4Y99B

Core domain of human cardiac troponin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
74
structure length
74
Chain Sequence
GKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Core domain of human cardiac troponin
rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 31
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4y99B00
4Y99C 1J1DC 1YTZT 1J1EB 4Y99B 1YTZI 1J1EC 1J1DB
chains in the Genus database with same CATH superfamily
1DX7A 4R4LA 2IBZD 3WU2E 2WQYC 4JQ0D 1EDLA 4KJMA 4ASWA 4A7PA 1T6AA 1SQBG 2FXPA 2LKMA 4L73A 4PD4D 5APYA 5KLVD 3LIDA 4DJGA 1YHQP 4GODA 2HYNA 2IPPA 2KLVA 3I5CA 5AW8B 1EZVE 1FDMA 5KAIH 2AXCA 2D2CB 3A2AA 4TLFA 1VF5D 2QA4P 1OIPA 4H0LC 2GUSA 1BCCJ 4ZKUA 1CSBA 1KILE 3L70G 1NKZB 3V2QA 4JBZA 5AVSB 1RF1B 3F89A 3HUSB 3VMXA 3AE3C 1OVVA 1Q90D 1H88A 3VMAA 1HGZA 1LTIC 4YPCA 1LWUA 1SQQK 2KUBA 3GG2A 4IFFA 4B86A 1L0LG 1P84I 1CI6B 2FXMA 2FYUJ 2M3EA 1NU1G 1R5LA 1SQBD 3CX5E 1T2KC 2BCCJ 2FXOA 2IFMA 3GF3A 3NMDA 3V6IA 1BDDA 1PP9E 3LW5J 4PJ0E 3UIAA 1JMBA 3CCRP 1YJ9P 2LXBA 3IF4A 1NU1D 1URQC 1M1KQ 1LWUC 2ZFCA 3N4XA 1U7JA 1EZVD 3B5NC 2ZXXA 2KP8A 3HD7D 3D71A 2M5AB 1HJ0A 1VQ9P 3PTZA 3H1LD 1QVFO 1M56D 1S5LE 2OYHB 1N7LA 3CXHD 3L71G 4NPFX 3KPEA 1NTMJ 2IBZE 3KQGA 1KB9I 3L75D 3RK2D 1NJIQ 1URQA 5CCHD 1GTWA 1L4AD 3OA7A 1SP4A 2SPZA 3L37A 3CMEP 1YIJP 1GL2A 1UIXA 4GIFA 5AW9B 1MZ9A 3TGUJ 1BE3J 1JO5A 4H0LB 1PGOA 1EDKA 4W7ZA 2JR8A 2KYVA 2LXCB 3U59A 3SWFA 2YO3A 3G6EP 3CCMP 1JUNA 1RF0A 4YXDC 3VOPA 1J1EB 2J58A 3IR9A 4Y28J 2ZVNB 3P32A 4JYBA 4W7YA 1JM0A 1YTZT 2M0BA 2JWDA 3AE9C 2OYOA 3D70A 1FZGA 4BXLA 1NGMB 1FJKA 1RE3C 4AYCA 5CCHC 1NH4A 4IFMA 1L4AC 3H1HG 3H1HD 2RN0A 1AQTA 2AXTE 1EXIA 3B5NA 3LW5H 3MGNA 5GTHE 3L74J 2R3CA 4UB6E 1EZVI 2OYHC 2A06E 1WMKA 1S1CX 5AW7B 3L70E 3IAOA 1EQ7A 3CX5H 1KMIZ 4HB1A 2W83C 4WVZA 1JMMA 4WY4B 1Y9BA 1NU1E 4U3FJ 3M91A 2ZT9C 1PGJA 2Q6QA 3F5HA 4D6TE 1QL2A 1LTJB 1NTKE 2QM8A 1H89A 1L0NE 1FAVA 3FWNA 2Q9IA 1BGYJ 2OTLP 1KYOH 1S2EA 1W2BO 5CMZA 2YXQB 1DH3A 1RH5B 1OW7A 2CK3H 1NTZG 2QIWA 2W6BA 3P8CE 1GW3A 4JYCA 4TT3H 1H8AA 1QX8A 1FZFA 5K5GB 2G3AA 2QJYC 3L74D 3FX0A 3FGAD 1E79H 2W8ZA 3GF7A 3L75G 1L4AB 3KXDA 3TYYA 1RE3A 1URQD 5CCHA 2E5TA 3TNUB 3VN0A 1S5LX 2RKLA 1G2CB 1K05A 1GK6A 1TU3F 1GL2B 4IL6E 4H13B 1SQPK 2O3JA 1HJBA 1S3JA 4WY4C 2KNCA 1SQVE 3L73G 5M1BA 1U57A 1KILC 1GU5A 3A3YB 1VL2A 1YQ3C 2OQQA 2HODB 3H1ID 3CMAP 3CWBE 2K1AA 1SFCD 3QWOC 2HODA 1L0LD 5TJHA 1JTHA 3TGUD 3G71P 1YJNP 1KYOD 1PP9G 4OH8B 5GTHH 3OW2O 5APUA 1G1JA 1N73A 4LLHA 1DD4A 1PFIA 1FE6A 4IL6X 3AEFC 1FDOA 1PPJE 2JJLA 3AE7C 2ZVOB 3RBZA 1LTBC 1PZQA 1VDFA 1W2EA 2H88C 3ABVC 3CWBG 1YI2P 2WMMA 3BRVB 3AEEC 2QEXP 2IX7C 1D7MA 3GW6A 3BCCJ 1LTAC 2QSIA 3HE5B 2XV5A 4IL6H 3GLMA 3BATA 1LTTC 3L72D 5EFWB 3TF5A 5KAIE 1KC8Q 2IDBA 1AV1A 4C46A 1EDJA 5CBOA 2I1JA 2BCCD 3L71E 3JCUE 1YQ4C 2JWAA 1Q86Q 1VF5C 2FYUD 4RO0A 3AE6C 3R4YA 3P7KA 1FZCB 3AE2C 3V5BA 3V2NA 1IFMA 2Q1KA 2KK7A 5KKZB 1LTSC 3RK2C 1N8RQ 1SQXJ 2ZAEB 1KILB 3C8VA 1AA0A 3EFGA 5APXA 2HFED 4ASVA 2OYHA 5AVQB 4BRYB 2O01J 1MV8A 2KZJA 3L72J 1OZHA 1SS1A 2ZXEB 3L35A 4XFJA 2WT7B 1M1JC 2IYOA 1Y8AA 4W80A 2B87B 1QGKB 3OAKA 4K3AA 1N73B 4I1LA 1JY3O 4CPGA 1L2PA 5KLVJ 2W6AA 1BDCA 1SQQE 4PV1C 1SQBK 2AEJA 4I7ZC 2ZYGA 1ZRTD 4H44C 3U1CA 2KNCB 1S9KD 1VQNP 3OJAB 1AFOA 1SFCB 1LT9C 2OYIB 1K9MQ 2P7JA 3B8EB 1L0LJ 1RE4A 2K9JA 3A0HH 2H89C 2Q7CA 3B4SA 5CCGA 1KZUB 4JF7A 4WBAA 3RL0D 3O6QA 3H1IJ 1FZEA 2YIUC 1LTJA 3CI9A 1RY3A 1IFJA 1PPJG 2E76C 5AW3B 3SSUA 3H1JD 1A02F 1ZMEC 2KOGA 3Q5RA 1OMIA 1K8AQ 1EXJA 3II6A 1NAYA 1NOHA 2BEQD 1M7LA 2G8YA 2YKOA 1SFCC 5CJ0A 3Q3DA 1PIXA 2NZ2A 3HRNA 3RK3D 1CW5A 1IK7A 1SQPE 1ZV8A 2XZRA 3A0HE 1SQXG 3USSA 1FU1A 4I7ZB 4UB8E 5AW1B 3NFQA 4Z1MH 3CPWO 3L75E 1AQ5A 2DW3A 2E75D 3FXDA 1PGQA 2FY8A 2O01H 3CXHE 1HUCA 1NTKK 3A7OA 3H1KE 4DOJA 3H1LE 4YXWH 5GTIH 2Z4EA 2NPSA 5KJ7D 3AE1C 2N1TC 1QEXA 3VYIA 1LP1A 1VQ6P 2QJPC 1SQVG 2B9BA 1JY2N 2J59M 2KLUA 4UB8H 5E79H 5KLIC 3CD6P 1BGYD 5DJUB 2R44A 1GD2E 1SQBE 1JCDA 2W6JH 1LJ2A 3AE4C 2YIUB 2ZYAA 2RH0A 1KFNA 1LWUB 2NPSC 2A06G 3L73E 3S1KA 3VMYA 4OGQD 5TISH 1SQXD 2Z5IA 1EZVG 5AVXB 3CL3D 2B88A 2HPCA 1VQKP 2QM7A 4JPZB 5CHXA 4DT0A 2WT7A 2BCCG 4AUWA 1HF9A 5KAFE 1FZAA 1HGVA 1GW4A 1DEBA 1HTLC 5APSA 1YJWP 4WWIA 2B89A 2M8RA 1L0NG 3Q5PA 1VQMP 1GU4A 2QRXA 2P2UA 3H1HJ 3A5TA 2GM4A 2ZYDA 1KB9E 2AEMA 3BCCD 1KTMA 3G4SP 1OVRA 3HUSC 2WSCJ 1MUUA 1DEEG 2AEFA 2C0XA 3V4QA 3VMZA 3CCLP 1KV4A 4PD4E 3S9OA 5GTIE 1NTZE 1FJPA 2WSCH 3CCUP 1IJDB 1FDIA 3WMM0 2D2CC 3FXEA 1X8YA 4U3FG 3H1JE 4K35A 1NHLA 4BRYA 5AVVB 3L4FA 3AECC 4R4MA 1N7SA 4L76A 1BSHA 3P8MC 2WPSA 1P84D 1KILA 3CLQA 5APVA 3WU2H 3RK3B 1GMJA 2W27A 3BCCG 2GA1A 1WRGA 3WUTA 1IFPA 2N9BA 3PH0A 1HH0A 1OXZA 3HE4B 3MTUE 2E75B 3W68A 2R5DA 2WPRA 2WPQA 1JY2P 3GHGB 3EQ2A 2E74C 1Q82Q 1N7SC 4N6JA 1NKNA 2FYNB 3MD0A 4N78E 1SQQD 2QVAA 5DJTB 1DIPA 1CI6A 1JTHB 2YO2A 1MKMA 3AE5C 3TSIA 1GL2D 2P1JA 4HH2A 1L0LK 1R8EA 2WITA 2H43A 2FYNC 3RL0C 1T3UA 2HPCB 3HUSA 1BCCE 3H25A 2YNYA 2E76D 4H13C 5CBNA 1G1IA 2O01N 1J2JB 3IFMA 1U7MA 2OGUA 3NXSA 4WY4A 3Q5SA 5KTBA 2E5YA 1H0TB 3JCUH 2Y9YA 4ZNCA 1GK4A 3BASA 2K88A 4H44D 2BEZF 4I6MC 4MN4C 3Q1MA 2B87A 2FFDA 2UWJE 4LGDE 2FYUE 3GHGC 1FOSF 4GOEA 2BCCE 3MUDC 1PP9J 1KB9H 5AVYB 1BCCD 5KLIB 1VQOP 2IZ0A 1SQVK 2OARA 1G2CA 1IK9A 1OW6A 2L91A 1VPCA 4UB6H 1SQPG 3A0BH 3AEDC 3HD7B 3IN6A 1J1DC 3KDPB 3MHVA 2L5GB 1VQ4P 4Y99C 3B71A 5CCGC 4D6TG 4EI2A 2JKVA 1X9VA 2KI7B 2QJKB 2ZT9D 2FYZA 3AE8C 3EWKA 1NVOA 3H1KG 3KHUA 3HD7C 4N78D 1NTME 2ZT9B 5H2FH 1JNMA 2HLOA 3E1RA 3C1LA 3H32B 1JOCA 2XDJA 1AVOA 1LNQA 2OTJP 2PAJA 3CCQP 3VP9A 1IO4A 3TGUE 2WSSH 4RKUJ 1J1EC 1BE3E 3RL0B 2Q3EA 3M0DA 4EYYQ 2WPVB 3CX5I 3G3ZA 1FZBA 1FS0E 1NTMG 3FWLA 3QH9A 1LTJC 2KSEA 1LTGC 2KS1A 3L74G 5H2FE 4RJTA 4L74A 5CCGD 3D6ZA 1HBWA 2KZIA 5AVUB 3CCVP 1S72P 2XKMA 3CC2P 2K37A 1USEA 2N1TA 1NU1K 2R32A 3M9HA 4GOFA 3H32A 1JY3P 1R5SA 3N7NA 4GKGA 1YITP 3CC7P 3D6YA 1KB9D 1BCCG 4HKZH 1NTMD 2XNXA 3KZIE 1ZP0C 3L74E 1MFTA 4IFDK 3T97B 1ZW0A 2PGDA 3B5NB 3V2PA 1K73Q 3L70J 3AEBC 1QLED 3B5ND 4QMAA 1KQGB 2WSFJ 3HE5A 2AXTH 3P8CD 4WB4A 4C7NA 2QE7H 5AW2B 3Q2YA 1N73C 1NU1J 1YTZI 3MIWA 4M3LA 3MP7B 4U3FE 3E1IA 2VRSA 5L8RJ 1IC2A 4D6TJ 3A0BE 1NTKJ 2N1TD 4H13D 1L0NJ 3SFEC 1BGYE 1GZLA 2E76B 1NTKG 1NTKD 4BWNA 3H1JG 4HJGH 2WZ7A 1KQLA 1ZXGA 2Z5HA 3R2PA 1S4XA 4IOIH 4N3YB 1KQFB 5B5EH 3AEGC 3I56P 1QVGO 2MJZA 3EFFK 2Y0CA 2Q3IA 1GL2C 3PJSK 1ZN5A 3W67A 3L70D 1KN7A 1SVFA 1IFIA 1E5WA 1M8OB 2A06D 2KIKA 3H1KD 1FZCC 2I1KA 4C7RA 3KYQA 5E79E 4OWFA 4EDFA 1JEKA 5AVRB 3S4RA 3PHLA 3I55P 3CX5D 2PRRA 1IFNA 3TGUG 1X22A 1SQPD 4WY4D 1P84H 2YKPA 5B5EE 4PD4I 4GT1A 1J1DB 2FFDC 1AVYA 5AW4B 1QL1A 2JO1A 5KKZC 3V2RA 2E42A 1PL5A 2QJPB 3O8ZA 1BE3G 1X0TA 4KHXA 3HE4A 1SQVJ 1FBMA 2K3RA 1NAFA 3RBXA 1VQ8P 2GUVA 5B66H 1K04A 2Y9ZA 3ZDMA 1YYCA 3CWBJ 3L36A 3M0DC 5KLVK 2WSFH 1PGPA 2NPSB 2XU6A 1KD1Q 1VQPP 1KORA 5AVZB 3HTKA 1SQQG 2FBWC 1T8ZA 3KZIH 1S9KE 3SFDC 1ZR4A 3AEAC 3PRJA 5AW5B 4ZKPA 2FYUG 2WSEJ 1W5CE 2R3SA 3E7KA 3BVHA 1URQB 1FC2C 2M5AA 1JY2O 1NTZD 1RE4C 2H8PD 3CCEP 2W90A 4Y99B 2E74D 2WSEH 1RQVA 2WVRA 1VF5B 2HR3A 2ITAA 3BCCE 3C9IA 1X79B 1L0NK 4I2LC 4KT0J 1IFDA 1MFZA 3LIEA 3SWYA 2YXRB 1JCCA 1BGYG 2QG4A 4RESB 3RK2B 2P58A 1PP9D 3MUDA 5TISE 3HTKB 3L71J 2KS1B 5B66E 5BVZA 1XTGB 3L72G 1NTMK 2P67A 2CPSA 2O1JA 1CZQA 2Q5UA 2IZ1A 2Y0DA 3SWKA 5KAFH 1SQXE 3CC4P 2MKVA 4GDOA 3L73D 4U7JA 1ZOYC 1M90Q 1PV3A 3CCJP 1NYHA 2E75C 5BU8B 1KILD 3GHGA 3WUVA 1A02J 2K9JB 2YKQA 2KB7P 3M0AA 3CXHH 1YBKA 3L72E 3WUUA 2I8DA 4U3FD 5C39A 1S5LH 1LT9B 4EOTA 2KSJA 5AVTB 2BASA 5BU5A 3H6PA 1NWQA 2POHA 3PP5A 5KJ7C 2H7HA 2C0WA 2KXPB 5KLVE 5APQA 1SQQJ 2YMYA 5APWA 1PPJD 1XTCC 2QJYB 1RF1A 2C9LY 2PFXA 2R5BA 2A45I 2O1KA 3ITKA 1KYOE 1N86A 2NPSD 3RK3E 1H0TA 1OW8A 2N9YB 1L0LE 2ZJSE 3G9RA 1RQUA 3TNUA 4NPDA 2FFDB 1Y47A 2N1TB 3JSVC 2M3BA 3TDKA 4H0LD 1NO4A 1ZLLA 3H1IE 4AQRD 1RF0C 2IYPA 4YTPC 1JY3N 1FZCA 2NRGA 1HWTC 1SQVD 3RL0g 4OGQB 1M1JB 4XA4A 1ZR2A 4DZOA 1BE3D 1VQ5P 1LGHB 2P10A 1OX3A 1OWAA 1WT6A 3U1AA 1AJYA 1SQPJ 4L75A 2JEEA 1BSNA 1Z56A 1ZRTE 3L75J 4HYTB 2FKWB 4NPEA 3H1LG 3RK3C 5KJ7A 3H1KJ 2OYIC 1DD3A 3H1LJ 2YMKA 2A45G 3O6QB 3V4WA 3M06A 1JB0J 1LP1B 3HD7A 5AVWB 2E43A 4H44B 1VQLP 2Y0EA 2C9NY 3TK1A 1M1JA 1NTZK 2E74B 1UIIA 2IBZI 1Q7YQ 1T3JA 2V4HA 4PV1D 3JC22 2CPBA 2PP6A 4OGQC 2XNDH 4ZMDA 3T97A 1T2KD 3VP8A 1L0ND 1SQBJ 2A45H 2WWWA 4D6TD 1M57D 1Q2NA 3L73J 4O9BA 1SLQA 4XE5B 1KQSO 1OVUA 5KLVG 1LT9A 2WTYA 1EDIA 3BRTB 1FOSE 2RMZA 3VTPC 3L71D 1N2DC 3GMAA 1VQ7P 3M9QA 5CJ4A 3CXHI 1RHZB 1OFCX 3NTNA 3CCSP 5APTA 3H1HE 2J5UA 3RGUA 4PJ0H 2K9YA 2V7QH 1LT1A 1SQXK 1HVVA 4LC1A 4OVNF 2D2CD 4PD4H 2JDIH 1USDA 1KFMA 1EC5A 4C7NB 1SFCA 2V7QJ 3H1IG 3M9BA 1NTZJ 4EIJA 1Q81Q 2IBZG 2OYIA 1RF1C 2IFNA 5AW0B 1KYOI 1L4AA 4PV1B 2FYUK 3H1JJ 2HG5D 2OTKE 3K5BA 3PLNA 5AW6B 1IZNB 2QJKC 4DCKA 1GDTA 2JP3A 1N7SB 2LR2A 3MZWB 1P84E 1N7SD 3CWBD
chains in the Genus database with same CATH topology
1DX7A 2LKMA 5APYA 3LIDA 2HYNA 2IPPA 2KLVA 3I5CA 5AW8B 1FDMA 3A2AA 2GUSA 4ZKUA 1CSBA 1NKZB 3V2QA 5AVSB 1RF1B 3HUSB 3VMXA 1H88A 1HGZA 1LTIC 1LWUA 1SQQK 4IFFA 4B86A 2HPCB 2FXMA 1CI6B 1FZCB 1T2KC 2IFMA 3NMDA 3UIAA 1URQC 3N4XA 1LWUC 2ZFCA 3B5NC 3HD7D 2KP8A 2OYHB 1N7LA 3KPEA 3KQGA 3RK2D 1URQA 5CCHD 1GTWA 1L4AD 3OA7A 1SP4A 3L37A 1GL2A 4GIFA 5AW9B 1MZ9A 1JO5A 4W7ZA 2KYVA 3SWFA 3U59A 2YO3A 1JUNA 1RF0A 3VOPA 1J1EB 2J58A 3IR9A 3P32A 4JYBA 4W7YA 1YTZT 1FZGA 1FJKA 1RE3C 4AYCA 5CCHC 1NH4A 4IFMA 1L4AC 3B5NA 3LW5H 3MGNA 2R3CA 2OYHC 5AW7B 1EQ7A 1JMMA 4WY4B 3M91A 1H89A 1QL2A 1LTJB 2QM8A 1FAVA 2Q9IA 1DH3A 2W6BA 1H8AA 3P8CE 4JYCA 1GW3A 1FZFA 1L4AB 3TYYA 1RE3A 1URQD 5CCHA 3TNUB 3VN0A 1G2CB 1GK6A 1GL2B 1HJBA 1SQPK 4WY4C 1KILC 1GU5A 3A3YB 2HODB 1SFCD 2HODA 1JTHA 4OH8B 1N73A 5APUA 1G1JA 1PFIA 4LLHA 2JJLA 1LTBC 1VDFA 1W2EA 3BRVB 2IX7C 1LTAC 3HE5B 2XV5A 3BATA 1LTTC 4C46A 2I1JA 3P7KA 3V5BA 3V2NA 1IFMA 1LTSC 3RK2C 1KILB 3EFGA 5APXA 2HFED 2OYHA 5AVQB 1MV8A 2ZXEB 2WT7B 3L35A 1M1JC 4W80A 3OAKA 4I1LA 1JY3O 2W6AA 1SQBK 3U1CA 1S9KD 3OJAB 1AFOA 1SFCB 1LT9C 2OYIB 2P7JA 3B8EB 1RE4A 2Q7CA 5CCGA 1KZUB 4JF7A 4WBAA 3RL0D 5AW3B 1FZEA 1LTJA 3CI9A 1RY3A 1IFJA 1A02F 2KOGA 3II6A 1NOHA 1M7LA 2YKOA 1SFCC 5CJ0A 3HRNA 3RK3D 1CW5A 1ZV8A 2XZRA 1FU1A 5AW1B 1AQ5A 3NFQA 2O01H 1HUCA 1NTKK 3A7OA 4DOJA 2Z4EA 2NPSA 5KJ7D 2N1TC 3VYIA 1JY2N 2J59M 1GD2E 1JCDA 5CMZA 1KFNA 1LWUB 2NPSC 3VMYA 2Z5IA 5AVXB 3CL3D 2HPCA 2QM7A 5CHXA 2WT7A 4AUWA 1FZAA 1HGVA 1GW4A 1DEBA 1HTLC 5APSA 1GU4A 2M8RA 2GM4A 2P2UA 3A5TA 3HUSC 3V4QA 1MUUA 3VMZA 2C0XA 1FJPA 2WSCH 1IJDB 3WMM0 1X8YA 1NHLA 5AVVB 3L4FA 1N7SA 3P8MC 2WPSA 1KILA 3CLQA 5APVA 3RK3B 2W27A 1WRGA 2N9BA 1HH0A 1OXZA 3HE4B 3MTUE 2R5DA 2WPRA 2WPQA 1JY2P 3GHGB 3EQ2A 1N7SC 4N6JA 1NKNA 3MD0A 4N78E 1CI6A 1JTHB 2YO2A 3TSIA 1GL2D 2P1JA 4HH2A 1L0LK 2H43A 2WITA 3RL0C 1T3UA 3HUSA 2YNYA 1G1IA 1J2JB 3IFMA 3NXSA 4WY4A 5KTBA 1GK4A 3BASA 4I6MC 2FFDA 4LGDE 3GHGC 1FOSF 5AVYB 1SQVK 2OARA 1G2CA 1IK9A 1VPCA 3HD7B 1J1DC 3KDPB 2L5GB 4Y99C 5CCGC 1X9VA 3BVHA 4N78D 2FYZA 1N73B 3HD7C 1JNMA 2HLOA 3H32B 1JOCA 2XDJA 2PAJA 3VP9A 1J1EC 3RL0B 3M0DA 3G3ZA 1FZBA 1LTJC 1LTGC 5CCGD 1HBWA 5AVUB 2XKMA 2R32A 2N1TA 1NU1K 3M9HA 3H32A 1JY3P 4GKGA 3N7NA 2XNXA 4IFDK 3B5NB 3V2PA 3B5ND 3HE5A 3P8CD 4WB4A 4C7NA 5AW2B 1N73C 1YTZI 3MIWA 4M3LA 3E1IA 2VRSA 1IC2A 2N1TD 1GZLA 2WZ7A 1KQLA 2Z5HA 3R2PA 4N3YB 2MJZA 2Q3IA 1GL2C 1ZN5A 1SVFA 1IFIA 1E5WA 1FZCC 2I1KA 4C7RA 3KYQA 5AVRB 1IFNA 4WY4D 2YKPA 4GT1A 1J1DB 2FFDC 5AW4B 1QL1A 3V2RA 2E42A 3O8ZA 4KHXA 3HE4A 1FBMA 1NAFA 2GUVA 1YYCA 3L36A 3M0DC 5KLVK 2WSFH 2NPSB 2XU6A 5AVZB 3HTKA 1T8ZA 1S9KE 1ZR4A 5AW5B 4ZKPA 1URQB 1JY2O 2H8PD 1RE4C 4Y99B 2WSEH 3C9IA 1X79B 1L0NK 4I2LC 3SWYA 1IFDA 1MFZA 3LIEA 1IO4A 4RESB 1JCCA 3RK2B 3MUDA 3HTKB 5BVZA 1XTGB 1NTMK 2P67A 2CPSA 2O1JA 1CZQA 2Q5UA 5BU8B 1A02J 1KILD 3GHGA 2YKQA 2KB7P 3M0AA 1LT9B 4EOTA 2KSJA 5AVTB 2BASA 5BU5A 3H6PA 1NWQA 2POHA 3PP5A 5KJ7C 2H7HA 2C0WA 5APQA 2YMYA 5APWA 1XTCC 1RF1A 2C9LY 2R5BA 2A45I 2O1KA 1N86A 2NPSD 3TNUA 2FFDB 2N1TB 4AQRD 2M3BA 1NO4A 1ZLLA 1FZCA 1RF0C 1JY3N 1HWTC 1M1JB 4XA4A 1ZR2A 4DZOA 1LGHB 1OWAA 1WT6A 3U1AA 2JEEA 1Z56A 4HYTB 2FKWB 3RK3C 5KJ7A 2OYIC 3V4WA 2A45G 3M06A 5AVWB 3HD7A 2E43A 2C9NY 3TK1A 1M1JA 1NTZK 1T3JA 2CPBA 2PP6A 1T2KD 3T97A 3VP8A 2A45H 2WWWA 4XE5B 4O9BA 1SLQA 1LT9A 2WTYA 1FOSE 3BRTB 3VTPC 1N2DC 3M9QA 5CJ4A 3NTNA 5APTA 4LC1A 1SQXK 1HVVA 1KFMA 4C7NB 1SFCA 3M9BA 4EIJA 2OYIA 1RF1C 2IFNA 5AW0B 1L4AA 2FYUK 2HG5D 5AW6B 1GDTA 1N7SB 1N7SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y99 C;  1J1D C;  1YTZ T;  1J1E B;  4Y99 B;  1YTZ I;  1J1E C;  1J1D B; 
#chains in the Genus database with same CATH topology
 1DX7 A;  4R4L A;  2IBZ D;  3WU2 E;  2WQY C;  4JQ0 D;  1EDL A;  4KJM A;  4ASW A;  4A7P A;  1T6A A;  1SQB G;  2FXP A;  2LKM A;  4L73 A;  4PD4 D;  5APY A;  5KLV D;  3LID A;  4DJG A;  1YHQ P;  4GOD A;  2HYN A;  2IPP A;  2KLV A;  3I5C A;  5AW8 B;  1EZV E;  1FDM A;  5KAI H;  2AXC A;  2D2C B;  3A2A A;  4TLF A;  1VF5 D;  2QA4 P;  1OIP A;  4H0L C;  2GUS A;  1BCC J;  4ZKU A;  1CSB A;  1KIL E;  3L70 G;  1NKZ B;  3V2Q A;  4JBZ A;  5AVS B;  1RF1 B;  3F89 A;  3HUS B;  3VMX A;  3AE3 C;  1OVV A;  1Q90 D;  1H88 A;  3VMA A;  1HGZ A;  1LTI C;  4YPC A;  1LWU A;  1SQQ K;  2KUB A;  3GG2 A;  4IFF A;  4B86 A;  1L0L G;  1P84 I;  1CI6 B;  2FXM A;  2FYU J;  2M3E A;  1NU1 G;  1R5L A;  1SQB D;  3CX5 E;  1T2K C;  2BCC J;  2FXO A;  2IFM A;  3GF3 A;  3NMD A;  3V6I A;  1BDD A;  1PP9 E;  3LW5 J;  4PJ0 E;  3UIA A;  1JMB A;  3CCR P;  1YJ9 P;  2LXB A;  3IF4 A;  1NU1 D;  1URQ C;  1M1K Q;  1LWU C;  2ZFC A;  3N4X A;  1U7J A;  1EZV D;  3B5N C;  2ZXX A;  2KP8 A;  3HD7 D;  3D71 A;  2M5A B;  1HJ0 A;  1VQ9 P;  3PTZ A;  3H1L D;  1QVF O;  1M56 D;  1S5L E;  2OYH B;  1N7L A;  3CXH D;  3L71 G;  4NPF X;  3KPE A;  1NTM J;  2IBZ E;  3KQG A;  1KB9 I;  3L75 D;  3RK2 D;  1NJI Q;  1URQ A;  5CCH D;  1GTW A;  1L4A D;  3OA7 A;  1SP4 A;  2SPZ A;  3L37 A;  3CME P;  1YIJ P;  1GL2 A;  1UIX A;  4GIF A;  5AW9 B;  1MZ9 A;  3TGU J;  1BE3 J;  1JO5 A;  4H0L B;  1PGO A;  1EDK A;  4W7Z A;  2JR8 A;  2KYV A;  2LXC B;  3U59 A;  3SWF A;  2YO3 A;  3G6E P;  3CCM P;  1JUN A;  1RF0 A;  4YXD C;  3VOP A;  1J1E B;  2J58 A;  3IR9 A;  4Y28 J;  2ZVN B;  3P32 A;  4JYB A;  4W7Y A;  1JM0 A;  1YTZ T;  2M0B A;  2JWD A;  3AE9 C;  2OYO A;  3D70 A;  1FZG A;  4BXL A;  1NGM B;  1FJK A;  1RE3 C;  4AYC A;  5CCH C;  1NH4 A;  4IFM A;  1L4A C;  3H1H G;  3H1H D;  2RN0 A;  1AQT A;  2AXT E;  1EXI A;  3B5N A;  3LW5 H;  3MGN A;  5GTH E;  3L74 J;  2R3C A;  4UB6 E;  1EZV I;  2OYH C;  2A06 E;  1WMK A;  1S1C X;  5AW7 B;  3L70 E;  3IAO A;  1EQ7 A;  3CX5 H;  1KMI Z;  4HB1 A;  2W83 C;  4WVZ A;  1JMM A;  4WY4 B;  1Y9B A;  1NU1 E;  4U3F J;  3M91 A;  2ZT9 C;  1PGJ A;  2Q6Q A;  3F5H A;  4D6T E;  1QL2 A;  1LTJ B;  1NTK E;  2QM8 A;  1H89 A;  1L0N E;  1FAV A;  3FWN A;  2Q9I A;  1BGY J;  2OTL P;  1KYO H;  1S2E A;  1W2B O;  5CMZ A;  2YXQ B;  1DH3 A;  1RH5 B;  1OW7 A;  2CK3 H;  1NTZ G;  2QIW A;  2W6B A;  3P8C E;  1GW3 A;  4JYC A;  4TT3 H;  1H8A A;  1QX8 A;  1FZF A;  5K5G B;  2G3A A;  2QJY C;  3L74 D;  3FX0 A;  3FGA D;  1E79 H;  2W8Z A;  3GF7 A;  3L75 G;  1L4A B;  3KXD A;  3TYY A;  1RE3 A;  1URQ D;  5CCH A;  2E5T A;  3TNU B;  3VN0 A;  1S5L X;  2RKL A;  1G2C B;  1K05 A;  1GK6 A;  1TU3 F;  1GL2 B;  4IL6 E;  4H13 B;  1SQP K;  2O3J A;  1HJB A;  1S3J A;  4WY4 C;  2KNC A;  1SQV E;  3L73 G;  5M1B A;  1U57 A;  1KIL C;  1GU5 A;  3A3Y B;  1VL2 A;  1YQ3 C;  2OQQ A;  2HOD B;  3H1I D;  3CMA P;  3CWB E;  2K1A A;  1SFC D;  3QWO C;  2HOD A;  1L0L D;  5TJH A;  1JTH A;  3TGU D;  3G71 P;  1YJN P;  1KYO D;  1PP9 G;  4OH8 B;  5GTH H;  3OW2 O;  5APU A;  1G1J A;  1N73 A;  4LLH A;  1DD4 A;  1PFI A;  1FE6 A;  4IL6 X;  3AEF C;  1FDO A;  1PPJ E;  2JJL A;  3AE7 C;  2ZVO B;  3RBZ A;  1LTB C;  1PZQ A;  1VDF A;  1W2E A;  2H88 C;  3ABV C;  3CWB G;  1YI2 P;  2WMM A;  3BRV B;  3AEE C;  2QEX P;  2IX7 C;  1D7M A;  3GW6 A;  3BCC J;  1LTA C;  2QSI A;  3HE5 B;  2XV5 A;  4IL6 H;  3GLM A;  3BAT A;  1LTT C;  3L72 D;  5EFW B;  3TF5 A;  5KAI E;  1KC8 Q;  2IDB A;  1AV1 A;  4C46 A;  1EDJ A;  5CBO A;  2I1J A;  2BCC D;  3L71 E;  3JCU E;  1YQ4 C;  2JWA A;  1Q86 Q;  1VF5 C;  2FYU D;  4RO0 A;  3AE6 C;  3R4Y A;  3P7K A;  1FZC B;  3AE2 C;  3V5B A;  3V2N A;  1IFM A;  2Q1K A;  2KK7 A;  5KKZ B;  1LTS C;  3RK2 C;  1N8R Q;  1SQX J;  2ZAE B;  1KIL B;  3C8V A;  1AA0 A;  3EFG A;  5APX A;  2HFE D;  4ASV A;  2OYH A;  5AVQ B;  4BRY B;  2O01 J;  1MV8 A;  2KZJ A;  3L72 J;  1OZH A;  1SS1 A;  2ZXE B;  3L35 A;  4XFJ A;  2WT7 B;  1M1J C;  2IYO A;  1Y8A A;  4W80 A;  2B87 B;  1QGK B;  3OAK A;  4K3A A;  1N73 B;  4I1L A;  1JY3 O;  4CPG A;  1L2P A;  5KLV J;  2W6A A;  1BDC A;  1SQQ E;  4PV1 C;  1SQB K;  2AEJ A;  4I7Z C;  2ZYG A;  1ZRT D;  4H44 C;  3U1C A;  2KNC B;  1S9K D;  1VQN P;  3OJA B;  1AFO A;  1SFC B;  1LT9 C;  2OYI B;  1K9M Q;  2P7J A;  3B8E B;  1L0L J;  1RE4 A;  2K9J A;  3A0H H;  2H89 C;  2Q7C A;  3B4S A;  5CCG A;  1KZU B;  4JF7 A;  4WBA A;  3RL0 D;  3O6Q A;  3H1I J;  1FZE A;  2YIU C;  1LTJ A;  3CI9 A;  1RY3 A;  1IFJ A;  1PPJ G;  2E76 C;  5AW3 B;  3SSU A;  3H1J D;  1A02 F;  1ZME C;  2KOG A;  3Q5R A;  1OMI A;  1K8A Q;  1EXJ A;  3II6 A;  1NAY A;  1NOH A;  2BEQ D;  1M7L A;  2G8Y A;  2YKO A;  1SFC C;  5CJ0 A;  3Q3D A;  1PIX A;  2NZ2 A;  3HRN A;  3RK3 D;  1CW5 A;  1IK7 A;  1SQP E;  1ZV8 A;  2XZR A;  3A0H E;  1SQX G;  3USS A;  1FU1 A;  4I7Z B;  4UB8 E;  5AW1 B;  3NFQ A;  4Z1M H;  3CPW O;  3L75 E;  1AQ5 A;  2DW3 A;  2E75 D;  3FXD A;  1PGQ A;  2FY8 A;  2O01 H;  3CXH E;  1HUC A;  1NTK K;  3A7O A;  3H1K E;  4DOJ A;  3H1L E;  4YXW H;  5GTI H;  2Z4E A;  2NPS A;  5KJ7 D;  3AE1 C;  2N1T C;  1QEX A;  3VYI A;  1LP1 A;  1VQ6 P;  2QJP C;  1SQV G;  2B9B A;  1JY2 N;  2J59 M;  2KLU A;  4UB8 H;  5E79 H;  5KLI C;  3CD6 P;  1BGY D;  5DJU B;  2R44 A;  1GD2 E;  1SQB E;  1JCD A;  2W6J H;  1LJ2 A;  3AE4 C;  2YIU B;  2ZYA A;  2RH0 A;  1KFN A;  1LWU B;  2NPS C;  2A06 G;  3L73 E;  3S1K A;  3VMY A;  4OGQ D;  5TIS H;  1SQX D;  2Z5I A;  1EZV G;  5AVX B;  3CL3 D;  2B88 A;  2HPC A;  1VQK P;  2QM7 A;  4JPZ B;  5CHX A;  4DT0 A;  2WT7 A;  2BCC G;  4AUW A;  1HF9 A;  5KAF E;  1FZA A;  1HGV A;  1GW4 A;  1DEB A;  1HTL C;  5APS A;  1YJW P;  4WWI A;  2B89 A;  2M8R A;  1L0N G;  3Q5P A;  1VQM P;  1GU4 A;  2QRX A;  2P2U A;  3H1H J;  3A5T A;  2GM4 A;  2ZYD A;  1KB9 E;  2AEM A;  3BCC D;  1KTM A;  3G4S P;  1OVR A;  3HUS C;  2WSC J;  1MUU A;  1DEE G;  2AEF A;  2C0X A;  3V4Q A;  3VMZ A;  3CCL P;  1KV4 A;  4PD4 E;  3S9O A;  5GTI E;  1NTZ E;  1FJP A;  2WSC H;  3CCU P;  1IJD B;  1FDI A;  3WMM 0;  2D2C C;  3FXE A;  1X8Y A;  4U3F G;  3H1J E;  4K35 A;  1NHL A;  4BRY A;  5AVV B;  3L4F A;  3AEC C;  4R4M A;  1N7S A;  4L76 A;  1BSH A;  3P8M C;  2WPS A;  1P84 D;  1KIL A;  3CLQ A;  5APV A;  3WU2 H;  3RK3 B;  1GMJ A;  2W27 A;  3BCC G;  2GA1 A;  1WRG A;  3WUT A;  1IFP A;  2N9B A;  3PH0 A;  1HH0 A;  1OXZ A;  3HE4 B;  3MTU E;  2E75 B;  3W68 A;  2R5D A;  2WPR A;  2WPQ A;  1JY2 P;  3GHG B;  3EQ2 A;  2E74 C;  1Q82 Q;  1N7S C;  4N6J A;  1NKN A;  2FYN B;  3MD0 A;  4N78 E;  1SQQ D;  2QVA A;  5DJT B;  1DIP A;  1CI6 A;  1JTH B;  2YO2 A;  1MKM A;  3AE5 C;  3TSI A;  1GL2 D;  2P1J A;  4HH2 A;  1L0L K;  1R8E A;  2WIT A;  2H43 A;  2FYN C;  3RL0 C;  1T3U A;  2HPC B;  3HUS A;  1BCC E;  3H25 A;  2YNY A;  2E76 D;  4H13 C;  5CBN A;  1G1I A;  2O01 N;  1J2J B;  3IFM A;  1U7M A;  2OGU A;  3NXS A;  4WY4 A;  3Q5S A;  5KTB A;  2E5Y A;  1H0T B;  3JCU H;  2Y9Y A;  4ZNC A;  1GK4 A;  3BAS A;  2K88 A;  4H44 D;  2BEZ F;  4I6M C;  4MN4 C;  3Q1M A;  2B87 A;  2FFD A;  2UWJ E;  4LGD E;  2FYU E;  3GHG C;  1FOS F;  4GOE A;  2BCC E;  3MUD C;  1PP9 J;  1KB9 H;  5AVY B;  1BCC D;  5KLI B;  1VQO P;  2IZ0 A;  1SQV K;  2OAR A;  1G2C A;  1IK9 A;  1OW6 A;  2L91 A;  1VPC A;  4UB6 H;  1SQP G;  3A0B H;  3AED C;  3HD7 B;  3IN6 A;  1J1D C;  3KDP B;  3MHV A;  2L5G B;  1VQ4 P;  4Y99 C;  3B71 A;  5CCG C;  4D6T G;  4EI2 A;  2JKV A;  1X9V A;  2KI7 B;  2QJK B;  2ZT9 D;  2FYZ A;  3AE8 C;  3EWK A;  1NVO A;  3H1K G;  3KHU A;  3HD7 C;  4N78 D;  1NTM E;  2ZT9 B;  5H2F H;  1JNM A;  2HLO A;  3E1R A;  3C1L A;  3H32 B;  1JOC A;  2XDJ A;  1AVO A;  1LNQ A;  2OTJ P;  2PAJ A;  3CCQ P;  3VP9 A;  1IO4 A;  3TGU E;  2WSS H;  4RKU J;  1J1E C;  1BE3 E;  3RL0 B;  2Q3E A;  3M0D A;  4EYY Q;  2WPV B;  3CX5 I;  3G3Z A;  1FZB A;  1FS0 E;  1NTM G;  3FWL A;  3QH9 A;  1LTJ C;  2KSE A;  1LTG C;  2KS1 A;  3L74 G;  5H2F E;  4RJT A;  4L74 A;  5CCG D;  3D6Z A;  1HBW A;  2KZI A;  5AVU B;  3CCV P;  1S72 P;  2XKM A;  3CC2 P;  2K37 A;  1USE A;  2N1T A;  1NU1 K;  2R32 A;  3M9H A;  4GOF A;  3H32 A;  1JY3 P;  1R5S A;  3N7N A;  4GKG A;  1YIT P;  3CC7 P;  3D6Y A;  1KB9 D;  1BCC G;  4HKZ H;  1NTM D;  2XNX A;  3KZI E;  1ZP0 C;  3L74 E;  1MFT A;  4IFD K;  3T97 B;  1ZW0 A;  2PGD A;  3B5N B;  3V2P A;  1K73 Q;  3L70 J;  3AEB C;  1QLE D;  3B5N D;  4QMA A;  1KQG B;  2WSF J;  3HE5 A;  2AXT H;  3P8C D;  4WB4 A;  4C7N A;  2QE7 H;  5AW2 B;  3Q2Y A;  1N73 C;  1NU1 J;  1YTZ I;  3MIW A;  4M3L A;  3MP7 B;  4U3F E;  3E1I A;  2VRS A;  5L8R J;  1IC2 A;  4D6T J;  3A0B E;  1NTK J;  2N1T D;  4H13 D;  1L0N J;  3SFE C;  1BGY E;  1GZL A;  2E76 B;  1NTK G;  1NTK D;  4BWN A;  3H1J G;  4HJG H;  2WZ7 A;  1KQL A;  1ZXG A;  2Z5H A;  3R2P A;  1S4X A;  4IOI H;  4N3Y B;  1KQF B;  5B5E H;  3AEG C;  3I56 P;  1QVG O;  2MJZ A;  3EFF K;  2Y0C A;  2Q3I A;  1GL2 C;  3PJS K;  1ZN5 A;  3W67 A;  3L70 D;  1KN7 A;  1SVF A;  1IFI A;  1E5W A;  1M8O B;  2A06 D;  2KIK A;  3H1K D;  1FZC C;  2I1K A;  4C7R A;  3KYQ A;  5E79 E;  4OWF A;  4EDF A;  1JEK A;  5AVR B;  3S4R A;  3PHL A;  3I55 P;  3CX5 D;  2PRR A;  1IFN A;  3TGU G;  1X22 A;  1SQP D;  4WY4 D;  1P84 H;  2YKP A;  5B5E E;  4PD4 I;  4GT1 A;  1J1D B;  2FFD C;  1AVY A;  5AW4 B;  1QL1 A;  2JO1 A;  5KKZ C;  3V2R A;  2E42 A;  1PL5 A;  2QJP B;  3O8Z A;  1BE3 G;  1X0T A;  4KHX A;  3HE4 A;  1SQV J;  1FBM A;  2K3R A;  1NAF A;  3RBX A;  1VQ8 P;  2GUV A;  5B66 H;  1K04 A;  2Y9Z A;  3ZDM A;  1YYC A;  3CWB J;  3L36 A;  3M0D C;  5KLV K;  2WSF H;  1PGP A;  2NPS B;  2XU6 A;  1KD1 Q;  1VQP P;  1KOR A;  5AVZ B;  3HTK A;  1SQQ G;  2FBW C;  1T8Z A;  3KZI H;  1S9K E;  3SFD C;  1ZR4 A;  3AEA C;  3PRJ A;  5AW5 B;  4ZKP A;  2FYU G;  2WSE J;  1W5C E;  2R3S A;  3E7K A;  3BVH A;  1URQ B;  1FC2 C;  2M5A A;  1JY2 O;  1NTZ D;  1RE4 C;  2H8P D;  3CCE P;  2W90 A;  4Y99 B;  2E74 D;  2WSE H;  1RQV A;  2WVR A;  1VF5 B;  2HR3 A;  2ITA A;  3BCC E;  3C9I A;  1X79 B;  1L0N K;  4I2L C;  4KT0 J;  1IFD A;  1MFZ A;  3LIE A;  3SWY A;  2YXR B;  1JCC A;  1BGY G;  2QG4 A;  4RES B;  3RK2 B;  2P58 A;  1PP9 D;  3MUD A;  5TIS E;  3HTK B;  3L71 J;  2KS1 B;  5B66 E;  5BVZ A;  1XTG B;  3L72 G;  1NTM K;  2P67 A;  2CPS A;  2O1J A;  1CZQ A;  2Q5U A;  2IZ1 A;  2Y0D A;  3SWK A;  5KAF H;  1SQX E;  3CC4 P;  2MKV A;  4GDO A;  3L73 D;  4U7J A;  1ZOY C;  1M90 Q;  1PV3 A;  3CCJ P;  1NYH A;  2E75 C;  5BU8 B;  1KIL D;  3GHG A;  3WUV A;  1A02 J;  2K9J B;  2YKQ A;  2KB7 P;  3M0A A;  3CXH H;  1YBK A;  3L72 E;  3WUU A;  2I8D A;  4U3F D;  5C39 A;  1S5L H;  1LT9 B;  4EOT A;  2KSJ A;  5AVT B;  2BAS A;  5BU5 A;  3H6P A;  1NWQ A;  2POH A;  3PP5 A;  5KJ7 C;  2H7H A;  2C0W A;  2KXP B;  5KLV E;  5APQ A;  1SQQ J;  2YMY A;  5APW A;  1PPJ D;  1XTC C;  2QJY B;  1RF1 A;  2C9L Y;  2PFX A;  2R5B A;  2A45 I;  2O1K A;  3ITK A;  1KYO E;  1N86 A;  2NPS D;  3RK3 E;  1H0T A;  1OW8 A;  2N9Y B;  1L0L E;  2ZJS E;  3G9R A;  1RQU A;  3TNU A;  4NPD A;  2FFD B;  1Y47 A;  2N1T B;  3JSV C;  2M3B A;  3TDK A;  4H0L D;  1NO4 A;  1ZLL A;  3H1I E;  4AQR D;  1RF0 C;  2IYP A;  4YTP C;  1JY3 N;  1FZC A;  2NRG A;  1HWT C;  1SQV D;  3RL0 g;  4OGQ B;  1M1J B;  4XA4 A;  1ZR2 A;  4DZO A;  1BE3 D;  1VQ5 P;  1LGH B;  2P10 A;  1OX3 A;  1OWA A;  1WT6 A;  3U1A A;  1AJY A;  1SQP J;  4L75 A;  2JEE A;  1BSN A;  1Z56 A;  1ZRT E;  3L75 J;  4HYT B;  2FKW B;  4NPE A;  3H1L G;  3RK3 C;  5KJ7 A;  3H1K J;  2OYI C;  1DD3 A;  3H1L J;  2YMK A;  2A45 G;  3O6Q B;  3V4W A;  3M06 A;  1JB0 J;  1LP1 B;  3HD7 A;  5AVW B;  2E43 A;  4H44 B;  1VQL P;  2Y0E A;  2C9N Y;  3TK1 A;  1M1J A;  1NTZ K;  2E74 B;  1UII A;  2IBZ I;  1Q7Y Q;  1T3J A;  2V4H A;  4PV1 D;  3JC2 2;  2CPB A;  2PP6 A;  4OGQ C;  2XND H;  4ZMD A;  3T97 A;  1T2K D;  3VP8 A;  1L0N D;  1SQB J;  2A45 H;  2WWW A;  4D6T D;  1M57 D;  1Q2N A;  3L73 J;  4O9B A;  1SLQ A;  4XE5 B;  1KQS O;  1OVU A;  5KLV G;  1LT9 A;  2WTY A;  1EDI A;  3BRT B;  1FOS E;  2RMZ A;  3VTP C;  3L71 D;  1N2D C;  3GMA A;  1VQ7 P;  3M9Q A;  5CJ4 A;  3CXH I;  1RHZ B;  1OFC X;  3NTN A;  3CCS P;  5APT A;  3H1H E;  2J5U A;  3RGU A;  4PJ0 H;  2K9Y A;  2V7Q H;  1LT1 A;  1SQX K;  1HVV A;  4LC1 A;  4OVN F;  2D2C D;  4PD4 H;  2JDI H;  1USD A;  1KFM A;  1EC5 A;  4C7N B;  1SFC A;  2V7Q J;  3H1I G;  3M9B A;  1NTZ J;  4EIJ A;  1Q81 Q;  2IBZ G;  2OYI A;  1RF1 C;  2IFN A;  5AW0 B;  1KYO I;  1L4A A;  4PV1 B;  2FYU K;  3H1J J;  2HG5 D;  2OTK E;  3K5B A;  3PLN A;  5AW6 B;  1IZN B;  2QJK C;  4DCK A;  1GDT A;  2JP3 A;  1N7S B;  2LR2 A;  3MZW B;  1P84 E;  1N7S D;  3CWB D; 
#chains in the Genus database with same CATH homology
 1DX7 A;  2LKM A;  5APY A;  3LID A;  2HYN A;  2IPP A;  2KLV A;  3I5C A;  5AW8 B;  1FDM A;  3A2A A;  2GUS A;  4ZKU A;  1CSB A;  1NKZ B;  3V2Q A;  5AVS B;  1RF1 B;  3HUS B;  3VMX A;  1H88 A;  1HGZ A;  1LTI C;  1LWU A;  1SQQ K;  4IFF A;  4B86 A;  2HPC B;  2FXM A;  1CI6 B;  1FZC B;  1T2K C;  2IFM A;  3NMD A;  3UIA A;  1URQ C;  3N4X A;  1LWU C;  2ZFC A;  3B5N C;  3HD7 D;  2KP8 A;  2OYH B;  1N7L A;  3KPE A;  3KQG A;  3RK2 D;  1URQ A;  5CCH D;  1GTW A;  1L4A D;  3OA7 A;  1SP4 A;  3L37 A;  1GL2 A;  4GIF A;  5AW9 B;  1MZ9 A;  1JO5 A;  4W7Z A;  2KYV A;  3SWF A;  3U59 A;  2YO3 A;  1JUN A;  1RF0 A;  3VOP A;  1J1E B;  2J58 A;  3IR9 A;  3P32 A;  4JYB A;  4W7Y A;  1YTZ T;  1FZG A;  1FJK A;  1RE3 C;  4AYC A;  5CCH C;  1NH4 A;  4IFM A;  1L4A C;  3B5N A;  3LW5 H;  3MGN A;  2R3C A;  2OYH C;  5AW7 B;  1EQ7 A;  1JMM A;  4WY4 B;  3M91 A;  1H89 A;  1QL2 A;  1LTJ B;  2QM8 A;  1FAV A;  2Q9I A;  1DH3 A;  2W6B A;  1H8A A;  3P8C E;  4JYC A;  1GW3 A;  1FZF A;  1L4A B;  3TYY A;  1RE3 A;  1URQ D;  5CCH A;  3TNU B;  3VN0 A;  1G2C B;  1GK6 A;  1GL2 B;  1HJB A;  1SQP K;  4WY4 C;  1KIL C;  1GU5 A;  3A3Y B;  2HOD B;  1SFC D;  2HOD A;  1JTH A;  4OH8 B;  1N73 A;  5APU A;  1G1J A;  1PFI A;  4LLH A;  2JJL A;  1LTB C;  1VDF A;  1W2E A;  3BRV B;  2IX7 C;  1LTA C;  3HE5 B;  2XV5 A;  3BAT A;  1LTT C;  4C46 A;  2I1J A;  3P7K A;  3V5B A;  3V2N A;  1IFM A;  1LTS C;  3RK2 C;  1KIL B;  3EFG A;  5APX A;  2HFE D;  2OYH A;  5AVQ B;  1MV8 A;  2ZXE B;  2WT7 B;  3L35 A;  1M1J C;  4W80 A;  3OAK A;  4I1L A;  1JY3 O;  2W6A A;  1SQB K;  3U1C A;  1S9K D;  3OJA B;  1AFO A;  1SFC B;  1LT9 C;  2OYI B;  2P7J A;  3B8E B;  1RE4 A;  2Q7C A;  5CCG A;  1KZU B;  4JF7 A;  4WBA A;  3RL0 D;  5AW3 B;  1FZE A;  1LTJ A;  3CI9 A;  1RY3 A;  1IFJ A;  1A02 F;  2KOG A;  3II6 A;  1NOH A;  1M7L A;  2YKO A;  1SFC C;  5CJ0 A;  3HRN A;  3RK3 D;  1CW5 A;  1ZV8 A;  2XZR A;  1FU1 A;  5AW1 B;  1AQ5 A;  3NFQ A;  2O01 H;  1HUC A;  1NTK K;  3A7O A;  4DOJ A;  2Z4E A;  2NPS A;  5KJ7 D;  2N1T C;  3VYI A;  1JY2 N;  2J59 M;  1GD2 E;  1JCD A;  5CMZ A;  1KFN A;  1LWU B;  2NPS C;  3VMY A;  2Z5I A;  5AVX B;  3CL3 D;  2HPC A;  2QM7 A;  5CHX A;  2WT7 A;  4AUW A;  1FZA A;  1HGV A;  1GW4 A;  1DEB A;  1HTL C;  5APS A;  1GU4 A;  2M8R A;  2GM4 A;  2P2U A;  3A5T A;  3HUS C;  3V4Q A;  1MUU A;  3VMZ A;  2C0X A;  1FJP A;  2WSC H;  1IJD B;  3WMM 0;  1X8Y A;  1NHL A;  5AVV B;  3L4F A;  1N7S A;  3P8M C;  2WPS A;  1KIL A;  3CLQ A;  5APV A;  3RK3 B;  2W27 A;  1WRG A;  2N9B A;  1HH0 A;  1OXZ A;  3HE4 B;  3MTU E;  2R5D A;  2WPR A;  2WPQ A;  1JY2 P;  3GHG B;  3EQ2 A;  1N7S C;  4N6J A;  1NKN A;  3MD0 A;  4N78 E;  1CI6 A;  1JTH B;  2YO2 A;  3TSI A;  1GL2 D;  2P1J A;  4HH2 A;  1L0L K;  2H43 A;  2WIT A;  3RL0 C;  1T3U A;  3HUS A;  2YNY A;  1G1I A;  1J2J B;  3IFM A;  3NXS A;  4WY4 A;  5KTB A;  1GK4 A;  3BAS A;  4I6M C;  2FFD A;  4LGD E;  3GHG C;  1FOS F;  5AVY B;  1SQV K;  2OAR A;  1G2C A;  1IK9 A;  1VPC A;  3HD7 B;  1J1D C;  3KDP B;  2L5G B;  4Y99 C;  5CCG C;  1X9V A;  3BVH A;  4N78 D;  2FYZ A;  1N73 B;  3HD7 C;  1JNM A;  2HLO A;  3H32 B;  1JOC A;  2XDJ A;  2PAJ A;  3VP9 A;  1J1E C;  3RL0 B;  3M0D A;  3G3Z A;  1FZB A;  1LTJ C;  1LTG C;  5CCG D;  1HBW A;  5AVU B;  2XKM A;  2R32 A;  2N1T A;  1NU1 K;  3M9H A;  3H32 A;  1JY3 P;  4GKG A;  3N7N A;  2XNX A;  4IFD K;  3B5N B;  3V2P A;  3B5N D;  3HE5 A;  3P8C D;  4WB4 A;  4C7N A;  5AW2 B;  1N73 C;  1YTZ I;  3MIW A;  4M3L A;  3E1I A;  2VRS A;  1IC2 A;  2N1T D;  1GZL A;  2WZ7 A;  1KQL A;  2Z5H A;  3R2P A;  4N3Y B;  2MJZ A;  2Q3I A;  1GL2 C;  1ZN5 A;  1SVF A;  1IFI A;  1E5W A;  1FZC C;  2I1K A;  4C7R A;  3KYQ A;  5AVR B;  1IFN A;  4WY4 D;  2YKP A;  4GT1 A;  1J1D B;  2FFD C;  5AW4 B;  1QL1 A;  3V2R A;  2E42 A;  3O8Z A;  4KHX A;  3HE4 A;  1FBM A;  1NAF A;  2GUV A;  1YYC A;  3L36 A;  3M0D C;  5KLV K;  2WSF H;  2NPS B;  2XU6 A;  5AVZ B;  3HTK A;  1T8Z A;  1S9K E;  1ZR4 A;  5AW5 B;  4ZKP A;  1URQ B;  1JY2 O;  2H8P D;  1RE4 C;  4Y99 B;  2WSE H;  3C9I A;  1X79 B;  1L0N K;  4I2L C;  3SWY A;  1IFD A;  1MFZ A;  3LIE A;  1IO4 A;  4RES B;  1JCC A;  3RK2 B;  3MUD A;  3HTK B;  5BVZ A;  1XTG B;  1NTM K;  2P67 A;  2CPS A;  2O1J A;  1CZQ A;  2Q5U A;  5BU8 B;  1A02 J;  1KIL D;  3GHG A;  2YKQ A;  2KB7 P;  3M0A A;  1LT9 B;  4EOT A;  2KSJ A;  5AVT B;  2BAS A;  5BU5 A;  3H6P A;  1NWQ A;  2POH A;  3PP5 A;  5KJ7 C;  2H7H A;  2C0W A;  5APQ A;  2YMY A;  5APW A;  1XTC C;  1RF1 A;  2C9L Y;  2R5B A;  2A45 I;  2O1K A;  1N86 A;  2NPS D;  3TNU A;  2FFD B;  2N1T B;  4AQR D;  2M3B A;  1NO4 A;  1ZLL A;  1FZC A;  1RF0 C;  1JY3 N;  1HWT C;  1M1J B;  4XA4 A;  1ZR2 A;  4DZO A;  1LGH B;  1OWA A;  1WT6 A;  3U1A A;  2JEE A;  1Z56 A;  4HYT B;  2FKW B;  3RK3 C;  5KJ7 A;  2OYI C;  3V4W A;  2A45 G;  3M06 A;  5AVW B;  3HD7 A;  2E43 A;  2C9N Y;  3TK1 A;  1M1J A;  1NTZ K;  1T3J A;  2CPB A;  2PP6 A;  1T2K D;  3T97 A;  3VP8 A;  2A45 H;  2WWW A;  4XE5 B;  4O9B A;  1SLQ A;  1LT9 A;  2WTY A;  1FOS E;  3BRT B;  3VTP C;  1N2D C;  3M9Q A;  5CJ4 A;  3NTN A;  5APT A;  4LC1 A;  1SQX K;  1HVV A;  1KFM A;  4C7N B;  1SFC A;  3M9B A;  4EIJ A;  2OYI A;  1RF1 C;  2IFN A;  5AW0 B;  1L4A A;  2FYU K;  2HG5 D;  5AW6 B;  1GDT A;  1N7S B;  1N7S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...