5AW7B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 11.3 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw7B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw7B02
2IPPA 3T97A 4AQRD 1HWTC 5AVZB 1GU5A 1J2JB 2BASA 3P32A 5AW4B 1NWQA 3V4WA 1GK6A 3MGNA 3NXSA 1CI6B 5APVA 4DZOA 1MUUA 3OAKA 2XU6A 3TNUB 2Q7CA 4GT1A 1SLQA 2WWWA 2Z5HA 3WGVB 3A5TA 2WPQA 1HUCA 3VYIA 3V4QA 4AYCA 1GU4A 1T2KC 5AW3B 1A02F 2R5DA 5CMZA 3HE5B 5AW1B 4B86A 2WTYA 3NMDA 2P67A 3VN0A 1DH3A 3L36A 2E42A 2WPSA 1GTWA 5AVYB 1JUNA 3A3YB 3MD0A 3M0DA 3M06A 2WT7B 3VTPC 5APUA 2P7JA 5APQA 4GKGA 4I2LC 2Z5IA 2YNYA 5AW9B 2YO2A 2VRSA 3VMYA 3UIAA 1OXZA 3P8MC 5AVRB 4I6MC 1FOSF 4C7NA 3TYYA 2E43A 3M91A 1KQLA 5AVXB 1MV8A 3TK1A 1CZQA 2R5BA 2N9BA 3KDPB 1GD2E 1A02J 5APXA 2W6AA 3NFQA 1GK4A 5AW6B 2YO3A 2ZXEB 2XV5A 3VMXA 3A7OA 4EOTA 2WT7A 3V5BA 3HTKA 2W27A 3P7KA 2Q5UA 3TNUA 5AW0B 4HYTB 5AW5B 2P2UA 5APSA 3HE4A 2R32A 1FOSE 2C9NY 2WPRA 4JYBA 1H89A 1SP4A 4C7NB 1IO4A 3A2AA 3IR9A 1YYCA 3L37A 1OWAA 3B8EB 1HJBA 5AW7B 2JJLA 4AUWA 4KHXA 5AW2B 5AW8B 5APTA 1X8YA 4C46A 4RETB 3HE5A 5AVVB 3M9HA 5AVSB 3L35A 1NAFA 1CSBA 1G2CB 5AVQB 3I5CA 5APYA 1CI6A 5AVUB 3VMZA 2QM8A 1H8AA 4XE5B 5AVWB 1S9KD 3SWFA 1MFZA 2KP8A 2R3CA 4JYCA 2C9LY 1HBWA 3HE4B 4LC1A 5AVTB 3NTNA 2QM7A 2ZFCA 3KQGA 2XZRA 3LIDA 2H7HA 1H88A 3M9BA 3M0AA 1S9KE 5APWA 1GZLA 1JNMA 3LIEA 3WGUB 1FAVA 3O8ZA 4RESB 4M3LA 2Q3IA 1T2KD
chains in the Genus database with same CATH superfamily
4PJ9D 1U8NB 1DANT 2QVMA 3T6WA 4LCWB 5FOBB 2J8HA 4K5LA 2HPCB 4K2UH 3BGMB 1HESA 4YZFE 2NCMA 2C9UA 1IT9H 2X7LA 3GMPB 3T71A 3MUGA 4MNGB 1WJ3A 4K9EL 2C3WA 2FWOB 2V5MA 4H0IA 1ODAA 3KPLB 4HEME 3A67H 1JVLA 4LPYA 2Y9ZA 1DZ0A 1I9EA 1PZQA 3C5XA 3K74B 5AG8A 2IPKA 2XNAB 4N2LA 2WSEH 4EDWL 5HI5C 3G5VA 1D5ZB 3RL0C 1RU9L 4LCYB 1OM3H 5I1IH 5I6OA 1MUJB 2G4GA 2SEBA 2BM3A 4MS8C 4WWOA 3H55A 5B1KA 3L81A 4NPYB 3NDZE 1WGVA 1ZT4B 1ZRTD 1FE6A 2YNYA 4Y89A 5GGSB 3F7RA 4LPTA 4EMZA 2FUTA 4U3FG 1CICA 2NPSC 2BCCE 2SODB 2H7WA 4KAQL 3TV8A 1LNUA 2EE6A 1H6EA 1OV8A 4I9WE 4Y9EA 4DVRL 3LZRA 2OMNA 3CDYA 3IE9A 3NG5A 4A7GA 3F6LA 2XY1A 2PKDA 2D9QB 1E43A 2PW1B 3FQWB 3P3UA 4R3SA 3VWKA 4MNQA 2K0RA 3NJHA 2Q87A 4Y4KB 1A6AA 4KHXH 4XNYH 4EOTA 5EBWB 3CCVP 3U1SL 5I1LB 1RUML 5ID1B 2D3NA 5I15L 4WU5B 1ZLLA 3N42F 4QHMB 1E2WA 3WEAA 2XWBA 3E6HA 1VCAA 3ARBB 4L9LB 2NY6B 2GJ6B 2EQDA 4RX4D 4DERA 5J8OA 2E5YA 2WD0A 1ZA3A 2NYYC 4WIQA 3WIAA 3D1MC 1A7QL 2FH8A 1FFNA 1NTKG 2VO8A 4NBZB 1MLBA 4XX1E 2Z93A 1OCOB 4MCYB 4LLVA 2M1KA 4OD2A 3SO3C 2A6DB 3T97B 3W0WB 4G9DB 2Q2LA 3S4SB 2OP4L 3T77A 2I07A 2OGUA 5EU3B 1VGEL 3OHXA 3FT0A 2PXYA 4GBXA 2FT7A 1FNSL 3B5NB 1QLRB 4UT6H 3RAJL 3O8XC 5HHNB 1AMXA 2Q10A 3EO1B 4ELMB 2X0UA 4GSUA 1SEBB 2WLLB 4PGCA 4WI7A 5E1IA 1F11A 2OQJA 4NLHA 2LTQC 5HJ3A 3BP6A 4PM1A 4O02H 4S1SH 4XBEH 3MUJA 4V1DA 3VWJB 3EW3B 2J4WH 2DQCL 3SPIA 2CIKA 3HD7A 5J11B 2V17L 6FABL 4KK8D 3H1JE 3CL3D 3B9AA 1GCYA 5C09E 2KZJA 1DVZA 3NTCH 5SWZD 4PGBA 4WY4C 1J5OL 1UKQA 4P23D 5E00A 3UJJL 1MCRA 3RBXA 1YNTB 3BZ5A 3CSGA 3EBAA 3HHRB 3Q44A 4NDMA 1CI6B 5APVA 5T1KA 4W70A 3P0GB 3WIFA 3JCUH 1OIPA 2VN7A 3V0WL 4G11A 2VGLM 1BYOA 4MA3B 2VXQH 2DLIA 4EIBA 1DUZB 5H37G 4G8GD 5GGUB 5FDYA 3UCQA 4WFGD 4Q9QH 4L9DA 4EYYQ 3JSSA 3BSGA 3ERXA 2C1PB 3LPGA 4OIAA 4R0LB 1YNLL 3FO1A 3AJ7A 43C9A 4HKXB 1A9EA 1KFMA 2I5YL 3BC9A 5C0BE 4UU9A 1ZK5A 3WEXA 1U8OA 1VQ4P 1RUAH 3H9HB 2N1TE 3WN5A 1T21A 4HGWA 1IEAB 4YDZA 1CJYA 3VXNA 3ECBB 4L29A 4MSWA 4CADA 2C8NA 4FG0A 2XICA 2QVTA 3QG7L 2WCSA 2VLRE 4AZUA 1QZNA 1ZT1A 2OFQA 3EGXB 5I5IA 5IOPA 4JE4B 2WTRA 4JFYA 5L8KB 4PGEB 2YMOA 4WTXA 3KJ4B 5E8OA 3NACH 2A77H 2N9BA 3Q01A 4ZO7A 3C6LB 5DQ9B 4S1RH 3DJZA 5EIIB 3C9IA 4CN4A 2J73A 4CMHC 1KCSH 4IGBB 5CJOH 5APXA 5AW6B 3RTQB 4DEPC 4V33A 2ZKMX 5H35B 3WEBA 5JYLA 4JKPL 4TKWA 1S5LX 5I5RA 4I3GA 1HOCA 3DUHA 3C5SA 3RL0D 4HYTB 1G7IA 3FYEB 3OR7B 1NAML 1CXLA 4I3SL 4NNYB 1DJXA 4P49A 5KTEL 1UJTA 5D7LA 4LPXA 4UUJB 4WV1C 5ILTH 1UOVA 2IFFL 5E8NA 5FKAB 3T08A 1CO1A 2AEQH 1NAKH 2ZWYA 4FAAB 2DQ6A 1FNEA 3MBXL 3F83A 3QDJA 4NWUL 4ZNCD 2YMYA 1RJLB 3BAIA 1HH6A 4TSAH 5AW8B 2PO6D 1FNFA 1N8OE 3LNHA 4GKLA 4XH2A 2Q2EB 4GQZA 5F8RC 2O4EA 4QNPF 2NTFB 1ZTXH 2WSKA 2JI3A 5IESH 3QORB 3BN3B 2QJPB 4YEEA 3DO7B 1DQTA 2VZSA 3NJXA 2CBQA 4G71B 5HJDA 4ZG1A 4YK4C 1OTSC 3HUSB 2H3KA 4HUXB 1PGJA 5FUCC 2XI9A 2JXMB 2WLIA 4XVUD 3FTWA 1QHPA 4GUPB 4Y8AA 1RZ8A 3EFFB 5KLIB 3BVVA 1HL9A 2K70A 4DZBB 1U8LA 5L9DL 3TS8A 4BEIA 4P9ML 2NY2B 4J1UB 1SDDB 5LXGH 4BQCA 2HMIC 4B97A 4RNRA 2E4TA 1J1OL 2GSGA 5C0DA 3PHOB 3CI9A 1RZ7H 2R1XB 2X6AA 3L9BA 3X13B 4YHPA 4XNUL 5I18L 4WY4A 2ZKWA 4PJFF 3V4WA 3ZE0E 1SLXA 4JW3A 3TA3B 4M4RB 4D0CA 4CVWA 3FB6A 5IW6A 5JLZB 3WUTA 1HFUA 3UAJA 4ZMNA 3G6AA 3EXJA 2G3XA 4A63A 3CVHB 4JB9L 3TBSA 3NSFA 3PWUB 5F6IB 1T2KC 1HYSC 1A14H 1O6SA 3H32A 1HXYB 3MA7A 2Z31B 1EZUA 1WUNT 1NCWL 3S8FB 1RU9H 2KBGA 5I1IL 3MR9A 5TE7H 5JXAH 5EOCJ 1L7TH 2E6PA 2VKWA 2V7HB 1QPXA 4FJZA 4R4NC 2DQEH 5D4JA 5IB4B 4W9KC 3FU7B 1J1XH 3SPJA 3IRCA 3U46A 2EE9A 4C56D 4DCKA 4BHUA 1DJIA 5DURB 1YO4A 1U8JB 3CMGA 2H1PH 1V7NL 2AC0A 3QIWD 1CDYA 5IK3B 1GL4B 3BKCL 4YHIA 4ZKUA 5C2UB 25C8H 2PWGA 4G1EB 4LSPL 1IFRA 4KQ3L 2D7TH 5B38G 1WIPA 2OMXA 1NVOA 3LKSA 3SCMB 5B8CC 5BZWA 3GJFB 3G6DH 1XGRA 1JHTB 5DGQA 3SKMA 1AD9B 2H9GB 4RFEA 4UM9D 5IBUG 2NYKA 5CILL 3R4RA 4MMZC 3V9EA 1MCEA 4K5PA 5D7JA 2E75D 4PG9B 3BHBA 3DV4B 3UG3A 4OJYA 4UB6H 4WRLA 3EBGA 2E8YA 5DRNB 2PP8A 3RFZC 4P57A 3MRCB 4KFZC 4Q6IA 3QXAA 2G5BA 2FL5B 5AAPA 3D0VB 3LQAL 1F42A 2EXYD 5FYJE 1Y18A 5HGGS 4G6JL 3GXIA 5KAQG 1LMKA 4LSVL 1SEBA 5LWYH 4H13D 1TTFA 3K6NA 1FYHB 1NTMJ 4HKJB 4UV4H 1AZRA 2ARWA 4XAKD 1VA9A 5JIKA 1SLWA 4KUCD 2Q7NA 5IZ7A 4F8OA 3W3BA 1A7RL 1CICC 2XETA 3MBED 1KPRA 4QTFA 1FH2A 3I56P 1NCUA 1EXGA 3PHLA 4L37B 1C08A 3IETA 2J3SA 4PS7A 4TVSa 3ZKNC 5CD5C 2JKNA 2R2HB 1NCAL 3SPVA 1KEGH 5HHVL 4OCSL 3A6CL 5H2FE 4XBMA 2A9ML 1RF1C 3AG3B 1IZKA 1JNNL 5IVZA 5HVGB 4HUVB 2JJTA 3RGUA 1BVKB 3WS3B 4UQIM 1MVUB 1OM9A 2MSPA 3LD8C 1AQMA 4Z7UB 1S5IL 1Z9MA 1IQDA 4FA8A 1CTMA 3BP5B 4HMDA 1ZS2A 4N3TA 4NZTL 4BCXA 5D9SA 4N2NA 4BCYA 4M6NH 2QQLH 3C8DA 3FFCE 4WO4C 4JVWA 5M94B 4N5UA 1OAYL 3P32A 3ILQD 2IBZG 4LVNB 1U8OB 5KSBE 1VZGA 1JSYA 3ZMEA 1GGUA 3HA0A 3IAGC 1MF2L 1AVYA 2GBAA 1HUCA 3UAJC 1EXUB 3WXVL 2DMCA 3ESVF 4V11A 1UH2A 2IZ0A 3KPSD 3CGTA 3MNDA 3OQRA 4AGOA 4Y99B 2BSED 2HX7A 2YSTA 2Q8AL 4MFHA 4WEBH 2G3AA 5ACZA 1IM9D 4IFFA 1X7QA 5DMIL 3OXRA 4N5ED 1E4KC 4GXVH 4FNTA 4TS6A 3IFLH 4RCAA 2Z7YA 4TNVK 8PAZA 1I8IA 5AKSA 3C6SA 4FFYA 2WIIA 2YSSB 4LSTH 3LRGA 3QE5A 3GB7A 1UXSB 1R19A 3BPOB 4NAMA 3DTXA 4KJQC 1N2DC 3S96B 3VGHA 1FOSF 4PV9A 2DTML 5I0DA 2FYYA 1SOKA 5B1BB 2FYUK 4PTTA 4GB9A 3BWAB 1DBAH 2NX5B 4ISVB 4LPWA 5HI5D 3AABA 3VXUE 3OF6D 4KNQA 2X41A 3DHUA 3EJQA 3NIFF 3NACL 4GAYA 3M7FB 5AQ0A 4F2EA 4U3SA 2TSBA 1YEFH 2UZXB 1EQWA 1XGYH 2JNZA 5T1LB 5JMOC 3HMWL 4PJ7E 5IUCA 1KC8Q 3BAWA 1TO5A 5AAMA 3MRRB 2NYZA 1ICTA 4ZUVB 3MZWB 1GRWA 1QI5A 2ZAHA 1LO4H 1NAMH 3WSQH 3OGCA 1ZRUA 1OZUA 3X1NA 5KJRL 5ILTL 1F6AB 2VQUA 5E4IA 5HI3D 3ELQA 4PRPB 3GS4A 1HH9B 1ZJAA 3ZKSD 3F7QA 3QH3A 2QTEA 4ZUTA 2AEPH 3KBPA 1JFQL 3AWFA 2WCPA 1BZQK 2YEVB 4IKJA 2XJLA 2DYSB 1OVVA 5E9DE 5KVEE 1KILE 2AK1L 2HYNA 4F7CB 4DN4L 1OD9A 2H6UA 3J07A 2ZCLH 3PQYA 4WO4A 3L7EA 2HWZL 5AVSB 4CC1A 4FNUA 1NAFA 3SO3B 1EXHA 4NZUH 5I6KA 1EEUA 2J2ZA 5H37A 3SDCD 2C9LY 1U8HA 3FQNB 3I9AA 3KCPB 1IV8A 2Y36L 2D9CA 3QI9C 3V55A 3ZMRA 1T8ZA 2ZP0T 4LP4A 3V4PB 1G84A 2BOCB 2LXBA 1MAML 2R29A 3L3GB 2UZPA 4PLNC 5DUML 4PJHA 5EF0A 3B7TA 3GHPA 4NRZB 4CDHA 3PHQA 3R7QA 3STZB 4YSRA 1JWUB 3L3DA 4A7SA 3C08L 4EQ2A 3WMSA 1JYXA 3LAFA 1J0YA 2XRAH 5E4EC 1NDMB 4FFVD 2EIZB 4DOJA 2ZG1A 1X5MA 4CU7A 1J2JB 5CCGA 4WTQA 4MQSB 4V1DD 4PJXA 1NKNA 3MGNA 2H0PA 5JW3H 3VWKC 1NANH 1ZK9A 1K2DB 2FQGA 1D2PA 5CLXA 1KB9D 5DD3L 4X6BB 3WGVB 4ANVA 4KI5D 5C0EB 1NPNA 4AIOA 4MJ6A 3CD6P 4YHKL 5CEXA 4HMEA 4AOFA 3TCLA 2IPTL 3DWTA 4B86A 3B37A 4Q0XH 1T0MB 4YDMA 3L95B 3RP1A 4ZFGH 4POZC 2CM6A 4Z7OB 5CWSA 2NY0D 1S46A 1G9MH 3QQ3B 2PO6A 3UGUA 5DD0L 2MPVA 4PBXA 1KY6A 5CSBA 5D93B 5DUJA 4K5OA 5JHBA 1EHLL 2DKSA 1WT5A 3QXDA 2O61A 3T0BA 5TJHA 5ISZE 3LEVH 3MV7D 1BZOA 1Q4NX 1S7SB 3VCLB 1ZGLP 4EXPX 2ZOKA 1PPJG 2G5BB 3QQ9C 3U6XS 4DNLA 1YNTF 1N3NA 2BVYA 3NCFB 1KILC 2D7MA 1CL7I 3M1OA 5J6HB 4JHWH 3IU3B 3OAUL 5LHDA 2W38A 5D7SL 1H0TA 4PJEA 1TSRA 2QE7H 2PXYC 3VTAA 2OR7A 2RD0A 7CGTA 1BLNA 2D73A 7TAAA 3TURA 3QEQE 4OLXH 1TQBC 2FX9H 4H8WL 4Z3IA 1SNRA 4KZEH 2BH0A 2OMTB 4OLEA 3ARRA 2KHAA 3GZKA 4Y5YA 3HRZB 1TKWA 3O2DH 3QUYB 4MNHB 1MJUL 3OKKA 3OWEA 3WY1A 1WAEA 5GSRB 1M1JA 4WHTA 3SBWC 5BOZG 3RPIB 1CR9L 5EO9B 4NP4L 3K1DA 1MH5A 2R32A 3VG0L 4JFVA 4XB8A 4F8NA 1F3JB 2IG2H 2XKNA 3CXDL 3B8SA 4CNIB 5DJAA 3WHE1 4AIEA 1OAXH 4FEIA 1LO3H 4QTHB 3QIBA 2X28A 5KS9E 2CKNA 1OL0A 5CJBA 4JFFD 3LEYH 3NEOA 3PXHA 3V6OC 5B39A 4HU8A 3QWRA 4TSCL 3EO0A 3LW5J 1MWOA 5E99H 1MFAL 5EN2B 5IROC 4WI0B 2RIKA 4WGKA 1ZXKA 1S7XA 1MCPL 3A6CH 3SIKA 3V4PL 1NDGA 3GLEA 3BRDA 1OAQL 1G6RL 1NCDL 2OR9H 4R7DB 1XR8B 3JTSB 5EULV 4XX5A 4HBQA 1Z5YD 4MAUH 1CBVL 4F7MA 3W0WE 1S78D 2XWTB 3BGFC 1A4KB 4RWYH 4XXWC 2CDGB 1UWGL 2NX5D 3WGUB 3T77B 2P49B 3FCGA 3KDMB 4RAUA 4A7GF 4OH8B 3C5JA 2MOGA 2F1AA 2Z92B 2QGBA 2F1BA 2FGWL 1TEFA 2WNXA 5IQ9B 1ID5I 2G5RA 3X3GH 3KPSE 1I8IB 3LKQA 2V9RA 3VA6A 2FLBT 2BP3A 3U6RB 3ZLQC 4UDUA 3RWDA 5HVFB 1M7UA 1PGPA 2V9TA 1S9WB 3FN0H 3ZQXA 1LP9B 1EFXA 3UMNA 1WRFA 3QXUA 4L2YA 3MUY1 3EXLA 4NNXB 2OMBA 5GRXG 1DH3A 5E8EB 1W5CE 5GSVA 1SJHA 5EZPA 4JY4B 3RIAK 4AM0A 1KJ2B 4UTAH 1XHHA 4IRJB 1ZTXE 1L0LE 2NXZB 2BX5A 3ARBD 1S9YB 3IFLL 2XUWA 3D2UA 4OFDA 4OZGE 3V4VH 1JZ3A 1JGLH 5GRWA 5JNYA 4GKGA 1PG7H 3HZMA 4PWHA 4EZJA 2W80C 2P48B 2HX9A 3S6CA 1PY9A 2X70B 3S3SA 2ZT9D 1TQWA 3CBRA 5DK2B 1L6PA 3VI3F 4RWHA 1DUZA 3WNOA 1MAKA 1N2RA 1T7ZA 3GRWL 3ZKXB 4AKOA 1PP9G 1NCJA 2GT9B 2VXVL 3PJSK 2HLEB 2AJSL 5I8KL 2DQDH 3VG9C 1NC4A 1L0NE 4Q9RL 3B8YA 1FC1A 1JXJA 3DX3A 3H0TA 4N0UE 2UWEB 2WZPA 1AO7B 1YY8B 1QSFB 3HR6A 5CKAA 2BNQA 4Q14A 3ES6A 5IB3B 1BGYG 1UHVA 3TASA 3PQYE 2P5PA 3L71D 1MJ7H 2CLRA 1LLAA 4W9HC 1TXKA 5D8JL 1OP5K 4PJGB 3MGTA 1G7PA 1IGFH 3VXNB 1FGNH 2J6WA 1KYDA 4G8EA 1C12B 4JM4H 4F9LC 2VITB 3RGHA 5JZ7D 2JFCA 2VDMB 4WJ5A 1ZT1B 3EGXA 4XBGB 4WSKA 1YN6B 3QS3A 5CMAB 1EVTC 2A6JA 2P26A 3V4UL 1U9KA 2C3HA 2VC2B 4DWHA 1OWAA 4P23C 1MW2A 1SQXD 4U6XB 2XTJC 5GS0D 3QPQC 1OMIA 3AUVA 3JUZA 1UENA 3CCHA 2MTPA 4HQQL 5I82A 2JR8A 3KVPA 3VXQA 4KMTL 3NABH 1BQHB 1Q1JH 3QFJA 5BUAA 2H47C 2PW2B 4N0UA 1FFTB 4HIXL 1QBLL 4KVCH 4NUJA 5EC2A 4EIZC 3NK4A 4PTUA 5DR5H 1AKPA 1SRDA 4A55A 1D7BA 4HCGA 1MAMH 1S7VB 1C7TA 1DQLL 1I85C 4DKEH 1DSYA 1WF5A 3SZKC 1JZ8A 1T6AA 1OF2A 5SX4H 1L0LK 3R2PA 4Z7NB 5JQHC 4GKOA 3U83A 2Z4EA 4FLRA 2FECI 2ESVA 1HH6B 3OAZH 1JNMA 3LH2L 1AGCB 5KLVJ 1WK0A 1DN0A 5JA9A 43CAA 3KWWB 3D39B 4NQDE 2XA3A 3EG9A 2FSDA 3BWZA 3U0PA 1OAJA 2JI2A 2I27N 2OW7A 3CQQA 4JFFE 1RERA 4UAOB 4TUOB 5BW7A 4R97C 1UUNA 2ROYA 5KSVB 3L5IA 1AP2A 4R7LA 2VDMH 4YS4A 2XU6A 3JQOB 4OCLC 1MHCA 5GRUL 4HB1A 1JNHB 1YPZF 2DLFL 3RKDC 4GP5B 1UEYA 4DP5X 2JV6A 4HXBH 1H6UA 2O5XL 1L7IH 3NBNA 2YKQA 4YO0B 2YXVA 4A6YL 1RE3C 3TNNA 1UXWB 1KIQA 3VGDA 1CUOA 5GRVL 3V9CA 3JBG7 1QVOB 5CIPA 4S1QL 1SBSL 5I17B 3C09C 3MD0A 1OGAB 2ODHA 3QDGD 5A3ID 3MBWA 2IFGA 2CXGA 2UXFA 1CD8A 1LJMA 5FYJH 4RMBA 2D7OA 2CIIA 3V4VA 1QFUH 3MU3A 5C6TH 3VNZA 3O3UN 3QO1B 4OZFA 3MTRA 4AMWA 5CBAB 3MO1B 2R7EB 1EDKA 1VIWA 3W11D 2CK0L 3TGUE 2VLRD 5INDB 1NJ9B 3PWVB 3L74E 1OT1A 5FM5M 3L08A 4DETA 2X10A 4ERSL 1MNNA 3GK8L 3QIUA 4M5ZL 1YJWP 1ZRTE 2MMXA 3ZTNL 4IOIH 1JPSL 4WK4B 4AV5A 2WVVA 1SQPD 3K6FA 1P7QB 4R9HA 4JFOB 5ADOH 3UO8B 4AYDC 2EE0A 1OWWA 3U46B 4QHLA 3CDGB 2P5WE 1A6WH 2Z7UA 2Y7MA 3LZLA 3MV9B 2DJSA 3TFKC 2O1KA 2XC8A 1S7XB 3G5YB 4W6WB 3JSVC 2WNKA 4R4BB 4P48A 2P2UA 2GK0B 3LRHA 1H3XA 2EC8A 1ZE3H 4BJLA 2Z35A 5HYSB 1RIVL 4EZKA 5AZEH 3K71B 4MA7H 5C0CE 4JPKH 1KUMA 1MKFA 5G2NA 4DVBA 2X0WA 5KSBF 1LK2A 3M17A 4TSCH 2C9SA 4PB0L 1P4UA 2OK0L 3NP4A 4W6XB 3PWNB 2R69L 2R2EB 1FFPA 4U3FE 1UG9A 2ZIDA 3V4PH 5I6MA 1Q90D 4OI8A 3RQ3A 4Y1AB 1QSEB 3MROA 4JRXA 1OEZW 1PBYA 1SYVB 4L8CB 1KIPB 2ESVD 4DHLA 4C56A 1AO7E 1JMBA 5DFTA 3MRHB 4OCXL 5LAXA 3V10A 4K8RD 1CU4H 2J8UA 3IDYB 2AQTA 2BVOB 5DJ8A 4EUPH 5E6YA 3ZBMA 4YGAB 3NA9H 3DRQB 1IX2A 2Y0CA 2CAKA 1YMMD 3FDWA 1C8QA 4W4NA 4PRAB 2UY7B 5KLIC 2HRGA 3CFCL 3GDCA 4KRMB 2JCCF 3H1HG 3K2UL 1G7LB 3T1FA 3OR6A 1GZPA 1D6EB 5BS0B 4CPGA 2F2HA 2E4FA 2NNXA 1C7SA 3WEMA 4J3UA 4NI6A 1GYWA 3AEGC 1IGML 3KD4A 1U93B 3RVTD 2G2NA 1BVKA 1MWAL 2GABA 5F9OH 3CMOL 3AECC 4L4VD 5JW4R 4JPSA 2Y24A 4MMXB 4KVPA 5JDJA 2E75C 1BF2A 1QBBA 1FZGA 4LLMB 1SDYA 3RDTD 4JDVB 3ILPA 1F13A 2EIBA 3V95A 1X5ZA 4L3EA 4WNJA 3CCSP 1SGKA 5JIPA 2R56L 4XGZB 3VSQA 9PCYA 2WZAA 4X5RA 4ABVA 3FL7A 2XWXA 1F00I 3ZE2E 1UIXA 3QUMA 3KPSB 1AR2A 2XQYG 1R3LA 1M3IA 4NQEB 1I9IL 2R0KL 5IVOA 4E9XA 4WJG3 2KLVA 3Q05A 2HP4A 1ZMYA 5FC9A 1QFOA 3ZYOA 4HJSA 4WJ5B 4HS3B 1JWMB 2CO3A 4FQCL 4Z0BL 4IU3A 1DBBH 1HIMH 4JGJA 1JL8A 2JJVA 3WJLA 4BCZA 2IBZD 2K4WA 1TVDA 1JY2P 1WFIA 2ZKYA 5E6SB 3UYPA 3V0DA 3MJ7B 1U2YA 3RKPA 3TL5A 1XGPA 4HWBA 4JEGB 4KXDA 2DI7A 2A74A 2H32B 3DK0A 1UD3A 2AXGB 3GJEA 3H4FA 4POZD 4F2MB 3AG4B 4JO2L 2VR3A 4MRBA 4Z7QB 1A4JA 1YPZE 3MUGB 4HEMA 5E95B 4P8QA 4P99A 3GWJA 3MNZB 4FYTA 1AQHA 4L1BA 1G5GA 3FOMB 3IF1B 5BMFH 1IJ9A 2CRZA 5D1QD 3QEHB 4PVNA 4UTAA 2BSSA 4M8RA 4ZMLA 2FX8H 4CVXB 3FC8A 4X7TB 5GHWL 3CFMA 4I1PA 3GJFK 1VQ9P 4F58H 2YEQA 3VXSD 4B7IA 3QCTH 5ID0A 1GOFA 2YAQA 4G42A 4MMXC 3QCVH 3TM6A 2GITB 4YSUA 1U95B 1VF5C 3VXRA 2N1TC 2IDUA 5GZND 1VFMA 3T2OA 4ESKA 1IGCH 5DUBA 3ZDYE 3F5WA 1TCMA 4YEFA 3JV4B 3L5WA 3GLDA 4JG1L 3HI1B 1OTSD 2HT4C 2A9AA 1TYRA 4Z0XA 1FLRL 3LS5H 1WBZB 5AKRA 2H1XA 4GRMA 3RK2D 4OF3A 2QJYC 4GS7C 3CU7A 2GI0A 3DUUB 4DP4X 3S37H 2ZJSE 1WH0A 3M07A 1M4KA 5KUMA 2WSCJ 2G60L 4Y9GA 4N0FA 4U05A 5BV7L 1CIDA 2SPZA 1OVUA 2H88C 2J2ZB 3EH5B 2YGOA 4TLTA 1P1VA 1AJ7L 3SE8L 3FQ1A 5L8JB 3B5NC 1GIGH 3MLRH 1DQMH 1WHPA 4XCEA 5AL0A 1Q81Q 4GXUN 4ZNEE 4M02A 1AQKL 3D6YA 1GU4A 1XF2A 3D71A 3L1OL 1HHJB 4AMKL 3OC5A 4P4RA 3WJJC 3MLTA 1Q72H 3MLXH 4U31A 1KB3A 3D48R 4N8VG 3IYLW 3G6JE 3CU1A 4P5TD 4Z7WF 1JGDA 1IAOB 4ZMXA 4JGMA 1XXFC 1LT9B 4M5TA 3FOLA 3I50H 3O2WH 1HCZA 3H1JD 5HYIA 5C6TL 3EYSH 1XGZA 4MNGE 1LGVA 1BFVH 4RO0A 1Z9SB 1BXVA 3ARDB 4O00A 1HJBC 2OPCA 2XN9B 5F7EL 1IIKA 5C0GB 3IXAB 4OFPA 2OX5B 1TLKA 1JYWA 2B0SH 2IH3B 3BAKA 3KR3L 3KYAA 2N56A 4ONHA 3VFNA 3KXDA 5F0MB 2ZUSA 1E4XI 1TZHA 3BLPX 3IDMA 3ZZSA 1FL6A 4NZ8A 3KDPB 1JYVA 5KANI 4FQIL 1KCBA 5LCVA 2J1YA 3MZTA 4ZX4A 1G7MA 3KPOA 4X7SH 3CXHE 1A21A 1X5JA 4M7LH 2OZ4A 1PDKA 4K35A 3FB8A 3L9EA 3DVGB 4YSSA 4PCKA 1BREA 2JCCA 3E7JA 4P2OB 5DWUH 1L9TA 2CLVA 1BLIA 3L3KA 1CG9A 1K8DA 2IZ1A 5K1JA 3T0XA 1SQPK 3HC0B 1BBJB 4HK3N 3RPBA 3L3HA 1JY2O 2KXPB 1QZ1A 1A6TA 4DP2X 2P24A 1JMMA 1OQOA 1OW0C 3JWOL 1I7TB 1L9RA 4DP8X 2VL5A 5HP5A 1HQRA 4KHXA 2DRUA 2DL2A 2K1MA 2FHFA 5EBMB 2Q9OA 1MRDL 3QEUB 3TGUJ 4X7EC 1M6UA 4XVSL 1KJVA 1ETZA 5C0NC 2FEJA 1TKWB 3QUYA 4HKZH 3LMJH 4EZMA 2VWEC 3VMZA 3U2SA 3LQAC 3BVXA 3S4SA 2A06D 2F1EA 1GGIH 3MTXA 3SQRA 4Z7OE 1SQXJ 2BP8B 4GXUM 5ALCL 3L72D 1WUZA 1IBYA 4YLBA 4K3DH 3EHBD 3UGXA 1NM9A 4G3YH 2LE9A 4PB9L 5TGBA 3WOVA 3CZNA 1BAFL 2H6PA 2DDQL 1KB5B 1SQMA 5E2VL 1XTLA 4NJAH 2WXMA 3F7VB 4OB5H 4KZCA 3HE6C 2W8CA 2VERN 4EI5C 4FLSA 2KERA 1FHNA 1NIDA 5C9JA 3V7AE 3GHBL 4JM2B 5DMKA 2Q8BH 1AHWA 1INEL 2JKRM 1MCDA 4JZNA 4KZDL 1R3LB 1XH3A 3GIVA 3QDAA 5BRZD 4PVBA 3HBPA 4KNUA 5E4AA 4S2SB 4M1DL 3SGKA 1S1CX 1E5BA 1M7IA 3PP4H 4Y19A 3C60C 5LCVL 1S4IA 2M3BA 2W83C 4GEJA 1CXIA 4QR7A 5D1XD 3SFDC 4JFQA 5DK0B 1A6VH 5J13C 3KYNA 1BCCE 1E9OA 2YAOA 1UJ3A 1V54B 2R83A 5DEGB 3ZO9A 3QYNA 2ZYGA 3O0RH 3T3MF 3DOSA 3CXHH 2F53B 3G5XA 5F1NA 4ZTPH 1CDHA 3UBXB 1LTJB 3UTZA 3LKQB 3WNJA 3KLAB 2J12B 3Q1SL 4G72B 2VN6A 1K9MQ 1GHFH 4G8GB 1FJKA 4NO3B 1LP9A 5D4HA 5AAMC 2C34A 4G6KL 1FFOB 2AAAA 2OSXA 4AKQA 3OB8A 3UBGA 1KMIZ 1U3HB 2H2SC 4PP2B 3BKJH 4BKLB 2VLKE 1MRCL 1QQDA 1MFBH 5EUKA 2J44A 2VUKA 3J2PA 4H0HB 4YVUA 4H20L 4HCFA 3KLLA 4JRYB 1QL1A 4Y19E 3VG9B 5CJQH 3VSVA 3BEWA 4BK5C 3AS3A 1YUHA 4NFCA 4WU7B 2OTJP 2ATPA 2CK2A 1E79H 4FKKA 4JPIA 3I74A 3W2DH 1HVXA 3MDJA 2VUOA 3VXMD 1QD0A 3NA4A 5HYFA 4Z6AT 1HEZA 5CJ0A 5KSAB 4G5ZH 2XTJE 4YDVA 5F7MC 4YWGL 5ES4B 1LGHB 1S7UA 1CZ8H 3O3BB 3PFUA 2JI1A 5HGDB 2ZXXA 4N0YH 3WKQA 2A0LC 1VZHA 3B8EB 1NZRA 4FQLL 1KQSO 5GGTA 3V8OA 4B3VA 1CD9B 4GI6A 4P5KA 4XRCB 2YA0A 3ULSB 5KBLA 4APQD 1Y7VA 1FO0H 3N91A 3RX5A 3NH7H 3WO4B 2VDPL 3PWJB 4JQIH 3STBA 2CRIA 3PABA 4U0QB 1MJ8L 1CDJA 4CC4A 3OWRA 5KG9A 2QL1A 3QP3A 5JTWA 1H6FA 2BC4A 5AFAA 2E76B 4LFHD 1RZKH 4GO6B 2NT1A 3W37A 2OJEA 3GM8A 2IV9A 1RY7B 5I0XA 3WIIH 3QQNA 5KVGH 1J7VR 1CE1L 4F15C 4LGRB 3DTUB 2AQ1A 3L73G 1OSPH 4PAZA 4ZO8A 3L3JB 5DHYB 3L74G 3NZHH 2KDYA 2DQTH 3V6OA 1H0DA 2WXOA 5F21B 3HPLA 3QIBC 5TQ2L 1TG8A 4NUJB 5JYMA 3IGAA 2WPGA 1EFXD 1T89C 2K6ZA 1SVFA 4A7PA 1RHHB 4NP9A 1X4YA 5KEZA 1GPOH 1F4HA 3VWKD 1LO2H 3GS0A 5MERB 4D6TG 2X4OA 5FA4A 3ESNA 2CO7A 1M1XB 3HIZA 1UA6L 1EO8H 2EAEA 4GRLC 3LRSB 4YDIH 2Y6SC 5I73C 3AU1B 4KK9C 1KXQA 1OP4A 2FWSA 4N87A 4QKXB 4U6VL 3I3DA 1ZP0C 2R5DA 2YMKA 1TITA 5ITFA 1USQA 5FGRA 4YSQA 3FB7B 3ZL4H 4HS6A 4KTDH 4RAHA 3CX5E 3MA9L 3VTPC 2D8KA 4MDRA 1KGXA 1H3PL 1X7SA 2B8OT 5TDPA 2YPKB 5FYLD 1SVCP 4AQEA 2CJSA 1AP2B 2OYIB 4PREB 1T0NA 2YUVA 5JXED 1ZMEC 3ATBA 4NUQA 3QZOA 4I9WD 4BQ8A 4F37F 5FHBL 2B1HL 1LEIB 1L9SA 2QKIC 4G82A 1NWPA 2HG5B 1F58L 2WWKT 3HAEA 4K94C 3KPNB 1KB9J 4NQVB 4O2EB 5IMKA 5IK3A 3VFRA 2ITCA 4LO9A 3FJTA 1OB1B 4QXGL 1ZGLM 5C08E 4HKBA 2ZYDA 1JNJA 3T4AC 3E7KA 2CKBH 2Y4SA 4BE5A 3GKWL 3CN0A 1QFWL 3MNMA 3Q6FB 5ESAB 1K4DB 3DXAE 3SQOH 5GGRY 1E3FA 3N40F 1BCCD 3APCA 4LLQA 2IWEA 4I8DA 1BFOA 4I3RH 2NRGA 1ET8A 5ABAA 3SWYA 2WXLA 4DKDC 1P5UA 1J5IA 2WXJA 4XP5H 5KWYC 4KRPC 3NP3A 1DJWA 3SKOA 2ZWSA 5JW4N 4QOKD 3CQPA 4HVBA 1HJBA 3B3IA 3P3RA 1MDAA 3RK2B 5JHDD 1H8OA 5EMYA 5IGXH 3FH7A 5TJWK 3NJGA 2VSMB 2JK5B 2CA3A 1KSRA 3REVB 5CR8A 2N7SA 3IJEB 3USSA 1GGIL 2DZEA 5BOJA 5C0FA 2Q9IA 3G5YA 1I8AA 3HB3B 4PUBL 2H2SD 1WFJA 4GSRA 1CFVH 2DICA 3CWBE 3BDYL 1ZA3B 3OMZA 3CHPA 3HCVB 1ZDQA 4NQSA 2E7MA 4XPFL 1R3KB 2ZWLT 3RZCC 1IC7L 1U3NA 3TN0B 5I8EA 4WWKC 4YZWA 1QFWI 3D70A 2EYRB 3S48A 4WSGA 4F8PA 1D5XA 1WRGA 4AYMC 5I1DA 4ETQA 2ZOOA 5BZDB 4JR9H 1OTUC 3M17B 1WE5A 5FUOL 5DQDL 1I8KA 4FMFA 1JGVH 2DS4A 1MEXH 5JR1H 1A4BA 5ETUA 4X99A 1NTKD 2WQUA 3DX6A 1ZW0A 1ACYL 2DMBA 5CN1A 5DJ2A 1U7MA 2R9HC 4G9FA 2AI0H 3NFNA 1YITP 2AQSA 2CPBA 4UANA 5A16A 5AD0B 4PJ7F 2AJVH 1XTGB 1I1AC 4KROC 1DSWA 4FJYA 3PYCA 4LSSH 3VRJA 2NY3D 4RBPH 2AQ2A 4K7FA 3UJIL 5FGCB 4N0CD 3AS2A 3MRBA 3VI4B 5CGBA 3LIZA 4FQXA 1UH4A 2V33A 1KF9B 1GL2C 3FMGH 3TFKD 3VXMB 1IUZA 4OLVH 1OPGL 2K37A 2QTVA 4XP1H 3BEWB 3M8OH 4OLWH 3U0TB 5E2JA 5CCHA 1TVHB 4M9OA 3VSTA 3OZ9H 5DJZB 3BWUC 4HPYH 4JO5A 3WFBL 3AE1C 2VLKD 3LH8A 4WI3A 5HY9A 3A67L 3W68A 1BWMA 1QAWA 2BNRB 2VDQH 8FABB 2WIIB 2YSSA 3ZXAC 5GGRB 5SX5K 1J10A 1UD8A 4GOEA 2NZ1A 4YQXL 1FV1A 2VAAB 1MFBL 1WITA 3UBXI 4H8WC 2NW3B 3VGBA 4A6YA 1ONQB 4WLCA 2D0FA 2R0WH 2YKPA 4TN9A 4I0CC 5TF1H 1DJHA 2B1OA 2GA1A 4HUWA 15C8H 3SPHA 3JUYA 2N0MA 4Z7NF 5F9DC 2ENSA 4ODXB 3UP6A 1P7QD 3FT4B 4RFOH 3QUML 4BRVA 2QV2A 4O2CA 5C0RH 2F08A 3UMTA 1XX9C 3KPPB 1YEDB 3S88L 3FQXA 1FS0E 4G6ML 4IRSA 5FO8A 1J05A 4YN3A 2QQNH 3U4EB 1PZAA 1PW3A 4LVHC 5DZOA 3FU9A 5MI0B 4KRNA 5CP3A 5GZNA 4PW9A 1XB6A 3VOPA 3FCUB 5FW6A 2V2TB 4NERA 3VE0A 4F8QA 1G0YR 5TISH 1IBHA 3CJJA 1X9RA 1JCVA 4Y16A 1RHHA 3OA7A 5IHUL 5I1GH 1OP5H 3NZ8B 3B2VH 2NSQA 3GSQA 1OCWH 4Y2NA 3TPUB 4AVJA 5GTHE 1HDMB 4LIQL 4NAJA 2CJTA 4ZPVA 1CDGA 5DJDB 4ZS7L 4IMLB 2JLPA 4XI5C 1YDPB 3O4LA 4OKVA 2P52A 2EZ0D 1IFGA 3IVKB 1T2KD 2DQJH 3W1ZA 1VQNP 1MLCA 4F2FA 1HYSD 4S0SD 5IG7A 4NKIL 1RK1A 1WD9A 4U7KA 1QTYT 3PXLA 2FEDC 1NYHA 2B88A 4BZ1L 4MD4A 4AM0Q 3WUZA 1D9KD 2OYIA 1YJDL 3DX9B 4PREA 3V6ZA 4JN2B 4UAOC 4LDCA 4L73A 4HD9A 4GRWB 4O02L 5ICXA 1L0LJ 3JTTA 3VXTA 4P5TB 4JBZA 5B5EE 1JK9A 1KXVA 4YDIL 4B5EA 1QTSA 3H53A 4IIQB 4ODUA 4Z78A 3RL2B 3ULUF 5K1NA 2KSEA 1FZOA 4LAQH 4ADJA 3KS0J 5T3XE 4G8IB 2MQ3A 3KXFA 1KLGB 2YAMA 3TCLB 2FJHA 5CBOA 3A3YB 4GYBA 4JFED 2DYRB 2OSLA 5F7KC 5FR3A 2DLHA 5CUSH 1VCBC 3AB0B 4L05A 3QIUC 4OCRL 3N1FC 4XE0A 3MMEA 5TF0A 3U1SH 5DZNA 1DUYB 1JZFA 2WBKA 4HG4J 3DSNB 3GQFA 4JM2F 1TYJA 1QI4A 1XAKA 5LGHL 3NQIA 1S8DA 3M91A 3EOTL 4MMZB 5ERWA 4YDNA 3RDTC 2DQHH 1NTMK 1KBBA 2N1TD 2JSFA 3I9PA 3AW5A 3WTYA 3TFBA 3O3DA 1THAA 3PJNA 2QGEA 3DRTB 4YAQB 1EO7A 5IV2B 1PLGL 4G6AC 4ZX5A 4B9FA 3G9AB 4Y2OA 4DCQA 2GTWB 3GC3A 4Z5RA 2VDPB 3EAKA 4ES9A 1KIRA 1IAIM 5CHNB 1AD0B 5GRZA 6CGTA 4RZKA 3B43A 3CZUB 4I3RL 3GW6A 3VGAC 3EYUL 1AR1D 2HFTA 2CNYA 3EFOB 1CGXA 3ARGD 4QRPB 5HPMA 1QSFD 3VFPB 3QUXD 3UZEA 3WELA 4FABL 5DLLA 4BZ2A 4Z7AA 5DDHA 2J5LB 3B5ND 4BHUI 1YAIA 4FQ2H 1KD1Q 4WFED 1RQVA 4S1SL 4R4FH 4XBEL 3FT2B 1FDLL 3KH4A 5K93A 3MJGX 1VDGA 4BFBD 1SQVD 2X4RB 1U8NA 1Q94A 2FECL 4XMLH 4AQ1B 3RYMA 3SKJH 5IHLB 1MCNA 4Z7VB 3OPUA 5CP3H 2P28B 5KTEH 2X1OA 5C0AB 1NMBH 1BV8A 3BVUA 4PEEA 3SKNB 2JB5L 3FU0A 1SHWA 3HG1E 5CKGA 3O9WD 1IIIA 3MPCA 5E1QA 2APTA 3E8UH 3ALWA 2XWJB 1CLZH 1LD9A 1DJGA 1RIUH 4R5VA 2FO1A 2NXZD 4AEFA 2G3MA 2MKLC 3CNKA 3FB5B 2ZX8A 2B59B 3JZYA 3QYCA 4P46B 4FX5A 1LILA 4HOXA 2BFVL 3ATAA 3X3FL 3MQIA 2Z8WC 4UTBH 4NXSA 5DMJB 4B9GA 3PDOA 1DQDL 3CSBA 4O4YH 1AGEA 1VF5D 4LSRL 3K6SA 4YHLL 3FF7A 2FKWB 1ACYH 4KI5C 4E41E 3RFRA 5AZUA 2KH2B 2VMEA 4MAYD 5HHOB 5IWLC 2EC9T 2CGZA 3UBFA 4YK4B 4C57C 5DMGC 3FRPA 2MCAA 5CJXA 2Z5HA 1JAEA 5LO7A 2AITA 3QDMA 5C0JB 4HUVA 4F5CE 3T4YB 5L9DH 4FLHA 2Q7AA 4BSVA 1ORSA 1DQVA 4WVZA 1I75A 3S36L 4BUQA 5K9KB 2W90A 4XNXH 4FXGB 4K5MA 4ZYKB 4HFWB 1XF4B 3FSVA 4HC1A 4K71B 4WKZB 5F3BB 5KVMC 4JFUA 1FSKB 1PJWA 2R29H 2XPGA 3NMDA 4WFHE 1IK9A 4PGZA 1BD2E 2AEMA 3HG0A 2X6UA 1QNIA 1P5VA 1U3YA 5DZJA 5I18H 3A6BH 2HX8A 4HHWA 5ADPL 4MQ7B 4XMVA 1PNDA 1OQXA 2WVRA 2NLJA 1XH3B 3A4AA 1U42A 1VQMP 1B2YA 4LHJB 5KOVC 4AC4A 3K8MA 5IKCA 1IBDA 4TL4A 3FTZA 4ODSH 1PD6A 2WXHA 5EZJB 5FO9A 1FYTA 3D0LB 2WXRA 4JG0L 2CO4A 1A14L 1X4XA 2X89D 4Q8BA 1TTUA 5DUPL 3AE3C 1YIJP 1SEQL 3F12A 3UAFA 4RSVA 1HEHC 1RJZA 3FBKA 4P4KB 5CCJA 2AXFB 4PI0A 4NT6B 3LY6A 3LIZL 2WGXA 3TIEB 5DYOB 2BSBA 3U4AA 2OMZA 4JGNA 1UVQB 5F9WB 3BH4A 3VYOA 4ADIA 2O6FA 4IHOB 2WXNA 1NLDH 1ZLUH 5CCHC 1B4JL 1ODUA 1GGCL 3ZZLA 2V2TA 1M71A 4LSPH 2YOCA 1J0JA 1FORL 2QV4A 3WU2E 2CJUL 4UQAA 1EVUA 4WWID 2E5TA 3Q5SA 1AXTH 2NX5A 1E8YA 3DMMD 4LOFA 4Q97A 4QF1A 2IANB 2NY5H 3A23A 2NSXA 3T4AB 3U9PL 4QYAA 3AEEC 1MHEA 3ZDZE 3WFHB 6PAZA 4J3OF 4N1CA 1RZPA 4N26A 5T1LA 1IZNB 3FUNA 3G3LA 5MEPA 4HH9B 1JGUL 1V3JA 4Y16D 2WKOA 4H8VA 1BW8A 4Z7VE 1BIHA 2QSIA 2APSA 5I1JH 5I1AB 3MLYH 1M42A 5I6PA 3EJUA 2GJPA 1QNZL 1SJEA 4EKXA 2Z8RA 3T65B 2ZG2A 3TH3T 3HZKA 4I5BB 5E8PA 5LQBH 1D5BA 2XHNA 3UTTD 5EU7C 3WUVA 2X1WL 4NYLB 4LIQH 4U1IA 1PD0A 3LCYA 5IHZA 3O8XD 2XZRA 1L4AC 2C9QA 4OLUL 5K9OB 1GMJA 3O8XA 2DQUL 3K6IA 2VXTL 2EIDA 3K46A 1X3DA 3MAWA 4YBLB 1ED3A 5A43C 4Y4KA 1MCQA 1IB5A 2DQJL 1J12A 1MZYA 4TSBH 2LAAA 4BKSC 4FQHA 4JCLA 3R06B 5CHXA 2CA4A 3DNKA 4GRLA 4GQRA 4J23A 4L1HA 5IMMA 3ABKB 2V6HA 4K8RL 2VDOL 2IBZX 3D85A 4B27A 3UTSA 4ABWA 1BWWA 1E50A 2J88L 5HYSA 4GUOA 3GF7A 2QSQA 3EJSA 5I76A 5IEHA 4AYCA 2R3SA 3HB3D 3IDXL 2IALB 3BKCH 2QVKA 5DVLA 5EFIB 1FVCA 3UPAA 1REIA 2WLKA 4CKVX 2Y0SA 4LL1A 3MLPA 4GBXC 4DQOH 1XCQB 3HUJA 3MXWH 3DV6B 4QGTA 5JXEA 3O6KH 1RPKA 4L9LC 4HIHA 4KKRA 4MB4A 3ULUE 1G0DA 1VPOH 3HHSB 1WO2A 3OJDA 2EVHA 4WUUD 4D8PB 3H85A 2H1LM 2VDLL 2DM3A 4HPOL 1ZE3C 4NM8H 3T0VA 1FNEB 2BVTA 4UIKL 4ZMZA 4ELMF 4N8VB 1KTLB 3RWIB 3MCKB 2BHYA 3MFGB 2Y5QA 2J6EL 3CFIC 4HZLA 2XVKA 1M1JC 4P3DA 5HGHB 1BGYJ 4GKSB 1GGBL 2CMRL 3SEPA 4GXVL 5CFHA 2OL3H 4XVJH 1I53A 1EHXA 4AW4A 4UILL 4PV8A 2VISB 5EF3A 4PJBE 2DQFA 1WA1X 3UG5A 2DTMH 2CRYA 2VW7A 3K2MC 3GBMH 3QQ4B 5LBVA 2ZOLB 1NCAH 1KEGL 4F7TA 2DWSA 1LDSA 2ADIB 4BH8A 2IH8A 1PEWA 4FLQA 1CFSB 5FK9B 2DMHA 1IO4A 3NCWA 4PBVC 4NEHB 2ZSVB 5LJYH 4LZKA 1H15A 4FQ2L 5EC1A 3A0BE 1DCLA 1JMZA 4JFZH 4Z7QE 2I26N 5IJDC 2OLDA 5JPMA 1O5PA 1WYJA 2R1XA 4HJGA 3IJHA 2PYFB 5D1ZI 4Z95L 4NZTH 4ZMPA 9CGTA 5I19H 2GJJA 2B77A 2QQKH 3MODL 4M6NL 2VAJA 3DROA 1S72P 5GSRA 3I6GB 2DBJA 4HA1A 1QRND 1BQSA 3ZMNA 4TTGA 1C16B 1E8WA 3IKKA 4OV5A 4IU3B 5BU8B 1FZBA 3JWOC 2D7QA 1W0VA 3KWUA 1VFBA 3C6LA 1L0YA 3TBWB 1NTZJ 3X3FH 3HG4A 5FXCH 1BM3H 4DKAA 1GKOA 5DSCA 3V2AR 2C3VB 5B4MD 2CU9A 5BV7C 1FH5H 1P5VB 2R0ZH 1KULA 3DOHA 4RZCA 2B4CL 3L7FB 4WEBL 1XF3B 3FCTA 3WYRA 5SWQA 2WMPB 3BEVB 1ITCA 4YX2H 1XZWA 3COOA 4HALA 5BXFB 3QC5X 3WKMH 4ODHH 5DC0A 4LSTL 5KYXB 4PJAA 2LKMA 5IB1B 2WP3T 3V2QA 3KHQA 2WQVA 4U33A 4UF7C 3R8BB 3SCMA 1OAKH 3RTLA 4U7JA 1CLOL 1BZEA 1YLBB 2R29L 3Q3GA 3QFDA 4D3CH 1MWAB 5CCKH 2DEYX 1CVRA 4DOHB 4QNPE 2R0LL 2NTSP 1N5AB 3PDGA 2W0FB 2AQPA 1FDMA 2WMMA 3AXLA 2BVPA 2G9HB 4WDIB 5C08A 4LVOB 5I9QC 3EDFA 1YC8A 2FBRA 2JKSA 4EUPA 1F2XK 2ARJQ 1CL7H 4ODSL 2NXYC 3FQTB 3O6FC 2WOBA 4NENA 5T5FL 5JIIA 2BSTB 1WGOA 1SEQH 3QXVA 2JJUA 3IDIB 4FFZH 4NNXA 4PJFA 4W9CC 4BM7A 3S9DB 3P40A 4IFDK 1EJOH 4YXLH 4JFDB 3AQDA 4LNRB 4Y4HD 3ZDYF 5TE4H 2YXWA 2FXOA 3DC0A 3OX8B 4KKLC 3ZO0A 3L3IB 3TO2A 1S9YA 2F74B 1PSKL 2V9UA 1A6ZB 2KYVA 2VW6A 4PRNB 1Z32X 2BNRE 3E1F1 7PCYA 1UZGA 1QOKA 1PZ3A 4NQEE 2UY6B 2Y6SD 2O6EA 1XB3A 2P8PB 4PRID 3NIGE 3T65A 3ORJA 4GSDL 3V0VB 1Z9LA 1I3GH 4EQ3A 2ZUTA 1TQSA 2AEQL 1I1FA 3H1KD 3DJRA 3GSNH 4IBWA 3E80A 3B9EA 4U1IB 5IHZB 3UGEA 5LNEA 4PWFA 5SWSB 4KJWC 2OZ4L 3NCEB 4OLXL 4Z7WE 4HU2A 3VXOA 4H2AA 4M7JH 2OSYA 2TSAA 3FOLB 4RMSA 3KM1A 5H35A 2MRYA 4Z9KB 3WG7B 1KC5L 5E7BA 3PWLB 1PZ2A 3L6FA 2Y0EA 4PJDB 5DEFA 2J1WA 1R75A 1Q9WB 3SDCC 5E8DL 1R5IB 2NY1C 2BIHA 2NSMA 4JHUA 4YDJB 1MCFA 1IZJA 3OKEB 4LSDA 3VD1A 1NCOA 4QXWA 2IQAA 2IWKA 3FU5A 5I1HH 1IC0A 5I8CB 5EEVA 3WNKA 3UL4A 3Q2VA 4JFEE 4QT5A 5F6HJ 3C5ZC 2COVD 2IBGA 5CJ8A 2V7NB 5JORA 3MV8A 5DJ0B 5AOZA 3EJZC 3RKDD 2C3GA 3P4NB 5HYJD 3I9IA 4J1UA 3P2DA 2KQMA 3TJPA 5D5MA 3QORA 1DVSA 1DP0A 3FZUD 4ZAKD 5KAFE 3TVMC 3RU8L 1EH9A 7PAZA 2DIAA 4XVOA 1LE5A 3TO4C 4GFXA 1NCDH 2OR9L 3QRGH 3TA3C 3V0JA 4AQAA 1J18A 1UKTA 1SQXG 2FT6A 1AY1H 2YJQA 2WWWA 3F5HA 2B08A 2IADB 4Z7VF 4JB9H 2W92A 3SDAC 5FYKE 2UYLB 3IDXH 4HWZA 3LX9A 3W5MA 1KPRB 3LKRB 4CVUA 2XV3A 4PVLA 5ICZA 3C8KA 1AVAA 3HJ0A 2ZPKH 1A1MB 4PJ6A 4YHYC 5JXAL 2FJGA 1F4AA 4GXFA 4FTVA 3JVFC 1LXMA 5F89B 4PJAF 1QABA 2WNGA 5FM5O 1J1XL 4LGPB 2I60H 3RI5K 5C7XH 4J3BA 3VRLE 2FX9L 4LGDE 4H8WH 1JCCA 2YPVH 1V7NH 4FZ8H 3HZYA 1MJUH 3EYOA 4I0PC 1OWRM 3BZ4A 1KG0B 35C8L 25C8L 2N1TA 3FSZA 5KBNC 3F04A 3H9YA 3SDDB 2QSCL 1AQDB 3VXRD 1TSHA 4XR8C 3F7VA 4L74A 4IL6E 2X4NA 2VDQB 3GLMA 3WS6A 2HFFB 4P2QA 1D6VL 3F8UB 3VFGH 2Y9YA 3BW9B 1HHHA 4N24A 3BAEL 1A02J 3UAJD 3V4LA 1LMIA 5D2NB 3AAZB 1PP9J 4Y8DC 1YEEH 4LCCB 4DK5A 4DGIH 1N8ZB 3BUQA 1AXSA 1MHPL 4QYOB 4RFNC 2ZNXA 4Y1TA 1M2OA 3LQAH 3QC6X 3TLRA 3RJDA 3RA7H 4TQEL 2CCVA 4ORGA 3GSVA 3P3YA 4PJ9C 2KZBA 5T3ZH 2AJYL 2YN5A 3CDFA 3VU2A 3PL6B 3OKNA 2HYMA 3D6GA 2PCPA 3WFDL 1VDFA 3K72A 5EDXA 3MV9D 3NCMA 3NIDF 4XC1H 3S97C 2W6JH 1J0ZA 4IGBD 1KFGA 4QHPA 3BQVA 1F02I 4HCRH 4CSTA 1NBYA 3QNYB 1XGUB 1EZSA 4WGVB 4OF5A 5FV2A 1MJ7L 3MODH 4BV1A 4U6YB 1RH5B 3D39D 3QZPA 2J58A 4QHMA 5IFAH 4Z3TA 2WN3A 4AENB 2EKSB 2FR4A 2EDQA 3NIDE 4PCYA 3FQUB 2BP8A 2OXGA 4YSPA 3CFJA 1KORA 2ERJC 4YPGB 5CN2A 3ENEA 3P9LA 4G8AC 2NY7H 3N43B 2CALA 1UD6A 5A6MA 2E74D 4UYPA 3LIEA 1RZFH 2FIKB 3MRRA 2OMWB 3II1A 4WHYG 5JMRA 4YIQA 5AYTA 3V7MA 2A73A 4WY7H 1J48A 3I9GH 1DLHA 2FO8A 1IGIL 1RZGA 2C7UB 2MNJB 1HE7A 1JGLL 2FQDA 4HLEA 1PG7L 1FC2D 2BIOA 2CDEA 3LZPA 2ZCHH 3OC8A 4IKLA 3KYKH 4L8DA 4QKTA 5CEZL 1ZSHA 1IM9B 4QRSB 3WS3A 3EJYD 4M3KB 2ZXCA 4D94A 4QOKA 1TQVA 3QWQB 3WE6B 3WI9A 1LQSR 2IH1A 1YEGH 3EYFB 4FNPA 2G3ZA 4JRFA 3BQUB 4GP4B 3S3DB 4PRHB 4OIFA 3S3JA 5I66A 3VFMB 2LTQB 3R8QA 4R26L 1X4ZA 1PZBA 4OVNF 3V2NA 3QIWC 2ICEA 4AIZA 3EJCA 1NGMB 4BA8A 3M7OA 3S35L 3S9OA 4PD4D 4A7TA 5AVRB 4F80A 1U91A 3RHWF 5C0AD 4A6YH 4XWOD 3GKZA 1MCWM 3WL9B 2R27A 4JQVA 4PD4K 3H1HD 3GLZA 4UQCA 4XXCA 3SGEH 5EU5B 1TFHA 5HBBA 4UNUA 5JHDE 1U3HA 2I7SA 4U7SA 1THCA 2VXSL 1T6BX 1KPUA 3CZEA 1A9BA 2GJ6D 3MACL 4H4NA 1JTHA 2EUWA 5DJTB 4NBXB 1BBDH 1NTZK 3MRJB 3FWLA 1YEWA 1P9MC 3MOAL 5DHVH 4E9YA 5KVDH 3ARFC 1X9VA 1KLUB 1Q1JL 5CD3B 5KJRH 4N28A 1NFIA 1Q9WA 3PGFH 4TPRH 5E03A 4OCNC 2VXUL 3GSNL 2QDVA 3U30B 1JS4A 3D2TA 2R2CA 3J27A 3AE6C 3GMLA 3CH1A 3MYJB 4JLRA 3ZX1A 2EH7H 3IXTA 4R83A 1S3RA 2CDFA 1HGVA 1PV3A 2ZCLL 3UYPB 3MLSH 2VM4A 3H3BC 3CWBJ 2MH4A 3BUIA 3LQZB 4LCUB 4FA6A 3LKNA 4PCTA 1GH7A 5TDPB 5AVVB 3L4UA 5I16A 1PP9D 3W9DB 1G5AA 4TLKA 3SBWA 5D71L 4GRWF 3CFUA 4E5XB 4Y5XC 1D7FA 5ANMA 4NGHH 4L4VB 3TBYB 3L4YA 5F7WC 5CNHA 4P07A 4KX9A 4QHKJ 5I30H 4K15A 1VADA 3SBRA 2FTAA 4MA7L 5IIEB 4LMQE 1QUPA 4P05A 1AIFA 1HI6A 5CFAA 1RZIB 3T0AA 4JANA 3Q8FA 3AC0A 3G6JA 4HX1B 4NKDA 3B56A 1N6QH 4I18A 2O5XH 1DVFA 2VJ8A 3EJPA 1YTZI 4KXZI 4J6RH 1Q9KB 5DXWA 1HCVA 4S1QH 4HZAA 3UTOA 1C5CH 3QIWB 2WB7A 4H0LD 3GI8L 5JW3L 1IFNA 4QXUH 4R8WL 5BVJA 3G6JF 5IB5B 4EIGB 1N6VA 3PPSA 2E76D 1JOCA 3D6ZA 3I75B 4JFFB 3ZE2B 4PG2A 4CKQA 3DX8A 5HJBA 1FVEB 3VD2A 4XMTA 4PQXA 1G1JA 4PJHF 5DWPA 1CU4L 5GTIE 1AYRA 4NRYA 4BGLA 1UZ8B 4KROB 5C0EA 3FXIC 4ZFGL 2Q3XA 2CUIA 3OMIB 4GKZB 4TVPD 2XIDA 1DEEB 1EMTH 4X5XB 3QRBA 4U1JB 4ENEC 5IB3A 3SDXB 5B22A 5B5EH 1LTTC 3ZTNH 1CLCA 4AC2A 1P7KA 2PYED 1T4KA 3VB8A 1UIIA 5KJ7A 2P8MB 2NR6A 3MGTB 1ACZA 1L0NJ 2V2WB 1OO2A 3JYCA 1H5BA 1KPVA 3NFSH 4QIRA 5F7NC 4I0PA 5T1KB 2UV3A 3W9EA 5F9OL 4ZUSA 1S7SA 2V9QA 2E74B 5CZXD 4D6TJ 4DEUA 4HDIA 4WWKB 1DDHB 1JPFA 1GCFA 5CZXC 1FVCB 1P53A 4GQ9H 5GS1B 1QEWA 1CGVA 2BS71 1J5DA 2Y06L 3HB3C 3H6PA 1K3IA 3JV6B 3O4OB 3NN8A 2I24N 2X4QA 1Y6NR 3BIAX 3L4XA 1DJZA 3IN0A 2ITDB 1TETL 3R4YA 3P7KA 3N41B 5E7FA 4HIHB 4KKCC 5CP7B 3WY2A 1QKZH 2JB6A 3L73J 3CLFH 4PV1C 4HUUB 3UFIA 1P84I 4J8RA 4QRQA 3RA7L 3PGDB 4F5CA 2UZIL 4H1LA 5JIQA 4BWUA 1IO4C 1YC7A 3H1LG 4PJ0H 1ET7A 2YMTA 4MMYA 3P4MB 4PJ5A 2N7BA 4KMLB 4AYFB 3VD7A 4PS4L 3N4XA 1OAXL 5J6GB 1I82A 3ZRFC 3MOBH 1NCIA 4HZLB 1HNYA 3O6LH 4GFTB 2E46A 1MIEH 1KELH 2X6BA 3LNFA 3PJSA 4OZIB 1I4FB 1NOFA 5MEOB 1ORQA 2UUDK 3D2UB 3V6FA 5D1ZA 3S3PA 4TVUA 1KIUA 3RTQA 3IFMA 1Q90A 3VI4E 5E1HB 3FXEA 3FCBA 3GTNA 4M3JA 5IFAL 3TX4A 1L0PA 4N5EC 2QJDA 3GIZH 3O0LA 5HHQA 2FLRT 2BY0A 3KYOB 1MH5B 4EDXB 2FX8L 3BX7C 4XFJA 1CBVH 3IPEA 2AXTE 1WSST 3C6LD 3SE9L 3LIDA 1G1IA 4U1SB 4F92B 3U6XA 3T2NH 2HR3A 2QJKC 1XCWA 4JPZB 1BJ8A 3VFOA 1S7RB 2PPDA 4D9RE 2OYIC 3DMMB 1TEYA 1YEHL 3BVNA 2EVIA 3ULUL 4M3LA 2P5ED 3MUUA 1ZXGA 5GJSL 4QY8B 5JOFA 1A1OB 1KGCD 1SPDA 3GXMA 4R4LA 5BRZE 4G8EB 1GK6A 2HT3C 3KBFA 4OZFB 1EGJL 5F0LB 5CBAA 2DI9A 2ZCHL 4U49A 3AEBC 2CUHA 2WSFJ 4YHYB 3PLYA 1Z3GL 3QUZD 1OTTD 2E9WA 2J21A 5D2LE 1Y1DA 2EXSA 4NLAA 3SDAB 1SFDA 3JTBA 1UA3A 4AZ8B 3L71G 1GY1A 5GRJL 2OI9B 4IL6H 3ECQA 3HHMA 4W9GC 4XXDB 3QWNA 1XTMA 1U92B 1IBZA 2VLRA 4D9QE 3SJVA 2B2XL 3D9AL 5DT1L 3IBOA 5DJXB 5T1MB 4ZSOA 4UDTA 2MPAH 2ZUQB 1LTIC 3Q2YA 5ENWB 3P54A 4FQJL 2TRYA 3QEQD 5FDWB 3CK0L 1DBML 4ZFZA 3K91A 3MI6A 1TZ8A 4GY4A 3CCLP 4HIEB 2OTWA 1R24B 3UIAA 1SXBA 2EXTA 3GSQB 4JZOB 5EG6C 4ZFOB 4ATTA 2I9TB 4IBYA 1ZGLB 3MFFA 3F7PC 3V0FA 4P2CG 2BJML 4L4JA 1JCDA 1AGCA 1JD7A 2X4PB 3PXJA 5GSVB 3HE7A 4YFLI 2K1AA 1HXYA 3MA7B 1KJ3L 1W15A 4F58L 2BVQB 3SDCB 1K5NA 3HTKB 1DBJL 4WI6A 3WLBA 1PIXA 1JY3O 1BBDL 2BP0A 3AY4C 2XT1B 3PUUA 4FI7A 2F8IA 4YZFF 4XAWH 1YY8A 3BUTA 5J9PB 4JF7A 5B66E 2A6IB 3PGFL 2Y5TB 5SWSD 1FGNL 5ECGA 4KROD 5LGKA 3UO1H 1G9NC 3UPRA 2BCMA 1G7PB 5MP6H 1P84J 2VQ1A 3FTVA 4PMEA 5LAXB 1ESOA 2Y7QB 1KTCA 4GRWH 4RMWA 4MDIA 1GJWA 1ZDSA 2ZT9B 5FKPA 1GS6X 1HHKA 5GGQL 2V5YA 4NPJA 1B90A 5BZZA 2EADA 5A2CA 5AWNL 3CLEL 1MY7A 3KPRE 1PFIA 3IGUA 3A47A 4RETB 3NABL 1DQQB 1I3RB 4NPYA 4MCZA 5E00B 1FGVH 3LB6C 2AK4D 3DGGA 1Q9KA 4UTCA 4AE0A 1F3RB 2XX1A 5EU6A 1OE2A 4I77L 3E38A 3GGWA 5HI4C 2WLNA 1U3JA 3DYMA 5BV7H 1U33A 1HJ0A 2KP8A 1F4WH 1W2BO 1NINA 4Y4KD 1T04B 4B6ZA 4PTUB 4LCIL 4B41A 2YHGA 4M8QA 1IKOP 1ZLUK 3PWPB 4I0PD 1XZ0A 1N6QL 4NKQB 1NGXA 4BFEA 2J5WA 1QRNB 1U8KA 4F33A 4AH2B 4AMKH 1T3FB 4LLYA 4JY6B 3IN6A 4J12A 1KJMA 1UWEH 3LN5B 4YSDA 5F7YC 2WCGA 3PCYA 4QXUL 3NEEA 4R8WH 1H3GA 5ALCH 1NKOA 4Y4FC 1BCIA 4WFEE 3BVHA 1T1XA 3EFOA 4XZUB 3TONA 1YY9D 1CVSC 1OP9A 1VQKP 3NGBC 3OSKA 1J1EB 5J13B 3JC22 2WWOA 1LWRA 2D03L 4YXHL 2YOAA 3MLVH 3H9SA 1F2QA 1MLBB 4DKFL 3TPKA 4ZUSB 4PD4I 4BFNA 4NUPA 1WZKA 2ZOWA 4DP7X 1ZTMA 3F2LA 5I1KL 4XVTH 2WYHA 3MP7B 5C6PB 2VH5L 2V37A 4LEEA 2B0SL 4EVNA 3HVDA 2A74B 1F4YH 2H32A 4WW1B 1LP1B 1YSOA 2AXJA 5DJYA 2O6PA 2XVLA 3G5VB 1PKQE 4MXQC 5G5DB 1NTME 5T5NG 3SDXE 5BV7B 5GZOA 2O30A 2W65A 5I5MA 1EZVG 3INUH 3Q2NA 4RGOL 4W7YA 2ZYHA 2ICWI 32C2A 4DO4A 4H1LB 3WTTA 2IDFA 2X09A 1XAUA 3GSWB 1RZJC 2J8UB 1XIWA 2PETA 3W82A 5E5UB 5IQ7H 5FA3B 1LTBC 2F7QA 4H5SB 3WLWC 4M5ZH 4APQB 4BZ2H 3L95A 1P6AB 1LDPH 2OYMA 4WUUA 4PY7B 4CMMB 1YYLH 4ZDHA 3DI2B 3ZKND 1AS7A 2AGJH 5CD5D 2W95A 1KILA 3FTUA 3IJ8A 4ZTPL 5L4IA 1RF0C 3B7UX 3TH4T 1SHMA 4F8LA 4OY9A 4TUKL 5TK2A 3V0IA 5KS9F 2JELL 3F5WB 4CGUB 3V0EA 2OXHB 3R1GL 3VXSE 3MHZA 1JI1A 5FCUL 3EF4A 4U1GB 4RJTA 4MGXA 4HOMA 1WBXB 1LNUB 4BKTC 1EEYB 4R5XA 3X17A 3BKJL 3H7LA 5M1BA 1ADQL 5D70L 3S98A 1IFMA 3AG1B 4G3YL 4JFDE 4PB9H 1FAKT 3AFLA 5HJGA 1NU1J 2F53E 5H2BA 4LQFH 5DEZA 5IJVA 4NKOB 5D7KD 2DDQH 5IVNA 3U1CA 3FU6A 1V27A 5TH2B 1DQJA 5D6DC 1AAJA 3Q13A 1CYXA 4WI5A 2GTZB 2G75B 1M1JB 2YPLE 4CADB 4AIXA 1EC5A 1QLRA 1G4RA 5BS0D 4HK0B 5L88L 4L3FA 5L8RJ 5F3HB 4JFYB 3MRPA 4JRXB 4TVPL 4Z3GA 2GUOA 2FFDB 4MJ5A 5SX4I 3SODB 4TNGA 4Y9BA 5EIIA 4LHUG 4JVPA 4ZXBC 4AZ8A 4X7DC 4AVKA 3OXSA 4F2MA 1TDQA 2KZIA 2KS0A 3ZYZA 4EBQL 4LK4A 3HD7B 2GEQA 2VDPH 4WKXA 1URIA 5MEQB 1K6QL 4N2DA 5DI8A 2A4EA 1H8LA 4NO0B 3QG6B 1WPCA 3LS4H 4WV1A 3MTUE 1CGSH 1R8EA 3FN9A 1FZKA 4HIEA 1NEPA 2FBOJ 4JFXA 3MV7B 4HIIA 1PG7X 4NQED 3WIIL 5KVGL 2XQ0A 2ALAA 1ETA1 5F88A 4YXDC 1OSPL 2CPCA 4FRWA 5DF0A 1BPLB 3BGAA 4U1HA 4Y1AD 3U1AA 4WW2B 4WK2B 4LMQI 3LD8B 5D7IB 1HE8A 3POCA 1ZLVK 3CSTA 4U6HA 1JF1A 5EU7E 1MRFL 2CHDA 4PJ8C 2MPAL 2H0JA 3A21A 1XBDA 2WT7B 3NZUA 4PG9A 5DMGD 1ZWIB 3WLBB 5K5YA 3I84A 1WS8A 3GXNA 1A5FH 3B2UC 4X80H 3WBDA 4E9RA 2FZ3B 4GDOA 3EDJA 1E27B 4N68A 1XMWA 5F93C 1IU1A 2JWAA 3VMYA 1IM9A 2BJMH 3T8XA 3T1WA 1XF1A 2A38A 1P6WA 3N04A 4NPEA 4LIQE 3DUSB 4H44D 2OBGA 2WLHA 4XXWA 3S5LA 1TZGH 3UTTB 2ADFL 1CQKA 4R0LA 2CO1A 4KBPA 3FUDA 3WKPA 4EXKA 5CZVL 1ZHNA 2D31A 4OUOA 4XAWL 4XNMA 1PQZA 4HLZG 1B6DA 3KH3A 4AJWA 4XNYL 3D85B 4PWGA 4Q58C 3DGDA 3TEWA 3FK3A 2EUVA 5EEWA 3NH7L 2VR9A 3ZSTA 3OHXC 5I15H 4PVMA 4X98B 1EEZA 2RCSL 1NKGA 4R2GC 3V52H 5IEHB 1QP1A 3HC2A 2QGDA 5D7LD 4EE2A 4FC3E 3HN8A 4Q56A 2RHEA 4BUGA 4F3FB 4V2CB 1K04A 5H4YA 5HGBB 1A7QH 4ZKPA 1S7WA 3PWPA 4BFJA 1CLYL 5BUPA 1DFBH 1HKLL 3O3AB 5AWNH 4PJEB 3MRDA 2ZUWA 5F72S 1Y6MR 1Z9OA 1ND0A 5EBGA 5K39B 2KLUA 5IB4A 1JTHB 3DV6A 4XNQB 4YTPC 5F1KC 2WO4A 3NZHL 1G7JA 2VRKA 3RWCA 4S1DC 1IGCL 2GITA 3ESOA 3EO9H 4MS8D 2PAJA 2AZAA 3T0EA 2BRRH 1DLFH 2X42A 3I02B 4K3EH 1TJXA 4P4KC 2EDYA 2B9BA 2IGFH 3V0AC 5FYKL 4P4KD 1M7IB 4ZOBA 4E36A 1FFQA 2ZFCA 1N73B 1GPOL 2BCCD 3G9VA 3IFOA 4NN7B 4NO5A 5M95B 2H7HA 1A22B 2NPLX 3FNKA 2OMUB 2VNCA 3B9KA 3IMSA 5ESQB 4J5VA 4ZFQA 2Z31C 3V5HB 3W56A 2EYSB 1VQ8P 1OK0A 2PCXA 4X4XB 4XN4A 4I85A 1UWEL 5DEGA 5HYSG 1AH1A 5JO5A 3QULA 1SYSB 2VLME 1GU5A 3O6MH 3UDWC 2HT2C 1O9ZA 4OGZA 3GB7B 4Z76B 5JPNC 1JO5A 5H4ZA 1TNNA 1DD4A 2ZSWA 3ABLB 5TE6L 2XG4B 4IFMA 1AQKH 4N2CA 2QZ5A 3WTWA 3UTSB 3H7BA 3QPXL 2GC4C 1S2EA 3ULVE 2CPSA 1Q72L 3MLXL 4Q9QL 1MFDL 1OANA 1T7WA 3QUXA 4X6FA 1C08B 5E6ID 4JBSA 1F4YL 4PW4A 3ARGA 1TQCB 3WE1A 4HSQA 5JR1L 1MCIA 5L6YH 1RL1A 2CKBL 2ZF8A 1E6JL 1HQ4A 2BNUB 2YUZA 3CCRP 4FQQA 4XA4A 3RIAF 3HUSC 4KOCA 3NJJA 3WKNA 4ZW3A 2IJ0C 1X79B 4HV8A 1J8RA 1RE3A 1S9XB 4BSWA 1Z9SA 3TBWA 4M9PA 4BFRA 1FZOB 1MAJA 3QG7H 2LU5A 3CZFA 4U3CA 5CZKA 5E6IB 2K78A 3JZ7A 4LHUA 4XP5L 3SZ6A 4UZSA 1NPUA 3O9WB 1OAUL 3LZOA 1IEHA 1ZHKB 3ZQWA 4RQQB 4XX1G 1JGDB 5A6LA 4KKBC 3L48A 1GK4A 1HL4A 4UT7L 3DGCR 4IBUA 1CD1B 4AQ1C 1QEXA 1FLTX 4G7YL 3T3PF 1XCTB 1NMCB 3L75D 3RWFA 5KG9B 1CK0L 3F01A 1PDKB 4TV3A 4YC2B 5DZLA 3PS6A 3B6SA 3GEFA 4JGUA 3W81A 1R17A 3HI6L 4QJ4B 4Q6IB 4LLWB 3BGMA 2Y5EA 4BELD 1I7RB 4HHAA 1CFVL 3BDYH 3QT2A 3ZE0B 2DWYA 4PRIA 4CDGC 3TO4D 5E2WH 1GZHC 4ILDA 1N26A 1TZHB 2H26A 1VGKA 3VVWA 4UB0L 2Q86A 4APXA 1JTTA 4QRPD 2GKIA 3VXUA 2IQ9L 4XVSH 2XV6B 1ROWA 4BUHA 2B3IA 1SXNA 1NMAL 2P7TA 4M6OL 1T5KA 1YCSA 2LABA 1MCJA 2A9NH 4PHXA 1N7SB 1KENH 4M7LT 5FB8B 1FUNA 2ZXBA 3PNWB 2FL5A 3X12B 3LXCA 4W81A 3B2MA 3S7GA 1ZPUA 4YR6A 4O51A 1TZIB 4WEMB 2YKKA 1KBKA 3IM1A 2MQGA 4OIIL 1MREL 3MV8E 4F57L 4PGJA 1VACB 2X2HA 1WCBB 3KJ6H 1YRKA 4I18C 5IROD 1A3QA 3BN9C 1O6VA 3VYNA 1RSYA 2ICWA 3LHAA 3DVNA 5C6WH 5FW8A 1Z56A 3UJIH 1S4XA 2B87B 1FL5A 3DIFB 4E9TA 2R4RL 4FNRA 1EAPB 4N8CH 5HDBE 3U7YH 1R6VA 2FCBA 4UM9B 1J5HA 4KZDH 1TCRA 1NU1E 4MB5A 3GT6A 4PJ5E 1CGSL 4Y5XA 3SCMD 3KYOA 1QBAA 4LU5L 2JIXD 3NOIA 3D33A 1KJ2L 3PAUA 4KT0J 2AK4B 1SLQA 3CCMP 3KPQA 4NJ9H 3VACA 3MLWL 1CLVA 4JDTH 1VAHA 4Y0GA 3QIBD 4Z7WA 2O5ZL 5EZLB 4PV1D 1SOXA 4NQDD 4WNQB 5GJTH 4PJGE 2VTFA 3WNIA 3AWGA 1BDCA 1T89A 1UQSA 1X5XA 4P23A 5EO1B 5H94B 3REWB 3RURA 1Q9OB 4P5KB 1KOAA 4B95C 1WWWX 3LZFH 3IAQA 3NFPB 1CF8H 2HFEB 3NIGF 1EHNA 5TE7L 5LKNA 4KH2A 4HIQA 1ITBB 2CHWA 4ZD3H 1G7LA 3KHOA 4FERA 4H1LH 4LF3B 4K2UL 4I2LC 1OK8A 4EF3A 3K8KA 4XCNA 1SOSA 2YO2A 3WJLC 2ZYSA 4WW2C 5TF1L 3FFCA 4I87A 3BVWA 1K05A 5I8CA 1DDTA 1JUFB 1RY3A 2JDIH 1OCCB 4MNGA 4FJ6A 4DF9A 3EADA 4PJBB 3QDGE 4ALAH 5D6DA 3CCJP 1NL0H 1P4BH 1URQC 4EN2A 5K9JL 1AKJB 1UXMA 4W7ZA 1RQUA 3P8CD 3JCUE 1RZJH 1G7QA 2ZJSL 1UXWA 4OUUB 2XU9A 5CBEB 1T1WA 5B66H 1DZBA 2E7CA 4LFHG 4JFDA 4LNRA 3OHMB 5FV1L 3SE4A 1KLFA 1HVVA 4DO5A 3A7OA 2A06G 3UTZB 3KG5A 1QL2A 3RY6C 2XA8L 3QZLA 1M57D 4YPJA 4ONFL 5DJUB 3WFEH 5J3HC 4ZJ9A 3EOTH 3N55A 4OM1L 4YE4L 2H0FA 1FI8C 1SBBA 5E5MA 1HKLH 2DOCA 2J6EA 1U3ZA 3R7RA 3VQLA 3L45A 2EDLA 3QHZH 1J1PL 5IEKB 3QJHB 4HS8L 4K3HA 3TEZA 4IU2B 3RGVB 3RL1B 2AXGA 3LHPH 5E9AA 3VQ1C 1KCKA 1HTYA 1MW0A 1NGWB 2XN2A 5HYQB 5FYJU 4GBXD 4K3EL 4ONOA 1AZCA 4G7RB 4TNEA 2CO6B 3JWNC 3P4OA 2PWDA 3JWNH 1YMHB 2X3BA 3MXVL 2M83A 4WNSA 1BX2A 1S9VA 3LZNA 4JNXA 4MHHI 4M61A 1JWSB 1BJMA 2QM7A 3ARSA 1P84D 1E0OB 3GM0A 1AACA 3L4ZA 1E4WL 4K9EC 1U6AL 2K6YA 3BE1H 5FGSA 1BQHG 4NBYB 3GSOB 5L2KE 4GI8A 4F7PB 1FDLH 5B8CA 3QFJE 2H32H 4JKNA 1G1OA 5JQIB 2OP4H 2ED6A 1XGTB 4X0KA 3S4RA 4OTXL 1BSIA 4HXAH 4FADA 4KH9A 4O58H 4UT6L 1Z0NA 1UACH 1X5GA 1HNFA 3KLDA 3U25A 2WLJA 5BCAA 3UYOD 2X88A 2FH6A 3GXFA 4BK4A 2IAMC 5JHAA 4HGKC 4ZO9A 2PR4L 4ICWA 3HPLB 3QR1A 4RAVA 2VO5A 2PCPB 2FYNC 2KC0A 2XKNB 3Q5RA 2APWA 1LEGB 3L3GA 1E30A 1EHAA 2PPAA 4IM8A 1WQVT 2C5DC 2C1OB 3N1MC 1I8LA 4W1TA 1OARH 3ARFD 2QKSA 3OLDA 5C07A 3MGAA 2BFVH 2CO7B 2FNWA 1V8HA 1U8KB 4HHGA 4KTDL 4DVRH 4ZBJA 1J5OH 3C8KB 1QUNB 2X4TA 1O7SA 4GBXB 2OTUA 4Y9CA 5L2KA 3D8MA 5GTIH 1VENA 1EBAA 1PLGH 2GCYB 2EO9A 5DGRA 4UB8H 2Z5IA 3OJVC 3MRNA 2MJWA 2HA1A 2KLTA 4NHUB 4PU2A 2XFGB 4AQ8C 1UYWL 5EZOH 3QDGB 5ANHA 4Z8FL 4GMTH 1BQKA 2XXMB 3TN0C 3AU1A 3HS9A 3OF6A 5T33H 4W4OC 1JHTA 3SKMB 3ZRSA 1PL3A 4TUUA 1WD8A 3FQXB 5EU6D 2DH3A 2JO1A 4Z77A 5CSZA 2YFOA 2C1PA 2WZ0A 2XFXB 2HPOA 4X5QA 2C7UA 5E94A 4G7YH 1NFAA 4ZTEA 1YPZB 2QRXA 1AXIB 1R33A 3AWEA 4L3CA 1J11A 5EFWB 4XMLL 2DMKA 1LT1A 3D18B 5I71B 3BH9A 3MV9E 1L9OA 4R4MA 1FNSH 1NBVL 4NM4H 4TULH 4PLJC 2OMYA 1XIWB 1IQWH 5D1XA 3X14B 5HYJA 1T22A 1MFVA 4KDTC 3CPLB 2GVYA 3I2CH 1UGNA 4UMSA 1PZ5A 5K5GB 2AW2A 3VFMA 1DBKL 3PWUA 3BFQG 1U57A 1DQIA 3S8GB 1IL1B 4G43B 5KVEL 43CAB 2DBLL 2KDGA 3MUDC 2G2RB 3CH8A 4PLKD 3RZCD 2B14A 1XGQA 3CFBB 5JXEC 4YVNA 3ARDD 1N7LA 4Q2ZA 2ENPA 2OS7A 3U7AA 4L0YA 3VI3E 5HY9B 3EOBA 5DJCA 1CDUA 3N1GC 3V0HA 2ZT9C 2I9LA 5FO7A 3D09A 1NAKL 1QO3B 3N41F 5EWIL 5I1CL 3TYFB 1SQBD 4PGCB 4X6EB 4E9WA 2OXGB 4LPVA 2NW3A 1KCVH 1KIQB 4A6YB 4UCFA 4L8SA 3B3IB 5L7XH 4LCWD 1GC1C 2VOTA 1RZKC 3S36H 1LTXA 3SBQA 1D5ZA 5L8LB 3EYQD 3PHAA 1J0KA 1S3KL 4IOFD 4FFYL 1V5JA 3BFOA 1JGVL 1T1ZA 4I1NB 4AW7A 5E9NA 5J3HD 4JHZA 4PJEF 4N2KA 4B3EA 1MFEL 4YIQB 3EZ8A 1MFUA 3DVIA 4IW4C 4JRXE 2E0PA 3A6BL 5LQBL 2QA4P 2X89A 4OCWL 3VMNA 4BXLA 1SQQD 3NPSB 3AT9A 5ITBH 2FO4A 4JDTL 3JV4A 3L5WB 5INDA 5I8EB 1NOLA 2HJFA 5F7BA 4D6TD 1YEKH 4FNLL 4B0MM 4DFIA 1KXTB 4RMQA 1BPVA 3V5DB 3FBQA 1EFXB 1Z5HA 5KSAD 2DW3A 2DM7A 5BZDA 4IOSA 1L0ND 3SY6A 4K7FB 3VWKB 3OXRB 1E28A 3H1ZA 5C8JB 2CLZB 4ZXBD 4XNUH 4FGMA 4WVRA 3MRMB 4Y2OB 4JZJC 5DTFB 3TEXA 4KKZA 2R1YA 4KNTA 4S1RL 2Z92A 3GYRA 4RRPA 4URKA 2VDOH 4L4VA 2YBRB 2EE3A 3VYPA 1M05A 1NAMA 1URZA 1Q8MA 3PAVA 1FDIA 1S5LE 3QNXA 3VP9A 1XB8A 1G1YA 4LLDB 4M62H 1FBMA 5IMLA 1NJIQ 3P3SA 5DRXB 3LEVL 5F1SA 4HAGA 3H1HE 4GG6F 4LLHA 1V7ML 3FO0H 5DJZA 1UB6A 3VXSB 4C59B 1KXHA 2Y3NA 3KEHA 1CMOA 3DBXB 3MRFB 5DK2A 3VGFA 5C97A 3GZQA 4K7PL 1CFTB 2EUZA 1AXTL 2VRQA 5D7SH 1BFSA 2KNCA 3BZFA 3RI5F 1HTLC 3CC7P 2XCMC 1YMMA 3DHJA 1KBGH 4Z7UA 3QIWA 2UZYA 4TOYH 3NSDA 1XL6A 2H41A 3MR9B 3N2JA 4QO1A 3ZT7A 1HILB