4Y99B

Core domain of human cardiac troponin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
74
structure length
74
Chain Sequence
GKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Core domain of human cardiac troponin
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 31
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4y99B00
1J1DC 1J1EB 4Y99B 1YTZI 4Y99C 1J1DB 1J1EC 1YTZT
chains in the Genus database with same CATH superfamily
1LNQA 1OVRA 3IFMA 2YIUB 2XU6A 1SFCA 2LR2A 3LIEA 2WSCH 2NRGA 3GF3A 3LW5J 2N1TC 1S5LH 2OTKE 3CXHD 1RE3C 1T3JA 3HTKA 1TU3F 4DOJA 1NGMB 1FZGA 3AE7C 4YXWH 3EFGA 1SQPJ 2K37A 4HJGH 2B88A 1JY3N 2HFED 4GOFA 1RY3A 1L4AC 2E5TA 1NTZK 1AQ5A 3HE5A 1LTAC 1SQXD 1WMKA 5KLIC 3HTKB 2WT7A 2WSFJ 3H32B 2N1TD 2OARA 3E7KA 4OVNF 5CMZA 1LWUA 1SQQK 1ZV8A 1JNMA 4JPZB 3CPWO 4IOIH 3B5NC 1G2CB 2FYZA 1IFNA 1R5LA 2FY8A 3L72D 3HE4B 3HE5B 3L72E 2FFDC 3E1RA 2WQYC 2WT7B 1L4AD 1PZQA 1SFCC 3VTPC 2FBWC 1J1EC 3H1ID 1OVVA 5AVUB 3JSVC 3H1IE 4LC1A 2GM4A 4AQRD 1KYOH 1ZMEC 1H88A 2WSCJ 4R4LA 1QEXA 4XE5B 1NTKG 2YMYA 4GOEA 5APQA 2KI7B 3B5ND 3CL3D 1RF1A 2HYNA 4H0LB 2FXOA 3L72J 3FWNA 2Y9ZA 3V2NA 5CCGC 4JF7A 1N73C 1SFCD 1RE4A 1OZHA 2Q5UA 3H1JD 4U3FG 2E75B 1K9MQ 1LWUC 3H1IJ 1JY3P 4PD4H 1KYOD 4K3AA 4YXDC 1ZXGA 1VQNP 2NPSC 4H13C 5EFWB 4K35A 4QMAA 1ZR2A 3A5TA 1KYOE 1RF1B 2BASA 3O6QA 2OYHB 3AE9C 2KLUA 2AEJA 2IPPA 1JY3O 1J2JB 2ZT9C 2B87A 3HUSA 3Q3DA 5CCGD 5TISH 4KT0J 4L73A 1FOSE 1AFOA 3TNUA 3A3YB 1S9KD 1LTIC 2YXRB 2M8RA 4W7YA 4IFDK 1L0LD 2D2CC 5AW5B 4PD4D 1U7JA 1FC2C 1L0LE 3MHVA 4PD4E 2NPSD 2Y0CA 4H13D 1USEA 3RL0g 2A45G 5KLVK 1L0NK 3CCUP 2WPVB 1PGQA 4IL6X 3HUSB 2FYNB 4UB6H 1VQMP 1NTZD 3QWOC 2AEFA 2ZT9D 3PHLA 1YQ3C 1BCCD 2ZXXA 3R4YA 3FXEA 1SVFA 2OQQA 1JO5A 4D6TD 1SQBE 3Q5SA 1Q86Q 5DJTB 3TSIA 1SQQD 2P2UA 3JCUE 2C0XA 3CMEP 2ZFCA 1EDKA 2BCCE 1W2BO 4AUWA 2D2CD 1AV1A 2Y0EA 2W90A 1L0LJ 3OA7A 3KZIH 2C9LY 2KIKA 2A06E 3CMAP 1NJIQ 2IDBA 4DT0A 3F89A 4UB6E 2PGDA 1NTZJ 1DIPA 3V5BA 2QG4A 4UB8H 4M3LA 2QVAA 5CHXA 3SSUA 4D6TJ 2ZJSE 1NKZB 3WUTA 2IBZD 2KYVA 2LXCB 4XFJA 3KHUA 2WWWA 1GTWA 4I7ZC 2KLVA 2AXCA 2WZ7A 1KTMA 1T6AA 2ITAA 1HF9A 3WU2H 4PJ0H 3SWYA 1EXJA 3CLQA 3L75E 5AVYB 1IFDA 2WPSA 1M56D 3L4FA 1H0TA 5AW6B 3M0AA 3KYQA 3TF5A 1NTMD 1GL2A 2ZYGA 3C8VA 3U59A 3L71D 1NTME 3VMXA 3H1KG 1UIXA 2A45I 1DX7A 1LT9A 2JR8A 1MKMA 3A7OA 2W8ZA 3L71E 3SFDC 1QVFO 5C39A 2GUVA 2FKWB 1FDOA 5M1BA 5GTHE 3KXDA 1KB9H 1N7SA 3H1LE 2FXPA 3VMZA 1H0TB 4AYCA 4PJ0E 2J58A 1VQ8P 1NU1G 1GL2B 3L75J 1X8YA 3RL0B 4ZNCA 1P84I 3MZWB 1YHQP 1LT9B 1X0TA 1J1DB 2XV5A 1LT1A 2JWAA 1PPJG 3A0BH 1K73Q 1IFIA 3L74G 1NTMJ 2E42A 3L71J 3L36A 1OW6A 1N7SB 2M0BA 2KS1B 1EDJA 2JWDA 1JCCA 3AE2C 1G1IA 4NPDA 1KB9D 4WY4C 4ASWA 1JEKA 3FXDA 2N9BA 3H1LJ 2KP8A 2KOGA 2AXTH 3GF7A 3LW5H 5CJ4A 1IZNB 2AEMA 2ZVNB 4ZKUA 3MP7B 4RJTA 5KLVG 1L0NG 1X79B 1KILC 1T2KC 5E79H 2O01J 5APSA 3PH0A 4ZKPA 1JTHB 4I2LC 2WSSH 2YMKA 1BE3D 5B5EE 2H89C 4EYYQ 2Y9YA 4O9BA 1N86A 3NMDA 1Q81Q 2XNXA 1PIXA 3KQGA 4RO0A 1OXZA 2H8PD 4LLHA 4H44C 4WY4D 1M1JC 2OYIA 1VF5C 4WB4A 1YTZT 3OW2O 1OWAA 1E79H 1KQFB 2UWJE 1KILD 3L73G 2RN0A 3CX5I 2POHA 3SFEC 5E79E 4W7ZA 4WVZA 4JYBA 4WBAA 2R5DA 3CCVP 1VDFA 1EZVI 5AVVB 3U1AA 2E76C 4OH8B 1BE3J 1N7LA 3RBXA 1S4XA 3B8EB 4H44D 5APVA 2XDJA 3M9BA 2L5GB 1VF5D 1NAYA 2KK7A 1RH5B 1HH0A 2KZJA 3IR9A 1SQPG 4C7NA 4N6JA 2GA1A 2Z5HA 3G71P 4OWFA 3H32A 1L0LK 1JM0A 5KKZC 3P7KA 1ZR4A 1ZRTD 1GDTA 1GW3A 1A02F 1G2CA 1IK7A 1ZRTE 1GK6A 3H1HD 1DEBA 2KSJA 4IFFA 2E76D 3H6PA 4EOTA 4IL6E 1W2EA 3N7NA 3H1HE 1NO4A 3SWFA 2OYIC 3HE4A 4IFMA 2HLOA 4C7NB 1SQBK 3HD7B 2YIUC 4JYCA 1SS1A 1T8ZA 3AE8C 2MJZA 1Y8AA 1A02J 1JY2O 3AECC 3PRJA 2JO1A 3VN0A 1AJYA 5CBOA 1NHLA 3M0DA 4C7RA 2O1KA 2O1JA 3H1HJ 3GHGA 5CBNA 5AW4B 1YIJP 1SQXG 3S9OA 3AEAC 1GW4A 3MUDA 3IF4A 4PV1B 1G1JA 2G8YA 3W68A 1Z56A 1FAVA 1RQVA 5KJ7A 1K8AQ 1S1CX 2ZYDA 1Q2NA 1KMIZ 2ZXEB 1FBMA 1N2DC 1BGYD 3WUUA 2Q7CA 3L72G 1URQB 2W6JH 1BGYE 3GHGB 3IN6A 2HR3A 2OYHA 4U3FE 1AVOA 2QJKB 2RMZA 3TGUD 2YNYA 3H1IG 3TGUE 3CI9A 3KPEA 2OYOA 1FS0E 4NPEA 5CJ0A 1IK9A 3WMM0 2QJYB 1FZFA 3VP8A 2QM8A 2LXBA 2JJLA 3LIDA 4DJGA 2N9YB 1NTMK 2I1JA 5AW1B 3M06A 1OIPA 2ZYAA 2Q3EA 1BGYJ 2KSEA 4H0LC 1LGHB 1RQUA 1M7LA 5DJUB 1QL2A 1GZLA 3CCQP 3CCSP 4I1LA 2WSEJ 3TYYA 1MUUA 3AEBC 3A0HE 1QVGO 1M57D 3ABVC 3JCUH 3TGUJ 2IYPA 3H1JG 1NAFA 1OVUA 2M3BA 2WITA 2E75C 2M3EA 3CXHI 3AEDC 1RHZB 1FOSF 1FZBA 1RF1C 4W80A 1AQTA 1SQVD 2OYHC 1QGKB 3BATA 2E74B 2WPRA 1VQOP 3Q5RA 2IFNA 1SQVE 1P84E 4YPCA 3G6EP 1MFTA 2O01N 4H0LD 2K1AA 1GU5A 1SQBD 1RE4C 2FXMA 1IFJA 4Y99B 1R8EA 1OMIA 1YQ4C 2QM7A 1EDIA 1CSBA 4WWIA 2FYUD 2K9YA 2BCCD 5BU8B 2QSIA 3RK3B 1YI2P 1L0LG 4DZOA 1AA0A 2FYUE 1YYCA 2WTYA 1WRGA 1BDDA 1VQ6P 1VQLP 2E75D 4L75A 1KFNA 1FZEA 4MN4C 2A06D 1FZCA 3P32A 1FZAA 1S5LX 1NTZG 4OGQB 1S3JA 1SQVJ 3B4SA 3HUSC 2FYNC 3TDKA 3S4RA 4HB1A 1R5SA 4BRYA 2H43A 1BCCG 1CZQA 4LGDE 1HTLC 3MD0A 4D6TG 2GUSA 2QA4P 1SLQA 3BCCD 5TJHA 1SQBJ 1PL5A 1SQQG 1XTGB 2B9BA 3BCCE 1LTJB 3V2RA 1RF0A 2V7QH 1NWQA 1FZCB 5KAIH 2FYUJ 2BCCJ 1IO4A 1ZP0C 3RK2B 1VQKP 5CCHA 3I56P 3GMAA 2P10A 4BRYB 1X9VA 2OGUA 1NKNA 2Q3IA 2Q1KA 5GTHH 3RBZA 3ITKA 3VMAA 1BSHA 2J5UA 3IAOA 3CC7P 1BSNA 3L75D 1PGJA 1MV8A 5APWA 5GTIE 1VL2A 1PP9D 1EZVD 2SPZA 1PP9E 2O01H 5AW3B 1EZVE 2BEZF 2ZVOB 3BCCJ 3T97B 1JMMA 3NFQA 1KYOI 1VQ4P 5AW0B 1YJ9P 5KAIE 1DD3A 2IBZG 4TLFA 1ZW0A 2OTJP 2QE7H 3M9HA 1NU1E 2YKQA 1ZN5A 4GDOA 2R5BA 3H1LD 4A7PA 4OGQD 1KN7A 3N4XA 4DCKA 1PPJE 2KS1A 1ZLLA 2WPQA 3L74E 4L76A 2IFMA 4GT1A 1PP9J 1N8RQ 4PD4I 1NTMG 2B89A 3NTNA 1KQLA 3L71G 1HGVA 4GIFA 2V7QJ 3M9QA 5B5EH 1KQGB 3A2AA 3VOPA 2P7JA 1QL1A 1S2EA 3EWKA 1JTHA 1NU1J 3TK1A 5APTA 2JEEA 5BVZA 1U57A 2JKVA 2CPSA 2K88A 1OX3A 3P8MC 2K9JB 2IYOA 4RKUJ 1GL2C 2QJPB 5AVQB 3RL0C 1LT9C 3B71A 4BWNA 1J1DC 1HBWA 1JY2N 2HPCA 3L70D 1USDA 3AE5C 3FGAD 4ZMDA 3L70E 2HODA 2C9NY 1N7SC 1KD1Q 4BXLA 2N1TA 1JB0J 3USSA 1AVYA 1RE3A 3L73E 1KQSO 1E5WA 1H89A 3O8ZA 2BEQD 1KC8Q 1QX8A 2R3SA 2R44A 2YKOA 3BASA 5K5GB 2WMMA 2V4HA 3CWBD 1Y47A 1JCDA 2HPCB 2PAJA 5B66E 1GL2D 5H2FH 5AVRB 3CC4P 3CWBE 3RL0D 4EIJA 3PP5A 1Q7YQ 2HODB 1WT6A 1MFZA 2WVRA 1L4AA 2IBZI 1YBKA 2G3AA 4JBZA 2N1TB 1BE3G 3CC2P 3L70J 4IL6H 1LP1A 3MTUE 1N7SD 2IZ1A 1SQPE 1GD2E 3L73J 3BRTB 3S1KA 2MKVA 3MIWA 3D71A 2NZ2A 1L4AB 1HVVA 2C0WA 2YO2A 3K5BA 3CWBJ 3HD7A 2FFDA 5H2FE 2I1KA 5KLIB 1LP1B 2QIWA 1SP4A 1FJPA 3V4QA 3G9RA 2W6AA 3OJAB 2KZIA 1IJDB 1SQVK 2I8DA 2R3CA 3B5NB 1PV3A 3CXHE 1HJ0A 2Z5IA 4JQ0D 2Y0DA 3F5HA 2IX7C 1JY2P 4EI2A 2OTLP 1UIIA 2FFDB 3C9IA 2Z4EA 1CW5A 1SFCB 2PFXA 2FYUK 5L8RJ 1J1EB 5CCGA 3VYIA 1N73A 1SQXE 3GLMA 3H1HG 2WSEH 5AW8B 3P8CD 3AE1C 1S5LE 3SWKA 1NTKD 3UIAA 1VPCA 1URQA 3P8CE 1M1KQ 1JMBA 2NPSA 1DEEG 2H88C 1KB9I 1NH4A 1NTKE 4TT3H 3D70A 1IFMA 1KORA 3CCMP 5AVXB 3M91A 1OW7A 4R4MA 4YTPC 3HD7C 2CPBA 1HUCA 1N73B 2LKMA 2YXQB 1LWUB 4U3FD 1SQXJ 2NPSB 4H13B 2Q6QA 5APYA 1BDCA 1KFMA 3A0HH 2A45H 1NTKJ 4N78D 2ZT9B 1CI6A 4N78E 3VP9A 4PV1C 3HD7D 2O3JA 3HRNA 1D7MA 1EXIA 1XTCC 3PTZA 4Y28J 1HWTC 2PP6A 1BGYG 2D2CB 1P84H 3M0DC 3PJSK 1LJ2A 3H1JE 1Q82Q 1URQC 3PLNA 1NU1K 3GHGC 4U3FJ 3FX0A 3QH9A 1Y9BA 3TGUG 1CI6B 2QJKC 1PGOA 3MUDC 1K05A 2E5YA 5KJ7C 2XZRA 2P67A 1GU4A 4PV1D 2H7HA 1U7MA 2QJYC 3BRVB 2KNCA 3G3ZA 3D6ZA 3AE4C 1DH3A 1P84D 5BU5A 1KZUB 3O6QB 1S9KE 3Q5PA 2M5AA 3H1JJ 2KXPB 5APXA 1URQD 2XNDH 3V6IA 5KTBA 5AVWB 5AW2B 4I6MC 2B87B 2IZ0A 1GK4A 1M8OB 3ZDMA 5KJ7D 2KNCB 5APUA 3TNUB 3Q1MA 1NTZE 3EQ2A 1LTJA 1BCCE 2KB7P 2YKPA 5TISE 2M5AB 1SQVG 4D6TE 1NOHA 2RH0A 3II6A 2E74C 1FJKA 4XA4A 1SQQE 3CX5H 3G4SP 1IFPA 5GTIH 2HG5D 1SQBG 3VMYA 2W27A 4I7ZB 3CCRP 4HH2A 3I55P 4Y99C 2FYUG 4HYTB 2BCCG 3AEEC 1YJWP 1FDIA 1OFCX 3RK3C 4RESB 2QEXP 1FE6A 1LTBC 1T3UA 3L35A 2A06G 3T97A 1BCCJ 3I5CA 3AEFC 1L2PA 2R32A 3OAKA 1ZOYC 2DW3A 3CCJP 2E74D 1SQQJ 3C1LA 3CX5D 4OGQC 3U1CA 2KUBA 4GKGA 4Z1MH 3CX5E 3H1KD 2P58A 1FU1A 1SQPK 2IBZE 3KZIE 3H1KE 3BCCG 2QRXA 2Q9IA 3KDPB 4NPFX 3MGNA 4GODA 1NVOA 1LTJC 3RK3D 2E43A 3WUVA 1FZCC 4EDFA 5AW7B 3RK3E 3RK2C 4UB8E 5AVTB 1NU1D 4N3YB 4WY4A 1VQ9P 4KJMA 4HKZH 1LTGC 1M90Q 1PPJD 1KILA 4KHXA 1VQ7P 3L74D 3L75G 1NYHA 2L91A 1PP9G 1MZ9A 1EZVG 3H1KJ 4L74A 1RF0C 1YITP 3BVHA 3H25A 2W83C 1Q90D 1PFIA 3AE3C 2ZAEB 4WY4B 3R2PA 2JP3A 3EFFK 1VQPP 3RGUA 2JDIH 2K9JA 3V4WA 5CCHC 2VRSA 3WU2E 1X22A 1H8AA 3RK2D 1KILB 1M1JA 5KLVD 1L0ND 1SQXK 3Q2YA 5KLVE 1L0NE 3H1LG 2W6BA 3CCEP 2K3RA 1S72P 1NTKK 3L74J 2YO3A 3NXSA 5B66H 1EC5A 1HJBA 1JUNA 1K04A 1QLED 5KAFH 1KV4A 3W67A 4H44B 1JOCA 3GW6A 1GMJA 1LTSC 2XKMA 1M1JB 5CCHD 1VF5B 3D6YA 1KB9E 4CPGA 5AVZB 1FDMA 2CK3H 3JC22 4U7JA 3L73D 5KLVJ 1L0NJ 5AVSB 1YJNP 1YTZI 1EDLA 3A0BE 2E76B 3CD6P 1BE3E 3AE6C 1LTTC 2QJPC 5KAFE 3L37A 5AW9B 2WSFH 3L70G 2PRRA 3CCLP 1PGPA 1EQ7A 2AXTE 1VQ5P 3CXHH 2J59M 1SQPD 1T2KD 5KKZB 1HGZA 1KILE 3FWLA 3E1IA 2RKLA 3V2PA 3B5NA 4C46A 1DD4A 3V2QA 1IC2A 3CWBG 4B86A 1OW8A 3AEGC 3GG2A 4ASVA 2P1JA 2OYIB 1W5CE
chains in the Genus database with same CATH topology
3HUSC 3IFMA 2XU6A 1CI6A 1IFIA 1SFCA 4N78E 3VP9A 2E42A 3LIEA 2WSCH 2H43A 1CZQA 3HD7D 4LGDE 1HTLC 3HRNA 2N1TC 3MD0A 3L36A 2GUSA 1XTCC 1SLQA 1RE3C 1N7SB 1T3JA 3HTKA 1JCCA 1HWTC 4DOJA 1FZGA 1XTGB 2PP6A 3EFGA 1LTJB 1G1IA 3V2RA 1RF0A 3M0DC 1NWQA 1FZCB 4WY4C 2N9BA 1IO4A 1URQC 2KP8A 1JY3N 2KOGA 3LW5H 1NU1K 5CJ4A 3GHGC 3RK2B 4ZKUA 2HFED 5CCHA 1X79B 1CI6B 1RY3A 1L4AC 1KILC 1T2KC 1X9VA 1NTZK 1AQ5A 1NKNA 2Q3IA 3HE5A 5APSA 1LTAC 4ZKPA 5KJ7C 2XZRA 1JTHB 4I2LC 2P67A 3HTKB 1GU4A 2WT7A 3H32B 2H7HA 1MV8A 5APWA 2N1TD 2OARA 3BRVB 5CMZA 1LWUA 4O9BA 1SQQK 3G3ZA 1N86A 3NMDA 1ZV8A 1JNMA 2O01H 3B5NC 5AW3B 1G2CB 2FYZA 1IFNA 2XNXA 1DH3A 3KQGA 1JMMA 1OXZA 3NFQA 1KZUB 5BU5A 2H8PD 4LLHA 1S9KE 5AW0B 4WY4D 1M1JC 5APXA 1URQD 3HE4B 3HE5B 2OYIA 4WB4A 2FFDC 1YTZT 1OWAA 5KTBA 3M9HA 5AVWB 2WT7B 5AW2B 1L4AD 1KILD 1SFCC 4I6MC 2YKQA 3VTPC 2POHA 1J1EC 1ZN5A 1GK4A 2R5BA 5AVUB 5KJ7D 3N4XA 4W7ZA 5APUA 3TNUB 4LC1A 4JYBA 2GM4A 3EQ2A 4WBAA 4AQRD 1H88A 1ZLLA 2R5DA 1VDFA 2WPQA 5AVVB 3U1AA 1LTJA 4OH8B 4XE5B 2YMYA 2KB7P 2YKPA 2IFMA 4GT1A 1NOHA 5APQA 3B5ND 1N7LA 3CL3D 3II6A 1FJKA 1RF1A 4XA4A 3NTNA 2HYNA 3B8EB 1KQLA 1HGVA 4GIFA 5APVA 3M9QA 2XDJA 3M9BA 2L5GB 2HG5D 3V2NA 5CCGC 3VMYA 2W27A 3A2AA 4JF7A 3VOPA 2P7JA 1HH0A 1QL1A 3IR9A 4HH2A 4Y99C 1JTHA 4N6JA 4C7NA 1N73C 1SFCD 3TK1A 2Z5HA 4HYTB 1RE4A 5APTA 2Q5UA 3H32A 1L0LK 2JEEA 5BVZA 3RK3C 3P7KA 4RESB 1LWUC 1ZR4A 1JY3P 1GDTA 1GW3A 2CPSA 1LTBC 2NPSC 1T3UA 1A02F 1G2CA 3L35A 1ZR2A 1GK6A 3A5TA 1RF1B 1DEBA 2BASA 3P8MC 3T97A 2KSJA 4IFFA 3I5CA 3H6PA 4EOTA 1W2EA 2OYHB 1GL2C 3N7NA 2R32A 3OAKA 5AVQB 3RL0C 1NO4A 3SWFA 2OYIC 3HE4A 2IPPA 4IFMA 1LT9C 1J1DC 1JY3O 1HBWA 1J2JB 2HLOA 1JY2N 2HPCA 4C7NB 1SQBK 3HD7B 3U1CA 4GKGA 4JYCA 1T8ZA 1FU1A 2MJZA 1SQPK 3HUSA 5CCGD 2HODA 1A02J 1FOSE 1AFOA 2C9NY 1N7SC 3TNUA 2N1TA 3A3YB 2Q9IA 1JY2O 3KDPB 1S9KD 1LTIC 2M8RA 1RE3A 3MGNA 4W7YA 3VN0A 4IFDK 1LTJC 1E5WA 5AW5B 3RK3D 1H89A 3O8ZA 2E43A 1FZCC 1NHLA 5AW7B 2YKOA 2NPSD 3BASA 3M0DA 4C7RA 2A45G 5KLVK 3RK2C 1L0NK 5AVTB 4N3YB 4WY4A 2O1KA 1JCDA 2O1JA 2HPCB 2PAJA 1GL2D 3GHGA 5AVRB 5AW4B 3RL0D 4EIJA 1LTGC 3PP5A 3HUSB 1GW4A 2HODB 1WT6A 1MFZA 1L4AA 1KILA 3MUDA 4KHXA 1G1JA 1Z56A 2N1TB 1FAVA 5KJ7A 1SVFA 1JO5A 1MZ9A 1RF0C 3MTUE 3BVHA 3TSIA 1N7SD 2P2UA 1FBMA 2ZXEB 1PFIA 1N2DC 2C0XA 2Q7CA 1GD2E 2ZFCA 4WY4B 3R2PA 4AUWA 1URQB 3BRTB 3V4WA 5CCHC 3GHGB 2OYHA 2VRSA 3OA7A 2C9LY 1H8AA 3MIWA 3RK2D 1L4AB 1KILB 1M1JA 1HVVA 2C0WA 2YO2A 1SQXK 2YNYA 3HD7A 2FFDA 2I1KA 3CI9A 3KPEA 2W6BA 1SP4A 5CJ0A 1IK9A 3WMM0 1FJPA 3V5BA 1FZFA 3VP8A 4M3LA 3V4QA 2QM8A 1NTKK 2JJLA 2W6AA 2YO3A 3LIDA 3NXSA 5CHXA 3OJAB 1IJDB 1SQVK 2R3CA 1HJBA 3B5NB 1JUNA 1NTMK 2Z5IA 2I1JA 1JOCA 5AW1B 2IX7C 3M06A 1NKZB 1JY2P 1LTSC 2XKMA 1M1JB 5CCHD 1LGHB 1M7LA 2FFDB 3C9IA 2KYVA 2Z4EA 1QL2A 1CW5A 5AVZB 1GZLA 4I1LA 3TYYA 1SFCB 1MUUA 2WWWA 1FDMA 2FYUK 1GTWA 1J1EB 2KLVA 5CCGA 3VYIA 5AVSB 1NAFA 2WITA 2M3BA 2WZ7A 1YTZI 1N73A 3SWYA 2WSEH 5AW8B 3P8CD 3CLQA 1FOSF 1FZBA 5AVYB 1RF1C 1IFDA 2WPSA 3UIAA 3L4FA 1VPCA 1URQA 3P8CE 4W80A 2NPSA 1LTTC 2OYHC 3BATA 5AW6B 2WPRA 1NH4A 3M0AA 3KYQA 2IFNA 1IFMA 1GL2A 3L37A 5AVXB 5AW9B 2WSFH 3M91A 3U59A 3VMXA 1GU5A 2A45I 1DX7A 3HD7C 1LT9A 1EQ7A 3A7OA 1RE4C 2FXMA 1IFJA 2CPBA 1HUCA 4Y99B 1N73B 2J59M 2QM7A 2LKMA 1T2KD 1CSBA 2GUVA 2FKWB 1HGZA 5BU8B 3RK3B 1LWUB 3E1IA 4DZOA 1YYCA 1N7SA 2WTYA 1WRGA 3V2PA 2NPSB 3B5NA 4C46A 5APYA 3VMZA 3V2QA 4AYCA 1KFNA 1FZEA 2J58A 1KFMA 1IC2A 1GL2B 1X8YA 2A45H 1FZCA 3P32A 3RL0B 4B86A 1FZAA 2P1JA 2OYIB 1LT9B 1J1DB 2XV5A 4N78D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1D C;  1J1E B;  4Y99 B;  1YTZ I;  4Y99 C;  1J1D B;  1J1E C;  1YTZ T; 
#chains in the Genus database with same CATH topology
 1LNQ A;  1OVR A;  3IFM A;  2YIU B;  2XU6 A;  1SFC A;  2LR2 A;  3LIE A;  2WSC H;  2NRG A;  3GF3 A;  3LW5 J;  2N1T C;  1S5L H;  2OTK E;  3CXH D;  1RE3 C;  1T3J A;  3HTK A;  1TU3 F;  4DOJ A;  1NGM B;  1FZG A;  3AE7 C;  4YXW H;  3EFG A;  1SQP J;  2K37 A;  4HJG H;  2B88 A;  1JY3 N;  2HFE D;  4GOF A;  1RY3 A;  1L4A C;  2E5T A;  1NTZ K;  1AQ5 A;  3HE5 A;  1LTA C;  1SQX D;  1WMK A;  5KLI C;  3HTK B;  2WT7 A;  2WSF J;  3H32 B;  2N1T D;  2OAR A;  3E7K A;  4OVN F;  5CMZ A;  1LWU A;  1SQQ K;  1ZV8 A;  1JNM A;  4JPZ B;  3CPW O;  4IOI H;  3B5N C;  1G2C B;  2FYZ A;  1IFN A;  1R5L A;  2FY8 A;  3L72 D;  3HE4 B;  3HE5 B;  3L72 E;  2FFD C;  3E1R A;  2WQY C;  2WT7 B;  1L4A D;  1PZQ A;  1SFC C;  3VTP C;  2FBW C;  1J1E C;  3H1I D;  1OVV A;  5AVU B;  3JSV C;  3H1I E;  4LC1 A;  2GM4 A;  4AQR D;  1KYO H;  1ZME C;  1H88 A;  2WSC J;  4R4L A;  1QEX A;  4XE5 B;  1NTK G;  2YMY A;  4GOE A;  5APQ A;  2KI7 B;  3B5N D;  3CL3 D;  1RF1 A;  2HYN A;  4H0L B;  2FXO A;  3L72 J;  3FWN A;  2Y9Z A;  3V2N A;  5CCG C;  4JF7 A;  1N73 C;  1SFC D;  1RE4 A;  1OZH A;  2Q5U A;  3H1J D;  4U3F G;  2E75 B;  1K9M Q;  1LWU C;  3H1I J;  1JY3 P;  4PD4 H;  1KYO D;  4K3A A;  4YXD C;  1ZXG A;  1VQN P;  2NPS C;  4H13 C;  5EFW B;  4K35 A;  4QMA A;  1ZR2 A;  3A5T A;  1KYO E;  1RF1 B;  2BAS A;  3O6Q A;  2OYH B;  3AE9 C;  2KLU A;  2AEJ A;  2IPP A;  1JY3 O;  1J2J B;  2ZT9 C;  2B87 A;  3HUS A;  3Q3D A;  5CCG D;  5TIS H;  4KT0 J;  4L73 A;  1FOS E;  1AFO A;  3TNU A;  3A3Y B;  1S9K D;  1LTI C;  2YXR B;  2M8R A;  4W7Y A;  4IFD K;  1L0L D;  2D2C C;  5AW5 B;  4PD4 D;  1U7J A;  1FC2 C;  1L0L E;  3MHV A;  4PD4 E;  2NPS D;  2Y0C A;  4H13 D;  1USE A;  3RL0 g;  2A45 G;  5KLV K;  1L0N K;  3CCU P;  2WPV B;  1PGQ A;  4IL6 X;  3HUS B;  2FYN B;  4UB6 H;  1VQM P;  1NTZ D;  3QWO C;  2AEF A;  2ZT9 D;  3PHL A;  1YQ3 C;  1BCC D;  2ZXX A;  3R4Y A;  3FXE A;  1SVF A;  2OQQ A;  1JO5 A;  4D6T D;  1SQB E;  3Q5S A;  1Q86 Q;  5DJT B;  3TSI A;  1SQQ D;  2P2U A;  3JCU E;  2C0X A;  3CME P;  2ZFC A;  1EDK A;  2BCC E;  1W2B O;  4AUW A;  2D2C D;  1AV1 A;  2Y0E A;  2W90 A;  1L0L J;  3OA7 A;  3KZI H;  2C9L Y;  2KIK A;  2A06 E;  3CMA P;  1NJI Q;  2IDB A;  4DT0 A;  3F89 A;  4UB6 E;  2PGD A;  1NTZ J;  1DIP A;  3V5B A;  2QG4 A;  4UB8 H;  4M3L A;  2QVA A;  5CHX A;  3SSU A;  4D6T J;  2ZJS E;  1NKZ B;  3WUT A;  2IBZ D;  2KYV A;  2LXC B;  4XFJ A;  3KHU A;  2WWW A;  1GTW A;  4I7Z C;  2KLV A;  2AXC A;  2WZ7 A;  1KTM A;  1T6A A;  2ITA A;  1HF9 A;  3WU2 H;  4PJ0 H;  3SWY A;  1EXJ A;  3CLQ A;  3L75 E;  5AVY B;  1IFD A;  2WPS A;  1M56 D;  3L4F A;  1H0T A;  5AW6 B;  3M0A A;  3KYQ A;  3TF5 A;  1NTM D;  1GL2 A;  2ZYG A;  3C8V A;  3U59 A;  3L71 D;  1NTM E;  3VMX A;  3H1K G;  1UIX A;  2A45 I;  1DX7 A;  1LT9 A;  2JR8 A;  1MKM A;  3A7O A;  2W8Z A;  3L71 E;  3SFD C;  1QVF O;  5C39 A;  2GUV A;  2FKW B;  1FDO A;  5M1B A;  5GTH E;  3KXD A;  1KB9 H;  1N7S A;  3H1L E;  2FXP A;  3VMZ A;  1H0T B;  4AYC A;  4PJ0 E;  2J58 A;  1VQ8 P;  1NU1 G;  1GL2 B;  3L75 J;  1X8Y A;  3RL0 B;  4ZNC A;  1P84 I;  3MZW B;  1YHQ P;  1LT9 B;  1X0T A;  1J1D B;  2XV5 A;  1LT1 A;  2JWA A;  1PPJ G;  3A0B H;  1K73 Q;  1IFI A;  3L74 G;  1NTM J;  2E42 A;  3L71 J;  3L36 A;  1OW6 A;  1N7S B;  2M0B A;  2KS1 B;  1EDJ A;  2JWD A;  1JCC A;  3AE2 C;  1G1I A;  4NPD A;  1KB9 D;  4WY4 C;  4ASW A;  1JEK A;  3FXD A;  2N9B A;  3H1L J;  2KP8 A;  2KOG A;  2AXT H;  3GF7 A;  3LW5 H;  5CJ4 A;  1IZN B;  2AEM A;  2ZVN B;  4ZKU A;  3MP7 B;  4RJT A;  5KLV G;  1L0N G;  1X79 B;  1KIL C;  1T2K C;  5E79 H;  2O01 J;  5APS A;  3PH0 A;  4ZKP A;  1JTH B;  4I2L C;  2WSS H;  2YMK A;  1BE3 D;  5B5E E;  2H89 C;  4EYY Q;  2Y9Y A;  4O9B A;  1N86 A;  3NMD A;  1Q81 Q;  2XNX A;  1PIX A;  3KQG A;  4RO0 A;  1OXZ A;  2H8P D;  4LLH A;  4H44 C;  4WY4 D;  1M1J C;  2OYI A;  1VF5 C;  4WB4 A;  1YTZ T;  3OW2 O;  1OWA A;  1E79 H;  1KQF B;  2UWJ E;  1KIL D;  3L73 G;  2RN0 A;  3CX5 I;  2POH A;  3SFE C;  5E79 E;  4W7Z A;  4WVZ A;  4JYB A;  4WBA A;  2R5D A;  3CCV P;  1VDF A;  1EZV I;  5AVV B;  3U1A A;  2E76 C;  4OH8 B;  1BE3 J;  1N7L A;  3RBX A;  1S4X A;  3B8E B;  4H44 D;  5APV A;  2XDJ A;  3M9B A;  2L5G B;  1VF5 D;  1NAY A;  2KK7 A;  1RH5 B;  1HH0 A;  2KZJ A;  3IR9 A;  1SQP G;  4C7N A;  4N6J A;  2GA1 A;  2Z5H A;  3G71 P;  4OWF A;  3H32 A;  1L0L K;  1JM0 A;  5KKZ C;  3P7K A;  1ZR4 A;  1ZRT D;  1GDT A;  1GW3 A;  1A02 F;  1G2C A;  1IK7 A;  1ZRT E;  1GK6 A;  3H1H D;  1DEB A;  2KSJ A;  4IFF A;  2E76 D;  3H6P A;  4EOT A;  4IL6 E;  1W2E A;  3N7N A;  3H1H E;  1NO4 A;  3SWF A;  2OYI C;  3HE4 A;  4IFM A;  2HLO A;  4C7N B;  1SQB K;  3HD7 B;  2YIU C;  4JYC A;  1SS1 A;  1T8Z A;  3AE8 C;  2MJZ A;  1Y8A A;  1A02 J;  1JY2 O;  3AEC C;  3PRJ A;  2JO1 A;  3VN0 A;  1AJY A;  5CBO A;  1NHL A;  3M0D A;  4C7R A;  2O1K A;  2O1J A;  3H1H J;  3GHG A;  5CBN A;  5AW4 B;  1YIJ P;  1SQX G;  3S9O A;  3AEA C;  1GW4 A;  3MUD A;  3IF4 A;  4PV1 B;  1G1J A;  2G8Y A;  3W68 A;  1Z56 A;  1FAV A;  1RQV A;  5KJ7 A;  1K8A Q;  1S1C X;  2ZYD A;  1Q2N A;  1KMI Z;  2ZXE B;  1FBM A;  1N2D C;  1BGY D;  3WUU A;  2Q7C A;  3L72 G;  1URQ B;  2W6J H;  1BGY E;  3GHG B;  3IN6 A;  2HR3 A;  2OYH A;  4U3F E;  1AVO A;  2QJK B;  2RMZ A;  3TGU D;  2YNY A;  3H1I G;  3TGU E;  3CI9 A;  3KPE A;  2OYO A;  1FS0 E;  4NPE A;  5CJ0 A;  1IK9 A;  3WMM 0;  2QJY B;  1FZF A;  3VP8 A;  2QM8 A;  2LXB A;  2JJL A;  3LID A;  4DJG A;  2N9Y B;  1NTM K;  2I1J A;  5AW1 B;  3M06 A;  1OIP A;  2ZYA A;  2Q3E A;  1BGY J;  2KSE A;  4H0L C;  1LGH B;  1RQU A;  1M7L A;  5DJU B;  1QL2 A;  1GZL A;  3CCQ P;  3CCS P;  4I1L A;  2WSE J;  3TYY A;  1MUU A;  3AEB C;  3A0H E;  1QVG O;  1M57 D;  3ABV C;  3JCU H;  3TGU J;  2IYP A;  3H1J G;  1NAF A;  1OVU A;  2M3B A;  2WIT A;  2E75 C;  2M3E A;  3CXH I;  3AED C;  1RHZ B;  1FOS F;  1FZB A;  1RF1 C;  4W80 A;  1AQT A;  1SQV D;  2OYH C;  1QGK B;  3BAT A;  2E74 B;  2WPR A;  1VQO P;  3Q5R A;  2IFN A;  1SQV E;  1P84 E;  4YPC A;  3G6E P;  1MFT A;  2O01 N;  4H0L D;  2K1A A;  1GU5 A;  1SQB D;  1RE4 C;  2FXM A;  1IFJ A;  4Y99 B;  1R8E A;  1OMI A;  1YQ4 C;  2QM7 A;  1EDI A;  1CSB A;  4WWI A;  2FYU D;  2K9Y A;  2BCC D;  5BU8 B;  2QSI A;  3RK3 B;  1YI2 P;  1L0L G;  4DZO A;  1AA0 A;  2FYU E;  1YYC A;  2WTY A;  1WRG A;  1BDD A;  1VQ6 P;  1VQL P;  2E75 D;  4L75 A;  1KFN A;  1FZE A;  4MN4 C;  2A06 D;  1FZC A;  3P32 A;  1FZA A;  1S5L X;  1NTZ G;  4OGQ B;  1S3J A;  1SQV J;  3B4S A;  3HUS C;  2FYN C;  3TDK A;  3S4R A;  4HB1 A;  1R5S A;  4BRY A;  2H43 A;  1BCC G;  1CZQ A;  4LGD E;  1HTL C;  3MD0 A;  4D6T G;  2GUS A;  2QA4 P;  1SLQ A;  3BCC D;  5TJH A;  1SQB J;  1PL5 A;  1SQQ G;  1XTG B;  2B9B A;  3BCC E;  1LTJ B;  3V2R A;  1RF0 A;  2V7Q H;  1NWQ A;  1FZC B;  5KAI H;  2FYU J;  2BCC J;  1IO4 A;  1ZP0 C;  3RK2 B;  1VQK P;  5CCH A;  3I56 P;  3GMA A;  2P10 A;  4BRY B;  1X9V A;  2OGU A;  1NKN A;  2Q3I A;  2Q1K A;  5GTH H;  3RBZ A;  3ITK A;  3VMA A;  1BSH A;  2J5U A;  3IAO A;  3CC7 P;  1BSN A;  3L75 D;  1PGJ A;  1MV8 A;  5APW A;  5GTI E;  1VL2 A;  1PP9 D;  1EZV D;  2SPZ A;  1PP9 E;  2O01 H;  5AW3 B;  1EZV E;  2BEZ F;  2ZVO B;  3BCC J;  3T97 B;  1JMM A;  3NFQ A;  1KYO I;  1VQ4 P;  5AW0 B;  1YJ9 P;  5KAI E;  1DD3 A;  2IBZ G;  4TLF A;  1ZW0 A;  2OTJ P;  2QE7 H;  3M9H A;  1NU1 E;  2YKQ A;  1ZN5 A;  4GDO A;  2R5B A;  3H1L D;  4A7P A;  4OGQ D;  1KN7 A;  3N4X A;  4DCK A;  1PPJ E;  2KS1 A;  1ZLL A;  2WPQ A;  3L74 E;  4L76 A;  2IFM A;  4GT1 A;  1PP9 J;  1N8R Q;  4PD4 I;  1NTM G;  2B89 A;  3NTN A;  1KQL A;  3L71 G;  1HGV A;  4GIF A;  2V7Q J;  3M9Q A;  5B5E H;  1KQG B;  3A2A A;  3VOP A;  2P7J A;  1QL1 A;  1S2E A;  3EWK A;  1JTH A;  1NU1 J;  3TK1 A;  5APT A;  2JEE A;  5BVZ A;  1U57 A;  2JKV A;  2CPS A;  2K88 A;  1OX3 A;  3P8M C;  2K9J B;  2IYO A;  4RKU J;  1GL2 C;  2QJP B;  5AVQ B;  3RL0 C;  1LT9 C;  3B71 A;  4BWN A;  1J1D C;  1HBW A;  1JY2 N;  2HPC A;  3L70 D;  1USD A;  3AE5 C;  3FGA D;  4ZMD A;  3L70 E;  2HOD A;  2C9N Y;  1N7S C;  1KD1 Q;  4BXL A;  2N1T A;  1JB0 J;  3USS A;  1AVY A;  1RE3 A;  3L73 E;  1KQS O;  1E5W A;  1H89 A;  3O8Z A;  2BEQ D;  1KC8 Q;  1QX8 A;  2R3S A;  2R44 A;  2YKO A;  3BAS A;  5K5G B;  2WMM A;  2V4H A;  3CWB D;  1Y47 A;  1JCD A;  2HPC B;  2PAJ A;  5B66 E;  1GL2 D;  5H2F H;  5AVR B;  3CC4 P;  3CWB E;  3RL0 D;  4EIJ A;  3PP5 A;  1Q7Y Q;  2HOD B;  1WT6 A;  1MFZ A;  2WVR A;  1L4A A;  2IBZ I;  1YBK A;  2G3A A;  4JBZ A;  2N1T B;  1BE3 G;  3CC2 P;  3L70 J;  4IL6 H;  1LP1 A;  3MTU E;  1N7S D;  2IZ1 A;  1SQP E;  1GD2 E;  3L73 J;  3BRT B;  3S1K A;  2MKV A;  3MIW A;  3D71 A;  2NZ2 A;  1L4A B;  1HVV A;  2C0W A;  2YO2 A;  3K5B A;  3CWB J;  3HD7 A;  2FFD A;  5H2F E;  2I1K A;  5KLI B;  1LP1 B;  2QIW A;  1SP4 A;  1FJP A;  3V4Q A;  3G9R A;  2W6A A;  3OJA B;  2KZI A;  1IJD B;  1SQV K;  2I8D A;  2R3C A;  3B5N B;  1PV3 A;  3CXH E;  1HJ0 A;  2Z5I A;  4JQ0 D;  2Y0D A;  3F5H A;  2IX7 C;  1JY2 P;  4EI2 A;  2OTL P;  1UII A;  2FFD B;  3C9I A;  2Z4E A;  1CW5 A;  1SFC B;  2PFX A;  2FYU K;  5L8R J;  1J1E B;  5CCG A;  3VYI A;  1N73 A;  1SQX E;  3GLM A;  3H1H G;  2WSE H;  5AW8 B;  3P8C D;  3AE1 C;  1S5L E;  3SWK A;  1NTK D;  3UIA A;  1VPC A;  1URQ A;  3P8C E;  1M1K Q;  1JMB A;  2NPS A;  1DEE G;  2H88 C;  1KB9 I;  1NH4 A;  1NTK E;  4TT3 H;  3D70 A;  1IFM A;  1KOR A;  3CCM P;  5AVX B;  3M91 A;  1OW7 A;  4R4M A;  4YTP C;  3HD7 C;  2CPB A;  1HUC A;  1N73 B;  2LKM A;  2YXQ B;  1LWU B;  4U3F D;  1SQX J;  2NPS B;  4H13 B;  2Q6Q A;  5APY A;  1BDC A;  1KFM A;  3A0H H;  2A45 H;  1NTK J;  4N78 D;  2ZT9 B;  1CI6 A;  4N78 E;  3VP9 A;  4PV1 C;  3HD7 D;  2O3J A;  3HRN A;  1D7M A;  1EXI A;  1XTC C;  3PTZ A;  4Y28 J;  1HWT C;  2PP6 A;  1BGY G;  2D2C B;  1P84 H;  3M0D C;  3PJS K;  1LJ2 A;  3H1J E;  1Q82 Q;  1URQ C;  3PLN A;  1NU1 K;  3GHG C;  4U3F J;  3FX0 A;  3QH9 A;  1Y9B A;  3TGU G;  1CI6 B;  2QJK C;  1PGO A;  3MUD C;  1K05 A;  2E5Y A;  5KJ7 C;  2XZR A;  2P67 A;  1GU4 A;  4PV1 D;  2H7H A;  1U7M A;  2QJY C;  3BRV B;  2KNC A;  3G3Z A;  3D6Z A;  3AE4 C;  1DH3 A;  1P84 D;  5BU5 A;  1KZU B;  3O6Q B;  1S9K E;  3Q5P A;  2M5A A;  3H1J J;  2KXP B;  5APX A;  1URQ D;  2XND H;  3V6I A;  5KTB A;  5AVW B;  5AW2 B;  4I6M C;  2B87 B;  2IZ0 A;  1GK4 A;  1M8O B;  3ZDM A;  5KJ7 D;  2KNC B;  5APU A;  3TNU B;  3Q1M A;  1NTZ E;  3EQ2 A;  1LTJ A;  1BCC E;  2KB7 P;  2YKP A;  5TIS E;  2M5A B;  1SQV G;  4D6T E;  1NOH A;  2RH0 A;  3II6 A;  2E74 C;  1FJK A;  4XA4 A;  1SQQ E;  3CX5 H;  3G4S P;  1IFP A;  5GTI H;  2HG5 D;  1SQB G;  3VMY A;  2W27 A;  4I7Z B;  3CCR P;  4HH2 A;  3I55 P;  4Y99 C;  2FYU G;  4HYT B;  2BCC G;  3AEE C;  1YJW P;  1FDI A;  1OFC X;  3RK3 C;  4RES B;  2QEX P;  1FE6 A;  1LTB C;  1T3U A;  3L35 A;  2A06 G;  3T97 A;  1BCC J;  3I5C A;  3AEF C;  1L2P A;  2R32 A;  3OAK A;  1ZOY C;  2DW3 A;  3CCJ P;  2E74 D;  1SQQ J;  3C1L A;  3CX5 D;  4OGQ C;  3U1C A;  2KUB A;  4GKG A;  4Z1M H;  3CX5 E;  3H1K D;  2P58 A;  1FU1 A;  1SQP K;  2IBZ E;  3KZI E;  3H1K E;  3BCC G;  2QRX A;  2Q9I A;  3KDP B;  4NPF X;  3MGN A;  4GOD A;  1NVO A;  1LTJ C;  3RK3 D;  2E43 A;  3WUV A;  1FZC C;  4EDF A;  5AW7 B;  3RK3 E;  3RK2 C;  4UB8 E;  5AVT B;  1NU1 D;  4N3Y B;  4WY4 A;  1VQ9 P;  4KJM A;  4HKZ H;  1LTG C;  1M90 Q;  1PPJ D;  1KIL A;  4KHX A;  1VQ7 P;  3L74 D;  3L75 G;  1NYH A;  2L91 A;  1PP9 G;  1MZ9 A;  1EZV G;  3H1K J;  4L74 A;  1RF0 C;  1YIT P;  3BVH A;  3H25 A;  2W83 C;  1Q90 D;  1PFI A;  3AE3 C;  2ZAE B;  4WY4 B;  3R2P A;  2JP3 A;  3EFF K;  1VQP P;  3RGU A;  2JDI H;  2K9J A;  3V4W A;  5CCH C;  2VRS A;  3WU2 E;  1X22 A;  1H8A A;  3RK2 D;  1KIL B;  1M1J A;  5KLV D;  1L0N D;  1SQX K;  3Q2Y A;  5KLV E;  1L0N E;  3H1L G;  2W6B A;  3CCE P;  2K3R A;  1S72 P;  1NTK K;  3L74 J;  2YO3 A;  3NXS A;  5B66 H;  1EC5 A;  1HJB A;  1JUN A;  1K04 A;  1QLE D;  5KAF H;  1KV4 A;  3W67 A;  4H44 B;  1JOC A;  3GW6 A;  1GMJ A;  1LTS C;  2XKM A;  1M1J B;  5CCH D;  1VF5 B;  3D6Y A;  1KB9 E;  4CPG A;  5AVZ B;  1FDM A;  2CK3 H;  3JC2 2;  4U7J A;  3L73 D;  5KLV J;  1L0N J;  5AVS B;  1YJN P;  1YTZ I;  1EDL A;  3A0B E;  2E76 B;  3CD6 P;  1BE3 E;  3AE6 C;  1LTT C;  2QJP C;  5KAF E;  3L37 A;  5AW9 B;  2WSF H;  3L70 G;  2PRR A;  3CCL P;  1PGP A;  1EQ7 A;  2AXT E;  1VQ5 P;  3CXH H;  2J59 M;  1SQP D;  1T2K D;  5KKZ B;  1HGZ A;  1KIL E;  3FWL A;  3E1I A;  2RKL A;  3V2P A;  3B5N A;  4C46 A;  1DD4 A;  3V2Q A;  1IC2 A;  3CWB G;  4B86 A;  1OW8 A;  3AEG C;  3GG2 A;  4ASV A;  2P1J A;  2OYI B;  1W5C E; 
#chains in the Genus database with same CATH homology
 3HUS C;  3IFM A;  2XU6 A;  1CI6 A;  1IFI A;  1SFC A;  4N78 E;  3VP9 A;  2E42 A;  3LIE A;  2WSC H;  2H43 A;  1CZQ A;  3HD7 D;  4LGD E;  1HTL C;  3HRN A;  2N1T C;  3MD0 A;  3L36 A;  2GUS A;  1XTC C;  1SLQ A;  1RE3 C;  1N7S B;  1T3J A;  3HTK A;  1JCC A;  1HWT C;  4DOJ A;  1FZG A;  1XTG B;  2PP6 A;  3EFG A;  1LTJ B;  1G1I A;  3V2R A;  1RF0 A;  3M0D C;  1NWQ A;  1FZC B;  4WY4 C;  2N9B A;  1IO4 A;  1URQ C;  2KP8 A;  1JY3 N;  2KOG A;  3LW5 H;  1NU1 K;  5CJ4 A;  3GHG C;  3RK2 B;  4ZKU A;  2HFE D;  5CCH A;  1X79 B;  1CI6 B;  1RY3 A;  1L4A C;  1KIL C;  1T2K C;  1X9V A;  1NTZ K;  1AQ5 A;  1NKN A;  2Q3I A;  3HE5 A;  5APS A;  1LTA C;  4ZKP A;  5KJ7 C;  2XZR A;  1JTH B;  4I2L C;  2P67 A;  3HTK B;  1GU4 A;  2WT7 A;  3H32 B;  2H7H A;  1MV8 A;  5APW A;  2N1T D;  2OAR A;  3BRV B;  5CMZ A;  1LWU A;  4O9B A;  1SQQ K;  3G3Z A;  1N86 A;  3NMD A;  1ZV8 A;  1JNM A;  2O01 H;  3B5N C;  5AW3 B;  1G2C B;  2FYZ A;  1IFN A;  2XNX A;  1DH3 A;  3KQG A;  1JMM A;  1OXZ A;  3NFQ A;  1KZU B;  5BU5 A;  2H8P D;  4LLH A;  1S9K E;  5AW0 B;  4WY4 D;  1M1J C;  5APX A;  1URQ D;  3HE4 B;  3HE5 B;  2OYI A;  4WB4 A;  2FFD C;  1YTZ T;  1OWA A;  5KTB A;  3M9H A;  5AVW B;  2WT7 B;  5AW2 B;  1L4A D;  1KIL D;  1SFC C;  4I6M C;  2YKQ A;  3VTP C;  2POH A;  1J1E C;  1ZN5 A;  1GK4 A;  2R5B A;  5AVU B;  5KJ7 D;  3N4X A;  4W7Z A;  5APU A;  3TNU B;  4LC1 A;  4JYB A;  2GM4 A;  3EQ2 A;  4WBA A;  4AQR D;  1H88 A;  1ZLL A;  2R5D A;  1VDF A;  2WPQ A;  5AVV B;  3U1A A;  1LTJ A;  4OH8 B;  4XE5 B;  2YMY A;  2KB7 P;  2YKP A;  2IFM A;  4GT1 A;  1NOH A;  5APQ A;  3B5N D;  1N7L A;  3CL3 D;  3II6 A;  1FJK A;  1RF1 A;  4XA4 A;  3NTN A;  2HYN A;  3B8E B;  1KQL A;  1HGV A;  4GIF A;  5APV A;  3M9Q A;  2XDJ A;  3M9B A;  2L5G B;  2HG5 D;  3V2N A;  5CCG C;  3VMY A;  2W27 A;  3A2A A;  4JF7 A;  3VOP A;  2P7J A;  1HH0 A;  1QL1 A;  3IR9 A;  4HH2 A;  4Y99 C;  1JTH A;  4N6J A;  4C7N A;  1N73 C;  1SFC D;  3TK1 A;  2Z5H A;  4HYT B;  1RE4 A;  5APT A;  2Q5U A;  3H32 A;  1L0L K;  2JEE A;  5BVZ A;  3RK3 C;  3P7K A;  4RES B;  1LWU C;  1ZR4 A;  1JY3 P;  1GDT A;  1GW3 A;  2CPS A;  1LTB C;  2NPS C;  1T3U A;  1A02 F;  1G2C A;  3L35 A;  1ZR2 A;  1GK6 A;  3A5T A;  1RF1 B;  1DEB A;  2BAS A;  3P8M C;  3T97 A;  2KSJ A;  4IFF A;  3I5C A;  3H6P A;  4EOT A;  1W2E A;  2OYH B;  1GL2 C;  3N7N A;  2R32 A;  3OAK A;  5AVQ B;  3RL0 C;  1NO4 A;  3SWF A;  2OYI C;  3HE4 A;  2IPP A;  4IFM A;  1LT9 C;  1J1D C;  1JY3 O;  1HBW A;  1J2J B;  2HLO A;  1JY2 N;  2HPC A;  4C7N B;  1SQB K;  3HD7 B;  3U1C A;  4GKG A;  4JYC A;  1T8Z A;  1FU1 A;  2MJZ A;  1SQP K;  3HUS A;  5CCG D;  2HOD A;  1A02 J;  1FOS E;  1AFO A;  2C9N Y;  1N7S C;  3TNU A;  2N1T A;  3A3Y B;  2Q9I A;  1JY2 O;  3KDP B;  1S9K D;  1LTI C;  2M8R A;  1RE3 A;  3MGN A;  4W7Y A;  3VN0 A;  4IFD K;  1LTJ C;  1E5W A;  5AW5 B;  3RK3 D;  1H89 A;  3O8Z A;  2E43 A;  1FZC C;  1NHL A;  5AW7 B;  2YKO A;  2NPS D;  3BAS A;  3M0D A;  4C7R A;  2A45 G;  5KLV K;  3RK2 C;  1L0N K;  5AVT B;  4N3Y B;  4WY4 A;  2O1K A;  1JCD A;  2O1J A;  2HPC B;  2PAJ A;  1GL2 D;  3GHG A;  5AVR B;  5AW4 B;  3RL0 D;  4EIJ A;  1LTG C;  3PP5 A;  3HUS B;  1GW4 A;  2HOD B;  1WT6 A;  1MFZ A;  1L4A A;  1KIL A;  3MUD A;  4KHX A;  1G1J A;  1Z56 A;  2N1T B;  1FAV A;  5KJ7 A;  1SVF A;  1JO5 A;  1MZ9 A;  1RF0 C;  3MTU E;  3BVH A;  3TSI A;  1N7S D;  2P2U A;  1FBM A;  2ZXE B;  1PFI A;  1N2D C;  2C0X A;  2Q7C A;  1GD2 E;  2ZFC A;  4WY4 B;  3R2P A;  4AUW A;  1URQ B;  3BRT B;  3V4W A;  5CCH C;  3GHG B;  2OYH A;  2VRS A;  3OA7 A;  2C9L Y;  1H8A A;  3MIW A;  3RK2 D;  1L4A B;  1KIL B;  1M1J A;  1HVV A;  2C0W A;  2YO2 A;  1SQX K;  2YNY A;  3HD7 A;  2FFD A;  2I1K A;  3CI9 A;  3KPE A;  2W6B A;  1SP4 A;  5CJ0 A;  1IK9 A;  3WMM 0;  1FJP A;  3V5B A;  1FZF A;  3VP8 A;  4M3L A;  3V4Q A;  2QM8 A;  1NTK K;  2JJL A;  2W6A A;  2YO3 A;  3LID A;  3NXS A;  5CHX A;  3OJA B;  1IJD B;  1SQV K;  2R3C A;  1HJB A;  3B5N B;  1JUN A;  1NTM K;  2Z5I A;  2I1J A;  1JOC A;  5AW1 B;  2IX7 C;  3M06 A;  1NKZ B;  1JY2 P;  1LTS C;  2XKM A;  1M1J B;  5CCH D;  1LGH B;  1M7L A;  2FFD B;  3C9I A;  2KYV A;  2Z4E A;  1QL2 A;  1CW5 A;  5AVZ B;  1GZL A;  4I1L A;  3TYY A;  1SFC B;  1MUU A;  2WWW A;  1FDM A;  2FYU K;  1GTW A;  1J1E B;  2KLV A;  5CCG A;  3VYI A;  5AVS B;  1NAF A;  2WIT A;  2M3B A;  2WZ7 A;  1YTZ I;  1N73 A;  3SWY A;  2WSE H;  5AW8 B;  3P8C D;  3CLQ A;  1FOS F;  1FZB A;  5AVY B;  1RF1 C;  1IFD A;  2WPS A;  3UIA A;  3L4F A;  1VPC A;  1URQ A;  3P8C E;  4W80 A;  2NPS A;  1LTT C;  2OYH C;  3BAT A;  5AW6 B;  2WPR A;  1NH4 A;  3M0A A;  3KYQ A;  2IFN A;  1IFM A;  1GL2 A;  3L37 A;  5AVX B;  5AW9 B;  2WSF H;  3M91 A;  3U59 A;  3VMX A;  1GU5 A;  2A45 I;  1DX7 A;  3HD7 C;  1LT9 A;  1EQ7 A;  3A7O A;  1RE4 C;  2FXM A;  1IFJ A;  2CPB A;  1HUC A;  4Y99 B;  1N73 B;  2J59 M;  2QM7 A;  2LKM A;  1T2K D;  1CSB A;  2GUV A;  2FKW B;  1HGZ A;  5BU8 B;  3RK3 B;  1LWU B;  3E1I A;  4DZO A;  1YYC A;  1N7S A;  2WTY A;  1WRG A;  3V2P A;  2NPS B;  3B5N A;  4C46 A;  5APY A;  3VMZ A;  3V2Q A;  4AYC A;  1KFN A;  1FZE A;  2J58 A;  1KFM A;  1IC2 A;  1GL2 B;  1X8Y A;  2A45 H;  1FZC A;  3P32 A;  3RL0 B;  4B86 A;  1FZA A;  2P1J A;  2OYI B;  1LT9 B;  1J1D B;  2XV5 A;  4N78 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...