; 
#chains in the Genus database with same CATH homology
 2FYU G;  4U3F G;  1BE3 G;  3H1I G;  3CX5 H;  1EZV G;  1NTM G;  3L75 G;  2BCC G;  3L70 G;  1KB9 H;  4PD4 H;  1KYO H;  3CXH H;  3TGU G;  1NU1 G;  2IBZ G;  1L0L G;  1BGY G;  3L73 G;  1SQB G;  1SQP G;  1SQX G;  3H1H G;  1L0N G;  1PPJ G;  1BCC G;  1NTK G;  3L74 G;  1NTZ G;  3L72 G;  1SQV G;  3H1K G;  3L71 G;  3H1L G;  3CWB G;  3H1J G;  5KLV G;  1P84 H;  3BCC G;  1SQQ G;  4D6T G;  1PP9 G;  2A06 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...