1S1CX

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transforming protein RhoA
publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 26
structure length 69
sequence length 69
chains with identical sequence Y
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08912 Rho_Binding Rho Binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s1cX00
1S1CX 1NYHA 1TU3F 1UIXA 3FGAD 1PL5A
chains in the Genus database with same CATH superfamily
1L2PA 3LW5J 1OW8A 4DOJA 1G2CB 2WZ7A 3RL0C 1FOSE 3SWKA 3FXEA 1PGOA 2IFNA 5DJUB 2WMMA 2Y9ZA 2IYPA 1LWUA 1ZMEC 3CCUP 3Q5PA 2IZ1A 1NU1D 1S9KD 1VQPP 3V4QA 2QJPB 1W5CE 3MGNA 1OZHA 2YKPA 1J1EB 3L74E 3EQ2A 1S3JA 2FYUG 2Q3IA 3L72D 3HUSC 1WRGA 1K8AQ 5TISH 2K1AA 4ASVA 3CC7P 1ZV8A 1NTKJ 1Y47A 2KP8A 2R3CA 4L73A 1X9VA 3H1JE 1CI6B 1N7LA 2XU6A 1H8AA 3V2RA 5B66H 1GL2A 2N1TD 5AVQB 1NTZK 1IO4A 4NPEA 3L73E 5AVYB 1S5LX 3RK2B 1X0TA 1SFCA 2OYHA 3M9HA 1IK9A 1SQXK 4UB8H 3L72J 2ZVNB 1GTWA 1KILC 3TF5A 1EZVI 1SQPG 5L8RJ 3MP7B 3CWBE 4Y28J 1LT1A 1NVOA 3H1LE 2KZJA 5AW9B 3H1HG 3L71E 5KLVE 5TISE 1H0TA 3CC4P 5M1BA 3RK3D 4W7YA 5CCHA 1KQGB 1QGKB 2K9JA 1CW5A 2RMZA 3PHLA 1NWQA 5B66E 4I7ZB 1W2EA 1EC5A 2FYNC 3L4FA 1KORA 5EFWB 1NU1G 5APSA 1VQ6P 2OTKE 1JTHA 2BCCD 2KXPB 2QG4A 3SWYA 2O01N 3PP5A 4UB8E 1KZUB 1EDLA 3B71A 3H6PA 3NXSA 3L35A 2C0XA 5KLIC 2YO3A 1HVVA 1HTLC 3L70D 1KN7A 1SLQA 4JBZA 2KK7A 4DT0A 4OGQD 4YXDC 1JB0J 1PZQA 4H13C 3B8EB 1L4AB 2Z5HA 1Q81Q 1JMMA 4KHXA 1LWUC 4ZKUA 1ZP0C 2M8RA 3MIWA 1RF1A 2BCCJ 1U7JA 4ZMDA 2H43A 4EI2A 1N7SB 3FXDA 1J2JB 2XNDH 4HH2A 3HD7B 2HPCA 3L70J 1LTJA 1SQVD 5KAIH 2I8DA 5KTBA 3H1KD 1L0LG 5CCGD 1RQVA 4N78D 2KSJA 2MJZA 1GL2C 1OVUA 1H88A 4WB4A 5CHXA 1SQBK 2LXCB 5C39A 1M1JA 3TSIA 4I1LA 1DIPA 2GA1A 4PJ0H 1PPJG 2KIKA 1SFCC 3H25A 1FC2C 2OYHC 2WSCJ 1LGHB 4QMAA 1DEBA 1T6AA 3H1IG 2B87A 1SQVJ 1VF5B 1NH4A 2QEXP 2PFXA 1IFNA 3RK2D 3B5NB 3VN0A 2E74D 3H1KJ 1KYOD 3Q1MA 4HB1A 3HE5B 4HYTB 2K9YA 4MN4C 2Q7CA 1NKNA 3IFMA 4DZOA 2KB7P 1S2EA 1LP1A 1K73Q 5KAIE 1SQPE 1GU5A 1EDIA 2E75C 1RH5B 1SQQK 1Y9BA 1KB9H 1IFPA 5CCHC 1N86A 2LKMA 3FWNA 4U3FJ 3H1HE 1YQ3C 1NTKK 3CXHI 1NTMG 2CPSA 1JM0A 3IF4A 1NTZD 1NYHA 1MV8A 2WSEH 1PFIA 3BATA 2HR3A 1MZ9A 1T8ZA 1HWTC 3JCUH 1SQXD 3WU2H 2FKWB 3HTKA 3G6EP 3HE4A 4WY4A 3T97A 1FZBA 1FBMA 3A5TA 4IL6H 2WWWA 1WMKA 4GT1A 4YPCA 3IN6A 1ZR2A 1YTZT 1URQB 3TNUB 1IFMA 2IDBA 1OW6A 1KQSO 3PTZA 4Z1MH 3H1JJ 1SS1A 4PD4D 1KB9E 1L0ND 1RF1C 2C0WA 3SWFA 4YXWH 1L4AD 2N1TA 1SQXJ 3VP9A 1QVGO 2ZYAA 1FZFA 1LTJC 3L75G 1EZVG 4IFMA 5AW0B 4O9BA 4K3AA 3ABVC 3BRVB 1YJ9P 2FXMA 2SPZA 1RQUA 2P1JA 2ZT9B 3JCUE 3WU2E 2H89C 1KQLA 3E7KA 1UIIA 3HD7D 5CMZA 4IL6E 2KS1A 2IZ0A 5BVZA 3H1LJ 1M1JC 1ZR4A 1L0NJ 4I2LC 4UB6H 5APWA 1NAFA 1L0LE 3HRNA 4BRYB 1H89A 1ZOYC 5AVVB 1VDFA 4D6TD 3D6YA 3VMAA 4HJGH 2WPVB 1NTZG 2WPSA 5AVXB 2W6BA 1PPJE 4IOIH 1U7MA 3MD0A 1AV1A 2ZYGA 3CCLP 2QJKB 3E1IA 3U1AA 3GG2A 3RL0B 3H1IE 1GMJA 3CD6P 1N8RQ 4H0LC 1VF5D 3GLMA 2WT7A 5AVSB 1FZCA 3CX5D 3CCJP 2RN0A 3SSUA 1KILE 2OYOA 4D6TJ 3HUSB 2PGDA 1YITP 3S1KA 1SQBD 3CXHD 3I5CA 4UB6E 5H2FH 1NO4A 3CCMP 1PGQA 2ZJSE 1NTME 4WY4C 1PP9D 1G2CA 4BWNA 3OW2O 1OXZA 2JEEA 3TDKA 2WQYC 1IFJA 3TK1A 1T2KD 5KJ7D 3H32A 2YMYA 1BDCA 4TLFA 1BE3G 2YXQB 2DW3A 2ZAEB 1KILB 3P8MC 5CCGA 1GDTA 4JYCA 1SQQD 2ITAA 4N78E 2E5YA 5AW8B 2E76B 2N1TC 1EXIA 2O1JA 1NTKD 3PJSK 1K04A 2K88A 4H44B 1PP9J 5AW6B 1ZRTD 1CI6A 2M3EA 5H2FE 2IYOA 3G9RA 1ZW0A 3VYIA 4XFJA 3O6QA 3IAOA 2HLOA 4C46A 2KI7B 1FU1A 3P8CD 3VP8A 2KLVA 2FYNB 3KHUA 1QEXA 3L75E 1EZVE 3KQGA 1QLED 3NTNA 3USSA 1SQQJ 3BCCG 2A45I 2ZT9D 2QVAA 5K5GB 1HH0A 3N4XA 1X79B 1Z56A 1SQBG 2QIWA 3RK3C 1MFZA 5KLIB 4PD4H 2NPSA 3M9BA 2POHA 3OJAB 1RE3A 2JO1A 3SFDC 1CZQA 1LTGC 4Y99B 2V7QH 1NTZE 2J58A 1P84D 1VPCA 1VQ5P 2K3RA 1FJKA 1AVOA 1MFTA 1FZCC 2JWDA 1S5LH 1KTMA 1XTGB 1GK6A 1VQNP 1KYOI 1Q2NA 1GZLA 5B5EH 2H7HA 4RESB 4OGQC 4CPGA 5KAFH 3AE2C 4RKUJ 3GHGB 2J59M 3KZIH 4NPDA 4GDOA 2I1JA 1JY2O 1NTKG 1L0NK 2LXBA 3A0BH 1FZAA 5KKZC 4PD4E 1G1IA 4AQRD 2OARA 2CK3H 1OMIA 1FOSF 1L4AA 1JUNA 3Q2YA 3U59A 1Q82Q 1SFCB 4EYYQ 2OYHB 5TJHA 1JY2P 2YIUC 1JY3O 3L72G 1HGZA 3CCVP 1S5LE 5CCGC 2P67A 1Q90D 3W67A 5AW5B 1BE3E 4WBAA 5B5EE 3G4SP 3CXHH 1JY3P 5KAFE 2QJYC 3A0HH 1KD1Q 1FDIA 3KZIE 2Q3EA 3AEAC 3AEDC 4PD4I 3A0BE 2E76D 2K9JB 2LR2A 2OYIA 3LW5H 4H44D 3RK2C 3OA7A 2R32A 2E74C 3PLNA 1BCCJ 1FS0E 1BGYD 4U7JA 5AVTB 3CMAP 2JKVA 3IR9A 1JTHB 3GMAA 3NFQA 4JQ0D 2YXRB 4NPFX 2WSFJ 1HJ0A 1IK7A 4ZKPA 3I55P 3FGAD 2Q5UA 1LTIC 2FYUE 2NPSC 2Q9IA 3BCCE 3HE5A 2R44A 1LTSC 1JCCA 2ZXEB 3WUTA 2E5TA 3EFGA 1RE3C 2A06D 1K9MQ 5AVWB 3TGUD 3EWKA 3CCEP 1QL2A 3CXHE 2QRXA 5DJTB 3A0HE 1R5SA 3CL3D 3CCSP 1BGYJ 4U3FD 1YQ4C 3D6ZA 3KPEA 2P10A 1K05A 2AEMA 2KNCA 2BCCG 4EDFA 1G1JA 1LTBC 3VMXA 3I56P 2J5UA 3M06A 2QE7H 3JC22 2FY8A 5KJ7A 3AE1C 2N9BA 4EOTA 3L70G 2HODA 3CX5I 1JOCA 3TGUJ 1AA0A 2O01J 1SQPK 2FXOA 2AEFA 1M1JB 1L4AC 3F89A 3U1CA 3H1JD 4PJ0E 1NTKE 2D2CB 2P58A 2E42A 3AE9C 3SFEC 2W6JH 2FFDA 1LT9A 3L73D 2JJLA 2PP6A 2Y0CA 2PAJA 4TT3H 3GF7A 1NU1E 2A45G 1SQVG 1MUUA 1S9KE 3L74J 3G71P 3V2QA 1LTAC 3H1KG 2H8PD 1J1DB 4A7PA 1JY2N 3M0DA 2JP3A 3L72E 2ZFCA 4GKGA 4H0LB 3A3YB 1LP1B 1EDJA 1LNQA 2WITA 1DX7A 3AE4C 2YMKA 2ZXXA 1MKMA 1LTTC 2IFMA 3RBZA 1IJDB 3H1LD 3B4SA 3L71D 2B89A 4HKZH 2OYIC 2Q1KA 3Q5RA 3L73J 4U3FG 2PRRA 3KXDA 1VQLP 1JY3N 4RJTA 3CCQP 1HJBA 5CCHD 5AW2B 2OQQA 4C7NA 1VF5C 5APUA 4AYCA 1PL5A 3R4YA 3V5BA 3HE4B 4WY4B 3T97B 3P32A 1HGVA 1N7SD 3CLQA 2E43A 3CWBJ 3S9OA 2KLUA 3V2NA 1S72P 1QL1A 1ZN5A 3ITKA 5AW4B 1RHZB 3L71J 5KLVJ 1BSHA 2Q6QA 5E79H 3PRJA 3WUUA 3L36A 2ZYDA 3H1JG 2IBZI 2RH0A 3RK3E 2C9LY 2YNYA 4KT0J 2N1TB 1E5WA 2GUSA 2WSCH 1SQXG 4W80A 2RKLA 1A02F 1N2DC 1P84I 3FX0A 5CBOA 4K35A 1T2KC 1T3JA 5KJ7C 2FXPA 2A45H 1E79H 1FE6A 4DJGA 2BCCE 4PV1C 3B5ND 3AE3C 3KYQA 1HBWA 2C9NY 2W90A 5APTA 3TYYA 2FBWC 2NZ2A 2XZRA 3L70E 1YTZI 1AJYA 2OTLP 3H1LG 1L0NG 1RY3A 3L71G 2H88C 3L37A 2WPQA 3LIDA 2FFDC 2Z5IA 1Q86Q 1ZLLA 5E79E 2QA4P 1YHQP 1LT9C 3S4RA 3A2AA 3QWOC 2XV5A 1VL2A 1N73A 2D2CD 1TU3F 1CSBA 2Y9YA 1KYOH 1NTMK 1S4XA 3MZWB 1OW7A 3M0DC 4AUWA 1ZXGA 5AVUB 2R5DA 2WT7B 1SQVE 3AE7C 2FYUJ 5CBNA 1JO5A 2M5AB 3H1KE 3W68A 3M9QA 1URQD 4R4LA 4JYBA 1SQPD 1YIJP 1N73B 4H0LD 4D6TG 2CPBA 4OGQB 3R2PA 2GM4A 4M3LA 3AEFC 1JNMA 2Y0EA 1M8OB 4L74A 3H1HD 3ZDMA 1QVFO 2M3BA 3MHVA 4U3FE 3AE5C 5KKZB 1GW3A 3RBXA 2AXTH 3D71A 2HG5D 4LC1A 1BSNA 4I6MC 1NAYA 1VQ9P 1KYOE 3VMZA 3GW6A 3H32B 1YJWP 2GUVA 1SQPJ 2YIUB 4WY4D 1UIXA 2W83C 5APVA 3AE6C 4BXLA 5APXA 1DEEG 2IBZD 1IC2A 2NRGA 3H1HJ 2P7JA 1DD3A 5AVRB 1X22A 3G3ZA 3AEGC 1YBKA 3GHGA 4H13B 2QJYB 5APYA 1KB9D 1PP9G 4XA4A 1A02J 1LWUB 1T3UA 1HF9A 3O6QB 1NU1J 4LGDE 5GTIH 3P7KA 1SQXE 3GF3A 3RL0D 3FWLA 2E74B 2AXTE 5AW1B 3Q5SA 2OGUA 4GOEA 2HYNA 1M1KQ 1KFNA 1SQQG 2MKVA 1VQ8P 3C1LA 3OAKA 1GD2E 5KLVK 1GK4A 2NPSB 1X8YA 3BASA 2E76C 1GL2B 1VQ4P 1L0LD 2Y0DA 1N73C 1L0NE 1RF0A 2O1KA 2O3JA 4H44C 2FYZA 1KQFB 4GIFA 2WSEJ 1NKZB 4N6JA 3PH0A 1PPJD 4DCKA 2QSIA 1U57A 1VQOP 2QM8A 4L76A 1PIXA 2QJPC 3H1ID 1BCCD 2UWJE 1LJ2A 3CX5H 1J1EC 5GTIE 1N7SA 1AVYA 3VTPC 1EQ7A 2VRSA 1AFOA 3HD7A 1AQ5A 1KFMA 5BU5A 1L0LJ 2IBZG 1KILD 1KV4A 1YJNP 1H0TB 4C7RA 2E75B 3WUVA 2K37A 1RE4A 4D6TE 3MUDA 2BEZF 1FAVA 1HUCA 4W7ZA 2I1KA 2IPPA 1WT6A 4Y99C 3H1IJ 1PGPA 2M0BA 1DD4A 1NTMD 3EFFK 2L91A 5BU8B 3N7NA 1M90Q 1BDDA 3B5NA 3CX5E 3K5BA 2V4HA 1OFCX 1OVRA 5APQA 3GHGC 2FYUK 3CCRP 1SQBE 2Z4EA 2YKQA 5AW3B 3KDPB 1NTMJ 1RF1B 4I7ZC 2OYIB 1USDA 1Y8AA 4H13D 2WVRA 3CI9A 1NOHA 3AECC 1PP9E 3C8VA 1DH3A 1BCCG 2HPCB 1LTJB 5CJ4A 3L75D 3AEBC 1EZVD 1PGJA 3L74D 3Q3DA 4IFDK 5CJ0A 1RF0C 1D7MA 4LLHA 1SQQE 1URQA 2IX7C 3BRTB 3V6IA 4OVNF 1GW4A 3TNUA 1SP4A 3VMYA 1AQTA 1VQMP 4WVZA 3F5HA 3M91A 2NPSD 2WSSH 2B87B 1P84H 1OX3A 1GL2D 1W2BO 2BEQD 3II6A 1ZRTE 1BGYG 2XNXA 2KOGA 3LIEA 3JSVC 2JR8A 2KNCB 1N7SC 1SFCD 1SVFA 3L75J 3P8CE 2XDJA 1FDOA 1KC8Q 4IL6X 3HD7C 2BASA 1USEA 1S1CX 1NU1K 3C9IA 2KUBA 1FZGA 2WPRA 1JEKA 4R4MA 1FDMA 4PV1B 2HODB 4OH8B 4B86A 3CWBD 2AEJA 2HFED 2A06G 3TGUG 4EIJA 1EXJA 1RE4C 4GOFA 3MUDC 5KLVD 3V2PA 3D70A 2IBZE 4XE5B 1JMBA 5GTHH 1IZNB 1NGMB 4BRYA 5AVZB 2E75D 2G3AA 1NTZJ 3CPWO 2FFDB 1VQ7P 3V4WA 1P84E 1LT9B 2R5BA 2P2UA 3HTKB 4OWFA 2R3SA 3B5NC 2JWAA 3E1RA 4JPZB 4N3YB 4JF7A 3L74G 3M0AA 2WSFH 1NHLA 2JDIH 3CMEP 1KMIZ 4WWIA 1YYCA 2XKMA 1OVVA 1BE3D 1OIPA 1L0LK 3AE8C 3RGUA 2N9YB 5AW7B 3HUSA 1R8EA 1Q7YQ 1FZEA 4YTPC 3QH9A 3MTUE 2D2CC 2B88A 3L73G 5GTHE 1VQKP 2W6AA 2WTYA 1KB9I 2V7QJ 2QM7A 4C7NB 2YO2A 1M7LA 4RO0A 3NMDA 3VOPA 1JCDA 3RL0g 2KYVA 1J1DC 1BCCE 3UIAA 1IFDA 2KS1B 3CWBG 1URQC 1BE3J 3WMM0 1M56D 2KZIA 2FYUD 5KLVG 2O01H 1YI2P 1KILA 3BCCD 2M5AA 1NJIQ 3RK3B 1PV3A 2OTJP 4GODA 2KSEA 4L75A 2W27A 4ASWA 4KJMA 1XTCC 2W8ZA 2B9BA 1BGYE 4IFFA 3BVHA 2ZT9C 1FZCB 1R5LA 1OWAA 4ZNCA 2AXCA 3BCCJ 1SQVK 1FJPA 1QX8A 3O8ZA 2ZVOB 2L5GB 3CC2P 3AEEC 4PV1D 2YKOA 1SQBJ 2A06E 3A7OA 1EDKA 3TGUE 1IFIA 1M57D 2G8YA 1GU4A 2QJKC
chains in the Genus database with same CATH topology
1PIXA 2QJPC 1NYHA 1VF5C 1OW8A 3LW5J 1EXJA 4I7ZC 3AE6C 3RL0g 1FDIA 1PL5A 3R4YA 2O01J 3D70A 3AEAC 3AEDC 1ZOYC 4H13D 3T97B 1VL2A 2E76D 1DD3A 3AECC 3D6YA 2WPVB 1NGMB 3S9OA 1KTMA 2D2CD 3Q5PA 1ZMEC 3AEGC 5M1BA 1TU3F 2E75D 3C8VA 2G3AA 4H44D 1RQVA 2E74C 1KQGB 4H13B 1OW7A 2E76B 4U7JA 1EXIA 4I7ZB 2D2CB 1WMKA 1K04A 4OGQC 2E75B 3IN6A 3AE9C 1GMJA 1PV3A 3AEBC 3GMAA 2FYNC 4H44B 1KORA 3SFEC 1HF9A 1DIPA 3AE7C 3AE2C 4RKUJ 3Q3DA 2WSFJ 4GDOA 3H25A 1HJ0A 1IK7A 2WSCJ 4H0LC 1VF5D 3GLMA 2IDBA 1OW6A 2BEZF 3G9RA 3GF3A 4TT3H 3FGAD 4XFJA 4Z1MH 3RK3E 3GF7A 2E74B 3O6QA 3IAOA 4R4LA 4KT0J 5KKZC 4H0LD 3B71A 3Q5SA 1KILE 1VF5B 4OGQB 1OMIA 1KMIZ 1DD4A 3AEFC 2ZT9C 5KLIC 2E74D 2JP3A 3Q2YA 3EWKA 2BEQD 3Q1MA 2MKVA 4H0LB 1ZRTE 2FXPA 2K9YA 4OGQD 3AE4C 3AE8C 4YXDC 1S5LX 2ZT9D 1JB0J 4PV1C 2YMKA 1MKMA 3AE5C 2YIUC 3AE3C 4H13C 1R8EA 1YQ4C 2E76C 3ABVC 4YTPC 3D6ZA 2D2CC 2FBWC 1FDOA 2QIWA 2NZ2A 2E75C 2P10A 3AEEC 1RQUA 4H44C 2ZT9B 4IL6X 4PV1D 1ZP0C 1K05A 3D71A 3Q5RA 1S1CX 1Y9BA 2V7QJ 2H89C 1AJYA 1Q90D 1KQFB 2WSEJ 2J5UA 5L8RJ 4R4MA 1YQ3C 4PV1B 2WQYC 2JO1A 3SFDC 2G8YA 2H88C 1U57A 2QSIA 4Y28J 1UIXA 2QJYC 3AE1C 2OQQA 2QJKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1C X;  1NYH A;  1TU3 F;  1UIX A;  3FGA D;  1PL5 A; 
#chains in the Genus database with same CATH topology
 1L2P A;  3LW5 J;  1OW8 A;  4DOJ A;  1G2C B;  2WZ7 A;  3RL0 C;  1FOS E;  3SWK A;  3FXE A;  1PGO A;  2IFN A;  5DJU B;  2WMM A;  2Y9Z A;  2IYP A;  1LWU A;  1ZME C;  3CCU P;  3Q5P A;  2IZ1 A;  1NU1 D;  1S9K D;  1VQP P;  3V4Q A;  2QJP B;  1W5C E;  3MGN A;  1OZH A;  2YKP A;  1J1E B;  3L74 E;  3EQ2 A;  1S3J A;  2FYU G;  2Q3I A;  3L72 D;  3HUS C;  1WRG A;  1K8A Q;  5TIS H;  2K1A A;  4ASV A;  3CC7 P;  1ZV8 A;  1NTK J;  1Y47 A;  2KP8 A;  2R3C A;  4L73 A;  1X9V A;  3H1J E;  1CI6 B;  1N7L A;  2XU6 A;  1H8A A;  3V2R A;  5B66 H;  1GL2 A;  2N1T D;  5AVQ B;  1NTZ K;  1IO4 A;  4NPE A;  3L73 E;  5AVY B;  1S5L X;  3RK2 B;  1X0T A;  1SFC A;  2OYH A;  3M9H A;  1IK9 A;  1SQX K;  4UB8 H;  3L72 J;  2ZVN B;  1GTW A;  1KIL C;  3TF5 A;  1EZV I;  1SQP G;  5L8R J;  3MP7 B;  3CWB E;  4Y28 J;  1LT1 A;  1NVO A;  3H1L E;  2KZJ A;  5AW9 B;  3H1H G;  3L71 E;  5KLV E;  5TIS E;  1H0T A;  3CC4 P;  5M1B A;  3RK3 D;  4W7Y A;  5CCH A;  1KQG B;  1QGK B;  2K9J A;  1CW5 A;  2RMZ A;  3PHL A;  1NWQ A;  5B66 E;  4I7Z B;  1W2E A;  1EC5 A;  2FYN C;  3L4F A;  1KOR A;  5EFW B;  1NU1 G;  5APS A;  1VQ6 P;  2OTK E;  1JTH A;  2BCC D;  2KXP B;  2QG4 A;  3SWY A;  2O01 N;  3PP5 A;  4UB8 E;  1KZU B;  1EDL A;  3B71 A;  3H6P A;  3NXS A;  3L35 A;  2C0X A;  5KLI C;  2YO3 A;  1HVV A;  1HTL C;  3L70 D;  1KN7 A;  1SLQ A;  4JBZ A;  2KK7 A;  4DT0 A;  4OGQ D;  4YXD C;  1JB0 J;  1PZQ A;  4H13 C;  3B8E B;  1L4A B;  2Z5H A;  1Q81 Q;  1JMM A;  4KHX A;  1LWU C;  4ZKU A;  1ZP0 C;  2M8R A;  3MIW A;  1RF1 A;  2BCC J;  1U7J A;  4ZMD A;  2H43 A;  4EI2 A;  1N7S B;  3FXD A;  1J2J B;  2XND H;  4HH2 A;  3HD7 B;  2HPC A;  3L70 J;  1LTJ A;  1SQV D;  5KAI H;  2I8D A;  5KTB A;  3H1K D;  1L0L G;  5CCG D;  1RQV A;  4N78 D;  2KSJ A;  2MJZ A;  1GL2 C;  1OVU A;  1H88 A;  4WB4 A;  5CHX A;  1SQB K;  2LXC B;  5C39 A;  1M1J A;  3TSI A;  4I1L A;  1DIP A;  2GA1 A;  4PJ0 H;  1PPJ G;  2KIK A;  1SFC C;  3H25 A;  1FC2 C;  2OYH C;  2WSC J;  1LGH B;  4QMA A;  1DEB A;  1T6A A;  3H1I G;  2B87 A;  1SQV J;  1VF5 B;  1NH4 A;  2QEX P;  2PFX A;  1IFN A;  3RK2 D;  3B5N B;  3VN0 A;  2E74 D;  3H1K J;  1KYO D;  3Q1M A;  4HB1 A;  3HE5 B;  4HYT B;  2K9Y A;  4MN4 C;  2Q7C A;  1NKN A;  3IFM A;  4DZO A;  2KB7 P;  1S2E A;  1LP1 A;  1K73 Q;  5KAI E;  1SQP E;  1GU5 A;  1EDI A;  2E75 C;  1RH5 B;  1SQQ K;  1Y9B A;  1KB9 H;  1IFP A;  5CCH C;  1N86 A;  2LKM A;  3FWN A;  4U3F J;  3H1H E;  1YQ3 C;  1NTK K;  3CXH I;  1NTM G;  2CPS A;  1JM0 A;  3IF4 A;  1NTZ D;  1NYH A;  1MV8 A;  2WSE H;  1PFI A;  3BAT A;  2HR3 A;  1MZ9 A;  1T8Z A;  1HWT C;  3JCU H;  1SQX D;  3WU2 H;  2FKW B;  3HTK A;  3G6E P;  3HE4 A;  4WY4 A;  3T97 A;  1FZB A;  1FBM A;  3A5T A;  4IL6 H;  2WWW A;  1WMK A;  4GT1 A;  4YPC A;  3IN6 A;  1ZR2 A;  1YTZ T;  1URQ B;  3TNU B;  1IFM A;  2IDB A;  1OW6 A;  1KQS O;  3PTZ A;  4Z1M H;  3H1J J;  1SS1 A;  4PD4 D;  1KB9 E;  1L0N D;  1RF1 C;  2C0W A;  3SWF A;  4YXW H;  1L4A D;  2N1T A;  1SQX J;  3VP9 A;  1QVG O;  2ZYA A;  1FZF A;  1LTJ C;  3L75 G;  1EZV G;  4IFM A;  5AW0 B;  4O9B A;  4K3A A;  3ABV C;  3BRV B;  1YJ9 P;  2FXM A;  2SPZ A;  1RQU A;  2P1J A;  2ZT9 B;  3JCU E;  3WU2 E;  2H89 C;  1KQL A;  3E7K A;  1UII A;  3HD7 D;  5CMZ A;  4IL6 E;  2KS1 A;  2IZ0 A;  5BVZ A;  3H1L J;  1M1J C;  1ZR4 A;  1L0N J;  4I2L C;  4UB6 H;  5APW A;  1NAF A;  1L0L E;  3HRN A;  4BRY B;  1H89 A;  1ZOY C;  5AVV B;  1VDF A;  4D6T D;  3D6Y A;  3VMA A;  4HJG H;  2WPV B;  1NTZ G;  2WPS A;  5AVX B;  2W6B A;  1PPJ E;  4IOI H;  1U7M A;  3MD0 A;  1AV1 A;  2ZYG A;  3CCL P;  2QJK B;  3E1I A;  3U1A A;  3GG2 A;  3RL0 B;  3H1I E;  1GMJ A;  3CD6 P;  1N8R Q;  4H0L C;  1VF5 D;  3GLM A;  2WT7 A;  5AVS B;  1FZC A;  3CX5 D;  3CCJ P;  2RN0 A;  3SSU A;  1KIL E;  2OYO A;  4D6T J;  3HUS B;  2PGD A;  1YIT P;  3S1K A;  1SQB D;  3CXH D;  3I5C A;  4UB6 E;  5H2F H;  1NO4 A;  3CCM P;  1PGQ A;  2ZJS E;  1NTM E;  4WY4 C;  1PP9 D;  1G2C A;  4BWN A;  3OW2 O;  1OXZ A;  2JEE A;  3TDK A;  2WQY C;  1IFJ A;  3TK1 A;  1T2K D;  5KJ7 D;  3H32 A;  2YMY A;  1BDC A;  4TLF A;  1BE3 G;  2YXQ B;  2DW3 A;  2ZAE B;  1KIL B;  3P8M C;  5CCG A;  1GDT A;  4JYC A;  1SQQ D;  2ITA A;  4N78 E;  2E5Y A;  5AW8 B;  2E76 B;  2N1T C;  1EXI A;  2O1J A;  1NTK D;  3PJS K;  1K04 A;  2K88 A;  4H44 B;  1PP9 J;  5AW6 B;  1ZRT D;  1CI6 A;  2M3E A;  5H2F E;  2IYO A;  3G9R A;  1ZW0 A;  3VYI A;  4XFJ A;  3O6Q A;  3IAO A;  2HLO A;  4C46 A;  2KI7 B;  1FU1 A;  3P8C D;  3VP8 A;  2KLV A;  2FYN B;  3KHU A;  1QEX A;  3L75 E;  1EZV E;  3KQG A;  1QLE D;  3NTN A;  3USS A;  1SQQ J;  3BCC G;  2A45 I;  2ZT9 D;  2QVA A;  5K5G B;  1HH0 A;  3N4X A;  1X79 B;  1Z56 A;  1SQB G;  2QIW A;  3RK3 C;  1MFZ A;  5KLI B;  4PD4 H;  2NPS A;  3M9B A;  2POH A;  3OJA B;  1RE3 A;  2JO1 A;  3SFD C;  1CZQ A;  1LTG C;  4Y99 B;  2V7Q H;  1NTZ E;  2J58 A;  1P84 D;  1VPC A;  1VQ5 P;  2K3R A;  1FJK A;  1AVO A;  1MFT A;  1FZC C;  2JWD A;  1S5L H;  1KTM A;  1XTG B;  1GK6 A;  1VQN P;  1KYO I;  1Q2N A;  1GZL A;  5B5E H;  2H7H A;  4RES B;  4OGQ C;  4CPG A;  5KAF H;  3AE2 C;  4RKU J;  3GHG B;  2J59 M;  3KZI H;  4NPD A;  4GDO A;  2I1J A;  1JY2 O;  1NTK G;  1L0N K;  2LXB A;  3A0B H;  1FZA A;  5KKZ C;  4PD4 E;  1G1I A;  4AQR D;  2OAR A;  2CK3 H;  1OMI A;  1FOS F;  1L4A A;  1JUN A;  3Q2Y A;  3U59 A;  1Q82 Q;  1SFC B;  4EYY Q;  2OYH B;  5TJH A;  1JY2 P;  2YIU C;  1JY3 O;  3L72 G;  1HGZ A;  3CCV P;  1S5L E;  5CCG C;  2P67 A;  1Q90 D;  3W67 A;  5AW5 B;  1BE3 E;  4WBA A;  5B5E E;  3G4S P;  3CXH H;  1JY3 P;  5KAF E;  2QJY C;  3A0H H;  1KD1 Q;  1FDI A;  3KZI E;  2Q3E A;  3AEA C;  3AED C;  4PD4 I;  3A0B E;  2E76 D;  2K9J B;  2LR2 A;  2OYI A;  3LW5 H;  4H44 D;  3RK2 C;  3OA7 A;  2R32 A;  2E74 C;  3PLN A;  1BCC J;  1FS0 E;  1BGY D;  4U7J A;  5AVT B;  3CMA P;  2JKV A;  3IR9 A;  1JTH B;  3GMA A;  3NFQ A;  4JQ0 D;  2YXR B;  4NPF X;  2WSF J;  1HJ0 A;  1IK7 A;  4ZKP A;  3I55 P;  3FGA D;  2Q5U A;  1LTI C;  2FYU E;  2NPS C;  2Q9I A;  3BCC E;  3HE5 A;  2R44 A;  1LTS C;  1JCC A;  2ZXE B;  3WUT A;  2E5T A;  3EFG A;  1RE3 C;  2A06 D;  1K9M Q;  5AVW B;  3TGU D;  3EWK A;  3CCE P;  1QL2 A;  3CXH E;  2QRX A;  5DJT B;  3A0H E;  1R5S A;  3CL3 D;  3CCS P;  1BGY J;  4U3F D;  1YQ4 C;  3D6Z A;  3KPE A;  2P10 A;  1K05 A;  2AEM A;  2KNC A;  2BCC G;  4EDF A;  1G1J A;  1LTB C;  3VMX A;  3I56 P;  2J5U A;  3M06 A;  2QE7 H;  3JC2 2;  2FY8 A;  5KJ7 A;  3AE1 C;  2N9B A;  4EOT A;  3L70 G;  2HOD A;  3CX5 I;  1JOC A;  3TGU J;  1AA0 A;  2O01 J;  1SQP K;  2FXO A;  2AEF A;  1M1J B;  1L4A C;  3F89 A;  3U1C A;  3H1J D;  4PJ0 E;  1NTK E;  2D2C B;  2P58 A;  2E42 A;  3AE9 C;  3SFE C;  2W6J H;  2FFD A;  1LT9 A;  3L73 D;  2JJL A;  2PP6 A;  2Y0C A;  2PAJ A;  4TT3 H;  3GF7 A;  1NU1 E;  2A45 G;  1SQV G;  1MUU A;  1S9K E;  3L74 J;  3G71 P;  3V2Q A;  1LTA C;  3H1K G;  2H8P D;  1J1D B;  4A7P A;  1JY2 N;  3M0D A;  2JP3 A;  3L72 E;  2ZFC A;  4GKG A;  4H0L B;  3A3Y B;  1LP1 B;  1EDJ A;  1LNQ A;  2WIT A;  1DX7 A;  3AE4 C;  2YMK A;  2ZXX A;  1MKM A;  1LTT C;  2IFM A;  3RBZ A;  1IJD B;  3H1L D;  3B4S A;  3L71 D;  2B89 A;  4HKZ H;  2OYI C;  2Q1K A;  3Q5R A;  3L73 J;  4U3F G;  2PRR A;  3KXD A;  1VQL P;  1JY3 N;  4RJT A;  3CCQ P;  1HJB A;  5CCH D;  5AW2 B;  2OQQ A;  4C7N A;  1VF5 C;  5APU A;  4AYC A;  1PL5 A;  3R4Y A;  3V5B A;  3HE4 B;  4WY4 B;  3T97 B;  3P32 A;  1HGV A;  1N7S D;  3CLQ A;  2E43 A;  3CWB J;  3S9O A;  2KLU A;  3V2N A;  1S72 P;  1QL1 A;  1ZN5 A;  3ITK A;  5AW4 B;  1RHZ B;  3L71 J;  5KLV J;  1BSH A;  2Q6Q A;  5E79 H;  3PRJ A;  3WUU A;  3L36 A;  2ZYD A;  3H1J G;  2IBZ I;  2RH0 A;  3RK3 E;  2C9L Y;  2YNY A;  4KT0 J;  2N1T B;  1E5W A;  2GUS A;  2WSC H;  1SQX G;  4W80 A;  2RKL A;  1A02 F;  1N2D C;  1P84 I;  3FX0 A;  5CBO A;  4K35 A;  1T2K C;  1T3J A;  5KJ7 C;  2FXP A;  2A45 H;  1E79 H;  1FE6 A;  4DJG A;  2BCC E;  4PV1 C;  3B5N D;  3AE3 C;  3KYQ A;  1HBW A;  2C9N Y;  2W90 A;  5APT A;  3TYY A;  2FBW C;  2NZ2 A;  2XZR A;  3L70 E;  1YTZ I;  1AJY A;  2OTL P;  3H1L G;  1L0N G;  1RY3 A;  3L71 G;  2H88 C;  3L37 A;  2WPQ A;  3LID A;  2FFD C;  2Z5I A;  1Q86 Q;  1ZLL A;  5E79 E;  2QA4 P;  1YHQ P;  1LT9 C;  3S4R A;  3A2A A;  3QWO C;  2XV5 A;  1VL2 A;  1N73 A;  2D2C D;  1TU3 F;  1CSB A;  2Y9Y A;  1KYO H;  1NTM K;  1S4X A;  3MZW B;  1OW7 A;  3M0D C;  4AUW A;  1ZXG A;  5AVU B;  2R5D A;  2WT7 B;  1SQV E;  3AE7 C;  2FYU J;  5CBN A;  1JO5 A;  2M5A B;  3H1K E;  3W68 A;  3M9Q A;  1URQ D;  4R4L A;  4JYB A;  1SQP D;  1YIJ P;  1N73 B;  4H0L D;  4D6T G;  2CPB A;  4OGQ B;  3R2P A;  2GM4 A;  4M3L A;  3AEF C;  1JNM A;  2Y0E A;  1M8O B;  4L74 A;  3H1H D;  3ZDM A;  1QVF O;  2M3B A;  3MHV A;  4U3F E;  3AE5 C;  5KKZ B;  1GW3 A;  3RBX A;  2AXT H;  3D71 A;  2HG5 D;  4LC1 A;  1BSN A;  4I6M C;  1NAY A;  1VQ9 P;  1KYO E;  3VMZ A;  3GW6 A;  3H32 B;  1YJW P;  2GUV A;  1SQP J;  2YIU B;  4WY4 D;  1UIX A;  2W83 C;  5APV A;  3AE6 C;  4BXL A;  5APX A;  1DEE G;  2IBZ D;  1IC2 A;  2NRG A;  3H1H J;  2P7J A;  1DD3 A;  5AVR B;  1X22 A;  3G3Z A;  3AEG C;  1YBK A;  3GHG A;  4H13 B;  2QJY B;  5APY A;  1KB9 D;  1PP9 G;  4XA4 A;  1A02 J;  1LWU B;  1T3U A;  1HF9 A;  3O6Q B;  1NU1 J;  4LGD E;  5GTI H;  3P7K A;  1SQX E;  3GF3 A;  3RL0 D;  3FWL A;  2E74 B;  2AXT E;  5AW1 B;  3Q5S A;  2OGU A;  4GOE A;  2HYN A;  1M1K Q;  1KFN A;  1SQQ G;  2MKV A;  1VQ8 P;  3C1L A;  3OAK A;  1GD2 E;  5KLV K;  1GK4 A;  2NPS B;  1X8Y A;  3BAS A;  2E76 C;  1GL2 B;  1VQ4 P;  1L0L D;  2Y0D A;  1N73 C;  1L0N E;  1RF0 A;  2O1K A;  2O3J A;  4H44 C;  2FYZ A;  1KQF B;  4GIF A;  2WSE J;  1NKZ B;  4N6J A;  3PH0 A;  1PPJ D;  4DCK A;  2QSI A;  1U57 A;  1VQO P;  2QM8 A;  4L76 A;  1PIX A;  2QJP C;  3H1I D;  1BCC D;  2UWJ E;  1LJ2 A;  3CX5 H;  1J1E C;  5GTI E;  1N7S A;  1AVY A;  3VTP C;  1EQ7 A;  2VRS A;  1AFO A;  3HD7 A;  1AQ5 A;  1KFM A;  5BU5 A;  1L0L J;  2IBZ G;  1KIL D;  1KV4 A;  1YJN P;  1H0T B;  4C7R A;  2E75 B;  3WUV A;  2K37 A;  1RE4 A;  4D6T E;  3MUD A;  2BEZ F;  1FAV A;  1HUC A;  4W7Z A;  2I1K A;  2IPP A;  1WT6 A;  4Y99 C;  3H1I J;  1PGP A;  2M0B A;  1DD4 A;  1NTM D;  3EFF K;  2L91 A;  5BU8 B;  3N7N A;  1M90 Q;  1BDD A;  3B5N A;  3CX5 E;  3K5B A;  2V4H A;  1OFC X;  1OVR A;  5APQ A;  3GHG C;  2FYU K;  3CCR P;  1SQB E;  2Z4E A;  2YKQ A;  5AW3 B;  3KDP B;  1NTM J;  1RF1 B;  4I7Z C;  2OYI B;  1USD A;  1Y8A A;  4H13 D;  2WVR A;  3CI9 A;  1NOH A;  3AEC C;  1PP9 E;  3C8V A;  1DH3 A;  1BCC G;  2HPC B;  1LTJ B;  5CJ4 A;  3L75 D;  3AEB C;  1EZV D;  1PGJ A;  3L74 D;  3Q3D A;  4IFD K;  5CJ0 A;  1RF0 C;  1D7M A;  4LLH A;  1SQQ E;  1URQ A;  2IX7 C;  3BRT B;  3V6I A;  4OVN F;  1GW4 A;  3TNU A;  1SP4 A;  3VMY A;  1AQT A;  1VQM P;  4WVZ A;  3F5H A;  3M91 A;  2NPS D;  2WSS H;  2B87 B;  1P84 H;  1OX3 A;  1GL2 D;  1W2B O;  2BEQ D;  3II6 A;  1ZRT E;  1BGY G;  2XNX A;  2KOG A;  3LIE A;  3JSV C;  2JR8 A;  2KNC B;  1N7S C;  1SFC D;  1SVF A;  3L75 J;  3P8C E;  2XDJ A;  1FDO A;  1KC8 Q;  4IL6 X;  3HD7 C;  2BAS A;  1USE A;  1S1C X;  1NU1 K;  3C9I A;  2KUB A;  1FZG A;  2WPR A;  1JEK A;  4R4M A;  1FDM A;  4PV1 B;  2HOD B;  4OH8 B;  4B86 A;  3CWB D;  2AEJ A;  2HFE D;  2A06 G;  3TGU G;  4EIJ A;  1EXJ A;  1RE4 C;  4GOF A;  3MUD C;  5KLV D;  3V2P A;  3D70 A;  2IBZ E;  4XE5 B;  1JMB A;  5GTH H;  1IZN B;  1NGM B;  4BRY A;  5AVZ B;  2E75 D;  2G3A A;  1NTZ J;  3CPW O;  2FFD B;  1VQ7 P;  3V4W A;  1P84 E;  1LT9 B;  2R5B A;  2P2U A;  3HTK B;  4OWF A;  2R3S A;  3B5N C;  2JWA A;  3E1R A;  4JPZ B;  4N3Y B;  4JF7 A;  3L74 G;  3M0A A;  2WSF H;  1NHL A;  2JDI H;  3CME P;  1KMI Z;  4WWI A;  1YYC A;  2XKM A;  1OVV A;  1BE3 D;  1OIP A;  1L0L K;  3AE8 C;  3RGU A;  2N9Y B;  5AW7 B;  3HUS A;  1R8E A;  1Q7Y Q;  1FZE A;  4YTP C;  3QH9 A;  3MTU E;  2D2C C;  2B88 A;  3L73 G;  5GTH E;  1VQK P;  2W6A A;  2WTY A;  1KB9 I;  2V7Q J;  2QM7 A;  4C7N B;  2YO2 A;  1M7L A;  4RO0 A;  3NMD A;  3VOP A;  1JCD A;  3RL0 g;  2KYV A;  1J1D C;  1BCC E;  3UIA A;  1IFD A;  2KS1 B;  3CWB G;  1URQ C;  1BE3 J;  3WMM 0;  1M56 D;  2KZI A;  2FYU D;  5KLV G;  2O01 H;  1YI2 P;  1KIL A;  3BCC D;  2M5A A;  1NJI Q;  3RK3 B;  1PV3 A;  2OTJ P;  4GOD A;  2KSE A;  4L75 A;  2W27 A;  4ASW A;  4KJM A;  1XTC C;  2W8Z A;  2B9B A;  1BGY E;  4IFF A;  3BVH A;  2ZT9 C;  1FZC B;  1R5L A;  1OWA A;  4ZNC A;  2AXC A;  3BCC J;  1SQV K;  1FJP A;  1QX8 A;  3O8Z A;  2ZVO B;  2L5G B;  3CC2 P;  3AEE C;  4PV1 D;  2YKO A;  1SQB J;  2A06 E;  3A7O A;  1EDK A;  3TGU E;  1IFI A;  1M57 D;  2G8Y A;  1GU4 A;  2QJK C; 
#chains in the Genus database with same CATH homology
 1PIX A;  2QJP C;  1NYH A;  1VF5 C;  1OW8 A;  3LW5 J;  1EXJ A;  4I7Z C;  3AE6 C;  3RL0 g;  1FDI A;  1PL5 A;  3R4Y A;  2O01 J;  3D70 A;  3AEA C;  3AED C;  1ZOY C;  4H13 D;  3T97 B;  1VL2 A;  2E76 D;  1DD3 A;  3AEC C;  3D6Y A;  2WPV B;  1NGM B;  3S9O A;  1KTM A;  2D2C D;  3Q5P A;  1ZME C;  3AEG C;  5M1B A;  1TU3 F;  2E75 D;  3C8V A;  2G3A A;  4H44 D;  1RQV A;  2E74 C;  1KQG B;  4H13 B;  1OW7 A;  2E76 B;  4U7J A;  1EXI A;  4I7Z B;  2D2C B;  1WMK A;  1K04 A;  4OGQ C;  2E75 B;  3IN6 A;  3AE9 C;  1GMJ A;  1PV3 A;  3AEB C;  3GMA A;  2FYN C;  4H44 B;  1KOR A;  3SFE C;  1HF9 A;  1DIP A;  3AE7 C;  3AE2 C;  4RKU J;  3Q3D A;  2WSF J;  4GDO A;  3H25 A;  1HJ0 A;  1IK7 A;  2WSC J;  4H0L C;  1VF5 D;  3GLM A;  2IDB A;  1OW6 A;  2BEZ F;  3G9R A;  3GF3 A;  4TT3 H;  3FGA D;  4XFJ A;  4Z1M H;  3RK3 E;  3GF7 A;  2E74 B;  3O6Q A;  3IAO A;  4R4L A;  4KT0 J;  5KKZ C;  4H0L D;  3B71 A;  3Q5S A;  1KIL E;  1VF5 B;  4OGQ B;  1OMI A;  1KMI Z;  1DD4 A;  3AEF C;  2ZT9 C;  5KLI C;  2E74 D;  2JP3 A;  3Q2Y A;  3EWK A;  2BEQ D;  3Q1M A;  2MKV A;  4H0L B;  1ZRT E;  2FXP A;  2K9Y A;  4OGQ D;  3AE4 C;  3AE8 C;  4YXD C;  1S5L X;  2ZT9 D;  1JB0 J;  4PV1 C;  2YMK A;  1MKM A;  3AE5 C;  2YIU C;  3AE3 C;  4H13 C;  1R8E A;  1YQ4 C;  2E76 C;  3ABV C;  4YTP C;  3D6Z A;  2D2C C;  2FBW C;  1FDO A;  2QIW A;  2NZ2 A;  2E75 C;  2P10 A;  3AEE C;  1RQU A;  4H44 C;  2ZT9 B;  4IL6 X;  4PV1 D;  1ZP0 C;  1K05 A;  3D71 A;  3Q5R A;  1S1C X;  1Y9B A;  2V7Q J;  2H89 C;  1AJY A;  1Q90 D;  1KQF B;  2WSE J;  2J5U A;  5L8R J;  4R4M A;  1YQ3 C;  4PV1 B;  2WQY C;  2JO1 A;  3SFD C;  2G8Y A;  2H88 C;  1U57 A;  2QSI A;  4Y28 J;  1UIX A;  2QJY C;  3AE1 C;  2OQQ A;  2QJK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...