1S1CX

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein RhoA
total genus 26
structure length 69
sequence length 69
chains with identical sequence Y
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08912 Rho_Binding Rho Binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s1cX00
3FGAD 1UIXA 1TU3F 1PL5A 1NYHA 1S1CX
chains in the Genus database with same CATH superfamily
1FDIA 5AW2B 3A2AA 2HODA 1K05A 1SQVJ 2FXPA 1NAYA 3L71E 3Q3DA 1BGYJ 1GZLA 3N4XA 5B5EE 5KJ7A 3P8MC 2E74C 2E76D 2OARA 1N7LA 1RH5B 4IFDK 2AXCA 2E75D 3B5ND 2A06D 2E75C 4PD4D 3V2PA 2P58A 5AW8B 3MD0A 1ZMEC 2XZRA 3L37A 1FOSE 1KB9I 1SQBK 1E79H 3N7NA 3CCRP 5AVZB 2C9LY 1LTTC 2WT7A 1VQKP 2OYIB 4IFMA 1RE3C 2QJKB 4I7ZC 3WMM0 1VQ6P 2OYOA 2W83C 2Q1KA 3CPWO 3RK3E 3CCLP 2ZT9B 2QJYC 2WVRA 1VL2A 3CCUP 2I1JA 3B4SA 3H1IG 1PZQA 1ZN5A 2Y0DA 3GF7A 4U3FG 1GU4A 1LTIC 3Q5SA 1L0LE 1NVOA 1SS1A 3L71D 3M0DA 4RJTA 3Q1MA 2RH0A 2ZYGA 2PFXA 2YXRB 1FE6A 1FS0E 2K9JB 3MP7B 5APYA 5CCHD 3L75G 1KQFB 1CI6A 2POHA 2W6BA 3BASA 4H13C 1NTMK 1SFCC 3NXSA 4H0LC 2E5YA 3D6ZA 1JM0A 3G6EP 1VQPP 3V2NA 3HTKA 4UB6E 2P2UA 2O1KA 1NHLA 1FZEA 3L70E 4L74A 2A45H 1N7SB 1AA0A 3E1IA 1BDDA 3HE5B 3W68A 1KYOD 1G1JA 1KD1Q 3JSVC 1S9KD 3QWOC 1LT9A 3VOPA 3BCCD 3K5BA 1R5SA 2B87B 1FAVA 2E76B 3MZWB 1IK7A 1T3JA 2Y9YA 3P8CD 5AVTB 2YMKA 1LWUB 4YTPC 1HUCA 4OGQB 4BXLA 2JWDA 1BCCE 3AE6C 2ZFCA 3IN6A 5CHXA 1PGQA 3U1AA 1SLQA 1RF1A 1JUNA 2IBZD 3M9HA 2GA1A 2JWAA 3VMYA 4LGDE 1FC2C 2NPSD 5GTHH 4JPZB 1NU1G 3WU2E 4HKZH 1ZR4A 1U7JA 3CCSP 3WUTA 1EQ7A 1NTZE 3USSA 1KFNA 4WY4D 4JYCA 5AVUB 3CC7P 1JCDA 3V5BA 1SFCD 1SQBJ 2I8DA 1NTZG 2RMZA 5B66H 4H44B 1EZVI 3NTNA 2Z4EA 1OXZA 5CJ0A 1NU1E 3SWYA 1M7LA 1N2DC 3P7KA 3CWBJ 1OW7A 3E7KA 1SQQJ 4IFFA 1T8ZA 1YQ4C 2V4HA 1M90Q 1VQ9P 3AEGC 2WSFH 1M57D 1LTBC 3C8VA 4D6TJ 1Q7YQ 3PP5A 4DOJA 2XV5A 1OW6A 4ASWA 4JF7A 1VF5D 3RK3C 3CD6P 1EDJA 1BGYG 1GU5A 1VF5B 2JO1A 2QJPC 1QX8A 3FGAD 3AEAC 1NKNA 2P7JA 4OVNF 1S72P 3MTUE 1NGMB 2CK3H 2HPCB 3VMZA 1NU1J 2IDBA 3U1CA 1PPJG 5KLVD 4RKUJ 3CL3D 1SQQE 3S4RA 3L72J 1IZNB 3H1LD 3M0DC 2A45G 1IFJA 2KZJA 3S1KA 5CCHA 4D6TG 1ZR2A 1YHQP 1L0NJ 3AE3C 1RY3A 1JY3O 2W6AA 3Q5PA 1JNMA 1J1DC 3L75E 1GMJA 1LP1B 3RK2D 3CWBG 2J58A 2FFDC 1YITP 1KORA 1Q82Q 1HJBA 2WPQA 3TYYA 3H6PA 1KTMA 1SQPD 3MGNA 1M1JC 4PD4E 1G2CA 4U3FE 1FZCC 3HUSA 4N3YB 4EI2A 3ZDMA 1RF1B 1UIXA 3CX5E 1SQBG 2IX7C 2R3CA 1SQXJ 3V6IA 2YIUC 2WSSH 3B71A 1BSNA 5KAIH 1AQ5A 4U7JA 5KJ7C 1SQQD 1RE4A 3CWBD 1YIJP 3A0BH 4M3LA 5CCGC 1S3JA 4C7NB 2WITA 3IR9A 2Z5IA 1K04A 1USEA 1JB0J 1T2KC 2G8YA 4PV1B 3RK2C 3L73G 1KYOI 4N78E 1SQVE 1Q90D 4DZOA 2M5AB 3ITKA 1QGKB 2KZIA 2DW3A 1KFMA 3OAKA 1HWTC 5TISH 3CC4P 2QRXA 4KJMA 3BRTB 1L0LJ 1GDTA 4Y99C 2KXPB 1GTWA 1U57A 1KQSO 1ZRTD 3HE4A 2R5DA 1H0TA 1BE3J 2N1TC 1SQBE 5AW0B 1S4XA 1IFPA 1GL2C 4N6JA 1AQTA 1TU3F 2WSCH 1MZ9A 2Q9IA 3D70A 1S5LE 2Q5UA 4H44D 2HPCA 2N9BA 1MKMA 1NTZD 1PP9G 1GK4A 1P84I 2B89A 1JTHB 1WT6A 2JP3A 2WQYC 3PJSK 4PV1C 5DJTB 3M0AA 2FY8A 3RBXA 2VRSA 3TGUE 5CJ4A 2QG4A 1L0NK 3F5HA 1OVRA 1EZVG 1RQUA 3HD7D 4GDOA 2OYHA 4D6TE 4AQRD 3A5TA 3KZIH 2IBZI 2OYHC 4W7ZA 3KZIE 2YIUB 1NTKE 4GIFA 3H1KE 3TNUB 3AEBC 1AJYA 2QVAA 2IBZG 1SQXK 1YYCA 3L71J 1RF1C 2GUVA 4B86A 2QE7H 1BGYE 3BRVB 1FZCB 2MJZA 1X79B 2CPBA 2H43A 3CC2P 5L8RJ 4JQ0D 1JMMA 1P84D 3L72E 2GUSA 2O1JA 3GG2A 3B5NC 3JC22 2FFDB 5E79H 1L0NE 2V7QJ 2M3EA 3SWKA 3AEFC 3B5NB 4WWIA 4HJGH 2PRRA 1EXJA 1KQLA 1DX7A 4I2LC 4HYTB 2FBWC 3H1JD 1FZCA 1LP1A 4TLFA 3H1KJ 2Q6QA 4DT0A 1IJDB 1LTGC 1QEXA 3GMAA 5AVWB 1N73A 4UB8E 1DD3A 4PD4H 5B5EH 1M1JA 1DEEG 1NJIQ 2FFDA 1X0TA 1Y9BA 3GF3A 1DD4A 2NZ2A 3FWNA 3LW5H 3CX5D 2OYHB 1VF5C 2FKWB 1IFMA 4U3FD 3RK3B 3H1HD 1VQ5P 1YJNP 4NPFX 5CBNA 4OWFA 4BRYA 4KHXA 5AW3B 3I55P 1SQVD 1NYHA 1RE4C 3H32B 3TDKA 1H8AA 2BEQD 1VDFA 1ZV8A 4ZMDA 1DH3A 5CCHC 3CMEP 2W27A 1ZP0C 3PHLA 1RHZB 3AEEC 5APXA 2IZ0A 1SQQK 2HODB 1LTJA 4KT0J 5AVVB 1JOCA 2WPVB 1YQ3C 2WSEH 4ZKUA 4EDFA 4H44C 1IO4A 1LJ2A 1YBKA 5AW5B 2WPRA 1GL2B 3L75J 2JEEA 1A02J 2N1TB 1K73Q 1BE3E 4GOFA 3I5CA 2FYZA 4Y99B 2AXTH 1URQA 1H0TB 3I56P 3MUDC 2AEJA 1PIXA 1SQPG 3A0HE 1RF0A 2HR3A 3IF4A 4IL6H 1EZVE 3WUUA 3TF5A 3V2RA 1PGPA 3BATA 5KTBA 2R3SA 3EFFK 4WBAA 1S5LH 1ZOYC 2PAJA 3TGUG 1BCCJ 2IZ1A 1HH0A 4R4LA 1JEKA 1LGHB 1MUUA 3RK2B 4CPGA 1GW3A 2WT7B 5AVYB 3L75D 4C46A 3CI9A 1L0LG 2KP8A 4OGQC 1R8EA 1DIPA 2BASA 3G9RA 2Y9ZA 1NAFA 3JCUE 3H1LE 2FYUK 4I6MC 5CCGA 2QEXP 2OGUA 2Q3EA 3CXHH 2WTYA 5EFWB 2YMYA 1Z56A 3RL0g 1PP9J 1PFIA 2OTKE 2KS1B 2B88A 2Z5HA 1FZBA 3HRNA 5AW9B 3NMDA 4H0LD 3H1HJ 4WY4A 1M1JB 2RN0A 2WSFJ 4H0LB 4U3FJ 4H13B 3VTPC 5CCGD 1SQVG 2N1TA 3FXDA 4NPEA 1AFOA 3L73E 1Q81Q 3CX5H 1K8AQ 3UIAA 1HGVA 1ZW0A 4HH2A 3O8ZA 1QVFO 1J1DB 5KAIE 2XNXA 2L91A 3C1LA 1HGZA 2FYUG 2O01J 3H1KD 3AE4C 1NTKD 3GHGA 1LNQA 3H1JJ 4GT1A 2ZT9C 3BCCE 3KHUA 3B5NA 4RO0A 2ZJSE 1AV1A 1LWUA 2C0XA 2Q3IA 5AVXB 3RGUA 4I7ZB 3II6A 1HVVA 3H25A 2HLOA 1N7SD 2W8ZA 2M3BA 3EQ2A 4PJ0E 2QJPB 3TGUD 3G71P 3PTZA 3D71A 1M56D 3C9IA 1JY2N 2P10A 3CX5I 3S9OA 3FX0A 1NOHA 4OH8B 2P1JA 3AE8C 3D6YA 2WZ7A 1YTZT 2E75B 2ZT9D 1N7SA 1Y8AA 2SPZA 2Y0EA 3HE5A 1D7MA 1L2PA 2O01N 2E74B 2O3JA 3ABVC 4H13D 3SSUA 1OIPA 2YNYA 1SQXE 1W2BO 1VQLP 1ZRTE 2CPSA 2H7HA 1URQD 1CZQA 3AE1C 4LLHA 3CLQA 3IAOA 3RK3D 1S9KE 1J1EC 3L74J 1PPJE 3M9BA 1RQVA 3VMAA 1EC5A 2R32A 1IFNA 2K88A 3L70D 1R5LA 1NTZJ 2H88C 2FXMA 1IFIA 1NTMD 2WWWA 1KQGB 3GLMA 3AECC 5AVQB 5AW7B 2OQQA 3RBZA 1PGOA 3A0HH 4IL6E 2NPSA 1AVYA 1URQC 2KUBA 5KLVK 3Q5RA 2OYIA 1NTKK 1T6AA 1X9VA 5BU8B 1EZVD 1BE3D 4Z1MH 1K9MQ 2KS1A 1FOSF 1X22A 1KB9D 5APWA 5CBOA 3GHGC 3U59A 4WY4B 1L0LD 5CMZA 2B87A 4YXDC 2W90A 2B9BA 1LWUC 2PGDA 3R4YA 5H2FH 4WB4A 4ZKPA 2XNDH 2E76C 2E74D 5AVRB 3VN0A 4JBZA 1OVVA 3WU2H 5AW4B 1KB9E 2ZAEB 1MV8A 1W2EA 2BCCE 4AUWA 1E5WA 2YKOA 2BCCG 2WMMA 2WSCJ 2YKQA 3FXEA 1N7SC 1OFCX 2H89C 2K37A 3VP8A 2QSIA 1KN7A 3V2QA 4A7PA 1QVGO 5KLIC 1PPJD 5KLVG 1FDOA 1IFDA 1RE3A 3E1RA 3OA7A 1VQOP 1FZFA 1SFCB 5TJHA 3LW5J 2Q7CA 2KYVA 3L73J 5BVZA 2JDIH 1YTZI 2W6JH 5AVSB 3VMXA 1HJ0A 1SQXD 1FJKA 3KYQA 3QH9A 4L76A 1KB9H 1H89A 2E42A 1MFTA 1WMKA 2J5UA 4LC1A 1FU1A 2NPSB 1U7MA 2A06G 4YPCA 1SQPJ 1S2EA 1UIIA 3VYIA 1AVOA 3H1JE 4HB1A 1DEBA 2K9JA 3HUSC 2QJYB 1GW4A 3W67A 3H1HG 1NTKG 1SP4A 2QJKC 2XKMA 3H1IJ 1BSHA 4XA4A 3P32A 1NU1K 3L4FA 3CCEP 1JMBA 4R4MA 2IFMA 4Y28J 5KKZB 2IPPA 2AEMA 1FJPA 2M8RA 1L0ND 1L4AA 1SQXG 2HG5D 2K9YA 4PJ0H 2ITAA 2V7QH 1HF9A 3H1LJ 1P84E 2KNCA 3L72D 3H1ID 2FXOA 2K3RA 4NPDA 3MIWA 5KLVJ 1NU1D 3EWKA 4PV1D 1X8YA 4OGQD 3TK1A 3CCVP 2HYNA 1NWQA 1PP9E 5K5GB 1L4AD 3AE2C 1L4AB 1SQVK 3H1IE 1M8OB 2QM7A 5APTA 1KMIZ 2K1AA 3LIEA 2LXBA 2YXQB 5APQA 1M1KQ 4BWNA 4D6TD 2KB7P 3M9QA 4YXWH 1NH4A 1OWAA 1LT1A 1Y47A 1OW8A 2ZXEB 3L73D 2OYIC 2QIWA 2R44A 3MUDA 2M0BA 3BCCG 1MFZA 4MN4C 1QL2A 1EDLA 1BDCA 3CXHI 2FYUE 1YJ9P 5BU5A 3OW2O 3M06A 3G3ZA 3EFGA 5APUA 3A0BE 3OJAB 4L73A 1LTJB 2G3AA 1SQBD 3RL0B 1T2KD 1HBWA 1JY2O 4UB8H 3CXHE 1N73C 1Q86Q 3TNUA 1VQMP 1PGJA 2H8PD 2JJLA 3PRJA 1SFCA 4W7YA 1LTSC 1NKZB 1FDMA 2KSEA 2ZXXA 2J59M 3HD7B 3L71G 2BEZF 1JY2P 1JY3N 1S1CX 1QL1A 1SQPK 1FZAA 2KIKA 4N78D 1L0LK 4TT3H 4BRYB 1H88A 3RL0D 1KILC 1GD2E 2C9NY 2OTJP 4ASVA 4EIJA 3H1LG 3HD7C 5E79E 2FYNC 2R5BA 1GL2D 1G2CB 1LT9C 3AE9C 1S5LX 5B66E 2OTLP 2ZYDA 1NTMJ 3HD7A 3BCCJ 1SVFA 4DCKA 3L70J 1N73B 4EYYQ 3L74E 2QM8A 5TISE 2C0WA 3KQGA 3CWBE 3L74D 5GTIH 1GL2A 1USDA 1WRGA 2YO2A 1PV3A 5GTIE 1JO5A 3JCUH 4K35A 2L5GB 3NFQA 1SQPE 4AYCA 1Q2NA 2D2CB 3BVHA 2LKMA 3R2PA 1W5CE 1HTLC 3LIDA 2KLUA 1SQQG 1VPCA 1BE3G 1OMIA 3M91A 3H1HE 1NTME 1OVUA 5DJUB 1RF0C 3H1JG 3TSIA 1L4AC 3FWLA 2QA4P 2Y0CA 2A06E 4I1LA 2XDJA 1IC2A 3TGUJ 1EXIA 1QLED 2KLVA 3AE7C 2HFED 1ZLLA 1N86A 2N9YB 3L36A 5C39A 5M1BA 2IYPA 2PP6A 3Q2YA 1NTZK 2JR8A 2MKVA 3V4QA 3WUVA 2O01H 2ZVNB 4ZNCA 2KNCB 5KJ7D 3O6QA 3SFDC 5KLVE 1NTKJ 1KC8Q 5KKZC 4GOEA 1NO4A 3SFEC 1JTHA 3VP9A 1VQNP 3B8EB 4RESB 2WPSA 2KSJA 2UWJE 4IOIH 5KAFE 1FZGA 1EDIA 1PL5A 2JKVA 2RKLA 3HUSB 4GODA 3CMAP 1OX3A 1IK9A 2NRGA 2YO3A 1JCCA 1A02F 1KV4A 2D2CC 2NPSC 4O9BA 1CW5A 1ZXGA 1BGYD 2KOGA 1CI6B 4IL6X 1VQ8P 3HE4B 3L35A 3KDPB 1PP9D 3T97B 4QMAA 2KI7B 5AW6B 1J2JB 2BCCJ 2I1KA 2IYOA 1L0NG 2LXCB 1BCCG 3AE5C 3CXHD 3KPEA 2AEFA 4L75A 4XFJA 1OZHA 4DJGA 4K3AA 1LTAC 3CCMP 3L72G 4UB6H 1T3UA 4C7NA 3CCQP 1KILE 2WSEJ 2FYUD 1G1IA 2IFNA 2D2CD 3PH0A 5KLIB 1VQ7P 4WVZA 1P84H 1LT9B 3F89A 4PD4I 3MHVA 5H2FE 2FYNB 2IBZE 3H32A 3PLNA 2M5AA 1N8RQ 1CSBA 1NTMG 2E5TA 3H1KG 1KILB 5AW1B 1XTCC 1BCCD 1KILD 1FBMA 3A7OA 3L70G 3GW6A 3G4SP 3A3YB 2AXTE 1XTGB 2P67A 5KAFH 2YKPA 4WY4C 3GHGB 4GKGA 4C7RA 1GK6A 1KZUB 1KILA 3HTKB 3P8CE 2LR2A 3IFMA 5GTHE 2KK7A 3L74G 1EDKA 1JY3P 1KYOH 1LTJC 1URQB 5APVA 3RL0C 3V4WA 4EOTA 1YI2P 3AEDC 4XE5B 2ZYAA 1KYOE 1YJWP 2FYUJ 3T97A 2ZVOB 2A45I 5APSA 2GM4A 2E43A 4W80A 1VQ4P 3KXDA 2XU6A 4JYBA 2N1TD 3SWFA 3CCJP 2BCCD 1J1EB 3O6QB
chains in the Genus database with same CATH topology
1FDIA 2QIWA 1K05A 2FXPA 3RL0g 3Q3DA 4U7JA 4H0LD 2WSFJ 4H0LB 4H13B 2E74C 2E76D 2G3AA 1K04A 2E75D 1JB0J 2E75C 2G8YA 4PV1B 1ZMEC 1Q90D 2O01J 3AE4C 2ZT9C 2BEZF 1S1CX 4I7ZB 1U57A 4TT3H 4I7ZC 3H25A 3RK3E 2ZT9B 2FYNC 1TU3F 2QJYC 1VL2A 3AE9C 3D70A 3GF7A 1S5LX 3D71A 4H44D 3S9OA 2P10A 3Q5SA 1MKMA 3D6YA 2JP3A 3AE8C 2WQYC 4PV1C 3Q1MA 2ZT9D 2E75B 2E74B 3ABVC 4H13D 1KQFB 1PV3A 4H13C 4H0LC 1RQUA 4GDOA 3D6ZA 1ZRTE 2D2CB 3AE1C 3IAOA 1OMIA 1RQVA 3AEBC 1AJYA 2H88C 2E76B 3GLMA 1KQGB 1IK7A 3AECC 2OQQA 2YMKA 1EXIA 5L8RJ 4YTPC 3Q5RA 4OGQB 3AE7C 3AE6C 5M1BA 2V7QJ 4Z1MH 3IN6A 2MKVA 3Q2YA 3AEFC 4YXDC 1EXJA 2FBWC 3O6QA 3SFDC 3R4YA 5KKZC 3SFEC 3GMAA 2E76C 2E74D 1DD3A 3GF3A 1Y9BA 1DD4A 2NZ2A 2WSCJ 1PL5A 2H89C 2QSIA 1VF5C 4H44B 2D2CC 5KLIC 1FDOA 1OW7A 4IL6X 1YQ4C 1NYHA 3AEGC 3LW5J 3T97B 2BEQD 3C8VA 1HJ0A 3AE5C 1ZP0C 4XFJA 3AEEC 4KT0J 1WMKA 1KILE 1OW6A 2J5UA 2WSEJ 2WPVB 2D2CD 1YQ3C 1VF5D 1VF5B 2JO1A 2QJPC 4H44C 3FGAD 3AEAC 1NGMB 2IDBA 2QJKC 4RKUJ 4R4MA 4Y28J 1PIXA 3AE3C 3Q5PA 2K9YA 1HF9A 1ZOYC 1GMJA 4R4LA 1KORA 3EWKA 4PV1D 4OGQD 4OGQC 1R8EA 1DIPA 3AEDC 1KTMA 3G9RA 3AE2C 1KMIZ 1UIXA 2YIUC 3B71A 1OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA D;  1UIX A;  1TU3 F;  1PL5 A;  1NYH A;  1S1C X; 
#chains in the Genus database with same CATH topology
 1FDI A;  5AW2 B;  3A2A A;  2HOD A;  1K05 A;  1SQV J;  2FXP A;  1NAY A;  3L71 E;  3Q3D A;  1BGY J;  1GZL A;  3N4X A;  5B5E E;  5KJ7 A;  3P8M C;  2E74 C;  2E76 D;  2OAR A;  1N7L A;  1RH5 B;  4IFD K;  2AXC A;  2E75 D;  3B5N D;  2A06 D;  2E75 C;  4PD4 D;  3V2P A;  2P58 A;  5AW8 B;  3MD0 A;  1ZME C;  2XZR A;  3L37 A;  1FOS E;  1KB9 I;  1SQB K;  1E79 H;  3N7N A;  3CCR P;  5AVZ B;  2C9L Y;  1LTT C;  2WT7 A;  1VQK P;  2OYI B;  4IFM A;  1RE3 C;  2QJK B;  4I7Z C;  3WMM 0;  1VQ6 P;  2OYO A;  2W83 C;  2Q1K A;  3CPW O;  3RK3 E;  3CCL P;  2ZT9 B;  2QJY C;  2WVR A;  1VL2 A;  3CCU P;  2I1J A;  3B4S A;  3H1I G;  1PZQ A;  1ZN5 A;  2Y0D A;  3GF7 A;  4U3F G;  1GU4 A;  1LTI C;  3Q5S A;  1L0L E;  1NVO A;  1SS1 A;  3L71 D;  3M0D A;  4RJT A;  3Q1M A;  2RH0 A;  2ZYG A;  2PFX A;  2YXR B;  1FE6 A;  1FS0 E;  2K9J B;  3MP7 B;  5APY A;  5CCH D;  3L75 G;  1KQF B;  1CI6 A;  2POH A;  2W6B A;  3BAS A;  4H13 C;  1NTM K;  1SFC C;  3NXS A;  4H0L C;  2E5Y A;  3D6Z A;  1JM0 A;  3G6E P;  1VQP P;  3V2N A;  3HTK A;  4UB6 E;  2P2U A;  2O1K A;  1NHL A;  1FZE A;  3L70 E;  4L74 A;  2A45 H;  1N7S B;  1AA0 A;  3E1I A;  1BDD A;  3HE5 B;  3W68 A;  1KYO D;  1G1J A;  1KD1 Q;  3JSV C;  1S9K D;  3QWO C;  1LT9 A;  3VOP A;  3BCC D;  3K5B A;  1R5S A;  2B87 B;  1FAV A;  2E76 B;  3MZW B;  1IK7 A;  1T3J A;  2Y9Y A;  3P8C D;  5AVT B;  2YMK A;  1LWU B;  4YTP C;  1HUC A;  4OGQ B;  4BXL A;  2JWD A;  1BCC E;  3AE6 C;  2ZFC A;  3IN6 A;  5CHX A;  1PGQ A;  3U1A A;  1SLQ A;  1RF1 A;  1JUN A;  2IBZ D;  3M9H A;  2GA1 A;  2JWA A;  3VMY A;  4LGD E;  1FC2 C;  2NPS D;  5GTH H;  4JPZ B;  1NU1 G;  3WU2 E;  4HKZ H;  1ZR4 A;  1U7J A;  3CCS P;  3WUT A;  1EQ7 A;  1NTZ E;  3USS A;  1KFN A;  4WY4 D;  4JYC A;  5AVU B;  3CC7 P;  1JCD A;  3V5B A;  1SFC D;  1SQB J;  2I8D A;  1NTZ G;  2RMZ A;  5B66 H;  4H44 B;  1EZV I;  3NTN A;  2Z4E A;  1OXZ A;  5CJ0 A;  1NU1 E;  3SWY A;  1M7L A;  1N2D C;  3P7K A;  3CWB J;  1OW7 A;  3E7K A;  1SQQ J;  4IFF A;  1T8Z A;  1YQ4 C;  2V4H A;  1M90 Q;  1VQ9 P;  3AEG C;  2WSF H;  1M57 D;  1LTB C;  3C8V A;  4D6T J;  1Q7Y Q;  3PP5 A;  4DOJ A;  2XV5 A;  1OW6 A;  4ASW A;  4JF7 A;  1VF5 D;  3RK3 C;  3CD6 P;  1EDJ A;  1BGY G;  1GU5 A;  1VF5 B;  2JO1 A;  2QJP C;  1QX8 A;  3FGA D;  3AEA C;  1NKN A;  2P7J A;  4OVN F;  1S72 P;  3MTU E;  1NGM B;  2CK3 H;  2HPC B;  3VMZ A;  1NU1 J;  2IDB A;  3U1C A;  1PPJ G;  5KLV D;  4RKU J;  3CL3 D;  1SQQ E;  3S4R A;  3L72 J;  1IZN B;  3H1L D;  3M0D C;  2A45 G;  1IFJ A;  2KZJ A;  3S1K A;  5CCH A;  4D6T G;  1ZR2 A;  1YHQ P;  1L0N J;  3AE3 C;  1RY3 A;  1JY3 O;  2W6A A;  3Q5P A;  1JNM A;  1J1D C;  3L75 E;  1GMJ A;  1LP1 B;  3RK2 D;  3CWB G;  2J58 A;  2FFD C;  1YIT P;  1KOR A;  1Q82 Q;  1HJB A;  2WPQ A;  3TYY A;  3H6P A;  1KTM A;  1SQP D;  3MGN A;  1M1J C;  4PD4 E;  1G2C A;  4U3F E;  1FZC C;  3HUS A;  4N3Y B;  4EI2 A;  3ZDM A;  1RF1 B;  1UIX A;  3CX5 E;  1SQB G;  2IX7 C;  2R3C A;  1SQX J;  3V6I A;  2YIU C;  2WSS H;  3B71 A;  1BSN A;  5KAI H;  1AQ5 A;  4U7J A;  5KJ7 C;  1SQQ D;  1RE4 A;  3CWB D;  1YIJ P;  3A0B H;  4M3L A;  5CCG C;  1S3J A;  4C7N B;  2WIT A;  3IR9 A;  2Z5I A;  1K04 A;  1USE A;  1JB0 J;  1T2K C;  2G8Y A;  4PV1 B;  3RK2 C;  3L73 G;  1KYO I;  4N78 E;  1SQV E;  1Q90 D;  4DZO A;  2M5A B;  3ITK A;  1QGK B;  2KZI A;  2DW3 A;  1KFM A;  3OAK A;  1HWT C;  5TIS H;  3CC4 P;  2QRX A;  4KJM A;  3BRT B;  1L0L J;  1GDT A;  4Y99 C;  2KXP B;  1GTW A;  1U57 A;  1KQS O;  1ZRT D;  3HE4 A;  2R5D A;  1H0T A;  1BE3 J;  2N1T C;  1SQB E;  5AW0 B;  1S4X A;  1IFP A;  1GL2 C;  4N6J A;  1AQT A;  1TU3 F;  2WSC H;  1MZ9 A;  2Q9I A;  3D70 A;  1S5L E;  2Q5U A;  4H44 D;  2HPC A;  2N9B A;  1MKM A;  1NTZ D;  1PP9 G;  1GK4 A;  1P84 I;  2B89 A;  1JTH B;  1WT6 A;  2JP3 A;  2WQY C;  3PJS K;  4PV1 C;  5DJT B;  3M0A A;  2FY8 A;  3RBX A;  2VRS A;  3TGU E;  5CJ4 A;  2QG4 A;  1L0N K;  3F5H A;  1OVR A;  1EZV G;  1RQU A;  3HD7 D;  4GDO A;  2OYH A;  4D6T E;  4AQR D;  3A5T A;  3KZI H;  2IBZ I;  2OYH C;  4W7Z A;  3KZI E;  2YIU B;  1NTK E;  4GIF A;  3H1K E;  3TNU B;  3AEB C;  1AJY A;  2QVA A;  2IBZ G;  1SQX K;  1YYC A;  3L71 J;  1RF1 C;  2GUV A;  4B86 A;  2QE7 H;  1BGY E;  3BRV B;  1FZC B;  2MJZ A;  1X79 B;  2CPB A;  2H43 A;  3CC2 P;  5L8R J;  4JQ0 D;  1JMM A;  1P84 D;  3L72 E;  2GUS A;  2O1J A;  3GG2 A;  3B5N C;  3JC2 2;  2FFD B;  5E79 H;  1L0N E;  2V7Q J;  2M3E A;  3SWK A;  3AEF C;  3B5N B;  4WWI A;  4HJG H;  2PRR A;  1EXJ A;  1KQL A;  1DX7 A;  4I2L C;  4HYT B;  2FBW C;  3H1J D;  1FZC A;  1LP1 A;  4TLF A;  3H1K J;  2Q6Q A;  4DT0 A;  1IJD B;  1LTG C;  1QEX A;  3GMA A;  5AVW B;  1N73 A;  4UB8 E;  1DD3 A;  4PD4 H;  5B5E H;  1M1J A;  1DEE G;  1NJI Q;  2FFD A;  1X0T A;  1Y9B A;  3GF3 A;  1DD4 A;  2NZ2 A;  3FWN A;  3LW5 H;  3CX5 D;  2OYH B;  1VF5 C;  2FKW B;  1IFM A;  4U3F D;  3RK3 B;  3H1H D;  1VQ5 P;  1YJN P;  4NPF X;  5CBN A;  4OWF A;  4BRY A;  4KHX A;  5AW3 B;  3I55 P;  1SQV D;  1NYH A;  1RE4 C;  3H32 B;  3TDK A;  1H8A A;  2BEQ D;  1VDF A;  1ZV8 A;  4ZMD A;  1DH3 A;  5CCH C;  3CME P;  2W27 A;  1ZP0 C;  3PHL A;  1RHZ B;  3AEE C;  5APX A;  2IZ0 A;  1SQQ K;  2HOD B;  1LTJ A;  4KT0 J;  5AVV B;  1JOC A;  2WPV B;  1YQ3 C;  2WSE H;  4ZKU A;  4EDF A;  4H44 C;  1IO4 A;  1LJ2 A;  1YBK A;  5AW5 B;  2WPR A;  1GL2 B;  3L75 J;  2JEE A;  1A02 J;  2N1T B;  1K73 Q;  1BE3 E;  4GOF A;  3I5C A;  2FYZ A;  4Y99 B;  2AXT H;  1URQ A;  1H0T B;  3I56 P;  3MUD C;  2AEJ A;  1PIX A;  1SQP G;  3A0H E;  1RF0 A;  2HR3 A;  3IF4 A;  4IL6 H;  1EZV E;  3WUU A;  3TF5 A;  3V2R A;  1PGP A;  3BAT A;  5KTB A;  2R3S A;  3EFF K;  4WBA A;  1S5L H;  1ZOY C;  2PAJ A;  3TGU G;  1BCC J;  2IZ1 A;  1HH0 A;  4R4L A;  1JEK A;  1LGH B;  1MUU A;  3RK2 B;  4CPG A;  1GW3 A;  2WT7 B;  5AVY B;  3L75 D;  4C46 A;  3CI9 A;  1L0L G;  2KP8 A;  4OGQ C;  1R8E A;  1DIP A;  2BAS A;  3G9R A;  2Y9Z A;  1NAF A;  3JCU E;  3H1L E;  2FYU K;  4I6M C;  5CCG A;  2QEX P;  2OGU A;  2Q3E A;  3CXH H;  2WTY A;  5EFW B;  2YMY A;  1Z56 A;  3RL0 g;  1PP9 J;  1PFI A;  2OTK E;  2KS1 B;  2B88 A;  2Z5H A;  1FZB A;  3HRN A;  5AW9 B;  3NMD A;  4H0L D;  3H1H J;  4WY4 A;  1M1J B;  2RN0 A;  2WSF J;  4H0L B;  4U3F J;  4H13 B;  3VTP C;  5CCG D;  1SQV G;  2N1T A;  3FXD A;  4NPE A;  1AFO A;  3L73 E;  1Q81 Q;  3CX5 H;  1K8A Q;  3UIA A;  1HGV A;  1ZW0 A;  4HH2 A;  3O8Z A;  1QVF O;  1J1D B;  5KAI E;  2XNX A;  2L91 A;  3C1L A;  1HGZ A;  2FYU G;  2O01 J;  3H1K D;  3AE4 C;  1NTK D;  3GHG A;  1LNQ A;  3H1J J;  4GT1 A;  2ZT9 C;  3BCC E;  3KHU A;  3B5N A;  4RO0 A;  2ZJS E;  1AV1 A;  1LWU A;  2C0X A;  2Q3I A;  5AVX B;  3RGU A;  4I7Z B;  3II6 A;  1HVV A;  3H25 A;  2HLO A;  1N7S D;  2W8Z A;  2M3B A;  3EQ2 A;  4PJ0 E;  2QJP B;  3TGU D;  3G71 P;  3PTZ A;  3D71 A;  1M56 D;  3C9I A;  1JY2 N;  2P10 A;  3CX5 I;  3S9O A;  3FX0 A;  1NOH A;  4OH8 B;  2P1J A;  3AE8 C;  3D6Y A;  2WZ7 A;  1YTZ T;  2E75 B;  2ZT9 D;  1N7S A;  1Y8A A;  2SPZ A;  2Y0E A;  3HE5 A;  1D7M A;  1L2P A;  2O01 N;  2E74 B;  2O3J A;  3ABV C;  4H13 D;  3SSU A;  1OIP A;  2YNY A;  1SQX E;  1W2B O;  1VQL P;  1ZRT E;  2CPS A;  2H7H A;  1URQ D;  1CZQ A;  3AE1 C;  4LLH A;  3CLQ A;  3IAO A;  3RK3 D;  1S9K E;  1J1E C;  3L74 J;  1PPJ E;  3M9B A;  1RQV A;  3VMA A;  1EC5 A;  2R32 A;  1IFN A;  2K88 A;  3L70 D;  1R5L A;  1NTZ J;  2H88 C;  2FXM A;  1IFI A;  1NTM D;  2WWW A;  1KQG B;  3GLM A;  3AEC C;  5AVQ B;  5AW7 B;  2OQQ A;  3RBZ A;  1PGO A;  3A0H H;  4IL6 E;  2NPS A;  1AVY A;  1URQ C;  2KUB A;  5KLV K;  3Q5R A;  2OYI A;  1NTK K;  1T6A A;  1X9V A;  5BU8 B;  1EZV D;  1BE3 D;  4Z1M H;  1K9M Q;  2KS1 A;  1FOS F;  1X22 A;  1KB9 D;  5APW A;  5CBO A;  3GHG C;  3U59 A;  4WY4 B;  1L0L D;  5CMZ A;  2B87 A;  4YXD C;  2W90 A;  2B9B A;  1LWU C;  2PGD A;  3R4Y A;  5H2F H;  4WB4 A;  4ZKP A;  2XND H;  2E76 C;  2E74 D;  5AVR B;  3VN0 A;  4JBZ A;  1OVV A;  3WU2 H;  5AW4 B;  1KB9 E;  2ZAE B;  1MV8 A;  1W2E A;  2BCC E;  4AUW A;  1E5W A;  2YKO A;  2BCC G;  2WMM A;  2WSC J;  2YKQ A;  3FXE A;  1N7S C;  1OFC X;  2H89 C;  2K37 A;  3VP8 A;  2QSI A;  1KN7 A;  3V2Q A;  4A7P A;  1QVG O;  5KLI C;  1PPJ D;  5KLV G;  1FDO A;  1IFD A;  1RE3 A;  3E1R A;  3OA7 A;  1VQO P;  1FZF A;  1SFC B;  5TJH A;  3LW5 J;  2Q7C A;  2KYV A;  3L73 J;  5BVZ A;  2JDI H;  1YTZ I;  2W6J H;  5AVS B;  3VMX A;  1HJ0 A;  1SQX D;  1FJK A;  3KYQ A;  3QH9 A;  4L76 A;  1KB9 H;  1H89 A;  2E42 A;  1MFT A;  1WMK A;  2J5U A;  4LC1 A;  1FU1 A;  2NPS B;  1U7M A;  2A06 G;  4YPC A;  1SQP J;  1S2E A;  1UII A;  3VYI A;  1AVO A;  3H1J E;  4HB1 A;  1DEB A;  2K9J A;  3HUS C;  2QJY B;  1GW4 A;  3W67 A;  3H1H G;  1NTK G;  1SP4 A;  2QJK C;  2XKM A;  3H1I J;  1BSH A;  4XA4 A;  3P32 A;  1NU1 K;  3L4F A;  3CCE P;  1JMB A;  4R4M A;  2IFM A;  4Y28 J;  5KKZ B;  2IPP A;  2AEM A;  1FJP A;  2M8R A;  1L0N D;  1L4A A;  1SQX G;  2HG5 D;  2K9Y A;  4PJ0 H;  2ITA A;  2V7Q H;  1HF9 A;  3H1L J;  1P84 E;  2KNC A;  3L72 D;  3H1I D;  2FXO A;  2K3R A;  4NPD A;  3MIW A;  5KLV J;  1NU1 D;  3EWK A;  4PV1 D;  1X8Y A;  4OGQ D;  3TK1 A;  3CCV P;  2HYN A;  1NWQ A;  1PP9 E;  5K5G B;  1L4A D;  3AE2 C;  1L4A B;  1SQV K;  3H1I E;  1M8O B;  2QM7 A;  5APT A;  1KMI Z;  2K1A A;  3LIE A;  2LXB A;  2YXQ B;  5APQ A;  1M1K Q;  4BWN A;  4D6T D;  2KB7 P;  3M9Q A;  4YXW H;  1NH4 A;  1OWA A;  1LT1 A;  1Y47 A;  1OW8 A;  2ZXE B;  3L73 D;  2OYI C;  2QIW A;  2R44 A;  3MUD A;  2M0B A;  3BCC G;  1MFZ A;  4MN4 C;  1QL2 A;  1EDL A;  1BDC A;  3CXH I;  2FYU E;  1YJ9 P;  5BU5 A;  3OW2 O;  3M06 A;  3G3Z A;  3EFG A;  5APU A;  3A0B E;  3OJA B;  4L73 A;  1LTJ B;  2G3A A;  1SQB D;  3RL0 B;  1T2K D;  1HBW A;  1JY2 O;  4UB8 H;  3CXH E;  1N73 C;  1Q86 Q;  3TNU A;  1VQM P;  1PGJ A;  2H8P D;  2JJL A;  3PRJ A;  1SFC A;  4W7Y A;  1LTS C;  1NKZ B;  1FDM A;  2KSE A;  2ZXX A;  2J59 M;  3HD7 B;  3L71 G;  2BEZ F;  1JY2 P;  1JY3 N;  1S1C X;  1QL1 A;  1SQP K;  1FZA A;  2KIK A;  4N78 D;  1L0L K;  4TT3 H;  4BRY B;  1H88 A;  3RL0 D;  1KIL C;  1GD2 E;  2C9N Y;  2OTJ P;  4ASV A;  4EIJ A;  3H1L G;  3HD7 C;  5E79 E;  2FYN C;  2R5B A;  1GL2 D;  1G2C B;  1LT9 C;  3AE9 C;  1S5L X;  5B66 E;  2OTL P;  2ZYD A;  1NTM J;  3HD7 A;  3BCC J;  1SVF A;  4DCK A;  3L70 J;  1N73 B;  4EYY Q;  3L74 E;  2QM8 A;  5TIS E;  2C0W A;  3KQG A;  3CWB E;  3L74 D;  5GTI H;  1GL2 A;  1USD A;  1WRG A;  2YO2 A;  1PV3 A;  5GTI E;  1JO5 A;  3JCU H;  4K35 A;  2L5G B;  3NFQ A;  1SQP E;  4AYC A;  1Q2N A;  2D2C B;  3BVH A;  2LKM A;  3R2P A;  1W5C E;  1HTL C;  3LID A;  2KLU A;  1SQQ G;  1VPC A;  1BE3 G;  1OMI A;  3M91 A;  3H1H E;  1NTM E;  1OVU A;  5DJU B;  1RF0 C;  3H1J G;  3TSI A;  1L4A C;  3FWL A;  2QA4 P;  2Y0C A;  2A06 E;  4I1L A;  2XDJ A;  1IC2 A;  3TGU J;  1EXI A;  1QLE D;  2KLV A;  3AE7 C;  2HFE D;  1ZLL A;  1N86 A;  2N9Y B;  3L36 A;  5C39 A;  5M1B A;  2IYP A;  2PP6 A;  3Q2Y A;  1NTZ K;  2JR8 A;  2MKV A;  3V4Q A;  3WUV A;  2O01 H;  2ZVN B;  4ZNC A;  2KNC B;  5KJ7 D;  3O6Q A;  3SFD C;  5KLV E;  1NTK J;  1KC8 Q;  5KKZ C;  4GOE A;  1NO4 A;  3SFE C;  1JTH A;  3VP9 A;  1VQN P;  3B8E B;  4RES B;  2WPS A;  2KSJ A;  2UWJ E;  4IOI H;  5KAF E;  1FZG A;  1EDI A;  1PL5 A;  2JKV A;  2RKL A;  3HUS B;  4GOD A;  3CMA P;  1OX3 A;  1IK9 A;  2NRG A;  2YO3 A;  1JCC A;  1A02 F;  1KV4 A;  2D2C C;  2NPS C;  4O9B A;  1CW5 A;  1ZXG A;  1BGY D;  2KOG A;  1CI6 B;  4IL6 X;  1VQ8 P;  3HE4 B;  3L35 A;  3KDP B;  1PP9 D;  3T97 B;  4QMA A;  2KI7 B;  5AW6 B;  1J2J B;  2BCC J;  2I1K A;  2IYO A;  1L0N G;  2LXC B;  1BCC G;  3AE5 C;  3CXH D;  3KPE A;  2AEF A;  4L75 A;  4XFJ A;  1OZH A;  4DJG A;  4K3A A;  1LTA C;  3CCM P;  3L72 G;  4UB6 H;  1T3U A;  4C7N A;  3CCQ P;  1KIL E;  2WSE J;  2FYU D;  1G1I A;  2IFN A;  2D2C D;  3PH0 A;  5KLI B;  1VQ7 P;  4WVZ A;  1P84 H;  1LT9 B;  3F89 A;  4PD4 I;  3MHV A;  5H2F E;  2FYN B;  2IBZ E;  3H32 A;  3PLN A;  2M5A A;  1N8R Q;  1CSB A;  1NTM G;  2E5T A;  3H1K G;  1KIL B;  5AW1 B;  1XTC C;  1BCC D;  1KIL D;  1FBM A;  3A7O A;  3L70 G;  3GW6 A;  3G4S P;  3A3Y B;  2AXT E;  1XTG B;  2P67 A;  5KAF H;  2YKP A;  4WY4 C;  3GHG B;  4GKG A;  4C7R A;  1GK6 A;  1KZU B;  1KIL A;  3HTK B;  3P8C E;  2LR2 A;  3IFM A;  5GTH E;  2KK7 A;  3L74 G;  1EDK A;  1JY3 P;  1KYO H;  1LTJ C;  1URQ B;  5APV A;  3RL0 C;  3V4W A;  4EOT A;  1YI2 P;  3AED C;  4XE5 B;  2ZYA A;  1KYO E;  1YJW P;  2FYU J;  3T97 A;  2ZVO B;  2A45 I;  5APS A;  2GM4 A;  2E43 A;  4W80 A;  1VQ4 P;  3KXD A;  2XU6 A;  4JYB A;  2N1T D;  3SWF A;  3CCJ P;  2BCC D;  1J1E B;  3O6Q B; 
#chains in the Genus database with same CATH homology
 1FDI A;  2QIW A;  1K05 A;  2FXP A;  3RL0 g;  3Q3D A;  4U7J A;  4H0L D;  2WSF J;  4H0L B;  4H13 B;  2E74 C;  2E76 D;  2G3A A;  1K04 A;  2E75 D;  1JB0 J;  2E75 C;  2G8Y A;  4PV1 B;  1ZME C;  1Q90 D;  2O01 J;  3AE4 C;  2ZT9 C;  2BEZ F;  1S1C X;  4I7Z B;  1U57 A;  4TT3 H;  4I7Z C;  3H25 A;  3RK3 E;  2ZT9 B;  2FYN C;  1TU3 F;  2QJY C;  1VL2 A;  3AE9 C;  3D70 A;  3GF7 A;  1S5L X;  3D71 A;  4H44 D;  3S9O A;  2P10 A;  3Q5S A;  1MKM A;  3D6Y A;  2JP3 A;  3AE8 C;  2WQY C;  4PV1 C;  3Q1M A;  2ZT9 D;  2E75 B;  2E74 B;  3ABV C;  4H13 D;  1KQF B;  1PV3 A;  4H13 C;  4H0L C;  1RQU A;  4GDO A;  3D6Z A;  1ZRT E;  2D2C B;  3AE1 C;  3IAO A;  1OMI A;  1RQV A;  3AEB C;  1AJY A;  2H88 C;  2E76 B;  3GLM A;  1KQG B;  1IK7 A;  3AEC C;  2OQQ A;  2YMK A;  1EXI A;  5L8R J;  4YTP C;  3Q5R A;  4OGQ B;  3AE7 C;  3AE6 C;  5M1B A;  2V7Q J;  4Z1M H;  3IN6 A;  2MKV A;  3Q2Y A;  3AEF C;  4YXD C;  1EXJ A;  2FBW C;  3O6Q A;  3SFD C;  3R4Y A;  5KKZ C;  3SFE C;  3GMA A;  2E76 C;  2E74 D;  1DD3 A;  3GF3 A;  1Y9B A;  1DD4 A;  2NZ2 A;  2WSC J;  1PL5 A;  2H89 C;  2QSI A;  1VF5 C;  4H44 B;  2D2C C;  5KLI C;  1FDO A;  1OW7 A;  4IL6 X;  1YQ4 C;  1NYH A;  3AEG C;  3LW5 J;  3T97 B;  2BEQ D;  3C8V A;  1HJ0 A;  3AE5 C;  1ZP0 C;  4XFJ A;  3AEE C;  4KT0 J;  1WMK A;  1KIL E;  1OW6 A;  2J5U A;  2WSE J;  2WPV B;  2D2C D;  1YQ3 C;  1VF5 D;  1VF5 B;  2JO1 A;  2QJP C;  4H44 C;  3FGA D;  3AEA C;  1NGM B;  2IDB A;  2QJK C;  4RKU J;  4R4M A;  4Y28 J;  1PIX A;  3AE3 C;  3Q5P A;  2K9Y A;  1HF9 A;  1ZOY C;  1GMJ A;  4R4L A;  1KOR A;  3EWK A;  4PV1 D;  4OGQ D;  4OGQ C;  1R8E A;  1DIP A;  3AED C;  1KTM A;  3G9R A;  3AE2 C;  1KMI Z;  1UIX A;  2YIU C;  3B71 A;  1OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...