1S1CX

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Transforming protein RhoA
publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 69
sequence length 69
chains with identical sequence Y
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08912 Rho_Binding Rho Binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s1cX00
3FGAD 1TU3F 1S1CX 1UIXA 1NYHA 1PL5A
chains in the Genus database with same CATH superfamily
1WT6A 2WSCH 3E1RA 1U7JA 1H0TA 2PFXA 1GMJA 3B8EB 2QE7H 3CCVP 1BCCD 4H0LB 3PP5A 4OH8B 3OAKA 2NPSC 1W5CE 1HH0A 5E79E 3H32A 2O3JA 4ASVA 3WMM0 1KTMA 2V7QJ 1PGQA 1BSHA 3A3YB 5APYA 1P84H 2IBZD 1VQ9P 1SP4A 3JSVC 3M9HA 2QJPC 4PV1D 3SFEC 1M57D 2YMKA 1JM0A 3M0DA 2BCCE 4PJ0E 1OW7A 5TJHA 1PGPA 3TNUB 1LTSC 2GUSA 1RE4A 3L4FA 1MFTA 1WMKA 4WY4C 3A0HH 2W83C 3H1KE 5H2FH 1FZFA 4IOIH 1R8EA 3CMAP 5KLIB 1M1JB 1NTZK 3B5ND 2JWAA 2QEXP 2OYIA 4GKGA 1PFIA 4C7NA 4I1LA 1OW8A 1LTIC 1VF5D 1Q2NA 1BCCE 1LT9C 3L72J 5AVWB 1L0NJ 2E74C 1SFCA 5KKZC 3V2PA 2WSFJ 1QGKB 1U57A 4CPGA 1NU1J 3S1KA 1FU1A 2IBZE 3GF7A 1KV4A 3CXHH 2JP3A 1ZMEC 3H1JJ 2KS1A 1S4XA 3TGUD 3AEAC 4ASWA 1T3JA 3G9RA 1VQ5P 2B87B 2KIKA 1L0LJ 3H1IJ 2C0XA 1KZUB 1KQLA 1KQSO 1YTZT 3AE5C 1FOSF 2YKQA 2ZVOB 3RBZA 3H1HD 1EC5A 3H1LG 5CCHD 1LT9A 4GIFA 3NXSA 1S1CX 2LR2A 1RF0C 2YMYA 3RK2B 3L37A 2J59M 1PL5A 1SQPK 3B71A 4IL6H 2PAJA 2ZT9D 3CXHD 1SQQD 2XNXA 3WUVA 1YQ3C 2IBZI 1BGYJ 5KJ7D 3C8VA 2E76C 5APQA 3O8ZA 3FWNA 3D70A 1RH5B 2KLUA 1JEKA 1GL2B 2QRXA 2HFED 1AQ5A 4NPDA 3L70D 1SQXJ 1OWAA 4H44D 4WVZA 1MUUA 2FXOA 3FGAD 3V5BA 3V4WA 2KP8A 1NWQA 3TGUE 1SLQA 1ZR4A 4EOTA 1N7SB 2H88C 2Q6QA 3Q3DA 2MJZA 1P84I 5B66E 1K04A 3H1HE 2HLOA 1LTGC 5AVQB 1SQVG 3P7KA 1RF1B 4OGQC 3RK3B 3MIWA 2RMZA 4I7ZB 2OQQA 2LKMA 3KHUA 2PRRA 2QM8A 3HUSC 3M0AA 3BRTB 3VN0A 3CXHE 1SQQE 1IZNB 2IFNA 3I55P 1HTLC 3CL3D 1Q86Q 2P67A 4H13D 2H43A 1L2PA 4PD4H 1FDIA 3CWBJ 2O1JA 1JMBA 1R5LA 4H44C 3L70E 3IAOA 1RHZB 2KNCA 4DT0A 3SWYA 1IJDB 1L0NK 3P32A 2XZRA 3AE1C 4HKZH 2WITA 1S5LE 2JO1A 4DZOA 3TK1A 1LWUB 3HE5B 3FXEA 4Z1MH 3CXHI 1NHLA 2KLVA 4L73A 2KXPB 2Y9YA 1DEEG 2OYIB 4JQ0D 1W2EA 1JUNA 4PD4D 1FZGA 4W80A 1GU4A 2FYUD 5KLVE 1BSNA 1PPJD 2WPRA 3L75D 4U3FD 4UB8H 2W27A 3KXDA 2A45H 1MV8A 1IFMA 3IR9A 2OYHA 1AA0A 3MUDC 1S3JA 1S5LX 1NTKJ 1FZAA 4YXWH 1VQ6P 1NO4A 2KS1B 3ITKA 2Z5IA 1NOHA 1NTMJ 3CCRP 2P10A 3TGUG 2Y0CA 1K05A 2M8RA 2V7QH 3NTNA 4KJMA 4C7RA 1YQ4C 1SQVK 1FAVA 2AEFA 2DW3A 1PGOA 4EDFA 2OTLP 3GHGC 1VDFA 3LW5H 1L4AD 3CX5H 1W2BO 1M90Q 2L91A 3HE4B 2YKOA 3L35A 1KYOH 4PD4E 2FYUE 2N9YB 3TNUA 3KDPB 1PPJE 3SSUA 1DEBA 1SQQG 1IO4A 2E75D 3L75E 2K3RA 4U3FE 3I56P 5GTHH 4LLHA 3HD7B 1ZN5A 3PLNA 1M1JA 1OVVA 3A7OA 1IFIA 4RO0A 1PGJA 3KZIH 1JY2O 2B88A 3L70G 1HF9A 4PV1B 3WU2H 1KILC 3CX5D 2H7HA 2GA1A 2H8PD 3QH9A 1FZBA 2WSFH 1KYOD 2MKVA 2N1TD 3CCSP 1J1EC 4PD4I 4N78D 2E43A 5TISH 2ZYDA 2D2CC 1JY3P 5L8RJ 3B5NB 4QMAA 2SPZA 4TLFA 1VF5B 2B87A 2OARA 2XDJA 3PRJA 1FZCC 5DJUB 1ZV8A 2Q3EA 3FX0A 5CCGD 5KLVG 2FFDB 5AW8B 1Y8AA 1VL2A 2WSSH 1RQVA 3GG2A 1Q7YQ 2KYVA 3L72D 4ZNCA 3RL0C 1CZQA 2A06G 1L0ND 3CC7P 1LTAC 1NU1D 1UIXA 3AE4C 2WPQA 1HJ0A 1LTBC 1PZQA 1IK9A 2NPSD 1E5WA 2E42A 1ZXGA 3AE3C 3CX5E 1L0LD 2A45I 2K9JB 1NTKK 3L74J 1KYOE 1N73B 1VQKP 1GL2A 4N78E 1ZLLA 5AW5B 3USSA 1FBMA 3D6YA 1N8RQ 1G1JA 5GTHE 1HGVA 3KYQA 5AVZB 1VQOP 1N7SA 1NKNA 1IC2A 3A2AA 4WY4D 2YIUB 1ZRTD 5BU8B 5M1BA 4XA4A 3L72E 3L75G 3M0DC 4U3FG 3WU2E 3T97B 1FJPA 1MZ9A 4GODA 1RF1A 3BATA 2XKMA 4IFDK 3CX5I 3V2QA 1DX7A 1RE4C 5KAFH 1NU1E 5AVRB 1KYOI 1SQXD 3S9OA 1BDDA 3CC4P 1OVUA 1QL2A 3A5TA 1G2CB 3U1CA 2LXBA 2E74D 4D6TD 2OYIC 1YITP 1L0LE 2FYNC 5DJTB 2QJYB 2AXTE 4EI2A 5AVVB 3LW5J 1EZVI 1DH3A 1SVFA 1SFCC 1ZW0A 3O6QB 3OW2O 1Y9BA 1PP9G 1VQPP 1YYCA 1URQB 1AJYA 1SQBD 1BE3J 1LWUA 3HE5A 3AE9C 2YKPA 3EFFK 1ZRTE 5KAIH 4H13B 3CI9A 3L71D 2C9LY 1IFJA 1YJ9P 1P84D 2WPSA 3CWBD 1GK4A 1SQXE 2E76D 1BE3G 1YBKA 3W68A 4LC1A 4HYTB 4D6TE 3V2RA 1T3UA 2HODB 3M06A 3H1LJ 4GOEA 3VP9A 2IYOA 1USDA 3WUTA 3V6IA 1NGMB 1WRGA 3GF3A 2J58A 1VQNP 3VOPA 2Q9IA 3BRVB 3K5BA 2V4HA 1JY3N 3CMEP 1AFOA 1X22A 5CMZA 3MHVA 1SQBE 1U7MA 1KQGB 1VQ4P 4OGQD 3CCLP 4AYCA 1USEA 3AEGC 3L71E 4U7JA 4XE5B 3HE4A 2Q5UA 1P84E 3KPEA 3CWBE 3HTKB 3F89A 2XU6A 1J1DB 3AEDC 3AE6C 1NTMD 1HJBA 2R44A 1A02J 2CK3H 2FXPA 1N7LA 1NH4A 3HD7A 2YXRB 4GOFA 2FFDC 1SQVJ 1L4AB 1A02F 3A0HE 5H2FE 1QEXA 5KAIE 3P8MC 4WB4A 3Q5PA 2GM4A 3S4RA 2BCCG 1JY2N 1Q90D 1RE3A 4K35A 4EIJA 3D6ZA 2E75B 3HRNA 3H1KG 3BCCD 4H0LD 3L73D 4RKUJ 3JC22 2JWDA 3FXDA 2Z4EA 3B5NA 1EDKA 4Y99B 3VYIA 1N73C 2JKVA 4NPEA 1S72P 1BCCG 2FFDA 2M5AB 1M1KQ 2IFMA 1NTME 1HUCA 2N1TB 4Y28J 2KB7P 4D6TG 2QJKC 2WVRA 3JCUH 2NRGA 1N86A 3VP8A 3Q2YA 2IBZG 1LNQA 2JDIH 1J2JB 2RN0A 3SWFA 3C1LA 1KORA 3VMYA 2OYHC 1PV3A 1NTZD 2W6JH 4M3LA 1XTGB 1VQ8P 3PH0A 2BEZF 4IL6E 2K9JA 3IF4A 1N73A 4H0LC 1SQBG 5CCHA 3BCCE 3IFMA 3L73E 3AEEC 5AVSB 2KOGA 3TSIA 2ITAA 3L71G 3G6EP 1EDIA 2KSJA 1K73Q 2CPBA 2UWJE 1JCCA 4HJGH 3ZDMA 3BASA 3AEFC 3TGUJ 3P8CD 3U59A 5KJ7A 4YXDC 1OMIA 1LT1A 3MD0A 3LIDA 1NAYA 3T97A 2G8YA 3L74D 3H1HJ 1URQC 2YNYA 4IL6X 2QJPB 2BASA 3PJSK 3KQGA 1JY3O 4DCKA 1KILD 2IDBA 5KLIC 5AW1B 1EDJA 1M1JC 3CCEP 1AVYA 1G2CA 4UB6H 1K8AQ 1NTZE 2WMMA 4WY4B 4MN4C 3M91A 2HPCB 1CI6B 1JOCA 1SQQJ 2W6BA 4WWIA 1SQPD 4N3YB 3MZWB 3H1HG 2AEMA 2D2CD 2WT7B 2R3CA 1QL1A 1IK7A 3N4XA 3AE2C 3O6QA 3L70J 1LTTC 1H89A 1HBWA 2WPVB 1URQA 3PTZA 3VMAA 3P8CE 5KKZB 3RL0D 1LTJB 3G4SP 3D71A 3H6PA 1GTWA 3L74E 1MFZA 5B5EH 2R32A 1KQFB 3R2PA 3M9BA 1KILE 2AEJA 2O1KA 1H88A 3RK3D 5KLVJ 2L5GB 3RK2C 3RBXA 2RH0A 2OTKE 2HODA 1OFCX 2Z5HA 2QIWA 1SQPE 4B86A 1KB9H 3Q5RA 4UB8E 1M56D 1QX8A 1JTHB 1GL2C 5AVUB 4RJTA 1EZVD 2E76B 3W67A 2M3EA 2XNDH 3CCUP 1ZR2A 1LP1B 2QM7A 3G71P 1FDOA 2P1JA 3N7NA 1FC2C 3CLQA 1N7SC 4C46A 1NKZB 3H1LD 1KB9D 3H1JD 1GW3A 3HTKA 2W8ZA 4PJ0H 1RF1C 3RK3C 2QG4A 3H1ID 3TDKA 1RY3A 4W7ZA 3RK3E 1FJKA 3GLMA 4I7ZC 1EXIA 4Y99C 2W6AA 1VQ7P 3UIAA 3CCMP 4AUWA 3L75J 2KI7B 3PHLA 4U3FJ 4OGQB 5EFWB 4JBZA 1L4AA 2LXCB 2IZ0A 4NPFX 1G1IA 1SFCD 3WUUA 4BRYB 1X79B 2P58A 1KD1Q 3I5CA 3AECC 1X0TA 1KFMA 3HUSB 2ZT9B 1SQQK 1HWTC 2FYUG 2FYZA 4XFJA 1OVRA 4YPCA 3C9IA 1YTZI 1PPJG 1EZVE 3KZIE 4BWNA 1BGYD 1NVOA 1VQMP 1IFDA 1N2DC 2O01J 1ZP0C 1L0NE 1T2KC 1HVVA 4DJGA 1OX3A 4H44B 1GDTA 2ZYAA 1LWUC 2PGDA 1SQVD 3H1LE 5TISE 1KC8Q 1PP9J 1FOSE 1KB9E 3H1JE 4KHXA 5C39A 2M5AA 1OIPA 4WBAA 3H1IE 1UIIA 2N1TA 5AW3B 3OA7A 3EQ2A 5KTBA 5AVXB 1YIJP 4GT1A 1SQPG 2I1KA 1M7LA 5AW9B 3GW6A 1IFNA 4R4LA 5KLVK 5CHXA 2A45G 2GUVA 3NMDA 3HD7D 1NYHA 5CCGA 1FZEA 4L76A 3OJAB 1GW4A 2P7JA 1BGYE 4ZKUA 2M3BA 1KB9I 1QLED 2B9BA 2E5TA 1NJIQ 3TF5A 3MP7B 2QSIA 1SQVE 1MKMA 3NFQA 2NPSA 2R5BA 3RL0g 5APSA 3EWKA 2JR8A 5B66H 2KUBA 3GHGB 4RESB 1E79H 4JF7A 4L74A 1H8AA 2FYUK 1LTJC 1HGZA 2G3AA 3E1IA 2HR3A 3HD7C 1T8ZA 1IFPA 5KAFE 3CPWO 4WY4A 1OXZA 1VPCA 2HPCA 1CI6A 1JMMA 1EZVG 4PV1C 4W7YA 2WSEJ 3L72G 1QVFO 2WT7A 2ZFCA 3L36A 5GTIH 1L0NG 4EYYQ 1RE3C 3F5HA 1NTKD 2HYNA 1NU1G 2HG5D 2IZ1A 1RQUA 1EXJA 3VMZA 1KILB 3V4QA 3BVHA 2K1AA 2BCCJ 2QVAA 3H1JG 3II6A 2WQYC 4HB1A 3B5NC 4GDOA 1S5LH 1YJWP 5AVTB 1J1EB 1L0LG 1LTJA 3H1IG 1AVOA 1VF5C 4L75A 4LGDE 3H1KJ 2D2CB 1YJNP 3TYYA 5CBNA 4KT0J 1X9VA 1FZCB 2ZXEB 2B89A 1BCCJ 4BXLA 2R5DA 1KFNA 3RL0B 1FE6A 2ZXXA 5AW2B 1BGYG 4D6TJ 5AW0B 1RF0A 3AE7C 3MGNA 3A0BH 2QA4P 4IFMA 1NTKE 2J5UA 1JTHA 5CCHC 1SQXG 2WSCJ 1H0TB 1Q81Q 3G3ZA 1Z56A 2JEEA 2POHA 5KLVD 2K37A 2K88A 1YI2P 1LP1A 1NAFA 2NZ2A 2ZT9C 1SQBJ 2R3SA 1R5SA 2ZVNB 3H32B 1URQD 5KJ7C 2WTYA 2A06D 2OYOA 2YIUC 1EQ7A 4AQRD 3L71J 2XV5A 5AW6B 5GTIE 1KN7A 1CSBA 5APTA 3CCQP 2ZAEB 1LJ2A 1JB0J 2H89C 2JJLA 1NU1K 4BRYA 1YHQP 2I1JA 2OYHB 5AW4B 3SWKA 3HUSA 3GMAA 2WWWA 3CWBG 2QJYC 2NPSB 2Y0EA 4OVNF 1L0LK 4ZKPA 2O01H 2FYNB 4C7NB 2IX7C 2CPSA 3LIEA 5K5GB 1DIPA 1GZLA 4N6JA 3Q5SA 3B4SA 1ZOYC 2Q3IA 2C9NY 1SFCB 2A06E 2YXQB 3R4YA 4H13C 1JNMA 1EDLA 3CD6P 2N9BA 3RK2D 3CCJP 3A0BE 2VRSA 2O01N 3VTPC 1FS0E 5BU5A 3AE8C 4K3AA 3MTUE 1AV1A 2FKWB 3CC2P 2RKLA 5APVA 1Q82Q 2Y0DA 1SQXK 3JCUE 1X8YA 1GL2D 1OW6A 1LT9B 3IN6A 1NTKG 4OWFA 5CBOA 4TT3H 1PP9D 3QWOC 2E74B 1GK6A 4R4MA 1NTMG 1VQLP 2I8DA 4O9BA 3MUDA 1N7SD 1S9KD 1DD3A 3BCCJ 3L73J 3E7KA 1LGHB 2IYPA 2M0BA 3U1AA 2FXMA 2ZYGA 2IPPA 3ABVC 3V2NA 4DOJA 2FBWC 5AVYB 1OZHA 3EFGA 1SQBK 2KK7A 2KZIA 1XTCC 1JO5A 3FWLA 1BE3D 3M9QA 1PIXA 3GHGA 1J1DC 3BCCG 3L73G 1QVGO 2KSEA 1JCDA 2KZJA 1GD2E 1DD4A 1T6AA 2OTJP 2WZ7A 5E79H 1L4AC 1D7MA 2FY8A 4HH2A 4JYBA 2WSEH 1PP9E 2AXCA 1NTZJ 1T2KD 1SS1A 4UB6E 2Q7CA 2AXTH 2Q1KA 1S9KE 4I6MC 2E75C 1GU5A 1KILA 3VMXA 4YTPC 1AQTA 2FYUJ 1NTZG 3RGUA 2KNCB 4A7PA 1TU3F 1K9MQ 5APUA 1BE3E 3Q1MA 1CW5A 2Y9ZA 4JPZB 2ZJSE 2N1TC 2P2UA 2PP6A 2W90A 5CJ0A 2YO3A 1FZCA 1KMIZ 1M8OB 4IFFA 4ZMDA 1JY2P 1S2EA 1NTMK 3H25A 5APWA 5B5EE 2BCCD 5APXA 2YO2A 4I2LC 3AEBC 2QJKB 5CCGC 1FDMA 3SFDC 4JYCA 5AW7B 1SQPJ 2E5YA 2C0WA 3H1KD 5BVZA 3L74G 1BDCA 2OGUA 2K9YA 5CJ4A 1Y47A 2BEQD
chains in the Genus database with same CATH topology
5KKZC 1HF9A 2FXPA 4PV1B 2H88C 2WSFJ 3D6YA 2WPVB 2BEZF 2NZ2A 4R4LA 3AE8C 2ZT9C 1U57A 3Q3DA 4H0LC 1K04A 1GMJA 1NYHA 2YIUC 1RQUA 1EXJA 3GF7A 3RK3E 3AEEC 3GLMA 4I7ZC 2JP3A 1EXIA 3D71A 1ZMEC 4OGQC 2MKVA 4H0LB 3AEAC 3Q5PA 2WQYC 3G9RA 4I7ZB 2E76D 1S5LX 2OQQA 5M1BA 4GDOA 4OGQB 1OW6A 2E75C 2D2CC 3IN6A 1KTMA 1Q90D 5L8RJ 3AE5C 3T97B 1VF5C 1KQFB 2V7QJ 3AEFC 4TT3H 3D6ZA 2E74B 2E75B 2D2CB 4YTPC 3AECC 2P10A 4YXDC 1KILE 1VF5B 4H0LD 1K05A 4R4MA 1OMIA 2ZT9B 4RKUJ 1JB0J 2QSIA 2H89C 3S9OA 1MKMA 4KT0J 4XFJA 1NGMB 4H13D 3GF3A 1TU3F 1S1CX 1YQ4C 2G8YA 3RL0g 2QJPC 1VL2A 1FDIA 1RQVA 1DD3A 4PV1D 3SFEC 2YMKA 3EWKA 2QIWA 3Q1MA 2O01J 3GMAA 1ZP0C 2E74D 4H44C 4IL6X 3Q5RA 2QJYC 1OW7A 1PL5A 3B71A 2FYNC 3IAOA 2ZT9D 1WMKA 1YQ3C 4H44B 2IDBA 3AE1C 3ABVC 5KLIC 3C8VA 1UIXA 1KMIZ 2E76C 2FBWC 3AE4C 1KQGB 1R8EA 3D70A 3LW5J 1DIPA 4OGQD 1HJ0A 3AE7C 4Y28J 3H25A 3AEGC 2QJKC 2E76B 2JO1A 4U7JA 3Q5SA 1Y9BA 2G3AA 1ZOYC 1PIXA 4Z1MH 2E75D 2D2CD 3AEBC 3AE3C 3Q2YA 1OW8A 4H44D 2J5UA 1VF5D 1FDOA 3SFDC 3FGAD 3R4YA 4H13C 1IK7A 2WSCJ 3AEDC 1AJYA 1KORA 3AE6C 1PV3A 3AE2C 3O6QA 1DD4A 4PV1C 2WSEJ 3AE9C 1ZRTE 2K9YA 4H13B 2E74C 2BEQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA D;  1TU3 F;  1S1C X;  1UIX A;  1NYH A;  1PL5 A; 
#chains in the Genus database with same CATH topology
 1WT6 A;  2WSC H;  3E1R A;  1U7J A;  1H0T A;  2PFX A;  1GMJ A;  3B8E B;  2QE7 H;  3CCV P;  1BCC D;  4H0L B;  3PP5 A;  4OH8 B;  3OAK A;  2NPS C;  1W5C E;  1HH0 A;  5E79 E;  3H32 A;  2O3J A;  4ASV A;  3WMM 0;  1KTM A;  2V7Q J;  1PGQ A;  1BSH A;  3A3Y B;  5APY A;  1P84 H;  2IBZ D;  1VQ9 P;  1SP4 A;  3JSV C;  3M9H A;  2QJP C;  4PV1 D;  3SFE C;  1M57 D;  2YMK A;  1JM0 A;  3M0D A;  2BCC E;  4PJ0 E;  1OW7 A;  5TJH A;  1PGP A;  3TNU B;  1LTS C;  2GUS A;  1RE4 A;  3L4F A;  1MFT A;  1WMK A;  4WY4 C;  3A0H H;  2W83 C;  3H1K E;  5H2F H;  1FZF A;  4IOI H;  1R8E A;  3CMA P;  5KLI B;  1M1J B;  1NTZ K;  3B5N D;  2JWA A;  2QEX P;  2OYI A;  4GKG A;  1PFI A;  4C7N A;  4I1L A;  1OW8 A;  1LTI C;  1VF5 D;  1Q2N A;  1BCC E;  1LT9 C;  3L72 J;  5AVW B;  1L0N J;  2E74 C;  1SFC A;  5KKZ C;  3V2P A;  2WSF J;  1QGK B;  1U57 A;  4CPG A;  1NU1 J;  3S1K A;  1FU1 A;  2IBZ E;  3GF7 A;  1KV4 A;  3CXH H;  2JP3 A;  1ZME C;  3H1J J;  2KS1 A;  1S4X A;  3TGU D;  3AEA C;  4ASW A;  1T3J A;  3G9R A;  1VQ5 P;  2B87 B;  2KIK A;  1L0L J;  3H1I J;  2C0X A;  1KZU B;  1KQL A;  1KQS O;  1YTZ T;  3AE5 C;  1FOS F;  2YKQ A;  2ZVO B;  3RBZ A;  3H1H D;  1EC5 A;  3H1L G;  5CCH D;  1LT9 A;  4GIF A;  3NXS A;  1S1C X;  2LR2 A;  1RF0 C;  2YMY A;  3RK2 B;  3L37 A;  2J59 M;  1PL5 A;  1SQP K;  3B71 A;  4IL6 H;  2PAJ A;  2ZT9 D;  3CXH D;  1SQQ D;  2XNX A;  3WUV A;  1YQ3 C;  2IBZ I;  1BGY J;  5KJ7 D;  3C8V A;  2E76 C;  5APQ A;  3O8Z A;  3FWN A;  3D70 A;  1RH5 B;  2KLU A;  1JEK A;  1GL2 B;  2QRX A;  2HFE D;  1AQ5 A;  4NPD A;  3L70 D;  1SQX J;  1OWA A;  4H44 D;  4WVZ A;  1MUU A;  2FXO A;  3FGA D;  3V5B A;  3V4W A;  2KP8 A;  1NWQ A;  3TGU E;  1SLQ A;  1ZR4 A;  4EOT A;  1N7S B;  2H88 C;  2Q6Q A;  3Q3D A;  2MJZ A;  1P84 I;  5B66 E;  1K04 A;  3H1H E;  2HLO A;  1LTG C;  5AVQ B;  1SQV G;  3P7K A;  1RF1 B;  4OGQ C;  3RK3 B;  3MIW A;  2RMZ A;  4I7Z B;  2OQQ A;  2LKM A;  3KHU A;  2PRR A;  2QM8 A;  3HUS C;  3M0A A;  3BRT B;  3VN0 A;  3CXH E;  1SQQ E;  1IZN B;  2IFN A;  3I55 P;  1HTL C;  3CL3 D;  1Q86 Q;  2P67 A;  4H13 D;  2H43 A;  1L2P A;  4PD4 H;  1FDI A;  3CWB J;  2O1J A;  1JMB A;  1R5L A;  4H44 C;  3L70 E;  3IAO A;  1RHZ B;  2KNC A;  4DT0 A;  3SWY A;  1IJD B;  1L0N K;  3P32 A;  2XZR A;  3AE1 C;  4HKZ H;  2WIT A;  1S5L E;  2JO1 A;  4DZO A;  3TK1 A;  1LWU B;  3HE5 B;  3FXE A;  4Z1M H;  3CXH I;  1NHL A;  2KLV A;  4L73 A;  2KXP B;  2Y9Y A;  1DEE G;  2OYI B;  4JQ0 D;  1W2E A;  1JUN A;  4PD4 D;  1FZG A;  4W80 A;  1GU4 A;  2FYU D;  5KLV E;  1BSN A;  1PPJ D;  2WPR A;  3L75 D;  4U3F D;  4UB8 H;  2W27 A;  3KXD A;  2A45 H;  1MV8 A;  1IFM A;  3IR9 A;  2OYH A;  1AA0 A;  3MUD C;  1S3J A;  1S5L X;  1NTK J;  1FZA A;  4YXW H;  1VQ6 P;  1NO4 A;  2KS1 B;  3ITK A;  2Z5I A;  1NOH A;  1NTM J;  3CCR P;  2P10 A;  3TGU G;  2Y0C A;  1K05 A;  2M8R A;  2V7Q H;  3NTN A;  4KJM A;  4C7R A;  1YQ4 C;  1SQV K;  1FAV A;  2AEF A;  2DW3 A;  1PGO A;  4EDF A;  2OTL P;  3GHG C;  1VDF A;  3LW5 H;  1L4A D;  3CX5 H;  1W2B O;  1M90 Q;  2L91 A;  3HE4 B;  2YKO A;  3L35 A;  1KYO H;  4PD4 E;  2FYU E;  2N9Y B;  3TNU A;  3KDP B;  1PPJ E;  3SSU A;  1DEB A;  1SQQ G;  1IO4 A;  2E75 D;  3L75 E;  2K3R A;  4U3F E;  3I56 P;  5GTH H;  4LLH A;  3HD7 B;  1ZN5 A;  3PLN A;  1M1J A;  1OVV A;  3A7O A;  1IFI A;  4RO0 A;  1PGJ A;  3KZI H;  1JY2 O;  2B88 A;  3L70 G;  1HF9 A;  4PV1 B;  3WU2 H;  1KIL C;  3CX5 D;  2H7H A;  2GA1 A;  2H8P D;  3QH9 A;  1FZB A;  2WSF H;  1KYO D;  2MKV A;  2N1T D;  3CCS P;  1J1E C;  4PD4 I;  4N78 D;  2E43 A;  5TIS H;  2ZYD A;  2D2C C;  1JY3 P;  5L8R J;  3B5N B;  4QMA A;  2SPZ A;  4TLF A;  1VF5 B;  2B87 A;  2OAR A;  2XDJ A;  3PRJ A;  1FZC C;  5DJU B;  1ZV8 A;  2Q3E A;  3FX0 A;  5CCG D;  5KLV G;  2FFD B;  5AW8 B;  1Y8A A;  1VL2 A;  2WSS H;  1RQV A;  3GG2 A;  1Q7Y Q;  2KYV A;  3L72 D;  4ZNC A;  3RL0 C;  1CZQ A;  2A06 G;  1L0N D;  3CC7 P;  1LTA C;  1NU1 D;  1UIX A;  3AE4 C;  2WPQ A;  1HJ0 A;  1LTB C;  1PZQ A;  1IK9 A;  2NPS D;  1E5W A;  2E42 A;  1ZXG A;  3AE3 C;  3CX5 E;  1L0L D;  2A45 I;  2K9J B;  1NTK K;  3L74 J;  1KYO E;  1N73 B;  1VQK P;  1GL2 A;  4N78 E;  1ZLL A;  5AW5 B;  3USS A;  1FBM A;  3D6Y A;  1N8R Q;  1G1J A;  5GTH E;  1HGV A;  3KYQ A;  5AVZ B;  1VQO P;  1N7S A;  1NKN A;  1IC2 A;  3A2A A;  4WY4 D;  2YIU B;  1ZRT D;  5BU8 B;  5M1B A;  4XA4 A;  3L72 E;  3L75 G;  3M0D C;  4U3F G;  3WU2 E;  3T97 B;  1FJP A;  1MZ9 A;  4GOD A;  1RF1 A;  3BAT A;  2XKM A;  4IFD K;  3CX5 I;  3V2Q A;  1DX7 A;  1RE4 C;  5KAF H;  1NU1 E;  5AVR B;  1KYO I;  1SQX D;  3S9O A;  1BDD A;  3CC4 P;  1OVU A;  1QL2 A;  3A5T A;  1G2C B;  3U1C A;  2LXB A;  2E74 D;  4D6T D;  2OYI C;  1YIT P;  1L0L E;  2FYN C;  5DJT B;  2QJY B;  2AXT E;  4EI2 A;  5AVV B;  3LW5 J;  1EZV I;  1DH3 A;  1SVF A;  1SFC C;  1ZW0 A;  3O6Q B;  3OW2 O;  1Y9B A;  1PP9 G;  1VQP P;  1YYC A;  1URQ B;  1AJY A;  1SQB D;  1BE3 J;  1LWU A;  3HE5 A;  3AE9 C;  2YKP A;  3EFF K;  1ZRT E;  5KAI H;  4H13 B;  3CI9 A;  3L71 D;  2C9L Y;  1IFJ A;  1YJ9 P;  1P84 D;  2WPS A;  3CWB D;  1GK4 A;  1SQX E;  2E76 D;  1BE3 G;  1YBK A;  3W68 A;  4LC1 A;  4HYT B;  4D6T E;  3V2R A;  1T3U A;  2HOD B;  3M06 A;  3H1L J;  4GOE A;  3VP9 A;  2IYO A;  1USD A;  3WUT A;  3V6I A;  1NGM B;  1WRG A;  3GF3 A;  2J58 A;  1VQN P;  3VOP A;  2Q9I A;  3BRV B;  3K5B A;  2V4H A;  1JY3 N;  3CME P;  1AFO A;  1X22 A;  5CMZ A;  3MHV A;  1SQB E;  1U7M A;  1KQG B;  1VQ4 P;  4OGQ D;  3CCL P;  4AYC A;  1USE A;  3AEG C;  3L71 E;  4U7J A;  4XE5 B;  3HE4 A;  2Q5U A;  1P84 E;  3KPE A;  3CWB E;  3HTK B;  3F89 A;  2XU6 A;  1J1D B;  3AED C;  3AE6 C;  1NTM D;  1HJB A;  2R44 A;  1A02 J;  2CK3 H;  2FXP A;  1N7L A;  1NH4 A;  3HD7 A;  2YXR B;  4GOF A;  2FFD C;  1SQV J;  1L4A B;  1A02 F;  3A0H E;  5H2F E;  1QEX A;  5KAI E;  3P8M C;  4WB4 A;  3Q5P A;  2GM4 A;  3S4R A;  2BCC G;  1JY2 N;  1Q90 D;  1RE3 A;  4K35 A;  4EIJ A;  3D6Z A;  2E75 B;  3HRN A;  3H1K G;  3BCC D;  4H0L D;  3L73 D;  4RKU J;  3JC2 2;  2JWD A;  3FXD A;  2Z4E A;  3B5N A;  1EDK A;  4Y99 B;  3VYI A;  1N73 C;  2JKV A;  4NPE A;  1S72 P;  1BCC G;  2FFD A;  2M5A B;  1M1K Q;  2IFM A;  1NTM E;  1HUC A;  2N1T B;  4Y28 J;  2KB7 P;  4D6T G;  2QJK C;  2WVR A;  3JCU H;  2NRG A;  1N86 A;  3VP8 A;  3Q2Y A;  2IBZ G;  1LNQ A;  2JDI H;  1J2J B;  2RN0 A;  3SWF A;  3C1L A;  1KOR A;  3VMY A;  2OYH C;  1PV3 A;  1NTZ D;  2W6J H;  4M3L A;  1XTG B;  1VQ8 P;  3PH0 A;  2BEZ F;  4IL6 E;  2K9J A;  3IF4 A;  1N73 A;  4H0L C;  1SQB G;  5CCH A;  3BCC E;  3IFM A;  3L73 E;  3AEE C;  5AVS B;  2KOG A;  3TSI A;  2ITA A;  3L71 G;  3G6E P;  1EDI A;  2KSJ A;  1K73 Q;  2CPB A;  2UWJ E;  1JCC A;  4HJG H;  3ZDM A;  3BAS A;  3AEF C;  3TGU J;  3P8C D;  3U59 A;  5KJ7 A;  4YXD C;  1OMI A;  1LT1 A;  3MD0 A;  3LID A;  1NAY A;  3T97 A;  2G8Y A;  3L74 D;  3H1H J;  1URQ C;  2YNY A;  4IL6 X;  2QJP B;  2BAS A;  3PJS K;  3KQG A;  1JY3 O;  4DCK A;  1KIL D;  2IDB A;  5KLI C;  5AW1 B;  1EDJ A;  1M1J C;  3CCE P;  1AVY A;  1G2C A;  4UB6 H;  1K8A Q;  1NTZ E;  2WMM A;  4WY4 B;  4MN4 C;  3M91 A;  2HPC B;  1CI6 B;  1JOC A;  1SQQ J;  2W6B A;  4WWI A;  1SQP D;  4N3Y B;  3MZW B;  3H1H G;  2AEM A;  2D2C D;  2WT7 B;  2R3C A;  1QL1 A;  1IK7 A;  3N4X A;  3AE2 C;  3O6Q A;  3L70 J;  1LTT C;  1H89 A;  1HBW A;  2WPV B;  1URQ A;  3PTZ A;  3VMA A;  3P8C E;  5KKZ B;  3RL0 D;  1LTJ B;  3G4S P;  3D71 A;  3H6P A;  1GTW A;  3L74 E;  1MFZ A;  5B5E H;  2R32 A;  1KQF B;  3R2P A;  3M9B A;  1KIL E;  2AEJ A;  2O1K A;  1H88 A;  3RK3 D;  5KLV J;  2L5G B;  3RK2 C;  3RBX A;  2RH0 A;  2OTK E;  2HOD A;  1OFC X;  2Z5H A;  2QIW A;  1SQP E;  4B86 A;  1KB9 H;  3Q5R A;  4UB8 E;  1M56 D;  1QX8 A;  1JTH B;  1GL2 C;  5AVU B;  4RJT A;  1EZV D;  2E76 B;  3W67 A;  2M3E A;  2XND H;  3CCU P;  1ZR2 A;  1LP1 B;  2QM7 A;  3G71 P;  1FDO A;  2P1J A;  3N7N A;  1FC2 C;  3CLQ A;  1N7S C;  4C46 A;  1NKZ B;  3H1L D;  1KB9 D;  3H1J D;  1GW3 A;  3HTK A;  2W8Z A;  4PJ0 H;  1RF1 C;  3RK3 C;  2QG4 A;  3H1I D;  3TDK A;  1RY3 A;  4W7Z A;  3RK3 E;  1FJK A;  3GLM A;  4I7Z C;  1EXI A;  4Y99 C;  2W6A A;  1VQ7 P;  3UIA A;  3CCM P;  4AUW A;  3L75 J;  2KI7 B;  3PHL A;  4U3F J;  4OGQ B;  5EFW B;  4JBZ A;  1L4A A;  2LXC B;  2IZ0 A;  4NPF X;  1G1I A;  1SFC D;  3WUU A;  4BRY B;  1X79 B;  2P58 A;  1KD1 Q;  3I5C A;  3AEC C;  1X0T A;  1KFM A;  3HUS B;  2ZT9 B;  1SQQ K;  1HWT C;  2FYU G;  2FYZ A;  4XFJ A;  1OVR A;  4YPC A;  3C9I A;  1YTZ I;  1PPJ G;  1EZV E;  3KZI E;  4BWN A;  1BGY D;  1NVO A;  1VQM P;  1IFD A;  1N2D C;  2O01 J;  1ZP0 C;  1L0N E;  1T2K C;  1HVV A;  4DJG A;  1OX3 A;  4H44 B;  1GDT A;  2ZYA A;  1LWU C;  2PGD A;  1SQV D;  3H1L E;  5TIS E;  1KC8 Q;  1PP9 J;  1FOS E;  1KB9 E;  3H1J E;  4KHX A;  5C39 A;  2M5A A;  1OIP A;  4WBA A;  3H1I E;  1UII A;  2N1T A;  5AW3 B;  3OA7 A;  3EQ2 A;  5KTB A;  5AVX B;  1YIJ P;  4GT1 A;  1SQP G;  2I1K A;  1M7L A;  5AW9 B;  3GW6 A;  1IFN A;  4R4L A;  5KLV K;  5CHX A;  2A45 G;  2GUV A;  3NMD A;  3HD7 D;  1NYH A;  5CCG A;  1FZE A;  4L76 A;  3OJA B;  1GW4 A;  2P7J A;  1BGY E;  4ZKU A;  2M3B A;  1KB9 I;  1QLE D;  2B9B A;  2E5T A;  1NJI Q;  3TF5 A;  3MP7 B;  2QSI A;  1SQV E;  1MKM A;  3NFQ A;  2NPS A;  2R5B A;  3RL0 g;  5APS A;  3EWK A;  2JR8 A;  5B66 H;  2KUB A;  3GHG B;  4RES B;  1E79 H;  4JF7 A;  4L74 A;  1H8A A;  2FYU K;  1LTJ C;  1HGZ A;  2G3A A;  3E1I A;  2HR3 A;  3HD7 C;  1T8Z A;  1IFP A;  5KAF E;  3CPW O;  4WY4 A;  1OXZ A;  1VPC A;  2HPC A;  1CI6 A;  1JMM A;  1EZV G;  4PV1 C;  4W7Y A;  2WSE J;  3L72 G;  1QVF O;  2WT7 A;  2ZFC A;  3L36 A;  5GTI H;  1L0N G;  4EYY Q;  1RE3 C;  3F5H A;  1NTK D;  2HYN A;  1NU1 G;  2HG5 D;  2IZ1 A;  1RQU A;  1EXJ A;  3VMZ A;  1KIL B;  3V4Q A;  3BVH A;  2K1A A;  2BCC J;  2QVA A;  3H1J G;  3II6 A;  2WQY C;  4HB1 A;  3B5N C;  4GDO A;  1S5L H;  1YJW P;  5AVT B;  1J1E B;  1L0L G;  1LTJ A;  3H1I G;  1AVO A;  1VF5 C;  4L75 A;  4LGD E;  3H1K J;  2D2C B;  1YJN P;  3TYY A;  5CBN A;  4KT0 J;  1X9V A;  1FZC B;  2ZXE B;  2B89 A;  1BCC J;  4BXL A;  2R5D A;  1KFN A;  3RL0 B;  1FE6 A;  2ZXX A;  5AW2 B;  1BGY G;  4D6T J;  5AW0 B;  1RF0 A;  3AE7 C;  3MGN A;  3A0B H;  2QA4 P;  4IFM A;  1NTK E;  2J5U A;  1JTH A;  5CCH C;  1SQX G;  2WSC J;  1H0T B;  1Q81 Q;  3G3Z A;  1Z56 A;  2JEE A;  2POH A;  5KLV D;  2K37 A;  2K88 A;  1YI2 P;  1LP1 A;  1NAF A;  2NZ2 A;  2ZT9 C;  1SQB J;  2R3S A;  1R5S A;  2ZVN B;  3H32 B;  1URQ D;  5KJ7 C;  2WTY A;  2A06 D;  2OYO A;  2YIU C;  1EQ7 A;  4AQR D;  3L71 J;  2XV5 A;  5AW6 B;  5GTI E;  1KN7 A;  1CSB A;  5APT A;  3CCQ P;  2ZAE B;  1LJ2 A;  1JB0 J;  2H89 C;  2JJL A;  1NU1 K;  4BRY A;  1YHQ P;  2I1J A;  2OYH B;  5AW4 B;  3SWK A;  3HUS A;  3GMA A;  2WWW A;  3CWB G;  2QJY C;  2NPS B;  2Y0E A;  4OVN F;  1L0L K;  4ZKP A;  2O01 H;  2FYN B;  4C7N B;  2IX7 C;  2CPS A;  3LIE A;  5K5G B;  1DIP A;  1GZL A;  4N6J A;  3Q5S A;  3B4S A;  1ZOY C;  2Q3I A;  2C9N Y;  1SFC B;  2A06 E;  2YXQ B;  3R4Y A;  4H13 C;  1JNM A;  1EDL A;  3CD6 P;  2N9B A;  3RK2 D;  3CCJ P;  3A0B E;  2VRS A;  2O01 N;  3VTP C;  1FS0 E;  5BU5 A;  3AE8 C;  4K3A A;  3MTU E;  1AV1 A;  2FKW B;  3CC2 P;  2RKL A;  5APV A;  1Q82 Q;  2Y0D A;  1SQX K;  3JCU E;  1X8Y A;  1GL2 D;  1OW6 A;  1LT9 B;  3IN6 A;  1NTK G;  4OWF A;  5CBO A;  4TT3 H;  1PP9 D;  3QWO C;  2E74 B;  1GK6 A;  4R4M A;  1NTM G;  1VQL P;  2I8D A;  4O9B A;  3MUD A;  1N7S D;  1S9K D;  1DD3 A;  3BCC J;  3L73 J;  3E7K A;  1LGH B;  2IYP A;  2M0B A;  3U1A A;  2FXM A;  2ZYG A;  2IPP A;  3ABV C;  3V2N A;  4DOJ A;  2FBW C;  5AVY B;  1OZH A;  3EFG A;  1SQB K;  2KK7 A;  2KZI A;  1XTC C;  1JO5 A;  3FWL A;  1BE3 D;  3M9Q A;  1PIX A;  3GHG A;  1J1D C;  3BCC G;  3L73 G;  1QVG O;  2KSE A;  1JCD A;  2KZJ A;  1GD2 E;  1DD4 A;  1T6A A;  2OTJ P;  2WZ7 A;  5E79 H;  1L4A C;  1D7M A;  2FY8 A;  4HH2 A;  4JYB A;  2WSE H;  1PP9 E;  2AXC A;  1NTZ J;  1T2K D;  1SS1 A;  4UB6 E;  2Q7C A;  2AXT H;  2Q1K A;  1S9K E;  4I6M C;  2E75 C;  1GU5 A;  1KIL A;  3VMX A;  4YTP C;  1AQT A;  2FYU J;  1NTZ G;  3RGU A;  2KNC B;  4A7P A;  1TU3 F;  1K9M Q;  5APU A;  1BE3 E;  3Q1M A;  1CW5 A;  2Y9Z A;  4JPZ B;  2ZJS E;  2N1T C;  2P2U A;  2PP6 A;  2W90 A;  5CJ0 A;  2YO3 A;  1FZC A;  1KMI Z;  1M8O B;  4IFF A;  4ZMD A;  1JY2 P;  1S2E A;  1NTM K;  3H25 A;  5APW A;  5B5E E;  2BCC D;  5APX A;  2YO2 A;  4I2L C;  3AEB C;  2QJK B;  5CCG C;  1FDM A;  3SFD C;  4JYC A;  5AW7 B;  1SQP J;  2E5Y A;  2C0W A;  3H1K D;  5BVZ A;  3L74 G;  1BDC A;  2OGU A;  2K9Y A;  5CJ4 A;  1Y47 A;  2BEQ D; 
#chains in the Genus database with same CATH homology
 5KKZ C;  1HF9 A;  2FXP A;  4PV1 B;  2H88 C;  2WSF J;  3D6Y A;  2WPV B;  2BEZ F;  2NZ2 A;  4R4L A;  3AE8 C;  2ZT9 C;  1U57 A;  3Q3D A;  4H0L C;  1K04 A;  1GMJ A;  1NYH A;  2YIU C;  1RQU A;  1EXJ A;  3GF7 A;  3RK3 E;  3AEE C;  3GLM A;  4I7Z C;  2JP3 A;  1EXI A;  3D71 A;  1ZME C;  4OGQ C;  2MKV A;  4H0L B;  3AEA C;  3Q5P A;  2WQY C;  3G9R A;  4I7Z B;  2E76 D;  1S5L X;  2OQQ A;  5M1B A;  4GDO A;  4OGQ B;  1OW6 A;  2E75 C;  2D2C C;  3IN6 A;  1KTM A;  1Q90 D;  5L8R J;  3AE5 C;  3T97 B;  1VF5 C;  1KQF B;  2V7Q J;  3AEF C;  4TT3 H;  3D6Z A;  2E74 B;  2E75 B;  2D2C B;  4YTP C;  3AEC C;  2P10 A;  4YXD C;  1KIL E;  1VF5 B;  4H0L D;  1K05 A;  4R4M A;  1OMI A;  2ZT9 B;  4RKU J;  1JB0 J;  2QSI A;  2H89 C;  3S9O A;  1MKM A;  4KT0 J;  4XFJ A;  1NGM B;  4H13 D;  3GF3 A;  1TU3 F;  1S1C X;  1YQ4 C;  2G8Y A;  3RL0 g;  2QJP C;  1VL2 A;  1FDI A;  1RQV A;  1DD3 A;  4PV1 D;  3SFE C;  2YMK A;  3EWK A;  2QIW A;  3Q1M A;  2O01 J;  3GMA A;  1ZP0 C;  2E74 D;  4H44 C;  4IL6 X;  3Q5R A;  2QJY C;  1OW7 A;  1PL5 A;  3B71 A;  2FYN C;  3IAO A;  2ZT9 D;  1WMK A;  1YQ3 C;  4H44 B;  2IDB A;  3AE1 C;  3ABV C;  5KLI C;  3C8V A;  1UIX A;  1KMI Z;  2E76 C;  2FBW C;  3AE4 C;  1KQG B;  1R8E A;  3D70 A;  3LW5 J;  1DIP A;  4OGQ D;  1HJ0 A;  3AE7 C;  4Y28 J;  3H25 A;  3AEG C;  2QJK C;  2E76 B;  2JO1 A;  4U7J A;  3Q5S A;  1Y9B A;  2G3A A;  1ZOY C;  1PIX A;  4Z1M H;  2E75 D;  2D2C D;  3AEB C;  3AE3 C;  3Q2Y A;  1OW8 A;  4H44 D;  2J5U A;  1VF5 D;  1FDO A;  3SFD C;  3FGA D;  3R4Y A;  4H13 C;  1IK7 A;  2WSC J;  3AED C;  1AJY A;  1KOR A;  3AE6 C;  1PV3 A;  3AE2 C;  3O6Q A;  1DD4 A;  4PV1 C;  2WSE J;  3AE9 C;  1ZRT E;  2K9Y A;  4H13 B;  2E74 C;  2BEQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...