3A0HH

Crystal structure of i-substituted photosystem ii complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 13
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3a0hH01
5KAIH 2AXTH 4IL6H 5B5EH 3A0BH 5KAFH 1S5LH 5E79H 4PJ0H 4UB8H 5TISH 5GTHH 5B66H 5GTIH 4UB6H 3JCUH 3KZIH 3A0HH 5H2FH 3WU2H
chains in the Genus database with same CATH superfamily
1SP4A 2XZRA 5KAFH 2A45I 5AW6B 1RH5B 5APVA 4U3FE 2KXPB 1KILA 2SPZA 5CCHC 1VQOP 1SQPG 2OTJP 1SFCC 4W80A 5KAFE 1KZUB 2WMMA 3B4SA 2OYIB 1ZRTD 1FZAA 3BCCJ 3H1KE 1NU1K 3E1IA 3PJSK 1J1EB 3LW5J 2ZT9B 2WPSA 1SLQA 2OYHB 1BGYD 1NTZK 2Q3IA 2QJYB 4Y99B 2QJPB 3D6YA 1KTMA 3GHGA 3NFQA 3S9OA 4OGQD 1HBWA 2IDBA 2HPCA 1FJPA 3IFMA 1YIJP 2Y9ZA 3GF3A 2YKQA 5AW5B 5APXA 2E5TA 3HUSB 3M9HA 3CPWO 2P2UA 1JO5A 2W6BA 4AYCA 1M7LA 2H43A 1DD3A 3V5BA 1URQC 3HD7C 3OAKA 1NU1J 1YI2P 4H0LC 4HH2A 3CX5I 3CC4P 1BE3D 3MIWA 3CL3D 3H1ID 1SQXD 1NTZJ 2HFED 1NJIQ 1LTTC 3H1LD 1H88A 3SWFA 1KQLA 2V4HA 4L73A 5BU5A 2OTKE 1S2EA 2IBZD 3AE4C 1JNMA 2FYNC 4IFDK 1JCDA 1HF9A 1DH3A 3L72E 1SQBJ 1JY3P 1SQQK 3T97A 4XFJA 1VQLP 4C46A 1Q81Q 1RF1A 1S9KE 2N9YB 3B5ND 2JWAA 3HE5B 3KYQA 1SQBG 4EIJA 3RK2B 4IFFA 1LTSC 3RGUA 1NTKD 3SFDC 1EC5A 2QJKC 4W7YA 1R8EA 1FJKA 2O1KA 4HYTB 3IR9A 3AEDC 2JP3A 5CJ4A 3CLQA 1VF5D 4GODA 1JMMA 2E76C 1BGYJ 4K3AA 3PTZA 4JBZA 1KQGB 1PIXA 4XA4A 4PD4I 2XV5A 2PGDA 1BGYG 1S5LH 2E75B 1GL2A 1KILC 2JR8A 2IYOA 1QL2A 5CCHD 3CXHI 3CC7P 3HD7B 4H0LB 2M3EA 4ZKUA 1S5LE 1SFCD 1Q86Q 1SQPE 2OYIA 4OWFA 2XDJA 1BE3J 3H1IJ 3TF5A 1SQXJ 2C9LY 1NAYA 4IL6X 4ASWA 5KAIH 4N78E 3V6IA 1ZXGA 1PGJA 2OYHA 3GHGC 3H1LJ 5AW9B 3LW5H 1BE3G 1SQXG 2NPSC 4KHXA 2KIKA 1L0NG 2QIWA 1GK6A 3I56P 3P32A 3L75G 2AEJA 2CK3H 4IFMA 4JF7A 1S4XA 3TDKA 2R5DA 1YYCA 3I5CA 3TK1A 1MFTA 3CI9A 1KV4A 3V2QA 4WWIA 1M8OB 3WUUA 3KDPB 5AW3B 1IK7A 2V7QJ 1NTKJ 1ZW0A 1URQD 1FDIA 4U7JA 1OZHA 1KYOE 1IJDB 3GF7A 1NTKG 1K8AQ 1NH4A 2P58A 2JKVA 2FYUG 3AECC 1WRGA 1AFOA 3H1KJ 1N7LA 3SWYA 4DCKA 2I8DA 1NHLA 1RF1C 3Q3DA 1M1JB 2KSJA 2KOGA 3HE5A 2QA4P 1P84E 2IZ1A 1RF0A 3BVHA 5AVRB 1EZVD 1L0LG 4ASVA 1WMKA 1JUNA 1SQBE 2KS1B 3AEBC 5AVZB 1R5LA 1EDJA 3PRJA 1SQVD 3C9IA 3D71A 1GU4A 4DZOA 1J1DB 1IK9A 1SQPD 2JWDA 2HPCB 4N3YB 3GLMA 1BSNA 3ZDMA 2JJLA 2E76D 3A7OA 3MGNA 1EXJA 3UIAA 3WUTA 2Q7CA 1GL2C 2KUBA 5CBOA 3MD0A 1FC2C 1JEKA 1KILD 2B88A 2W6AA 2QSIA 1YJ9P 1BGYE 3CCVP 1JB0J 2Z4EA 4MN4C 2DW3A 2ZYGA 4A7PA 4Z1MH 2QG4A 2YO3A 2OYIC 1CSBA 1OFCX 2BCCD 1J1EC 3N4XA 5GTIH 2KP8A 1VQ5P 2OYHC 2E42A 1SVFA 2KI7B 2QJYC 4Y99C 2QJPC 4TT3H 4NPEA 1Q2NA 2W83C 5AVUB 1LTJA 1KYOD 2NPSD 5GTIE 1E5WA 1KQSO 2JO1A 2IFMA 3M9BA 2YMYA 3EFFK 1AJYA 1BE3E 5BVZA 3H1IE 1SQXE 2WZ7A 5CBNA 3CWBG 1L2PA 5C39A 3RBXA 3L75E 1X8YA 2ZJSE 2FY8A 2NRGA 1RE4A 4IOIH 2IBZE 2D2CB 1EXIA 4WY4B 1LWUB 1GTWA 1A02J 4PV1D 2LKMA 2V7QH 3RK3B 1G2CB 2WQYC 3K5BA 1P84D 3KQGA 2ZAEB 3W67A 4Y28J 2YNYA 3AE3C 1KB9D 1EZVG 1TU3F 3H1JD 1LTBC 1Z56A 4DJGA 1VQKP 2M3BA 2XNDH 1SQPJ 2POHA 2ZVNB 3U59A 1FBMA 1MFZA 3VMAA 3CCEP 1GL2B 4I7ZB 1WT6A 2HYNA 1NTKE 1SQVG 2C9NY 3L71G 3U1CA 3P8CD 4W7ZA 2FYUE 1W5CE 2P67A 1H0TB 1M1JA 3RK2C 1RF0C 4H44B 3AEGC 2E5YA 5APQA 4KJMA 2XKMA 2PAJA 2HG5D 2ZVOB 2KS1A 3CC2P 3N7NA 1LTAC 2O01J 3AE5C 2BCCJ 1L0LE 3A3YB 2Z5IA 3NXSA 1FZFA 2GA1A 2UWJE 2FFDA 2BCCG 2WT7A 5CMZA 3RL0C 2E75C 2J59M 3PLNA 1PP9G 3VTPC 1SQBK 2B87B 3BRTB 2LXBA 4EDFA 2YO2A 3QWOC 1IZNB 1X0TA 3D6ZA 3FX0A 1OVUA 2NZ2A 1U7JA 2C0WA 1Q7YQ 1YJWP 3V4WA 2HODB 2KLUA 1PGPA 1L0ND 3BRVB 3HTKB 1UIXA 3L75D 4C7NB 5APUA 4EOTA 3Q2YA 2K3RA 3NMDA 1G1IA 4WB4A 2Y0CA 2ZT9D 2PP6A 1OW7A 1VQ4P 2ZYDA 1LTJC 2QRXA 2OTLP 1IFMA 4GT1A 2YKOA 2GUSA 1VQMP 5KJ7D 2R32A 3CMAP 3O6QB 1VQ9P 2B9BA 3TGUG 3H1JG 3SWKA 5KLIB 2M5AA 1RE4C 2MJZA 1PFIA 1Y47A 1W2EA 2H8PD 5M1BA 2W8ZA 3IAOA 5TJHA 4YXWH 4WY4A 1LWUA 2FYUD 1IFNA 2WPVB 1IFJA 3ABVC 2BEQD 2KZJA 1G2CA 2PRRA 3KXDA 1SQXK 2G8YA 3OW2O 4DOJA 3TYYA 1KMIZ 1YTZI 3L74D 3RL0B 4K35A 1GU5A 4IL6H 3P8MC 1HGZA 3H6PA 1EQ7A 1QEXA 3TSIA 4H13B 3E1RA 2KB7P 1L0LD 1EZVE 3B71A 3U1AA 3MTUE 1CZQA 1FAVA 1M1JC 2ZYAA 2W90A 1N7SB 2H89C 2YIUB 1H0TA 1VQ8P 1BCCG 1JY3N 3C8VA 3USSA 2A06D 4IL6E 3RK2D 1PGQA 1SQVE 1VDFA 3L71E 5E79H 3ITKA 1AQ5A 1L4AB 3AE7C 5AW8B 5APWA 1EDKA 1L0NJ 1NTKK 2O3JA 2P10A 3L75J 3Q1MA 1FOSE 1J1DC 3G4SP 1FZBA 3BATA 2O01H 1LTJB 5E79E 2YMKA 2I1JA 1IFPA 1XTGB 3M0DA 2FFDC 1KILE 4M3LA 2B89A 2R3SA 3SFEC 2J5UA 3PH0A 5AW7B 2RH0A 5AVTB 4WBAA 2YXQB 1JM0A 1M1KQ 3R4YA 5K5GB 2E75D 2K1AA 1MUUA 5TISH 2B87A 1KYOH 2BCCE 3L73G 2VRSA 3FWLA 1QLED 1L0LK 5AW2B 1VQ6P 1JY3O 1KYOI 2ITAA 1PP9E 3B5NA 2IYPA 5DJTB 2Q9IA 1X79B 1AV1A 2N1TB 2O01N 2HODA 1LJ2A 3HD7D 1X9VA 4H0LD 1FE6A 2KLVA 1HVVA 2FYUJ 3HTKA 5TISE 4C7NA 3CCMP 1K73Q 2P1JA 5KLVD 3CWBD 3W68A 4HJGH 2WSEJ 1P84H 1E79H 1DEBA 5KKZB 1KD1Q 4GDOA 4ZNCA 1KB9H 1JMBA 1DEEG 1P84I 4I1LA 2WPRA 1VPCA 4BXLA 3JC22 3F89A 3O6QA 1Q90D 1L0LJ 2AXTH 3VP8A 2OYOA 3LIEA 3VP9A 2A45G 3L74G 1FZCB 1NTMD 4JPZB 3CCRP 1N73B 2D2CC 2YKPA 4JQ0D 4RO0A 1KB9E 2IFNA 5L8RJ 2W6JH 4WY4C 1LWUC 3TGUE 3QH9A 3H1JE 3WUVA 1M90Q 3M9QA 3AEEC 3H32A 3L70D 4BRYA 2Y0DA 1IC2A 3RK3C 3IN6A 2AXTE 5AVXB 1RQVA 3CD6P 1YTZT 4UB8H 2A06G 3L71D 2XNXA 1QL1A 5B66H 1IO4A 3O8ZA 2R5BA 3P8CE 1HGVA 4PD4D 3VMZA 2FFDB 2WT7B 2AEMA 2K9JB 1U7MA 2E74B 3H1HD 3BASA 4D6TG 4I7ZC 4UB8E 1K9MQ 1KORA 5AVSB 5B66E 1AVOA 4L76A 2GM4A 1N7SA 3CXHD 1FZGA 1PPJD 2WPQA 1OIPA 4H44C 1FS0E 2M8RA 3AEAC 1LGHB 1K04A 1ZV8A 1IFIA 1YJNP 3FXEA 1L4AA 1DX7A 1CI6A 4ZKPA 3JCUE 1NAFA 1BCCE 4AUWA 1H8AA 4PV1B 4WVZA 2FKWB 1PP9D 3OJAB 1A02F 3NTNA 2BASA 3P7KA 1N8RQ 3FWNA 3CMEP 3M0DC 4B86A 2Y9YA 5KLVJ 3CWBJ 2WVRA 1SQVK 2CPSA 1OXZA 4RESB 5APSA 1SQPK 2IBZI 3MP7B 2I1KA 2C0XA 5KLVG 2M5AB 1L0NE 3A2AA 5APTA 3IF4A 1SS1A 3L37A 3MUDA 3AE8C 4QMAA 1QX8A 3TNUB 3PP5A 3A0HH 3G71P 1NOHA 1NTMJ 1ZMEC 3VMXA 1OVRA 1NWQA 2N1TA 1RE3A 3L73E 1NU1D 1GW3A 3EWKA 1QGKB 1BDCA 1ZOYC 2QM8A 1NTZD 1NTMG 3L4FA 1GMJA 1JTHA 1KFMA 3TGUD 2LXCB 3A0HE 1YHQP 2HLOA 1ZLLA 1SQVJ 5AW1B 3L71J 1VF5C 3L70G 1PV3A 2OARA 4OGQB 3M0AA 2FXPA 2WSEH 3H1HJ 2N9BA 1USEA 1USDA 1NYHA 1HH0A 2H7HA 1R5SA 2A45H 5KLIC 1HWTC 3C1LA 3KPEA 3H1HG 1FZCA 1YQ4C 5KTBA 1Y9BA 4NPDA 1N73A 1EDIA 4HKZH 2D2CD 3Q5RA 3A5TA 2XU6A 2PFXA 4WY4D 4GIFA 2Q3EA 3L74E 1HUCA 2G3AA 2HR3A 5CCGA 1NO4A 1PPJG 3A0BH 1T2KC 3VYIA 2LR2A 2M0BA 3AEFC 3Q5PA 1OVVA 3RK3D 1PP9J 1U57A 2KSEA 1M57D 1LT9A 2RMZA 4JYBA 1BCCD 2K9JA 3LIDA 1RY3A 1N2DC 1LP1B 2A06E 1SQQD 4LLHA 4H13C 3AE6C 3BCCG 3A0BE 2KYVA 1MZ9A 1GL2D 1LNQA 3AE2C 2NPSA 1N7SC 5AVYB 1LTGC 2YIUC 4D6TE 2H88C 1VQ7P 1FZEA 5AVWB 3Q5SA 3II6A 1KC8Q 4L75A 3B5NB 4H44D 1L4AC 1OX3A 1VQNP 3SSUA 5AVQB 2FBWC 3CX5H 3G9RA 3GMAA 3CCUP 2QE7H 2P7JA 3VMYA 1VF5B 1JY2P 3L73D 3RBZA 3TGUJ 3H1JJ 1NU1G 3CCJP 2WITA 3CX5E 1NTZG 1K05A 1KQFB 1T8ZA 3RL0g 1HJBA 3MUDC 1GD2E 2YXRB 4AQRD 2JDIH 3B8EB 1NKNA 1YBKA 2R44A 3TNUA 3AE1C 3E7KA 4L74A 5KLVE 2N1TC 3H32B 1RE3C 3CWBE 2L91A 4BRYB 1MV8A 2WSFH 3EQ2A 1SFCB 2Q5UA 2BEZF 4U3FD 1L0NK 1VL2A 5DJUB 1EZVI 2JEEA 4OH8B 1RHZB 3S1KA 5KKZC 3V2NA 3VN0A 1NTME 1BCCJ 5GTHH 1QVGO 4PD4H 1SQQJ 3H1KD 1M56D 2W27A 3L70E 1JY2N 3D70A 1Q82Q 5BU8B 2WTYA 1FZCC 2MKVA 1N73C 1SQQG 2WSCJ 3CCQP 1FDOA 5GTHE 4LC1A 4CPGA 3CXHH 1CI6B 4PD4E 1GK4A 5CCGC 4D6TD 4OVNF 3H1HE 1ZP0C 3HRNA 4I6MC 4GOEA 1N86A 2IPPA 1URQB 2CPBA 1Y8AA 1IFDA 2FYUK 1T2KD 1QVFO 2AEFA 1LT1A 1LT9C 5EFWB 4YPCA 3S4RA 1MKMA 4EYYQ 4NPFX 3GG2A 3CXHE 2E74C 1PPJE 2J58A 3L36A 1J2JB 5H2FH 2KNCB 3L73J 2K9YA 2IX7C 1S5LX 1LP1A 1S1CX 3RL0D 2FYNB 3H1IG 1AVYA 4H13D 2Y0EA 2O1JA 2RKLA 1JY2O 3H1LG 4RKUJ 5KJ7A 3JSVC 3M91A 4JYCA 1N7SD 3GW6A 3BCCE 3CX5D 2IBZG 5H2FE 5KAIE 1OW8A 3WMM0 1AA0A 3HE4B 3V4QA 2OQQA 4PJ0H 1XTCC 3EFGA 3HUSA 2IZ0A 3L72D 2QM7A 1L4AD 2FYZA 4PV1C 2ZXXA 4GOFA 4R4MA 2Q6QA 1YITP 1JTHB 5AW4B 2QJKB 4ZMDA 1S9KD 3R2PA 4U3FJ 2K88A 4PJ0E 1G1JA 3L74J 4BWNA 2E76B 1KB9I 3KHUA 4U3FG 1GDTA 4LGDE 4XE5B 1H89A 1JOCA 2FXMA 1S72P 4I2LC 1LTIC 1NU1E 5CHXA 1ZN5A 1ZR4A 5CJ0A 1NTZE 1KILB 4UB6H 3KZIH 3OA7A 3H1KG 2K37A 5CCHA 2L5GB 1KFNA 1D7MA 1AQTA 1OW6A 2N1TD 1DD4A 3AE9C 1SFCA 4D6TJ 3VOPA 1NGMB 1PL5A 1DIPA 1T3UA 3I55P 1PGOA 2R3CA 4UB6E 1OWAA 1LT9B 3KZIE 3FGAD 1YQ3C 1HJ0A 4OGQC 3GHGB 1NVOA 5KLVK 1HTLC 2QEXP 1KN7A 3G3ZA 2NPSB 3JCUH 1BSHA 3CCLP 2GUVA 3PHLA 3L35A 2KZIA 4N78D 4GKGA 2Q1KA 3RK3E 1ZRTE 1FDMA 1FU1A 3F5HA 2ZFCA 3MZWB 3G6EP 1EDLA 1RQUA 2WSCH 4N6JA 1NTMK 3WU2H 4TLFA 3BCCD 3MHVA 1SQQE 3L72J 5CCGD 2E43A 1URQA 3HD7A 5B5EH 3M06A 4RJTA 4C7RA 1T3JA 2ZT9C 2RN0A 2WSSH 3L72G 2AXCA 2KNCA 3FXDA 3WU2E 1VQPP 4YXDC 2E74D 3H25A 4O9BA 5B5EE 3V2RA 2ZXEB 1OMIA 5KJ7C 3T97B 4R4LA 4KT0J 4YTPC 1X22A 3B5NC 1RF1B 2WSFJ 1T6AA 3HE4A 1FOSF 3HUSC 2QVAA 4DT0A 3H1LE 2Z5HA 2OGUA 1ZR2A 3L70J 1GW4A 5APYA 2KK7A 1CW5A 1BDDA 5AW0B 3V2PA 1GZLA 1PZQA 1JCCA 4HB1A 5AVVB 4EI2A 3CCSP 2FXOA 1UIIA 1W2BO 2WWWA 1S3JA 1NKZB 1SQBD
chains in the Genus database with same CATH topology
5KAIH 2AXTH 4IL6H 5B5EH 3A0BH 5KAFH 1S5LH 5E79H 4PJ0H 4UB8H 5TISH 5GTHH 5B66H 5GTIH 4UB6H 3JCUH 3KZIH 3A0HH 5H2FH 3WU2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI H;  2AXT H;  4IL6 H;  5B5E H;  3A0B H;  5KAF H;  1S5L H;  5E79 H;  4PJ0 H;  4UB8 H;  5TIS H;  5GTH H;  5B66 H;  5GTI H;  4UB6 H;  3JCU H;  3KZI H;  3A0H H;  5H2F H;  3WU2 H; 
#chains in the Genus database with same CATH topology
 1SP4 A;  2XZR A;  5KAF H;  2A45 I;  5AW6 B;  1RH5 B;  5APV A;  4U3F E;  2KXP B;  1KIL A;  2SPZ A;  5CCH C;  1VQO P;  1SQP G;  2OTJ P;  1SFC C;  4W80 A;  5KAF E;  1KZU B;  2WMM A;  3B4S A;  2OYI B;  1ZRT D;  1FZA A;  3BCC J;  3H1K E;  1NU1 K;  3E1I A;  3PJS K;  1J1E B;  3LW5 J;  2ZT9 B;  2WPS A;  1SLQ A;  2OYH B;  1BGY D;  1NTZ K;  2Q3I A;  2QJY B;  4Y99 B;  2QJP B;  3D6Y A;  1KTM A;  3GHG A;  3NFQ A;  3S9O A;  4OGQ D;  1HBW A;  2IDB A;  2HPC A;  1FJP A;  3IFM A;  1YIJ P;  2Y9Z A;  3GF3 A;  2YKQ A;  5AW5 B;  5APX A;  2E5T A;  3HUS B;  3M9H A;  3CPW O;  2P2U A;  1JO5 A;  2W6B A;  4AYC A;  1M7L A;  2H43 A;  1DD3 A;  3V5B A;  1URQ C;  3HD7 C;  3OAK A;  1NU1 J;  1YI2 P;  4H0L C;  4HH2 A;  3CX5 I;  3CC4 P;  1BE3 D;  3MIW A;  3CL3 D;  3H1I D;  1SQX D;  1NTZ J;  2HFE D;  1NJI Q;  1LTT C;  3H1L D;  1H88 A;  3SWF A;  1KQL A;  2V4H A;  4L73 A;  5BU5 A;  2OTK E;  1S2E A;  2IBZ D;  3AE4 C;  1JNM A;  2FYN C;  4IFD K;  1JCD A;  1HF9 A;  1DH3 A;  3L72 E;  1SQB J;  1JY3 P;  1SQQ K;  3T97 A;  4XFJ A;  1VQL P;  4C46 A;  1Q81 Q;  1RF1 A;  1S9K E;  2N9Y B;  3B5N D;  2JWA A;  3HE5 B;  3KYQ A;  1SQB G;  4EIJ A;  3RK2 B;  4IFF A;  1LTS C;  3RGU A;  1NTK D;  3SFD C;  1EC5 A;  2QJK C;  4W7Y A;  1R8E A;  1FJK A;  2O1K A;  4HYT B;  3IR9 A;  3AED C;  2JP3 A;  5CJ4 A;  3CLQ A;  1VF5 D;  4GOD A;  1JMM A;  2E76 C;  1BGY J;  4K3A A;  3PTZ A;  4JBZ A;  1KQG B;  1PIX A;  4XA4 A;  4PD4 I;  2XV5 A;  2PGD A;  1BGY G;  1S5L H;  2E75 B;  1GL2 A;  1KIL C;  2JR8 A;  2IYO A;  1QL2 A;  5CCH D;  3CXH I;  3CC7 P;  3HD7 B;  4H0L B;  2M3E A;  4ZKU A;  1S5L E;  1SFC D;  1Q86 Q;  1SQP E;  2OYI A;  4OWF A;  2XDJ A;  1BE3 J;  3H1I J;  3TF5 A;  1SQX J;  2C9L Y;  1NAY A;  4IL6 X;  4ASW A;  5KAI H;  4N78 E;  3V6I A;  1ZXG A;  1PGJ A;  2OYH A;  3GHG C;  3H1L J;  5AW9 B;  3LW5 H;  1BE3 G;  1SQX G;  2NPS C;  4KHX A;  2KIK A;  1L0N G;  2QIW A;  1GK6 A;  3I56 P;  3P32 A;  3L75 G;  2AEJ A;  2CK3 H;  4IFM A;  4JF7 A;  1S4X A;  3TDK A;  2R5D A;  1YYC A;  3I5C A;  3TK1 A;  1MFT A;  3CI9 A;  1KV4 A;  3V2Q A;  4WWI A;  1M8O B;  3WUU A;  3KDP B;  5AW3 B;  1IK7 A;  2V7Q J;  1NTK J;  1ZW0 A;  1URQ D;  1FDI A;  4U7J A;  1OZH A;  1KYO E;  1IJD B;  3GF7 A;  1NTK G;  1K8A Q;  1NH4 A;  2P58 A;  2JKV A;  2FYU G;  3AEC C;  1WRG A;  1AFO A;  3H1K J;  1N7L A;  3SWY A;  4DCK A;  2I8D A;  1NHL A;  1RF1 C;  3Q3D A;  1M1J B;  2KSJ A;  2KOG A;  3HE5 A;  2QA4 P;  1P84 E;  2IZ1 A;  1RF0 A;  3BVH A;  5AVR B;  1EZV D;  1L0L G;  4ASV A;  1WMK A;  1JUN A;  1SQB E;  2KS1 B;  3AEB C;  5AVZ B;  1R5L A;  1EDJ A;  3PRJ A;  1SQV D;  3C9I A;  3D71 A;  1GU4 A;  4DZO A;  1J1D B;  1IK9 A;  1SQP D;  2JWD A;  2HPC B;  4N3Y B;  3GLM A;  1BSN A;  3ZDM A;  2JJL A;  2E76 D;  3A7O A;  3MGN A;  1EXJ A;  3UIA A;  3WUT A;  2Q7C A;  1GL2 C;  2KUB A;  5CBO A;  3MD0 A;  1FC2 C;  1JEK A;  1KIL D;  2B88 A;  2W6A A;  2QSI A;  1YJ9 P;  1BGY E;  3CCV P;  1JB0 J;  2Z4E A;  4MN4 C;  2DW3 A;  2ZYG A;  4A7P A;  4Z1M H;  2QG4 A;  2YO3 A;  2OYI C;  1CSB A;  1OFC X;  2BCC D;  1J1E C;  3N4X A;  5GTI H;  2KP8 A;  1VQ5 P;  2OYH C;  2E42 A;  1SVF A;  2KI7 B;  2QJY C;  4Y99 C;  2QJP C;  4TT3 H;  4NPE A;  1Q2N A;  2W83 C;  5AVU B;  1LTJ A;  1KYO D;  2NPS D;  5GTI E;  1E5W A;  1KQS O;  2JO1 A;  2IFM A;  3M9B A;  2YMY A;  3EFF K;  1AJY A;  1BE3 E;  5BVZ A;  3H1I E;  1SQX E;  2WZ7 A;  5CBN A;  3CWB G;  1L2P A;  5C39 A;  3RBX A;  3L75 E;  1X8Y A;  2ZJS E;  2FY8 A;  2NRG A;  1RE4 A;  4IOI H;  2IBZ E;  2D2C B;  1EXI A;  4WY4 B;  1LWU B;  1GTW A;  1A02 J;  4PV1 D;  2LKM A;  2V7Q H;  3RK3 B;  1G2C B;  2WQY C;  3K5B A;  1P84 D;  3KQG A;  2ZAE B;  3W67 A;  4Y28 J;  2YNY A;  3AE3 C;  1KB9 D;  1EZV G;  1TU3 F;  3H1J D;  1LTB C;  1Z56 A;  4DJG A;  1VQK P;  2M3B A;  2XND H;  1SQP J;  2POH A;  2ZVN B;  3U59 A;  1FBM A;  1MFZ A;  3VMA A;  3CCE P;  1GL2 B;  4I7Z B;  1WT6 A;  2HYN A;  1NTK E;  1SQV G;  2C9N Y;  3L71 G;  3U1C A;  3P8C D;  4W7Z A;  2FYU E;  1W5C E;  2P67 A;  1H0T B;  1M1J A;  3RK2 C;  1RF0 C;  4H44 B;  3AEG C;  2E5Y A;  5APQ A;  4KJM A;  2XKM A;  2PAJ A;  2HG5 D;  2ZVO B;  2KS1 A;  3CC2 P;  3N7N A;  1LTA C;  2O01 J;  3AE5 C;  2BCC J;  1L0L E;  3A3Y B;  2Z5I A;  3NXS A;  1FZF A;  2GA1 A;  2UWJ E;  2FFD A;  2BCC G;  2WT7 A;  5CMZ A;  3RL0 C;  2E75 C;  2J59 M;  3PLN A;  1PP9 G;  3VTP C;  1SQB K;  2B87 B;  3BRT B;  2LXB A;  4EDF A;  2YO2 A;  3QWO C;  1IZN B;  1X0T A;  3D6Z A;  3FX0 A;  1OVU A;  2NZ2 A;  1U7J A;  2C0W A;  1Q7Y Q;  1YJW P;  3V4W A;  2HOD B;  2KLU A;  1PGP A;  1L0N D;  3BRV B;  3HTK B;  1UIX A;  3L75 D;  4C7N B;  5APU A;  4EOT A;  3Q2Y A;  2K3R A;  3NMD A;  1G1I A;  4WB4 A;  2Y0C A;  2ZT9 D;  2PP6 A;  1OW7 A;  1VQ4 P;  2ZYD A;  1LTJ C;  2QRX A;  2OTL P;  1IFM A;  4GT1 A;  2YKO A;  2GUS A;  1VQM P;  5KJ7 D;  2R32 A;  3CMA P;  3O6Q B;  1VQ9 P;  2B9B A;  3TGU G;  3H1J G;  3SWK A;  5KLI B;  2M5A A;  1RE4 C;  2MJZ A;  1PFI A;  1Y47 A;  1W2E A;  2H8P D;  5M1B A;  2W8Z A;  3IAO A;  5TJH A;  4YXW H;  4WY4 A;  1LWU A;  2FYU D;  1IFN A;  2WPV B;  1IFJ A;  3ABV C;  2BEQ D;  2KZJ A;  1G2C A;  2PRR A;  3KXD A;  1SQX K;  2G8Y A;  3OW2 O;  4DOJ A;  3TYY A;  1KMI Z;  1YTZ I;  3L74 D;  3RL0 B;  4K35 A;  1GU5 A;  4IL6 H;  3P8M C;  1HGZ A;  3H6P A;  1EQ7 A;  1QEX A;  3TSI A;  4H13 B;  3E1R A;  2KB7 P;  1L0L D;  1EZV E;  3B71 A;  3U1A A;  3MTU E;  1CZQ A;  1FAV A;  1M1J C;  2ZYA A;  2W90 A;  1N7S B;  2H89 C;  2YIU B;  1H0T A;  1VQ8 P;  1BCC G;  1JY3 N;  3C8V A;  3USS A;  2A06 D;  4IL6 E;  3RK2 D;  1PGQ A;  1SQV E;  1VDF A;  3L71 E;  5E79 H;  3ITK A;  1AQ5 A;  1L4A B;  3AE7 C;  5AW8 B;  5APW A;  1EDK A;  1L0N J;  1NTK K;  2O3J A;  2P10 A;  3L75 J;  3Q1M A;  1FOS E;  1J1D C;  3G4S P;  1FZB A;  3BAT A;  2O01 H;  1LTJ B;  5E79 E;  2YMK A;  2I1J A;  1IFP A;  1XTG B;  3M0D A;  2FFD C;  1KIL E;  4M3L A;  2B89 A;  2R3S A;  3SFE C;  2J5U A;  3PH0 A;  5AW7 B;  2RH0 A;  5AVT B;  4WBA A;  2YXQ B;  1JM0 A;  1M1K Q;  3R4Y A;  5K5G B;  2E75 D;  2K1A A;  1MUU A;  5TIS H;  2B87 A;  1KYO H;  2BCC E;  3L73 G;  2VRS A;  3FWL A;  1QLE D;  1L0L K;  5AW2 B;  1VQ6 P;  1JY3 O;  1KYO I;  2ITA A;  1PP9 E;  3B5N A;  2IYP A;  5DJT B;  2Q9I A;  1X79 B;  1AV1 A;  2N1T B;  2O01 N;  2HOD A;  1LJ2 A;  3HD7 D;  1X9V A;  4H0L D;  1FE6 A;  2KLV A;  1HVV A;  2FYU J;  3HTK A;  5TIS E;  4C7N A;  3CCM P;  1K73 Q;  2P1J A;  5KLV D;  3CWB D;  3W68 A;  4HJG H;  2WSE J;  1P84 H;  1E79 H;  1DEB A;  5KKZ B;  1KD1 Q;  4GDO A;  4ZNC A;  1KB9 H;  1JMB A;  1DEE G;  1P84 I;  4I1L A;  2WPR A;  1VPC A;  4BXL A;  3JC2 2;  3F89 A;  3O6Q A;  1Q90 D;  1L0L J;  2AXT H;  3VP8 A;  2OYO A;  3LIE A;  3VP9 A;  2A45 G;  3L74 G;  1FZC B;  1NTM D;  4JPZ B;  3CCR P;  1N73 B;  2D2C C;  2YKP A;  4JQ0 D;  4RO0 A;  1KB9 E;  2IFN A;  5L8R J;  2W6J H;  4WY4 C;  1LWU C;  3TGU E;  3QH9 A;  3H1J E;  3WUV A;  1M90 Q;  3M9Q A;  3AEE C;  3H32 A;  3L70 D;  4BRY A;  2Y0D A;  1IC2 A;  3RK3 C;  3IN6 A;  2AXT E;  5AVX B;  1RQV A;  3CD6 P;  1YTZ T;  4UB8 H;  2A06 G;  3L71 D;  2XNX A;  1QL1 A;  5B66 H;  1IO4 A;  3O8Z A;  2R5B A;  3P8C E;  1HGV A;  4PD4 D;  3VMZ A;  2FFD B;  2WT7 B;  2AEM A;  2K9J B;  1U7M A;  2E74 B;  3H1H D;  3BAS A;  4D6T G;  4I7Z C;  4UB8 E;  1K9M Q;  1KOR A;  5AVS B;  5B66 E;  1AVO A;  4L76 A;  2GM4 A;  1N7S A;  3CXH D;  1FZG A;  1PPJ D;  2WPQ A;  1OIP A;  4H44 C;  1FS0 E;  2M8R A;  3AEA C;  1LGH B;  1K04 A;  1ZV8 A;  1IFI A;  1YJN P;  3FXE A;  1L4A A;  1DX7 A;  1CI6 A;  4ZKP A;  3JCU E;  1NAF A;  1BCC E;  4AUW A;  1H8A A;  4PV1 B;  4WVZ A;  2FKW B;  1PP9 D;  3OJA B;  1A02 F;  3NTN A;  2BAS A;  3P7K A;  1N8R Q;  3FWN A;  3CME P;  3M0D C;  4B86 A;  2Y9Y A;  5KLV J;  3CWB J;  2WVR A;  1SQV K;  2CPS A;  1OXZ A;  4RES B;  5APS A;  1SQP K;  2IBZ I;  3MP7 B;  2I1K A;  2C0X A;  5KLV G;  2M5A B;  1L0N E;  3A2A A;  5APT A;  3IF4 A;  1SS1 A;  3L37 A;  3MUD A;  3AE8 C;  4QMA A;  1QX8 A;  3TNU B;  3PP5 A;  3A0H H;  3G71 P;  1NOH A;  1NTM J;  1ZME C;  3VMX A;  1OVR A;  1NWQ A;  2N1T A;  1RE3 A;  3L73 E;  1NU1 D;  1GW3 A;  3EWK A;  1QGK B;  1BDC A;  1ZOY C;  2QM8 A;  1NTZ D;  1NTM G;  3L4F A;  1GMJ A;  1JTH A;  1KFM A;  3TGU D;  2LXC B;  3A0H E;  1YHQ P;  2HLO A;  1ZLL A;  1SQV J;  5AW1 B;  3L71 J;  1VF5 C;  3L70 G;  1PV3 A;  2OAR A;  4OGQ B;  3M0A A;  2FXP A;  2WSE H;  3H1H J;  2N9B A;  1USE A;  1USD A;  1NYH A;  1HH0 A;  2H7H A;  1R5S A;  2A45 H;  5KLI C;  1HWT C;  3C1L A;  3KPE A;  3H1H G;  1FZC A;  1YQ4 C;  5KTB A;  1Y9B A;  4NPD A;  1N73 A;  1EDI A;  4HKZ H;  2D2C D;  3Q5R A;  3A5T A;  2XU6 A;  2PFX A;  4WY4 D;  4GIF A;  2Q3E A;  3L74 E;  1HUC A;  2G3A A;  2HR3 A;  5CCG A;  1NO4 A;  1PPJ G;  3A0B H;  1T2K C;  3VYI A;  2LR2 A;  2M0B A;  3AEF C;  3Q5P A;  1OVV A;  3RK3 D;  1PP9 J;  1U57 A;  2KSE A;  1M57 D;  1LT9 A;  2RMZ A;  4JYB A;  1BCC D;  2K9J A;  3LID A;  1RY3 A;  1N2D C;  1LP1 B;  2A06 E;  1SQQ D;  4LLH A;  4H13 C;  3AE6 C;  3BCC G;  3A0B E;  2KYV A;  1MZ9 A;  1GL2 D;  1LNQ A;  3AE2 C;  2NPS A;  1N7S C;  5AVY B;  1LTG C;  2YIU C;  4D6T E;  2H88 C;  1VQ7 P;  1FZE A;  5AVW B;  3Q5S A;  3II6 A;  1KC8 Q;  4L75 A;  3B5N B;  4H44 D;  1L4A C;  1OX3 A;  1VQN P;  3SSU A;  5AVQ B;  2FBW C;  3CX5 H;  3G9R A;  3GMA A;  3CCU P;  2QE7 H;  2P7J A;  3VMY A;  1VF5 B;  1JY2 P;  3L73 D;  3RBZ A;  3TGU J;  3H1J J;  1NU1 G;  3CCJ P;  2WIT A;  3CX5 E;  1NTZ G;  1K05 A;  1KQF B;  1T8Z A;  3RL0 g;  1HJB A;  3MUD C;  1GD2 E;  2YXR B;  4AQR D;  2JDI H;  3B8E B;  1NKN A;  1YBK A;  2R44 A;  3TNU A;  3AE1 C;  3E7K A;  4L74 A;  5KLV E;  2N1T C;  3H32 B;  1RE3 C;  3CWB E;  2L91 A;  4BRY B;  1MV8 A;  2WSF H;  3EQ2 A;  1SFC B;  2Q5U A;  2BEZ F;  4U3F D;  1L0N K;  1VL2 A;  5DJU B;  1EZV I;  2JEE A;  4OH8 B;  1RHZ B;  3S1K A;  5KKZ C;  3V2N A;  3VN0 A;  1NTM E;  1BCC J;  5GTH H;  1QVG O;  4PD4 H;  1SQQ J;  3H1K D;  1M56 D;  2W27 A;  3L70 E;  1JY2 N;  3D70 A;  1Q82 Q;  5BU8 B;  2WTY A;  1FZC C;  2MKV A;  1N73 C;  1SQQ G;  2WSC J;  3CCQ P;  1FDO A;  5GTH E;  4LC1 A;  4CPG A;  3CXH H;  1CI6 B;  4PD4 E;  1GK4 A;  5CCG C;  4D6T D;  4OVN F;  3H1H E;  1ZP0 C;  3HRN A;  4I6M C;  4GOE A;  1N86 A;  2IPP A;  1URQ B;  2CPB A;  1Y8A A;  1IFD A;  2FYU K;  1T2K D;  1QVF O;  2AEF A;  1LT1 A;  1LT9 C;  5EFW B;  4YPC A;  3S4R A;  1MKM A;  4EYY Q;  4NPF X;  3GG2 A;  3CXH E;  2E74 C;  1PPJ E;  2J58 A;  3L36 A;  1J2J B;  5H2F H;  2KNC B;  3L73 J;  2K9Y A;  2IX7 C;  1S5L X;  1LP1 A;  1S1C X;  3RL0 D;  2FYN B;  3H1I G;  1AVY A;  4H13 D;  2Y0E A;  2O1J A;  2RKL A;  1JY2 O;  3H1L G;  4RKU J;  5KJ7 A;  3JSV C;  3M91 A;  4JYC A;  1N7S D;  3GW6 A;  3BCC E;  3CX5 D;  2IBZ G;  5H2F E;  5KAI E;  1OW8 A;  3WMM 0;  1AA0 A;  3HE4 B;  3V4Q A;  2OQQ A;  4PJ0 H;  1XTC C;  3EFG A;  3HUS A;  2IZ0 A;  3L72 D;  2QM7 A;  1L4A D;  2FYZ A;  4PV1 C;  2ZXX A;  4GOF A;  4R4M A;  2Q6Q A;  1YIT P;  1JTH B;  5AW4 B;  2QJK B;  4ZMD A;  1S9K D;  3R2P A;  4U3F J;  2K88 A;  4PJ0 E;  1G1J A;  3L74 J;  4BWN A;  2E76 B;  1KB9 I;  3KHU A;  4U3F G;  1GDT A;  4LGD E;  4XE5 B;  1H89 A;  1JOC A;  2FXM A;  1S72 P;  4I2L C;  1LTI C;  1NU1 E;  5CHX A;  1ZN5 A;  1ZR4 A;  5CJ0 A;  1NTZ E;  1KIL B;  4UB6 H;  3KZI H;  3OA7 A;  3H1K G;  2K37 A;  5CCH A;  2L5G B;  1KFN A;  1D7M A;  1AQT A;  1OW6 A;  2N1T D;  1DD4 A;  3AE9 C;  1SFC A;  4D6T J;  3VOP A;  1NGM B;  1PL5 A;  1DIP A;  1T3U A;  3I55 P;  1PGO A;  2R3C A;  4UB6 E;  1OWA A;  1LT9 B;  3KZI E;  3FGA D;  1YQ3 C;  1HJ0 A;  4OGQ C;  3GHG B;  1NVO A;  5KLV K;  1HTL C;  2QEX P;  1KN7 A;  3G3Z A;  2NPS B;  3JCU H;  1BSH A;  3CCL P;  2GUV A;  3PHL A;  3L35 A;  2KZI A;  4N78 D;  4GKG A;  2Q1K A;  3RK3 E;  1ZRT E;  1FDM A;  1FU1 A;  3F5H A;  2ZFC A;  3MZW B;  3G6E P;  1EDL A;  1RQU A;  2WSC H;  4N6J A;  1NTM K;  3WU2 H;  4TLF A;  3BCC D;  3MHV A;  1SQQ E;  3L72 J;  5CCG D;  2E43 A;  1URQ A;  3HD7 A;  5B5E H;  3M06 A;  4RJT A;  4C7R A;  1T3J A;  2ZT9 C;  2RN0 A;  2WSS H;  3L72 G;  2AXC A;  2KNC A;  3FXD A;  3WU2 E;  1VQP P;  4YXD C;  2E74 D;  3H25 A;  4O9B A;  5B5E E;  3V2R A;  2ZXE B;  1OMI A;  5KJ7 C;  3T97 B;  4R4L A;  4KT0 J;  4YTP C;  1X22 A;  3B5N C;  1RF1 B;  2WSF J;  1T6A A;  3HE4 A;  1FOS F;  3HUS C;  2QVA A;  4DT0 A;  3H1L E;  2Z5H A;  2OGU A;  1ZR2 A;  3L70 J;  1GW4 A;  5APY A;  2KK7 A;  1CW5 A;  1BDD A;  5AW0 B;  3V2P A;  1GZL A;  1PZQ A;  1JCC A;  4HB1 A;  5AVV B;  4EI2 A;  3CCS P;  2FXO A;  1UII A;  1W2B O;  2WWW A;  1S3J A;  1NKZ B;  1SQB D; 
#chains in the Genus database with same CATH homology
 5KAI H;  2AXT H;  4IL6 H;  5B5E H;  3A0B H;  5KAF H;  1S5L H;  5E79 H;  4PJ0 H;  4UB8 H;  5TIS H;  5GTH H;  5B66 H;  5GTI H;  4UB6 H;  3JCU H;  3KZI H;  3A0H H;  5H2F H;  3WU2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...