1S1CX

Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Interaction of ROCKI with the Switch Regions of RhoA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein RhoA
total genus 26
structure length 69
sequence length 69
chains with identical sequence Y
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF08912 Rho_Binding Rho Binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s1cX00
1UIXA 1S1CX 3FGAD 1PL5A 1NYHA 1TU3F
chains in the Genus database with same CATH superfamily
2KLVA 4LLHA 1EZVE 1PPJG 1EDIA 1OWAA 1NTZG 1SQQJ 1X9VA 1VQ6P 1SQPJ 3RL0g 3SSUA 1EQ7A 4H13D 1G1JA 3QWOC 2KNCB 1KB9I 2D2CD 1VL2A 3VP8A 3M9BA 4PV1D 1KYOI 1RF1B 3GHGA 1W2EA 3I5CA 1Q7YQ 1DEBA 4PD4D 3HE5B 3B5NB 3OAKA 3PLNA 2QEXP 1HJBA 3HD7B 1FS0E 2PRRA 2WT7A 4K35A 2JDIH 3CMEP 4Y99B 1X22A 3B71A 1L0NJ 1HF9A 1NOHA 2WZ7A 2J58A 1H0TA 5GTHH 2V7QJ 1PZQA 1KILD 2QIWA 3AE3C 3FX0A 5AW6B 1JMMA 1AQ5A 3OA7A 2P10A 2C9NY 2FY8A 1EDLA 1FZAA 1CW5A 1GL2D 2HODB 3H32B 3NXSA 3H1IG 4N78D 1Y47A 4OGQB 5AVTB 4KJMA 1N7SB 5CJ0A 1IO4A 1LT9C 1SQBE 3CCSP 2WSSH 2ZVNB 2FYUE 3AEAC 1GK4A 3BCCD 3H1JD 5AW2B 3D71A 4I7ZB 4W7ZA 1YJWP 2XKMA 3A2AA 4H0LD 5KAFE 2HYNA 1JNMA 1CSBA 1FBMA 4PV1C 3V2RA 1H88A 3WUTA 3EFGA 3M91A 2L91A 2RMZA 4YTPC 3NMDA 2E75D 1LTBC 1NU1K 3IF4A 4L76A 2RH0A 4N3YB 5AVXB 3L71E 1OVRA 4R4MA 1SQPD 2W8ZA 2IBZD 1EZVG 1RH5B 3BVHA 2OYHA 1X0TA 5KLVD 1N73B 1ZMEC 3UIAA 2K3RA 2GUVA 5KLVK 1LTJC 3N7NA 1LTJA 2IFNA 3L71G 1J1EB 1JMBA 1SQXG 1ZXGA 2XDJA 3AEDC 1G1IA 1PPJE 5AW9B 1FJPA 3Q1MA 1FC2C 4L74A 1S72P 3CX5H 1RE4A 4W80A 3G6EP 1GU5A 1SQXK 3CWBE 3H25A 2H7HA 1D7MA 1HGZA 1BSHA 5KKZB 2K9JA 1FDMA 2OYIA 2M3EA 2ZYGA 3H1JG 4H0LC 3GLMA 3KZIH 1N73A 1NTKE 2HR3A 5CCGA 3LW5J 2KSJA 1OXZA 2R5BA 3V2PA 1LP1B 4C7NA 4D6TD 3S4RA 5AVVB 2NPSA 3NFQA 3CCMP 2PAJA 1PGQA 2ZT9D 3BASA 5APVA 1JY2N 3MP7B 1BGYE 2WPSA 5APUA 1S9KD 2FFDA 1FZCA 2ZYAA 2IYOA 2HODA 3H32A 3H1HG 1SQVG 4XFJA 1NGMB 3CC7P 1OIPA 3C9IA 3AEBC 4H0LB 1N7SA 1NAFA 1WT6A 4RESB 1PP9E 2KZJA 3H1HD 3S1KA 1NTME 3CX5E 1IFDA 1N7LA 2NRGA 4GT1A 5M1BA 4GDOA 1NTMD 1YBKA 2NZ2A 3CX5D 3E1RA 1P84D 1NTMK 2WSEH 4OVNF 1OX3A 4PJ0E 3WU2E 3L36A 1J2JB 3H1KG 2HPCA 2A06G 1U7MA 1SQBJ 1TU3F 2PP6A 2YXRB 2B9BA 3L73G 2FXPA 3L75E 3O8ZA 1JTHB 3R2PA 4H44D 1KYOH 4D6TG 1JCCA 2IFMA 4WY4A 1L4AC 1GZLA 2BASA 1MUUA 1DH3A 3BRTB 2WQYC 3FXDA 3WUUA 3BCCG 3OW2O 1MZ9A 5BVZA 1L0LK 3CWBG 2N1TD 3BCCJ 2ZYDA 3V2QA 3PTZA 1UIIA 1S3JA 5AVRB 1M7LA 5CCGD 1LNQA 2O01N 3TDKA 2O01H 2N9YB 2OTJP 1GD2E 4JF7A 1BDCA 2D2CB 3I56P 3MHVA 1AVOA 3HUSC 3T97A 4B86A 1ZOYC 3TGUG 3L73J 1LWUC 1ZLLA 3HUSA 2FYNC 1URQB 3L72D 1R5LA 5B66H 2XZRA 1VQMP 2QRXA 1DIPA 1KILC 2K9JB 2R3SA 2DW3A 3L72G 2ZVOB 3SFEC 2OTKE 1K8AQ 2E43A 1K04A 5BU5A 2B87A 3GG2A 2MJZA 1LTIC 1ZR2A 2P1JA 2E5YA 5AW5B 1P84H 3RK3B 2POHA 1YI2P 1X8YA 1LGHB 4GOEA 3L70J 1YTZT 3WMM0 1S5LX 3KHUA 1LP1A 4C7NB 3CXHE 1G2CB 1N2DC 3L72E 4I2LC 4WY4C 2J5UA 3PJSK 2IBZE 1SQVK 1SQPE 2V4HA 2YXQB 4OGQD 1VQLP 1SQVD 1VQOP 2FFDB 3PHLA 1SQQD 2WSCH 2IX7C 3U1AA 1NWQA 1FZCB 1R5SA 1S5LE 1LT1A 2R44A 4DCKA 2KYVA 2E75C 2ZXEB 3CI9A 5AW8B 1KZUB 5KAIH 4U7JA 1S4XA 3AEEC 3CXHI 1NTMG 1JY3N 2XV5A 2Y9YA 4RJTA 2YKQA 3F5HA 1YHQP 1E5WA 5L8RJ 1RF1C 1Q86Q 2ZT9C 2KB7P 2RN0A 5KAFH 3C1LA 2MKVA 2K9YA 3B5NC 4GODA 1URQC 2KXPB 1NU1E 1LTAC 3CX5I 2FKWB 2WWWA 2JWDA 2QJPC 3SWFA 2HPCB 2FFDC 1Q2NA 1PP9J 4PJ0H 4PV1B 1VQ8P 1KQFB 1OW8A 1BE3E 1ZRTE 1T3JA 1YYCA 2FXMA 2QM8A 3KPEA 1GDTA 1MFTA 3LIDA 1J1DC 5KLVE 1GW4A 1KILE 1VQKP 4ZNCA 1L0LD 1VDFA 3ABVC 1LT9A 5APSA 1ZP0C 5AW1B 3RGUA 1QLED 3U1CA 1GTWA 1L0ND 2O3JA 2N9BA 3G71P 3LIEA 1DX7A 1QL2A 2BEQD 5DJUB 3V6IA 1KILB 2M5AA 3KZIE 3L74G 1BGYD 1IJDB 3Q2YA 3IR9A 1WRGA 1CZQA 2RKLA 1BSNA 5AVSB 1L4AA 2E74C 3EQ2A 3L74D 4NPDA 4TLFA 1NH4A 2JJLA 2FYZA 1E79H 2JWAA 2YKOA 3HE4A 3N4XA 2KUBA 3TNUA 4D6TE 4DJGA 4EDFA 4EI2A 1QVFO 1RF1A 1NTKD 2C0XA 2FBWC 2YO3A 3GHGB 3MD0A 1NTKK 4K3AA 5E79H 1SQBK 1ZN5A 1URQD 2HFED 3B5NA 3JSVC 1BE3J 1M57D 4YPCA 2BCCJ 3HD7A 5TISE 3A0BE 1KB9E 1LTGC 2W90A 2WT7B 3HD7C 5KTBA 3D70A 2I1JA 1DEEG 2M0BA 3H1IJ 3Q5SA 1BCCG 2E75B 1FOSE 5KJ7D 2IBZI 3A0BH 4R4LA 2W6AA 3M0DC 3AE7C 4O9BA 3L4FA 5EFWB 3FGAD 3JCUE 1BE3D 5H2FE 4Z1MH 1OW6A 1FZFA 1BCCJ 4W7YA 1PGJA 2JR8A 1OMIA 1AFOA 1NKZB 2JP3A 3B8EB 2JEEA 2E74D 2C9LY 2JO1A 2IYPA 3TK1A 2Z4EA 1BE3G 1R8EA 3EWKA 4HB1A 2UWJE 3CCLP 5AW7B 2A45I 4QMAA 3SWYA 3Q5PA 3TGUE 1OFCX 1SFCA 1KD1Q 2B89A 1LTSC 3E7KA 1HH0A 3TGUD 1T2KD 1SQPG 4L75A 1JY2P 1SQQE 1JM0A 1NTZJ 3U59A 1U7JA 1FAVA 1L0LJ 1RF0A 2QG4A 3PP5A 1Y8AA 1H89A 1FDIA 1KQGB 3FWNA 2OYHB 1L0NK 5H2FH 1XTCC 4BRYA 4RKUJ 3CXHD 2GA1A 3BCCE 1KQSO 4KHXA 2P2UA 1X79B 2WPQA 3B5ND 5GTHE 3CMAP 1W5CE 4N78E 4IL6X 1UIXA 1LTJB 1Z56A 3BRVB 4UB8E 2KSEA 5KJ7C 1VF5C 2IBZG 4PD4H 5KLVJ 2K37A 3P8MC 5GTIH 2M8RA 1PGOA 1Q81Q 2H88C 3L75J 3H1ID 4WBAA 2FYUK 2FYUJ 3KYQA 3GF7A 2E76C 3HE4B 5CHXA 1BDDA 2AEJA 3Q5RA 2OYHC 2CPBA 1J1EC 4HKZH 3A5TA 1NU1J 3CCQP 1RF0C 3KXDA 4OH8B 2Y9ZA 3QH9A 4WY4D 4CPGA 3H1LJ 1AA0A 2Z5HA 2Q9IA 1KQLA 5C39A 2O1JA 2QJKC 3TYYA 2WSCJ 1SP4A 1LJ2A 2FXOA 1IFIA 4DT0A 4U3FG 3V4QA 1T2KC 4KT0J 2IZ0A 2H43A 1USDA 5AW0B 3HRNA 2H89C 3V2NA 3HTKB 5CCGC 3L74E 3CCRP 1RE3A 1NAYA 1NVOA 3L73E 1BGYJ 4ZKPA 3V5BA 1JY3P 1T8ZA 3KQGA 2OGUA 4M3LA 2VRSA 1JOCA 3A0HE 1FE6A 1FZBA 1NTZE 2JKVA 1L0NE 5APXA 1ZR4A 2OTLP 2XNXA 1HVVA 2IPPA 1PFIA 2P67A 4IFMA 1GL2A 1L0LE 2KK7A 2ZFCA 3RBZA 3E1IA 3VMYA 2WSFH 2WSFJ 1PIXA 2E42A 3CC2P 2GUSA 3H1LE 1IFNA 1CI6B 4IFFA 2WSEJ 1ZRTD 3H1HE 5AVYB 1PP9D 1NU1G 4UB8H 1FZGA 1JO5A 4AUWA 2QA4P 2QVAA 2FYUG 3F89A 1NU1D 3L75G 1HGVA 1JTHA 4EIJA 5CBNA 2QSIA 2R5DA 2W6JH 4WY4B 1S5LH 3RL0D 1VQ7P 1M8OB 5KLVG 1PL5A 3CCEP 1NTKG 2Y0CA 2ZJSE 4GIFA 2IZ1A 1SQPK 4GOFA 2KP8A 4BRYB 3CD6P 3D6YA 1IZNB 1FZEA 4L73A 2XNDH 1XTGB 2WPVB 4H44C 4DZOA 5CJ4A 1JY3O 3CCVP 5AVWB 2B88A 2SPZA 3CXHH 1VQNP 4U3FD 2KIKA 3A3YB 3EFFK 3WUVA 3IAOA 1NTKJ 1KB9H 1NJIQ 1QL1A 1L0LG 1WMKA 1QGKB 1SQVE 3LW5H 2YIUC 4YXWH 2G3AA 3T97B 4A7PA 4D6TJ 1RQUA 3HUSB 5CMZA 1SQBG 3VOPA 3CWBD 4C7RA 4ASWA 5KAIE 2KNCA 3G4SP 1Q82Q 5AVZB 2FYNB 4I6MC 5CCHC 1NTZK 1YQ3C 1AV1A 1T6AA 2V7QH 4I7ZC 2Z5IA 1PPJD 5E79E 4H13B 3HE5A 2P7JA 3MUDA 3PH0A 1AVYA 4MN4C 1S2EA 1KFMA 1FJKA 5B5EH 1A02J 4EOTA 3A7OA 2HG5D 1JEKA 1KORA 4UB6H 3HTKA 4IL6H 1LWUA 2CK3H 3L71D 3AECC 2OQQA 5AVUB 2WITA 1NYHA 1SS1A 3MUDC 2Q7CA 4H13C 3C8VA 1GU4A 4N6JA 1VQ4P 3M06A 3SWKA 1QX8A 2KS1A 2LXBA 2M3BA 4Y28J 1SLQA 2J59M 4H44B 3CCJP 2WPRA 3ITKA 4U3FJ 1N8RQ 1HUCA 1GL2B 1RY3A 1SVFA 1T3UA 2A45G 2AEMA 1EDKA 3G9RA 3JC22 1A02F 1AQTA 2YIUB 3H1LG 3ZDMA 3VYIA 2FYUD 2BCCD 1SQBD 3L75D 2KLUA 3IN6A 1IK7A 3CPWO 3AE1C 2D2CC 1PGPA 3CLQA 4TT3H 3MIWA 5B5EE 1P84E 5KJ7A 3TF5A 1FDOA 2GM4A 1IK9A 3L74J 1M1KQ 3I55P 3L71J 1QVGO 1GL2C 1MFZA 1RHZB 3MZWB 3SFDC 2YMYA 2R32A 3L70D 2Y0DA 2KOGA 1KN7A 3P32A 3L37A 1K73Q 2XU6A 1Y9BA 2YMKA 1W2BO 1KILA 2M5AB 3VP9A 3AEGC 4PD4E 1S9KE 1YTZI 2CPSA 2L5GB 2N1TA 2QJYC 4WWIA 1SFCC 3FXEA 3USSA 1L4AB 1YIJP 4NPEA 2N1TC 1EXJA 1M1JC 1PP9G 3RL0B 4OWFA 3TNUB 1GK6A 3TSIA 1RE3C 1DD3A 1RE4C 3AE4C 5APYA 2OYIB 3O6QA 5B66E 3CL3D 1QEXA 3A0HH 1FOSF 4WB4A 2H8PD 4Y99C 3NTNA 1KYOE 5BU8B 3S9OA 1JCDA 1JY2O 4U3FE 2O1KA 3H6PA 3W67A 2LR2A 4I1LA 4XE5B 4JQ0D 2OYOA 3P8CE 5APQA 4AQRD 1KFNA 2Q6QA 4NPFX 2KZIA 1NHLA 2R3CA 3AE8C 1LWUB 3MTUE 5APTA 3FWLA 1EZVI 2NPSB 2PFXA 3G3ZA 4PD4I 3R4YA 2AXTH 1SQQK 1RQVA 2OARA 3GW6A 2QM7A 4IOIH 2Q3EA 4ZMDA 2E76D 4ASVA 1ZW0A 1HJ0A 1L0NG 2KS1B 2C0WA 3M9HA 1HBWA 1H8AA 3VTPC 2Q1KA 4JYBA 1GW3A 3L70E 1MV8A 2BCCG 1N7SC 5AVQB 1VF5D 2QJYB 1SQXE 1ZV8A 3AE5C 3RK2B 4ZKUA 1JB0J 3CCUP 1M1JB 3H1KE 1MKMA 2WMMA 1SFCB 3MGNA 1YJNP 1NTZD 1EDJA 2YO2A 3TGUJ 2ZAEB 3VMXA 2BCCE 1SQQG 3M9QA 1K9MQ 2A45H 2QE7H 5AW4B 2Y0EA 3L73D 1KC8Q 2ITAA 3D6ZA 2AXTE 4BWNA 1HWTC 1KV4A 2E76B 2A06D 2W27A 3H1JE 4LC1A 1DD4A 1IFMA 3CWBJ 3RK2C 5CCHD 1KMIZ 1S1CX 2KI7B 4HYTB 4JPZB 3GF3A 5AW3B 3Q3DA 1IC2A 2K1AA 3JCUH 2QJPB 2NPSD 5GTIE 5DJTB 1N86A 5APWA 1BCCD 3HD7D 5TISH 2N1TB 1VQ5P 1JUNA 1VQ9P 5KKZC 3PRJA 4C46A 1HTLC 1URQA 2AEFA 1P84I 1M90Q 3H1KJ 1K05A 3H1IE 3RBXA 2LXCB 1EC5A 3O6QB 1BCCE 1KTMA 3M0AA 2B87B 3AE2C 2LKMA 1GMJA 2YKPA 1N7SD 1U57A 3K5BA 1YITP 5KLIC 3VMAA 1YJ9P 1FU1A 1NTMJ 3P7KA 2K88A 1L4AD 2QJKB 4EYYQ 1LTTC 4IL6E 4XA4A 3BATA 1USEA 3IFMA 3RL0C 4HJGH 2A06E 1G2CA 1SQVJ 2E74B 3H1HJ 4HH2A 5CCHA 4JBZA 1H0TB 1AJYA 1J1DB 4AYCA 3AEFC 1EZVD 1VF5B 3RK2D 1VQPP 1BGYG 3VMZA 3AE6C 2W83C 3B4SA 3RK3C 1IFPA 4YXDC 5K5GB 3W68A 4BXLA 2I1KA 1N73C 3RK3E 3H1KD 4GKGA 1OZHA 1IFJA 1YQ4C 1OW7A 2O01J 3AE9C 3KDPB 3L70G 1SQXD 3V4WA 3H1JJ 2ZT9B 2NPSC 2BEZF 2P58A 2PGDA 1CI6A 1L2PA 2AXCA 3L72J 1M1JA 5CBOA 1FZCC 3VN0A 1OVVA 4LGDE 2OYIC 1VPCA 3WU2H 4IFDK 2W6BA 2E5TA 1M56D 4JYCA 3L35A 4RO0A 4DOJA 1EXIA 3II6A 4WVZA 2I8DA 2Q3IA 2G8YA 2HLOA 3H1LD 3GHGC 3CC4P 1SFCD 3M0DA 1SQXJ 3GMAA 3OJAB 2WVRA 1OVUA 1Q90D 2YNYA 1PV3A 2Q5UA 5KLIB 1LT9B 1NO4A 5TJHA 3P8CD 1NKNA 4OGQC 4UB6E 3RK3D 2ZXXA 1KB9D 2WTYA 1KYOD 2IDBA
chains in the Genus database with same CATH topology
1VF5C 3AEGC 2D2CB 2QJYC 1EXJA 2H88C 1ZOYC 3RL0g 2FYNC 4H13D 3GF7A 2E76C 3Q5RA 2D2CD 1VL2A 1DIPA 4PV1D 1DD3A 3AE4C 3SFEC 3O6QA 1K04A 2QJKC 2WSCJ 3S9OA 4KT0J 3B71A 1S5LX 1HF9A 2H89C 3AE8C 2J5UA 2V7QJ 2QIWA 3R4YA 4OGQD 3AE3C 1RQVA 2P10A 2E76D 1HJ0A 4OGQB 2E75C 4U7JA 3AEAC 3AEEC 3D71A 4I7ZB 5L8RJ 2WSFJ 1PIXA 1VF5D 4H0LD 2ZT9C 3AE5C 1JB0J 2MKVA 2K9YA 2WSEJ 4PV1C 1MKMA 2QJPC 4YTPC 4PV1B 2E75D 1KQFB 1OW8A 1ZRTE 2QSIA 4R4MA 1PL5A 1KILE 1ZMEC 3D6ZA 2E76B 3D6YA 3ABVC 1DD4A 2WPVB 1ZP0C 4H44C 1KMIZ 1S1CX 3GF3A 3Q3DA 2BEQD 3IAOA 3AEDC 1WMKA 3Q1MA 3Q2YA 2YIUC 2G3AA 3T97B 5KKZC 1RQUA 2E74C 3H25A 1K05A 1YQ3C 2FBWC 1KTMA 4I7ZC 3AE2C 4H13B 1GMJA 1U57A 5KLIC 4H0LC 3GLMA 3D70A 3LW5J 1KORA 2E74B 3Q5SA 2E75B 2ZT9D 4R4LA 1AJYA 3AE7C 3AEFC 3AECC 1VF5B 2OQQA 3FGAD 4Z1MH 1OW6A 3AE6C 1NYHA 4YXDC 4H13C 3C8VA 4XFJA 1NGMB 3AEBC 3RK3E 1OMIA 4H0LB 4Y28J 2JP3A 1YQ4C 3AE9C 4H44B 1OW7A 2E74D 2O01J 2JO1A 3G9RA 2ZT9B 1R8EA 2BEZF 5M1BA 4GDOA 3EWKA 2NZ2A 3Q5PA 3IN6A 1IK7A 1TU3F 3AE1C 4H44D 2D2CC 2FXPA 4TT3H 1EXIA 1FDOA 2G8YA 3GMAA 1FDIA 1KQGB 1Q90D 4RKUJ 2WQYC 1PV3A 3SFDC 4OGQC 4IL6X 1UIXA 1Y9BA 2YMKA 2IDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIX A;  1S1C X;  3FGA D;  1PL5 A;  1NYH A;  1TU3 F; 
#chains in the Genus database with same CATH topology
 2KLV A;  4LLH A;  1EZV E;  1PPJ G;  1EDI A;  1OWA A;  1NTZ G;  1SQQ J;  1X9V A;  1VQ6 P;  1SQP J;  3RL0 g;  3SSU A;  1EQ7 A;  4H13 D;  1G1J A;  3QWO C;  2KNC B;  1KB9 I;  2D2C D;  1VL2 A;  3VP8 A;  3M9B A;  4PV1 D;  1KYO I;  1RF1 B;  3GHG A;  1W2E A;  3I5C A;  1Q7Y Q;  1DEB A;  4PD4 D;  3HE5 B;  3B5N B;  3OAK A;  3PLN A;  2QEX P;  1HJB A;  3HD7 B;  1FS0 E;  2PRR A;  2WT7 A;  4K35 A;  2JDI H;  3CME P;  4Y99 B;  1X22 A;  3B71 A;  1L0N J;  1HF9 A;  1NOH A;  2WZ7 A;  2J58 A;  1H0T A;  5GTH H;  2V7Q J;  1PZQ A;  1KIL D;  2QIW A;  3AE3 C;  3FX0 A;  5AW6 B;  1JMM A;  1AQ5 A;  3OA7 A;  2P10 A;  2C9N Y;  2FY8 A;  1EDL A;  1FZA A;  1CW5 A;  1GL2 D;  2HOD B;  3H32 B;  3NXS A;  3H1I G;  4N78 D;  1Y47 A;  4OGQ B;  5AVT B;  4KJM A;  1N7S B;  5CJ0 A;  1IO4 A;  1LT9 C;  1SQB E;  3CCS P;  2WSS H;  2ZVN B;  2FYU E;  3AEA C;  1GK4 A;  3BCC D;  3H1J D;  5AW2 B;  3D71 A;  4I7Z B;  4W7Z A;  1YJW P;  2XKM A;  3A2A A;  4H0L D;  5KAF E;  2HYN A;  1JNM A;  1CSB A;  1FBM A;  4PV1 C;  3V2R A;  1H88 A;  3WUT A;  3EFG A;  3M91 A;  2L91 A;  2RMZ A;  4YTP C;  3NMD A;  2E75 D;  1LTB C;  1NU1 K;  3IF4 A;  4L76 A;  2RH0 A;  4N3Y B;  5AVX B;  3L71 E;  1OVR A;  4R4M A;  1SQP D;  2W8Z A;  2IBZ D;  1EZV G;  1RH5 B;  3BVH A;  2OYH A;  1X0T A;  5KLV D;  1N73 B;  1ZME C;  3UIA A;  2K3R A;  2GUV A;  5KLV K;  1LTJ C;  3N7N A;  1LTJ A;  2IFN A;  3L71 G;  1J1E B;  1JMB A;  1SQX G;  1ZXG A;  2XDJ A;  3AED C;  1G1I A;  1PPJ E;  5AW9 B;  1FJP A;  3Q1M A;  1FC2 C;  4L74 A;  1S72 P;  3CX5 H;  1RE4 A;  4W80 A;  3G6E P;  1GU5 A;  1SQX K;  3CWB E;  3H25 A;  2H7H A;  1D7M A;  1HGZ A;  1BSH A;  5KKZ B;  2K9J A;  1FDM A;  2OYI A;  2M3E A;  2ZYG A;  3H1J G;  4H0L C;  3GLM A;  3KZI H;  1N73 A;  1NTK E;  2HR3 A;  5CCG A;  3LW5 J;  2KSJ A;  1OXZ A;  2R5B A;  3V2P A;  1LP1 B;  4C7N A;  4D6T D;  3S4R A;  5AVV B;  2NPS A;  3NFQ A;  3CCM P;  2PAJ A;  1PGQ A;  2ZT9 D;  3BAS A;  5APV A;  1JY2 N;  3MP7 B;  1BGY E;  2WPS A;  5APU A;  1S9K D;  2FFD A;  1FZC A;  2ZYA A;  2IYO A;  2HOD A;  3H32 A;  3H1H G;  1SQV G;  4XFJ A;  1NGM B;  3CC7 P;  1OIP A;  3C9I A;  3AEB C;  4H0L B;  1N7S A;  1NAF A;  1WT6 A;  4RES B;  1PP9 E;  2KZJ A;  3H1H D;  3S1K A;  1NTM E;  3CX5 E;  1IFD A;  1N7L A;  2NRG A;  4GT1 A;  5M1B A;  4GDO A;  1NTM D;  1YBK A;  2NZ2 A;  3CX5 D;  3E1R A;  1P84 D;  1NTM K;  2WSE H;  4OVN F;  1OX3 A;  4PJ0 E;  3WU2 E;  3L36 A;  1J2J B;  3H1K G;  2HPC A;  2A06 G;  1U7M A;  1SQB J;  1TU3 F;  2PP6 A;  2YXR B;  2B9B A;  3L73 G;  2FXP A;  3L75 E;  3O8Z A;  1JTH B;  3R2P A;  4H44 D;  1KYO H;  4D6T G;  1JCC A;  2IFM A;  4WY4 A;  1L4A C;  1GZL A;  2BAS A;  1MUU A;  1DH3 A;  3BRT B;  2WQY C;  3FXD A;  3WUU A;  3BCC G;  3OW2 O;  1MZ9 A;  5BVZ A;  1L0L K;  3CWB G;  2N1T D;  3BCC J;  2ZYD A;  3V2Q A;  3PTZ A;  1UII A;  1S3J A;  5AVR B;  1M7L A;  5CCG D;  1LNQ A;  2O01 N;  3TDK A;  2O01 H;  2N9Y B;  2OTJ P;  1GD2 E;  4JF7 A;  1BDC A;  2D2C B;  3I56 P;  3MHV A;  1AVO A;  3HUS C;  3T97 A;  4B86 A;  1ZOY C;  3TGU G;  3L73 J;  1LWU C;  1ZLL A;  3HUS A;  2FYN C;  1URQ B;  3L72 D;  1R5L A;  5B66 H;  2XZR A;  1VQM P;  2QRX A;  1DIP A;  1KIL C;  2K9J B;  2R3S A;  2DW3 A;  3L72 G;  2ZVO B;  3SFE C;  2OTK E;  1K8A Q;  2E43 A;  1K04 A;  5BU5 A;  2B87 A;  3GG2 A;  2MJZ A;  1LTI C;  1ZR2 A;  2P1J A;  2E5Y A;  5AW5 B;  1P84 H;  3RK3 B;  2POH A;  1YI2 P;  1X8Y A;  1LGH B;  4GOE A;  3L70 J;  1YTZ T;  3WMM 0;  1S5L X;  3KHU A;  1LP1 A;  4C7N B;  3CXH E;  1G2C B;  1N2D C;  3L72 E;  4I2L C;  4WY4 C;  2J5U A;  3PJS K;  2IBZ E;  1SQV K;  1SQP E;  2V4H A;  2YXQ B;  4OGQ D;  1VQL P;  1SQV D;  1VQO P;  2FFD B;  3PHL A;  1SQQ D;  2WSC H;  2IX7 C;  3U1A A;  1NWQ A;  1FZC B;  1R5S A;  1S5L E;  1LT1 A;  2R44 A;  4DCK A;  2KYV A;  2E75 C;  2ZXE B;  3CI9 A;  5AW8 B;  1KZU B;  5KAI H;  4U7J A;  1S4X A;  3AEE C;  3CXH I;  1NTM G;  1JY3 N;  2XV5 A;  2Y9Y A;  4RJT A;  2YKQ A;  3F5H A;  1YHQ P;  1E5W A;  5L8R J;  1RF1 C;  1Q86 Q;  2ZT9 C;  2KB7 P;  2RN0 A;  5KAF H;  3C1L A;  2MKV A;  2K9Y A;  3B5N C;  4GOD A;  1URQ C;  2KXP B;  1NU1 E;  1LTA C;  3CX5 I;  2FKW B;  2WWW A;  2JWD A;  2QJP C;  3SWF A;  2HPC B;  2FFD C;  1Q2N A;  1PP9 J;  4PJ0 H;  4PV1 B;  1VQ8 P;  1KQF B;  1OW8 A;  1BE3 E;  1ZRT E;  1T3J A;  1YYC A;  2FXM A;  2QM8 A;  3KPE A;  1GDT A;  1MFT A;  3LID A;  1J1D C;  5KLV E;  1GW4 A;  1KIL E;  1VQK P;  4ZNC A;  1L0L D;  1VDF A;  3ABV C;  1LT9 A;  5APS A;  1ZP0 C;  5AW1 B;  3RGU A;  1QLE D;  3U1C A;  1GTW A;  1L0N D;  2O3J A;  2N9B A;  3G71 P;  3LIE A;  1DX7 A;  1QL2 A;  2BEQ D;  5DJU B;  3V6I A;  1KIL B;  2M5A A;  3KZI E;  3L74 G;  1BGY D;  1IJD B;  3Q2Y A;  3IR9 A;  1WRG A;  1CZQ A;  2RKL A;  1BSN A;  5AVS B;  1L4A A;  2E74 C;  3EQ2 A;  3L74 D;  4NPD A;  4TLF A;  1NH4 A;  2JJL A;  2FYZ A;  1E79 H;  2JWA A;  2YKO A;  3HE4 A;  3N4X A;  2KUB A;  3TNU A;  4D6T E;  4DJG A;  4EDF A;  4EI2 A;  1QVF O;  1RF1 A;  1NTK D;  2C0X A;  2FBW C;  2YO3 A;  3GHG B;  3MD0 A;  1NTK K;  4K3A A;  5E79 H;  1SQB K;  1ZN5 A;  1URQ D;  2HFE D;  3B5N A;  3JSV C;  1BE3 J;  1M57 D;  4YPC A;  2BCC J;  3HD7 A;  5TIS E;  3A0B E;  1KB9 E;  1LTG C;  2W90 A;  2WT7 B;  3HD7 C;  5KTB A;  3D70 A;  2I1J A;  1DEE G;  2M0B A;  3H1I J;  3Q5S A;  1BCC G;  2E75 B;  1FOS E;  5KJ7 D;  2IBZ I;  3A0B H;  4R4L A;  2W6A A;  3M0D C;  3AE7 C;  4O9B A;  3L4F A;  5EFW B;  3FGA D;  3JCU E;  1BE3 D;  5H2F E;  4Z1M H;  1OW6 A;  1FZF A;  1BCC J;  4W7Y A;  1PGJ A;  2JR8 A;  1OMI A;  1AFO A;  1NKZ B;  2JP3 A;  3B8E B;  2JEE A;  2E74 D;  2C9L Y;  2JO1 A;  2IYP A;  3TK1 A;  2Z4E A;  1BE3 G;  1R8E A;  3EWK A;  4HB1 A;  2UWJ E;  3CCL P;  5AW7 B;  2A45 I;  4QMA A;  3SWY A;  3Q5P A;  3TGU E;  1OFC X;  1SFC A;  1KD1 Q;  2B89 A;  1LTS C;  3E7K A;  1HH0 A;  3TGU D;  1T2K D;  1SQP G;  4L75 A;  1JY2 P;  1SQQ E;  1JM0 A;  1NTZ J;  3U59 A;  1U7J A;  1FAV A;  1L0L J;  1RF0 A;  2QG4 A;  3PP5 A;  1Y8A A;  1H89 A;  1FDI A;  1KQG B;  3FWN A;  2OYH B;  1L0N K;  5H2F H;  1XTC C;  4BRY A;  4RKU J;  3CXH D;  2GA1 A;  3BCC E;  1KQS O;  4KHX A;  2P2U A;  1X79 B;  2WPQ A;  3B5N D;  5GTH E;  3CMA P;  1W5C E;  4N78 E;  4IL6 X;  1UIX A;  1LTJ B;  1Z56 A;  3BRV B;  4UB8 E;  2KSE A;  5KJ7 C;  1VF5 C;  2IBZ G;  4PD4 H;  5KLV J;  2K37 A;  3P8M C;  5GTI H;  2M8R A;  1PGO A;  1Q81 Q;  2H88 C;  3L75 J;  3H1I D;  4WBA A;  2FYU K;  2FYU J;  3KYQ A;  3GF7 A;  2E76 C;  3HE4 B;  5CHX A;  1BDD A;  2AEJ A;  3Q5R A;  2OYH C;  2CPB A;  1J1E C;  4HKZ H;  3A5T A;  1NU1 J;  3CCQ P;  1RF0 C;  3KXD A;  4OH8 B;  2Y9Z A;  3QH9 A;  4WY4 D;  4CPG A;  3H1L J;  1AA0 A;  2Z5H A;  2Q9I A;  1KQL A;  5C39 A;  2O1J A;  2QJK C;  3TYY A;  2WSC J;  1SP4 A;  1LJ2 A;  2FXO A;  1IFI A;  4DT0 A;  4U3F G;  3V4Q A;  1T2K C;  4KT0 J;  2IZ0 A;  2H43 A;  1USD A;  5AW0 B;  3HRN A;  2H89 C;  3V2N A;  3HTK B;  5CCG C;  3L74 E;  3CCR P;  1RE3 A;  1NAY A;  1NVO A;  3L73 E;  1BGY J;  4ZKP A;  3V5B A;  1JY3 P;  1T8Z A;  3KQG A;  2OGU A;  4M3L A;  2VRS A;  1JOC A;  3A0H E;  1FE6 A;  1FZB A;  1NTZ E;  2JKV A;  1L0N E;  5APX A;  1ZR4 A;  2OTL P;  2XNX A;  1HVV A;  2IPP A;  1PFI A;  2P67 A;  4IFM A;  1GL2 A;  1L0L E;  2KK7 A;  2ZFC A;  3RBZ A;  3E1I A;  3VMY A;  2WSF H;  2WSF J;  1PIX A;  2E42 A;  3CC2 P;  2GUS A;  3H1L E;  1IFN A;  1CI6 B;  4IFF A;  2WSE J;  1ZRT D;  3H1H E;  5AVY B;  1PP9 D;  1NU1 G;  4UB8 H;  1FZG A;  1JO5 A;  4AUW A;  2QA4 P;  2QVA A;  2FYU G;  3F89 A;  1NU1 D;  3L75 G;  1HGV A;  1JTH A;  4EIJ A;  5CBN A;  2QSI A;  2R5D A;  2W6J H;  4WY4 B;  1S5L H;  3RL0 D;  1VQ7 P;  1M8O B;  5KLV G;  1PL5 A;  3CCE P;  1NTK G;  2Y0C A;  2ZJS E;  4GIF A;  2IZ1 A;  1SQP K;  4GOF A;  2KP8 A;  4BRY B;  3CD6 P;  3D6Y A;  1IZN B;  1FZE A;  4L73 A;  2XND H;  1XTG B;  2WPV B;  4H44 C;  4DZO A;  5CJ4 A;  1JY3 O;  3CCV P;  5AVW B;  2B88 A;  2SPZ A;  3CXH H;  1VQN P;  4U3F D;  2KIK A;  3A3Y B;  3EFF K;  3WUV A;  3IAO A;  1NTK J;  1KB9 H;  1NJI Q;  1QL1 A;  1L0L G;  1WMK A;  1QGK B;  1SQV E;  3LW5 H;  2YIU C;  4YXW H;  2G3A A;  3T97 B;  4A7P A;  4D6T J;  1RQU A;  3HUS B;  5CMZ A;  1SQB G;  3VOP A;  3CWB D;  4C7R A;  4ASW A;  5KAI E;  2KNC A;  3G4S P;  1Q82 Q;  5AVZ B;  2FYN B;  4I6M C;  5CCH C;  1NTZ K;  1YQ3 C;  1AV1 A;  1T6A A;  2V7Q H;  4I7Z C;  2Z5I A;  1PPJ D;  5E79 E;  4H13 B;  3HE5 A;  2P7J A;  3MUD A;  3PH0 A;  1AVY A;  4MN4 C;  1S2E A;  1KFM A;  1FJK A;  5B5E H;  1A02 J;  4EOT A;  3A7O A;  2HG5 D;  1JEK A;  1KOR A;  4UB6 H;  3HTK A;  4IL6 H;  1LWU A;  2CK3 H;  3L71 D;  3AEC C;  2OQQ A;  5AVU B;  2WIT A;  1NYH A;  1SS1 A;  3MUD C;  2Q7C A;  4H13 C;  3C8V A;  1GU4 A;  4N6J A;  1VQ4 P;  3M06 A;  3SWK A;  1QX8 A;  2KS1 A;  2LXB A;  2M3B A;  4Y28 J;  1SLQ A;  2J59 M;  4H44 B;  3CCJ P;  2WPR A;  3ITK A;  4U3F J;  1N8R Q;  1HUC A;  1GL2 B;  1RY3 A;  1SVF A;  1T3U A;  2A45 G;  2AEM A;  1EDK A;  3G9R A;  3JC2 2;  1A02 F;  1AQT A;  2YIU B;  3H1L G;  3ZDM A;  3VYI A;  2FYU D;  2BCC D;  1SQB D;  3L75 D;  2KLU A;  3IN6 A;  1IK7 A;  3CPW O;  3AE1 C;  2D2C C;  1PGP A;  3CLQ A;  4TT3 H;  3MIW A;  5B5E E;  1P84 E;  5KJ7 A;  3TF5 A;  1FDO A;  2GM4 A;  1IK9 A;  3L74 J;  1M1K Q;  3I55 P;  3L71 J;  1QVG O;  1GL2 C;  1MFZ A;  1RHZ B;  3MZW B;  3SFD C;  2YMY A;  2R32 A;  3L70 D;  2Y0D A;  2KOG A;  1KN7 A;  3P32 A;  3L37 A;  1K73 Q;  2XU6 A;  1Y9B A;  2YMK A;  1W2B O;  1KIL A;  2M5A B;  3VP9 A;  3AEG C;  4PD4 E;  1S9K E;  1YTZ I;  2CPS A;  2L5G B;  2N1T A;  2QJY C;  4WWI A;  1SFC C;  3FXE A;  3USS A;  1L4A B;  1YIJ P;  4NPE A;  2N1T C;  1EXJ A;  1M1J C;  1PP9 G;  3RL0 B;  4OWF A;  3TNU B;  1GK6 A;  3TSI A;  1RE3 C;  1DD3 A;  1RE4 C;  3AE4 C;  5APY A;  2OYI B;  3O6Q A;  5B66 E;  3CL3 D;  1QEX A;  3A0H H;  1FOS F;  4WB4 A;  2H8P D;  4Y99 C;  3NTN A;  1KYO E;  5BU8 B;  3S9O A;  1JCD A;  1JY2 O;  4U3F E;  2O1K A;  3H6P A;  3W67 A;  2LR2 A;  4I1L A;  4XE5 B;  4JQ0 D;  2OYO A;  3P8C E;  5APQ A;  4AQR D;  1KFN A;  2Q6Q A;  4NPF X;  2KZI A;  1NHL A;  2R3C A;  3AE8 C;  1LWU B;  3MTU E;  5APT A;  3FWL A;  1EZV I;  2NPS B;  2PFX A;  3G3Z A;  4PD4 I;  3R4Y A;  2AXT H;  1SQQ K;  1RQV A;  2OAR A;  3GW6 A;  2QM7 A;  4IOI H;  2Q3E A;  4ZMD A;  2E76 D;  4ASV A;  1ZW0 A;  1HJ0 A;  1L0N G;  2KS1 B;  2C0W A;  3M9H A;  1HBW A;  1H8A A;  3VTP C;  2Q1K A;  4JYB A;  1GW3 A;  3L70 E;  1MV8 A;  2BCC G;  1N7S C;  5AVQ B;  1VF5 D;  2QJY B;  1SQX E;  1ZV8 A;  3AE5 C;  3RK2 B;  4ZKU A;  1JB0 J;  3CCU P;  1M1J B;  3H1K E;  1MKM A;  2WMM A;  1SFC B;  3MGN A;  1YJN P;  1NTZ D;  1EDJ A;  2YO2 A;  3TGU J;  2ZAE B;  3VMX A;  2BCC E;  1SQQ G;  3M9Q A;  1K9M Q;  2A45 H;  2QE7 H;  5AW4 B;  2Y0E A;  3L73 D;  1KC8 Q;  2ITA A;  3D6Z A;  2AXT E;  4BWN A;  1HWT C;  1KV4 A;  2E76 B;  2A06 D;  2W27 A;  3H1J E;  4LC1 A;  1DD4 A;  1IFM A;  3CWB J;  3RK2 C;  5CCH D;  1KMI Z;  1S1C X;  2KI7 B;  4HYT B;  4JPZ B;  3GF3 A;  5AW3 B;  3Q3D A;  1IC2 A;  2K1A A;  3JCU H;  2QJP B;  2NPS D;  5GTI E;  5DJT B;  1N86 A;  5APW A;  1BCC D;  3HD7 D;  5TIS H;  2N1T B;  1VQ5 P;  1JUN A;  1VQ9 P;  5KKZ C;  3PRJ A;  4C46 A;  1HTL C;  1URQ A;  2AEF A;  1P84 I;  1M90 Q;  3H1K J;  1K05 A;  3H1I E;  3RBX A;  2LXC B;  1EC5 A;  3O6Q B;  1BCC E;  1KTM A;  3M0A A;  2B87 B;  3AE2 C;  2LKM A;  1GMJ A;  2YKP A;  1N7S D;  1U57 A;  3K5B A;  1YIT P;  5KLI C;  3VMA A;  1YJ9 P;  1FU1 A;  1NTM J;  3P7K A;  2K88 A;  1L4A D;  2QJK B;  4EYY Q;  1LTT C;  4IL6 E;  4XA4 A;  3BAT A;  1USE A;  3IFM A;  3RL0 C;  4HJG H;  2A06 E;  1G2C A;  1SQV J;  2E74 B;  3H1H J;  4HH2 A;  5CCH A;  4JBZ A;  1H0T B;  1AJY A;  1J1D B;  4AYC A;  3AEF C;  1EZV D;  1VF5 B;  3RK2 D;  1VQP P;  1BGY G;  3VMZ A;  3AE6 C;  2W83 C;  3B4S A;  3RK3 C;  1IFP A;  4YXD C;  5K5G B;  3W68 A;  4BXL A;  2I1K A;  1N73 C;  3RK3 E;  3H1K D;  4GKG A;  1OZH A;  1IFJ A;  1YQ4 C;  1OW7 A;  2O01 J;  3AE9 C;  3KDP B;  3L70 G;  1SQX D;  3V4W A;  3H1J J;  2ZT9 B;  2NPS C;  2BEZ F;  2P58 A;  2PGD A;  1CI6 A;  1L2P A;  2AXC A;  3L72 J;  1M1J A;  5CBO A;  1FZC C;  3VN0 A;  1OVV A;  4LGD E;  2OYI C;  1VPC A;  3WU2 H;  4IFD K;  2W6B A;  2E5T A;  1M56 D;  4JYC A;  3L35 A;  4RO0 A;  4DOJ A;  1EXI A;  3II6 A;  4WVZ A;  2I8D A;  2Q3I A;  2G8Y A;  2HLO A;  3H1L D;  3GHG C;  3CC4 P;  1SFC D;  3M0D A;  1SQX J;  3GMA A;  3OJA B;  2WVR A;  1OVU A;  1Q90 D;  2YNY A;  1PV3 A;  2Q5U A;  5KLI B;  1LT9 B;  1NO4 A;  5TJH A;  3P8C D;  1NKN A;  4OGQ C;  4UB6 E;  3RK3 D;  2ZXX A;  1KB9 D;  2WTY A;  1KYO D;  2IDB A; 
#chains in the Genus database with same CATH homology
 1VF5 C;  3AEG C;  2D2C B;  2QJY C;  1EXJ A;  2H88 C;  1ZOY C;  3RL0 g;  2FYN C;  4H13 D;  3GF7 A;  2E76 C;  3Q5R A;  2D2C D;  1VL2 A;  1DIP A;  4PV1 D;  1DD3 A;  3AE4 C;  3SFE C;  3O6Q A;  1K04 A;  2QJK C;  2WSC J;  3S9O A;  4KT0 J;  3B71 A;  1S5L X;  1HF9 A;  2H89 C;  3AE8 C;  2J5U A;  2V7Q J;  2QIW A;  3R4Y A;  4OGQ D;  3AE3 C;  1RQV A;  2P10 A;  2E76 D;  1HJ0 A;  4OGQ B;  2E75 C;  4U7J A;  3AEA C;  3AEE C;  3D71 A;  4I7Z B;  5L8R J;  2WSF J;  1PIX A;  1VF5 D;  4H0L D;  2ZT9 C;  3AE5 C;  1JB0 J;  2MKV A;  2K9Y A;  2WSE J;  4PV1 C;  1MKM A;  2QJP C;  4YTP C;  4PV1 B;  2E75 D;  1KQF B;  1OW8 A;  1ZRT E;  2QSI A;  4R4M A;  1PL5 A;  1KIL E;  1ZME C;  3D6Z A;  2E76 B;  3D6Y A;  3ABV C;  1DD4 A;  2WPV B;  1ZP0 C;  4H44 C;  1KMI Z;  1S1C X;  3GF3 A;  3Q3D A;  2BEQ D;  3IAO A;  3AED C;  1WMK A;  3Q1M A;  3Q2Y A;  2YIU C;  2G3A A;  3T97 B;  5KKZ C;  1RQU A;  2E74 C;  3H25 A;  1K05 A;  1YQ3 C;  2FBW C;  1KTM A;  4I7Z C;  3AE2 C;  4H13 B;  1GMJ A;  1U57 A;  5KLI C;  4H0L C;  3GLM A;  3D70 A;  3LW5 J;  1KOR A;  2E74 B;  3Q5S A;  2E75 B;  2ZT9 D;  4R4L A;  1AJY A;  3AE7 C;  3AEF C;  3AEC C;  1VF5 B;  2OQQ A;  3FGA D;  4Z1M H;  1OW6 A;  3AE6 C;  1NYH A;  4YXD C;  4H13 C;  3C8V A;  4XFJ A;  1NGM B;  3AEB C;  3RK3 E;  1OMI A;  4H0L B;  4Y28 J;  2JP3 A;  1YQ4 C;  3AE9 C;  4H44 B;  1OW7 A;  2E74 D;  2O01 J;  2JO1 A;  3G9R A;  2ZT9 B;  1R8E A;  2BEZ F;  5M1B A;  4GDO A;  3EWK A;  2NZ2 A;  3Q5P A;  3IN6 A;  1IK7 A;  1TU3 F;  3AE1 C;  4H44 D;  2D2C C;  2FXP A;  4TT3 H;  1EXI A;  1FDO A;  2G8Y A;  3GMA A;  1FDI A;  1KQG B;  1Q90 D;  4RKU J;  2WQY C;  1PV3 A;  3SFD C;  4OGQ C;  4IL6 X;  1UIX A;  1Y9B A;  2YMK A;  2IDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...