4Y99B

Core domain of human cardiac troponin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
74
structure length
74
Chain Sequence
GKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Core domain of human cardiac troponin
rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 31
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4y99B00
1YTZT 1J1EC 1YTZI 1J1DC 1J1DB 4Y99B 4Y99C 1J1EB
chains in the Genus database with same CATH superfamily
5KLVE 1NAYA 4LLHA 1P84H 2KB7P 3CPWO 1PPJG 1G1JA 3EFFK 3AEGC 3PLNA 3RL0g 2BCCG 4GOFA 3WU2H 5TISH 1KILD 3A0HE 4WB4A 4DZOA 1VQ9P 5BU5A 2KIKA 3GG2A 1L4AC 1EDKA 4AQRD 5B5EH 3JCUE 4GODA 2Q3EA 1H0TA 5AVWB 5AVSB 3RL0D 1BCCD 1M57D 4BXLA 2IX7C 3AEBC 1NU1D 1PP9G 4WY4B 1A02F 1UIIA 3L35A 4D6TD 1IFMA 4IOIH 2NPSD 1FZEA 1JY3P 4L73A 4W7YA 1KB9E 1JOCA 1VF5B 1NTME 1L0LD 2BEZF 1OW7A 2IFNA 4I7ZC 4XA4A 4DCKA 5CBOA 3Q2YA 1GL2B 3H6PA 1Q82Q 1VQLP 3I55P 2FFDC 2BCCE 1SQVJ 5KLVK 3FXEA 5AW2B 1YTZI 3CXHI 2BASA 1Y47A 1GK4A 3V2QA 5B5EE 2GUVA 3AEAC 1JY2P 2IBZI 2JWAA 1GW4A 2D2CC 1FU1A 2E74C 1BE3E 3L74E 3R2PA 2N1TA 3C8VA 1FZCA 2G8YA 1AQTA 1SQPD 2C9LY 4YXDC 3M0DC 3P32A 3QH9A 2HPCB 3CX5I 4M3LA 4AYCA 1SP4A 5APXA 3H1KJ 1KILB 3H1JJ 2KZIA 4JYBA 2B87A 3FGAD 1TU3F 3HD7A 2CPSA 1NTZD 1JUNA 2JWDA 2YXRB 1KMIZ 3A0BE 4DOJA 1BE3D 2FYNC 3M0DA 4L74A 3VMAA 1KV4A 1RY3A 1SS1A 1FZCC 4MN4C 1FZFA 2E76B 1NTKG 4RESB 1L0NE 3BCCD 2WSCH 3L72D 1G2CB 4EDFA 1L0ND 1GL2D 5GTHE 1NTMK 3KXDA 2YO2A 3MIWA 3H1LJ 4O9BA 1N2DC 1NTKK 1VF5D 2FYZA 3L72J 1FC2C 2ZXXA 3CCQP 2ZYAA 1SQVK 3P8CD 3L71G 3USSA 5BVZA 5KJ7D 2M0BA 3EFGA 1YHQP 1NU1E 1SFCB 2B88A 1GW3A 1YIJP 2L91A 2PRRA 1NJIQ 2WQYC 1NTZJ 2H88C 3MUDA 5B66E 1BGYJ 2FKWB 2Q3IA 5AVTB 1Q86Q 1FOSF 1KFNA 1CI6B 1M1JC 2IBZE 3TGUD 2R3CA 3CCRP 1ZMEC 1Q81Q 1KQGB 2E75D 5AW8B 3LIDA 3OW2O 2HFED 1VDFA 2NRGA 1J1EC 1FDIA 1JTHB 2FYUE 3B5NC 3GLMA 3L73J 1HGVA 3LW5J 1SQQJ 2P10A 3AE8C 1JY2O 4H13D 1H0TB 1BGYE 1SQBD 2ZVNB 3M9HA 4WY4A 1LJ2A 4UB6E 4AUWA 4DT0A 1YQ3C 3MUDC 2Y0DA 4OVNF 1L0NK 1RQUA 3I56P 1GL2A 3P7KA 1N7SA 2HYNA 3AE4C 4YXWH 2ZT9C 2P7JA 1BDCA 2P2UA 4Z1MH 1JB0J 5CCGC 1T3UA 3SWKA 1EXJA 1ZN5A 3TGUJ 2I1JA 5AW9B 1G1IA 2W27A 2V4HA 2IYPA 1T2KD 1T6AA 2SPZA 3CXHD 3IFMA 1N73B 1PZQA 4WVZA 2CK3H 2JJLA 3CC2P 2HPCA 2KS1B 4Y99B 4XFJA 1Q90D 4UB8E 1L4AD 1SQBJ 4IL6H 1R5SA 5H2FE 1IZNB 1GU5A 2B87B 1KYOE 2FXOA 2N9BA 5DJTB 3WMM0 3BCCJ 1VQ6P 3BRTB 1E79H 3RK3C 3VMZA 5CHXA 4C7RA 3A3YB 3N4XA 1ZRTE 2RKLA 5AVXB 1P84E 3CCMP 1ZV8A 2QSIA 4KT0J 1YJWP 3WU2E 3O6QA 1DEEG 2GUSA 2N1TC 3L75D 5TISE 2KUBA 1BE3G 3WUUA 4NPDA 2AXCA 2O01J 3CD6P 3KPEA 4TT3H 3JCUH 4WWIA 3VMXA 3L75J 2OYIB 3VN0A 3ABVC 1YI2P 1GDTA 2YIUB 2POHA 4Y99C 1GK6A 3HUSB 1SFCA 2W6AA 1U7MA 2Z5IA 5AW1B 5AW3B 2FYUJ 1KYOI 1AV1A 2Y9ZA 1IFDA 4LC1A 3E7KA 1VQOP 2QJKB 1SQPG 1FDMA 2K9YA 3RGUA 1VQ4P 1KB9D 1PGQA 4I1LA 2OGUA 5CMZA 5AVQB 1JMMA 1JY3O 1LWUC 3A5TA 3H1HG 3JSVC 3PTZA 1IFIA 2FFDA 2ZT9B 2ZAEB 2ZVOB 3FWNA 2GA1A 1IFNA 3S1KA 4KJMA 1EZVE 1M1JA 1NOHA 2HLOA 1NKNA 1SQXE 1PIXA 4IFMA 4PJ0E 2PFXA 3V4QA 2W6JH 2A06E 3CMAP 3VP8A 1H8AA 1KQSO 1LTAC 4JQ0D 3CMEP 5KKZB 3L73D 5APYA 1PL5A 1P84D 1J1DB 2PGDA 1ZLLA 2C0XA 2K37A 2KXPB 5C39A 1K9MQ 3NTNA 1HJBA 1DD4A 2E75B 3D6YA 2WZ7A 2H89C 1AA0A 2LXBA 3L37A 1IC2A 3HD7C 3HD7D 1J1DC 2KSJA 3OAKA 3CCLP 1HGZA 2I8DA 3CL3D 4PJ0H 2K1AA 3CWBJ 1UIXA 2LR2A 3V6IA 3L36A 3L73E 1LTIC 2K9JB 1LTJC 2E5TA 2UWJE 4W7ZA 2OYHC 1OVUA 1VPCA 2Z4EA 2JP3A 1L0LE 1NU1J 1VQ7P 1M56D 1U57A 3BASA 1VQ8P 2B89A 2FYUG 3PH0A 4CPGA 2W6BA 2Q5UA 4H44C 1S72P 2KNCB 2QJKC 4BRYA 1S9KD 2Q7CA 5AVVB 1CSBA 1PGOA 2KP8A 3L75G 3BRVB 3WUVA 3G6EP 2R5DA 3CXHE 1LTJB 1SQQD 1KORA 2OYHB 1VL2A 1RF0A 3GHGA 1EZVI 2WSEH 2YKPA 1ZW0A 2MJZA 1BSNA 3ITKA 1LP1B 1KQLA 4WBAA 3C1LA 1RQVA 1HF9A 2WMMA 2QG4A 2XV5A 1AVOA 1KD1Q 2FBWC 2PAJA 4HB1A 2FXPA 3BCCG 2H7HA 2XNXA 2NZ2A 5KKZC 1NTZK 1KC8Q 2W8ZA 5CCHD 3M9BA 1X8YA 2YMYA 1OWAA 2HR3A 5CCGA 3N7NA 2FYUD 1GZLA 3TNUA 2WWWA 3M06A 3P8CE 1RE3C 2XU6A 3NFQA 4RO0A 1M1JB 2Y0EA 1WMKA 3BVHA 1W2EA 3H1LD 1JY3N 3V4WA 1MKMA 5APVA 4N78E 5TJHA 3L72E 1FZCB 2FXMA 4EOTA 3M0AA 3S9OA 1SFCC 3IR9A 1T2KC 2ZT9D 4GKGA 1EC5A 1LWUB 4H44B 1NTZE 4ASVA 2A45H 5CCGD 5GTIH 3CCEP 3TSIA 5KAFH 1BCCE 1CW5A 1QEXA 2E43A 1SQQG 3CX5D 4L75A 2WSEJ 2E76C 4N78D 2N1TB 3H1IE 3L73G 1HUCA 3H1LE 3NXSA 3SSUA 5B66H 3CCJP 3F5HA 4N6JA 1RF1A 2FYNB 2YIUC 2HG5D 1NU1G 1PP9D 1SQQK 3FX0A 5KAIH 1PP9E 1RE4C 1AVYA 1MUUA 5APTA 3CC7P 3HD7B 3CWBG 4Y28J 1N86A 2KNCA 2E75C 2WITA 2WSCJ 1Y8AA 2YMKA 3QWOC 3W68A 4BRYB 3L72G 2LXCB 4HYTB 3OJAB 3H1LG 3H1JE 3G9RA 5KJ7C 1N73C 2YKQA 1USEA 2QM8A 1M7LA 1QVFO 4U3FE 1MV8A 3UIAA 3KHUA 3V2PA 1ZP0C 2KLUA 1NTKJ 2XKMA 1LP1A 3RL0B 4EYYQ 1H88A 1PFIA 4L76A 1YBKA 3HRNA 3KDPB 1OVVA 2K88A 2PP6A 4PV1D 4R4MA 3TDKA 2QA4P 1HJ0A 3H32A 1AJYA 3BCCE 2J5UA 3MGNA 1EXIA 2IPPA 3H1HJ 3H1JG 3H1KG 3P8MC 2IDBA 4UB8H 2GM4A 1RH5B 2M3BA 4OWFA 2KYVA 1HBWA 1QGKB 1NO4A 1SQPJ 2RN0A 1SQPK 3HTKB 3HUSC 1DD3A 4ZMDA 2I1KA 1EQ7A 3FWLA 5DJUB 1KILE 3G3ZA 1OW6A 3H1KD 2JR8A 3B4SA 1QVGO 1NAFA 1S5LX 3EQ2A 4NPEA 1GD2E 5KLVD 2QRXA 2OQQA 1SQPE 1BE3J 3MHVA 1J1EB 4JF7A 3IAOA 3H25A 4TLFA 2E76D 4GDOA 2E74D 2B9BA 1OW8A 4W80A 3A7OA 3RK3D 3U1AA 1LWUA 5BU8B 1DEBA 5CCHA 2Q9IA 1WRGA 1PP9J 4I7ZB 2W90A 5AVRB 4YTPC 2AEJA 3LIEA 2G3AA 5AW7B 4WY4C 3M9QA 1OVRA 2IYOA 1NVOA 1SFCD 2OTLP 1OZHA 5AW4B 1LTTC 1SQBG 1EDIA 2BCCJ 2KS1A 4WY4D 3TYYA 2WPQA 1CZQA 3CWBD 4C46A 1FJPA 2JKVA 1S5LH 3AE6C 3D71A 2E42A 2E5YA 1X0TA 2OYIC 2OTKE 2M5AA 3AEEC 3L74J 1U7JA 5APWA 4ASWA 1DH3A 1PV3A 1L0LG 3TGUG 1USDA 1OMIA 1RE4A 1Q7YQ 4PD4D 3PP5A 1QX8A 1SQVD 2WPVB 2WSFH 4I2LC 1QLED 5CJ0A 4IL6X 1EZVG 2HODA 3W67A 3CC4P 3RK3B 2ITAA 2CPBA 4H13B 4JYCA 3HE5B 1KYOD 2OYIA 3B5NB 1L4AA 2V7QJ 2DW3A 3MZWB 4OH8B 3H1ID 1LTSC 1PPJD 2R44A 1LNQA 3V2RA 1FAVA 3H32B 1NTKD 3KZIH 2H43A 3RBXA 2OARA 2YKOA 3L71E 1JNMA 1YYCA 3SWFA 5KAIE 4H0LD 3RK2D 2FY8A 1BGYG 3HTKA 3NMDA 1IK9A 1NTZG 1OIPA 2R3SA 3AE9C 1GL2C 2FFDB 4ZKPA 1N7SC 4OGQB 1MFZA 5KAFE 3Q5PA 4C7NA 1JEKA 1KZUB 1VF5C 3GW6A 4HJGH 1KQFB 3SWYA 1RHZB 3FXDA 1IFPA 3L71J 5L8RJ 3K5BA 2QJPC 1S3JA 2VRSA 1HH0A 2YXQB 1K73Q 1URQD 5AVYB 2O3JA 3L71D 1S1CX 3Q1MA 3IF4A 5E79H 1T3JA 2P1JA 2XNDH 3PHLA 3VMYA 1GTWA 2A45G 1GMJA 2IZ1A 5M1BA 1SLQA 1PPJE 4HH2A 3H1KE 1FBMA 1R5LA 2ZFCA 3TK1A 4K35A 3R4YA 4RJTA 1SQXK 3T97A 3F89A 3KZIE 2KOGA 1JY2N 1WT6A 2A45I 3B71A 3BATA 1ZRTD 2M3EA 1E5WA 4UB6H 2QIWA 2KLVA 3V5BA 2KI7B 5EFWB 3CI9A 1M8OB 1K04A 2A06G 2D2CD 2E74B 2P58A 2ZYDA 3PRJA 5APUA 5KTBA 3Q3DA 3KYQA 1NWQA 1KTMA 2RMZA 1URQC 3HE4A 2O01N 1NTMG 2C0WA 3M91A 1EZVD 3CLQA 3V2NA 4ZKUA 1FJKA 5AW6B 1SQVG 2Q6QA 1LTJA 2NPSC 4PV1C 5CBNA 3II6A 2OYHA 3D70A 3GHGB 1L2PA 1KB9H 3AEDC 4N3YB 5AW5B 3HE5A 4U7JA 3B5NA 1L4AB 2OTJP 2P67A 1X9VA 1KILC 1X22A 2NPSA 2Y9YA 4XE5B 3G4SP 1OXZA 4IFDK 2WPSA 1VQNP 1IFJA 4D6TG 3E1RA 2N1TD 2AXTH 2YO3A 4GIFA 1L0LK 1BCCG 1J2JB 1URQA 1ZXGA 1CI6A 1JCCA 1LT1A 1N7LA 2D2CB 3L75E 3LW5H 1IJDB 1PGJA 5H2FH 1KFMA 1FZBA 3H1HD 3TNUB 4A7PA 1S4XA 1S5LE 2BCCD 2AEFA 2M8RA 2J59M 1JTHA 3VYIA 4C7NB 3L70E 4JPZB 1L0NG 2WTYA 3CCUP 1LT9C 2A06D 1FOSE 1K05A 4JBZA 4U3FJ 1RF1C 1NU1K 1OFCX 1SQXD 3SFEC 3L74D 2QVAA 1S2EA 1FE6A 5KLVG 3CWBE 1SQXG 4DJGA 1MZ9A 1N7SB 4OGQC 1EDJA 2ZXEB 3B8EB 1KN7A 5AVZB 3JC22 4GOEA 4H0LB 3RK2B 1VQKP 2IBZG 1BSHA 4U3FG 1X79B 3VTPC 4EI2A 3T97B 3MP7B 4ZNCA 4OGQD 1S9KE 2LKMA 4PV1B 4D6TE 1T8ZA 3CXHH 1RF1B 5KJ7A 1N73A 3VOPA 2JDIH 1LT9B 2QJYC 2WVRA 2KSEA 5GTHH 3GF7A 1XTCC 3MTUE 5KLIC 2XZRA 1BCCJ 1NKZB 1HWTC 4H13C 3L70D 2WPRA 1IK7A 1LTGC 3B5ND 4D6TJ 5CCHC 1BGYD 3HE4B 2W83C 2QM7A 3AECC 3S4RA 1K8AQ 3E1IA 4BWNA 1ZOYC 1SQVE 4LGDE 2IFMA 4QMAA 2AEMA 4HKZH 4I6MC 2QJYB 1D7MA 2YNYA 3O6QB 4NPFX 1JMBA 1SQQE 3TGUE 3H1IG 3U1CA 2RH0A 1NTMD 2H8PD 2Y0CA 1M90Q 2C9NY 3RBZA 1GU4A 1Z56A 3O8ZA 1Y9BA 1RF0C 3AE2C 1LGHB 2L5GB 1NTMJ 3GHGC 2NPSB 3HUSA 3U59A 1W2BO 2ZJSE 4R4LA 3A0BH 1LTBC 2R32A 2QJPB 3A2AA 3L70J 5APSA 3CCVP 1DIPA 2KZJA 2Q1KA 1PGPA 5AW0B 1EDLA 1NTKE 1URQB 4H44D 3G71P 3I5CA 4IFFA 5CJ4A 1HVVA 3TF5A 3WUTA 4IL6E 1H89A 2QEXP 1ZR2A 1XTGB 3L70G 1KB9I 3AE3C 1A02J 2XDJA 1M1KQ 4RKUJ 1SQBK 3MD0A 1VQPP 3AE7C 4PD4E 3ZDMA 3H1IJ 3Q5SA 1ZR4A 1AFOA 1JCDA 1NH4A 1AQ5A 1JM0A 2IBZD 1SVFA 1IO4A 1P84I 5AVUB 2WT7A 5K5GB 3CX5E 3Q5RA 4K3AA 2QE7H 1W5CE 4YPCA 3AE1C 2R5BA 2WT7B 1VQ5P 1NYHA 2FYUK 2JEEA 1YTZT 1LT9A 2IZ0A 2J58A 2K9JA 2O01H 3GF3A 3D6ZA 4EIJA 3CCSP 2V7QH 1NGMB 2WSSH 1YJNP 1N7SD 2KK7A 1KILA 3EWKA 1OX3A 3KQGA 1YQ4C 3RL0C 3SFDC 3IN6A 3A0HH 2M5AB 3OA7A 4H0LC 4PD4I 1MFTA 1Q2NA 1BDDA 5APQA 3RK2C 3VP9A 2WSFJ 1VQMP 1YJ9P 3CX5H 1R8EA 3AE5C 1QL2A 2AXTE 3H1JD 1FDOA 2N9YB 3L4FA 2JO1A 2O1JA 2ZYGA 1NHLA 2OYOA 4KHXA 4PD4H 4U3FD 1G2CA 5E79E 1FZAA 1SQXJ 3AEFC 2BEQD 1HTLC 2HODB 5KLVJ 1N8RQ 2K3RA 3H1HE 1QL1A 5GTIE 4B86A 1KYOH 2O1KA 1RE3A 3RK3E 1DX7A 3GMAA 5KLIB 1FS0E 1L0LJ 2Z5HA 1JO5A 1SQBE 1L0NJ 3C9IA 3PJSK 2MKVA 4GT1A 1YITP 3L74G 1FZGA
chains in the Genus database with same CATH topology
4LLHA 2KB7P 1G1JA 1KILD 4WB4A 4DZOA 5BU5A 1L4AC 4AQRD 5AVWB 5AVSB 3RL0D 2IX7C 1A02F 4WY4B 3L35A 1IFMA 2NPSD 1FZEA 1JY3P 4W7YA 1JOCA 2IFNA 4XA4A 1GL2B 3H6PA 2FFDC 5KLVK 5AW2B 1YTZI 3V2QA 2BASA 2WT7B 1GK4A 2Z4EA 2H7HA 2GUVA 1JY2P 1GW4A 1FU1A 3R2PA 2N1TA 1FZCA 2C9LY 3M0DC 3P32A 2HPCB 4M3LA 4AYCA 1SP4A 5APXA 1KILB 4JYBA 3HD7A 2CPSA 1JUNA 4DOJA 3M0DA 1RY3A 1FZCC 1FZFA 4RESB 2WSCH 1G2CB 1GL2D 1NTMK 3MIWA 2YO2A 4O9BA 1N2DC 1NTKK 2FYZA 1SQVK 3P8CD 5BVZA 5KJ7D 3EFGA 1SFCB 1GW3A 3MUDA 1FOSF 2FKWB 2Q3IA 5AVTB 1KFNA 1CI6B 1M1JC 2R3CA 5AW8B 3LIDA 2HFED 1VDFA 1J1EC 3B5NC 1JTHB 1HGVA 1JY2O 3M9HA 4WY4A 1L0NK 1GL2A 3P7KA 1N7SA 2HYNA 2P7JA 2P2UA 5CCGC 1T3UA 1ZN5A 2I1JA 5AW9B 1G1IA 2W27A 1T2KD 3IFMA 1N73B 2JJLA 2HPCA 4Y99B 1L4AD 1GU5A 2N9BA 3WMM0 3BRTB 3RK3C 3VMZA 5CHXA 4C7RA 3A3YB 3N4XA 5AVXB 1ZV8A 2GUSA 2N1TC 3KPEA 1GDTA 3VMXA 2OYIB 3VN0A 2POHA 4Y99C 3HUSB 1GK6A 1SFCA 2W6AA 2Z5IA 5AW3B 5AW1B 1IFDA 4LC1A 1FDMA 4I1LA 5CMZA 5AVQB 3A5TA 1JMMA 1JY3O 1LWUC 2FFDA 1IFIA 1IFNA 1NOHA 1M1JA 2HLOA 4IFMA 1NKNA 3V4QA 1H8AA 1LTAC 5APYA 1J1DB 1HJBA 1ZLLA 2C0XA 3NTNA 2WZ7A 3L37A 1IC2A 3HD7C 3HD7D 1J1DC 2KSJA 3OAKA 1HGZA 3CL3D 3L36A 1LTIC 4W7ZA 1LTJC 2OYHC 1VPCA 3BASA 2W6BA 2Q5UA 1S9KD 2Q7CA 5AVVB 1CSBA 2KP8A 3BRVB 2R5DA 1LTJB 2OYHB 1RF0A 3GHGA 2WSEH 2YKPA 2MJZA 1KQLA 4WBAA 2XV5A 2PAJA 2XNXA 1NTZK 5CCHD 3M9BA 1X8YA 2YMYA 1OWAA 5CCGA 3N7NA 1GZLA 3TNUA 2WWWA 3M06A 3P8CE 1RE3C 2XU6A 3NFQA 1M1JB 3BVHA 1W2EA 3V4WA 1JY3N 5APVA 4N78E 2FXMA 4EOTA 3M0AA 1SFCC 3IR9A 1T2KC 4GKGA 1LWUB 2A45H 5CCGD 1CW5A 3TSIA 2E43A 1DH3A 4N78D 2N1TB 1FZCB 1HUCA 3NXSA 1RF1A 4N6JA 2HG5D 1SQQK 1RE4C 5APTA 1MUUA 3HD7B 1N86A 2WITA 4HYTB 3OJAB 5KJ7C 1N73C 2YKQA 2QM8A 1M7LA 1MV8A 3UIAA 3V2PA 1PFIA 2XKMA 3RL0B 1H88A 3HRNA 3KDPB 2PP6A 3H32A 3MGNA 2IPPA 3P8MC 2GM4A 2M3BA 2KYVA 1HBWA 1NO4A 3HTKB 3HUSC 1SQPK 2I1KA 1EQ7A 3G3ZA 1NAFA 3EQ2A 1GD2E 1J1EB 4JF7A 3U1AA 4AUWA 4W80A 3RK3D 3A7OA 5BU8B 2Q9IA 1LWUA 5CCHA 1DEBA 1WRGA 5AVRB 3LIEA 5AW7B 4WY4C 3M9QA 1SFCD 5AW4B 3TYYA 1LTTC 4WY4D 1FJPA 2WPQA 1CZQA 4C46A 2E42A 2OYIC 5APWA 1RE4A 3PP5A 2WSFH 4I2LC 5CJ0A 2HODA 3RK3B 2CPBA 4JYCA 3HE5B 2OYIA 3B5NB 1L4AA 4OH8B 1LTSC 3V2RA 1FAVA 3H32B 2H43A 2OARA 2YKOA 1JNMA 1YYCA 3SWFA 3RK2D 3NMDA 3HTKA 1IK9A 2FFDB 1GL2C 4ZKPA 1N7SC 1MFZA 4C7NA 1KZUB 3SWYA 2VRSA 1HH0A 1URQD 5AVYB 1GTWA 1T3JA 2P1JA 3VMYA 2A45G 1SLQA 4HH2A 1FBMA 2ZFCA 3TK1A 1SQXK 3T97A 2KOGA 1JY2N 1WT6A 2A45I 3BATA 1E5WA 2KLVA 3V5BA 3CI9A 5APUA 5KTBA 3KYQA 1NWQA 1URQC 3HE4A 3M91A 2C0WA 3CLQA 3V2NA 4ZKUA 1FJKA 5AW6B 1LTJA 2NPSC 2OYHA 3II6A 3GHGB 4N3YB 5AW5B 3HE5A 3B5NA 1L4AB 2P67A 1KILC 1X9VA 2NPSA 4XE5B 4IFDK 1OXZA 2WPSA 1IFJA 2N1TD 2YO3A 4GIFA 1L0LK 1J2JB 1URQA 1CI6A 1JCCA 1N7LA 3LW5H 1IJDB 1KFMA 1FZBA 3TNUB 2M8RA 2WTYA 2J59M 1JTHA 3VYIA 4C7NB 1H89A 1FOSE 1LT9C 1RF1C 1NU1K 1MZ9A 1N7SB 2ZXEB 3B8EB 5AVZB 3RK2B 1X79B 3VTPC 1S9KE 2LKMA 1T8ZA 1RF1B 5KJ7A 1N73A 3VOPA 1LT9B 1XTCC 3MTUE 2XZRA 1NKZB 1HWTC 2WPRA 1LTGC 3B5ND 5CCHC 3HE4B 2QM7A 3E1IA 4LGDE 2IFMA 4I6MC 2YNYA 3U1CA 2C9NY 2H8PD 1GU4A 1Z56A 3O8ZA 1RF0C 3GHGC 1LGHB 2L5GB 3U59A 2NPSB 3HUSA 1LTBC 2R32A 3A2AA 5APSA 5AW0B 1URQB 3I5CA 4IFFA 5CJ4A 1HVVA 1ZR2A 1XTGB 1A02J 2XDJA 1SQBK 3MD0A 1ZR4A 1AFOA 1JCDA 1NH4A 1AQ5A 1SVFA 1IO4A 5AVUB 2WT7A 2R5BA 2FYUK 2JEEA 1YTZT 1LT9A 2J58A 2O01H 4EIJA 1N7SD 1KILA 3KQGA 3RL0C 3OA7A 5APQA 3RK2C 3VP9A 1QL2A 3L4FA 3VP8A 2O1JA 1NHLA 4KHXA 1G2CA 1FZAA 2HODB 1HTLC 1QL1A 4B86A 2O1KA 1RE3A 1DX7A 1JO5A 2Z5HA 4GT1A 3C9IA 1FZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTZ T;  1J1E C;  1YTZ I;  1J1D C;  1J1D B;  4Y99 B;  4Y99 C;  1J1E B; 
#chains in the Genus database with same CATH topology
 5KLV E;  1NAY A;  4LLH A;  1P84 H;  2KB7 P;  3CPW O;  1PPJ G;  1G1J A;  3EFF K;  3AEG C;  3PLN A;  3RL0 g;  2BCC G;  4GOF A;  3WU2 H;  5TIS H;  1KIL D;  3A0H E;  4WB4 A;  4DZO A;  1VQ9 P;  5BU5 A;  2KIK A;  3GG2 A;  1L4A C;  1EDK A;  4AQR D;  5B5E H;  3JCU E;  4GOD A;  2Q3E A;  1H0T A;  5AVW B;  5AVS B;  3RL0 D;  1BCC D;  1M57 D;  4BXL A;  2IX7 C;  3AEB C;  1NU1 D;  1PP9 G;  4WY4 B;  1A02 F;  1UII A;  3L35 A;  4D6T D;  1IFM A;  4IOI H;  2NPS D;  1FZE A;  1JY3 P;  4L73 A;  4W7Y A;  1KB9 E;  1JOC A;  1VF5 B;  1NTM E;  1L0L D;  2BEZ F;  1OW7 A;  2IFN A;  4I7Z C;  4XA4 A;  4DCK A;  5CBO A;  3Q2Y A;  1GL2 B;  3H6P A;  1Q82 Q;  1VQL P;  3I55 P;  2FFD C;  2BCC E;  1SQV J;  5KLV K;  3FXE A;  5AW2 B;  1YTZ I;  3CXH I;  2BAS A;  1Y47 A;  1GK4 A;  3V2Q A;  5B5E E;  2GUV A;  3AEA C;  1JY2 P;  2IBZ I;  2JWA A;  1GW4 A;  2D2C C;  1FU1 A;  2E74 C;  1BE3 E;  3L74 E;  3R2P A;  2N1T A;  3C8V A;  1FZC A;  2G8Y A;  1AQT A;  1SQP D;  2C9L Y;  4YXD C;  3M0D C;  3P32 A;  3QH9 A;  2HPC B;  3CX5 I;  4M3L A;  4AYC A;  1SP4 A;  5APX A;  3H1K J;  1KIL B;  3H1J J;  2KZI A;  4JYB A;  2B87 A;  3FGA D;  1TU3 F;  3HD7 A;  2CPS A;  1NTZ D;  1JUN A;  2JWD A;  2YXR B;  1KMI Z;  3A0B E;  4DOJ A;  1BE3 D;  2FYN C;  3M0D A;  4L74 A;  3VMA A;  1KV4 A;  1RY3 A;  1SS1 A;  1FZC C;  4MN4 C;  1FZF A;  2E76 B;  1NTK G;  4RES B;  1L0N E;  3BCC D;  2WSC H;  3L72 D;  1G2C B;  4EDF A;  1L0N D;  1GL2 D;  5GTH E;  1NTM K;  3KXD A;  2YO2 A;  3MIW A;  3H1L J;  4O9B A;  1N2D C;  1NTK K;  1VF5 D;  2FYZ A;  3L72 J;  1FC2 C;  2ZXX A;  3CCQ P;  2ZYA A;  1SQV K;  3P8C D;  3L71 G;  3USS A;  5BVZ A;  5KJ7 D;  2M0B A;  3EFG A;  1YHQ P;  1NU1 E;  1SFC B;  2B88 A;  1GW3 A;  1YIJ P;  2L91 A;  2PRR A;  1NJI Q;  2WQY C;  1NTZ J;  2H88 C;  3MUD A;  5B66 E;  1BGY J;  2FKW B;  2Q3I A;  5AVT B;  1Q86 Q;  1FOS F;  1KFN A;  1CI6 B;  1M1J C;  2IBZ E;  3TGU D;  2R3C A;  3CCR P;  1ZME C;  1Q81 Q;  1KQG B;  2E75 D;  5AW8 B;  3LID A;  3OW2 O;  2HFE D;  1VDF A;  2NRG A;  1J1E C;  1FDI A;  1JTH B;  2FYU E;  3B5N C;  3GLM A;  3L73 J;  1HGV A;  3LW5 J;  1SQQ J;  2P10 A;  3AE8 C;  1JY2 O;  4H13 D;  1H0T B;  1BGY E;  1SQB D;  2ZVN B;  3M9H A;  4WY4 A;  1LJ2 A;  4UB6 E;  4AUW A;  4DT0 A;  1YQ3 C;  3MUD C;  2Y0D A;  4OVN F;  1L0N K;  1RQU A;  3I56 P;  1GL2 A;  3P7K A;  1N7S A;  2HYN A;  3AE4 C;  4YXW H;  2ZT9 C;  2P7J A;  1BDC A;  2P2U A;  4Z1M H;  1JB0 J;  5CCG C;  1T3U A;  3SWK A;  1EXJ A;  1ZN5 A;  3TGU J;  2I1J A;  5AW9 B;  1G1I A;  2W27 A;  2V4H A;  2IYP A;  1T2K D;  1T6A A;  2SPZ A;  3CXH D;  3IFM A;  1N73 B;  1PZQ A;  4WVZ A;  2CK3 H;  2JJL A;  3CC2 P;  2HPC A;  2KS1 B;  4Y99 B;  4XFJ A;  1Q90 D;  4UB8 E;  1L4A D;  1SQB J;  4IL6 H;  1R5S A;  5H2F E;  1IZN B;  1GU5 A;  2B87 B;  1KYO E;  2FXO A;  2N9B A;  5DJT B;  3WMM 0;  3BCC J;  1VQ6 P;  3BRT B;  1E79 H;  3RK3 C;  3VMZ A;  5CHX A;  4C7R A;  3A3Y B;  3N4X A;  1ZRT E;  2RKL A;  5AVX B;  1P84 E;  3CCM P;  1ZV8 A;  2QSI A;  4KT0 J;  1YJW P;  3WU2 E;  3O6Q A;  1DEE G;  2GUS A;  2N1T C;  3L75 D;  5TIS E;  2KUB A;  1BE3 G;  3WUU A;  4NPD A;  2AXC A;  2O01 J;  3CD6 P;  3KPE A;  4TT3 H;  3JCU H;  4WWI A;  3VMX A;  3L75 J;  2OYI B;  3VN0 A;  3ABV C;  1YI2 P;  1GDT A;  2YIU B;  2POH A;  4Y99 C;  1GK6 A;  3HUS B;  1SFC A;  2W6A A;  1U7M A;  2Z5I A;  5AW1 B;  5AW3 B;  2FYU J;  1KYO I;  1AV1 A;  2Y9Z A;  1IFD A;  4LC1 A;  3E7K A;  1VQO P;  2QJK B;  1SQP G;  1FDM A;  2K9Y A;  3RGU A;  1VQ4 P;  1KB9 D;  1PGQ A;  4I1L A;  2OGU A;  5CMZ A;  5AVQ B;  1JMM A;  1JY3 O;  1LWU C;  3A5T A;  3H1H G;  3JSV C;  3PTZ A;  1IFI A;  2FFD A;  2ZT9 B;  2ZAE B;  2ZVO B;  3FWN A;  2GA1 A;  1IFN A;  3S1K A;  4KJM A;  1EZV E;  1M1J A;  1NOH A;  2HLO A;  1NKN A;  1SQX E;  1PIX A;  4IFM A;  4PJ0 E;  2PFX A;  3V4Q A;  2W6J H;  2A06 E;  3CMA P;  3VP8 A;  1H8A A;  1KQS O;  1LTA C;  4JQ0 D;  3CME P;  5KKZ B;  3L73 D;  5APY A;  1PL5 A;  1P84 D;  1J1D B;  2PGD A;  1ZLL A;  2C0X A;  2K37 A;  2KXP B;  5C39 A;  1K9M Q;  3NTN A;  1HJB A;  1DD4 A;  2E75 B;  3D6Y A;  2WZ7 A;  2H89 C;  1AA0 A;  2LXB A;  3L37 A;  1IC2 A;  3HD7 C;  3HD7 D;  1J1D C;  2KSJ A;  3OAK A;  3CCL P;  1HGZ A;  2I8D A;  3CL3 D;  4PJ0 H;  2K1A A;  3CWB J;  1UIX A;  2LR2 A;  3V6I A;  3L36 A;  3L73 E;  1LTI C;  2K9J B;  1LTJ C;  2E5T A;  2UWJ E;  4W7Z A;  2OYH C;  1OVU A;  1VPC A;  2Z4E A;  2JP3 A;  1L0L E;  1NU1 J;  1VQ7 P;  1M56 D;  1U57 A;  3BAS A;  1VQ8 P;  2B89 A;  2FYU G;  3PH0 A;  4CPG A;  2W6B A;  2Q5U A;  4H44 C;  1S72 P;  2KNC B;  2QJK C;  4BRY A;  1S9K D;  2Q7C A;  5AVV B;  1CSB A;  1PGO A;  2KP8 A;  3L75 G;  3BRV B;  3WUV A;  3G6E P;  2R5D A;  3CXH E;  1LTJ B;  1SQQ D;  1KOR A;  2OYH B;  1VL2 A;  1RF0 A;  3GHG A;  1EZV I;  2WSE H;  2YKP A;  1ZW0 A;  2MJZ A;  1BSN A;  3ITK A;  1LP1 B;  1KQL A;  4WBA A;  3C1L A;  1RQV A;  1HF9 A;  2WMM A;  2QG4 A;  2XV5 A;  1AVO A;  1KD1 Q;  2FBW C;  2PAJ A;  4HB1 A;  2FXP A;  3BCC G;  2H7H A;  2XNX A;  2NZ2 A;  5KKZ C;  1NTZ K;  1KC8 Q;  2W8Z A;  5CCH D;  3M9B A;  1X8Y A;  2YMY A;  1OWA A;  2HR3 A;  5CCG A;  3N7N A;  2FYU D;  1GZL A;  3TNU A;  2WWW A;  3M06 A;  3P8C E;  1RE3 C;  2XU6 A;  3NFQ A;  4RO0 A;  1M1J B;  2Y0E A;  1WMK A;  3BVH A;  1W2E A;  3H1L D;  1JY3 N;  3V4W A;  1MKM A;  5APV A;  4N78 E;  5TJH A;  3L72 E;  1FZC B;  2FXM A;  4EOT A;  3M0A A;  3S9O A;  1SFC C;  3IR9 A;  1T2K C;  2ZT9 D;  4GKG A;  1EC5 A;  1LWU B;  4H44 B;  1NTZ E;  4ASV A;  2A45 H;  5CCG D;  5GTI H;  3CCE P;  3TSI A;  5KAF H;  1BCC E;  1CW5 A;  1QEX A;  2E43 A;  1SQQ G;  3CX5 D;  4L75 A;  2WSE J;  2E76 C;  4N78 D;  2N1T B;  3H1I E;  3L73 G;  1HUC A;  3H1L E;  3NXS A;  3SSU A;  5B66 H;  3CCJ P;  3F5H A;  4N6J A;  1RF1 A;  2FYN B;  2YIU C;  2HG5 D;  1NU1 G;  1PP9 D;  1SQQ K;  3FX0 A;  5KAI H;  1PP9 E;  1RE4 C;  1AVY A;  1MUU A;  5APT A;  3CC7 P;  3HD7 B;  3CWB G;  4Y28 J;  1N86 A;  2KNC A;  2E75 C;  2WIT A;  2WSC J;  1Y8A A;  2YMK A;  3QWO C;  3W68 A;  4BRY B;  3L72 G;  2LXC B;  4HYT B;  3OJA B;  3H1L G;  3H1J E;  3G9R A;  5KJ7 C;  1N73 C;  2YKQ A;  1USE A;  2QM8 A;  1M7L A;  1QVF O;  4U3F E;  1MV8 A;  3UIA A;  3KHU A;  3V2P A;  1ZP0 C;  2KLU A;  1NTK J;  2XKM A;  1LP1 A;  3RL0 B;  4EYY Q;  1H88 A;  1PFI A;  4L76 A;  1YBK A;  3HRN A;  3KDP B;  1OVV A;  2K88 A;  2PP6 A;  4PV1 D;  4R4M A;  3TDK A;  2QA4 P;  1HJ0 A;  3H32 A;  1AJY A;  3BCC E;  2J5U A;  3MGN A;  1EXI A;  2IPP A;  3H1H J;  3H1J G;  3H1K G;  3P8M C;  2IDB A;  4UB8 H;  2GM4 A;  1RH5 B;  2M3B A;  4OWF A;  2KYV A;  1HBW A;  1QGK B;  1NO4 A;  1SQP J;  2RN0 A;  1SQP K;  3HTK B;  3HUS C;  1DD3 A;  4ZMD A;  2I1K A;  1EQ7 A;  3FWL A;  5DJU B;  1KIL E;  3G3Z A;  1OW6 A;  3H1K D;  2JR8 A;  3B4S A;  1QVG O;  1NAF A;  1S5L X;  3EQ2 A;  4NPE A;  1GD2 E;  5KLV D;  2QRX A;  2OQQ A;  1SQP E;  1BE3 J;  3MHV A;  1J1E B;  4JF7 A;  3IAO A;  3H25 A;  4TLF A;  2E76 D;  4GDO A;  2E74 D;  2B9B A;  1OW8 A;  4W80 A;  3A7O A;  3RK3 D;  3U1A A;  1LWU A;  5BU8 B;  1DEB A;  5CCH A;  2Q9I A;  1WRG A;  1PP9 J;  4I7Z B;  2W90 A;  5AVR B;  4YTP C;  2AEJ A;  3LIE A;  2G3A A;  5AW7 B;  4WY4 C;  3M9Q A;  1OVR A;  2IYO A;  1NVO A;  1SFC D;  2OTL P;  1OZH A;  5AW4 B;  1LTT C;  1SQB G;  1EDI A;  2BCC J;  2KS1 A;  4WY4 D;  3TYY A;  2WPQ A;  1CZQ A;  3CWB D;  4C46 A;  1FJP A;  2JKV A;  1S5L H;  3AE6 C;  3D71 A;  2E42 A;  2E5Y A;  1X0T A;  2OYI C;  2OTK E;  2M5A A;  3AEE C;  3L74 J;  1U7J A;  5APW A;  4ASW A;  1DH3 A;  1PV3 A;  1L0L G;  3TGU G;  1USD A;  1OMI A;  1RE4 A;  1Q7Y Q;  4PD4 D;  3PP5 A;  1QX8 A;  1SQV D;  2WPV B;  2WSF H;  4I2L C;  1QLE D;  5CJ0 A;  4IL6 X;  1EZV G;  2HOD A;  3W67 A;  3CC4 P;  3RK3 B;  2ITA A;  2CPB A;  4H13 B;  4JYC A;  3HE5 B;  1KYO D;  2OYI A;  3B5N B;  1L4A A;  2V7Q J;  2DW3 A;  3MZW B;  4OH8 B;  3H1I D;  1LTS C;  1PPJ D;  2R44 A;  1LNQ A;  3V2R A;  1FAV A;  3H32 B;  1NTK D;  3KZI H;  2H43 A;  3RBX A;  2OAR A;  2YKO A;  3L71 E;  1JNM A;  1YYC A;  3SWF A;  5KAI E;  4H0L D;  3RK2 D;  2FY8 A;  1BGY G;  3HTK A;  3NMD A;  1IK9 A;  1NTZ G;  1OIP A;  2R3S A;  3AE9 C;  1GL2 C;  2FFD B;  4ZKP A;  1N7S C;  4OGQ B;  1MFZ A;  5KAF E;  3Q5P A;  4C7N A;  1JEK A;  1KZU B;  1VF5 C;  3GW6 A;  4HJG H;  1KQF B;  3SWY A;  1RHZ B;  3FXD A;  1IFP A;  3L71 J;  5L8R J;  3K5B A;  2QJP C;  1S3J A;  2VRS A;  1HH0 A;  2YXQ B;  1K73 Q;  1URQ D;  5AVY B;  2O3J A;  3L71 D;  1S1C X;  3Q1M A;  3IF4 A;  5E79 H;  1T3J A;  2P1J A;  2XND H;  3PHL A;  3VMY A;  1GTW A;  2A45 G;  1GMJ A;  2IZ1 A;  5M1B A;  1SLQ A;  1PPJ E;  4HH2 A;  3H1K E;  1FBM A;  1R5L A;  2ZFC A;  3TK1 A;  4K35 A;  3R4Y A;  4RJT A;  1SQX K;  3T97 A;  3F89 A;  3KZI E;  2KOG A;  1JY2 N;  1WT6 A;  2A45 I;  3B71 A;  3BAT A;  1ZRT D;  2M3E A;  1E5W A;  4UB6 H;  2QIW A;  2KLV A;  3V5B A;  2KI7 B;  5EFW B;  3CI9 A;  1M8O B;  1K04 A;  2A06 G;  2D2C D;  2E74 B;  2P58 A;  2ZYD A;  3PRJ A;  5APU A;  5KTB A;  3Q3D A;  3KYQ A;  1NWQ A;  1KTM A;  2RMZ A;  1URQ C;  3HE4 A;  2O01 N;  1NTM G;  2C0W A;  3M91 A;  1EZV D;  3CLQ A;  3V2N A;  4ZKU A;  1FJK A;  5AW6 B;  1SQV G;  2Q6Q A;  1LTJ A;  2NPS C;  4PV1 C;  5CBN A;  3II6 A;  2OYH A;  3D70 A;  3GHG B;  1L2P A;  1KB9 H;  3AED C;  4N3Y B;  5AW5 B;  3HE5 A;  4U7J A;  3B5N A;  1L4A B;  2OTJ P;  2P67 A;  1X9V A;  1KIL C;  1X22 A;  2NPS A;  2Y9Y A;  4XE5 B;  3G4S P;  1OXZ A;  4IFD K;  2WPS A;  1VQN P;  1IFJ A;  4D6T G;  3E1R A;  2N1T D;  2AXT H;  2YO3 A;  4GIF A;  1L0L K;  1BCC G;  1J2J B;  1URQ A;  1ZXG A;  1CI6 A;  1JCC A;  1LT1 A;  1N7L A;  2D2C B;  3L75 E;  3LW5 H;  1IJD B;  1PGJ A;  5H2F H;  1KFM A;  1FZB A;  3H1H D;  3TNU B;  4A7P A;  1S4X A;  1S5L E;  2BCC D;  2AEF A;  2M8R A;  2J59 M;  1JTH A;  3VYI A;  4C7N B;  3L70 E;  4JPZ B;  1L0N G;  2WTY A;  3CCU P;  1LT9 C;  2A06 D;  1FOS E;  1K05 A;  4JBZ A;  4U3F J;  1RF1 C;  1NU1 K;  1OFC X;  1SQX D;  3SFE C;  3L74 D;  2QVA A;  1S2E A;  1FE6 A;  5KLV G;  3CWB E;  1SQX G;  4DJG A;  1MZ9 A;  1N7S B;  4OGQ C;  1EDJ A;  2ZXE B;  3B8E B;  1KN7 A;  5AVZ B;  3JC2 2;  4GOE A;  4H0L B;  3RK2 B;  1VQK P;  2IBZ G;  1BSH A;  4U3F G;  1X79 B;  3VTP C;  4EI2 A;  3T97 B;  3MP7 B;  4ZNC A;  4OGQ D;  1S9K E;  2LKM A;  4PV1 B;  4D6T E;  1T8Z A;  3CXH H;  1RF1 B;  5KJ7 A;  1N73 A;  3VOP A;  2JDI H;  1LT9 B;  2QJY C;  2WVR A;  2KSE A;  5GTH H;  3GF7 A;  1XTC C;  3MTU E;  5KLI C;  2XZR A;  1BCC J;  1NKZ B;  1HWT C;  4H13 C;  3L70 D;  2WPR A;  1IK7 A;  1LTG C;  3B5N D;  4D6T J;  5CCH C;  1BGY D;  3HE4 B;  2W83 C;  2QM7 A;  3AEC C;  3S4R A;  1K8A Q;  3E1I A;  4BWN A;  1ZOY C;  1SQV E;  4LGD E;  2IFM A;  4QMA A;  2AEM A;  4HKZ H;  4I6M C;  2QJY B;  1D7M A;  2YNY A;  3O6Q B;  4NPF X;  1JMB A;  1SQQ E;  3TGU E;  3H1I G;  3U1C A;  2RH0 A;  1NTM D;  2H8P D;  2Y0C A;  1M90 Q;  2C9N Y;  3RBZ A;  1GU4 A;  1Z56 A;  3O8Z A;  1Y9B A;  1RF0 C;  3AE2 C;  1LGH B;  2L5G B;  1NTM J;  3GHG C;  2NPS B;  3HUS A;  3U59 A;  1W2B O;  2ZJS E;  4R4L A;  3A0B H;  1LTB C;  2R32 A;  2QJP B;  3A2A A;  3L70 J;  5APS A;  3CCV P;  1DIP A;  2KZJ A;  2Q1K A;  1PGP A;  5AW0 B;  1EDL A;  1NTK E;  1URQ B;  4H44 D;  3G71 P;  3I5C A;  4IFF A;  5CJ4 A;  1HVV A;  3TF5 A;  3WUT A;  4IL6 E;  1H89 A;  2QEX P;  1ZR2 A;  1XTG B;  3L70 G;  1KB9 I;  3AE3 C;  1A02 J;  2XDJ A;  1M1K Q;  4RKU J;  1SQB K;  3MD0 A;  1VQP P;  3AE7 C;  4PD4 E;  3ZDM A;  3H1I J;  3Q5S A;  1ZR4 A;  1AFO A;  1JCD A;  1NH4 A;  1AQ5 A;  1JM0 A;  2IBZ D;  1SVF A;  1IO4 A;  1P84 I;  5AVU B;  2WT7 A;  5K5G B;  3CX5 E;  3Q5R A;  4K3A A;  2QE7 H;  1W5C E;  4YPC A;  3AE1 C;  2R5B A;  2WT7 B;  1VQ5 P;  1NYH A;  2FYU K;  2JEE A;  1YTZ T;  1LT9 A;  2IZ0 A;  2J58 A;  2K9J A;  2O01 H;  3GF3 A;  3D6Z A;  4EIJ A;  3CCS P;  2V7Q H;  1NGM B;  2WSS H;  1YJN P;  1N7S D;  2KK7 A;  1KIL A;  3EWK A;  1OX3 A;  3KQG A;  1YQ4 C;  3RL0 C;  3SFD C;  3IN6 A;  3A0H H;  2M5A B;  3OA7 A;  4H0L C;  4PD4 I;  1MFT A;  1Q2N A;  1BDD A;  5APQ A;  3RK2 C;  3VP9 A;  2WSF J;  1VQM P;  1YJ9 P;  3CX5 H;  1R8E A;  3AE5 C;  1QL2 A;  2AXT E;  3H1J D;  1FDO A;  2N9Y B;  3L4F A;  2JO1 A;  2O1J A;  2ZYG A;  1NHL A;  2OYO A;  4KHX A;  4PD4 H;  4U3F D;  1G2C A;  5E79 E;  1FZA A;  1SQX J;  3AEF C;  2BEQ D;  1HTL C;  2HOD B;  5KLV J;  1N8R Q;  2K3R A;  3H1H E;  1QL1 A;  5GTI E;  4B86 A;  1KYO H;  2O1K A;  1RE3 A;  3RK3 E;  1DX7 A;  3GMA A;  5KLI B;  1FS0 E;  1L0L J;  2Z5H A;  1JO5 A;  1SQB E;  1L0N J;  3C9I A;  3PJS K;  2MKV A;  4GT1 A;  1YIT P;  3L74 G;  1FZG A; 
#chains in the Genus database with same CATH homology
 4LLH A;  2KB7 P;  1G1J A;  1KIL D;  4WB4 A;  4DZO A;  5BU5 A;  1L4A C;  4AQR D;  5AVW B;  5AVS B;  3RL0 D;  2IX7 C;  1A02 F;  4WY4 B;  3L35 A;  1IFM A;  2NPS D;  1FZE A;  1JY3 P;  4W7Y A;  1JOC A;  2IFN A;  4XA4 A;  1GL2 B;  3H6P A;  2FFD C;  5KLV K;  5AW2 B;  1YTZ I;  3V2Q A;  2BAS A;  2WT7 B;  1GK4 A;  2Z4E A;  2H7H A;  2GUV A;  1JY2 P;  1GW4 A;  1FU1 A;  3R2P A;  2N1T A;  1FZC A;  2C9L Y;  3M0D C;  3P32 A;  2HPC B;  4M3L A;  4AYC A;  1SP4 A;  5APX A;  1KIL B;  4JYB A;  3HD7 A;  2CPS A;  1JUN A;  4DOJ A;  3M0D A;  1RY3 A;  1FZC C;  1FZF A;  4RES B;  2WSC H;  1G2C B;  1GL2 D;  1NTM K;  3MIW A;  2YO2 A;  4O9B A;  1N2D C;  1NTK K;  2FYZ A;  1SQV K;  3P8C D;  5BVZ A;  5KJ7 D;  3EFG A;  1SFC B;  1GW3 A;  3MUD A;  1FOS F;  2FKW B;  2Q3I A;  5AVT B;  1KFN A;  1CI6 B;  1M1J C;  2R3C A;  5AW8 B;  3LID A;  2HFE D;  1VDF A;  1J1E C;  3B5N C;  1JTH B;  1HGV A;  1JY2 O;  3M9H A;  4WY4 A;  1L0N K;  1GL2 A;  3P7K A;  1N7S A;  2HYN A;  2P7J A;  2P2U A;  5CCG C;  1T3U A;  1ZN5 A;  2I1J A;  5AW9 B;  1G1I A;  2W27 A;  1T2K D;  3IFM A;  1N73 B;  2JJL A;  2HPC A;  4Y99 B;  1L4A D;  1GU5 A;  2N9B A;  3WMM 0;  3BRT B;  3RK3 C;  3VMZ A;  5CHX A;  4C7R A;  3A3Y B;  3N4X A;  5AVX B;  1ZV8 A;  2GUS A;  2N1T C;  3KPE A;  1GDT A;  3VMX A;  2OYI B;  3VN0 A;  2POH A;  4Y99 C;  3HUS B;  1GK6 A;  1SFC A;  2W6A A;  2Z5I A;  5AW3 B;  5AW1 B;  1IFD A;  4LC1 A;  1FDM A;  4I1L A;  5CMZ A;  5AVQ B;  3A5T A;  1JMM A;  1JY3 O;  1LWU C;  2FFD A;  1IFI A;  1IFN A;  1NOH A;  1M1J A;  2HLO A;  4IFM A;  1NKN A;  3V4Q A;  1H8A A;  1LTA C;  5APY A;  1J1D B;  1HJB A;  1ZLL A;  2C0X A;  3NTN A;  2WZ7 A;  3L37 A;  1IC2 A;  3HD7 C;  3HD7 D;  1J1D C;  2KSJ A;  3OAK A;  1HGZ A;  3CL3 D;  3L36 A;  1LTI C;  4W7Z A;  1LTJ C;  2OYH C;  1VPC A;  3BAS A;  2W6B A;  2Q5U A;  1S9K D;  2Q7C A;  5AVV B;  1CSB A;  2KP8 A;  3BRV B;  2R5D A;  1LTJ B;  2OYH B;  1RF0 A;  3GHG A;  2WSE H;  2YKP A;  2MJZ A;  1KQL A;  4WBA A;  2XV5 A;  2PAJ A;  2XNX A;  1NTZ K;  5CCH D;  3M9B A;  1X8Y A;  2YMY A;  1OWA A;  5CCG A;  3N7N A;  1GZL A;  3TNU A;  2WWW A;  3M06 A;  3P8C E;  1RE3 C;  2XU6 A;  3NFQ A;  1M1J B;  3BVH A;  1W2E A;  3V4W A;  1JY3 N;  5APV A;  4N78 E;  2FXM A;  4EOT A;  3M0A A;  1SFC C;  3IR9 A;  1T2K C;  4GKG A;  1LWU B;  2A45 H;  5CCG D;  1CW5 A;  3TSI A;  2E43 A;  1DH3 A;  4N78 D;  2N1T B;  1FZC B;  1HUC A;  3NXS A;  1RF1 A;  4N6J A;  2HG5 D;  1SQQ K;  1RE4 C;  5APT A;  1MUU A;  3HD7 B;  1N86 A;  2WIT A;  4HYT B;  3OJA B;  5KJ7 C;  1N73 C;  2YKQ A;  2QM8 A;  1M7L A;  1MV8 A;  3UIA A;  3V2P A;  1PFI A;  2XKM A;  3RL0 B;  1H88 A;  3HRN A;  3KDP B;  2PP6 A;  3H32 A;  3MGN A;  2IPP A;  3P8M C;  2GM4 A;  2M3B A;  2KYV A;  1HBW A;  1NO4 A;  3HTK B;  3HUS C;  1SQP K;  2I1K A;  1EQ7 A;  3G3Z A;  1NAF A;  3EQ2 A;  1GD2 E;  1J1E B;  4JF7 A;  3U1A A;  4AUW A;  4W80 A;  3RK3 D;  3A7O A;  5BU8 B;  2Q9I A;  1LWU A;  5CCH A;  1DEB A;  1WRG A;  5AVR B;  3LIE A;  5AW7 B;  4WY4 C;  3M9Q A;  1SFC D;  5AW4 B;  3TYY A;  1LTT C;  4WY4 D;  1FJP A;  2WPQ A;  1CZQ A;  4C46 A;  2E42 A;  2OYI C;  5APW A;  1RE4 A;  3PP5 A;  2WSF H;  4I2L C;  5CJ0 A;  2HOD A;  3RK3 B;  2CPB A;  4JYC A;  3HE5 B;  2OYI A;  3B5N B;  1L4A A;  4OH8 B;  1LTS C;  3V2R A;  1FAV A;  3H32 B;  2H43 A;  2OAR A;  2YKO A;  1JNM A;  1YYC A;  3SWF A;  3RK2 D;  3NMD A;  3HTK A;  1IK9 A;  2FFD B;  1GL2 C;  4ZKP A;  1N7S C;  1MFZ A;  4C7N A;  1KZU B;  3SWY A;  2VRS A;  1HH0 A;  1URQ D;  5AVY B;  1GTW A;  1T3J A;  2P1J A;  3VMY A;  2A45 G;  1SLQ A;  4HH2 A;  1FBM A;  2ZFC A;  3TK1 A;  1SQX K;  3T97 A;  2KOG A;  1JY2 N;  1WT6 A;  2A45 I;  3BAT A;  1E5W A;  2KLV A;  3V5B A;  3CI9 A;  5APU A;  5KTB A;  3KYQ A;  1NWQ A;  1URQ C;  3HE4 A;  3M91 A;  2C0W A;  3CLQ A;  3V2N A;  4ZKU A;  1FJK A;  5AW6 B;  1LTJ A;  2NPS C;  2OYH A;  3II6 A;  3GHG B;  4N3Y B;  5AW5 B;  3HE5 A;  3B5N A;  1L4A B;  2P67 A;  1KIL C;  1X9V A;  2NPS A;  4XE5 B;  4IFD K;  1OXZ A;  2WPS A;  1IFJ A;  2N1T D;  2YO3 A;  4GIF A;  1L0L K;  1J2J B;  1URQ A;  1CI6 A;  1JCC A;  1N7L A;  3LW5 H;  1IJD B;  1KFM A;  1FZB A;  3TNU B;  2M8R A;  2WTY A;  2J59 M;  1JTH A;  3VYI A;  4C7N B;  1H89 A;  1FOS E;  1LT9 C;  1RF1 C;  1NU1 K;  1MZ9 A;  1N7S B;  2ZXE B;  3B8E B;  5AVZ B;  3RK2 B;  1X79 B;  3VTP C;  1S9K E;  2LKM A;  1T8Z A;  1RF1 B;  5KJ7 A;  1N73 A;  3VOP A;  1LT9 B;  1XTC C;  3MTU E;  2XZR A;  1NKZ B;  1HWT C;  2WPR A;  1LTG C;  3B5N D;  5CCH C;  3HE4 B;  2QM7 A;  3E1I A;  4LGD E;  2IFM A;  4I6M C;  2YNY A;  3U1C A;  2C9N Y;  2H8P D;  1GU4 A;  1Z56 A;  3O8Z A;  1RF0 C;  3GHG C;  1LGH B;  2L5G B;  3U59 A;  2NPS B;  3HUS A;  1LTB C;  2R32 A;  3A2A A;  5APS A;  5AW0 B;  1URQ B;  3I5C A;  4IFF A;  5CJ4 A;  1HVV A;  1ZR2 A;  1XTG B;  1A02 J;  2XDJ A;  1SQB K;  3MD0 A;  1ZR4 A;  1AFO A;  1JCD A;  1NH4 A;  1AQ5 A;  1SVF A;  1IO4 A;  5AVU B;  2WT7 A;  2R5B A;  2FYU K;  2JEE A;  1YTZ T;  1LT9 A;  2J58 A;  2O01 H;  4EIJ A;  1N7S D;  1KIL A;  3KQG A;  3RL0 C;  3OA7 A;  5APQ A;  3RK2 C;  3VP9 A;  1QL2 A;  3L4F A;  3VP8 A;  2O1J A;  1NHL A;  4KHX A;  1G2C A;  1FZA A;  2HOD B;  1HTL C;  1QL1 A;  4B86 A;  2O1K A;  1RE3 A;  1DX7 A;  1JO5 A;  2Z5H A;  4GT1 A;  3C9I A;  1FZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...