4Y99B

Core domain of human cardiac troponin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
74
structure length
74
Chain Sequence
GKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Core domain of human cardiac troponin
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 31
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4y99B00
1J1EC 1J1DC 1YTZT 4Y99C 1J1EB 1J1DB 1YTZI 4Y99B
chains in the Genus database with same CATH superfamily
1L0NG 3CCMP 1USDA 3VMYA 1YQ3C 1Q90D 1Q2NA 5K5GB 2Q5UA 3B5NA 4HJGH 1BGYJ 2QRXA 2QSIA 1URQB 5KLIB 3L71D 1N7SA 1LTJB 3AEEC 2B87B 2YO3A 3CCSP 5KAFH 5AVTB 3CCJP 2WWWA 2PAJA 2HR3A 3RK3E 1W2EA 1S5LH 3H1HE 3MUDC 2HG5D 2Y9ZA 1DD3A 2BASA 1SQPD 3USSA 1LT1A 3Q5SA 4N78E 2YMYA 1S5LX 1SP4A 4W80A 1SQQK 3H1JD 3P8CE 2H43A 2WSFH 3L73E 1FDOA 4EDFA 3H32B 2BCCG 1NTMD 3IF4A 5AVSB 1QVGO 3FWNA 2L5GB 3E1RA 2W8ZA 4ZMDA 3GW6A 2FYUJ 2BEQD 3O6QA 1L0LD 1HJ0A 3MTUE 4OH8B 3BATA 1LTTC 5APTA 2FY8A 4BRYB 1BGYG 5KJ7A 2E5TA 1GK6A 1X79B 3P32A 1KILB 1LT9A 2WPSA 4H13D 2FXPA 2AEJA 2A06G 3ABVC 4XFJA 1IFJA 1BE3J 1GL2B 1L4AA 5AW3B 3O8ZA 1YBKA 5AW5B 3SFDC 3SFEC 1KD1Q 1NTKE 3M9BA 1P84E 1IK7A 1WMKA 2QE7H 3GF3A 2N9BA 3CWBD 2E76D 2OYIA 2FYUE 4ASVA 4B86A 4WBAA 1GMJA 4AYCA 2D2CC 1EDIA 1QL1A 3AE9C 2E75C 5AVYB 3CCEP 2KLUA 5BVZA 2N1TD 3H1KJ 3D71A 1SFCB 2FFDB 2JR8A 3IAOA 2IPPA 2HODB 2RH0A 1DH3A 1HH0A 3EWKA 1Q7YQ 1KV4A 1BE3E 2Y9YA 2NPSA 2OYOA 5BU5A 1J1EC 1YQ4C 2WPRA 1RE3A 1SQVJ 4HKZH 2CK3H 3I55P 1Q82Q 3HD7D 1RE4A 3VYIA 1RE3C 2FYZA 5GTIE 1CW5A 2HFED 1BCCE 1SQBD 1L0ND 2M3BA 4MN4C 3C9IA 3NMDA 1YI2P 2AEMA 3CCRP 1CZQA 1E5WA 5B66E 2J59M 1KILE 1FDIA 1FOSE 4LC1A 1OVRA 1OVVA 1JMBA 3H1LJ 5TJHA 2K9YA 2YXRB 3G71P 1W5CE 2FYUK 2WPVB 3RL0C 1IJDB 4UB6H 2CPBA 3H1KG 1NAYA 1RF0C 3VMAA 4JPZB 4IOIH 3CC2P 1T3JA 4LGDE 1IZNB 1VQPP 3N4XA 4I2LC 2M5AB 2P10A 1VQ7P 2YMKA 3CXHH 2BCCD 1HF9A 2IFNA 1URQA 4OGQD 2SPZA 1SQVG 5APYA 1LTJA 2R44A 2B87A 1PGQA 5KLIC 4W7ZA 4KT0J 2IBZG 1AVYA 3Q5PA 1BSNA 5APXA 3M91A 3H1LE 1SS1A 3TYYA 4HYTB 2G3AA 3TSIA 5TISH 1CI6B 2XNDH 3L72J 3CX5I 4NPFX 4PD4I 4WY4C 2IYOA 4H0LC 1KQGB 1KYOI 1BGYD 3CX5H 4NPDA 4PD4H 2OGUA 2OARA 2YKPA 5GTHH 4RESB 1KYOH 2A06D 5AVXB 3RK2D 1U7MA 3G4SP 3H1LG 1IO4A 3H32A 2KYVA 5CBOA 5H2FH 1DEBA 1FAVA 3CXHD 2D2CB 1OMIA 2E75B 3A3YB 4R4MA 3KZIE 2FKWB 3H1IJ 1ZV8A 1QL2A 4I1LA 2YKOA 3L70J 2W6JH 1SQQJ 3KHUA 5CCGA 2XZRA 1T2KD 3BCCJ 1RQVA 2PP6A 4IL6E 4BRYA 3QH9A 4TT3H 3TK1A 3A0HH 3CC7P 1M1JA 3L74E 1J1EB 5CBNA 1KILA 1M1JC 1KN7A 1N86A 3CX5D 4PD4D 2P2UA 3KPEA 1T8ZA 4U3FJ 3E7KA 1EXJA 3HTKB 1JY2N 4Y99C 3RGUA 1KYOD 1VF5D 1PGPA 2NRGA 1GL2A 3SWKA 1SLQA 1L2PA 1IFDA 4WB4A 1FZFA 1JY3N 1Q81Q 4JBZA 5AW0B 1PP9E 4UB8E 1EZVE 2JDIH 1H89A 1ZRTE 3VP8A 3L72G 1NJIQ 3LIEA 2K3RA 1LNQA 3H1IE 1NHLA 3HE4B 1KFMA 1KQFB 4OVNF 3WMM0 1EXIA 4H44D 5AW9B 1SFCA 1FZCC 5KLVJ 3BCCE 2IBZI 2H88C 2FXMA 3CMAP 1VQ9P 1NU1E 4I6MC 3RL0B 1YJNP 1KB9E 3H1HJ 3H1IG 1IFPA 4GDOA 1PFIA 4U3FE 2Y0CA 1HGVA 3L70G 2XU6A 4W7YA 5M1BA 1OWAA 2Z5IA 1LP1B 1SQQG 1JOCA 5DJUB 3L73J 3H1KD 3CD6P 2H89C 2RN0A 1D7MA 2YKQA 1SQXJ 2BEZF 1NTZE 1HBWA 4U3FG 1CSBA 4IFMA 3WU2H 2WITA 2B89A 4BXLA 5AW1B 1NGMB 1KFNA 1N8RQ 2WSEH 5KLVE 3U1AA 4QMAA 1SQVD 4WY4B 3MUDA 2OTKE 4H0LB 2IBZD 2POHA 4H13C 1WRGA 1HTLC 4YTPC 2WSCH 2ITAA 1ZR2A 5AVZB 2Z4EA 2O1JA 3R4YA 1J1DC 3TGUJ 1NTKJ 1PGOA 2ZFCA 5B5EH 3AE6C 4ASWA 3IN6A 3PP5A 3HE5B 2R3CA 3BASA 1SQXE 4D6TE 1GW4A 3MGNA 4BWNA 1OIPA 1NU1K 3H1HG 1NAFA 2E76C 3PTZA 2M5AA 1PPJE 2J58A 3A0BE 1H8AA 1ZMEC 5APUA 2JO1A 1AFOA 2N1TC 3F89A 3B5ND 3G3ZA 1USEA 3OJAB 1M8OB 2OQQA 1FZBA 3L73G 1E79H 2Y0EA 1KORA 5AW7B 1M1JB 1VQLP 1H0TB 1N7SD 2LR2A 4PJ0H 3CXHE 1CI6A 4Y99B 4IFFA 1NTZK 1S9KE 3U59A 3MD0A 2Q3IA 5AVVB 2M8RA 5AVRB 1IFMA 3HD7C 2AEFA 1A02F 3TGUE 2E74D 5KLVK 3AEBC 3LW5H 2DW3A 1VDFA 2V7QJ 2JKVA 2ZYGA 1N73C 2QJKC 3Q1MA 3BRTB 3E1IA 1BCCJ 2ZXEB 1PGJA 3L75J 1KTMA 3Q3DA 1AQ5A 3L72D 2O01J 1FZCB 1G2CA 3VMZA 4XA4A 2IYPA 1NKZB 4EOTA 1EQ7A 1U7JA 5KAIH 3JCUE 3S9OA 2QIWA 5E79E 3TGUG 1NTKG 1OW8A 3CLQA 1AQTA 3FXEA 3BRVB 2O1KA 2HYNA 1YYCA 1DIPA 1SQXK 1XTCC 2FYUG 1QVFO 3EQ2A 2MJZA 3M9QA 2W27A 5APWA 2HLOA 1H88A 5L8RJ 3HTKA 1EC5A 5KJ7D 2ZT9D 1MFTA 3L70D 2L91A 1WT6A 1M90Q 1R8EA 1KC8Q 3I5CA 1Y9BA 1SQQD 1S4XA 3WUUA 4K3AA 1RH5B 1X8YA 3L75E 1MKMA 1L4AD 1GTWA 3VTPC 2P7JA 2N9YB 3QWOC 1YITP 4OGQC 1BE3G 4GIFA 1EDKA 3HE4A 3MIWA 5CCHC 3D70A 2KS1B 2KK7A 3S4RA 3NXSA 2OTLP 1NTKK 1JCCA 1RHZB 3AEDC 4H13B 5CJ0A 2OTJP 2MKVA 3A2AA 3F5HA 1BCCG 1G1IA 4XE5B 5DJTB 4DZOA 2ZVNB 3H6PA 1J1DB 3TDKA 3L71E 1YTZT 1RF0A 2KI7B 3D6YA 1YJ9P 2O01N 3ZDMA 3RK2C 1LP1A 2ZAEB 2KB7P 1S72P 2C9LY 3GLMA 2WSSH 2E76B 3M9HA 3V2NA 3D6ZA 2NPSD 4JF7A 2ZYDA 2N1TB 1QX8A 2Q1KA 2P58A 3RK3D 1SQPE 3H1HD 5CCHD 3M0DC 1PV3A 4EI2A 3H1JE 4NPEA 2WSFJ 4EIJA 4I7ZC 2P67A 1T2KC 1NTME 1P84I 4N78D 4WY4A 3P8CD 2J5UA 3JC22 3L37A 3L73D 1JO5A 3CCQP 3AEAC 2ZVOB 3L74J 1P84H 2OYHC 3HD7B 2W83C 3VOPA 1NWQA 3UIAA 1YIJP 1VF5C 2KNCA 2ZJSE 1FU1A 5KAFE 2E42A 2FXOA 1OFCX 3AE3C 3CC4P 2QVAA 1N73B 2QJKB 1JY2O 1L0LE 2B9BA 2AXTH 4DJGA 1M1KQ 1PP9J 1S5LE 2ZXXA 3VP9A 1JY3O 3HE5A 2WMMA 1Q86Q 3V2PA 3Q2YA 4AUWA 1M57D 1FJKA 2I1JA 4Z1MH 1EDJA 1G2CB 2W6AA 1U57A 1VQOP 2RMZA 1GU5A 2WPQA 4H44C 1OX3A 3AE7C 3R2PA 5KKZC 1BDCA 3G9RA 2R3SA 2I8DA 2KOGA 3WUTA 4A7PA 1LTAC 1TU3F 1N2DC 3EFFK 3G6EP 1URQD 1NU1J 3AE8C 4L76A 1FC2C 1P84D 4C7NB 1UIXA 3CWBE 2PFXA 1H0TA 3HRNA 1SQBJ 2W6BA 1G1JA 1NO4A 5GTIH 5KTBA 1ZW0A 3Q5RA 3WUVA 1ZXGA 1PIXA 1SQPK 2FYUD 2M0BA 1ZOYC 2UWJE 2Q9IA 4L74A 3V5BA 3AECC 2O01H 4HH2A 5B66H 1NTMK 4OGQB 2K88A 2XDJA 2ZYAA 2QM8A 1YTZI 1GZLA 2K37A 1LTBC 3L74G 2H7HA 1NTZJ 1ZN5A 3GF7A 1KQSO 3TNUB 2AXCA 2YNYA 1IC2A 1FZCA 1VQNP 1BE3D 3B71A 4RO0A 4KHXA 1PP9G 1L0LK 4RJTA 3AE2C 1EZVG 3FWLA 4YXDC 4ZKUA 3V2RA 1RF1C 1SQBE 3AEGC 1L0NE 1LWUC 3JSVC 3RK2B 2WVRA 5CCGD 3B8EB 3P8MC 3TF5A 1BCCD 1VQ8P 3GG2A 2Q3EA 3CCLP 4C7RA 2R5DA 1GK4A 2PGDA 4K35A 3BCCG 3BVHA 1KILD 3L35A 4HB1A 1AV1A 3II6A 1NU1G 1LGHB 2XNXA 2QEXP 4R4LA 3AE5C 4D6TJ 3NTNA 1BSHA 2YIUC 1GL2D 3CL3D 1QGKB 2QJPC 1JUNA 1RQUA 1FZEA 1KMIZ 4I7ZB 3HUSA 3B5NC 2KS1A 3HUSC 4GKGA 1HGZA 1UIIA 2OYHB 1N7SC 1OW7A 1JM0A 1QEXA 5APQA 1VF5B 3M0AA 1NTZG 1HVVA 3I56P 2GM4A 2BCCE 2KP8A 2KNCB 1KZUB 3A5TA 3T97B 1SFCD 1X0TA 3L36A 1OVUA 4GOFA 1M56D 2GA1A 5AVWB 2JWAA 3OA7A 3MZWB 5KLVG 3KZIH 2E74C 1OW6A 5EFWB 3N7NA 1VQ6P 1DD4A 2QA4P 3H1LD 1SQBK 1L0NK 4CPGA 2N1TA 4UB6E 2R5BA 5CHXA 1GD2E 4H44B 5KKZB 1BGYE 2KZIA 3H25A 3C8VA 3U1CA 4RKUJ 4IL6H 2YXQB 2FBWC 2JP3A 1T3UA 5AVQB 2NZ2A 2KIKA 2A06E 4N3YB 3KYQA 1JTHB 3GHGA 1K73Q 1SQXG 3SWYA 4D6TG 4IL6X 1JEKA 3GHGC 1EZVI 3MHVA 1PPJG 1W2BO 3CCVP 3OW2O 2FYNC 3HD7A 3IR9A 4UB8H 1MUUA 1PZQA 3V4WA 5KJ7C 1Z56A 2ZT9C 2GUVA 2A45G 3PJSK 1LT9C 2B88A 1N73A 5AW4B 1YHQP 5APVA 3B4SA 1NOHA 5TISE 4JYCA 1PL5A 2QG4A 1L4AC 2I1KA 1FE6A 4OWFA 2C0WA 1LTIC 2K9JB 3GMAA 1KB9I 3CX5E 4PD4E 5C39A 2HPCB 2Y0DA 5GTHE 1KYOE 1N7LA 3L74D 1AA0A 3FX0A 4IFDK 1KB9H 2G8YA 2LKMA 2AXTE 2OYIC 2H8PD 1RF1B 2E43A 5H2FE 3AE1C 1LWUB 2WT7B 1IK9A 1Y8AA 2Q7CA 3C1LA 1NH4A 4C7NA 1PP9D 1EZVD 1NKNA 1HJBA 1ZRTD 3A7OA 1IFNA 3L71J 3KDPB 3H1ID 1K8AQ 3K5BA 5AW8B 2YIUB 1FZAA 1NVOA 2NPSC 4DT0A 3A0HE 1VQ5P 2QJPB 2Z5HA 1VPCA 4M3LA 3SSUA 3AE4C 1BDDA 3BCCD 1RE4C 5CCHA 3B5NB 3RK3C 1NU1D 3HUSB 2JEEA 3FGAD 3FXDA 2LXBA 1SQPJ 1KB9D 3TNUA 3M06A 3PHLA 4U3FD 1N7SB 4AQRD 1MV8A 1ZLLA 3VMXA 3H1JJ 2IZ1A 2D2CD 3AEFC 4WWIA 2E75D 3H1KE 4KJMA 1NTMJ 3CMEP 2IZ0A 1XTGB 2KSEA 2K1AA 3L75G 2R32A 2RKLA 1M7LA 4C46A 3KQGA 3W67A 4U7JA 2E74B 1FZGA 1R5SA 1NTZD 4PV1C 4DOJA 3PH0A 2WSEJ 2QJYC 1FS0E 3KXDA 1DEEG 1K04A 2XV5A 3A0BH 1L0LJ 1SQVE 5AVUB 2A45I 2IFMA 1OZHA 1FBMA 4GT1A 2IBZE 5KLVD 2VRSA 3RBXA 2A45H 2PRRA 4L75A 1K9MQ 1VQ4P 3M0DA 2WSCJ 3CXHI 3LIDA 3L71G 3V4QA 1VQKP 2XKMA 1FJPA 1ZR4A 1VQMP 1AVOA 1S1CX 1X9VA 2WZ7A 2M3EA 2W90A 2YO2A 3GHGB 2KXPB 2E5YA 2WQYC 1URQC 4JQ0D 3O6QB 3RBZA 3V2QA 2OYHA 2FYNB 1LTJC 1S2EA 1FOSF 3CWBJ 2C9NY 2JWDA 3WU2E 1IFIA 3CI9A 2ZT9B 4ZKPA 1SQXD 1JMMA 4D6TD 1SQPG 2O3JA 2IX7C 1LT9B 3T97A 5BU8B 2GUSA 1S3JA 3S1KA 1PPJD 4PV1D 3MP7B 1QLED 1MZ9A 1K05A 1YJWP 3H1JG 4GOEA 1L4AB 3RL0D 3W68A 1Y47A 1NTMG 4O9BA 3CPWO 1LJ2A 1GDTA 3JCUH 5E79H 4Y28J 5CJ4A 5CMZA 3EFGA 2LXCB 2OYIB 5AW2B 1KQLA 5APSA 5B5EE 1S9KD 1ZP0C 1L0LG 3V6IA 3CCUP 4JYBA 3LW5J 3SWFA 3RL0g 1JTHA 4YXWH 1SQVK 3TGUD 1NTKD 2KSJA 4TLFA 2C0XA 3ITKA 3NFQA 1L0NJ 4N6JA 5CCGC 1R5LA 2V7QH 1HUCA 3VN0A 3L72E 1LTGC 2NPSB 1T6AA 4WY4D 2Q6QA 4H0LD 4WVZA 1GW3A 2KUBA 1KILC 1DX7A 3OAKA 1EDLA 4PJ0E 3RK3B 2CPSA 3CWBG 1GL2C 4L73A 2QM7A 1AJYA 2K9JA 3P7KA 1HWTC 2V4HA 1OXZA 2HPCA 1GU4A 4EYYQ 2P1JA 4GODA 1VL2A 3L70E 3IFMA 1RF1A 1SQQE 1RY3A 2KLVA 1LWUA 2WT7A 3PRJA 2WTYA 1LTSC 2IDBA 1JY2P 4ZNCA 2FFDA 1MFZA 1JNMA 4PV1B 2BCCJ 1SFCC 2FFDC 2QJYB 5AW6B 1JB0J 3L75D 1NYHA 2HODA 1JY3P 3L4FA 1A02J 5KAIE 4LLHA 1J2JB 3PLNA 1X22A 1JCDA 1SVFA 4YPCA 4DCKA 2KZJA 2JJLA 1SQBG 1FDMA
chains in the Genus database with same CATH topology
3A2AA 5KJ7C 1Z56A 3VMYA 2GUVA 1G1IA 2A45G 1LT9C 4XE5B 2Q5UA 3B5NA 3H6PA 5AW4B 4DZOA 1N73A 5APVA 1J1DB 5CCGA 1NOHA 4JYCA 1YTZT 1RF0A 2XZRA 1URQB 1T2KD 1L4AC 2I1KA 2PP6A 2C0WA 1N7SA 3RK2C 1LTJB 1LTIC 2KB7P 3TK1A 1M1JA 2YO3A 2C9LY 1J1EB 1KILA 2HPCB 1M1JC 3M9HA 3V2NA 1N7LA 1N86A 2P2UA 3KPEA 1T8ZA 5AVTB 4IFDK 2NPSD 3HTKB 4JF7A 1JY2N 4Y99C 2LKMA 1GL2A 2WWWA 2OYIC 2PAJA 1SLQA 2H8PD 1RF1B 2E43A 2N1TB 1W2EA 1IFDA 4WB4A 1FZFA 1JY3N 1LWUB 2WT7B 1IK9A 5AW0B 3RK3D 2HG5D 2Q7CA 5CCHD 3M0DC 2BASA 1H89A 1NH4A 4C7NA 3VP8A 1NKNA 3LIEA 1HJBA 4N78E 4EIJA 2YMYA 1SP4A 2P67A 3A7OA 1IFNA 4W80A 1T2KC 1NHLA 1SQQK 3HE4B 3KDPB 3P8CE 2H43A 1KFMA 2WSFH 4N78D 4WY4A 3WMM0 3H32B 3P8CD 3L37A 5AVSB 1JO5A 2L5GB 5AW8B 2OYHC 3HD7B 1FZAA 5AW9B 3VOPA 1SFCA 2NPSC 3UIAA 1NWQA 1FZCC 2FXMA 2Z5HA 1VPCA 4M3LA 1FU1A 2E42A 4I6MC 3RL0B 1RE4C 5CCHA 3B5NB 1N73B 3RK3C 1JY2O 3HUSB 2JEEA 1PFIA 3TNUA 1HGVA 3M06A 3MTUE 2XU6A 4OH8B 3VP9A 3BATA 1JY3O 1LTTC 4W7YA 3HE5A 1OWAA 5APTA 2Z5IA 1N7SB 3V2PA 4AQRD 1MV8A 1ZLLA 3VMXA 4AUWA 5KJ7A 1JOCA 1GK6A 1X79B 1FJKA 2I1JA 3P32A 1KILB 1LT9A 2WPSA 1G2CB 2W6AA 1XTGB 2R32A 1GU5A 1M7LA 1IFJA 2WPQA 4C46A 1GL2B 3R2PA 1L4AA 2YKQA 5AW3B 3KQGA 3O8ZA 2KOGA 1HBWA 1LTAC 5AW5B 1N2DC 1FZGA 1CSBA 3M9BA 4DOJA 1URQD 4IFMA 2WITA 5AW1B 4C7NB 3HRNA 1KFNA 2XV5A 2W6BA 2WSEH 2N9BA 5AVUB 1G1JA 1NO4A 2A45I 2IFMA 3U1AA 5KTBA 2OYIA 1FBMA 4GT1A 2VRSA 4B86A 4WBAA 1SQPK 4WY4B 3MUDA 4AYCA 1QL1A 2A45H 5AVYB 2POHA 3M0DA 1WRGA 3LIDA 5BVZA 3V4QA 2N1TD 2XKMA 2Q9IA 1FJPA 1SFCB 1HTLC 3V5BA 2FFDB 3V4WA 2WSCH 1ZR4A 2O01H 4HH2A 1NTMK 1ZR2A 5AVZB 2XDJA 2QM8A 2IPPA 1YTZI 1X9VA 1GZLA 2HODB 1LTBC 2WZ7A 2Z4EA 2O1JA 2H7HA 1J1DC 2YO2A 3GHGB 1ZN5A 1DH3A 1HH0A 1URQC 2ZFCA 3TNUB 3V2QA 2OYHA 3PP5A 1LTJC 3HE5B 2YNYA 2NPSA 2R3CA 3BASA 1FOSF 1IC2A 1FZCA 1GW4A 3MGNA 5BU5A 2C9NY 1J1EC 1NU1K 1NAFA 1IFIA 2WPRA 3CI9A 1RE3A 4KHXA 4ZKPA 1JMMA 3HD7D 2IX7C 1LT9B 1RE4A 1L0LK 3T97A 2J58A 5BU8B 3VYIA 1RE3C 2FYZA 1H8AA 2GUSA 4ZKUA 5APUA 1AFOA 3V2RA 1MZ9A 1RF1C 2N1TC 1CW5A 2HFED 1L4AB 3RL0D 1LWUC 3B5ND 3G3ZA 3OJAB 4O9BA 3RK2B 1FZBA 5CCGD 3B8EB 3P8MC 2M3BA 3C9IA 1GDTA 3NMDA 5AW7B 1M1JB 4C7RA 1CZQA 1N7SD 1E5WA 5CJ4A 2J59M 5CMZA 2R5DA 1CI6A 4Y99B 1GK4A 3EFGA 1FOSE 4LC1A 4IFFA 2OYIB 1NTZK 3BVHA 1KILD 3L35A 1S9KE 3U59A 3II6A 1LGHB 3MD0A 2Q3IA 2XNXA 5AVVB 2M8RA 5AW2B 1KQLA 5APSA 5AVRB 1S9KD 3NTNA 1IFMA 3HD7C 1A02F 4JYBA 1GL2D 3CL3D 3SWFA 1JTHA 5KLVK 1SQVK 3LW5H 2KSJA 1JUNA 1FZEA 1VDFA 2C0XA 2FYUK 3HUSA 3RL0C 1IJDB 3B5NC 1N73C 3BRTB 3NFQA 3HUSC 4N6JA 5CCGC 2CPBA 3E1IA 2ZXEB 1RF0C 1HUCA 4GKGA 3VN0A 1HGZA 1LTGC 2OYHB 1N7SC 1T3JA 1AQ5A 2NPSB 4WY4D 5APQA 1FZCB 4LGDE 3M0AA 1G2CA 3VMZA 4XA4A 3N4XA 1HVVA 1NKZB 4EOTA 1GW3A 1EQ7A 2GM4A 1KILC 4I2LC 2KP8A 1DX7A 1KZUB 3A5TA 3OAKA 3CLQA 3BRVB 1SFCD 3L36A 3RK3B 2O1KA 2HYNA 2CPSA 2IFNA 1URQA 5AVWB 1GL2C 3OA7A 1YYCA 2QM7A 5APYA 1SQXK 1LTJA 1XTCC 3P7KA 1HWTC 3N7NA 4W7ZA 1OXZA 3EQ2A 2MJZA 5APXA 2HPCA 3M91A 3M9QA 2W27A 5APWA 3TYYA 2HLOA 1H88A 1GU4A 2P1JA 3HTKA 4HYTB 3IFMA 3TSIA 1SQBK 5KJ7D 1CI6B 1RF1A 1L0NK 2N1TA 1GD2E 2R5BA 5CHXA 1WT6A 4WY4C 1RY3A 2KLVA 1LWUA 3U1CA 2WT7A 3I5CA 2WTYA 1T3UA 1LTSC 5AVQB 1JY2P 2FFDA 1MFZA 1X8YA 1JNMA 4N3YB 2OARA 1SFCC 1L4AD 2FFDC 2YKPA 4RESB 3KYQA 5AVXB 1JTHB 5AW6B 2P7JA 3VTPC 2HODA 1JY3P 3RK2D 1GTWA 3L4FA 1A02J 3GHGA 4LLHA 4GIFA 3HE4A 3MIWA 1J2JB 3SWYA 5CCHC 3GHGC 1IO4A 3H32A 2KYVA 1JCDA 1DEBA 1SVFA 1FAVA 3NXSA 1NTKK 1JCCA 3A3YB 3HD7A 3IR9A 2FKWB 5CJ0A 1MUUA 2JJLA 1ZV8A 1FDMA 1QL2A 4I1LA 2YKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1E C;  1J1D C;  1YTZ T;  4Y99 C;  1J1E B;  1J1D B;  1YTZ I;  4Y99 B; 
#chains in the Genus database with same CATH topology
 1L0N G;  3CCM P;  1USD A;  3VMY A;  1YQ3 C;  1Q90 D;  1Q2N A;  5K5G B;  2Q5U A;  3B5N A;  4HJG H;  1BGY J;  2QRX A;  2QSI A;  1URQ B;  5KLI B;  3L71 D;  1N7S A;  1LTJ B;  3AEE C;  2B87 B;  2YO3 A;  3CCS P;  5KAF H;  5AVT B;  3CCJ P;  2WWW A;  2PAJ A;  2HR3 A;  3RK3 E;  1W2E A;  1S5L H;  3H1H E;  3MUD C;  2HG5 D;  2Y9Z A;  1DD3 A;  2BAS A;  1SQP D;  3USS A;  1LT1 A;  3Q5S A;  4N78 E;  2YMY A;  1S5L X;  1SP4 A;  4W80 A;  1SQQ K;  3H1J D;  3P8C E;  2H43 A;  2WSF H;  3L73 E;  1FDO A;  4EDF A;  3H32 B;  2BCC G;  1NTM D;  3IF4 A;  5AVS B;  1QVG O;  3FWN A;  2L5G B;  3E1R A;  2W8Z A;  4ZMD A;  3GW6 A;  2FYU J;  2BEQ D;  3O6Q A;  1L0L D;  1HJ0 A;  3MTU E;  4OH8 B;  3BAT A;  1LTT C;  5APT A;  2FY8 A;  4BRY B;  1BGY G;  5KJ7 A;  2E5T A;  1GK6 A;  1X79 B;  3P32 A;  1KIL B;  1LT9 A;  2WPS A;  4H13 D;  2FXP A;  2AEJ A;  2A06 G;  3ABV C;  4XFJ A;  1IFJ A;  1BE3 J;  1GL2 B;  1L4A A;  5AW3 B;  3O8Z A;  1YBK A;  5AW5 B;  3SFD C;  3SFE C;  1KD1 Q;  1NTK E;  3M9B A;  1P84 E;  1IK7 A;  1WMK A;  2QE7 H;  3GF3 A;  2N9B A;  3CWB D;  2E76 D;  2OYI A;  2FYU E;  4ASV A;  4B86 A;  4WBA A;  1GMJ A;  4AYC A;  2D2C C;  1EDI A;  1QL1 A;  3AE9 C;  2E75 C;  5AVY B;  3CCE P;  2KLU A;  5BVZ A;  2N1T D;  3H1K J;  3D71 A;  1SFC B;  2FFD B;  2JR8 A;  3IAO A;  2IPP A;  2HOD B;  2RH0 A;  1DH3 A;  1HH0 A;  3EWK A;  1Q7Y Q;  1KV4 A;  1BE3 E;  2Y9Y A;  2NPS A;  2OYO A;  5BU5 A;  1J1E C;  1YQ4 C;  2WPR A;  1RE3 A;  1SQV J;  4HKZ H;  2CK3 H;  3I55 P;  1Q82 Q;  3HD7 D;  1RE4 A;  3VYI A;  1RE3 C;  2FYZ A;  5GTI E;  1CW5 A;  2HFE D;  1BCC E;  1SQB D;  1L0N D;  2M3B A;  4MN4 C;  3C9I A;  3NMD A;  1YI2 P;  2AEM A;  3CCR P;  1CZQ A;  1E5W A;  5B66 E;  2J59 M;  1KIL E;  1FDI A;  1FOS E;  4LC1 A;  1OVR A;  1OVV A;  1JMB A;  3H1L J;  5TJH A;  2K9Y A;  2YXR B;  3G71 P;  1W5C E;  2FYU K;  2WPV B;  3RL0 C;  1IJD B;  4UB6 H;  2CPB A;  3H1K G;  1NAY A;  1RF0 C;  3VMA A;  4JPZ B;  4IOI H;  3CC2 P;  1T3J A;  4LGD E;  1IZN B;  1VQP P;  3N4X A;  4I2L C;  2M5A B;  2P10 A;  1VQ7 P;  2YMK A;  3CXH H;  2BCC D;  1HF9 A;  2IFN A;  1URQ A;  4OGQ D;  2SPZ A;  1SQV G;  5APY A;  1LTJ A;  2R44 A;  2B87 A;  1PGQ A;  5KLI C;  4W7Z A;  4KT0 J;  2IBZ G;  1AVY A;  3Q5P A;  1BSN A;  5APX A;  3M91 A;  3H1L E;  1SS1 A;  3TYY A;  4HYT B;  2G3A A;  3TSI A;  5TIS H;  1CI6 B;  2XND H;  3L72 J;  3CX5 I;  4NPF X;  4PD4 I;  4WY4 C;  2IYO A;  4H0L C;  1KQG B;  1KYO I;  1BGY D;  3CX5 H;  4NPD A;  4PD4 H;  2OGU A;  2OAR A;  2YKP A;  5GTH H;  4RES B;  1KYO H;  2A06 D;  5AVX B;  3RK2 D;  1U7M A;  3G4S P;  3H1L G;  1IO4 A;  3H32 A;  2KYV A;  5CBO A;  5H2F H;  1DEB A;  1FAV A;  3CXH D;  2D2C B;  1OMI A;  2E75 B;  3A3Y B;  4R4M A;  3KZI E;  2FKW B;  3H1I J;  1ZV8 A;  1QL2 A;  4I1L A;  2YKO A;  3L70 J;  2W6J H;  1SQQ J;  3KHU A;  5CCG A;  2XZR A;  1T2K D;  3BCC J;  1RQV A;  2PP6 A;  4IL6 E;  4BRY A;  3QH9 A;  4TT3 H;  3TK1 A;  3A0H H;  3CC7 P;  1M1J A;  3L74 E;  1J1E B;  5CBN A;  1KIL A;  1M1J C;  1KN7 A;  1N86 A;  3CX5 D;  4PD4 D;  2P2U A;  3KPE A;  1T8Z A;  4U3F J;  3E7K A;  1EXJ A;  3HTK B;  1JY2 N;  4Y99 C;  3RGU A;  1KYO D;  1VF5 D;  1PGP A;  2NRG A;  1GL2 A;  3SWK A;  1SLQ A;  1L2P A;  1IFD A;  4WB4 A;  1FZF A;  1JY3 N;  1Q81 Q;  4JBZ A;  5AW0 B;  1PP9 E;  4UB8 E;  1EZV E;  2JDI H;  1H89 A;  1ZRT E;  3VP8 A;  3L72 G;  1NJI Q;  3LIE A;  2K3R A;  1LNQ A;  3H1I E;  1NHL A;  3HE4 B;  1KFM A;  1KQF B;  4OVN F;  3WMM 0;  1EXI A;  4H44 D;  5AW9 B;  1SFC A;  1FZC C;  5KLV J;  3BCC E;  2IBZ I;  2H88 C;  2FXM A;  3CMA P;  1VQ9 P;  1NU1 E;  4I6M C;  3RL0 B;  1YJN P;  1KB9 E;  3H1H J;  3H1I G;  1IFP A;  4GDO A;  1PFI A;  4U3F E;  2Y0C A;  1HGV A;  3L70 G;  2XU6 A;  4W7Y A;  5M1B A;  1OWA A;  2Z5I A;  1LP1 B;  1SQQ G;  1JOC A;  5DJU B;  3L73 J;  3H1K D;  3CD6 P;  2H89 C;  2RN0 A;  1D7M A;  2YKQ A;  1SQX J;  2BEZ F;  1NTZ E;  1HBW A;  4U3F G;  1CSB A;  4IFM A;  3WU2 H;  2WIT A;  2B89 A;  4BXL A;  5AW1 B;  1NGM B;  1KFN A;  1N8R Q;  2WSE H;  5KLV E;  3U1A A;  4QMA A;  1SQV D;  4WY4 B;  3MUD A;  2OTK E;  4H0L B;  2IBZ D;  2POH A;  4H13 C;  1WRG A;  1HTL C;  4YTP C;  2WSC H;  2ITA A;  1ZR2 A;  5AVZ B;  2Z4E A;  2O1J A;  3R4Y A;  1J1D C;  3TGU J;  1NTK J;  1PGO A;  2ZFC A;  5B5E H;  3AE6 C;  4ASW A;  3IN6 A;  3PP5 A;  3HE5 B;  2R3C A;  3BAS A;  1SQX E;  4D6T E;  1GW4 A;  3MGN A;  4BWN A;  1OIP A;  1NU1 K;  3H1H G;  1NAF A;  2E76 C;  3PTZ A;  2M5A A;  1PPJ E;  2J58 A;  3A0B E;  1H8A A;  1ZME C;  5APU A;  2JO1 A;  1AFO A;  2N1T C;  3F89 A;  3B5N D;  3G3Z A;  1USE A;  3OJA B;  1M8O B;  2OQQ A;  1FZB A;  3L73 G;  1E79 H;  2Y0E A;  1KOR A;  5AW7 B;  1M1J B;  1VQL P;  1H0T B;  1N7S D;  2LR2 A;  4PJ0 H;  3CXH E;  1CI6 A;  4Y99 B;  4IFF A;  1NTZ K;  1S9K E;  3U59 A;  3MD0 A;  2Q3I A;  5AVV B;  2M8R A;  5AVR B;  1IFM A;  3HD7 C;  2AEF A;  1A02 F;  3TGU E;  2E74 D;  5KLV K;  3AEB C;  3LW5 H;  2DW3 A;  1VDF A;  2V7Q J;  2JKV A;  2ZYG A;  1N73 C;  2QJK C;  3Q1M A;  3BRT B;  3E1I A;  1BCC J;  2ZXE B;  1PGJ A;  3L75 J;  1KTM A;  3Q3D A;  1AQ5 A;  3L72 D;  2O01 J;  1FZC B;  1G2C A;  3VMZ A;  4XA4 A;  2IYP A;  1NKZ B;  4EOT A;  1EQ7 A;  1U7J A;  5KAI H;  3JCU E;  3S9O A;  2QIW A;  5E79 E;  3TGU G;  1NTK G;  1OW8 A;  3CLQ A;  1AQT A;  3FXE A;  3BRV B;  2O1K A;  2HYN A;  1YYC A;  1DIP A;  1SQX K;  1XTC C;  2FYU G;  1QVF O;  3EQ2 A;  2MJZ A;  3M9Q A;  2W27 A;  5APW A;  2HLO A;  1H88 A;  5L8R J;  3HTK A;  1EC5 A;  5KJ7 D;  2ZT9 D;  1MFT A;  3L70 D;  2L91 A;  1WT6 A;  1M90 Q;  1R8E A;  1KC8 Q;  3I5C A;  1Y9B A;  1SQQ D;  1S4X A;  3WUU A;  4K3A A;  1RH5 B;  1X8Y A;  3L75 E;  1MKM A;  1L4A D;  1GTW A;  3VTP C;  2P7J A;  2N9Y B;  3QWO C;  1YIT P;  4OGQ C;  1BE3 G;  4GIF A;  1EDK A;  3HE4 A;  3MIW A;  5CCH C;  3D70 A;  2KS1 B;  2KK7 A;  3S4R A;  3NXS A;  2OTL P;  1NTK K;  1JCC A;  1RHZ B;  3AED C;  4H13 B;  5CJ0 A;  2OTJ P;  2MKV A;  3A2A A;  3F5H A;  1BCC G;  1G1I A;  4XE5 B;  5DJT B;  4DZO A;  2ZVN B;  3H6P A;  1J1D B;  3TDK A;  3L71 E;  1YTZ T;  1RF0 A;  2KI7 B;  3D6Y A;  1YJ9 P;  2O01 N;  3ZDM A;  3RK2 C;  1LP1 A;  2ZAE B;  2KB7 P;  1S72 P;  2C9L Y;  3GLM A;  2WSS H;  2E76 B;  3M9H A;  3V2N A;  3D6Z A;  2NPS D;  4JF7 A;  2ZYD A;  2N1T B;  1QX8 A;  2Q1K A;  2P58 A;  3RK3 D;  1SQP E;  3H1H D;  5CCH D;  3M0D C;  1PV3 A;  4EI2 A;  3H1J E;  4NPE A;  2WSF J;  4EIJ A;  4I7Z C;  2P67 A;  1T2K C;  1NTM E;  1P84 I;  4N78 D;  4WY4 A;  3P8C D;  2J5U A;  3JC2 2;  3L37 A;  3L73 D;  1JO5 A;  3CCQ P;  3AEA C;  2ZVO B;  3L74 J;  1P84 H;  2OYH C;  3HD7 B;  2W83 C;  3VOP A;  1NWQ A;  3UIA A;  1YIJ P;  1VF5 C;  2KNC A;  2ZJS E;  1FU1 A;  5KAF E;  2E42 A;  2FXO A;  1OFC X;  3AE3 C;  3CC4 P;  2QVA A;  1N73 B;  2QJK B;  1JY2 O;  1L0L E;  2B9B A;  2AXT H;  4DJG A;  1M1K Q;  1PP9 J;  1S5L E;  2ZXX A;  3VP9 A;  1JY3 O;  3HE5 A;  2WMM A;  1Q86 Q;  3V2P A;  3Q2Y A;  4AUW A;  1M57 D;  1FJK A;  2I1J A;  4Z1M H;  1EDJ A;  1G2C B;  2W6A A;  1U57 A;  1VQO P;  2RMZ A;  1GU5 A;  2WPQ A;  4H44 C;  1OX3 A;  3AE7 C;  3R2P A;  5KKZ C;  1BDC A;  3G9R A;  2R3S A;  2I8D A;  2KOG A;  3WUT A;  4A7P A;  1LTA C;  1TU3 F;  1N2D C;  3EFF K;  3G6E P;  1URQ D;  1NU1 J;  3AE8 C;  4L76 A;  1FC2 C;  1P84 D;  4C7N B;  1UIX A;  3CWB E;  2PFX A;  1H0T A;  3HRN A;  1SQB J;  2W6B A;  1G1J A;  1NO4 A;  5GTI H;  5KTB A;  1ZW0 A;  3Q5R A;  3WUV A;  1ZXG A;  1PIX A;  1SQP K;  2FYU D;  2M0B A;  1ZOY C;  2UWJ E;  2Q9I A;  4L74 A;  3V5B A;  3AEC C;  2O01 H;  4HH2 A;  5B66 H;  1NTM K;  4OGQ B;  2K88 A;  2XDJ A;  2ZYA A;  2QM8 A;  1YTZ I;  1GZL A;  2K37 A;  1LTB C;  3L74 G;  2H7H A;  1NTZ J;  1ZN5 A;  3GF7 A;  1KQS O;  3TNU B;  2AXC A;  2YNY A;  1IC2 A;  1FZC A;  1VQN P;  1BE3 D;  3B71 A;  4RO0 A;  4KHX A;  1PP9 G;  1L0L K;  4RJT A;  3AE2 C;  1EZV G;  3FWL A;  4YXD C;  4ZKU A;  3V2R A;  1RF1 C;  1SQB E;  3AEG C;  1L0N E;  1LWU C;  3JSV C;  3RK2 B;  2WVR A;  5CCG D;  3B8E B;  3P8M C;  3TF5 A;  1BCC D;  1VQ8 P;  3GG2 A;  2Q3E A;  3CCL P;  4C7R A;  2R5D A;  1GK4 A;  2PGD A;  4K35 A;  3BCC G;  3BVH A;  1KIL D;  3L35 A;  4HB1 A;  1AV1 A;  3II6 A;  1NU1 G;  1LGH B;  2XNX A;  2QEX P;  4R4L A;  3AE5 C;  4D6T J;  3NTN A;  1BSH A;  2YIU C;  1GL2 D;  3CL3 D;  1QGK B;  2QJP C;  1JUN A;  1RQU A;  1FZE A;  1KMI Z;  4I7Z B;  3HUS A;  3B5N C;  2KS1 A;  3HUS C;  4GKG A;  1HGZ A;  1UII A;  2OYH B;  1N7S C;  1OW7 A;  1JM0 A;  1QEX A;  5APQ A;  1VF5 B;  3M0A A;  1NTZ G;  1HVV A;  3I56 P;  2GM4 A;  2BCC E;  2KP8 A;  2KNC B;  1KZU B;  3A5T A;  3T97 B;  1SFC D;  1X0T A;  3L36 A;  1OVU A;  4GOF A;  1M56 D;  2GA1 A;  5AVW B;  2JWA A;  3OA7 A;  3MZW B;  5KLV G;  3KZI H;  2E74 C;  1OW6 A;  5EFW B;  3N7N A;  1VQ6 P;  1DD4 A;  2QA4 P;  3H1L D;  1SQB K;  1L0N K;  4CPG A;  2N1T A;  4UB6 E;  2R5B A;  5CHX A;  1GD2 E;  4H44 B;  5KKZ B;  1BGY E;  2KZI A;  3H25 A;  3C8V A;  3U1C A;  4RKU J;  4IL6 H;  2YXQ B;  2FBW C;  2JP3 A;  1T3U A;  5AVQ B;  2NZ2 A;  2KIK A;  2A06 E;  4N3Y B;  3KYQ A;  1JTH B;  3GHG A;  1K73 Q;  1SQX G;  3SWY A;  4D6T G;  4IL6 X;  1JEK A;  3GHG C;  1EZV I;  3MHV A;  1PPJ G;  1W2B O;  3CCV P;  3OW2 O;  2FYN C;  3HD7 A;  3IR9 A;  4UB8 H;  1MUU A;  1PZQ A;  3V4W A;  5KJ7 C;  1Z56 A;  2ZT9 C;  2GUV A;  2A45 G;  3PJS K;  1LT9 C;  2B88 A;  1N73 A;  5AW4 B;  1YHQ P;  5APV A;  3B4S A;  1NOH A;  5TIS E;  4JYC A;  1PL5 A;  2QG4 A;  1L4A C;  2I1K A;  1FE6 A;  4OWF A;  2C0W A;  1LTI C;  2K9J B;  3GMA A;  1KB9 I;  3CX5 E;  4PD4 E;  5C39 A;  2HPC B;  2Y0D A;  5GTH E;  1KYO E;  1N7L A;  3L74 D;  1AA0 A;  3FX0 A;  4IFD K;  1KB9 H;  2G8Y A;  2LKM A;  2AXT E;  2OYI C;  2H8P D;  1RF1 B;  2E43 A;  5H2F E;  3AE1 C;  1LWU B;  2WT7 B;  1IK9 A;  1Y8A A;  2Q7C A;  3C1L A;  1NH4 A;  4C7N A;  1PP9 D;  1EZV D;  1NKN A;  1HJB A;  1ZRT D;  3A7O A;  1IFN A;  3L71 J;  3KDP B;  3H1I D;  1K8A Q;  3K5B A;  5AW8 B;  2YIU B;  1FZA A;  1NVO A;  2NPS C;  4DT0 A;  3A0H E;  1VQ5 P;  2QJP B;  2Z5H A;  1VPC A;  4M3L A;  3SSU A;  3AE4 C;  1BDD A;  3BCC D;  1RE4 C;  5CCH A;  3B5N B;  3RK3 C;  1NU1 D;  3HUS B;  2JEE A;  3FGA D;  3FXD A;  2LXB A;  1SQP J;  1KB9 D;  3TNU A;  3M06 A;  3PHL A;  4U3F D;  1N7S B;  4AQR D;  1MV8 A;  1ZLL A;  3VMX A;  3H1J J;  2IZ1 A;  2D2C D;  3AEF C;  4WWI A;  2E75 D;  3H1K E;  4KJM A;  1NTM J;  3CME P;  2IZ0 A;  1XTG B;  2KSE A;  2K1A A;  3L75 G;  2R32 A;  2RKL A;  1M7L A;  4C46 A;  3KQG A;  3W67 A;  4U7J A;  2E74 B;  1FZG A;  1R5S A;  1NTZ D;  4PV1 C;  4DOJ A;  3PH0 A;  2WSE J;  2QJY C;  1FS0 E;  3KXD A;  1DEE G;  1K04 A;  2XV5 A;  3A0B H;  1L0L J;  1SQV E;  5AVU B;  2A45 I;  2IFM A;  1OZH A;  1FBM A;  4GT1 A;  2IBZ E;  5KLV D;  2VRS A;  3RBX A;  2A45 H;  2PRR A;  4L75 A;  1K9M Q;  1VQ4 P;  3M0D A;  2WSC J;  3CXH I;  3LID A;  3L71 G;  3V4Q A;  1VQK P;  2XKM A;  1FJP A;  1ZR4 A;  1VQM P;  1AVO A;  1S1C X;  1X9V A;  2WZ7 A;  2M3E A;  2W90 A;  2YO2 A;  3GHG B;  2KXP B;  2E5Y A;  2WQY C;  1URQ C;  4JQ0 D;  3O6Q B;  3RBZ A;  3V2Q A;  2OYH A;  2FYN B;  1LTJ C;  1S2E A;  1FOS F;  3CWB J;  2C9N Y;  2JWD A;  3WU2 E;  1IFI A;  3CI9 A;  2ZT9 B;  4ZKP A;  1SQX D;  1JMM A;  4D6T D;  1SQP G;  2O3J A;  2IX7 C;  1LT9 B;  3T97 A;  5BU8 B;  2GUS A;  1S3J A;  3S1K A;  1PPJ D;  4PV1 D;  3MP7 B;  1QLE D;  1MZ9 A;  1K05 A;  1YJW P;  3H1J G;  4GOE A;  1L4A B;  3RL0 D;  3W68 A;  1Y47 A;  1NTM G;  4O9B A;  3CPW O;  1LJ2 A;  1GDT A;  3JCU H;  5E79 H;  4Y28 J;  5CJ4 A;  5CMZ A;  3EFG A;  2LXC B;  2OYI B;  5AW2 B;  1KQL A;  5APS A;  5B5E E;  1S9K D;  1ZP0 C;  1L0L G;  3V6I A;  3CCU P;  4JYB A;  3LW5 J;  3SWF A;  3RL0 g;  1JTH A;  4YXW H;  1SQV K;  3TGU D;  1NTK D;  2KSJ A;  4TLF A;  2C0X A;  3ITK A;  3NFQ A;  1L0N J;  4N6J A;  5CCG C;  1R5L A;  2V7Q H;  1HUC A;  3VN0 A;  3L72 E;  1LTG C;  2NPS B;  1T6A A;  4WY4 D;  2Q6Q A;  4H0L D;  4WVZ A;  1GW3 A;  2KUB A;  1KIL C;  1DX7 A;  3OAK A;  1EDL A;  4PJ0 E;  3RK3 B;  2CPS A;  3CWB G;  1GL2 C;  4L73 A;  2QM7 A;  1AJY A;  2K9J A;  3P7K A;  1HWT C;  2V4H A;  1OXZ A;  2HPC A;  1GU4 A;  4EYY Q;  2P1J A;  4GOD A;  1VL2 A;  3L70 E;  3IFM A;  1RF1 A;  1SQQ E;  1RY3 A;  2KLV A;  1LWU A;  2WT7 A;  3PRJ A;  2WTY A;  1LTS C;  2IDB A;  1JY2 P;  4ZNC A;  2FFD A;  1MFZ A;  1JNM A;  4PV1 B;  2BCC J;  1SFC C;  2FFD C;  2QJY B;  5AW6 B;  1JB0 J;  3L75 D;  1NYH A;  2HOD A;  1JY3 P;  3L4F A;  1A02 J;  5KAI E;  4LLH A;  1J2J B;  3PLN A;  1X22 A;  1JCD A;  1SVF A;  4YPC A;  4DCK A;  2KZJ A;  2JJL A;  1SQB G;  1FDM A; 
#chains in the Genus database with same CATH homology
 3A2A A;  5KJ7 C;  1Z56 A;  3VMY A;  2GUV A;  1G1I A;  2A45 G;  1LT9 C;  4XE5 B;  2Q5U A;  3B5N A;  3H6P A;  5AW4 B;  4DZO A;  1N73 A;  5APV A;  1J1D B;  5CCG A;  1NOH A;  4JYC A;  1YTZ T;  1RF0 A;  2XZR A;  1URQ B;  1T2K D;  1L4A C;  2I1K A;  2PP6 A;  2C0W A;  1N7S A;  3RK2 C;  1LTJ B;  1LTI C;  2KB7 P;  3TK1 A;  1M1J A;  2YO3 A;  2C9L Y;  1J1E B;  1KIL A;  2HPC B;  1M1J C;  3M9H A;  3V2N A;  1N7L A;  1N86 A;  2P2U A;  3KPE A;  1T8Z A;  5AVT B;  4IFD K;  2NPS D;  3HTK B;  4JF7 A;  1JY2 N;  4Y99 C;  2LKM A;  1GL2 A;  2WWW A;  2OYI C;  2PAJ A;  1SLQ A;  2H8P D;  1RF1 B;  2E43 A;  2N1T B;  1W2E A;  1IFD A;  4WB4 A;  1FZF A;  1JY3 N;  1LWU B;  2WT7 B;  1IK9 A;  5AW0 B;  3RK3 D;  2HG5 D;  2Q7C A;  5CCH D;  3M0D C;  2BAS A;  1H89 A;  1NH4 A;  4C7N A;  3VP8 A;  1NKN A;  3LIE A;  1HJB A;  4N78 E;  4EIJ A;  2YMY A;  1SP4 A;  2P67 A;  3A7O A;  1IFN A;  4W80 A;  1T2K C;  1NHL A;  1SQQ K;  3HE4 B;  3KDP B;  3P8C E;  2H43 A;  1KFM A;  2WSF H;  4N78 D;  4WY4 A;  3WMM 0;  3H32 B;  3P8C D;  3L37 A;  5AVS B;  1JO5 A;  2L5G B;  5AW8 B;  2OYH C;  3HD7 B;  1FZA A;  5AW9 B;  3VOP A;  1SFC A;  2NPS C;  3UIA A;  1NWQ A;  1FZC C;  2FXM A;  2Z5H A;  1VPC A;  4M3L A;  1FU1 A;  2E42 A;  4I6M C;  3RL0 B;  1RE4 C;  5CCH A;  3B5N B;  1N73 B;  3RK3 C;  1JY2 O;  3HUS B;  2JEE A;  1PFI A;  3TNU A;  1HGV A;  3M06 A;  3MTU E;  2XU6 A;  4OH8 B;  3VP9 A;  3BAT A;  1JY3 O;  1LTT C;  4W7Y A;  3HE5 A;  1OWA A;  5APT A;  2Z5I A;  1N7S B;  3V2P A;  4AQR D;  1MV8 A;  1ZLL A;  3VMX A;  4AUW A;  5KJ7 A;  1JOC A;  1GK6 A;  1X79 B;  1FJK A;  2I1J A;  3P32 A;  1KIL B;  1LT9 A;  2WPS A;  1G2C B;  2W6A A;  1XTG B;  2R32 A;  1GU5 A;  1M7L A;  1IFJ A;  2WPQ A;  4C46 A;  1GL2 B;  3R2P A;  1L4A A;  2YKQ A;  5AW3 B;  3KQG A;  3O8Z A;  2KOG A;  1HBW A;  1LTA C;  5AW5 B;  1N2D C;  1FZG A;  1CSB A;  3M9B A;  4DOJ A;  1URQ D;  4IFM A;  2WIT A;  5AW1 B;  4C7N B;  3HRN A;  1KFN A;  2XV5 A;  2W6B A;  2WSE H;  2N9B A;  5AVU B;  1G1J A;  1NO4 A;  2A45 I;  2IFM A;  3U1A A;  5KTB A;  2OYI A;  1FBM A;  4GT1 A;  2VRS A;  4B86 A;  4WBA A;  1SQP K;  4WY4 B;  3MUD A;  4AYC A;  1QL1 A;  2A45 H;  5AVY B;  2POH A;  3M0D A;  1WRG A;  3LID A;  5BVZ A;  3V4Q A;  2N1T D;  2XKM A;  2Q9I A;  1FJP A;  1SFC B;  1HTL C;  3V5B A;  2FFD B;  3V4W A;  2WSC H;  1ZR4 A;  2O01 H;  4HH2 A;  1NTM K;  1ZR2 A;  5AVZ B;  2XDJ A;  2QM8 A;  2IPP A;  1YTZ I;  1X9V A;  1GZL A;  2HOD B;  1LTB C;  2WZ7 A;  2Z4E A;  2O1J A;  2H7H A;  1J1D C;  2YO2 A;  3GHG B;  1ZN5 A;  1DH3 A;  1HH0 A;  1URQ C;  2ZFC A;  3TNU B;  3V2Q A;  2OYH A;  3PP5 A;  1LTJ C;  3HE5 B;  2YNY A;  2NPS A;  2R3C A;  3BAS A;  1FOS F;  1IC2 A;  1FZC A;  1GW4 A;  3MGN A;  5BU5 A;  2C9N Y;  1J1E C;  1NU1 K;  1NAF A;  1IFI A;  2WPR A;  3CI9 A;  1RE3 A;  4KHX A;  4ZKP A;  1JMM A;  3HD7 D;  2IX7 C;  1LT9 B;  1RE4 A;  1L0L K;  3T97 A;  2J58 A;  5BU8 B;  3VYI A;  1RE3 C;  2FYZ A;  1H8A A;  2GUS A;  4ZKU A;  5APU A;  1AFO A;  3V2R A;  1MZ9 A;  1RF1 C;  2N1T C;  1CW5 A;  2HFE D;  1L4A B;  3RL0 D;  1LWU C;  3B5N D;  3G3Z A;  3OJA B;  4O9B A;  3RK2 B;  1FZB A;  5CCG D;  3B8E B;  3P8M C;  2M3B A;  3C9I A;  1GDT A;  3NMD A;  5AW7 B;  1M1J B;  4C7R A;  1CZQ A;  1N7S D;  1E5W A;  5CJ4 A;  2J59 M;  5CMZ A;  2R5D A;  1CI6 A;  4Y99 B;  1GK4 A;  3EFG A;  1FOS E;  4LC1 A;  4IFF A;  2OYI B;  1NTZ K;  3BVH A;  1KIL D;  3L35 A;  1S9K E;  3U59 A;  3II6 A;  1LGH B;  3MD0 A;  2Q3I A;  2XNX A;  5AVV B;  2M8R A;  5AW2 B;  1KQL A;  5APS A;  5AVR B;  1S9K D;  3NTN A;  1IFM A;  3HD7 C;  1A02 F;  4JYB A;  1GL2 D;  3CL3 D;  3SWF A;  1JTH A;  5KLV K;  1SQV K;  3LW5 H;  2KSJ A;  1JUN A;  1FZE A;  1VDF A;  2C0X A;  2FYU K;  3HUS A;  3RL0 C;  1IJD B;  3B5N C;  1N73 C;  3BRT B;  3NFQ A;  3HUS C;  4N6J A;  5CCG C;  2CPB A;  3E1I A;  2ZXE B;  1RF0 C;  1HUC A;  4GKG A;  3VN0 A;  1HGZ A;  1LTG C;  2OYH B;  1N7S C;  1T3J A;  1AQ5 A;  2NPS B;  4WY4 D;  5APQ A;  1FZC B;  4LGD E;  3M0A A;  1G2C A;  3VMZ A;  4XA4 A;  3N4X A;  1HVV A;  1NKZ B;  4EOT A;  1GW3 A;  1EQ7 A;  2GM4 A;  1KIL C;  4I2L C;  2KP8 A;  1DX7 A;  1KZU B;  3A5T A;  3OAK A;  3CLQ A;  3BRV B;  1SFC D;  3L36 A;  3RK3 B;  2O1K A;  2HYN A;  2CPS A;  2IFN A;  1URQ A;  5AVW B;  1GL2 C;  3OA7 A;  1YYC A;  2QM7 A;  5APY A;  1SQX K;  1LTJ A;  1XTC C;  3P7K A;  1HWT C;  3N7N A;  4W7Z A;  1OXZ A;  3EQ2 A;  2MJZ A;  5APX A;  2HPC A;  3M91 A;  3M9Q A;  2W27 A;  5APW A;  3TYY A;  2HLO A;  1H88 A;  1GU4 A;  2P1J A;  3HTK A;  4HYT B;  3IFM A;  3TSI A;  1SQB K;  5KJ7 D;  1CI6 B;  1RF1 A;  1L0N K;  2N1T A;  1GD2 E;  2R5B A;  5CHX A;  1WT6 A;  4WY4 C;  1RY3 A;  2KLV A;  1LWU A;  3U1C A;  2WT7 A;  3I5C A;  2WTY A;  1T3U A;  1LTS C;  5AVQ B;  1JY2 P;  2FFD A;  1MFZ A;  1X8Y A;  1JNM A;  4N3Y B;  2OAR A;  1SFC C;  1L4A D;  2FFD C;  2YKP A;  4RES B;  3KYQ A;  5AVX B;  1JTH B;  5AW6 B;  2P7J A;  3VTP C;  2HOD A;  1JY3 P;  3RK2 D;  1GTW A;  3L4F A;  1A02 J;  3GHG A;  4LLH A;  4GIF A;  3HE4 A;  3MIW A;  1J2J B;  3SWY A;  5CCH C;  3GHG C;  1IO4 A;  3H32 A;  2KYV A;  1JCD A;  1DEB A;  1SVF A;  1FAV A;  3NXS A;  1NTK K;  1JCC A;  3A3Y B;  3HD7 A;  3IR9 A;  2FKW B;  5CJ0 A;  1MUU A;  2JJL A;  1ZV8 A;  1FDM A;  1QL2 A;  4I1L A;  2YKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...