5AW7B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 11.3 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw7B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw7B02
2N9BA 3IR9A 3O8ZA 1HUCA 3WGVB 3M0DA 4AQRD 2WT7A 5AW7B 5AVWB 4C46A 3P7KA 4HYTB 1HJBA 2IPPA 2XU6A 1MFZA 2QM7A 2XV5A 3TNUA 1SLQA 2P7JA 1CI6A 2Z5IA 2Q7CA 4RETB 2WPSA 3V4QA 2W6AA 3VMYA 1S9KD 1H89A 1OWAA 3HE5B 5APXA 2WWWA 3A2AA 2XZRA 3MD0A 3VN0A 1H8AA 1A02J 4LC1A 3L36A 4GKGA 3V5BA 1G2CB 5APUA 3HE4A 2YO2A 5AW5B 3M9BA 4M3LA 3VTPC 3TNUB 1S9KE 5AVRB 2E43A 4C7NB 3VYIA 1FOSE 3B8EB 5AW0B 1CZQA 1NWQA 2Z5HA 1X8YA 5APTA 3V4WA 1FOSF 1GU5A 3KQGA 2JJLA 5AVVB 5AW9B 3UIAA 3VMXA 1NAFA 5AW3B 5AVUB 5AVZB 1GZLA 3A7OA 4JYCA 2Q3IA 3KDPB 2Q5UA 2R32A 5AW1B 1HWTC 3NMDA 5AW6B 2R5DA 2QM8A 3TK1A 3L37A 2WT7B 1HBWA 1GTWA 1CSBA 2C9NY 3NXSA 3P8MC 2R3CA 1A02F 3SWFA 1KQLA 1CI6B 2BASA 3A3YB 2KP8A 2C9LY 5AW8B 5APYA 3NTNA 4XE5B 2R5BA 3LIEA 4KHXA 1J2JB 5APQA 3WGUB 1T2KC 1JUNA 3L35A 2WPQA 1T2KD 3HE4B 4RESB 1DH3A 2H7HA 2WPRA 3P32A 3M06A 3HE5A 3M9HA 3VMZA 3OAKA 4EOTA 2VRSA 5AW2B 1H88A 1MV8A 3MGNA 4B86A 1IO4A 1MUUA 1FAVA 1SP4A 3M91A 1YYCA 2WTYA 3A5TA 4I2LC 4JYBA 2ZXEB 3I5CA 2YNYA 5AW4B 2P67A 2YO3A 5AVXB 4C7NA 3NFQA 3TYYA 5AVTB 5CMZA 5APVA 4AYCA 4DZOA 4I6MC 2P2UA 5AVQB 5APWA 5AVYB 1GU4A 1GK6A 3M0AA 1GK4A 5APSA 4AUWA 1JNMA 4GT1A 2ZFCA 3HTKA 1OXZA 3LIDA 2E42A 2W27A 3T97A 1GD2E 5AVSB
chains in the Genus database with same CATH superfamily
3HUSC 3SPJA 3MRBB 2XNDH 1D9KB 1VDFA 3QDGB 4AQAA 4N2NA 1GJIA 1T1YB 1R3JA 5AALA 3U0TB 3KE0A 3WNJA 4HIJB 3SN6N 3L9RA 5D72L 3MRRB 2FRGP 3H1ID 3ETBF 4B27A 3KEHA 1MCDA 3VRJB 4OI8A 1AH1A 1WIUA 3L70J 3P77A 2EC9U 1SQQG 3HE7D 1JTHA 3HZVA 4NS0A 4P57B 2GBVA 3IDNB 1G2CB 2Q1KA 5EZIL 3BSHA 1L9PA 2YO2A 5HVHB 3CFDA 5DS1A 5GS0C 1UACH 3IEAA 5I1LA 2IBGA 2XDHA 3HNSH 3H7LA 2AV1B 3NA9L 4A2GA 1ID2A 5GGRB 1SYVB 2Z5HA 5F1SA 4CMMA 3KR3L 3R4YA 4E9TA 4WUUA 5C0GB 4RGMB 4KOCA 1XD1A 1D5XA 4Z5RB 4AQ1C 5C3IA 4RQQB 2M5AB 1I9RL 5ALCL 2NR6D 3KLDA 1AHWB 2K4WA 3ILEA 2AK1H 4OFPA 3P9LA 3ZL1A 1EC5A 5JORA 5F6HI 1MJUH 3QI9C 1TO5A 1CXEA 4FFVD 4P2RD 3T08A 4JW3A 1JDCA 5G4MA 2IFMA 4HCRH 3FUKA 5AUMB 3AB0B 5HY9A 5ANME 2E7CA 2H4EA 4FYRA 4D8OA 1F86A 4FQJH 1LTGC 3MAWA 4CC1A 2P9RA 2X4UB 4K9EH 4MGXA 3UCRA 5GGSY 5EO9A 2J2ZB 3BDBA 1ZHKB 4AT6A 4WV1A 1MW0A 1WISA 3ULVC 3BZ4B 2I1KA 2ZNXA 2P7TB 2IAAC 4J7RA 2X88A 2F5BH 3DO3A 5HHOE 3M9HA 3HBZA 5FOBB 3FZUD 4K94H 3ECBB 4HOMA 3FPXA 5HYSA 5FYLL 3U79A 3BN3B 1HGVA 3Q1SH 4QMAA 2GM4A 1VZGA 5MP6L 1QMUA 3RVXC 5DGRA 1QSZA 1DQQA 2Z0UA 3KPSD 1IFJA 1DLFL 1LP9A 1U8LA 1XH2A 4HHAA 3GGWB 1UEYA 5C08D 5C7XL 1Q82Q 5TE6H 1FN4B 1G7PA 4Q89A 2O5NA 2VXQA 3NGBC 3MLTB 3SKNB 3HHRB 2IAMB 15C8H 3X14A 2AEFA 1RQ5A 3BFOA 4PWJA 1MFVA 2Y5TB 3PWNB 1EV2E 3QEQA 1FL5B 1KT2A 3F58L 2PR4L 4W9DC 1TU2B 4X6DA 1MN4A 1L5GB 4FADA 3CVCA 5L6YL 1U57A 1DEDA 1CG9A 1N7ML 1E8WA 1WH0A 3LDBB 1C8PA 3KPRD 2XTJB 2W9DL 5ESVB 1KWGA 3K6SB 1R0AH 1LEKB 1Q0XH 2IPPA 3KXFA 1IGFH 1A6PA 4QXTB 1ODAA 1OGTB 1P6FA 1X4XA 4YWGL 3G5VB 3TN0A 4AEHL 3ISWA 3C12A 3AWGA 3CX5I 3SE3C 5GJTH 4MJID 4DK3A 3P2DA 1IBGL 4L3FA 1J1PH 2WVVB 3T6ZA 3VFRB 4PU2A 1VZIA 4TVPE 3SWYA 1E4XH 4MZ2A 4Z95H 2DD8L 4DO5A 3TNUB 1KTRL 2CLZA 3KLAA 1OTSD 2XFXB 3FHEA 1GIGL 5ADPH 4KI5D 3RL2A 3FT1A 1SQBK 1RLWA 3D3VA 3ZDXB 1WUNT 3B7YA 3V5DB 1JSYA 1U8CA 4GAJL 1T2JA 1UOLA 2BCCD 2Y1YA 3GXFA 1IZKA 1PD0A 1I7UA 5DJAA 3E3QC 5SWZA 1IUZA 3VXRA 1YQ3C 4BFIB 4HW6A 1RZ8A 1J9CT 5F93C 2FB4H 3GMNA 4QO1A 1ITBB 2WWOA 3EJZC 3QUZA 3SE9L 1LTSC 3I02B 2NY2D 4EOWH 3HD7B 4H20H 3KCWA 4KTDH 3NJJA 2R0WL 4XP4L 1UA7A 2KK7A 5GRVL 1S5HA 1TO4A 4Y0GA 1LT1A 1FE8H 2NDGA 3FCSB 4DAGL 1F6FB 5ID0A 4I8DA 3MRBA 4KXZI 2XN9B 4OLYH 1D9KA 3QDGA 3HB3D 1EZVE 3K2KA 1D7BA 1S9VA 1FNSL 1T1YA 2P26A 1AXIB 3ZSTA 2LGNA 4G82A 3O8XD 1P7QB 4MJHA 1JHKH 4BDVA 1HKLH 3HW7A 3U0TA 1C5BL 2Y24A 4HIJA 1EANA 1W72B 3MRRA 3QFDB 2HJFB 3ZRSA 2DBLH 3VRJA 4PRHE 1HCFX 4X98A 3C5ZC 1QLEL 4NI6A 1CD8A 2QV4A 3N0PB 3RJQB 2OP4L 3ESVF 3H6AA 4XBEH 5E6YA 4A39A 4P57A 1LEGB 3IDNA 4FLQA 4XCYB 4X50A 1G2CA 2HUEA 1LJMA 3GIZH 1AKJB 3C5JB 3II3A 1M7IB 2FYUD 3C60C 3BWUF 3ZBMA 4ZS7L 3LYRA 1YY9D 2YO3A 1IGMH 2J21A 2PKDA 2AV1A 2KUBA 1MHHB 4XXWC 1J8HE 1NEZB 5GGRA 2WQYC 1SYVA 2E5EA 3E6HB 4L74A 3N2JA 4TPRH 3TWCL 3WEOA 1XV8A 5D1XD 5C0GA 3ZX1A 1YUHB 2P58A 2KMWA 1OAXL 1UADC 1URQD 1Z0MA 4RQQA 4X7CC 4Z5RA 3VXNB 4U6XA 2HKHL 3V4LA 4U1GC 4A6YB 1AHWA 1RURH 2IOIA 3JTTB 3U4KA 1SQQJ 3GM0A 1TTFA 4O00A 1T7YA 5HVWA 2OMUB 3IWVA 3P4NB 3U25A 1ZSDA 2HT4D 4KPHL 3A24A 4IU2B 4XH2B 2JLLA 2OX5B 3OKEB 3TH4T 4R4NC 3SODB 3FGAD 4U3FD 1E6OL 2QJKC 2NY0D 3QG6B 3KZIE 1MCWM 3OWEA 4M5YH 1M57D 4XMLL 2FQEA 4QJ5B 3BP5B 1CFMA 4N2HA 2J2ZA 5CJOL 1ZHKA 2OSXA 4AIEA 1IAIH 4JO3H 5AAWA 4GUCA 3SE4C 2X0UA 4LAQH 3CX5J 2XV6B 3S4RA 2UXFA 3FULA 4OLWL 5FYKH 2P7TA 1Q9OB 4DCQB 4JRYB 4M03A 5FYKU 2C0XA 1TZOA 2EXYD 1NC2B 5FOBA 5JHDE 2O30A 3SQBB 4G8FA 5IROA 3ECBA 4P3DA 5DVMA 4OZHF 1OP5H 3O41A 3NA4A 2CHDA 3DIFB 4G80B 3QPKA 5MHSE 3SYQA 4GAGH 1BAFL 2YKLH 4XMXA 4PTTA 1FDOA 1FPTL 3C09C 5I6MA 4TLFA 4JKMA 1TQWA 2WNXA 3SJVB 2EDEA 3WD5H 2NSMA 1FIGH 1MHPL 1KZQA 4N0YL 3MLTA 3SKNA 5HJDA 3APDA 4RKUJ 1FCGA 2Z4QA 1FL5A 4MB4A 2Q3EA 2G30A 3CU7A 4J3OH 1QW8A 1L5GA 1TU2A 3F64A 4QY8B 5IJDC 4LARL 2XV0A 1R75A 3ALWA 2LKMA 5H4ZA 2BY3A 2LU7A 1BFVH 4UZUA 2H47C 1OB0A 3PGDB 3H1HD 3K6SA 1LEKA 4M56A 4UANA 2HMIC 2WVUA 1PQZB 4D7BA 2VQTA 1EZVY 3BVTA 4Q97A 2L7EA 4HOZA 2B16A 1OOWA 1SLXA 1TQBB 3GB7B 1OGTA 3N44B 4NPDA 5GJSH 2R4RL 3G5VA 4TTDD 1J5OH 1KOAA 3TTSA 3ARWA 3MBEC 4B96A 5HHVL 2A06E 1CFQB 3L3KA 4TNFA 5HJGA 5JIMA 5EU4B 4M1GL 5CGMA 3O81A 1JK9B 4G5ZH 4ERSH 2WVVA 3FUHA 5DJTB 1EAJA 3MV8D 1U8IB 1DBAH 2FX9H 2J56A 4I77H 1HTYA 4ZTOL 4PD4H 1ZV8A 1YCSA 2WO3B 5FV2A 4U31A 4XNXH 3K0WA 4FOMA 2VAAB 5C07B 1EXHA 2CPUA 3ARRA 4Z9KB 1DQVA 2PPCA 1FFPB 3BGFC 3RKDC 3VGAB 3I84A 5T1DL 2B88A 2QHLA 3IS0X 1KGCD 3JWNG 1JGLL 1K3IA 4JR9L 3I9IA 5CKAA 4AMXA 1Z0NA 1BQLH 4FXGB 2OBGA 1YPZF 3QUMB 1U3HD 5AW7B 4A7SA 3I02A 3HD7A 3RFRA 1TZIA 4HIXH 3BMVA 1I8IB 3UG4A 4AYDC 3QH9A 1WWAX 2CIKB 4H8HA 4PYHA 5HYJE 2FGWH 3BATA 5IFAH 4IHBA 5CP3A 2G0LA 2XN9A 1XMEB 4I3RH 4I2XA 1OAKL 1RE3C 1W8NA 4QJ3B 3ZXAC 1PPJE 1A02J 1P7QA 1NMAL 4GFTB 4XO3A 3MI6A 3SY6A 3B7TA 4J1UB 3QFDA 3DBSA 2HJFA 2RCSL 4LKXB 1BE3G 2Q86A 2YMXH 4DEUA 1QEWA 1SXZA 4LLVB 3NABH 1QBML 1XZWA 1DUYB 1I8LC 2CR0A 3FBQA 1SQVD 4X7SL 1LEGA 3HJEA 1BGYD 2A1WH 3HI5H 5D2LB 4O4YH 1AKJA 3C5JA 1RK0B 1TF4A 5J0BA 2Z31C 4AJYV 5I6XB 1NYHA 2BY0A 2VZOA 2IC2A 2EO1A 1MHHA 2R1YB 1NEZA 1KEGH 3E6HA 3V5KB 2NY4D 1SEBA 5IHUH 1NLBL 1RY7B 1YUHA 1I3GH 2UWEE 3MJ9A 4MDJB 2Y9RT 1AZRA 3VXNA 3HAEB 2R51A 4A6YA 2XN0A 1OEZW 3JT0A 1GW6A 3VE0B 4HKZH 4ZMYA 5EUOE 5DC9B 2VN5A 5D1ZI 2ZG1A 3U1PA 3JTTA 2VW7A 1UACL 5ICYB 3DUHA 4KXCA 4KZDH 5E6RB 3O6MH 3HNSL 1AO7D 2WANA 2OMUA 3P4NA 1GYUA 4LXFA 4YC2B 3VFVA 4ZMQA 3M7FB 4YHMH 2D73A 1ZE3H 4IU2A 5J7CC 3P54A 2FECI 2IADA 2OX5A 3OKEA 4WJKB 3VMPA 4NSKB 4OFDA 1S2EA 3QG6A 1RPUA 3LZPA 3FQNB 3WL9B 1AJ7H 1UZ8B 4PRAB 3BP5A 4R26L 4KMQA 2NXYB 1JV2B 3PLYA 4DP0X 1JYNA 1MJUL 3BPOC 3EUDA 1N5YL 1GZQB 4H0LC 1Q9OA 4DCQA 4JRYA 3BQUC 4Y2OB 5GISH 3FFOA 2JQZA 1NC2A 1SQXK 1V7NH 1XR9B 3EFOB 3M6DA 3B2UC 3SQBA 3OL2A 3BRGC 3IN0A 3D2UB 2EXWD 1SQXE 1M6OB 1GS6X 1A47A 3IU3A 3OTTA 4G6JH 1ZA3B 1SLWA 3ZPDA 5J4MA 3BKML 4ONOA 2Y7MA 1DUZB 3LHPH 4YBLB 4PJXB 3V6OE 1NDTA 3QRFM 1F8TH 1TPXB 4JPWL 2F5BL 2ITEA 3QHFH 4FQLL 2XZZA 2VZ3A 1AG0A 4AIOA 1LGVA 3MNWB 2O6DA 1SY6L 1T0MA 1R3LA 1NQBA 3BP6A 2WQAA 1AI1H 3NRQA 4JFFE 3GXDA 2X6UA 5DUPH 3Q1SL 4GAYB 1BOGB 3TCLA 2OGUA 4LCWB 5AB9A 3UZQB 1QD0A 2DLEA 5IQNA 3S37H 2YIUB 3PGDA 5BZWB 1IE4A 5K9QG 2Q20A 1PQZA 3OHXC 1QTYT 2L8AA 5A40E 3GB7A 1AIFB 1AMXA 2J8UB 3DETC 5DVOA 3A0HH 4R7XA 4W70A 5D7LE 3T4AC 5J6SA 5IIEA 2WN3A 4GINA 4LLMA 2JIXB 1L0LG 5EU4A 3HZKB 3L4WA 2YRPA 1DFXA 1U8IA 4X7EC 5AVVB 2MPVA 1P6WA 2X05A 3VMXA 1Q0XL 3MUGB 1UD6A 4XBGB 2XJLA 5HHOA 3AREC 1TJIH 1WGOA 1QEXA 1DL7H 4FMVA 2WMPB 4U0RB 2VAAA 5IBTL 5C07A 3AGWA 1IKNA 3RJOA 3CX2A 1YY8A 2AJXL 2WBJD 3KPOB 2F68X 5FIEA 1GTWA 1OGAD 3L54A 5KYYB 3QG7H 1M9SA 4Q9BA 1E4XL 1XX9C 2BWQA 4Z95L 1MCSA 3CCMP 3WEBA 4FXGA 3CN1A 2HT3D 3QUMA 3HS9A 4JPVH 2Z34A 2X5PA 1XIWC 1K73Q 5ADPL 5K9OB 1I8IA 5HYIA 1P84I 3EHBD 4WEUD 5FLUA 5E00B 4AGLA 2CIKA 3LIZH 2XLLA 2H32B 5TK4A 2CXKA 2V7HB 4OGAC 2WPRA 2XIBA 3FO0H 2FJGA 1MRFH 2YZ1A 4RWHA 5ENWB 1A6WH 4XMUA 2CMRH 4M7JH 1NPNA 3DSNB 1XD0A 2FB4L 2FEDC 3GHEH 1SFDA 4YX2H 4LVHC 2QQLL 3LNEA 4HCGA 5IQOA 2WPVB 4HMCA 4J1UA 4I0PB 1HEJC 4EOWL 4LKXA 1G4MA 4LLVA 2ZKXA 4KTDL 2HFTA 3I2CH 1DUYA 5CCHE 1FE8L 1YEGL 3AABA 2DQCH 3NCFB 3MV01 5D2LA 1JFQL 3L5WB 1URLA 4GP5B 5F0JB 5LXVA 1RK0A 1LQBC 2F7QA 2C7FA 1SDDB 5K9QI 1EEZA 5D55A 1SBSL 2BVQB 4LHUD 1GS8A 1HKLL 2R1YA 1RHHA 1N6UA 3ZTEA 4V11A 3TC9A 3MOQA 3SPGA 3V5KA 2E75C 3AEDC 3IAOA 4QHKI 1I3RB 1UURA 2DBLL 4CC4A 1CDBA 3X1BA 5KSVB 4Y1AD 4L4JA 3Q5SA 3TU6A 1U8PB 4MDJA 2VERA 3JWDC 1KXQE 4XBEL 3NMEA 5EIIB 3F7VB 1BE3J 3DX0A 1BJ1H 3ZKQD 1BSHA 5C09D 5ICYA 3H54A 2YKKA 1IGML 4KVCH 4GRLB 1MAKA 2ZWZA 1F11B 4Y9CA 5B1JC 1MAMH 3B9KD 5IMOB 3RFZC 4TPRL 4HGWA 1YUKB 4WFHD 5DA0B 3JWOH 3RWFB 3ZHDA 1IO4C 2Y36H 2DMKA 2XZAL 4KJWC 2O6CA 4H4NA 4NSKA 4GEJA 4N90E 1GGTA 3M9BA 1EX0A 4ZI8A 3FQNA 3WL9A 3RGUA 1R5SA 2UZXB 1UZ8A 1XCTB 1QUNB 3O9WC 1AFVL 2ED9A 3R06A 3JYBA 4Y4FC 1JV2A 2DQTL 5F0MB 5DJCB 1KB3A 1XAKA 1GZQA 1LO4L 5DK0B 5CEYB 4AQ1B 4PRHA 4Y2OA 1L0QA 3TLRA 4AG4H 4AL8C 1XR9A 2PO6C 4KQ0A 4QKXB 1VZHA 1OZUA 3UTOA 1P53A 3D2UA 1WO2A 2E9IA 3CDGA 2Z7WA 4S2SB 3RGBA 3CWBE 1DVSA 1G1IA 1ZSHA 1M6OA 2EXTA 1X5AA 2QBWA 4JFDB 3B1TA 1ZA3A 1FIEA 4EDXB 4AVKA 3VXSD 4JO3L 2OYHC 5CGBA 4OGZA 1J0IA 2AXTE 2RMZA 2E4TA 4FFZH 1PG7W 1F1GA 4TVUA 4NYLA 5GGVY 3UYOD 4AM0Q 3UBGA 3GHGC 5LN4A 3MNWA 3RVTC 1J05B 5FWQA 1R4XA 1OSEA 2C9PA 2AI0H 2YXMA 4U1KA 2JR8A 2E27L 5I8OH 1KV3A 3ZR5A 2QDWA 1NOLA 4GAYA 1BOGA 4GAGL 4LCWA 3TBYB 3UZQA 4WTXA 1P84J 4JJ5B 1UA6H 3CXHK 2FIRT 5BZWA 2RB8A 3WD5L 4UT9L 3RRQA 1AIFA 1G9NH 2J8UA 4AYMC 1HIMH 3VXPB 5KEZA 1Q9LA 3CFIC 3MGTB 4GXUN 5FS5A 3EFGA 1W8OA 4ABQA 2ARJQ 1NU1D 4M7LT 2JIXA 1B3IA 1K2DB 3HE6D 2FYNB 2B39A 2R9HD 3FUFA 4FNUA 4JZJC 3FW6A 4XPGL 3UAJA 3HZKA 3QIUC 5JW4Q 1OY3B 1SHMA 5GTIE 1U33A 2ZZUT 5ID1B 4JHUA 4X5WB 1BFVL 2FATL 4QHLB 3A4DA 2QMKA 2CGZA 3L4ZA 3P11H 1B3JA 3LXAA 4P2OD 2OTLP 2TSBA 2QGCA 3FU5A 1MFCL 3CZGA 1TCRB 4NUMA 2WMPA 4HBQA 4YK4C 2P8LB 1M05B 5GJSL 4DP4X 4NM4L 5C0NC 3B5HA 3M8OL 2DWDB 3QEGH 1O7SA 4JAMB 4HWEH 2AABH 3KLQA 2BNQA 1T4KB 5BS0E 3KPOA 5EPMB 1SMDA 4YBHA 5BOJA 1PAMA 5KYYA 5DVPA 4QHKJ 3ZYIA 3RVVC 2BVOB 1MLBA 2VL4A 2G75B 4ABUA 3AEFC 1DBAL 3Q7JA 2FX9L 4NJAH 4I77L 1L0LJ 1AMYA 2DQ6A 2Y06L 5DHYB 4IDLA 4DP6X 3V2NA 2EDHA 2IJ0C 4H8WH 4TT3H 3OKNB 4XNXL 3LIUA 5K9OA 4Q6KA 1CF8H 3LV3B 5CEZH 3I9PA 5E00A 4EUPH 3TO4C 2V7HA 5EEWA 1XTGB 4FQHB 4F7TA 3U9WA 1PZUB 2B1AL 5HGAA 3D34A 1TTAA 4QRTB 5ENWA 4OZHE 2PTUA 1SLUA 5E4EC 3Q3DA 1BQLL 3OKKB 3K5BA 2PCFB 3V0DA 3OHMB 1VADB 1WZAA 3CNKA 4I0PA 3S3CB 4HIXL 2R69H 2APWA 3N7NA 3MCKB 4YJZL 3OV6A 1IC1A 1RY3A 3KDPB 4PJDA 1E40A 1M7DB 2FGWL 2TAAA 5IFAL 4I13B 2OR9H 3L5WA 5DFVC 4P46D 4A04A 2WT7B 4NFCA 1SDDA 2V2XA 3AY4A 1E5BA 2PYFB 3WMPA 4H40A 1Q90A 1KXVC 4EQ3A 1IC2A 2XN1A 1JL8A 2M0BA 2L7JA 2X2YA 3HUSA 1I3RA 3DNKA 1YI2P 1E4WL 4JUSA 5KSVA 5KLVK 1U8PA 1J2JB 4P2AA 4JFEE 5M1BA 5LCVH 2APFA 2ZUQC 4FQPA 4G70B 4J28A 5EIIA 3F7VA 4O4YL 2C0WA 1FZMB 3MO1B 5DHDA 4DQOH 3FT4B 1CICC 1A02N 2JKWA 5JZ7C 1YEIL 4TNVK 1T1WB 1F11A 5IMOA 3G5YB 3P4OA 3I3BA 3C5ZB 1OVRA 4AZ8B 1KEGL 2VR4A 3H1JE 4JPKH 1OPGH 2CK0H 3P73A 4PJCB 1ED3B 1F13A 2EIJB 4WEBL 1KILD 2E59A 3RWFA 5J1SC 1N6QH 1I3GL 3GPEA 2MHAB 4Z0XB 5DT1H 2ATAA 3PWUB 2YMYA 1PZ5B 2BMKB 4LMQI 4V2BA 3W5MA 2UZXA 1XCTA 1QUNA 4I0KA 1L4AC 5D2NC 4KZDL 3B9AA 5DJCA 4JL2A 3O6ML 4JM4H 3Q01A 2K9FB 1RMFH 3GQFA 2WUCH 5DK0A 2QPSA 5BOZG 1YNKH 5CEYA 4YHML 2A38A 5AOMA 5I24A 3GSNB 1MG2C 4RAVB 1A22B 1T2XA 2G3MA 4HUUB 4LHJB 4RWYH 1MWOA 3TSIA 4OV6F 4UOQA 5FCSH 1YPZE 2XHNA 4X5XB 1CBVH 1DEBA 1JDAA 1VCAA 2ZXCA 4QYOB 4S2SA 5CILH 3Q05A 1J0YA 2RBLA 3G04B 3QI9A 4JFDA 7FABL 5CBEA 1IZNB 3L5IA 5DA4A 4EDXA 4QRRB 1Z66A 4RZCB 3D52A 5HDBB 4NKMA 2CJTA 2Z6FA 2BVPB 2DLHA 5IB2B 2Z9TA 5IMLB 1RQVA 1BBDL 5GISL 2QJKB 1A6ZB 4HISA 2P5EB 3RWDB 3GJEB 1V7NL 4D9QE 2VH5H 1H0TB 1J05A 3GMOB 5CGYD 2BSRB 4ZXBD 2ZYGA 1THAA 3KPNB 4HEMA 3NRPA 3K46A 3TBYA 3HBPA 4GNKB 4JJ5A 1X7QB 4FULA 3LHPL 1OALA 3EF7A 1CF1A 4WU5B 1S7VB 3WHXB 2P80D 1NA8A 2X89A 2K6YA 3T0AA 4QI3A 1X7SA 4P8QA 1R3HB 3Q9PA 2PETA 3VXPA 3LW5J 3MGTA 1UASA 5DYOB 5GS2H 3FO9B 3H53A 1UWXH 2YMOA 3C09B 3BLPX 5D8JH 3CBJB 4AVIA 3BLBA 4WQOA 3C6SB 1RZFH 1RE4C 1XH0A 3C6EA 4UB8H 4HS6B 3WIIH 1YIJP 4X5WA 5ID1A 4MASA 4QHLA 2WYIA 4W9HC 1OLLA 1YNTF 3MLXH 5I16B 3AU0A 1NCCH 2RR3A 5D7JB 3BP4A 4K8RH 4NENB 3FO1B 4BFRA 3DX4A 3IFNL 2P8LA 1C5DB 4JFHD 5LN8A 3A4EA 1Z7JA 2Y6SD 1D5IH 4YBQD 1JZ5A 2DWDA 4JAMA 5A7BA 2A06G 3I55P 1INQB 3UX9B 5EH1A 4F2MB 3BAYA 3T77B 5IBLD 5LGJB 4ATWA 4UM8B 4F5CE 5IB1B 4CN6A 2BVOA 1BQHG 2G75A 1PV3A 3MHZA 1NCGA 4OB5L 4NPYA 4OQTH 3GZQA 1I4FB 4L4TD 1QRKA 5D7EA 4UQCA 3F7LA 3DX3A 1TJIL 3MBEB 3EAKA 3OKNA 4MSWB 3SE3A 1DL7L 2OW6A 3VG9C 5TDOB 2XVLA 3KDMB 3LV3A 1QKZL 1ADWA 4YQXH 3CSBA 1MUUA 1OHZA 3ZO9A 1JNHB 3MRMB 1CE6A 4FQHA 2KB7P 5CBOA 3U9PH 3ZMRA 3WLBB 2VM3A 3QG7L 4UT7H 4QRTA 5EIIG 5CMZA 2J6EL 2JJVA 5KJ7C 1KYOK 2IO5A 1VJSA 3OKKA 2PCFA 2K37A 2MJZA 4PV1D 1QI5A 2HXAA 1CU4H 3CFBA 1VADA 4JPVL 3KYKL 3HC2A 3BGFB 1M7LA 3L2LA 4DT0A 3FMGH 1KYOE 4LRNH 3V0WL 5CLXA 3EO9L 2MKVA 2F19H 1F97A 3EBGA 3MCKA 5E6SB 4AITA 1M7DA 2K45A 3ZKMD 1Q81Q 4XP5H 1KB9H 2WT7A 3MOBL 3P9MB 1A6WL 4BSWB 2CMRL 3RNKB 3BKYH 1WD9A 2EZ0D 3GHEL 2PYFA 3WKYA 3L74E 1PPJG 5KTBA 4DKAA 4OCRL 1D6VH 5D4JA 1EHAA 1R17A 3IJEB 5ECGA 1TQTA 4LLYB 1X5LA 1FVEB 1WFUA 1TMCB 3HC3L 3I2CL 4L8CB 1BD2B 5D96C 5KVEH 1SRDA 3QH3B 2E76C 1TYEB 5E9NA 1SQQD 1XCQB 5FCUH 4S1DC 3MO1A 3P0VH 4MAYD 1YN6B 1CLCA 2DJ4A 2FJUB 1LLAA 3VG0H 1VA9A 3QISA 3VGEA 3HNTH 4QRPE 1BLNB 4JRLA 4OJEH 1T1WA 2GJ6D 4FLOA 1CPUA 4KRMB 1A3LH 3G5YA 4NQDE 3C5ZA 1DBKH 4AZ8A 3UBXG 2CALA 1E30A 1NTKK 1NKNA 1MREH 2JKRM 4ZO8A 1ED3A 2IFFL 2NQ3A 1FZKB 3HG2A 1AC0A 3HBGA 1OCCB 2MHAA 3AS0A 1DSYA 5ECJE 4Z0XA 4JY5H 3VMNA 3PWUA 3C60A 3IFLH 5IB5B 1N6VA 2QL1A 1ETB1 1N18A 5F9WC 3CX5D 4OGYL 4XXWA 5G55A 4AWJC 4K3HA 3ZY7A 1L7IL 4AXWB 4Z3FA 2NPLX 3VD9A 1MAML 4YHZH 4FQXD 3Q44A 3GSNA 1PS3A 3KM2A 4V1DE 1WITA 3MRFB 5CNHA 3J8F7 4B9IA 2RAMA 3RGHA 2VLKE 1CWVA 2Y36L 2KZBA 3CIQA 4NC0B 2BW5A 1FHNA 1GC1C 4X5XA 1AD0B 2B15A 4LT7A 4LSQH 5JHMA 4QYOA 3ILQC 2XRAL 4D8PB 4GSDL 3G04A 5CF3A 1T7ZA 5E2VH 3ULAB 1SQPG 3N04A 3GLAA 4RZCA 4QRRA 1JBJA 2AKRA 5IW6A 3QHZL 3L16A 3B5ND 3F65A 5IB2A 5IMLA 4XNUL 5HSFA 1S3JA 1NGXB 4X0KB 1A6ZA 1KELH 4AG4L 1GL2D 2AAAA 4R8WL 3GJEA 3RWDA 3WFBL 2AZUA 1AQMA 1H0TA 1EPFA 2ADYA 1E9QB 3OJMB 3GMOA 1MKMA 3DXAB 2WGNB 3QWRD 2BSRA 3QORC 3SE4A 1OTUD 3KPNA 2Q8AH 1SQXG 1I9EA 4XXDB 1JZIA 4HK0A 2Q7YB 1X7QA 2HFGL 3BQUB 3GEWB 3W81A 3MV9A 3ECWA 1AZVA 1CN4A 1DQDH 2A6KB 1IM9B 3P4MB 4PB0L 3ZE2B 1HNGA 1R3HA 3GMRB 4PLNC 1ULVA 3M0AA 5DYOA 3VD4A 1A6AB 3FO9A 3NSJA 2I1JA 2AI0L 5I8OL 2FGZA 1GHFL 2IQAB 3BCFA 3RNQB 3WTTA 3C08H 4W6XB 3C6SA 2EDOA 5BZXA 3KBEA 1IBZA 1JZGA 3I75B 1UA6L 1C08B 4TL5A 2AEJA 5I16A 3U0WL 3VM5A 1BF8A 1OM3L 4OQ1A 3GDCA 1CTNA 3UBXI 5EZJB 4ZUWB 1G9NL 1JCVA 3Q2WA 3QAQA 3P0YH 4HUKB 2J88H 1ACYL 1INQA 4F2MA 3PP3K 3T77A 3N1FC 3P3RA 4LLUA 5LGJA 1VQOP 4OFVA 3A2AA 4GRMA 1O9ZA 3AE5C 4OZIF 5TFSL 3P11L 1I4FA 4WI2A 4YSOA 4Y88A 4YDKL 4LSSH 5AAMC 4F93B 3MBEA 4XX1E 2WY3B 4F3FB 1IK7A 2D9CA 3OZ9H 4MSWA 3ENEA 3S98A 1S5LX 5TDOA 3GSQB 3KDMA 4M00A 1USDA 1NZRA 2A74C 3MYJA 2WBWB 2CHZA 3HMWL 3QR1A 2AABL 1JNHA 3FQRB 5CGTA 3OPZH 5SX4H 3IVKB 5KVMC 1Q2NA 2AJVH 1N0XH 2N59A 4GS7C 3WLBA 1NTZK 4KBPA 2OJEB 2EEXA 4KH2A 3UEQA 4AYSA 2IWKA 4K3EH 4F92B 4NGHH 5C0AE 2DTML 4H26B 4L0PB 4RMSA 3EH5B 3WU1A 2QELA 1NTZE 1IVTA 5C7ZA 4KTGA 4AEFA 4W93A 5LHDA 2ZKWA 3A22A 5DVKA 1JWSB 2CGRL 2QFRA 2B1HH 3K6DA 1G7IB 1GYVA 3HG1D 4GT0A 3F83A 2Z91B 3VFTB 5BZZA 5AW8B 3FB5A 2VXUH 3GO1L 3IXTB 1Q8MA 4MBOA 3PF2A 2OMTB 3P9MA 4BSWA 2EDBA 3RNKA 2XQYA 1XIWB 4Q6YA 3RPBA 3F7QA 3PAYA 5H35B 1U8NB 1VGEH 2E5TA 3FS9A 5HVGB 2FEEL 4C56B 3H1LE 1GVIA 3IJEA 5A2LH 4LLYA 2GJRA 4IFDK 1FVEA 3OGCB 5KOVC 2W92A 4ODXB 4WFFE 4FQ1L 5FM5M 3WN6A 1V3KA 4L8CA 1BD2A 2PWDA 4FERA 1JPGB 3VMZA 4L18A 4BXSV 4MXWH 1RE3A 3QH3A 4GI8A 3ISRA 1PTZA 4WWNA 1XCQA 4B50A 5JR1L 1HHKB 4LVHB 3BUYB 1VGKB 4FTVB 2CR3A 1YN6A 3L3JB 5J3HD 2AJ3B 3QIBD 4H1LB 5I1KH 3A5TA 2Y6TE 5CD5D 3APFA 1BLNA 4MMXB 2P67A 3BKJH 4FCHA 4LIQE 1ZLSH 4KVNH 2CLVB 2JJSC 3BZ5A 4XVUD 1I8LA 3VX0A 4FMKA 4Q9RL 4JFZH 1FZKA 1NANI 4I85A 3O2WH 2AK4A 2ZXAA 4R4FH 3BYTA 1U7JA 2WLIA 2J6WA 2Z31A 5LCVL 3WEMA 4DQOL 4PRPE 4BUQA 5DK3A 4FL4B 2AZAA 5FC9A 4AY0A 2E75B 2JB5L 4N86A 4AXWA 4AYEC 1VQNP 3NT0A 1V7MH 4G8EB 2W5PA 4JQIH 3TURA 3TO2B 4JPKL 1OPGL 2CK0L 3MRFA 2HH0H 4PCSA 3G71P 4OLZH 5I8EB 5KSAD 1SJHB 3U4AA 4HWBL 4KKLD 4BSJA 5DT1L 2CNYA 4PPTA 1CO1A 1B0WA 5F7BA 2F54E 3D2TA 3UO1L 2IANB 2EIDA 4CU7A 3L3DA 5MEND 4FP8L 4DP1X 1KFGA 5MEPB 3POHA 3RFZB 4DETA 3PPSA 4X0NA 2WQRA 4JM4L 4LLDB 5DHXB 2XZQL 4E41E 1RMFL 1QVOB 1NGXA 5EA0L 4X0KA 3H0TB 3KGUA 5BRZE 3UTPD 4RWYL 4U6YA 4JFEA 2VLJB 3QDJE 1E9QA 1BG9A 2NX5E 3GWJA 1CBVL 1OAUH 4Y4FB 3KXFD 2QSIA 2JI2A 3P3SA 1NCWL 3PFUA 2GEEA 4MQXC 4PJBF 5CILL 5F97E 5C0DB 1KN2H 3FTXA 2CRZA 4HU2A 3RU8H 4NNPH 3NCBB 1J86A 2Q7YA 4N5UA 3BQUA 4R5VA 3NJKA 5L4IA 1R1CA 2DI7A 1M56B 2EUVA 4XCNB 4ZS6C 2PO6B 2WLLB 3P4MA 1EEUA 3QXDB 1AJYA 4F8TA 4NBXB 3AU1B 3GMRA 1SQPJ 3FT0A 4BK4A 4HT1L 1E4JA 1A6AA 2VH5L 2JFCA 3QZLA 4LVOC 2VDOB 5BV7H 1M2OA 1WEJH 3N9GH 3UH8A 2QQQA 3RK3C 2IGFL 3TX4A 1JS4A 4LAJH 2OYHB 3CVHH 2B14A 1HL4A 2XX1A 2ITAA 2JELH 2DV6A 3I75A 1C08A 1QI3A 3KG5A 4NQXA 2KI7B 3GHGB 4B7IA 5EZJA 3TJEH 1LXMA 4ZUWA 4RLDA 1PEZA 5E8OB 4P9HC 2Y7NA 3MLZH 2BSSB 5D8JL 2H0FA 3OHXA 1NDGB 3LKQB 4IMLB 2XI9A 5I6LA 3WIIL 4FE9A 4LCVA 5C6TH 2JCCF 5L88H 2NPSC 4OTXH 4TNWK 2NT1A 4J2XA 3D39D 5D1ZD 3T4AA 3ETBJ 3OM3B 2XQYG 4F3FA 3SJVE 2YPVH 5AVTB 1YDPB 2P5WD 1G0YR 3W11D 5A6MA 3GSQA 3K6NA 4JZJB 4DUXA 1AQKH 2E8ZA 4CDGC 3QIUB 5CKGA 3CN4A 3V7MA 4CILA 3FQRA 3IVKA 2G4EA 1H8OA 1N64L 1L2PA 2JP3A 1A6UH 4N9GA 3WUUA 2P4AB 3AREA 2CKBA 1L7TH 2OJEA 1GR7A 3D4CA 4OQTL 4YK4B 2BZDA 1JXDA 1OWRM 3J07A 3ABGA 4H8VA 3UPAA 2VLRD 4H26A 3BRDA 1JVLA 3PP4L 4GO9A 4OZGB 4X9HA 5MI0C 1FYTE 4P5MA 1G7IA 1ADQH 1AZUA 2O01J 1H8LA 1FZJA 2Z91A 2Q7AA 1YJ9P 2MTAA 2QEXP 4HLZH 3IXTA 4OKDA 5C0BB 3HE7C 2DQHH 4UT7L 2OMTA 2ZSWB 4QRUB 2J5LB 2FBJH 3ARYA 3ATAA 4YIQB 3VXUD 1XIWA 3REWA 5FLVA 4EKJA 5H35A 1MRDH 1U8NA 3C8KA 5A2JH 2Y4SA 1KTKE 4C56A 5FFLA 1CU4L 2DM4A 5C0EB 3Q6GH 5L0QB 2N1TE 4LASH 3TO4B 3MU3A 2X2IA 4NO0B 4ODXA 3V5HB 2F19L 3L17A 4JFVA 4XA4A 1JPGA 1J0HA 2P43B 5ESAB 3CFJB 3BT2L 3GXUB 3MV7D 3T3MB 3VQ2C 2YN3A 2UX7A 2VJXA 1HHKA 3EOAB 4F7MB 3T2PA 3BUYA 1VGKA 4FTVA 2NR6C 1JYXA 1HVVA 3L3JA 4P49A 2EIZB 2AJ3A 1IVLA 4H1LA 4HIQA 4PM1A 3LNFA 5KSBB 1WPCA 1CIDA 4PY7B 2H6UA 1OQOA 3WY1A 1D6VL 2CLVA 3HG4A 2PF6A 3IFMA 3L3IB 3B2DC 4FFVC 3W0WB 4LLWB 3BLKA 4Z7WF 4N78D 2QJYC 1ZTXE 1F6AB 5IGXH 4PCKA 3MLSH 4IKKA 3L1GA 4Q2ZB 3SYPA 3O11A 4HX1B 3MXVH 4I88A 5FCUL 3AADB 3P0VL 1CI6B 3EIFA 1DZ0A 5KYUA 3T0XA 1RIHH 3HNTL 5DRZB 1PU0A 4UQ9A 4EXPX 3DVGB 5T3ZE 3GC3A 4L4VB 4N8CL 4WK4B 1DBKL 2YGNA 4FABH 3TO2A 4NEHB 4JQXC 1AQ8A 2VDML 2PYEB 2ZUQB 4HWNA 4DERA 2W83C 5I8EA 1T5KA 1SJHA 1DQKA 4JY5L 3TBSB 1CICB 1Z6JT 3FZUC 2IV8A 3IFLL 1FVCB 1H3XA 3BO8A 3QDME 3P32A 1JHLL 2IANA 3B83A 4B3VA 1UKSA 4YLCA 3N5AA 4GUQA 5B1JA 4RGND 1NC4B 3UTZB 3L1OH 2F53B 3NTCL 2AMGA 3ZDZB 1MFEH 3OBAA 3JV5A 3ROOB 1IO4A 1YEFH 4LLDA 1M6UA 3LZQA 1USEA 1VACB 1BXAA 4ESKA 2EUZA 3H0TA 6CGTA 4UBDD 4H0GA 2VLJA 1EXGA 2CAKA 3O9WA 1DX7A 1RK1B 4LSQL 1BQUA 4Y4FA 5APWA 5D2NB 1BIIB 3PDDA 3O4LE 5C0DA 3CH1B 5E2VL 1OW7A 2WAQA 5D6CB 2ZP9A 2QSVA 1CVRA 4IOSD 1V3MA 3C2AH 2PO6A 2WLLA 3QXDA 1ZN5A 4U6TA 4W9FC 1UIXA 5BXFB 2VC2H 1KELL 2EKSB 3TV3L 5AVWB 1F58H 4GQQA 1J9SA 3A0BE 4B53A 4JGUA 2OYHA 3GG2A 1YA5A 4XODA 2WWMD 1FAIH 1LYQA 5E8PB 2Q8AL 2F7PA 4EI6A 3HTKB 3PHOB 5HHMB 4AUJA 1SHSA 1CGSH 1KENL 2PLTA 2J1KA 2MKLC 4XN8A 2W6JH 4N3UA 3GHGA 1YEEH 1ZRTE 1GMEA 3BSZH 4JUTA 4MNQA 4NZFA 3KHUA 1MXGA 2A2QT 3CC7P 1FL6B 5EFWB 5IHLB 5LAPA 5E8OA 1SYSB 4ODSH 1OTSC 3CSGA 1A4KA 2BSSA 1S9KE 1GGUA 1R5WA 1Q72L 4KI5C 1SM3H 2ENPA 2IPUK 2EE9A 4MMYB 3B71A 1SY6A 3F5WB 4IMLA 1NDGA 1XWVA 3LKQA 4MJJA 5E5UB 1L0LD 5EORH 1HHGB 3MRPB 2MNJB 3TPUB 4D9RE 3VUAA 1LTJB 5JHAA 4WFGD 3I3EA 4JPZB 3GSXB 5CSZB 1JGIA 4E2OA 1YDPA 4PJXE 3FTWA 4JZJA 5EN2B 4HC1A 4MD0B 3P0YL 2VDKB 2UXGA 3V8CA 3QIUA 2NY2C 2A5UA 2ENJA 3II2A 3WELA 3HKFA 1BYOA 1NGYB 1X6NA 2FKWB 3N1QC 1WTGT 2C1OB 1C16A 1NICA 4G2AA 1VIWA 3HB3C 4LSSL 4P2QA 3CFQA 3ALPA 3MX0B 3OZ9L 3O8XC 2JCWA 3FU8A 4OZGA 2VMEA 5DEFB 3L95B 5B5EE 1HHHB 5C0BA 1N0XL 4ZNCD 5E24E 2ZSWA 1M9WA 5BQ7B 4YIQA 1HNYA 2G8YA 4XP9H 3SOTA 4PG9A 5EIVA 4X80H 2J5WA 3QVAA 4NGHL 4RMTA 5KS9B 1YY9C 3T09A 8CGTA 3TO4A 5DK2B 4NO0A 3O3DA 3V5HA 2OCFD 3EYFB 1ZA6B 5K39B 1MPAH 2WLZA 3D4ZA 3GBNH 1BMZA 1IGCH 3H9ZA 5D1XC 2B1HL 4MQSB 3K4AA 5ESAA 5C97A 3KMDA 2OMWA 3OAUH 1FGNH 4Y4KD 1URQC 3EOAA 4OLEA 2K9JB 1FORH 2VXUL 4F7MA 3RP1A 5T1MA 2FO8A 1QLRB 2EIZA 5SWSA 1UKQA 5KSBA 4PLOB 2IDFA 2NY6D 5LJYH 3QWOC 2KLTA 4PY7A 5DRWB 5JW4N 2FWOB 4LLWA 4UTBL 3W0WA 3ORJA 2HT4C 1IL1B 2EAEA 1Z5YD 3QNZB 5DO2D 3IE4A 1RSFA 5PAZA 3NFSL 5JMRA 2KDYA 4JKKA 2V2WB 2H1XA 4Q2ZA 2XU6A 2FFDC 4HX1A 4NCDA 2NY0C 1ACCA 3NZHH 1CI6A 1KXVA 2OTPA 3CCHA 2X10A 3DI3B 3X1EA 5I1KL 3DVGA 3PGFH 2H3NB 4PJIB 3ULUF 2XIDA 1ZLSL 4L4VA 3COOA 3VRLE 2PYEA 3MP7B 1EA9C 1PZBA 3GXNA 4JFZL 2E76B 4CW1B 2BSEA 3C5XA 1JP5A 4F57H 1L0NG 2J1ZA 4R4FL 2EXYC 4DIXA 3TBSA 1CICA 4XWOD 5ISZB 1AXSB 1D5MA 3DPBB 3NEOA 1L4IA 1NC4A 4HIIB 3UTZA 4UZGA 2F53A 1AQHA 3BAEH 5DC0A 1G4RA 1AGBB 1ZPLA 4KXDA 3VVWA 4JQIL 5FUOH 2HVJB 1S3KL 1JMMA 2HH0L 5IW1A 3OGOE 4FI8A 4ZK8A 4OLZL 1XBDA 4PS7A 5F9WB 2FLBT 4ABVA 1L4AA 3GRWL 4HPYH 5D2NA 1BIIA 3KYOB 1IAIM 2H2PD 3CH1A 4NIKB 4PS4H 1EDYA 3ILPB 1ET5A 1JZ3A 5D6CA 4U3SB 1C12B 4WO4D 5I15L 1XSKA 3RX7A 5B3SB 1BAGA 4G8GE 4M7LH 1S7UB 3UTSB 2EKSA 3GS7A 4ZAKD 4WBAA 5CCKL 4RFOH 3IMTA 2PP9A 2IH8A 1OAQH 5HHOD 4TTDC 1ZT7B 1IFIA 4M48L 3MKGA 5D9SB 4E68A 4NNPL 3PHOA 4OVNF 4NERA 2I69A 4UM9D 2MQ0A 1U7MA 1ANUA 1MI5B 1MWAL 2AP2A 4BYHA 1FL6A 4IJ3C 3PQYB 3ZYJA 3ECQA 3D71A 2FL5B 3QCUH 3QORB 2AEPL 1SYSA 3K2MC 4GBXD 4WFEE 5BV7L 1YYCA 3PXHA 3N9GL 3Q3GB 3HMXH 3CMAP 4MMYA 4U4BA 4XMPH 1FZFA 3CVHL 3RUGB 4ORGB 1XDTT 4D0BA 3F5WA 4ZQTA 2WTPA 3Q48A 5HHXH 3FQ4A 4GXVH 1HHGA 3MRPA 3CLWA 2LR4A 3TPUA 4ELMB 3V0VB 3GSXA 3TJEL 3ZT5A 3V4VL 5CSZA 2Z8RA 3H1ZA 1A64A 1U3HC 5EEUA 1NUDA 4IBUA 3AQZA 2VMDA 1RE4A 3MLZL 3P30H 3O8ZA 2XNAB 5IREA 3MDJA 1WC7B 1G1OA 4NBZB 4F9LC 1NGYA 4MA1C 5FW8A 3EZ8A 1BDYA 1LHZA 3SOBH 4PLJC 1PP9G 2WW8A 5JA9A 1QWNA 5E9DB 2IZ1A 2CBQA 3CXHH 2WSCJ 9CGTA 4TVPD 1NBZB 4XX1G 4IYKA 1ECYA 3WS6C 1AQKL 1PMYA 4FDWA 3IJ9A 3OR6B 5DEFA 5J1TC 3ULUC 3L95A 5IQMA 1HHHA 3VWJD 3BN9D 5AW5B 4FZ8H 5BQ7A 2RHEA 3CSYB 4PJ9D 5IT2H 2LLLA 3NCYP 2DQIH 4YNYA 1AVOA 1PG7H 2GITB 3OKMB 1FOSF 2A74B 3VXMA 5B38B 5KS9A 4DFIA 5CINH 1EXJA 3KYMB 4BCZA 5DK2A 1YEJL 5K39A 2EILB 3EYFA 2HRLA 3TIDB 5CR8A 1DVYA 2NY4C 3ML9A 2X4NB 1GYCA 1ADQL 1O7DC 5IHZB 1MF2H 2QZ5A 3PL6B 5KJ7A 4DZ8B 3DHMA 2K9JA 4U7JA 2Y3NA 4XNYH 3OWRA 3N43B 1QLRA 5CXPA 4IJTA 2NSQA 5DRWA 1MRDL 5DJ6B 2E7MA 1U8KB 1EZVD 5F1IB 3H1LG 4M6MH 1OSYA 2FWOA 5B1BB 5E2UL 5JA8B 4P5TC 1AGEB 1IL1A 1S4IA 3QNZA 3WNPA 2P28B 1PGOA 1ZXGA 4LEOB 1VF5C 5IQ7H 1NM9A 4PRHD 3ZKND 2Z3FA 4AENB 3MUJA 2Y9YA 3EW3B 3ZMEA 4UT6H 5FO7B 1I85C 3PV7A 1HWHB 4JVUA 3WE1A 4KKZA 3FNKA 3BSGA 3T0EB 4PJIA 5JLZB 2WVTA 3US1A 5F3FA 1EDKA 2Y0SA 2JCCE 1CGWA 1YTZI 2GY7B 1J8HD 4JO2L 4F7EA 1MV8A 4LNRB 4X8XA 2ZWYA 2G2NA 5GRUL 2UZIH 1B6UA 2YBGA 4G6FB 5ISZA 1BEYH 3MLSL 2DYPD 3DPBA 3MXVL 5GSRB 1QBBA 2V9QA 1VESA 2EXWC 2AJZB 4HIIA 1GGYA 4B60A 2ILLA 3KWWB 4XCEB 3SYCA 5T1JA 1C9SA 4I9XA 3DVNA 1AGBA 2RIKA 3O0RH 3UBHA 3NOIA 1LD9B 2R15A 2DLGA 2HVJA 5IHHA 2UY6B 3ZN6A 1CL7L 3G5WA 3V9EA 1S9WB 1I7RB 2G2RB 5DEGA 4E9QA 3TF5A 2E9WA 1ND0B 3KYOA 4MXVF 2CE6A 1PLGL 3ILPA 1MW2A 2CPBA 5DZJA 4BHUA 4U3SA 1L0NJ 1C12A 1GAFL 3IDGB 1MFEL 3FRUB 4LSRH 5C86A 4JHZA 2P7JA 3CCJP 3BIKA 1PZSA 1YNTA 4NKDB 1NAKH 4F27A 2JKVA 1S7UA 3UTSA 4C55A 4JM2D 3FH5A 5DD3H 4NIYE 4PJCE 5JHDD 4PVMA 1ZT7A 3Q8AA 4U7KA 2DMCA 4F15C 2F8XC 4GXUM 5D9SA 1PFOA 3P2TA 5DVLA 5MHSD 3QYNA 3GZPA 1L6XA 1VSCA 4K71C 5T1KD 3C2AL 4U1NB 4JFWA 3VI4B 4OZIB 1MI5A 3QUGA 2BH0A 2AEWA 3PQYA 4HJEA 1LK3L 2VC2L 1XGPB 2FL5A 4YGAB 4HSQA 3QORA 4ABWA 4G1MB 1C5CH 1MJ8H 3RK2D 1IBBA 2QVFB 4WY7L 3QWQB 4A2HA 4C4BA 3Q3GA 5E6ID 3GEFA 3GZOA 4M62L 4WNJA 2PXYB 3W3BA 3RUGA 1ZHBB 3OAWA 1FAIL 2H0PA 2O1JA 4Z7WE 5FUCC 1NJIQ 2WBJC 3NMDA 1BBJB 2LFGA 2WOYA 1DANT 4Y7MA 3BSZL 3NAAL 3T3PB 3JQOB 4YDZA 2H2SD 3TYGL 1P1ZB 2HT3C 1NBYB 2HLFD 4ODSL 3AS1A 4ZPVB 3VFPA 1SM3L 3C6LB 3EHBC 3RWHB 1MCIA 2OTWB 4Y19E 3WGUB 3NSDA 2A06D 2XC8A 4ODUB 3LS5H 2WQXA 4B97A 1BVOA 5E9DA 4OD2A 2FVNA 4RESB 2DN7A 2R27A 3B34A 5LBGA 4OZFG 4MJ2A 1NBZA 4ILDA 4Q6IC 1HE8A 3FPYA 5DD1L 3S2AA 2ZKHH 3MBXH 3VACA 5F7FA 2HVKB 3DTXB 3X2QB 4APQD 1Q90D 4J23A 3CVBA 4JDEB 1LDPH 3AG1B 2NPSB 3N55A 2B8OT 5DZNA 4Y1SA 4DTGH 4HCFA 4Z7OB 4XN9A 5AAMA 3SGKC 2UX6A 1MCOL 4TULL 4MS6A 4QRSA 8PAZA 4O02L 4X6FB 4NO5B 5IMMB 2JKSA 2J1XA 4YPGB 1LEIB 2L91A 1EMTH 2GITA 2A74A 5E8DH 5B38A 1CD0A 1USZA 5B22A 5L8JB 3KYMA 3DECA 4JJOA 1PP9J 1KBKA 3X17A 2OPCA 3O2VH 1G6RB 1MQ8A 4WW1B 3TIDA 4AIXA 2X4NA 3MTXA 5IHZA 1QL1A 4DZ8A 4KJYB 4MLIA 1A7RH 1UVQB 5HYJD 3MLPA 3C1LA 5GGQH 1ES0B 4KJQD 4QTIH 4XP9L 1DDTA 2XWBB 3S8WA 1JXFA 3CC2P 4X80L 4JG1L 4N87A 1IJ9A 5MI0B 1U8KA 5F1IA 2QM7A 5HDQH 4TLTA 1PPJD 3SE8H 2VXQH 3B9KC 2ZXQA 1AGEA 3OC8A 5BRQA 3HE7B 2IV9A 1VL2A 2OR7A 3GBNL 4LEOA 1FNEB 4G8AC 2VR6A 3INOA 1Z9NA 3D4GA 3OAUL 1FGNL 4YXDC 1TVHB 2AXGA 2BDNH 3CFUA 5FO7A 4LC1A 4OFQA 5F0PB 5E1HB 1X6LA 5I2IA 2V17H 5FUZL 2VXTL 5JLZA 1ZTMA 3CZLA 3QI9D 2KERA 1JGDB 4L3EB 1KYOH 3PDOB 3NIFB 3B8EB 1EAOA 2X40A 2WWKT 3QRBA 1EJ8A 3UP1A 1IFPA 4LNRA 4P3WA 1XF3B 3H1LJ 4PG2C 4JX0A 2WSEH 5BNXD 5GSRA 3BJLA 5A6LA 3BP7A 3AE8C 4Q56A 2AJZA 2JJSA 3A7OA 4G6ML 5DXWA 3KWWA 1X5GA 3IB4A 2HX8A 3U6XA 1SVZA 4P2RB 5I1CH 5KAIE 2QJYB 4LLHA 1IGIH 3M45A 1B90A 5T5NF 1RUML 5SX5H 1LD9A 1P7BA 4FI7A 3DVFA 4Z3GA 2UY6A 1A7PL 2OMNA 4N1EA 5IFHH 2YGVA 1JVOA 1I7RA 4M9PA 3OMZA 4F57L 2G2RA 4Q4IA 4U6HA 4PJ6A 5GRVK 4FA6A 4LRIC 2FDBP 4MRCA 2P46B 1RZKC 3IDGA 3FRUA 3N42F 3BAEL 3W2DH 1WZMA 2AAVA 4X99B 3QARA 1MY5A 3BCCE 2E5YA 4GP8B 4NKDA 4YSDA 5DU7A 2FT6A 1T7XA 1ZK5A 4WCYH 3HG5A 1LM8V 3H9HA 2NQDA 4XPFH 1CT8B 2YXVA 2AJUH 4HPYL 3KD4A 2X1QA 2FSEB 4RMRA 4PGDB 3DKHA 2YD3A 4PS4L 3KPSB 1BXVA 3HE6C 1JRHH 2CM6A 2P3YA 2R9HC 4L29B 5AL0A 1SQXD 1CQYA 4GLRH 5C08B 5AG8A 3BD4A 4EDWL 1Z9SB 1EHXA 1KC8Q 4U1NA 3VI4A 3MRKB 5EZLA 5FV1L 4OZIA 1R5VB 4MA8L 2J72A 3CLEH 4M7LL 3GBEA 1IAKB 1FO0B 3E6FB 4G1MA 4HF5H 4EBQH 4RFOL 3DGCR 3IRZA 1OGPA 1OAQL 2M83A 4J3OF 2KLUA 4XPAH 4NP9A 5I0VA 2HX7A 1ZHBA 2W38A 3FQYA 1KGXA 2XG4B 3VI3B 4JFFD 5EU3B 3KPRB 4X6EB 2IBZE 3HPJB 3NP4A 4DGYH 4BHUI 3IETB 1BBJA 1ORSB 1THCA 1EZUA 2MQGA 2VRQA 4IFFA 4OH8B 4Q74A 1TJHH 5FO9B 1CYXA 4FQCL 5MERA 5LLIC 1P1ZA 3TVMD 1N4XL 1NBYA 3QCUL 3E2HC 3VFGL 3PUUA 4ZPVA 5D7LD 1ZOYC 3MNVB 4MJIB 2QJDA 1FQ9C 3RWHA 2CKNA 2JQMA 1DVUA 1EFXD 1AFOA 2OTWA 3DXAE 3SKMB 5K9JH 2MH4A 1J12A 5HHXL 4RA0C 4GXVL 4JDTH 4ZMLA 1A25A 4KRPD 1X5ZA 1F6LL 2X9XA 4KX7A 2D7NA 1TYRA 1URIA 3BHBB 2BNRE 3RIFF 1S4XA 4JPQA 2HVKA 3DTXA 3ZE2E 3VGBA 3S8FB 4JDEA 4IBZA 2NPSA 4TQEH 4LDOB 3LRMA 4ZFZB 3JSSA 2O61B 1W2KT 4XNAA 1PKQB 2W9EL 2A9ML 3C8VA 1WWCA 4X6FA 5FPIA 1S5IH 5IMMA 3R18A 4P46C 3SD5A 1HK6A 1V8HA 4N8VB 3ITKA 5CBNA 1LEIA 2JO1A 2YIHA 4JY6B 2NY2B 5GHWH 5ADOH 4NZUH 3BAJA 5DUML 2ZXDA 3DOSB 3HI1B 3UFIA 2XWEA 2NZ2A 1G6RA 2WLYA 4JE0A 4WW1A 5FHBH 5ITBH 1AQTA 3ZDMA 4M7KL 1PZ3A 4P4KC 4KJYA 4B41A 1IFNA 1SF5A 3B4SA 1UVQA 3NCEB 1MFTA 1ES0A 1QFWM 3PP3H 3QDAA 4FZ8L 4TSBL 3O8XB 4N28A 2H1PL 3RPKA 3E8VA 3IPEA 4M6NH 2DQIL 2AEQL 4FS0A 4WZ9A 3BVNA 2DOCA 2K8MA 1CDYA 4XZ4A 4R90H 1M1JC 4NXSA 3B5TA 3HE7A 1HWWA 3EADA 3VFOB 2B9AA 2FHCA 4S10A 1M90Q 1FNEA 1KILC 2I27N 3EFFB 4KKPA 3U7YL 1MF2L 1PDKB 3JCUH 1N7SD 5CCHD 1TVHA 2VKWA 3KCPB 1D2OA 3EGXB 5D7SH 1JY2O 5M94B 1RVFH 3WSQH 1SP4A 5JPMC 4KU1A 3QEUB 4P5SA 1BREA 1NBVL 1JGDA 1OQXA 2WIMA 4NQEE 1X4YA 4G7RB 5E99L 5EBMB 4M6ML 4FHBD 5D1XB 3N91A 3PDOA 5I6OA 5EF2A 4PJ8D 3LNIA 1XGRB 2DQEH 1URQB 2JWYA 5AVQB 4C59B 3C2SA 5F7EL 1N68A 2NR6A 3HTLX 1E8XA 1BQ5A 1XF3A 5IQ7L 2ITDB 1UJ3B 4GEIA 3VGGA 3ZRCC 4PJBA 5CJQH 4N2CA 3MNMA 2HLOA 4HFWB 5KVDL 3DRTB 1RZIA 1BF2A 4P2RA 1NAYA 4JFPA 2D0FA 2OZ4L 4BFGA 3VWKD 1YNLH 3MJWA 2QDVA 1IK9A 4C83B 3D6YA 2FFDB 1GKEA 5IVOA 2NY0B 2XXCB 1E7UA 1T6AA 2H88C 2UZIL 3CCSP 1UOVA 5FHAH 1M57B 3Q2YA 1FHGA 1Y1DA 2OXGB 3D85A 5CGYC 3ZIYA 4N90D 4ZXBC 4JQXA 4X6CB 2WO2B 3TT3L 2WP3T 4N68A 4OCYH 1OAJA 5EV7A 3EJYD 5BUPA 3QIWC 1DBMH 5F7WC 1DD4A 3L3GB 4JRWA 1CT8A 2VDMB 1FOSE 3CC1A 2DW5A 3FUIA 4GRWB 5KVFL 2FSEA 4R4MA 3TEWA 3BH8B 2OYPA 1CGXA 2DWEA 3B9VA 3KPSA 2BERA 5CP3H 1ZPUA 2LABA 4GUOA 5KN5B 3CWBD 1OT2A 1ET8A 3FQTB 4L29A 4XRCB 5C08A 2A4EA 2FO1A 1Z9SA 1ZJAA 3ARZA 2DBJA 3MRKA 3K1KC 4PJGF 2HMID 1R5VA 3MA9H 1WS7A 2QR0B 2UYLA 1UT9A 1NAKL 5E1GA 4S1SH 3R8BB 3TWYA 1QFUL 1W72H 1IAKA 1DIPA 2CK3H 1FO0A 4LCIH 2HAZA 2CPCA 4BFOA 3BFWA 5DD3L 3QJVB 4NAJA 3TM6A 2Y6SC 4WW2C 3FFCE 2C9NY 1IBDA 4YBQC 1CDHA 2XG4A 3VI3A 3WFZA 5EU3A 3KPRA 3PJNA 1QHOA 3IJSB 4X6EA 3HPJA 4MWFB 2D7OA 3GUFA 1Y9BA 2JJUA 3IETA 5IBLC 3Q6FB 1ORSA 5C2UB 5FO9A 4Y5YC 1XEUA 1G1KA 4BQCA 3F6LA 1J1OH 1E9OA 4N0CC 4PVNA 1MJ8L 2PWHA 1KLGB 3HE4B 2DIJA 2VWEC 3MJ9H 3MNVA 4MJIA 2VR7A 3MLWL 1Z56A 1ZV2A 3JVFC 3MUZ1 5D1QE 3RKDD 4A6YH 1HAUA 1CCZA 4KY2A 2W81C 5HI5D 3RX5A 1FJPA 1BZ9B 1T83A 3MV8B 3SKMA 1OLZA 2DH2A 2OSYA 3KJ6H 1MJ7H 4IJ3B 5IM7B 1GJUA 1KTJA 1HWGB 5HP5A 2WXFA 1F90H 2H45A 3AS2A 1DJSA 4MAUH 4CJ0A 4EIGB 4FI6A 1EUTA 2LQRA 4HG4K 3S97C 3RBZA 3C5SA 3TYYA 4Y7OC 4PV1C 3GS4A 3BDXA 4F2EA 1U42A 3HIZA 3LCYA 3ZTCC 1HINH 3SDYH 4C58B 1D5RA 4GODA 1ONQB 2ZOWA 4ZFZA 2WK2A 3DV6B 1ORQB 3H3KA 3WNNA 5BS0D 1IC7L 2VDRB 3ZKMC 2O61A 4DKFH 1U3HB 3FXDA 4N8VA 4MXVE 1RFDL 2NQCA 4JY6A 4W6YB 3ARUA 1AR1D 3MRLB 4WSJA 2EZ0C 2BX5A 4PI0A 4XVOA 2NYYC 3DOSA 4OGXH 1AGFB 1U8MB 2DS4A 5CHNB 3QNFA 3VSQA 3FHQA 3D0VB 3CPWO 2IG2H 2X70B 2BWIA 4MA1B 5DMYA 2DIBA 2W0KA 3CV5A 3WNKA 1HESA 4UAHA 1TU3F 1S7SA 1CFVL 3LQAL 3O8XA 2Z31D 4MAYC 4HUCA 4ODTH 3VN0A 1EMTL 2WLJA 3H9YA 1G9MH 1JIBA 3P69A 4P2CG 4E9WA 4XNQB 1NPUA 1JCKA 2YOCA 2DICA 1WD8A 4PR5B 2EADA 4R5XA 3VFOA 5KVGL 1M71B 2X9WA 3U7WL 4G8IB 2ZOUA 3EFFA 3EWKA 1PDKA 3OR7A 2FR4B 5KUKA 3H25A 3KCPA 5IMKB 3KWVA 4UIKH 4QTIL 4PJ5E 3PWJB 4AJVA 3MBWB 3K4DA 1QSFE 1R19A 3QEUA 4HV8B 2YKPA 4G3YH 3U2SA 5EBMA 4ZNEA 2KDGA 2NY4B 5D1XA 3LRSB 4EZJA 4JN1H 3SE8L 5HI4D 1WK0A 1XGRA 2KZ1B 1HH9B 1URQA 4ZUUA 4MCMA 3HZYB 2WXHA 1HOCB 4X9FA 5JIKA 4Y1TA 2VTFA 1JG9A 4LHQB 3QWOA 4GYBA 2ITDA 4UTCA 1IQWH 2VLME 4JFED 4HFWA 3VSVA 1TQCC 4JRFA 4PJEF 3DRTA 4OCNC 2OJ1A 4AE1A 4YHNB 2MOVA 4I4WB 2X0VA 2JKLA 4W6WB 4BRJA 2GFBB 3QR0A 1U3NA 3IRPX 3SBQA 4H0LD 4P07A 4C83A 1OAYH 1JUNA 4FG4A 3B5NC 3QK0A 4HKJB 2OS7A 4ALAL 2FFDA 4LPTA 1E65A 3H1JD 3BE1L 1GL2C 1HVXA 4EMZA 4HPOH 4J6IA 3QNXB 3WE6B 2AITA 4LQ1A 1HSAB 1LNUB 3BZFB 3N41B 3KHOA 1OTUC 1KFAH 1NAML 2BIIA 4FEIA 3CFEB 5E79E 2AXJA 1F3JB 1FC2C 1GGBH 1IC5H 1YMHB 1BZQK 1AXTH 1IGIL 1RUKL 3QUMH 2C1PB 4LGPB 3S5LB 4OIIH 2GVYA 3ZOAA 1RULH 2ZXXA 1IGTB 2PP8A 3L3GA 4DOHE 2RKLA 1Q38A 4PWGA 3SY0B 4YSEA 3ARTA 2EDTA 3Q8EA 4XMTA 5BZDA 3NIGF 3WJMB 1XB3A 3BH8A 4G71B 3U48A 1ZKAA 2TSAA 4AEEA 3TONA 1TYJA 2KC0A 5KN5A 2XSKA 3GJFB 4KHTH 4XRCA 5C1MB 4DNLA 1KJ2A 1MQKH 2ZUVA 5D6DC 5ID0B 2MEJB 1NIDA 5DRXB 1CFNB 1IB5A 2H89C 3CC4P 4LPYA 4X7SH 3MREB 3II1A 3UP6A 4A63A 2W0PA 3QJSB 4WCYL 2BEZF 2BSTB 4DVRH 1SF3A 2DJSA 1QUPA 4D9QD 5I76A 1PL5A 3QXWA 1K8DB 4D7PA 4OR1A 3RWCB 4NAQA 4S1RH 5GTHH 3ECUA 3IJSA 4WF7A 4MWFA 4F20A 5I5MA 1PLAA 2FWSA 4DOJA 3NEEA 1KCRH 4FXLA 1YMME 2KSJA 1EDLA 1FGVH 3D70A 2EE6A 3BD3A 1Z9OA 4R3SB 3CLEL 2FECL 1I8MB 4ONGH 2K4AA 2X4PB 1VQKP 1PY4A 2L3BA 3ULSB 4EBQL 4F15B 4J5VA 2LU4A 3HE4A 3W9EB 2NY1D 1XB8A 1YTZT 3M17B 2Y1ZA 2W8ZA 3HAEH 4G6KH 4N85A 4XPAL 5D7IF 2BP0A 3MNDA 2E43A 4H44D 1BZ9A 1FZOA 2DEYX 3DARA 3MV8A 4K7PX 2GIYA 2ZKYA 4R7LA 3G6JF 4DGYL 1OKEA 1CK0H 4JO8A 1KNOB 4HWZA 2SPZA 2D3NA 1FG2B 2V4HA 5L7XH 4UQAA 2BXZA 1W6LA 5ESQB 2FD6L 1KF9B 5FGCE 3GS0A 4W1TA 5K9KA 5HHNB 4ZRGA 1MWAB 3T97B 4DK5A 2WBJB 2CRMA 3VXOB 2EEAA 5TQ2H 3ROLB 1OGAB 4NQCE 2YBRB 4FCAA 2YPLB 1ONQA 5K9JL 5MEQB 3DV6A 1ORQA 3HUJE 2W8CA 3QUYD 4JDTL 2XWRA 2EE2A 4GW5B 2EC8A 3VNZA 3LPGA 1UTDA 1EDQA 3PCYA 1U3HA 2NY5H 5JXED 2WXKA 5HHME 4UB6H 1KJ3L 3VDAA 3MRLA 2D2CD 5I5JA 1AGFA 1U8MA 2C3VA 3EHBB 5CHNA 2B9BA 3D0VA 3V4VB 1X5YA 1BSIA 1CLOH 1TEGA 4MYWB 4F9LA 5IP4A 2OMBA 3OB8A 2VISB 4ELKB 3ETTA 5FYKE 1IE5A 1OP5K 2Y22A 4K73A 1KCSL 2ZG2A 4ZW3A 4M6AA 4Q6IB 3JWOC 1N8ZB 4MJ5B 2HJLB 1NKZB 1S5IL 4L3AA 4BGDA 4G9DB 4GKSB 5J3HC 3WS6A 3QIBC 1XXDC 5CD5C 1U8HB 1KUMA 2JK5B 1RZ7H 3AG4B 1AG6A 1CR9H 2WTYA 2BOCB 1P2CB 3LZRA 4PR5A 4AYGA 2VL5B 1M71A 3LQAC 1IEHA 3AXIA 2Y5QA 1KYOD 3AMLA 5JO5B 5ITBL 5DMJB 1RZGB 3L9EA 1QWUA 2Z8VC 2FR4A 2O6EA 1N0LA 1QNIA 5IMKA 5D70L 3X11B 2BP5M 4K3AA 2VITB 4KAQL 2D2OA 3PWJA 3WTVA 3MBWA 4LHUB 1IKFH 4HV8A 4OFYD 4J39A 3L74D 3BH4A 1PX8A 2FX8H 2D03L 4R90L 4Y1AB 5FGSA 4B9CA 2XTLA 2VDQL 1HOCA 4NP4H 5I0DA 4Z8FH 4OCWL 3IF1B 5KSAC 1OGSA 4KKLC 4KK8D 3WENA 4L23A 5C09B 3ARQA 3AE3C 3PWLA 1XR8B 1EAPB 1CXIA 3WSQL 4I4WA 1AO7A 5H37G 4OD3H 3B9KB 4P5TA 3CDZB 2GFBA 4QRPD 4AK1A 3CU1A 4HKJA 4NQDD 4PGEB 5FEBA 4NQSA 1U9KA 1I85A 4UTBA 5BVZA 4PD4E 2CO1A 3DPDA 5APUA 3Q5OA 2CJUH 4EJ1C 5AAPA 1RP9A 3QNXA 4QD2E 3T8XB 3WE6A 4UB0L 3DO7B 1HSAA 1NWPA 2G5BB 3I9GL 4FFYA 1LNUA 3BZFA 4DT2A 4GG6F 4X7FC 3D87B 1JNNH 4ZTPH 1QRNE 3CFEA 4ALAC 3CJJA 3OMNB 1YMHA 4MQTB 3H1HG 2FE0A 3CMOL 1YNLL 1HQ4B 2C1PA 1MDTA 5CJBA 3S5LA 3VU2A 2SEBA 4CN1A 1IGTA 3BI9X 3E80A 1DEEB 1X7TA 4V1DD 1QA9B 4GQZA 3I3DA 3HZ3A 4U1HB 3SY0A 2VLKD 4PRNA 5FHAL 3DX2A 4I1NB 2H32H 3BRVB 2DQUL 3VXSB 3W1ZA 1AGCB 2JNZA 2XT1B 3KBHE 4EIJA 3UAFA 4NCC1 4OCYL 3MLYH 1CFNA 2HFED 2BHYA 2BZCA 5IJBC 3MREA 5M7QA 3BCCG 1DBML 1SN0A 3PDGA 4DW2H 2G9HB 1FBIL 4QIRA 4LDLB 3X13B 2B4CL 2B2XH 2BSTA 4N20A 4YFLF 5E8NB 3V2RA 5E08L 3WOVA 1QTPA 1JPEA 1MUJB 4HUMB 1HCYA 1QAWA 4JM0A 3GRWA 4H8WC 2IMMA 2NCEA 4LL1A 1NTMK 3L75E 1EXUB 2M2DA 5F6IC 3BEWA 4DJMA 4KZEH 2IFGA 3IGFA 5DZ9A 4R3SA 4CRPA 1FH5H 5D1ZC 1NTME 1I8MA 3QULB 1HILB 1I1RA 2X4PA 3Q9QA 5AOIA 3ULSA 4B86A 1PY0A 1FAVA 5C0ND 1FFNB 3HE6B 3M17A 1E42A 2ZVOB 3LRKA 5DFAA 3W11C 2ATKB 4OW6A 4RGOL 2V37A 4OJCA 1GOGA 2NY3D 1S9YB 3LS4L 1T66D 4XBPB 2HLAB 1DBBH 1F45A 1DSWA 4CSSA 2IBZG 5A2AA 4PMEA 2DYSB 2XQ0A 5AVYB 3A6BH 4P2OB 4DPRA 1CXKA 1IBYA 1FG2A 4G5AA 4X4KA 5ESQA 3B3IB 2XU9A 5LQBH 4U1IB 2UZYB 2WLKA 4ZYKB 2BNUA 1MWAA 3T97A 1V3LA 3VX1A 1JNJA 3TYFB 4JZNB 3MJ9L 2WBJA 5F7MC 3HRNA 3ROLA 1OGAA 2YBRA 3FTGA 5GS0H 1SQVG 3CZSA 4A6YL 2NZ9C 1P4IL 5MEQA 1BGYG 5E23A 4HYTB 3L9BA 4HWUA 3KJ6L 1BM3H 4LP5A 5DTFB 2VN4A 4NT6A 4GW5A 1EO7A 3E2HB 4MAUL 4DZBB 2UXTA 4IL6X 2PWEA 1DQTA 2WPSA 2YQBA 2BSCA 2W88A 1JXGA 4HJ0C 2G3NA 2JMRA 4ISVB 4PJAF 1K85A 3THMH 4XCCL 2EICA 4AQEB 3V4VA 3RVUD 4TLKA 1BCCE 2VISA 2O5ZL 4ELKA 4A68A 4ZTEA 1YJWP 1I7TB 2AQQA 2HPOA 3SDYL 1NMBL 1N3NB 3U1CA 3CFNA 2IAMD 1SBBA 3BD5A 2JKJA 1ICTA 2C3XA 5EBLB 2LLNA 1C8QA 1N8ZA 3ASWA 4MJ5A 2HJLA 2A45H 4G9DA 3KJ4B 4GKSA 2OULB 2XBZA 3H9SB 5EIQA 2WTRB 1U8HA 4ELME 3TESA 1Q7YQ 4OGXL 4YDNA 1Y6KR 5C0AD 2XQBH 3TFKD 3OD3A 3L5XH 5JW4M 1P2CA 1NTZD 2VL5A 4PJGE 4Z7VF 1OFCX 5AAWC 2DYRB 3SGKA 4UTAH 1QPPA 1E5CA 1TXKA 4X4ME 1XBRA 4P46B 4TVSa 3ULVH 4NX0A 2VITA 4X5RA 3OKDA 3TBWB 1RJZB 1OWWA 2P10A 3L4FA 4PP2B 4LHUA 2X09A 1PIFA 4ODTL 4O02B 1JTTA 3CN0A 3ZE1B 4Y1AA 3H1LD 2FHBA 4XN4A 3S5LG 3U2IA 5B4MD 2UY7B 2R0KH 1BMWA 4WFFD 4KUCF 4BCXA 3ETSA 3IF1A 1IM3D 4PBDA 5HGDB 1KYUA 4PBVC 5C09A 3A0HE 2IBZI 4OGQB 2WKGA 1S7QB 4U7SA 4IIZA 1OX3A 4UIKL 2R2CA 1H3PH 4QWWD 4RGNC 3B9KA 2NUTA 2WQWA 1M1JB 4MRBA 3GMAA 3QEHB 3CDZA 2E74D 4IGBD 1TEFA 4JFYB 5F8RC 4XMKH 1KILB 3A67H 3UBFA 1OP3K 2ZICA 4WGKA 4Q9QH 3ERXA 3TH2T 4M5ZH 4BH7B 3PAVA 3T8XA 3WEAA 3UJIL 2GKIA 2ZX7A 3UC0H 3V0EA 2F7IA 2G5BA 5JPMB 1KTBA 3LH8A 3MJ7B 1A4JB 5D5MB 1GKOA 3SDAD 3EYOA 4TMPA 1FS0E 4PRPD 4MKMA 3UC2A 1HQ4A 1WCQA 2FYVA 4JN2B 2H8PD 4C8XA 3VP8A 2F1BA 3FFDB 3NG5A 1J9TA 1HDMB 4WHCA 4PG2A 5EEZA 1BGXL 1QA9A 2XJKA 4YUEL 1ERNA 4K55A 1RIUL 3SHSA 4HPOL 4WLCA 1QBLL 2XA8L 2OMXB 1KCVH 1WBXB 3VXSA 3C9IA 1AGCA 1QSFA 2F54D 2Q6QA 4DP8X 1KFAL 2B0SH 5TDNB 3T0BA 2ALWA 1YC7A 1TZGL 2EECA 1AXTL 3QQXA 3QUML 5F3BB 4OIIL 1WAAA 2Z93A 1NANH 3T0EE 4E41D 3X13A 5EOCH 4L1HA 4LRIA 4IW4C 5E8NA 5BRZD 3MLUH 3H1HJ 4M5TA 1W91A 4J2QA 4ZXBB 3QDJD 2NTSP 4B9ZA 2NX5D 1MUJA 3GLZA 1KBBA 4XWGH 1FWXA 1ILUA 1DANU 2OKMA 4KHTL 4QR7A 4Y2DD 1MQKL 4G9FE 3G5ZA 4DQAA 1EXUA 2VDPB 1JWUA 1B4LA 4TUUA 4WKZB 3QAZC 4WHTB 3UAAA 1I9JL 3WS3B 1PSKH 1HILA 4WJG3 5F7UA 2ZPKL 3F6IA 4E9LA 4JCMA 5JTWA 2JXMB 4DVRL 1FFNA 1IRAY 3FH7A 3HE6A 7PCYA 2PW1A 1ZLLA 2AQ3A 3BCCJ 2ATKA 4QXGH 1OANA 1S9YA 3MCLH 3FQ2A 4MA7L 3QXTA 4MA3B 4TVPL 4XBPA 3ZL2A 4Z7NF 4L73A 1GMJA 1V5JA 3B2VL 4FTDA 4CGTA 5JOPE 3O6FD 2RACA 1FGVL 2L04A 2L7QA 3B3IA 4MKTA 4U1IA 1VFUA 4YL4A 5FWRA 4XI5D 2UZYA 4HHGA 3AUVA 2CM5A 2DWSA 2BHZA 2WLMA 4UILH 4WW2B 5EZOL 4ZYKA 4PWHA 4I48A 4LPXA 4LOVA 3TYFA 4JZNA 3IU4L 3VFSB 2GG1A 5D72H 3GM8A 1E50A 3ZKXB 4E5XB 4G6KL 3NTNA 5BU8B 3UTTE 5IWLC 5GQBA 3RQ3A 3S3SA 5INCB 1INEH 5E8EB 2IWFA 2HRHA 1TR7A 1NFDB 5G4NA 4L4TB 1KXHA 1O0VA 3L35A 4NHCH 4IDJH 4WI4A 5EZIH 5G2NA 3VFMB 4TUKL 1RERA 3KHQA 1DH3A 2VXSH 3GSNH 2WVRA 4ISVA 5ABZA 3CDCA 1DFBH 4AQEA 3SJVD 1GW4A 4LSDA 3T8MA 3ESPA 2YWYA 1NOHA 2JWAA 3KR3H 5DF0A 2CBPA 1N3NA 3BVVA 3P8CE 3H7BA 2NDFA 4ANVA 4ETQB 2Q3AA 5EBLA 4Y4KC 3NCYS 2ICEB 2CJ3A 4NM8H 2GHZA 1EBPA 3NFQA 3NIGE 3SYOA 4A2EA 4PV1B 1L6ZA 1SQVJ 3GBDA 2NY6C 2WTRA 1BGYJ 1QSEE 3B9EA 2A73B 3VTTA 4JREC 1OARL 3KL5A 4W7YA 1UG9A 2WCSA 4CNIB 1CLOL 2Q2LA 2VZ1A 3MUDC 3RIAK 1PZQA 2CDGA 5F9JB 1ZXKA 5EF1A 5LDUA 1FYTD 1AGDB 2W27A 1UHVA 2FH8A 2WNKA 4P46A 4PIBA 5DO2C 1N26A 4F1ZA 5FECB 2EDXA 4X5LA 1NUFA 3TBWA 1RJZA 5D93C 1PPIA 4LP4A 4HKZB 3NESA 4AI7A 1B88A 1J1EC 4DKDC 5KLIC 4EO5A 3WKML 3PS6A 2HB0A 3FKUS 4M7ZC 4P4KA 1PF3A 1CR9L 3KH4A 3TIEB 2UY7A 2N1TD 3GKWL 1T5WB 3GSWB 3INUL 1HC1A 3HE5B 4DGWC 4QF1B 3U36B 4MAYB 5HGDA 4BBWA 4GKNB 4XWOC 1S7QA 1LT9C 4AW4A 5FYLH 5JW5A 3EYVA 5D7IE 1W5CE 2GJ6B 4JNXA 4YSRA 3V55A 2AVGA 1URZA 1M1JA 3W5NA 1CB4A 3QEHA 4OLXH 5FYJU 5J11C 4JFYA 4EAEA 2EUWA 4ZKPA 1DLFH 1KILA 3G6JE 2FX8L 3H32B 2LU5A 3QW9A 1BZOA 4UNUA 5DGQA 4A7GF 4ACTA 2DKUA 4BH7A 1U2YA 2VGLM 5EFIB 4K9JA 3ARDD 5AKRA 5JPMA 3LPFA 2PR4H 1D5ZB 2ZX6A 3MJ7A 1G7JB 1A4JA 4QPEA 2H2PC 5D5MA 4MNGE 2QPEB 4ODHL 2FT7A 2Q3IA 5L6YH 1N7MH 3LVTA 4WK0B 4FQXB 1Y47A 1CLYH 4PUBL 1NHLA 4WO4C 2YUVA 1P4UA 5T3ZD 1HNFA 2FQDA 1HDMA 4H7VA 1X5FA 1J8KA 4XP1L 1UD5A 1TQCB 4J6RL 1I9IH 4ZAKC 2OMXA 4UDTB 1WBXA 1GY1A 3QDMD 1E8ZA 4YO0B 3RVWD 2EO9A 5CEZE 2HWZH 5TDNA 1JNNL 5B66H 4AJWA 2ZUTA 1PW3A 1A3QA 3ZTJG 2BS8A 3IGUA 1GOHA 5F3BA 1GL2B 4OIAA 5JIPA 2M8RA 4E9SA 2AEMA 2OSLB 4L3EE 2CGYA 4YPJA 3L5HA 4ZXBA 1MVFA 5CM1A 1GIGH 4GBXC 2VSMB 1ZHNB 2BVTA 1G7QA 3OKLB 3GIVB 3FU7B 5KAIH 3B7RL 3O4LD 3QIWA 2KPWA 1ZAGA 4WI6A 2P80A 4CMHC 2I07A 3DBXB 4WKZA 2ED8A 3B8SA 4WHTA 4Y8AA 5K33A 3WS3A 4DW2L 4HS8H 4XO4A 3K74B 5TQ0L 1T0NB 1HJ0A 1YJDL 3SE9H 5CHXA 1CDGA 1I1AD 1WBZA 4AQOA 3S2CA 1B4RA 1AA0A 1H0DB 5KW9L 2R0WH 4GSQA 4XP4H 5F7DB 2R0ZH 2WITA 4HEPG 1KJMB 3GRGA 3VFWB 1T4WA 1N5AA 2GSGB 1KMGA 1FH5L 4IBSA 4UDUB 1FNSH 1ZRTD 4WW2A 2JKXA 6TAAA 1C5BH 3VFSA 1ET7A 1HGZA 4PJFB 3JZYA 4U2YA 1BQRA 2C9VA 1S9KD 5INCA 2F74B 4Y5YA 1DBBL 2OP4H 2P1JA 4YE0A 4L4TA 4BQ9A 3VWJC 3FTSA 1MCEA 3A6BL 3BN9C 2FZ3B 5DJ0B 2GSIB 4PJ9C 5ERWB 4KY1H 1PLBA 4D9RD 5LQBL 1X9VA 4ZS7H 4GG6E 4MMZC 1HZHH 2LT9A 4XCFL 1A7BA 1A2YB 2XOTA 4XN2A 4X6BB 5AW0B 1SHWA 1E2VA 3TWCH 3NJFA 5T5NG 1AZZC 3AT9A 3BC9A 4XPBL 4ETQA 3P77B 1QP1A 4EI5D 4KHXL 5GZOD 1JTHB 2HKHH 4DP9X 3HZVB 4IKIA 3DRQB 5AVZB 5F0LB 4N4YB 5TH2A 3AWEA 3EJJX 3WEXB 5EU5B 3OKYA 3CFDB 3HI6L 4KKBD 1KGYE 2A73A 1Q1JL 5J13C 2R5DA 3THML 2VW4A 2A6JB 4CNIA 2YA2A 3PWPE 4KPHH 4YSTA 2Y7SA 4ZX5A 3HG1B 5F9JA 4TS6A 1OW6A 5IUSA 1MNNA 2YUZA 1AGDA 5FECA 4IS6B 3ZKNC 2BXYA 3IDIB 5TD4A 2ZXWB 1BPLB 4HKZA 4XMLH 3EYUL 3QZBA 4DFHA 3T2OA 4JRXE 5CJOH 3ZL4H 5DHVB 3VH8B 3JV6B 1WAPA 1S7XB 2XQBL 4R97C 3BISA 4UNVA 4S0TD 1H3UA 3TIEA 3H4HA 3LB6C 1T5WA 3GSWA 4YAQB 5GRJL 2ZQKA 1GYWA 5C0FA 3HE5A 5IVXB 2CUMA 4QF1A 3U36A 4MAYA 4GKNA 1UUNA 3QIBB 1EXIA 3ULVL 4OCSH 4Q58C 2K1MA 2GJ6A 4J3OG 3WMSA 3H2WA 1JMBA 1BAFH 1CTMA 4DEWA 1Z9LA 3F6JA 4MX7B 2QJPC