3A0HH

Crystal structure of i-substituted photosystem ii complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 13
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3a0hH01
5GTIH 3KZIH 3JCUH 4IL6H 4PJ0H 3WU2H 4UB8H 1S5LH 5GTHH 5E79H 5KAIH 5B66H 5H2FH 4UB6H 5B5EH 2AXTH 5KAFH 3A0BH 3A0HH 5TISH
chains in the Genus database with same CATH superfamily
2KUBA 1FZEA 1BSNA 1LP1A 3HD7D 5AVRB 1YHQP 1Q82Q 2R5BA 2ZT9D 3N4XA 3HUSA 3OA7A 1KV4A 1NU1K 1SQBG 2GA1A 4N3YB 2H43A 1GD2E 5APVA 1LTTC 1JTHB 3HD7C 4U7JA 1KQFB 3CMAP 3G9RA 3KZIE 3MD0A 3D70A 5E79E 1KILB 1M8OB 1YYCA 1AQ5A 3OW2O 3E1RA 3EWKA 2E5TA 1L4AA 4PD4D 2OTJP 1NU1D 1KILA 3A2AA 2N9YB 4WVZA 5AVQB 3CCUP 1N7LA 4RESB 2YKQA 1SQVE 1SFCC 3TYYA 2LXCB 3CMEP 3A0HE 2IFNA 1USDA 3L4FA 1GU5A 1AQTA 5KJ7D 4LC1A 5C39A 3HUSB 3H1HE 4JPZB 3EFFK 4NPEA 4OH8B 5KLVJ 2WSCJ 1LT1A 2M0BA 3C9IA 1NJIQ 2YIUC 3CL3D 5CCHA 1T3UA 1RQVA 2O1JA 4H13D 2CK3H 4M3LA 4IFDK 5B66E 1HWTC 4I7ZC 3SWYA 1FAVA 1GW3A 1G2CA 3H1JG 3MHVA 3V2NA 3L74J 4IOIH 3H1LJ 1HJ0A 2XKMA 3H1KD 2D2CC 2HG5D 1CW5A 3SWFA 2NZ2A 1NTMD 2WPQA 3OAKA 4R4MA 3L72D 4U3FE 2KOGA 3AE5C 4C7NB 1HH0A 3PTZA 3NMDA 2IYPA 1RF0A 4H44C 3MP7B 1VQ8P 3H1JE 3JCUE 1ZRTE 1KB9H 1N86A 2HODA 3MTUE 3A5TA 1QL1A 2KYVA 3H25A 3CCRP 1OW7A 1FS0E 1OZHA 2DW3A 2QJPC 1IFDA 2IX7C 3FGAD 1NU1G 1SQPK 2ZXEB 1S2EA 5BU8B 2P1JA 4W7YA 2E76C 5AW8B 1FZAA 5CBOA 2WPRA 2WQYC 1SQBE 2K37A 3CCMP 1IK9A 4C46A 1PFIA 3CCEP 2KS1A 1KILC 2B89A 1SQVJ 3CD6P 4LLHA 1NTZE 1ZW0A 2A06G 2QRXA 3MUDC 2BCCJ 2N1TD 3K5BA 4GT1A 2JP3A 1NTMG 3CCSP 2B88A 5APSA 2YO2A 1GMJA 1QL2A 1N73B 1MUUA 3AEBC 1EDIA 3L73D 4YTPC 5M1BA 1KB9D 5AW5B 1N73A 1FZCB 3TK1A 1N7SA 1K04A 1NU1J 1URQA 3WUUA 2PFXA 2NPSA 2IBZE 2YKPA 1AVYA 1SQQG 3O8ZA 3CCVP 4I7ZB 3S4RA 5KLIB 1MFTA 2WT7B 2E75D 2KS1B 2P10A 2Q3IA 5AW2B 1RF1B 1LJ2A 3L71E 3RBXA 4N78D 3L75E 3G3ZA 3G71P 4L74A 1BE3D 3TGUE 2YO3A 1J1DC 1OWAA 3RL0D 2JWAA 3L35A 2Y0CA 5KTBA 3L74D 5AVSB 1Y8AA 2YXQB 1EQ7A 2RMZA 1M90Q 3CX5H 2Z5IA 2JEEA 1LTJA 3R4YA 5GTHE 1KFMA 1PP9E 1QX8A 2VRSA 1NTMJ 3CWBG 3CXHH 3B5NA 3II6A 2JJLA 1N2DC 3RK3D 4DJGA 1FDMA 4ZKPA 2HLOA 3AECC 1KB9E 1GL2D 1MKMA 2PP6A 3GMAA 1UIIA 2QJPB 3HE4A 3VMAA 1YJNP 3RL0C 1U57A 2Y0DA 3BASA 5AVWB 2BCCD 2G3AA 3H1IJ 1M56D 1EZVG 4K35A 3D71A 2LKMA 3G6EP 1CI6B 2I1KA 4W80A 4AQRD 2P67A 1OFCX 1JCCA 3KXDA 1BCCJ 1X0TA 5APWA 2FFDB 1YIJP 1JNMA 1MFZA 1EXIA 2ZYAA 5GTHH 3N7NA 3T97B 1EZVI 5CJ4A 4PD4E 1GL2C 1SQPE 1ZN5A 2KSJA 5APXA 3RK3E 3RL0g 3CC2P 3L37A 4CPGA 1KTMA 1L0LJ 4L76A 5DJUB 1Q2NA 1AV1A 1CSBA 2W8ZA 5KJ7C 1HUCA 1NTKK 1Q7YQ 2IBZG 3F5HA 1NTMK 3NFQA 1LTJC 1GZLA 1S72P 1LTAC 1IK7A 1KC8Q 2Z4EA 3I55P 1L0NG 2R3CA 1PPJG 5TISE 3AE4C 1NTKD 4Y99B 1OMIA 5B5EH 1E5WA 3PP5A 1JTHA 2JO1A 3H1KJ 3KQGA 2JR8A 2IFMA 1HVVA 1J1DB 4PV1C 4D6TJ 2V7QJ 3CWBE 3B5NC 1LP1B 3GW6A 1FZFA 2JKVA 3JCUH 3H32A 1PP9D 3MUDA 3B71A 3U1AA 1VQ9P 4GIFA 2E42A 1JY3P 1KILD 4RJTA 1LWUC 5AW4B 1CI6A 4DCKA 3EQ2A 2KNCB 4WY4C 2QEXP 1FBMA 1SQBK 3M91A 3I56P 1LTBC 4A7PA 2IZ0A 3PJSK 1AFOA 1K8AQ 4TT3H 1SQXJ 2E76D 2FFDC 1VQNP 1EDLA 1BE3E 2KI7B 3TGUD 3AE9C 3HE4B 3TGUJ 2WSEH 1JEKA 1EDKA 4UB6H 1SQQJ 5APQA 3CX5D 3IR9A 1R5SA 2Q9IA 1DX7A 3JSVC 4AUWA 2QJYB 3BCCJ 3AEFC 1H88A 1VF5C 2O01H 2QJKB 1VQOP 2KK7A 4JQ0D 4BRYB 2N1TC 2M5AB 3L73E 1GW4A 1FZGA 5AW9B 4L75A 2WT7A 4YPCA 1IJDB 4KHXA 1QGKB 2WWWA 2Y9YA 1DD4A 2A45G 1P84E 1WMKA 2NPSB 3CWBJ 3GF3A 4H0LC 1N7SB 3GHGB 3KHUA 4K3AA 5CMZA 4OGQC 3V5BA 1BE3J 2FXOA 5KLVG 1W2BO 1FZCA 4N78E 2WMMA 2CPBA 3LIEA 3H1KG 5CCHC 3VMZA 3L74E 3D6ZA 1EZVE 3CX5I 3U59A 1R8EA 1DIPA 2K3RA 2V7QH 2AEMA 3H1JD 3CXHI 3L72J 1M7LA 1NU1E 4WY4A 4LGDE 1EXJA 2E43A 1FE6A 1T8ZA 2HR3A 3CCJP 1MV8A 1AVOA 1SQXD 2C0WA 2FYUG 2QM7A 3WU2E 3L70E 2R32A 5CHXA 4ASWA 1KILE 1N73C 2H7HA 3LIDA 1N8RQ 3RBZA 1Q81Q 5GTIE 1X22A 1L0NK 3OJAB 1S9KD 1NTZJ 2KZIA 1URQD 2QVAA 1SQXK 2XNXA 5KKZC 1ZMEC 1VQLP 1LGHB 1Q90D 1QLED 3A0BE 3M9HA 1RHZB 2C0XA 3USSA 1YQ3C 1L0ND 1BGYG 3AE6C 1SFCD 1EZVD 3CI9A 3HTKA 4PD4H 2OYIC 1NOHA 1RE4A 1JM0A 1YBKA 1SQVD 2PRRA 5KLVD 1UIXA 1VF5B 4C7NA 1HGVA 1A02J 2N1TB 4GOFA 1SFCB 4GODA 4OVNF 4TLFA 3L75J 3L73G 3MGNA 3EFGA 1G2CB 1J1EB 1YTZT 2QM8A 3B5ND 1R5LA 4L73A 3M9BA 1GL2A 4H0LB 5B5EE 2RH0A 3TSIA 3GHGC 4HJGH 1P84H 2ZT9B 2KXPB 4RKUJ 3A0BH 1DEEG 3GHGA 4H13C 3A7OA 3PH0A 1S5LX 5EFWB 2C9LY 5AW7B 1SQBD 1DD3A 3KPEA 3QH9A 3CWBD 3Q5SA 4ZMDA 3FX0A 3BRTB 4Y28J 1LT9B 1ZOYC 4YXWH 1IZNB 1BDCA 1YJ9P 2OTKE 3I5CA 4WBAA 1BCCD 2C9NY 3AEAC 5CCGA 1BDDA 1SVFA 1D7MA 2B87B 2AXTH 3Q1MA 2OGUA 3VMXA 1OXZA 3H6PA 2L5GB 3M0DC 1NTZK 1KZUB 1BGYJ 1IO4A 5APTA 3ZDMA 5K5GB 2OQQA 5KKZB 1LTGC 3G4SP 3FXDA 2HFED 1NAYA 3MIWA 3BRVB 4PJ0H 2ZYDA 1SQVG 3W68A 5TISH 1KORA 3IN6A 3Q2YA 2OYHC 2BEQD 3Q5RA 1HBWA 1NTZD 2PGDA 2KZJA 4HH2A 1L0LE 4XA4A 1USEA 1Y47A 3FWLA 5AVXB 2I1JA 3V2PA 2IPPA 2OYIB 3CC4P 3CX5E 1W2EA 1RE4C 1H0TA 1L0LG 2N9BA 3R2PA 4PD4I 5KJ7A 1OIPA 1K73Q 2FY8A 1CZQA 4U3FJ 2QA4P 3L71J 2H8PD 1Z56A 2QIWA 1KYOE 1SQPJ 3HE5A 4DZOA 3VTPC 5APYA 2FYZA 1SQXG 3LW5J 2E5YA 1YI2P 3H1HG 2E74D 2YNYA 1NTKE 4PJ0E 2ZT9C 3VYIA 2B87A 4H0LD 5KLIC 4DOJA 3H1IG 1N7SD 2SPZA 1T2KC 1VQKP 2NPSD 1RF1C 1KQGB 2HYNA 2WVRA 1FZBA 1KD1Q 1J2JB 3UIAA 1VQ6P 3H1JJ 1LT9A 2FYNC 2WTYA 2LR2A 1LT9C 2RKLA 4HB1A 1DH3A 4ZKUA 3CXHD 1LWUA 1L2PA 2WSFJ 5DJTB 3RK3C 2XDJA 2J5UA 1Q86Q 1Y9BA 3HD7A 1VQ7P 1NKNA 3BVHA 1K05A 2W90A 2ZFCA 1KFNA 4KJMA 4DT0A 2OARA 4MN4C 1NO4A 2BASA 2XV5A 2BCCE 1H89A 3RL0B 3AE7C 1SQVK 5KLVK 1S5LE 3RK2B 3T97A 3VOPA 2WSCH 3C8VA 3NTNA 3KZIH 2OYHB 3WUVA 1K9MQ 1NTZG 2A06E 1S4XA 2ITAA 4O9BA 1EDJA 2N1TA 1NTME 4U3FD 1G1IA 3PRJA 1L0LD 1BGYE 1PZQA 2W6JH 3LW5H 2K9JA 2P2UA 2YMKA 1JMMA 3RGUA 2ZJSE 4Z1MH 5CCHD 1LNQA 1ZV8A 2OYOA 1IFNA 3HUSC 3IFMA 3H1LD 1L0LK 3L73J 1BCCG 1X9VA 3B4SA 3FWNA 3M0AA 2O01N 1KYOD 4IL6X 4OWFA 4BWNA 1LTJB 3H1HD 3BATA 3M0DA 5B66H 1T6AA 2M8RA 5CJ0A 3VP8A 4JYCA 2YXRB 2V4HA 1NKZB 1P84D 1M1JB 1TU3F 3P8MC 5AVYB 4D6TD 4ZNCA 1VQPP 2HPCB 1P84I 4Y99C 1E79H 4IL6E 1RF1A 2D2CB 1EC5A 1VDFA 1PP9J 2K88A 5AVUB 1L4AD 2FXPA 2GUVA 4UB6E 4WWIA 4GOEA 3NXSA 1NWQA 3H32B 1HTLC 4H44B 1RY3A 3RK3B 2ZXXA 3L70J 3GG2A 3PLNA 3CXHE 5AW1B 1VQ5P 2M3EA 1VQMP 2A45H 2J59M 2YMYA 3BCCG 4EOTA 3CPWO 5KAFE 3B8EB 4EI2A 3KYQA 5AVTB 1M57D 1RE3C 1LWUB 2I8DA 3RK2C 1YITP 1X8YA 1FDIA 1GTWA 4NPFX 2Q3EA 2E76B 1NVOA 2Q5UA 1MZ9A 4B86A 2G8YA 5H2FH 2P7JA 4R4LA 4EDFA 3IAOA 3RK2D 3L75D 2ZVNB 2GM4A 4WB4A 1NHLA 2ZAEB 2FBWC 3O6QA 3CCLP 1RH5B 2MKVA 1BE3G 4XFJA 3A3YB 2YKOA 1OVUA 1NTKG 1DEBA 1WT6A 5APUA 5KLVE 4H44D 1BGYD 1ZP0C 2BCCG 2QJYC 2WPSA 3WUTA 3HE5B 5AW3B 1AJYA 2QJKC 1FZCC 1KQSO 1PPJE 3TDKA 3VP9A 2IDBA 3BCCD 1YJWP 1M1KQ 3CLQA 1HJBA 1YQ4C 1M1JC 4GKGA 1JUNA 3PHLA 5H2FE 2FYUJ 3H1HJ 1LTIC 2E75C 4UB8E 3S9OA 3V4WA 1U7MA 3SFEC 4D6TE 1N7SC 3E1IA 5AVVB 2AXCA 2K9YA 4I6MC 4IL6H 1BSHA 1GK4A 3L72G 3TGUG 2Y0EA 3VMYA 4U3FG 3U1CA 1JY2O 1L0NE 1ZR4A 1ZLLA 4JBZA 3SSUA 1SQBJ 5AVZB 3H1ID 1NGMB 1GU4A 2KB7P 2OTLP 3H1LE 2KLUA 1SQQE 3O6QB 2HPCA 2KP8A 3AEDC 3L70D 3CCQP 4C7RA 2A45I 1RF0C 2IBZD 3E7KA 3H1LG 1AA0A 1L4AB 2H89C 3KDPB 1IFMA 1S5LH 3V2RA 1SLQA 1OVVA 2D2CD 1FOSF 3L71D 1URQC 2XZRA 2LXBA 2ZYGA 1KQLA 2AEJA 3FXEA 2FKWB 2A06D 3C1LA 1PGPA 5AW0B 4EYYQ 4EIJA 5GTIH 1JMBA 3AE8C 2E74C 2NRGA 4IFFA 3AE3C 1A02F 1GDTA 3MZWB 1GL2B 3V6IA 3AE2C 2H88C 4IFMA 1NAFA 2KSEA 5L8RJ 3VN0A 3M06A 4HKZH 3CC7P 2RN0A 1JB0J 3SFDC 2FFDA 1KN7A 4YXDC 1NTKJ 1SFCA 1VL2A 2KLVA 3A0HH 2Q7CA 2QE7H 1KYOI 1SQXE 2O01J 1JY3N 5KAIE 2IBZI 3TNUA 2XNDH 3P7KA 4QMAA 1J1EC 4XE5B 1M1JA 3W67A 1IFIA 1JY2N 1ZR2A 2PAJA 1XTGB 1X79B 3HTKB 3TF5A 2E75B 1G1JA 1JY3O 1S1CX 1W5CE 3F89A 4RO0A 3AE1C 1NH4A 2WSEJ 1OW6A 1SQPG 2QSIA 2O3JA 3L74G 4PV1B 2QG4A 1FDOA 2CPSA 3L71G 3B5NB 3L75G 2UWJE 3AEGC 4H13B 3L72E 1IFPA 2JWDA 2W83C 3SWKA 1PGQA 2B9BA 2K9JB 4WY4D 1VQ4P 1RQUA 2J58A 2IYOA 2P58A 3IF4A 4HYTB 3V2QA 2WSSH 1FU1A 4N6JA 3S1KA 3P8CD 2O1KA 3V4QA 4AYCA 1VF5D 2Z5HA 1LTSC 1IFJA 2KIKA 2XU6A 1KB9I 3L70G 2W6BA 3Q3DA 1IC2A 3BCCE 3GF7A 2JDIH 4W7ZA 4WY4B 1L4AC 2OYHA 5KAIH 1WRGA 1U7JA 1FOSE 1JO5A 2POHA 1JY2P 4PV1D 5CCGD 1URQB 2GUSA 4GDOA 2ZVOB 2AEFA 2IZ1A 2WPVB 3ITKA 1PGJA 2L91A 1SQQK 2E74B 3D6YA 1PL5A 5BVZA 3JC22 3HD7B 5E79H 5CCGC 4NPDA 1JCDA 4KT0J 1VPCA 1L0NJ 1QEXA 2R3SA 3H1IE 3M9QA 4I2LC 1PV3A 1FJKA 3P8CE 1SQPD 2FYUK 1SQQD 1YTZI 2WZ7A 3L36A 5BU5A 4JF7A 2K1AA 2FXMA 3Q5PA 3AEEC 1BCCE 2M5AA 4BRYA 1ZRTD 1OX3A 2WSFH 5CBNA 1JOCA 1PPJD 3WMM0 1SS1A 2FYUD 2BEZF 5KAFH 1PGOA 1HF9A 1KYOH 2Q6QA 1OVRA 1RE3A 2YIUB 2NPSC 3ABVC 1S9KE 1QVFO 4UB8H 2MJZA 2R44A 1T3JA 3P32A 2WITA 4OGQB 2W6AA 3H1KE 1T2KD 4OGQD 1QVGO 1PP9G 2HODB 1OW8A 2W27A 1KMIZ 1HGZA 1FC2C 2R5DA 4JYBA 5TJHA 5AW6B 1S3JA 4D6TG 1SP4A 2FYNB 1H8AA 1H0TB 1PIXA 3HRNA 3TNUB 2KNCA 2Q1KA 1ZXGA 2OYIA 3WU2H 4ASVA 1GK6A 3GLMA 4I1LA 3QWOC 2Y9ZA 2M3BA 1XTCC 4BXLA 1FJPA 2FYUE 2AXTE 1NYHA
chains in the Genus database with same CATH topology
5GTIH 3KZIH 3JCUH 4IL6H 4PJ0H 3WU2H 4UB8H 1S5LH 5GTHH 5E79H 5KAIH 5B66H 5H2FH 4UB6H 5B5EH 2AXTH 5KAFH 3A0BH 3A0HH 5TISH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI H;  3KZI H;  3JCU H;  4IL6 H;  4PJ0 H;  3WU2 H;  4UB8 H;  1S5L H;  5GTH H;  5E79 H;  5KAI H;  5B66 H;  5H2F H;  4UB6 H;  5B5E H;  2AXT H;  5KAF H;  3A0B H;  3A0H H;  5TIS H; 
#chains in the Genus database with same CATH topology
 2KUB A;  1FZE A;  1BSN A;  1LP1 A;  3HD7 D;  5AVR B;  1YHQ P;  1Q82 Q;  2R5B A;  2ZT9 D;  3N4X A;  3HUS A;  3OA7 A;  1KV4 A;  1NU1 K;  1SQB G;  2GA1 A;  4N3Y B;  2H43 A;  1GD2 E;  5APV A;  1LTT C;  1JTH B;  3HD7 C;  4U7J A;  1KQF B;  3CMA P;  3G9R A;  3KZI E;  3MD0 A;  3D70 A;  5E79 E;  1KIL B;  1M8O B;  1YYC A;  1AQ5 A;  3OW2 O;  3E1R A;  3EWK A;  2E5T A;  1L4A A;  4PD4 D;  2OTJ P;  1NU1 D;  1KIL A;  3A2A A;  2N9Y B;  4WVZ A;  5AVQ B;  3CCU P;  1N7L A;  4RES B;  2YKQ A;  1SQV E;  1SFC C;  3TYY A;  2LXC B;  3CME P;  3A0H E;  2IFN A;  1USD A;  3L4F A;  1GU5 A;  1AQT A;  5KJ7 D;  4LC1 A;  5C39 A;  3HUS B;  3H1H E;  4JPZ B;  3EFF K;  4NPE A;  4OH8 B;  5KLV J;  2WSC J;  1LT1 A;  2M0B A;  3C9I A;  1NJI Q;  2YIU C;  3CL3 D;  5CCH A;  1T3U A;  1RQV A;  2O1J A;  4H13 D;  2CK3 H;  4M3L A;  4IFD K;  5B66 E;  1HWT C;  4I7Z C;  3SWY A;  1FAV A;  1GW3 A;  1G2C A;  3H1J G;  3MHV A;  3V2N A;  3L74 J;  4IOI H;  3H1L J;  1HJ0 A;  2XKM A;  3H1K D;  2D2C C;  2HG5 D;  1CW5 A;  3SWF A;  2NZ2 A;  1NTM D;  2WPQ A;  3OAK A;  4R4M A;  3L72 D;  4U3F E;  2KOG A;  3AE5 C;  4C7N B;  1HH0 A;  3PTZ A;  3NMD A;  2IYP A;  1RF0 A;  4H44 C;  3MP7 B;  1VQ8 P;  3H1J E;  3JCU E;  1ZRT E;  1KB9 H;  1N86 A;  2HOD A;  3MTU E;  3A5T A;  1QL1 A;  2KYV A;  3H25 A;  3CCR P;  1OW7 A;  1FS0 E;  1OZH A;  2DW3 A;  2QJP C;  1IFD A;  2IX7 C;  3FGA D;  1NU1 G;  1SQP K;  2ZXE B;  1S2E A;  5BU8 B;  2P1J A;  4W7Y A;  2E76 C;  5AW8 B;  1FZA A;  5CBO A;  2WPR A;  2WQY C;  1SQB E;  2K37 A;  3CCM P;  1IK9 A;  4C46 A;  1PFI A;  3CCE P;  2KS1 A;  1KIL C;  2B89 A;  1SQV J;  3CD6 P;  4LLH A;  1NTZ E;  1ZW0 A;  2A06 G;  2QRX A;  3MUD C;  2BCC J;  2N1T D;  3K5B A;  4GT1 A;  2JP3 A;  1NTM G;  3CCS P;  2B88 A;  5APS A;  2YO2 A;  1GMJ A;  1QL2 A;  1N73 B;  1MUU A;  3AEB C;  1EDI A;  3L73 D;  4YTP C;  5M1B A;  1KB9 D;  5AW5 B;  1N73 A;  1FZC B;  3TK1 A;  1N7S A;  1K04 A;  1NU1 J;  1URQ A;  3WUU A;  2PFX A;  2NPS A;  2IBZ E;  2YKP A;  1AVY A;  1SQQ G;  3O8Z A;  3CCV P;  4I7Z B;  3S4R A;  5KLI B;  1MFT A;  2WT7 B;  2E75 D;  2KS1 B;  2P10 A;  2Q3I A;  5AW2 B;  1RF1 B;  1LJ2 A;  3L71 E;  3RBX A;  4N78 D;  3L75 E;  3G3Z A;  3G71 P;  4L74 A;  1BE3 D;  3TGU E;  2YO3 A;  1J1D C;  1OWA A;  3RL0 D;  2JWA A;  3L35 A;  2Y0C A;  5KTB A;  3L74 D;  5AVS B;  1Y8A A;  2YXQ B;  1EQ7 A;  2RMZ A;  1M90 Q;  3CX5 H;  2Z5I A;  2JEE A;  1LTJ A;  3R4Y A;  5GTH E;  1KFM A;  1PP9 E;  1QX8 A;  2VRS A;  1NTM J;  3CWB G;  3CXH H;  3B5N A;  3II6 A;  2JJL A;  1N2D C;  3RK3 D;  4DJG A;  1FDM A;  4ZKP A;  2HLO A;  3AEC C;  1KB9 E;  1GL2 D;  1MKM A;  2PP6 A;  3GMA A;  1UII A;  2QJP B;  3HE4 A;  3VMA A;  1YJN P;  3RL0 C;  1U57 A;  2Y0D A;  3BAS A;  5AVW B;  2BCC D;  2G3A A;  3H1I J;  1M56 D;  1EZV G;  4K35 A;  3D71 A;  2LKM A;  3G6E P;  1CI6 B;  2I1K A;  4W80 A;  4AQR D;  2P67 A;  1OFC X;  1JCC A;  3KXD A;  1BCC J;  1X0T A;  5APW A;  2FFD B;  1YIJ P;  1JNM A;  1MFZ A;  1EXI A;  2ZYA A;  5GTH H;  3N7N A;  3T97 B;  1EZV I;  5CJ4 A;  4PD4 E;  1GL2 C;  1SQP E;  1ZN5 A;  2KSJ A;  5APX A;  3RK3 E;  3RL0 g;  3CC2 P;  3L37 A;  4CPG A;  1KTM A;  1L0L J;  4L76 A;  5DJU B;  1Q2N A;  1AV1 A;  1CSB A;  2W8Z A;  5KJ7 C;  1HUC A;  1NTK K;  1Q7Y Q;  2IBZ G;  3F5H A;  1NTM K;  3NFQ A;  1LTJ C;  1GZL A;  1S72 P;  1LTA C;  1IK7 A;  1KC8 Q;  2Z4E A;  3I55 P;  1L0N G;  2R3C A;  1PPJ G;  5TIS E;  3AE4 C;  1NTK D;  4Y99 B;  1OMI A;  5B5E H;  1E5W A;  3PP5 A;  1JTH A;  2JO1 A;  3H1K J;  3KQG A;  2JR8 A;  2IFM A;  1HVV A;  1J1D B;  4PV1 C;  4D6T J;  2V7Q J;  3CWB E;  3B5N C;  1LP1 B;  3GW6 A;  1FZF A;  2JKV A;  3JCU H;  3H32 A;  1PP9 D;  3MUD A;  3B71 A;  3U1A A;  1VQ9 P;  4GIF A;  2E42 A;  1JY3 P;  1KIL D;  4RJT A;  1LWU C;  5AW4 B;  1CI6 A;  4DCK A;  3EQ2 A;  2KNC B;  4WY4 C;  2QEX P;  1FBM A;  1SQB K;  3M91 A;  3I56 P;  1LTB C;  4A7P A;  2IZ0 A;  3PJS K;  1AFO A;  1K8A Q;  4TT3 H;  1SQX J;  2E76 D;  2FFD C;  1VQN P;  1EDL A;  1BE3 E;  2KI7 B;  3TGU D;  3AE9 C;  3HE4 B;  3TGU J;  2WSE H;  1JEK A;  1EDK A;  4UB6 H;  1SQQ J;  5APQ A;  3CX5 D;  3IR9 A;  1R5S A;  2Q9I A;  1DX7 A;  3JSV C;  4AUW A;  2QJY B;  3BCC J;  3AEF C;  1H88 A;  1VF5 C;  2O01 H;  2QJK B;  1VQO P;  2KK7 A;  4JQ0 D;  4BRY B;  2N1T C;  2M5A B;  3L73 E;  1GW4 A;  1FZG A;  5AW9 B;  4L75 A;  2WT7 A;  4YPC A;  1IJD B;  4KHX A;  1QGK B;  2WWW A;  2Y9Y A;  1DD4 A;  2A45 G;  1P84 E;  1WMK A;  2NPS B;  3CWB J;  3GF3 A;  4H0L C;  1N7S B;  3GHG B;  3KHU A;  4K3A A;  5CMZ A;  4OGQ C;  3V5B A;  1BE3 J;  2FXO A;  5KLV G;  1W2B O;  1FZC A;  4N78 E;  2WMM A;  2CPB A;  3LIE A;  3H1K G;  5CCH C;  3VMZ A;  3L74 E;  3D6Z A;  1EZV E;  3CX5 I;  3U59 A;  1R8E A;  1DIP A;  2K3R A;  2V7Q H;  2AEM A;  3H1J D;  3CXH I;  3L72 J;  1M7L A;  1NU1 E;  4WY4 A;  4LGD E;  1EXJ A;  2E43 A;  1FE6 A;  1T8Z A;  2HR3 A;  3CCJ P;  1MV8 A;  1AVO A;  1SQX D;  2C0W A;  2FYU G;  2QM7 A;  3WU2 E;  3L70 E;  2R32 A;  5CHX A;  4ASW A;  1KIL E;  1N73 C;  2H7H A;  3LID A;  1N8R Q;  3RBZ A;  1Q81 Q;  5GTI E;  1X22 A;  1L0N K;  3OJA B;  1S9K D;  1NTZ J;  2KZI A;  1URQ D;  2QVA A;  1SQX K;  2XNX A;  5KKZ C;  1ZME C;  1VQL P;  1LGH B;  1Q90 D;  1QLE D;  3A0B E;  3M9H A;  1RHZ B;  2C0X A;  3USS A;  1YQ3 C;  1L0N D;  1BGY G;  3AE6 C;  1SFC D;  1EZV D;  3CI9 A;  3HTK A;  4PD4 H;  2OYI C;  1NOH A;  1RE4 A;  1JM0 A;  1YBK A;  1SQV D;  2PRR A;  5KLV D;  1UIX A;  1VF5 B;  4C7N A;  1HGV A;  1A02 J;  2N1T B;  4GOF A;  1SFC B;  4GOD A;  4OVN F;  4TLF A;  3L75 J;  3L73 G;  3MGN A;  3EFG A;  1G2C B;  1J1E B;  1YTZ T;  2QM8 A;  3B5N D;  1R5L A;  4L73 A;  3M9B A;  1GL2 A;  4H0L B;  5B5E E;  2RH0 A;  3TSI A;  3GHG C;  4HJG H;  1P84 H;  2ZT9 B;  2KXP B;  4RKU J;  3A0B H;  1DEE G;  3GHG A;  4H13 C;  3A7O A;  3PH0 A;  1S5L X;  5EFW B;  2C9L Y;  5AW7 B;  1SQB D;  1DD3 A;  3KPE A;  3QH9 A;  3CWB D;  3Q5S A;  4ZMD A;  3FX0 A;  3BRT B;  4Y28 J;  1LT9 B;  1ZOY C;  4YXW H;  1IZN B;  1BDC A;  1YJ9 P;  2OTK E;  3I5C A;  4WBA A;  1BCC D;  2C9N Y;  3AEA C;  5CCG A;  1BDD A;  1SVF A;  1D7M A;  2B87 B;  2AXT H;  3Q1M A;  2OGU A;  3VMX A;  1OXZ A;  3H6P A;  2L5G B;  3M0D C;  1NTZ K;  1KZU B;  1BGY J;  1IO4 A;  5APT A;  3ZDM A;  5K5G B;  2OQQ A;  5KKZ B;  1LTG C;  3G4S P;  3FXD A;  2HFE D;  1NAY A;  3MIW A;  3BRV B;  4PJ0 H;  2ZYD A;  1SQV G;  3W68 A;  5TIS H;  1KOR A;  3IN6 A;  3Q2Y A;  2OYH C;  2BEQ D;  3Q5R A;  1HBW A;  1NTZ D;  2PGD A;  2KZJ A;  4HH2 A;  1L0L E;  4XA4 A;  1USE A;  1Y47 A;  3FWL A;  5AVX B;  2I1J A;  3V2P A;  2IPP A;  2OYI B;  3CC4 P;  3CX5 E;  1W2E A;  1RE4 C;  1H0T A;  1L0L G;  2N9B A;  3R2P A;  4PD4 I;  5KJ7 A;  1OIP A;  1K73 Q;  2FY8 A;  1CZQ A;  4U3F J;  2QA4 P;  3L71 J;  2H8P D;  1Z56 A;  2QIW A;  1KYO E;  1SQP J;  3HE5 A;  4DZO A;  3VTP C;  5APY A;  2FYZ A;  1SQX G;  3LW5 J;  2E5Y A;  1YI2 P;  3H1H G;  2E74 D;  2YNY A;  1NTK E;  4PJ0 E;  2ZT9 C;  3VYI A;  2B87 A;  4H0L D;  5KLI C;  4DOJ A;  3H1I G;  1N7S D;  2SPZ A;  1T2K C;  1VQK P;  2NPS D;  1RF1 C;  1KQG B;  2HYN A;  2WVR A;  1FZB A;  1KD1 Q;  1J2J B;  3UIA A;  1VQ6 P;  3H1J J;  1LT9 A;  2FYN C;  2WTY A;  2LR2 A;  1LT9 C;  2RKL A;  4HB1 A;  1DH3 A;  4ZKU A;  3CXH D;  1LWU A;  1L2P A;  2WSF J;  5DJT B;  3RK3 C;  2XDJ A;  2J5U A;  1Q86 Q;  1Y9B A;  3HD7 A;  1VQ7 P;  1NKN A;  3BVH A;  1K05 A;  2W90 A;  2ZFC A;  1KFN A;  4KJM A;  4DT0 A;  2OAR A;  4MN4 C;  1NO4 A;  2BAS A;  2XV5 A;  2BCC E;  1H89 A;  3RL0 B;  3AE7 C;  1SQV K;  5KLV K;  1S5L E;  3RK2 B;  3T97 A;  3VOP A;  2WSC H;  3C8V A;  3NTN A;  3KZI H;  2OYH B;  3WUV A;  1K9M Q;  1NTZ G;  2A06 E;  1S4X A;  2ITA A;  4O9B A;  1EDJ A;  2N1T A;  1NTM E;  4U3F D;  1G1I A;  3PRJ A;  1L0L D;  1BGY E;  1PZQ A;  2W6J H;  3LW5 H;  2K9J A;  2P2U A;  2YMK A;  1JMM A;  3RGU A;  2ZJS E;  4Z1M H;  5CCH D;  1LNQ A;  1ZV8 A;  2OYO A;  1IFN A;  3HUS C;  3IFM A;  3H1L D;  1L0L K;  3L73 J;  1BCC G;  1X9V A;  3B4S A;  3FWN A;  3M0A A;  2O01 N;  1KYO D;  4IL6 X;  4OWF A;  4BWN A;  1LTJ B;  3H1H D;  3BAT A;  3M0D A;  5B66 H;  1T6A A;  2M8R A;  5CJ0 A;  3VP8 A;  4JYC A;  2YXR B;  2V4H A;  1NKZ B;  1P84 D;  1M1J B;  1TU3 F;  3P8M C;  5AVY B;  4D6T D;  4ZNC A;  1VQP P;  2HPC B;  1P84 I;  4Y99 C;  1E79 H;  4IL6 E;  1RF1 A;  2D2C B;  1EC5 A;  1VDF A;  1PP9 J;  2K88 A;  5AVU B;  1L4A D;  2FXP A;  2GUV A;  4UB6 E;  4WWI A;  4GOE A;  3NXS A;  1NWQ A;  3H32 B;  1HTL C;  4H44 B;  1RY3 A;  3RK3 B;  2ZXX A;  3L70 J;  3GG2 A;  3PLN A;  3CXH E;  5AW1 B;  1VQ5 P;  2M3E A;  1VQM P;  2A45 H;  2J59 M;  2YMY A;  3BCC G;  4EOT A;  3CPW O;  5KAF E;  3B8E B;  4EI2 A;  3KYQ A;  5AVT B;  1M57 D;  1RE3 C;  1LWU B;  2I8D A;  3RK2 C;  1YIT P;  1X8Y A;  1FDI A;  1GTW A;  4NPF X;  2Q3E A;  2E76 B;  1NVO A;  2Q5U A;  1MZ9 A;  4B86 A;  2G8Y A;  5H2F H;  2P7J A;  4R4L A;  4EDF A;  3IAO A;  3RK2 D;  3L75 D;  2ZVN B;  2GM4 A;  4WB4 A;  1NHL A;  2ZAE B;  2FBW C;  3O6Q A;  3CCL P;  1RH5 B;  2MKV A;  1BE3 G;  4XFJ A;  3A3Y B;  2YKO A;  1OVU A;  1NTK G;  1DEB A;  1WT6 A;  5APU A;  5KLV E;  4H44 D;  1BGY D;  1ZP0 C;  2BCC G;  2QJY C;  2WPS A;  3WUT A;  3HE5 B;  5AW3 B;  1AJY A;  2QJK C;  1FZC C;  1KQS O;  1PPJ E;  3TDK A;  3VP9 A;  2IDB A;  3BCC D;  1YJW P;  1M1K Q;  3CLQ A;  1HJB A;  1YQ4 C;  1M1J C;  4GKG A;  1JUN A;  3PHL A;  5H2F E;  2FYU J;  3H1H J;  1LTI C;  2E75 C;  4UB8 E;  3S9O A;  3V4W A;  1U7M A;  3SFE C;  4D6T E;  1N7S C;  3E1I A;  5AVV B;  2AXC A;  2K9Y A;  4I6M C;  4IL6 H;  1BSH A;  1GK4 A;  3L72 G;  3TGU G;  2Y0E A;  3VMY A;  4U3F G;  3U1C A;  1JY2 O;  1L0N E;  1ZR4 A;  1ZLL A;  4JBZ A;  3SSU A;  1SQB J;  5AVZ B;  3H1I D;  1NGM B;  1GU4 A;  2KB7 P;  2OTL P;  3H1L E;  2KLU A;  1SQQ E;  3O6Q B;  2HPC A;  2KP8 A;  3AED C;  3L70 D;  3CCQ P;  4C7R A;  2A45 I;  1RF0 C;  2IBZ D;  3E7K A;  3H1L G;  1AA0 A;  1L4A B;  2H89 C;  3KDP B;  1IFM A;  1S5L H;  3V2R A;  1SLQ A;  1OVV A;  2D2C D;  1FOS F;  3L71 D;  1URQ C;  2XZR A;  2LXB A;  2ZYG A;  1KQL A;  2AEJ A;  3FXE A;  2FKW B;  2A06 D;  3C1L A;  1PGP A;  5AW0 B;  4EYY Q;  4EIJ A;  5GTI H;  1JMB A;  3AE8 C;  2E74 C;  2NRG A;  4IFF A;  3AE3 C;  1A02 F;  1GDT A;  3MZW B;  1GL2 B;  3V6I A;  3AE2 C;  2H88 C;  4IFM A;  1NAF A;  2KSE A;  5L8R J;  3VN0 A;  3M06 A;  4HKZ H;  3CC7 P;  2RN0 A;  1JB0 J;  3SFD C;  2FFD A;  1KN7 A;  4YXD C;  1NTK J;  1SFC A;  1VL2 A;  2KLV A;  3A0H H;  2Q7C A;  2QE7 H;  1KYO I;  1SQX E;  2O01 J;  1JY3 N;  5KAI E;  2IBZ I;  3TNU A;  2XND H;  3P7K A;  4QMA A;  1J1E C;  4XE5 B;  1M1J A;  3W67 A;  1IFI A;  1JY2 N;  1ZR2 A;  2PAJ A;  1XTG B;  1X79 B;  3HTK B;  3TF5 A;  2E75 B;  1G1J A;  1JY3 O;  1S1C X;  1W5C E;  3F89 A;  4RO0 A;  3AE1 C;  1NH4 A;  2WSE J;  1OW6 A;  1SQP G;  2QSI A;  2O3J A;  3L74 G;  4PV1 B;  2QG4 A;  1FDO A;  2CPS A;  3L71 G;  3B5N B;  3L75 G;  2UWJ E;  3AEG C;  4H13 B;  3L72 E;  1IFP A;  2JWD A;  2W83 C;  3SWK A;  1PGQ A;  2B9B A;  2K9J B;  4WY4 D;  1VQ4 P;  1RQU A;  2J58 A;  2IYO A;  2P58 A;  3IF4 A;  4HYT B;  3V2Q A;  2WSS H;  1FU1 A;  4N6J A;  3S1K A;  3P8C D;  2O1K A;  3V4Q A;  4AYC A;  1VF5 D;  2Z5H A;  1LTS C;  1IFJ A;  2KIK A;  2XU6 A;  1KB9 I;  3L70 G;  2W6B A;  3Q3D A;  1IC2 A;  3BCC E;  3GF7 A;  2JDI H;  4W7Z A;  4WY4 B;  1L4A C;  2OYH A;  5KAI H;  1WRG A;  1U7J A;  1FOS E;  1JO5 A;  2POH A;  1JY2 P;  4PV1 D;  5CCG D;  1URQ B;  2GUS A;  4GDO A;  2ZVO B;  2AEF A;  2IZ1 A;  2WPV B;  3ITK A;  1PGJ A;  2L91 A;  1SQQ K;  2E74 B;  3D6Y A;  1PL5 A;  5BVZ A;  3JC2 2;  3HD7 B;  5E79 H;  5CCG C;  4NPD A;  1JCD A;  4KT0 J;  1VPC A;  1L0N J;  1QEX A;  2R3S A;  3H1I E;  3M9Q A;  4I2L C;  1PV3 A;  1FJK A;  3P8C E;  1SQP D;  2FYU K;  1SQQ D;  1YTZ I;  2WZ7 A;  3L36 A;  5BU5 A;  4JF7 A;  2K1A A;  2FXM A;  3Q5P A;  3AEE C;  1BCC E;  2M5A A;  4BRY A;  1ZRT D;  1OX3 A;  2WSF H;  5CBN A;  1JOC A;  1PPJ D;  3WMM 0;  1SS1 A;  2FYU D;  2BEZ F;  5KAF H;  1PGO A;  1HF9 A;  1KYO H;  2Q6Q A;  1OVR A;  1RE3 A;  2YIU B;  2NPS C;  3ABV C;  1S9K E;  1QVF O;  4UB8 H;  2MJZ A;  2R44 A;  1T3J A;  3P32 A;  2WIT A;  4OGQ B;  2W6A A;  3H1K E;  1T2K D;  4OGQ D;  1QVG O;  1PP9 G;  2HOD B;  1OW8 A;  2W27 A;  1KMI Z;  1HGZ A;  1FC2 C;  2R5D A;  4JYB A;  5TJH A;  5AW6 B;  1S3J A;  4D6T G;  1SP4 A;  2FYN B;  1H8A A;  1H0T B;  1PIX A;  3HRN A;  3TNU B;  2KNC A;  2Q1K A;  1ZXG A;  2OYI A;  3WU2 H;  4ASV A;  1GK6 A;  3GLM A;  4I1L A;  3QWO C;  2Y9Z A;  2M3B A;  1XTC C;  4BXL A;  1FJP A;  2FYU E;  2AXT E;  1NYH A; 
#chains in the Genus database with same CATH homology
 5GTI H;  3KZI H;  3JCU H;  4IL6 H;  4PJ0 H;  3WU2 H;  4UB8 H;  1S5L H;  5GTH H;  5E79 H;  5KAI H;  5B66 H;  5H2F H;  4UB6 H;  5B5E H;  2AXT H;  5KAF H;  3A0B H;  3A0H H;  5TIS H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...