4Y99B

Core domain of human cardiac troponin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
74
structure length
74
Chain Sequence
GKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Core domain of human cardiac troponin
rcsb
source organism Homo sapiens
total genus 31
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00992 Troponin Troponin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.350 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4y99B00
4Y99B 4Y99C 1YTZT 1J1DB 1J1DC 1J1EC 1YTZI 1J1EB
chains in the Genus database with same CATH superfamily
5KLVG 2R3SA 1SQVG 1FZAA 2B88A 1L4AC 1OXZA 3HTKA 1J1EB 1N7SC 3D6YA 4WVZA 2PGDA 1M7LA 2E76D 1EQ7A 4U3FD 1IFNA 2B9BA 2GUSA 2H89C 3H1HD 2FXPA 2IFMA 3PHLA 3TYYA 2QE7H 2YKQA 2KI7B 2JR8A 1Q82Q 1PPJE 5AW2B 2O01H 1BGYJ 3BATA 3H1KE 3RBXA 1GU4A 1EDIA 1VL2A 1LTTC 3KZIE 3MUDC 3RK2D 5KAIE 4PV1B 2Y0DA 2M0BA 3P8MC 1JY3O 2O1JA 3CXHH 1QL1A 2Q9IA 3HUSC 4HYTB 1SQQE 4U3FE 3BCCD 1NAYA 4ZKUA 3CXHD 2YXRB 3L35A 1SQBG 4ASWA 5CJ4A 3HRNA 3AE4C 2E43A 1HWTC 2K9JA 4U7JA 2BEQD 3R4YA 4H13B 5B66H 3FXDA 5TISH 3D6ZA 3AE1C 3H1IG 3FGAD 1J1DC 2NRGA 2R44A 1BCCG 3MHVA 1L4AD 3AE7C 1KB9E 1N7SD 3AEFC 1KTMA 1A02F 4LC1A 4UB6H 4Y28J 2N1TA 1TU3F 1BE3G 2PP6A 3G3ZA 2BCCG 3CXHE 2QG4A 3L72J 2OQQA 1BGYD 3TGUG 1J1EC 2KB7P 1T6AA 3VMZA 1OVRA 2H88C 1IC2A 2ZYGA 1NOHA 1KN7A 1DEBA 1S5LH 3TSIA 1FDOA 1SQXK 3P7KA 3CCRP 1PZQA 3TDKA 1YYCA 3RL0g 1FC2C 5TISE 1KYOI 1VF5B 2QJPC 3TNUB 5B5EE 2R3CA 3OJAB 1EDKA 5APQA 3VYIA 1SQXJ 1CI6B 1IFDA 1PPJG 5E79E 3IN6A 3H1KG 3USSA 1M1JB 5AVSB 5C39A 1HVVA 1WT6A 4JBZA 3CMAP 3CX5I 1DD3A 2KIKA 1DX7A 3Q2YA 1JMMA 2XNXA 1LTBC 3V2QA 1DD4A 3NFQA 1GL2B 1FZBA 2HODA 3CWBE 2IZ0A 2V7QJ 5GTHE 4U3FG 2ZAEB 2XU6A 1KILD 3L72D 2CPBA 3H1HG 2E5YA 1JY2N 1YTZT 5CCGC 2WSEJ 3VOPA 3P8CD 3IF4A 2Z4EA 1JEKA 3L4FA 4C7NA 1EDLA 2ZT9C 3AE8C 1NAFA 4DJGA 1EXIA 4WWIA 4L73A 1L0NK 1X79B 1NHLA 2E74B 1M90Q 5AVZB 2K1AA 1GD2E 1NTZJ 2K37A 4N6JA 2OYIA 3WUVA 5KKZB 4NPEA 2AXTE 1FOSF 2Z5HA 1QL2A 1SQXD 1P84E 4H44C 4I2LC 2KSEA 3RL0B 1EXJA 3OAKA 3VMYA 1L0NJ 2W90A 3L75E 1SP4A 3AE6C 1Q90D 1LTJA 3WU2E 3V2RA 1SQPE 1NU1E 2E5TA 2V7QH 3B5NA 1GMJA 3BRVB 4OGQB 2QJYB 3SWYA 1YQ3C 1DH3A 4PD4H 4GT1A 1LTGC 3G4SP 1IK9A 5GTIH 1ZR4A 4H13D 1RF0C 2WSEH 4PD4D 3U1CA 3L70J 2WMMA 1IFPA 1UIXA 3KQGA 1IO4A 3SWFA 3M9QA 3MD0A 1VQMP 5CCGD 1E79H 3RK3E 2YO2A 1VQ6P 2YMKA 1LP1A 2I8DA 3JC22 1URQC 3D71A 2W6JH 3MP7B 1JTHA 4WY4A 1VQNP 1NTZD 3Q5RA 1IFIA 1OX3A 5AVWB 3CLQA 1KV4A 2P2UA 2ZXXA 1N73B 2FYNC 1ZV8A 1L0ND 4CPGA 3MTUE 4H44D 1NTKD 3AE3C 3CMEP 4UB8E 1YI2P 1QGKB 1YTZI 2H43A 2W83C 1X8YA 2IYPA 2KS1B 1LWUB 3L74E 1OMIA 2Y9YA 3HE5A 3MUDA 1S5LX 1NTZE 2JEEA 1KQFB 2HYNA 3FWLA 3V4QA 2QJKB 5APVA 3L70D 3L72G 3AE5C 1ZMEC 1KORA 3HUSA 3K5BA 1FZCB 1GL2D 3L75G 4TLFA 1NTKE 4GKGA 1VQ4P 2JWDA 1L0LK 2ZJSE 5AVRB 4WY4B 4H0LB 2M8RA 1URQD 4WBAA 2QM8A 4Y99C 1EZVD 2QRXA 1SFCC 1VQOP 5CCHC 1KQSO 2YXQB 4AYCA 2E76C 4XFJA 5KAFE 2KNCA 2A06D 1L0LJ 1GU5A 1WRGA 1S2EA 2NPSC 2Q7CA 3HE4B 3H1LE 1KYOH 3IR9A 4LGDE 1H8AA 5AW4B 2IX7C 3CCVP 1KYOD 1MKMA 4DT0A 3TK1A 3HD7B 3Q3DA 1Y47A 1AVYA 3VN0A 1S4XA 4K35A 3H1IE 2FFDC 3VP9A 1FE6A 1M56D 4N3YB 1NKZB 2IYOA 5AVTB 2OYHB 1RF1B 1LWUC 3VP8A 1GTWA 5DJUB 2HFED 1RQUA 1DEEG 3JCUH 1R5LA 2BCCE 5K5GB 1GZLA 1EDJA 3CCJP 2XZRA 3CI9A 1J2JB 4PD4I 2LR2A 1MZ9A 3L74G 3CPWO 3U1AA 3AECC 1NTZG 1X9VA 2V4HA 3O8ZA 3CCUP 2KYVA 1ZXGA 1JY3N 2KNCB 1SFCD 4ZKPA 5CCHD 3ITKA 1L0LD 1GK4A 4EDFA 1ZRTD 3L73J 4B86A 1LTSC 3C8VA 2M5AB 1FAVA 3O6QB 1KQGB 3L71E 1EC5A 1T8ZA 2MJZA 1NTKG 2NPSD 3CX5E 4RO0A 1Z56A 5AVQB 1R8EA 3CC7P 4N78D 2K88A 1LJ2A 1OVVA 1Q7YQ 3PH0A 1GDTA 1AV1A 2IDBA 3JCUE 1NGMB 1NTMK 1FZEA 2KP8A 3UIAA 1AQ5A 2RMZA 2E75B 2FXMA 1S9KD 1BDDA 2ZYDA 4W80A 3E1RA 3M06A 2WT7B 1MUUA 3S9OA 3W67A 3EFFK 4IFDK 3H1LG 2R32A 3RK3B 2R5BA 3CCEP 3GHGC 1NTMJ 3H1HE 1PV3A 1N86A 1NKNA 2XKMA 2L5GB 1AQTA 2O01N 1LTAC 1LTIC 4OWFA 5AW3B 1LT9A 2VRSA 3HTKB 2UWJE 2AEMA 4ZMDA 5TJHA 3L73D 1NVOA 4GDOA 1K9MQ 2A06G 1KILC 2FY8A 3CCLP 4KT0J 4H0LD 2KZIA 3D70A 4BRYA 2FKWB 1EZVI 1RF0A 1X0TA 3BCCE 2WPVB 2O3JA 5AVUB 2JP3A 2I1JA 1JNMA 4NPFX 2KLVA 5CMZA 4RKUJ 1URQA 3H1JJ 2FYUK 1FOSE 5B66E 1KQLA 5KJ7C 2Y0EA 3PRJA 2IPPA 1GW3A 3CC2P 2H8PD 4M3LA 3AEAC 1OZHA 2DW3A 3L71G 3HD7D 1NTMD 1YQ4C 4HKZH 3QH9A 1Q2NA 1KFNA 4UB6E 2K9JB 2FYUJ 4PV1C 3N7NA 1BGYE 3NXSA 1HF9A 1YJWP 1LT9B 4LLHA 3GW6A 1Y8AA 1S5LE 1QEXA 4IL6H 1FDIA 4L76A 2H7HA 2M3EA 2Q3IA 2N1TB 4H13C 1FS0E 2I1KA 2NZ2A 1H0TA 1FJKA 1K04A 3IFMA 2OGUA 4JPZB 1SS1A 5AW9B 3A0HH 1KFMA 2QA4P 1BDCA 1FJPA 4BWNA 1U7MA 2OTKE 1LT1A 2IFNA 5APXA 3H1JD 2YIUB 4HJGH 2GM4A 5KLVK 1SQVK 2B87A 1SFCA 2WVRA 3A7OA 5KJ7D 4IFMA 3CCSP 1OW8A 3BCCG 5AW7B 3KPEA 1KILE 2FYUD 2RKLA 3L72E 1SLQA 2NPSA 5KLVJ 1SQVJ 1NH4A 2YO3A 1VF5C 4PV1D 4YPCA 3P8CE 4D6TJ 1T3JA 2OARA 4EI2A 2WSSH 1H88A 5KLIB 2HODB 3FWNA 3H32A 2KUBA 3BASA 3R2PA 3L73G 1JUNA 3Q5SA 2D2CB 1M1JC 3EQ2A 2FFDA 4I7ZB 1ZN5A 3GLMA 2WPRA 2Q1KA 1SQXE 1U57A 1VQPP 1GL2C 1SQBK 2BASA 3KDPB 1YHQP 3PJSK 1BGYG 3CCQP 3CD6P 4C7NB 5AW6B 1PFIA 1VQ5P 2CK3H 3LW5J 4PJ0H 1R5SA 2A45H 1G2CA 1SQBJ 2OYIB 1RQVA 2WSFJ 4DZOA 1L4AA 1VPCA 3T97A 1JB0J 1N7SA 1HUCA 1U7JA 2C9NY 1NTMG 4PD4E 2E74C 1G1IA 3MZWB 5KLVD 5GTIE 1SQVD 5CJ0A 1W5CE 4DCKA 4D6TD 4OVNF 2PRRA 1YJ9P 1QVFO 3U59A 1LTJB 3M9HA 5KKZC 1VF5D 1BCCJ 2IZ1A 2KK7A 2E42A 3B5NB 4EIJA 3RL0C 1IJDB 2QVAA 1BE3J 3RK2B 1PP9J 4PJ0E 1NWQA 1L2PA 4NPDA 4DOJA 3GG2A 4OGQC 2QJYC 3M0DC 1L0NE 1JO5A 4KJMA 1LP1B 3AEDC 4ASVA 1Q81Q 3GHGA 1YJNP 2W6BA 2JO1A 3LW5H 1JTHB 4I7ZC 1QVGO 2WQYC 4D6TE 4K3AA 1PL5A 2N1TD 5APUA 1IFMA 3AEGC 2WSFH 1SQBD 3A3YB 3E1IA 4R4MA 1YIJP 4XE5B 2IBZD 1MV8A 4GOFA 2HPCA 3GMAA 3MIWA 1SQQK 1FZGA 1FU1A 3OW2O 1S1CX 2W27A 2KZJA 4IL6X 1SQXG 3L70E 1KILA 2N9YB 3B71A 1IFJA 2E74D 3CCMP 1BCCD 1XTCC 1KMIZ 1JMBA 1VQ7P 1N73C 1HBWA 1ZLLA 1SQQJ 4U3FJ 3L37A 1BE3D 3HE5B 1PP9D 1ZOYC 2AEFA 1MFTA 3RL0D 1EZVE 4JYCA 2XV5A 1UIIA 1LTJC 1H89A 5KJ7A 2C9LY 2A06E 2YKOA 3HUSB 3WMM0 2HG5D 5AVYB 2ZXEB 3RGUA 3SFDC 2WPSA 4OGQD 4IOIH 3M9BA 1QX8A 2QJKC 3VMAA 5AW5B 1YITP 3F5HA 3V5BA 1JM0A 3AEEC 1XTGB 1KYOE 5APTA 2RN0A 4A7PA 2P1JA 2P67A 1FZCC 1PPJD 1J1DB 2PAJA 5BU8B 3EWKA 3KZIH 2A45G 4WY4C 4H0LC 4YXDC 2LKMA 5KAIH 1PGJA 1RE4C 1L0NG 3M0AA 5AW1B 2LXBA 2B89A 2W8ZA 4YXWH 1M8OB 3B4SA 3NMDA 4D6TG 1JY2P 2A45I 5CCGA 1SQQD 4I1LA 5M1BA 3VTPC 3N4XA 5BVZA 1VQLP 5CBOA 4JYBA 2C0WA 3M91A 2QJPB 3I5CA 2JWAA 3L70G 1USDA 3SSUA 4GODA 3HD7C 2J59M 1L0LE 3B5ND 3PTZA 1X22A 1ZRTE 1USEA 3FX0A 1KB9H 3Q1MA 3RBZA 1OIPA 2WTYA 3CL3D 5CBNA 1KB9D 3CWBJ 4R4LA 4GOEA 2WITA 2G8YA 4N78E 2OYHC 1RF1C 3TNUA 3A0BH 1FDMA 2QIWA 1RE3C 1FZFA 1EZVG 2Q5UA 3G9RA 1CI6A 2IBZG 1HJ0A 1VQ9P 3V2PA 4BXLA 4EYYQ 3NTNA 1ZW0A 1S9KE 4WY4D 1M1JA 2POHA 2KXPB 1NYHA 5B5EH 4HB1A 2IBZI 1GL2A 2GUVA 1M1KQ 1W2EA 1SQPK 1NU1K 3V2NA 1KZUB 1KC8Q 3TF5A 1CZQA 2Y0CA 5APYA 2KLUA 2ZT9B 1DIPA 1OWAA 5E79H 2FBWC 3E7KA 3G71P 1PP9G 1OVUA 2AXCA 2MKVA 2Q3EA 1HGZA 3A0BE 3IAOA 3L75J 2KSJA 3L73E 1RHZB 2JJLA 3SFEC 1SQPJ 1NU1J 4H44B 5APWA 5GTHH 3CWBD 2P58A 1PGPA 2ZVOB 5DJTB 3QWOC 4JF7A 2E75C 2WSCJ 1HH0A 2WPQA 3MGNA 1HGVA 3II6A 2Z5IA 1FBMA 2P7JA 3WUUA 1VQKP 4HH2A 3RK3C 2QM7A 4EOTA 4W7ZA 3V6IA 2O1KA 3C1LA 5AVVB 4BRYB 1L0LG 2SPZA 4YTPC 1OFCX 1K05A 3Q5PA 3W68A 3KHUA 2AXTH 1OW6A 1BSNA 1LGHB 1NTME 3GF7A 3FXEA 1K73Q 1P84H 1N2DC 2P10A 1S3JA 3M0DA 2XDJA 1SQQG 1HTLC 1P84D 3BRTB 1URQB 3CC4P 2PFXA 1PIXA 5AVXB 1W2BO 1NJIQ 2GA1A 1NTZK 3L75D 3WU2H 1SVFA 5KTBA 5AW8B 4AUWA 3EFGA 2ITAA 3I55P 5CCHA 1SQPD 1NU1D 2K3RA 4IL6E 3LIDA 2FYNB 2WSCH 2YMYA 2R5DA 3L74J 1RH5B 1NTKK 1ZR2A 3C9IA 3AE2C 3KXDA 2YNYA 5CHXA 3PLNA 3ZDMA 2E75D 3G6EP 1AA0A 2ZFCA 3A0HE 1VQ8P 3VMXA 1N73A 3H1JE 4XA4A 2ZYAA 2HLOA 2XNDH 2K9YA 3RK3D 1KB9I 5L8RJ 1MFZA 1JY2O 1NTKJ 4JQ0D 2WWWA 2OTLP 2M3BA 1H0TB 4I6MC 1LT9C 3CXHI 2KS1A 4MN4C 2L91A 3V4WA 5BU5A 1LWUA 2OYOA 2FYUE 1N8RQ 3ABVC 1Y9BA 2N9BA 3OA7A 3PP5A 1YBKA 2N1TC 4UB8H 3BVHA 5APSA 4Y99B 2B87B 1Q86Q 1SFCB 3H1LJ 3B8EB 1FZCA 1BSHA 3AE9C 3LIEA 4C7RA 2E76B 3F89A 3SWKA 1HJBA 1JY3P 3L74D 2YIUC 2ZT9D 1NO4A 2C0XA 2BEZF 2W6AA 2NPSB 1PGOA 2HR3A 3CWBG 3S1KA 1RE4A 3H1IJ 4O9BA 1T2KC 3I56P 1ZP0C 2G3AA 5H2FH 1RY3A 1LNQA 1D7MA 2CPSA 1KD1Q 3H32B 1N7LA 3GF3A 3JSVC 1CSBA 2FFDB 3HE4A 2FXOA 2BCCJ 4Z1MH 2RH0A 2Y9ZA 3TGUJ 4AQRD 1IK7A 3P32A 1M57D 2AEJA 4IFFA 1GK6A 5KLIC 5KAFH 4WB4A 3HD7A 2ZVNB 1K8AQ 1A02J 1JCDA 4TT3H 5KLVE 2JKVA 1SQVE 1T3UA 1CW5A 2Q6QA 2D2CC 2JDIH 2FYZA 3H1JG 4C46A 2J5UA 2OYHA 3H1LD 1G2CB 1RF1A 3L71J 5H2FE 1RE3A 2OTJP 1L4AB 3T97B 4L75A 1N7SB 1P84I 3A2AA 1QLED 1SQPG 3WUTA 1NU1G 3A5TA 3H1KJ 1IZNB 1AJYA 5AW0B 4RESB 3H1ID 2FYUG 1AFOA 2QSIA 3H6PA 2OYIC 1T2KD 3AEBC 2J58A 4KHXA 4QMAA 1PGQA 4RJTA 2M5AA 2LXCB 3O6QA 2BCCD 1OW7A 3H1HJ 2QEXP 1AVOA 1JOCA 3TGUD 1SQBE 2IBZE 3KYQA 3H25A 3L36A 3B5NC 2KOGA 5EFWB 4GIFA 2O01J 3RK2C 3GHGB 1G1JA 1BCCE 3CX5H 4ZNCA 2D2CD 4W7YA 1VDFA 3L71D 1GW4A 2WT7A 3CX5D 4OH8B 3BCCJ 1JCCA 2YKPA 1BE3E 2HPCB 1E5WA 1PP9E 3S4RA 3H1KD 1S72P 3TGUE 2WZ7A 4L74A 1KILB 1WMKA
chains in the Genus database with same CATH topology
1NH4A 2YO3A 1HGZA 3P8CE 1T3JA 1FZAA 3HUSA 2KSJA 1FZCB 2OARA 1L4AC 1OXZA 3HTKA 1J1EB 1N7SC 1GL2D 1H88A 2HODB 2JJLA 1M7LA 1EQ7A 4GKGA 1IFNA 5APWA 2GUSA 1L0LK 3H32A 3BASA 5AVRB 4WY4B 3R2PA 2M8RA 1JUNA 1URQD 2IFMA 4WBAA 2FFDA 3EQ2A 1M1JC 3TYYA 4JF7A 2QM8A 2YKQA 4Y99C 1ZN5A 1HH0A 2WPQA 2WPRA 3MGNA 1HGVA 1SFCC 5AW2B 5CCHC 2O01H 3II6A 1GL2C 1SQBK 2BASA 3BATA 1GU4A 3KDPB 2Z5IA 4AYCA 1FBMA 2P7JA 4HH2A 3RK3C 1LTTC 2QM7A 4EOTA 4C7NB 5AW6B 4W7ZA 1GU5A 1WRGA 2O1KA 2NPSC 1PFIA 3RK2D 5AVVB 2Q7CA 3HE4B 3P8MC 3IR9A 1JY3O 4LGDE 2O1JA 1H8AA 5AW4B 1QL1A 2IX7C 2A45H 1G2CA 2Q9IA 3HUSC 4HYTB 2OYIB 1LGHB 4ZKUA 3TK1A 3HD7B 1N2DC 3L35A 4DZOA 1L4AA 1VPCA 3HRNA 3T97A 3VN0A 5CJ4A 3M0DA 1N7SA 2XDJA 1HUCA 1HTLC 3BRTB 1URQB 2E43A 1HWTC 2C9NY 1G1IA 2FFDC 3VP9A 5CJ0A 5AVXB 1NTZK 4N3YB 1NKZB 5AVTB 2OYHB 1SVFA 3U59A 1LTJB 3M9HA 5KTBA 5AW8B 1RF1B 4AUWA 1LWUC 3EFGA 3VP8A 1GTWA 2E42A 1J1DC 3B5NB 5CCHA 4EIJA 2HFED 3LIDA 1L4AD 3RL0C 1IJDB 1N7SD 1A02F 4LC1A 2WSCH 2YMYA 1GZLA 2R5DA 3RK2B 2N1TA 2XZRA 3CI9A 1NTKK 1J2JB 1ZR2A 2PP6A 3C9IA 3G3ZA 1MZ9A 2YNYA 5CHXA 3U1AA 1NWQA 1J1EC 1X9VA 3O8ZA 2KB7P 2KYVA 3VMZA 1IC2A 1JY3N 2ZFCA 4DOJA 1SFCD 4ZKPA 1NOHA 1DEBA 5CCHD 3M0DC 3TSIA 3VMXA 1N73A 1JO5A 4XA4A 1SQXK 2HLOA 1GK4A 3P7KA 3RK3D 3GHGA 2W6BA 4B86A 3LW5H 1JTHB 1LTSC 1YYCA 1MFZA 1JY2O 1FAVA 2WWWA 2N1TD 1T8ZA 2MJZA 2NPSD 1Z56A 2M3BA 5APUA 5AVQB 1IFMA 2WSFH 4I6MC 1LT9C 3TNUB 4N78D 3A3YB 3E1IA 2R3CA 4XE5B 3OJAB 1MV8A 3V4WA 5BU5A 1GDTA 2HPCA 1LWUA 5APQA 3VYIA 3MIWA 1CI6B 1SQQK 1FZGA 1IFDA 1FU1A 2W27A 1NTMK 2N9BA 3OA7A 3PP5A 2N1TC 1FZEA 1KILA 2KP8A 3BVHA 1M1JB 5APSA 3UIAA 5AVSB 1HVVA 1IFJA 1AQ5A 1WT6A 2FXMA 1S9KD 4Y99B 4W80A 1DX7A 3M06A 2WT7B 1MUUA 1JMMA 2XNXA 1SFCB 1XTCC 3B8EB 1LTBC 3V2QA 1FZCA 3NFQA 1GL2B 3LIEA 4C7RA 1FZBA 1N73C 2HODA 4IFDK 1HBWA 2R32A 1ZLLA 2R5BA 3RK3B 1HJBA 1JY3P 3L37A 3GHGC 3HE5B 1NO4A 2C0XA 3RL0D 2W6AA 2XU6A 1N86A 4JYCA 1NKNA 1KILD 2NPSB 2XKMA 2L5GB 2XV5A 1LTAC 1LTJC 1RE4A 2CPBA 4O9BA 1H89A 1T2KC 1JY2N 1LTIC 1YTZT 5CCGC 5KJ7A 2C9LY 5AW3B 2YKOA 3HUSB 1LT9A 3VOPA 2HG5D 3WMM0 2VRSA 5AVYB 3HTKB 3P8CD 1RY3A 2ZXEB 2Z4EA 3L4FA 4C7NA 2WPSA 2CPSA 1NAFA 3H32B 3M9BA 1N7LA 1KILC 1L0NK 1X79B 1NHLA 2FFDB 1CSBA 2FKWB 3HE4A 5AW5B 5AVZB 1RF0A 3V5BA 1XTGB 1GD2E 4AQRD 5APTA 2P1JA 2P67A 3P32A 1FZCC 5AVUB 4N6JA 2OYIA 4IFFA 1FOSF 1GK6A 2Z5HA 2I1JA 1QL2A 4WB4A 1JNMA 3HD7A 1J1DB 2PAJA 5BU8B 1A02J 4I2LC 1JCDA 2A45G 2KLVA 5CMZA 3RL0B 1URQA 4WY4C 3OAKA 1T3UA 3VMYA 1CW5A 2LKMA 2FYUK 2FYZA 1FOSE 1RE4C 4C46A 1SP4A 3M0AA 5AW1B 1KQLA 5KJ7C 2OYHA 1LTJA 3NMDA 1G2CB 1RF1A 3V2RA 2IPPA 1GW3A 1JY2P 2A45I 3B5NA 5CCGA 2H8PD 1RE3A 4M3LA 3BRVB 3HD7D 1L4AB 1N7SB 4I1LA 3VTPC 3A2AA 3SWYA 3A5TA 1DH3A 4GT1A 1LTGC 5AW0B 1KFNA 3N4XA 4RESB 1IK9A 5BVZA 1ZR4A 3N7NA 4JYBA 1RF0C 2WSEH 2C0WA 3NXSA 3M91A 1AFOA 3U1CA 3H6PA 3KQGA 2OYIC 1LT9B 1IO4A 3SWFA 4LLHA 3M9QA 3I5CA 1T2KD 3MD0A 3HD7C 2J59M 3B5ND 5CCGD 2J58A 2YO2A 4KHXA 1URQC 2H7HA 2WTYA 3CL3D 1JTHA 2Q3IA 2N1TB 4WY4A 1JOCA 2WITA 2I1KA 1IFIA 4N78E 5AVWB 2OYHC 1FJKA 3IFMA 1RF1C 3TNUA 3KYQA 1FDMA 3CLQA 3L36A 2P2UA 5AW9B 3B5NC 2KOGA 1KFMA 1RE3C 1FZFA 2Q5UA 1FJPA 1N73B 1CI6A 4GIFA 2IFNA 1ZV8A 5APXA 3RK2C 3V2PA 3GHGB 3MTUE 3NTNA 2GM4A 1S9KE 4WY4D 1G1JA 1M1JA 1YTZI 5KLVK 2POHA 1SQVK 4W7YA 2H43A 1VDFA 1X8YA 1GW4A 2WT7A 1SFCA 1GL2A 3A7OA 4OH8B 5KJ7D 1JCCA 2YKPA 2GUVA 4IFMA 2HPCB 1E5WA 1LWUB 1W2EA 1SQPK 1NU1K 3V2NA 3HE5A 3MUDA 1KZUB 1CZQA 5APYA 5AW7B 3KPEA 1OWAA 2WZ7A 2JEEA 2HYNA 1KILB 1SLQA 2NPSA 3V4QA 5APVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y99 B;  4Y99 C;  1YTZ T;  1J1D B;  1J1D C;  1J1E C;  1YTZ I;  1J1E B; 
#chains in the Genus database with same CATH topology
 5KLV G;  2R3S A;  1SQV G;  1FZA A;  2B88 A;  1L4A C;  1OXZ A;  3HTK A;  1J1E B;  1N7S C;  3D6Y A;  4WVZ A;  2PGD A;  1M7L A;  2E76 D;  1EQ7 A;  4U3F D;  1IFN A;  2B9B A;  2GUS A;  2H89 C;  3H1H D;  2FXP A;  2IFM A;  3PHL A;  3TYY A;  2QE7 H;  2YKQ A;  2KI7 B;  2JR8 A;  1Q82 Q;  1PPJ E;  5AW2 B;  2O01 H;  1BGY J;  3BAT A;  3H1K E;  3RBX A;  1GU4 A;  1EDI A;  1VL2 A;  1LTT C;  3KZI E;  3MUD C;  3RK2 D;  5KAI E;  4PV1 B;  2Y0D A;  2M0B A;  3P8M C;  1JY3 O;  2O1J A;  3CXH H;  1QL1 A;  2Q9I A;  3HUS C;  4HYT B;  1SQQ E;  4U3F E;  3BCC D;  1NAY A;  4ZKU A;  3CXH D;  2YXR B;  3L35 A;  1SQB G;  4ASW A;  5CJ4 A;  3HRN A;  3AE4 C;  2E43 A;  1HWT C;  2K9J A;  4U7J A;  2BEQ D;  3R4Y A;  4H13 B;  5B66 H;  3FXD A;  5TIS H;  3D6Z A;  3AE1 C;  3H1I G;  3FGA D;  1J1D C;  2NRG A;  2R44 A;  1BCC G;  3MHV A;  1L4A D;  3AE7 C;  1KB9 E;  1N7S D;  3AEF C;  1KTM A;  1A02 F;  4LC1 A;  4UB6 H;  4Y28 J;  2N1T A;  1TU3 F;  1BE3 G;  2PP6 A;  3G3Z A;  2BCC G;  3CXH E;  2QG4 A;  3L72 J;  2OQQ A;  1BGY D;  3TGU G;  1J1E C;  2KB7 P;  1T6A A;  3VMZ A;  1OVR A;  2H88 C;  1IC2 A;  2ZYG A;  1NOH A;  1KN7 A;  1DEB A;  1S5L H;  3TSI A;  1FDO A;  1SQX K;  3P7K A;  3CCR P;  1PZQ A;  3TDK A;  1YYC A;  3RL0 g;  1FC2 C;  5TIS E;  1KYO I;  1VF5 B;  2QJP C;  3TNU B;  5B5E E;  2R3C A;  3OJA B;  1EDK A;  5APQ A;  3VYI A;  1SQX J;  1CI6 B;  1IFD A;  1PPJ G;  5E79 E;  3IN6 A;  3H1K G;  3USS A;  1M1J B;  5AVS B;  5C39 A;  1HVV A;  1WT6 A;  4JBZ A;  3CMA P;  3CX5 I;  1DD3 A;  2KIK A;  1DX7 A;  3Q2Y A;  1JMM A;  2XNX A;  1LTB C;  3V2Q A;  1DD4 A;  3NFQ A;  1GL2 B;  1FZB A;  2HOD A;  3CWB E;  2IZ0 A;  2V7Q J;  5GTH E;  4U3F G;  2ZAE B;  2XU6 A;  1KIL D;  3L72 D;  2CPB A;  3H1H G;  2E5Y A;  1JY2 N;  1YTZ T;  5CCG C;  2WSE J;  3VOP A;  3P8C D;  3IF4 A;  2Z4E A;  1JEK A;  3L4F A;  4C7N A;  1EDL A;  2ZT9 C;  3AE8 C;  1NAF A;  4DJG A;  1EXI A;  4WWI A;  4L73 A;  1L0N K;  1X79 B;  1NHL A;  2E74 B;  1M90 Q;  5AVZ B;  2K1A A;  1GD2 E;  1NTZ J;  2K37 A;  4N6J A;  2OYI A;  3WUV A;  5KKZ B;  4NPE A;  2AXT E;  1FOS F;  2Z5H A;  1QL2 A;  1SQX D;  1P84 E;  4H44 C;  4I2L C;  2KSE A;  3RL0 B;  1EXJ A;  3OAK A;  3VMY A;  1L0N J;  2W90 A;  3L75 E;  1SP4 A;  3AE6 C;  1Q90 D;  1LTJ A;  3WU2 E;  3V2R A;  1SQP E;  1NU1 E;  2E5T A;  2V7Q H;  3B5N A;  1GMJ A;  3BRV B;  4OGQ B;  2QJY B;  3SWY A;  1YQ3 C;  1DH3 A;  4PD4 H;  4GT1 A;  1LTG C;  3G4S P;  1IK9 A;  5GTI H;  1ZR4 A;  4H13 D;  1RF0 C;  2WSE H;  4PD4 D;  3U1C A;  3L70 J;  2WMM A;  1IFP A;  1UIX A;  3KQG A;  1IO4 A;  3SWF A;  3M9Q A;  3MD0 A;  1VQM P;  5CCG D;  1E79 H;  3RK3 E;  2YO2 A;  1VQ6 P;  2YMK A;  1LP1 A;  2I8D A;  3JC2 2;  1URQ C;  3D71 A;  2W6J H;  3MP7 B;  1JTH A;  4WY4 A;  1VQN P;  1NTZ D;  3Q5R A;  1IFI A;  1OX3 A;  5AVW B;  3CLQ A;  1KV4 A;  2P2U A;  2ZXX A;  1N73 B;  2FYN C;  1ZV8 A;  1L0N D;  4CPG A;  3MTU E;  4H44 D;  1NTK D;  3AE3 C;  3CME P;  4UB8 E;  1YI2 P;  1QGK B;  1YTZ I;  2H43 A;  2W83 C;  1X8Y A;  2IYP A;  2KS1 B;  1LWU B;  3L74 E;  1OMI A;  2Y9Y A;  3HE5 A;  3MUD A;  1S5L X;  1NTZ E;  2JEE A;  1KQF B;  2HYN A;  3FWL A;  3V4Q A;  2QJK B;  5APV A;  3L70 D;  3L72 G;  3AE5 C;  1ZME C;  1KOR A;  3HUS A;  3K5B A;  1FZC B;  1GL2 D;  3L75 G;  4TLF A;  1NTK E;  4GKG A;  1VQ4 P;  2JWD A;  1L0L K;  2ZJS E;  5AVR B;  4WY4 B;  4H0L B;  2M8R A;  1URQ D;  4WBA A;  2QM8 A;  4Y99 C;  1EZV D;  2QRX A;  1SFC C;  1VQO P;  5CCH C;  1KQS O;  2YXQ B;  4AYC A;  2E76 C;  4XFJ A;  5KAF E;  2KNC A;  2A06 D;  1L0L J;  1GU5 A;  1WRG A;  1S2E A;  2NPS C;  2Q7C A;  3HE4 B;  3H1L E;  1KYO H;  3IR9 A;  4LGD E;  1H8A A;  5AW4 B;  2IX7 C;  3CCV P;  1KYO D;  1MKM A;  4DT0 A;  3TK1 A;  3HD7 B;  3Q3D A;  1Y47 A;  1AVY A;  3VN0 A;  1S4X A;  4K35 A;  3H1I E;  2FFD C;  3VP9 A;  1FE6 A;  1M56 D;  4N3Y B;  1NKZ B;  2IYO A;  5AVT B;  2OYH B;  1RF1 B;  1LWU C;  3VP8 A;  1GTW A;  5DJU B;  2HFE D;  1RQU A;  1DEE G;  3JCU H;  1R5L A;  2BCC E;  5K5G B;  1GZL A;  1EDJ A;  3CCJ P;  2XZR A;  3CI9 A;  1J2J B;  4PD4 I;  2LR2 A;  1MZ9 A;  3L74 G;  3CPW O;  3U1A A;  3AEC C;  1NTZ G;  1X9V A;  2V4H A;  3O8Z A;  3CCU P;  2KYV A;  1ZXG A;  1JY3 N;  2KNC B;  1SFC D;  4ZKP A;  5CCH D;  3ITK A;  1L0L D;  1GK4 A;  4EDF A;  1ZRT D;  3L73 J;  4B86 A;  1LTS C;  3C8V A;  2M5A B;  1FAV A;  3O6Q B;  1KQG B;  3L71 E;  1EC5 A;  1T8Z A;  2MJZ A;  1NTK G;  2NPS D;  3CX5 E;  4RO0 A;  1Z56 A;  5AVQ B;  1R8E A;  3CC7 P;  4N78 D;  2K88 A;  1LJ2 A;  1OVV A;  1Q7Y Q;  3PH0 A;  1GDT A;  1AV1 A;  2IDB A;  3JCU E;  1NGM B;  1NTM K;  1FZE A;  2KP8 A;  3UIA A;  1AQ5 A;  2RMZ A;  2E75 B;  2FXM A;  1S9K D;  1BDD A;  2ZYD A;  4W80 A;  3E1R A;  3M06 A;  2WT7 B;  1MUU A;  3S9O A;  3W67 A;  3EFF K;  4IFD K;  3H1L G;  2R32 A;  3RK3 B;  2R5B A;  3CCE P;  3GHG C;  1NTM J;  3H1H E;  1PV3 A;  1N86 A;  1NKN A;  2XKM A;  2L5G B;  1AQT A;  2O01 N;  1LTA C;  1LTI C;  4OWF A;  5AW3 B;  1LT9 A;  2VRS A;  3HTK B;  2UWJ E;  2AEM A;  4ZMD A;  5TJH A;  3L73 D;  1NVO A;  4GDO A;  1K9M Q;  2A06 G;  1KIL C;  2FY8 A;  3CCL P;  4KT0 J;  4H0L D;  2KZI A;  3D70 A;  4BRY A;  2FKW B;  1EZV I;  1RF0 A;  1X0T A;  3BCC E;  2WPV B;  2O3J A;  5AVU B;  2JP3 A;  2I1J A;  1JNM A;  4NPF X;  2KLV A;  5CMZ A;  4RKU J;  1URQ A;  3H1J J;  2FYU K;  1FOS E;  5B66 E;  1KQL A;  5KJ7 C;  2Y0E A;  3PRJ A;  2IPP A;  1GW3 A;  3CC2 P;  2H8P D;  4M3L A;  3AEA C;  1OZH A;  2DW3 A;  3L71 G;  3HD7 D;  1NTM D;  1YQ4 C;  4HKZ H;  3QH9 A;  1Q2N A;  1KFN A;  4UB6 E;  2K9J B;  2FYU J;  4PV1 C;  3N7N A;  1BGY E;  3NXS A;  1HF9 A;  1YJW P;  1LT9 B;  4LLH A;  3GW6 A;  1Y8A A;  1S5L E;  1QEX A;  4IL6 H;  1FDI A;  4L76 A;  2H7H A;  2M3E A;  2Q3I A;  2N1T B;  4H13 C;  1FS0 E;  2I1K A;  2NZ2 A;  1H0T A;  1FJK A;  1K04 A;  3IFM A;  2OGU A;  4JPZ B;  1SS1 A;  5AW9 B;  3A0H H;  1KFM A;  2QA4 P;  1BDC A;  1FJP A;  4BWN A;  1U7M A;  2OTK E;  1LT1 A;  2IFN A;  5APX A;  3H1J D;  2YIU B;  4HJG H;  2GM4 A;  5KLV K;  1SQV K;  2B87 A;  1SFC A;  2WVR A;  3A7O A;  5KJ7 D;  4IFM A;  3CCS P;  1OW8 A;  3BCC G;  5AW7 B;  3KPE A;  1KIL E;  2FYU D;  2RKL A;  3L72 E;  1SLQ A;  2NPS A;  5KLV J;  1SQV J;  1NH4 A;  2YO3 A;  1VF5 C;  4PV1 D;  4YPC A;  3P8C E;  4D6T J;  1T3J A;  2OAR A;  4EI2 A;  2WSS H;  1H88 A;  5KLI B;  2HOD B;  3FWN A;  3H32 A;  2KUB A;  3BAS A;  3R2P A;  3L73 G;  1JUN A;  3Q5S A;  2D2C B;  1M1J C;  3EQ2 A;  2FFD A;  4I7Z B;  1ZN5 A;  3GLM A;  2WPR A;  2Q1K A;  1SQX E;  1U57 A;  1VQP P;  1GL2 C;  1SQB K;  2BAS A;  3KDP B;  1YHQ P;  3PJS K;  1BGY G;  3CCQ P;  3CD6 P;  4C7N B;  5AW6 B;  1PFI A;  1VQ5 P;  2CK3 H;  3LW5 J;  4PJ0 H;  1R5S A;  2A45 H;  1G2C A;  1SQB J;  2OYI B;  1RQV A;  2WSF J;  4DZO A;  1L4A A;  1VPC A;  3T97 A;  1JB0 J;  1N7S A;  1HUC A;  1U7J A;  2C9N Y;  1NTM G;  4PD4 E;  2E74 C;  1G1I A;  3MZW B;  5KLV D;  5GTI E;  1SQV D;  5CJ0 A;  1W5C E;  4DCK A;  4D6T D;  4OVN F;  2PRR A;  1YJ9 P;  1QVF O;  3U59 A;  1LTJ B;  3M9H A;  5KKZ C;  1VF5 D;  1BCC J;  2IZ1 A;  2KK7 A;  2E42 A;  3B5N B;  4EIJ A;  3RL0 C;  1IJD B;  2QVA A;  1BE3 J;  3RK2 B;  1PP9 J;  4PJ0 E;  1NWQ A;  1L2P A;  4NPD A;  4DOJ A;  3GG2 A;  4OGQ C;  2QJY C;  3M0D C;  1L0N E;  1JO5 A;  4KJM A;  1LP1 B;  3AED C;  4ASV A;  1Q81 Q;  3GHG A;  1YJN P;  2W6B A;  2JO1 A;  3LW5 H;  1JTH B;  4I7Z C;  1QVG O;  2WQY C;  4D6T E;  4K3A A;  1PL5 A;  2N1T D;  5APU A;  1IFM A;  3AEG C;  2WSF H;  1SQB D;  3A3Y B;  3E1I A;  4R4M A;  1YIJ P;  4XE5 B;  2IBZ D;  1MV8 A;  4GOF A;  2HPC A;  3GMA A;  3MIW A;  1SQQ K;  1FZG A;  1FU1 A;  3OW2 O;  1S1C X;  2W27 A;  2KZJ A;  4IL6 X;  1SQX G;  3L70 E;  1KIL A;  2N9Y B;  3B71 A;  1IFJ A;  2E74 D;  3CCM P;  1BCC D;  1XTC C;  1KMI Z;  1JMB A;  1VQ7 P;  1N73 C;  1HBW A;  1ZLL A;  1SQQ J;  4U3F J;  3L37 A;  1BE3 D;  3HE5 B;  1PP9 D;  1ZOY C;  2AEF A;  1MFT A;  3RL0 D;  1EZV E;  4JYC A;  2XV5 A;  1UII A;  1LTJ C;  1H89 A;  5KJ7 A;  2C9L Y;  2A06 E;  2YKO A;  3HUS B;  3WMM 0;  2HG5 D;  5AVY B;  2ZXE B;  3RGU A;  3SFD C;  2WPS A;  4OGQ D;  4IOI H;  3M9B A;  1QX8 A;  2QJK C;  3VMA A;  5AW5 B;  1YIT P;  3F5H A;  3V5B A;  1JM0 A;  3AEE C;  1XTG B;  1KYO E;  5APT A;  2RN0 A;  4A7P A;  2P1J A;  2P67 A;  1FZC C;  1PPJ D;  1J1D B;  2PAJ A;  5BU8 B;  3EWK A;  3KZI H;  2A45 G;  4WY4 C;  4H0L C;  4YXD C;  2LKM A;  5KAI H;  1PGJ A;  1RE4 C;  1L0N G;  3M0A A;  5AW1 B;  2LXB A;  2B89 A;  2W8Z A;  4YXW H;  1M8O B;  3B4S A;  3NMD A;  4D6T G;  1JY2 P;  2A45 I;  5CCG A;  1SQQ D;  4I1L A;  5M1B A;  3VTP C;  3N4X A;  5BVZ A;  1VQL P;  5CBO A;  4JYB A;  2C0W A;  3M91 A;  2QJP B;  3I5C A;  2JWA A;  3L70 G;  1USD A;  3SSU A;  4GOD A;  3HD7 C;  2J59 M;  1L0L E;  3B5N D;  3PTZ A;  1X22 A;  1ZRT E;  1USE A;  3FX0 A;  1KB9 H;  3Q1M A;  3RBZ A;  1OIP A;  2WTY A;  3CL3 D;  5CBN A;  1KB9 D;  3CWB J;  4R4L A;  4GOE A;  2WIT A;  2G8Y A;  4N78 E;  2OYH C;  1RF1 C;  3TNU A;  3A0B H;  1FDM A;  2QIW A;  1RE3 C;  1FZF A;  1EZV G;  2Q5U A;  3G9R A;  1CI6 A;  2IBZ G;  1HJ0 A;  1VQ9 P;  3V2P A;  4BXL A;  4EYY Q;  3NTN A;  1ZW0 A;  1S9K E;  4WY4 D;  1M1J A;  2POH A;  2KXP B;  1NYH A;  5B5E H;  4HB1 A;  2IBZ I;  1GL2 A;  2GUV A;  1M1K Q;  1W2E A;  1SQP K;  1NU1 K;  3V2N A;  1KZU B;  1KC8 Q;  3TF5 A;  1CZQ A;  2Y0C A;  5APY A;  2KLU A;  2ZT9 B;  1DIP A;  1OWA A;  5E79 H;  2FBW C;  3E7K A;  3G71 P;  1PP9 G;  1OVU A;  2AXC A;  2MKV A;  2Q3E A;  1HGZ A;  3A0B E;  3IAO A;  3L75 J;  2KSJ A;  3L73 E;  1RHZ B;  2JJL A;  3SFE C;  1SQP J;  1NU1 J;  4H44 B;  5APW A;  5GTH H;  3CWB D;  2P58 A;  1PGP A;  2ZVO B;  5DJT B;  3QWO C;  4JF7 A;  2E75 C;  2WSC J;  1HH0 A;  2WPQ A;  3MGN A;  1HGV A;  3II6 A;  2Z5I A;  1FBM A;  2P7J A;  3WUU A;  1VQK P;  4HH2 A;  3RK3 C;  2QM7 A;  4EOT A;  4W7Z A;  3V6I A;  2O1K A;  3C1L A;  5AVV B;  4BRY B;  1L0L G;  2SPZ A;  4YTP C;  1OFC X;  1K05 A;  3Q5P A;  3W68 A;  3KHU A;  2AXT H;  1OW6 A;  1BSN A;  1LGH B;  1NTM E;  3GF7 A;  3FXE A;  1K73 Q;  1P84 H;  1N2D C;  2P10 A;  1S3J A;  3M0D A;  2XDJ A;  1SQQ G;  1HTL C;  1P84 D;  3BRT B;  1URQ B;  3CC4 P;  2PFX A;  1PIX A;  5AVX B;  1W2B O;  1NJI Q;  2GA1 A;  1NTZ K;  3L75 D;  3WU2 H;  1SVF A;  5KTB A;  5AW8 B;  4AUW A;  3EFG A;  2ITA A;  3I55 P;  5CCH A;  1SQP D;  1NU1 D;  2K3R A;  4IL6 E;  3LID A;  2FYN B;  2WSC H;  2YMY A;  2R5D A;  3L74 J;  1RH5 B;  1NTK K;  1ZR2 A;  3C9I A;  3AE2 C;  3KXD A;  2YNY A;  5CHX A;  3PLN A;  3ZDM A;  2E75 D;  3G6E P;  1AA0 A;  2ZFC A;  3A0H E;  1VQ8 P;  3VMX A;  1N73 A;  3H1J E;  4XA4 A;  2ZYA A;  2HLO A;  2XND H;  2K9Y A;  3RK3 D;  1KB9 I;  5L8R J;  1MFZ A;  1JY2 O;  1NTK J;  4JQ0 D;  2WWW A;  2OTL P;  2M3B A;  1H0T B;  4I6M C;  1LT9 C;  3CXH I;  2KS1 A;  4MN4 C;  2L91 A;  3V4W A;  5BU5 A;  1LWU A;  2OYO A;  2FYU E;  1N8R Q;  3ABV C;  1Y9B A;  2N9B A;  3OA7 A;  3PP5 A;  1YBK A;  2N1T C;  4UB8 H;  3BVH A;  5APS A;  4Y99 B;  2B87 B;  1Q86 Q;  1SFC B;  3H1L J;  3B8E B;  1FZC A;  1BSH A;  3AE9 C;  3LIE A;  4C7R A;  2E76 B;  3F89 A;  3SWK A;  1HJB A;  1JY3 P;  3L74 D;  2YIU C;  2ZT9 D;  1NO4 A;  2C0X A;  2BEZ F;  2W6A A;  2NPS B;  1PGO A;  2HR3 A;  3CWB G;  3S1K A;  1RE4 A;  3H1I J;  4O9B A;  1T2K C;  3I56 P;  1ZP0 C;  2G3A A;  5H2F H;  1RY3 A;  1LNQ A;  1D7M A;  2CPS A;  1KD1 Q;  3H32 B;  1N7L A;  3GF3 A;  3JSV C;  1CSB A;  2FFD B;  3HE4 A;  2FXO A;  2BCC J;  4Z1M H;  2RH0 A;  2Y9Z A;  3TGU J;  4AQR D;  1IK7 A;  3P32 A;  1M57 D;  2AEJ A;  4IFF A;  1GK6 A;  5KLI C;  5KAF H;  4WB4 A;  3HD7 A;  2ZVN B;  1K8A Q;  1A02 J;  1JCD A;  4TT3 H;  5KLV E;  2JKV A;  1SQV E;  1T3U A;  1CW5 A;  2Q6Q A;  2D2C C;  2JDI H;  2FYZ A;  3H1J G;  4C46 A;  2J5U A;  2OYH A;  3H1L D;  1G2C B;  1RF1 A;  3L71 J;  5H2F E;  1RE3 A;  2OTJ P;  1L4A B;  3T97 B;  4L75 A;  1N7S B;  1P84 I;  3A2A A;  1QLE D;  1SQP G;  3WUT A;  1NU1 G;  3A5T A;  3H1K J;  1IZN B;  1AJY A;  5AW0 B;  4RES B;  3H1I D;  2FYU G;  1AFO A;  2QSI A;  3H6P A;  2OYI C;  1T2K D;  3AEB C;  2J58 A;  4KHX A;  4QMA A;  1PGQ A;  4RJT A;  2M5A A;  2LXC B;  3O6Q A;  2BCC D;  1OW7 A;  3H1H J;  2QEX P;  1AVO A;  1JOC A;  3TGU D;  1SQB E;  2IBZ E;  3KYQ A;  3H25 A;  3L36 A;  3B5N C;  2KOG A;  5EFW B;  4GIF A;  2O01 J;  3RK2 C;  3GHG B;  1G1J A;  1BCC E;  3CX5 H;  4ZNC A;  2D2C D;  4W7Y A;  1VDF A;  3L71 D;  1GW4 A;  2WT7 A;  3CX5 D;  4OH8 B;  3BCC J;  1JCC A;  2YKP A;  1BE3 E;  2HPC B;  1E5W A;  1PP9 E;  3S4R A;  3H1K D;  1S72 P;  3TGU E;  2WZ7 A;  4L74 A;  1KIL B;  1WMK A; 
#chains in the Genus database with same CATH homology
 1NH4 A;  2YO3 A;  1HGZ A;  3P8C E;  1T3J A;  1FZA A;  3HUS A;  2KSJ A;  1FZC B;  2OAR A;  1L4A C;  1OXZ A;  3HTK A;  1J1E B;  1N7S C;  1GL2 D;  1H88 A;  2HOD B;  2JJL A;  1M7L A;  1EQ7 A;  4GKG A;  1IFN A;  5APW A;  2GUS A;  1L0L K;  3H32 A;  3BAS A;  5AVR B;  4WY4 B;  3R2P A;  2M8R A;  1JUN A;  1URQ D;  2IFM A;  4WBA A;  2FFD A;  3EQ2 A;  1M1J C;  3TYY A;  4JF7 A;  2QM8 A;  2YKQ A;  4Y99 C;  1ZN5 A;  1HH0 A;  2WPQ A;  2WPR A;  3MGN A;  1HGV A;  1SFC C;  5AW2 B;  5CCH C;  2O01 H;  3II6 A;  1GL2 C;  1SQB K;  2BAS A;  3BAT A;  1GU4 A;  3KDP B;  2Z5I A;  4AYC A;  1FBM A;  2P7J A;  4HH2 A;  3RK3 C;  1LTT C;  2QM7 A;  4EOT A;  4C7N B;  5AW6 B;  4W7Z A;  1GU5 A;  1WRG A;  2O1K A;  2NPS C;  1PFI A;  3RK2 D;  5AVV B;  2Q7C A;  3HE4 B;  3P8M C;  3IR9 A;  1JY3 O;  4LGD E;  2O1J A;  1H8A A;  5AW4 B;  1QL1 A;  2IX7 C;  2A45 H;  1G2C A;  2Q9I A;  3HUS C;  4HYT B;  2OYI B;  1LGH B;  4ZKU A;  3TK1 A;  3HD7 B;  1N2D C;  3L35 A;  4DZO A;  1L4A A;  1VPC A;  3HRN A;  3T97 A;  3VN0 A;  5CJ4 A;  3M0D A;  1N7S A;  2XDJ A;  1HUC A;  1HTL C;  3BRT B;  1URQ B;  2E43 A;  1HWT C;  2C9N Y;  1G1I A;  2FFD C;  3VP9 A;  5CJ0 A;  5AVX B;  1NTZ K;  4N3Y B;  1NKZ B;  5AVT B;  2OYH B;  1SVF A;  3U59 A;  1LTJ B;  3M9H A;  5KTB A;  5AW8 B;  1RF1 B;  4AUW A;  1LWU C;  3EFG A;  3VP8 A;  1GTW A;  2E42 A;  1J1D C;  3B5N B;  5CCH A;  4EIJ A;  2HFE D;  3LID A;  1L4A D;  3RL0 C;  1IJD B;  1N7S D;  1A02 F;  4LC1 A;  2WSC H;  2YMY A;  1GZL A;  2R5D A;  3RK2 B;  2N1T A;  2XZR A;  3CI9 A;  1NTK K;  1J2J B;  1ZR2 A;  2PP6 A;  3C9I A;  3G3Z A;  1MZ9 A;  2YNY A;  5CHX A;  3U1A A;  1NWQ A;  1J1E C;  1X9V A;  3O8Z A;  2KB7 P;  2KYV A;  3VMZ A;  1IC2 A;  1JY3 N;  2ZFC A;  4DOJ A;  1SFC D;  4ZKP A;  1NOH A;  1DEB A;  5CCH D;  3M0D C;  3TSI A;  3VMX A;  1N73 A;  1JO5 A;  4XA4 A;  1SQX K;  2HLO A;  1GK4 A;  3P7K A;  3RK3 D;  3GHG A;  2W6B A;  4B86 A;  3LW5 H;  1JTH B;  1LTS C;  1YYC A;  1MFZ A;  1JY2 O;  1FAV A;  2WWW A;  2N1T D;  1T8Z A;  2MJZ A;  2NPS D;  1Z56 A;  2M3B A;  5APU A;  5AVQ B;  1IFM A;  2WSF H;  4I6M C;  1LT9 C;  3TNU B;  4N78 D;  3A3Y B;  3E1I A;  2R3C A;  4XE5 B;  3OJA B;  1MV8 A;  3V4W A;  5BU5 A;  1GDT A;  2HPC A;  1LWU A;  5APQ A;  3VYI A;  3MIW A;  1CI6 B;  1SQQ K;  1FZG A;  1IFD A;  1FU1 A;  2W27 A;  1NTM K;  2N9B A;  3OA7 A;  3PP5 A;  2N1T C;  1FZE A;  1KIL A;  2KP8 A;  3BVH A;  1M1J B;  5APS A;  3UIA A;  5AVS B;  1HVV A;  1IFJ A;  1AQ5 A;  1WT6 A;  2FXM A;  1S9K D;  4Y99 B;  4W80 A;  1DX7 A;  3M06 A;  2WT7 B;  1MUU A;  1JMM A;  2XNX A;  1SFC B;  1XTC C;  3B8E B;  1LTB C;  3V2Q A;  1FZC A;  3NFQ A;  1GL2 B;  3LIE A;  4C7R A;  1FZB A;  1N73 C;  2HOD A;  4IFD K;  1HBW A;  2R32 A;  1ZLL A;  2R5B A;  3RK3 B;  1HJB A;  1JY3 P;  3L37 A;  3GHG C;  3HE5 B;  1NO4 A;  2C0X A;  3RL0 D;  2W6A A;  2XU6 A;  1N86 A;  4JYC A;  1NKN A;  1KIL D;  2NPS B;  2XKM A;  2L5G B;  2XV5 A;  1LTA C;  1LTJ C;  1RE4 A;  2CPB A;  4O9B A;  1H89 A;  1T2K C;  1JY2 N;  1LTI C;  1YTZ T;  5CCG C;  5KJ7 A;  2C9L Y;  5AW3 B;  2YKO A;  3HUS B;  1LT9 A;  3VOP A;  2HG5 D;  3WMM 0;  2VRS A;  5AVY B;  3HTK B;  3P8C D;  1RY3 A;  2ZXE B;  2Z4E A;  3L4F A;  4C7N A;  2WPS A;  2CPS A;  1NAF A;  3H32 B;  3M9B A;  1N7L A;  1KIL C;  1L0N K;  1X79 B;  1NHL A;  2FFD B;  1CSB A;  2FKW B;  3HE4 A;  5AW5 B;  5AVZ B;  1RF0 A;  3V5B A;  1XTG B;  1GD2 E;  4AQR D;  5APT A;  2P1J A;  2P67 A;  3P32 A;  1FZC C;  5AVU B;  4N6J A;  2OYI A;  4IFF A;  1FOS F;  1GK6 A;  2Z5H A;  2I1J A;  1QL2 A;  4WB4 A;  1JNM A;  3HD7 A;  1J1D B;  2PAJ A;  5BU8 B;  1A02 J;  4I2L C;  1JCD A;  2A45 G;  2KLV A;  5CMZ A;  3RL0 B;  1URQ A;  4WY4 C;  3OAK A;  1T3U A;  3VMY A;  1CW5 A;  2LKM A;  2FYU K;  2FYZ A;  1FOS E;  1RE4 C;  4C46 A;  1SP4 A;  3M0A A;  5AW1 B;  1KQL A;  5KJ7 C;  2OYH A;  1LTJ A;  3NMD A;  1G2C B;  1RF1 A;  3V2R A;  2IPP A;  1GW3 A;  1JY2 P;  2A45 I;  3B5N A;  5CCG A;  2H8P D;  1RE3 A;  4M3L A;  3BRV B;  3HD7 D;  1L4A B;  1N7S B;  4I1L A;  3VTP C;  3A2A A;  3SWY A;  3A5T A;  1DH3 A;  4GT1 A;  1LTG C;  5AW0 B;  1KFN A;  3N4X A;  4RES B;  1IK9 A;  5BVZ A;  1ZR4 A;  3N7N A;  4JYB A;  1RF0 C;  2WSE H;  2C0W A;  3NXS A;  3M91 A;  1AFO A;  3U1C A;  3H6P A;  3KQG A;  2OYI C;  1LT9 B;  1IO4 A;  3SWF A;  4LLH A;  3M9Q A;  3I5C A;  1T2K D;  3MD0 A;  3HD7 C;  2J59 M;  3B5N D;  5CCG D;  2J58 A;  2YO2 A;  4KHX A;  1URQ C;  2H7H A;  2WTY A;  3CL3 D;  1JTH A;  2Q3I A;  2N1T B;  4WY4 A;  1JOC A;  2WIT A;  2I1K A;  1IFI A;  4N78 E;  5AVW B;  2OYH C;  1FJK A;  3IFM A;  1RF1 C;  3TNU A;  3KYQ A;  1FDM A;  3CLQ A;  3L36 A;  2P2U A;  5AW9 B;  3B5N C;  2KOG A;  1KFM A;  1RE3 C;  1FZF A;  2Q5U A;  1FJP A;  1N73 B;  1CI6 A;  4GIF A;  2IFN A;  1ZV8 A;  5APX A;  3RK2 C;  3V2P A;  3GHG B;  3MTU E;  3NTN A;  2GM4 A;  1S9K E;  4WY4 D;  1G1J A;  1M1J A;  1YTZ I;  5KLV K;  2POH A;  1SQV K;  4W7Y A;  2H43 A;  1VDF A;  1X8Y A;  1GW4 A;  2WT7 A;  1SFC A;  1GL2 A;  3A7O A;  4OH8 B;  5KJ7 D;  1JCC A;  2YKP A;  2GUV A;  4IFM A;  2HPC B;  1E5W A;  1LWU B;  1W2E A;  1SQP K;  1NU1 K;  3V2N A;  3HE5 A;  3MUD A;  1KZU B;  1CZQ A;  5APY A;  5AW7 B;  3KPE A;  1OWA A;  2WZ7 A;  2JEE A;  2HYN A;  1KIL B;  1SLQ A;  2NPS A;  3V4Q A;  5APV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...