3A0HH

Crystal structure of i-substituted photosystem ii complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 13
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3a0hH01
5TISH 4UB6H 4IL6H 5B66H 5H2FH 3JCUH 4UB8H 3KZIH 5GTIH 4PJ0H 1S5LH 5KAIH 5KAFH 2AXTH 3A0BH 3A0HH 5GTHH 3WU2H 5E79H 5B5EH
chains in the Genus database with same CATH superfamily
1ZR2A 1R5SA 2W83C 3MHVA 5AVTB 3CXHI 1RY3A 2FYUJ 3IF4A 1FZCB 1ZRTD 4KHXA 4Y99B 4OGQB 2B87A 3R2PA 4I7ZC 3H1KJ 3L73E 3RL0B 3TGUE 2AXTE 1W2EA 2RKLA 3MUDA 1LWUC 4MN4C 1VF5D 3CXHD 3Q5RA 5CCHD 2HLOA 1FZCC 3AE2C 5BVZA 1T3UA 2ZVOB 1X8YA 4OGQC 2Q6QA 5KAFE 5CCGC 1L4AC 3GHGB 2QG4A 3S9OA 2I1KA 3RGUA 2AXTH 1TU3F 2WITA 1Q81Q 1BGYJ 4Z1MH 1GU5A 1N7SA 4N6JA 2R32A 1NTZD 2KSJA 5KJ7A 5AW7B 3F5HA 5CJ4A 3L74D 2Z5IA 3FWLA 5APUA 2IZ1A 1KN7A 3GHGC 4U3FG 2Y0DA 2C9NY 1KYOI 1HF9A 1G2CB 1HGZA 3O6QA 3NXSA 3TNUA 2M5AB 2NPSC 5KLVD 1YQ4C 1K73Q 1G1JA 3G71P 4ZKUA 1Q90D 1FBMA 1LTBC 3L36A 5H2FH 3TSIA 1BSHA 3H1IE 2QEXP 2PFXA 4JF7A 5C39A 4I6MC 3H32B 1L0NJ 4JPZB 4PD4I 3P8CD 1JY3N 3L75G 4IL6E 2MKVA 4A7PA 3H1HG 2YNYA 4EIJA 3CX5E 1U57A 1M8OB 1SQPD 2WPVB 1H0TA 1KB9I 3AEAC 3RK3D 1ZR4A 3CL3D 1NU1K 1KZUB 1N7SD 2GM4A 1PP9G 3I56P 4AYCA 2BASA 4PD4D 1WRGA 4H0LC 5KJ7D 4IL6H 1SQVD 1GW4A 3VOPA 2HFED 3CX5H 2KK7A 1K05A 2AEFA 5EFWB 1KB9E 3L72J 2BEZF 3R4YA 5KLIB 3D6ZA 2FYZA 3V4WA 1HJ0A 1MV8A 1QX8A 4C7RA 1AVOA 1YJNP 1K04A 4LC1A 1SFCD 1IC2A 1P84I 3WUVA 3M9BA 1BCCE 2WSFJ 1DD4A 2N9BA 4H44D 1SQQJ 1IO4A 1IFNA 5BU8B 1PV3A 2QRXA 3ITKA 1A02J 5AVXB 4BRYA 3KHUA 1LNQA 2ZJSE 1FJPA 1USDA 1SQBK 2QM7A 1LTJA 1IFPA 1PP9E 1P84D 2FYUD 3IN6A 1KQSO 2H7HA 1EZVE 3B5NC 2N1TB 2FFDA 4NPDA 2RMZA 2LKMA 3CWBG 3H1KD 3RK2C 4LLHA 5CHXA 2K9JA 3V2RA 5AVRB 4DZOA 3L4FA 4C7NB 1PPJD 3FGAD 5AW6B 3MIWA 5B66E 3H1JG 2XDJA 1JO5A 1BE3G 1VQ6P 3KZIH 4WY4C 1M1JC 3L70E 3JSVC 3AEEC 3OA7A 1RF1A 4R4LA 5TJHA 1NO4A 1OIPA 3AE4C 1CSBA 3CCEP 1BGYD 1RQVA 5B66H 1T2KD 4GT1A 4EDFA 2IBZI 3ABVC 1EDJA 1CI6B 1AV1A 1NHLA 3VMXA 2IX7C 4L74A 1R5LA 1VQOP 3AE7C 3JC22 3L73J 1GK6A 2H89C 3TGUJ 1HTLC 2QE7H 3CWBE 1NU1G 2W6BA 5AVWB 2IBZD 3M9HA 1K8AQ 1ZMEC 4JBZA 1FOSF 3P32A 1S5LE 3SWFA 3A3YB 3SWYA 2R5BA 1ZOYC 1AQTA 4JQ0D 1JTHB 2OTLP 3HD7A 5AW4B 1KILA 1QVGO 1DX7A 1NAYA 2B88A 2QIWA 1Q7YQ 1L0ND 5APYA 2FKWB 2OYIB 4DT0A 4M3LA 2KNCA 3VMZA 2PGDA 2BCCG 1S5LH 1JY2O 1NTZK 3UIAA 3AEFC 2LR2A 5APQA 1LJ2A 1OWAA 1H89A 1GL2B 4I2LC 2E75C 3USSA 2A45I 4Y28J 3A7OA 3AECC 1RE4A 1SQBG 4H13D 1X0TA 2ZYGA 1PIXA 1OW7A 3NMDA 4TT3H 1OW6A 5KLVK 1S3JA 2HR3A 1OVUA 3E1RA 1FJKA 2OYHB 3H1IJ 1D7MA 1LTAC 3CMEP 3VYIA 4D6TJ 3TYYA 3A0BE 1FU1A 1HGVA 2WZ7A 5AW8B 2DW3A 4GODA 4B86A 2D2CB 2QM8A 1L2PA 1J1DB 3H1LE 1LTTC 2K37A 3ZDMA 1S72P 2JKVA 3HD7D 2WT7B 2Y0CA 3M0DA 2BCCE 1KILD 2Q9IA 1FZGA 1SQPK 3A0BH 2JDIH 2GUVA 2D2CC 2YXRB 2JWAA 3KQGA 1RF0A 3LW5H 3I55P 3CCMP 3CLQA 2IDBA 1J1DC 4RESB 1IK9A 1SQVK 1SQXE 3CCQP 3GLMA 4ASWA 3B71A 2O01N 4HJGH 2B9BA 1YYCA 2YXQB 1EDLA 2RH0A 1BCCJ 2NZ2A 2Q7CA 3B8EB 1FDMA 3V2PA 2O3JA 3BATA 1JUNA 4IFFA 2HG5D 1LTIC 1VQLP 3BCCE 1PGQA 4DCKA 2B87B 2E42A 2QJKC 1NWQA 2ZT9D 2W90A 3WUUA 1JY3O 5L8RJ 1PP9J 3AEGC 1WT6A 2QJYB 5AW9B 1Q86Q 2CK3H 2PP6A 2E74D 1S1CX 3CC7P 1NTZG 3L73D 1FS0E 3HUSA 2Q5UA 3P8MC 2FYUK 5AVYB 3L74G 2H8PD 3TGUD 1KQLA 3GMAA 2WTYA 2IYOA 1ZRTE 5APXA 5B5EE 4L73A 1LWUA 1DIPA 1L0LD 2ZXEB 4Y99C 3MUDC 1N2DC 3L70J 3FX0A 3RK3B 3RL0C 5KLVG 3BRTB 1N7SB 2OTJP 2KZIA 3WU2E 2LXCB 3C8VA 5GTHH 1L4AA 2R3CA 3EQ2A 5B5EH 1M57D 2FXOA 2YMKA 2YO2A 2JWDA 2O01H 2UWJE 3D70A 1S9KE 3O6QB 3KDPB 1N7SC 3TNUB 3WU2H 5KJ7C 3WUTA 3CWBJ 2HODA 2KI7B 1NTZE 5H2FE 1SQPG 3L71D 1SFCB 4PJ0H 1JMMA 3FXDA 1EDIA 3Q5SA 5AVUB 4BXLA 2NPSA 1SFCA 3CX5I 1SQVG 2N9YB 2OYOA 2P7JA 1KYOD 4OH8B 3H1ID 2KSEA 4D6TD 1EC5A 2YIUB 4TLFA 2IZ0A 5APSA 1H0TB 2Y9ZA 2C0XA 3LIDA 3CX5D 1NOHA 1M56D 1L0NK 1L4AD 1MFTA 1PGPA 2XU6A 1KFNA 3AEBC 4CPGA 4U3FE 4IL6X 1MUUA 3TK1A 1NTMD 3EWKA 2B89A 5AVVB 3GG2A 2YKOA 1NYHA 2W8ZA 1KB9D 2FYUG 4NPFX 3MP7B 4C46A 2WSCH 3H1KG 3VP8A 2NPSD 2PAJA 4DOJA 1PPJG 4EI2A 2FXPA 3H1LJ 4HB1A 4GOFA 1BCCD 2FYNB 4BRYB 3L75E 1EZVI 1LP1A 2Q1KA 3VMAA 3CCVP 3H1HE 3G9RA 2BCCJ 1LTJB 5KLIC 3SSUA 1UIIA 4YXWH 2FFDB 1YTZT 1IFDA 2K9JB 3IR9A 2ITAA 1PP9D 1IZNB 2FYNC 2KXPB 1EXIA 1VQ9P 1EZVD 3KZIE 1NKZB 5AVQB 1SQXJ 3B5NA 1R8EA 1VL2A 1SLQA 1NTKK 1LTJC 2KS1A 1E5WA 3MTUE 2JR8A 1KMIZ 2KLVA 4H0LD 1RF1B 1NH4A 4QMAA 2IBZG 2LXBA 2N1TC 3Q2YA 3T97A 1DH3A 1N8RQ 1PPJE 3L70D 4WY4A 1QEXA 2E76D 4RO0A 3II6A 2ZYDA 2XV5A 3BCCJ 2KZJA 2KYVA 1YQ3C 1RE3C 4H13B 1U7MA 4XA4A 3U1CA 1JY2P 4XFJA 1YBKA 3OW2O 2Z5HA 4PV1B 3A0HH 4OWFA 1YJWP 2QSIA 1L0NG 2E43A 4UB8E 5AVSB 1WMKA 1ZV8A 1M1KQ 5CBNA 4L75A 2A06D 1T3JA 2FXMA 4PV1C 5KKZB 3H1JE 2WQYC 3B5ND 2J59M 3HD7B 1KILB 1BE3E 1L0LK 3FXEA 4UB8H 1FZFA 1CZQA 3RK2D 2W27A 3V2NA 1AA0A 2QJPB 4KT0J 2R5DA 1GDTA 2KNCB 3V6IA 2H43A 1LT9A 2XNDH 2Q3IA 2OGUA 3P7KA 3S4RA 5KKZC 2AEMA 1S5LX 4K3AA 1YJ9P 4L76A 3PJSK 4WY4D 3CPWO 2G3AA 4W7ZA 3G6EP 1NGMB 1MZ9A 1NTZJ 1IFJA 3PHLA 1AJYA 1W5CE 2OARA 3KXDA 1NU1E 2ZXXA 3CCJP 2OYIC 5M1BA 2HPCA 4EYYQ 2M0BA 4BWNA 4UB6E 3N7NA 1RE4C 1N73B 1QGKB 1NTKG 2ZT9B 3U1AA 3L72D 1DEBA 2XKMA 1GL2C 3RBZA 1N73A 1Z56A 2E74B 2K3RA 3K5BA 3G3ZA 4GOEA 1GMJA 4AQRD 1AFOA 1S2EA 4RJTA 1VQ8P 1LTSC 4O9BA 2W6AA 2JP3A 3M9QA 4UB6H 3H1LD 1YIJP 3PP5A 4XE5B 1OW8A 2W6JH 1JY3P 2FY8A 1URQA 2ZFCA 4N78E 1SQQD 2OYHC 2QVAA 1VF5B 2JJLA 3IFMA 3MGNA 4U3FJ 5APVA 1VQKP 4W80A 1J1EB 1EQ7A 2WSCJ 1FAVA 2J5UA 3PRJA 1SQBE 1NTMK 3E1IA 2CPBA 1VF5C 1SQXD 2XZRA 2HYNA 5CCHC 5CMZA 1A02F 2P67A 3L73G 4WVZA 1NTKE 2KLUA 1NKNA 2E75D 4HYTB 1KFMA 1HH0A 3TGUG 2Y9YA 1HVVA 4AUWA 3L75J 2IPPA 3H1HJ 1L0LG 1QL2A 5TISH 1KQFB 1JOCA 4K35A 2J58A 3BCCD 1JM0A 2NRGA 3HUSB 1QVFO 1VDFA 1Y9BA 3L37A 2AEJA 3Q5PA 3HTKA 2QA4P 1URQD 3SFDC 1LWUB 2E5YA 5AVZB 3Q1MA 4GDOA 5GTHE 3L35A 2I8DA 1PFIA 2WMMA 3HUSC 2K88A 3VTPC 2D2CD 2M3BA 3CI9A 2QJYC 1VPCA 1HUCA 3L71G 2P1JA 3BASA 3OJAB 5APWA 2K1AA 1L4AB 2KUBA 1NAFA 1FZCA 4IFMA 1GU4A 1AQ5A 3NTNA 3LIEA 3A5TA 3CXHE 1QL1A 5CCGA 1DEEG 3CC4P 1L0LE 4N3YB 4EOTA 1PL5A 2M3EA 5DJTB 4LGDE 2IFMA 2MJZA 4PJ0E 3H1IG 4HKZH 1S4XA 2HODB 4D6TG 3CMAP 3RK3C 1NJIQ 1VQMP 1S9KD 2ZAEB 1JEKA 2OTKE 3CXHH 1EXJA 3GHGA 1X22A 3A2AA 2NPSB 1T8ZA 3SWKA 3L74E 1BDCA 3AE6C 3VN0A 5KAFH 2FBWC 3D6YA 1RQUA 1RHZB 1GTWA 3H1JJ 4H44B 1G1IA 1U7JA 1BDDA 3W67A 2WWWA 2POHA 1BE3J 1ZN5A 4NPEA 3L71E 2KIKA 2IYPA 1NTMG 1KORA 2P2UA 1T6AA 5KLVE 4I1LA 4YPCA 1SFCC 4IFDK 1G2CA 4HH2A 1JCCA 2M5AA 4H44C 1FC2C 1MKMA 3CCLP 1BSNA 4OGQD 1ZLLA 3AE3C 3E7KA 1IFMA 1KYOE 3HE5B 2IFNA 1OFCX 2V4HA 3RL0D 5CCGD 4D6TE 1GD2E 1BCCG 3P8CE 4H0LB 1PGOA 3V5BA 4ASVA 3HE5A 2XNXA 4U3FD 2YIUC 1AVYA 3GW6A 1NU1J 1XTCC 2KP8A 2G8YA 2WSEH 1SQPE 4OVNF 3BVHA 3AE9C 3H32A 3EFGA 1KYOH 2E76B 2Q3EA 3RK3E 1CW5A 1HBWA 3VMYA 1LGHB 3W68A 1XTGB 4PD4E 1EZVG 1USEA 2KB7P 1SQVE 1NTME 3CCSP 1LP1B 2Y0EA 5BU5A 3LW5J 1HWTC 3EFFK 2E76C 3MZWB 1SVFA 3L75D 2PRRA 3HRNA 3N4XA 1T2KC 4PD4H 3H1HD 1OX3A 1W2BO 3AE1C 1H88A 2R44A 3AE5C 1IK7A 4IOIH 3L70G 3AE8C 2SPZA 2WVRA 1SQQK 2WPSA 3B5NB 1OVVA 1KB9H 5DJUB 3RL0g 1ZW0A 1K9MQ 2KS1B 1BGYG 1JCDA 3PTZA 3M06A 1Y47A 1SQBJ 3I5CA 3RK2B 1KTMA 5AW5B 1VQ4P 1RH5B 1JNMA 1VQ7P 2RN0A 2V7QH 3GF3A 2WPRA 1NTKJ 2BEQD 5AW0B 1YTZI 1P84E 3CCUP 1H8AA 2FYUE 3T97B 2FFDC 1FZBA 1SQXK 4WY4B 1M1JB 3H1KE 1X9VA 2O1KA 2CPSA 2YO3A 3A0HE 2A06G 2OQQA 3PLNA 2WPQA 1ZP0C 5E79E 2N1TA 1M1JA 3Q3DA 2GA1A 1P84H 2WSSH 4C7NA 1GZLA 2C9LY 5KAIE 1DD3A 1RF1C 3CD6P 1RE3A 5AW3B 4ZNCA 4JYBA 1HJBA 1OZHA 3GF7A 1GK4A 5E79H 3AEDC 1BGYE 1KV4A 4RKUJ 3F89A 2L91A 1E79H 4R4MA 2YMYA 4ZMDA 2Z4EA 4H13C 3CWBD 3V2QA 5KAIH 1EDKA 2JO1A 1FZAA 1OMIA 1FDOA 3M0AA 1IFIA 1CI6A 2K9YA 4KJMA 1FOSE 1JMBA 3U59A 2C0WA 3H1JD 1VQPP 2O01J 5GTIE 4U7JA 1BE3D 2IBZE 4JYCA 3BRVB 1LT9B 2A06E 1L0LJ 1GW3A 3SFEC 5AW1B 5APTA 1Y8AA 2L5GB 3V4QA 3L72G 2I1JA 3QH9A 1SP4A 1Q2NA 1M90Q 3RBXA 2A45G 3HD7C 2N1TD 5GTIH 1VQNP 1KC8Q 1KILC 1JB0J 1LT9C 3IAOA 3C9IA 2QJPC 3VP9A 1KD1Q 2E75B 3QWOC 2HPCB 3H1LG 1L0NE 5CBOA 1FZEA 3L74J 1JTHA 2JEEA 1SQQG 4WWIA 1M7LA 1NU1D 3OAKA 3HE4B 1J2JB 3D71A 2P10A 3H25A 3L71J 1LTGC 2AXCA 2M8RA 2P58A 2OYIA 2ZVNB 3CC2P 1YI2P 3JCUE 4YXDC 3HE4A 5KLVJ 1PGJA 2R3SA 3TF5A 2YKPA 3KYQA 1SQXG 1GL2A 2WSEJ 4WB4A 3FWNA 1URQB 1VQ5P 4PV1D 4WBAA 5KTBA 3CCRP 3L72E 1OVRA 2YKQA 1N73C 3JCUH 1YHQP 3B4SA 2ZT9C 4N78D 2BCCD 1LT1A 2OYHA 1SS1A 1ZXGA 3G4SP 4ZKPA 1IJDB 2E74C 1SQPJ 2H88C 1URQC 3M0DC 3BCCG 1SQQE 1YITP 2ZYAA 1OXZA 1KILE 1SQBD 4GIFA 3WMM0 5AW2B 1MFZA 2A45H 3O8ZA 4GKGA 1RF0C 1SQVJ 1NTMJ 5TISE 1FE6A 2VRSA 1J1EC 2WT7A 3NFQA 1NTKD 3M91A 5CCHA 1FDIA 2WSFH 3MD0A 2GUSA 1X79B 4YTPC 3PH0A 3H6PA 4W7YA 1N7LA 1KQGB 3C1LA 1UIXA 1NVOA 1QLED 2V7QJ 2E5TA 2QJKB 3S1KA 2KOGA 3TDKA 4DJGA 3HTKB 1GL2D 5K5GB 1PZQA 5CJ0A 2O1JA 1N86A 4I7ZB 1Q82Q 3KPEA 1JY2N
chains in the Genus database with same CATH topology
5TISH 4UB6H 4IL6H 5B66H 5H2FH 3JCUH 4UB8H 3KZIH 5GTIH 4PJ0H 1S5LH 5KAIH 5KAFH 2AXTH 3A0BH 3A0HH 5GTHH 3WU2H 5E79H 5B5EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS H;  4UB6 H;  4IL6 H;  5B66 H;  5H2F H;  3JCU H;  4UB8 H;  3KZI H;  5GTI H;  4PJ0 H;  1S5L H;  5KAI H;  5KAF H;  2AXT H;  3A0B H;  3A0H H;  5GTH H;  3WU2 H;  5E79 H;  5B5E H; 
#chains in the Genus database with same CATH topology
 1ZR2 A;  1R5S A;  2W83 C;  3MHV A;  5AVT B;  3CXH I;  1RY3 A;  2FYU J;  3IF4 A;  1FZC B;  1ZRT D;  4KHX A;  4Y99 B;  4OGQ B;  2B87 A;  3R2P A;  4I7Z C;  3H1K J;  3L73 E;  3RL0 B;  3TGU E;  2AXT E;  1W2E A;  2RKL A;  3MUD A;  1LWU C;  4MN4 C;  1VF5 D;  3CXH D;  3Q5R A;  5CCH D;  2HLO A;  1FZC C;  3AE2 C;  5BVZ A;  1T3U A;  2ZVO B;  1X8Y A;  4OGQ C;  2Q6Q A;  5KAF E;  5CCG C;  1L4A C;  3GHG B;  2QG4 A;  3S9O A;  2I1K A;  3RGU A;  2AXT H;  1TU3 F;  2WIT A;  1Q81 Q;  1BGY J;  4Z1M H;  1GU5 A;  1N7S A;  4N6J A;  2R32 A;  1NTZ D;  2KSJ A;  5KJ7 A;  5AW7 B;  3F5H A;  5CJ4 A;  3L74 D;  2Z5I A;  3FWL A;  5APU A;  2IZ1 A;  1KN7 A;  3GHG C;  4U3F G;  2Y0D A;  2C9N Y;  1KYO I;  1HF9 A;  1G2C B;  1HGZ A;  3O6Q A;  3NXS A;  3TNU A;  2M5A B;  2NPS C;  5KLV D;  1YQ4 C;  1K73 Q;  1G1J A;  3G71 P;  4ZKU A;  1Q90 D;  1FBM A;  1LTB C;  3L36 A;  5H2F H;  3TSI A;  1BSH A;  3H1I E;  2QEX P;  2PFX A;  4JF7 A;  5C39 A;  4I6M C;  3H32 B;  1L0N J;  4JPZ B;  4PD4 I;  3P8C D;  1JY3 N;  3L75 G;  4IL6 E;  2MKV A;  4A7P A;  3H1H G;  2YNY A;  4EIJ A;  3CX5 E;  1U57 A;  1M8O B;  1SQP D;  2WPV B;  1H0T A;  1KB9 I;  3AEA C;  3RK3 D;  1ZR4 A;  3CL3 D;  1NU1 K;  1KZU B;  1N7S D;  2GM4 A;  1PP9 G;  3I56 P;  4AYC A;  2BAS A;  4PD4 D;  1WRG A;  4H0L C;  5KJ7 D;  4IL6 H;  1SQV D;  1GW4 A;  3VOP A;  2HFE D;  3CX5 H;  2KK7 A;  1K05 A;  2AEF A;  5EFW B;  1KB9 E;  3L72 J;  2BEZ F;  3R4Y A;  5KLI B;  3D6Z A;  2FYZ A;  3V4W A;  1HJ0 A;  1MV8 A;  1QX8 A;  4C7R A;  1AVO A;  1YJN P;  1K04 A;  4LC1 A;  1SFC D;  1IC2 A;  1P84 I;  3WUV A;  3M9B A;  1BCC E;  2WSF J;  1DD4 A;  2N9B A;  4H44 D;  1SQQ J;  1IO4 A;  1IFN A;  5BU8 B;  1PV3 A;  2QRX A;  3ITK A;  1A02 J;  5AVX B;  4BRY A;  3KHU A;  1LNQ A;  2ZJS E;  1FJP A;  1USD A;  1SQB K;  2QM7 A;  1LTJ A;  1IFP A;  1PP9 E;  1P84 D;  2FYU D;  3IN6 A;  1KQS O;  2H7H A;  1EZV E;  3B5N C;  2N1T B;  2FFD A;  4NPD A;  2RMZ A;  2LKM A;  3CWB G;  3H1K D;  3RK2 C;  4LLH A;  5CHX A;  2K9J A;  3V2R A;  5AVR B;  4DZO A;  3L4F A;  4C7N B;  1PPJ D;  3FGA D;  5AW6 B;  3MIW A;  5B66 E;  3H1J G;  2XDJ A;  1JO5 A;  1BE3 G;  1VQ6 P;  3KZI H;  4WY4 C;  1M1J C;  3L70 E;  3JSV C;  3AEE C;  3OA7 A;  1RF1 A;  4R4L A;  5TJH A;  1NO4 A;  1OIP A;  3AE4 C;  1CSB A;  3CCE P;  1BGY D;  1RQV A;  5B66 H;  1T2K D;  4GT1 A;  4EDF A;  2IBZ I;  3ABV C;  1EDJ A;  1CI6 B;  1AV1 A;  1NHL A;  3VMX A;  2IX7 C;  4L74 A;  1R5L A;  1VQO P;  3AE7 C;  3JC2 2;  3L73 J;  1GK6 A;  2H89 C;  3TGU J;  1HTL C;  2QE7 H;  3CWB E;  1NU1 G;  2W6B A;  5AVW B;  2IBZ D;  3M9H A;  1K8A Q;  1ZME C;  4JBZ A;  1FOS F;  3P32 A;  1S5L E;  3SWF A;  3A3Y B;  3SWY A;  2R5B A;  1ZOY C;  1AQT A;  4JQ0 D;  1JTH B;  2OTL P;  3HD7 A;  5AW4 B;  1KIL A;  1QVG O;  1DX7 A;  1NAY A;  2B88 A;  2QIW A;  1Q7Y Q;  1L0N D;  5APY A;  2FKW B;  2OYI B;  4DT0 A;  4M3L A;  2KNC A;  3VMZ A;  2PGD A;  2BCC G;  1S5L H;  1JY2 O;  1NTZ K;  3UIA A;  3AEF C;  2LR2 A;  5APQ A;  1LJ2 A;  1OWA A;  1H89 A;  1GL2 B;  4I2L C;  2E75 C;  3USS A;  2A45 I;  4Y28 J;  3A7O A;  3AEC C;  1RE4 A;  1SQB G;  4H13 D;  1X0T A;  2ZYG A;  1PIX A;  1OW7 A;  3NMD A;  4TT3 H;  1OW6 A;  5KLV K;  1S3J A;  2HR3 A;  1OVU A;  3E1R A;  1FJK A;  2OYH B;  3H1I J;  1D7M A;  1LTA C;  3CME P;  3VYI A;  4D6T J;  3TYY A;  3A0B E;  1FU1 A;  1HGV A;  2WZ7 A;  5AW8 B;  2DW3 A;  4GOD A;  4B86 A;  2D2C B;  2QM8 A;  1L2P A;  1J1D B;  3H1L E;  1LTT C;  2K37 A;  3ZDM A;  1S72 P;  2JKV A;  3HD7 D;  2WT7 B;  2Y0C A;  3M0D A;  2BCC E;  1KIL D;  2Q9I A;  1FZG A;  1SQP K;  3A0B H;  2JDI H;  2GUV A;  2D2C C;  2YXR B;  2JWA A;  3KQG A;  1RF0 A;  3LW5 H;  3I55 P;  3CCM P;  3CLQ A;  2IDB A;  1J1D C;  4RES B;  1IK9 A;  1SQV K;  1SQX E;  3CCQ P;  3GLM A;  4ASW A;  3B71 A;  2O01 N;  4HJG H;  2B9B A;  1YYC A;  2YXQ B;  1EDL A;  2RH0 A;  1BCC J;  2NZ2 A;  2Q7C A;  3B8E B;  1FDM A;  3V2P A;  2O3J A;  3BAT A;  1JUN A;  4IFF A;  2HG5 D;  1LTI C;  1VQL P;  3BCC E;  1PGQ A;  4DCK A;  2B87 B;  2E42 A;  2QJK C;  1NWQ A;  2ZT9 D;  2W90 A;  3WUU A;  1JY3 O;  5L8R J;  1PP9 J;  3AEG C;  1WT6 A;  2QJY B;  5AW9 B;  1Q86 Q;  2CK3 H;  2PP6 A;  2E74 D;  1S1C X;  3CC7 P;  1NTZ G;  3L73 D;  1FS0 E;  3HUS A;  2Q5U A;  3P8M C;  2FYU K;  5AVY B;  3L74 G;  2H8P D;  3TGU D;  1KQL A;  3GMA A;  2WTY A;  2IYO A;  1ZRT E;  5APX A;  5B5E E;  4L73 A;  1LWU A;  1DIP A;  1L0L D;  2ZXE B;  4Y99 C;  3MUD C;  1N2D C;  3L70 J;  3FX0 A;  3RK3 B;  3RL0 C;  5KLV G;  3BRT B;  1N7S B;  2OTJ P;  2KZI A;  3WU2 E;  2LXC B;  3C8V A;  5GTH H;  1L4A A;  2R3C A;  3EQ2 A;  5B5E H;  1M57 D;  2FXO A;  2YMK A;  2YO2 A;  2JWD A;  2O01 H;  2UWJ E;  3D70 A;  1S9K E;  3O6Q B;  3KDP B;  1N7S C;  3TNU B;  3WU2 H;  5KJ7 C;  3WUT A;  3CWB J;  2HOD A;  2KI7 B;  1NTZ E;  5H2F E;  1SQP G;  3L71 D;  1SFC B;  4PJ0 H;  1JMM A;  3FXD A;  1EDI A;  3Q5S A;  5AVU B;  4BXL A;  2NPS A;  1SFC A;  3CX5 I;  1SQV G;  2N9Y B;  2OYO A;  2P7J A;  1KYO D;  4OH8 B;  3H1I D;  2KSE A;  4D6T D;  1EC5 A;  2YIU B;  4TLF A;  2IZ0 A;  5APS A;  1H0T B;  2Y9Z A;  2C0X A;  3LID A;  3CX5 D;  1NOH A;  1M56 D;  1L0N K;  1L4A D;  1MFT A;  1PGP A;  2XU6 A;  1KFN A;  3AEB C;  4CPG A;  4U3F E;  4IL6 X;  1MUU A;  3TK1 A;  1NTM D;  3EWK A;  2B89 A;  5AVV B;  3GG2 A;  2YKO A;  1NYH A;  2W8Z A;  1KB9 D;  2FYU G;  4NPF X;  3MP7 B;  4C46 A;  2WSC H;  3H1K G;  3VP8 A;  2NPS D;  2PAJ A;  4DOJ A;  1PPJ G;  4EI2 A;  2FXP A;  3H1L J;  4HB1 A;  4GOF A;  1BCC D;  2FYN B;  4BRY B;  3L75 E;  1EZV I;  1LP1 A;  2Q1K A;  3VMA A;  3CCV P;  3H1H E;  3G9R A;  2BCC J;  1LTJ B;  5KLI C;  3SSU A;  1UII A;  4YXW H;  2FFD B;  1YTZ T;  1IFD A;  2K9J B;  3IR9 A;  2ITA A;  1PP9 D;  1IZN B;  2FYN C;  2KXP B;  1EXI A;  1VQ9 P;  1EZV D;  3KZI E;  1NKZ B;  5AVQ B;  1SQX J;  3B5N A;  1R8E A;  1VL2 A;  1SLQ A;  1NTK K;  1LTJ C;  2KS1 A;  1E5W A;  3MTU E;  2JR8 A;  1KMI Z;  2KLV A;  4H0L D;  1RF1 B;  1NH4 A;  4QMA A;  2IBZ G;  2LXB A;  2N1T C;  3Q2Y A;  3T97 A;  1DH3 A;  1N8R Q;  1PPJ E;  3L70 D;  4WY4 A;  1QEX A;  2E76 D;  4RO0 A;  3II6 A;  2ZYD A;  2XV5 A;  3BCC J;  2KZJ A;  2KYV A;  1YQ3 C;  1RE3 C;  4H13 B;  1U7M A;  4XA4 A;  3U1C A;  1JY2 P;  4XFJ A;  1YBK A;  3OW2 O;  2Z5H A;  4PV1 B;  3A0H H;  4OWF A;  1YJW P;  2QSI A;  1L0N G;  2E43 A;  4UB8 E;  5AVS B;  1WMK A;  1ZV8 A;  1M1K Q;  5CBN A;  4L75 A;  2A06 D;  1T3J A;  2FXM A;  4PV1 C;  5KKZ B;  3H1J E;  2WQY C;  3B5N D;  2J59 M;  3HD7 B;  1KIL B;  1BE3 E;  1L0L K;  3FXE A;  4UB8 H;  1FZF A;  1CZQ A;  3RK2 D;  2W27 A;  3V2N A;  1AA0 A;  2QJP B;  4KT0 J;  2R5D A;  1GDT A;  2KNC B;  3V6I A;  2H43 A;  1LT9 A;  2XND H;  2Q3I A;  2OGU A;  3P7K A;  3S4R A;  5KKZ C;  2AEM A;  1S5L X;  4K3A A;  1YJ9 P;  4L76 A;  3PJS K;  4WY4 D;  3CPW O;  2G3A A;  4W7Z A;  3G6E P;  1NGM B;  1MZ9 A;  1NTZ J;  1IFJ A;  3PHL A;  1AJY A;  1W5C E;  2OAR A;  3KXD A;  1NU1 E;  2ZXX A;  3CCJ P;  2OYI C;  5M1B A;  2HPC A;  4EYY Q;  2M0B A;  4BWN A;  4UB6 E;  3N7N A;  1RE4 C;  1N73 B;  1QGK B;  1NTK G;  2ZT9 B;  3U1A A;  3L72 D;  1DEB A;  2XKM A;  1GL2 C;  3RBZ A;  1N73 A;  1Z56 A;  2E74 B;  2K3R A;  3K5B A;  3G3Z A;  4GOE A;  1GMJ A;  4AQR D;  1AFO A;  1S2E A;  4RJT A;  1VQ8 P;  1LTS C;  4O9B A;  2W6A A;  2JP3 A;  3M9Q A;  4UB6 H;  3H1L D;  1YIJ P;  3PP5 A;  4XE5 B;  1OW8 A;  2W6J H;  1JY3 P;  2FY8 A;  1URQ A;  2ZFC A;  4N78 E;  1SQQ D;  2OYH C;  2QVA A;  1VF5 B;  2JJL A;  3IFM A;  3MGN A;  4U3F J;  5APV A;  1VQK P;  4W80 A;  1J1E B;  1EQ7 A;  2WSC J;  1FAV A;  2J5U A;  3PRJ A;  1SQB E;  1NTM K;  3E1I A;  2CPB A;  1VF5 C;  1SQX D;  2XZR A;  2HYN A;  5CCH C;  5CMZ A;  1A02 F;  2P67 A;  3L73 G;  4WVZ A;  1NTK E;  2KLU A;  1NKN A;  2E75 D;  4HYT B;  1KFM A;  1HH0 A;  3TGU G;  2Y9Y A;  1HVV A;  4AUW A;  3L75 J;  2IPP A;  3H1H J;  1L0L G;  1QL2 A;  5TIS H;  1KQF B;  1JOC A;  4K35 A;  2J58 A;  3BCC D;  1JM0 A;  2NRG A;  3HUS B;  1QVF O;  1VDF A;  1Y9B A;  3L37 A;  2AEJ A;  3Q5P A;  3HTK A;  2QA4 P;  1URQ D;  3SFD C;  1LWU B;  2E5Y A;  5AVZ B;  3Q1M A;  4GDO A;  5GTH E;  3L35 A;  2I8D A;  1PFI A;  2WMM A;  3HUS C;  2K88 A;  3VTP C;  2D2C D;  2M3B A;  3CI9 A;  2QJY C;  1VPC A;  1HUC A;  3L71 G;  2P1J A;  3BAS A;  3OJA B;  5APW A;  2K1A A;  1L4A B;  2KUB A;  1NAF A;  1FZC A;  4IFM A;  1GU4 A;  1AQ5 A;  3NTN A;  3LIE A;  3A5T A;  3CXH E;  1QL1 A;  5CCG A;  1DEE G;  3CC4 P;  1L0L E;  4N3Y B;  4EOT A;  1PL5 A;  2M3E A;  5DJT B;  4LGD E;  2IFM A;  2MJZ A;  4PJ0 E;  3H1I G;  4HKZ H;  1S4X A;  2HOD B;  4D6T G;  3CMA P;  3RK3 C;  1NJI Q;  1VQM P;  1S9K D;  2ZAE B;  1JEK A;  2OTK E;  3CXH H;  1EXJ A;  3GHG A;  1X22 A;  3A2A A;  2NPS B;  1T8Z A;  3SWK A;  3L74 E;  1BDC A;  3AE6 C;  3VN0 A;  5KAF H;  2FBW C;  3D6Y A;  1RQU A;  1RHZ B;  1GTW A;  3H1J J;  4H44 B;  1G1I A;  1U7J A;  1BDD A;  3W67 A;  2WWW A;  2POH A;  1BE3 J;  1ZN5 A;  4NPE A;  3L71 E;  2KIK A;  2IYP A;  1NTM G;  1KOR A;  2P2U A;  1T6A A;  5KLV E;  4I1L A;  4YPC A;  1SFC C;  4IFD K;  1G2C A;  4HH2 A;  1JCC A;  2M5A A;  4H44 C;  1FC2 C;  1MKM A;  3CCL P;  1BSN A;  4OGQ D;  1ZLL A;  3AE3 C;  3E7K A;  1IFM A;  1KYO E;  3HE5 B;  2IFN A;  1OFC X;  2V4H A;  3RL0 D;  5CCG D;  4D6T E;  1GD2 E;  1BCC G;  3P8C E;  4H0L B;  1PGO A;  3V5B A;  4ASV A;  3HE5 A;  2XNX A;  4U3F D;  2YIU C;  1AVY A;  3GW6 A;  1NU1 J;  1XTC C;  2KP8 A;  2G8Y A;  2WSE H;  1SQP E;  4OVN F;  3BVH A;  3AE9 C;  3H32 A;  3EFG A;  1KYO H;  2E76 B;  2Q3E A;  3RK3 E;  1CW5 A;  1HBW A;  3VMY A;  1LGH B;  3W68 A;  1XTG B;  4PD4 E;  1EZV G;  1USE A;  2KB7 P;  1SQV E;  1NTM E;  3CCS P;  1LP1 B;  2Y0E A;  5BU5 A;  3LW5 J;  1HWT C;  3EFF K;  2E76 C;  3MZW B;  1SVF A;  3L75 D;  2PRR A;  3HRN A;  3N4X A;  1T2K C;  4PD4 H;  3H1H D;  1OX3 A;  1W2B O;  3AE1 C;  1H88 A;  2R44 A;  3AE5 C;  1IK7 A;  4IOI H;  3L70 G;  3AE8 C;  2SPZ A;  2WVR A;  1SQQ K;  2WPS A;  3B5N B;  1OVV A;  1KB9 H;  5DJU B;  3RL0 g;  1ZW0 A;  1K9M Q;  2KS1 B;  1BGY G;  1JCD A;  3PTZ A;  3M06 A;  1Y47 A;  1SQB J;  3I5C A;  3RK2 B;  1KTM A;  5AW5 B;  1VQ4 P;  1RH5 B;  1JNM A;  1VQ7 P;  2RN0 A;  2V7Q H;  3GF3 A;  2WPR A;  1NTK J;  2BEQ D;  5AW0 B;  1YTZ I;  1P84 E;  3CCU P;  1H8A A;  2FYU E;  3T97 B;  2FFD C;  1FZB A;  1SQX K;  4WY4 B;  1M1J B;  3H1K E;  1X9V A;  2O1K A;  2CPS A;  2YO3 A;  3A0H E;  2A06 G;  2OQQ A;  3PLN A;  2WPQ A;  1ZP0 C;  5E79 E;  2N1T A;  1M1J A;  3Q3D A;  2GA1 A;  1P84 H;  2WSS H;  4C7N A;  1GZL A;  2C9L Y;  5KAI E;  1DD3 A;  1RF1 C;  3CD6 P;  1RE3 A;  5AW3 B;  4ZNC A;  4JYB A;  1HJB A;  1OZH A;  3GF7 A;  1GK4 A;  5E79 H;  3AED C;  1BGY E;  1KV4 A;  4RKU J;  3F89 A;  2L91 A;  1E79 H;  4R4M A;  2YMY A;  4ZMD A;  2Z4E A;  4H13 C;  3CWB D;  3V2Q A;  5KAI H;  1EDK A;  2JO1 A;  1FZA A;  1OMI A;  1FDO A;  3M0A A;  1IFI A;  1CI6 A;  2K9Y A;  4KJM A;  1FOS E;  1JMB A;  3U59 A;  2C0W A;  3H1J D;  1VQP P;  2O01 J;  5GTI E;  4U7J A;  1BE3 D;  2IBZ E;  4JYC A;  3BRV B;  1LT9 B;  2A06 E;  1L0L J;  1GW3 A;  3SFE C;  5AW1 B;  5APT A;  1Y8A A;  2L5G B;  3V4Q A;  3L72 G;  2I1J A;  3QH9 A;  1SP4 A;  1Q2N A;  1M90 Q;  3RBX A;  2A45 G;  3HD7 C;  2N1T D;  5GTI H;  1VQN P;  1KC8 Q;  1KIL C;  1JB0 J;  1LT9 C;  3IAO A;  3C9I A;  2QJP C;  3VP9 A;  1KD1 Q;  2E75 B;  3QWO C;  2HPC B;  3H1L G;  1L0N E;  5CBO A;  1FZE A;  3L74 J;  1JTH A;  2JEE A;  1SQQ G;  4WWI A;  1M7L A;  1NU1 D;  3OAK A;  3HE4 B;  1J2J B;  3D71 A;  2P10 A;  3H25 A;  3L71 J;  1LTG C;  2AXC A;  2M8R A;  2P58 A;  2OYI A;  2ZVN B;  3CC2 P;  1YI2 P;  3JCU E;  4YXD C;  3HE4 A;  5KLV J;  1PGJ A;  2R3S A;  3TF5 A;  2YKP A;  3KYQ A;  1SQX G;  1GL2 A;  2WSE J;  4WB4 A;  3FWN A;  1URQ B;  1VQ5 P;  4PV1 D;  4WBA A;  5KTB A;  3CCR P;  3L72 E;  1OVR A;  2YKQ A;  1N73 C;  3JCU H;  1YHQ P;  3B4S A;  2ZT9 C;  4N78 D;  2BCC D;  1LT1 A;  2OYH A;  1SS1 A;  1ZXG A;  3G4S P;  4ZKP A;  1IJD B;  2E74 C;  1SQP J;  2H88 C;  1URQ C;  3M0D C;  3BCC G;  1SQQ E;  1YIT P;  2ZYA A;  1OXZ A;  1KIL E;  1SQB D;  4GIF A;  3WMM 0;  5AW2 B;  1MFZ A;  2A45 H;  3O8Z A;  4GKG A;  1RF0 C;  1SQV J;  1NTM J;  5TIS E;  1FE6 A;  2VRS A;  1J1E C;  2WT7 A;  3NFQ A;  1NTK D;  3M91 A;  5CCH A;  1FDI A;  2WSF H;  3MD0 A;  2GUS A;  1X79 B;  4YTP C;  3PH0 A;  3H6P A;  4W7Y A;  1N7L A;  1KQG B;  3C1L A;  1UIX A;  1NVO A;  1QLE D;  2V7Q J;  2E5T A;  2QJK B;  3S1K A;  2KOG A;  3TDK A;  4DJG A;  3HTK B;  1GL2 D;  5K5G B;  1PZQ A;  5CJ0 A;  2O1J A;  1N86 A;  4I7Z B;  1Q82 Q;  3KPE A;  1JY2 N; 
#chains in the Genus database with same CATH homology
 5TIS H;  4UB6 H;  4IL6 H;  5B66 H;  5H2F H;  3JCU H;  4UB8 H;  3KZI H;  5GTI H;  4PJ0 H;  1S5L H;  5KAI H;  5KAF H;  2AXT H;  3A0B H;  3A0H H;  5GTH H;  3WU2 H;  5E79 H;  5B5E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...