5AW7B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 11.3 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw7B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw7B02
1HJBA 5AVZB 2Q3IA 2Z5HA 3L36A 5AVSB 5AVUB 1MFZA 5AVQB 3TK1A 2P2UA 2W6AA 2XZRA 3WGVB 3VMZA 2E43A 3M0AA 1KQLA 3MGNA 5AW5B 1CI6B 2YO2A 1HBWA 1G2CB 3HTKA 1GZLA 1S9KD 3M06A 1SLQA 4LC1A 3NMDA 2WT7B 3HE4B 3WGUB 3MD0A 5AVRB 4AQRD 5AW2B 4C7NB 1CSBA 5AW9B 1GTWA 5AVTB 4I6MC 4GT1A 4HYTB 2R5DA 4RETB 1GK6A 3A7OA 3L35A 1DH3A 4M3LA 3M91A 4AUWA 5APWA 2W27A 3TNUB 2E42A 3I5CA 4I2LC 3TYYA 2R32A 1HUCA 3VN0A 2WPSA 3LIDA 3NXSA 3O8ZA 1NAFA 1OXZA 2N9BA 1OWAA 3KDPB 3KQGA 1YYCA 1GU5A 3V4WA 2P7JA 3V5BA 1X8YA 2XU6A 2C9LY 3NTNA 4XE5B 3VMXA 2H7HA 3HE5B 1GD2E 5APSA 2WPRA 1GK4A 1SP4A 4JYBA 5APTA 1CI6A 5APYA 2Q7CA 3IR9A 2JJLA 1H8AA 1GU4A 3T97A 1NWQA 1FOSF 2C9NY 1MUUA 2WT7A 3HE4A 4B86A 5AVWB 2R5BA 4EOTA 4C7NA 1A02F 1H89A 2QM7A 3M9HA 1S9KE 2IPPA 5AW7B 1A02J 3VYIA 3LIEA 1CZQA 5AW8B 5AVYB 3UIAA 2BASA 3A3YB 4JYCA 5APVA 5AVVB 1FOSE 3TNUA 1FAVA 3A5TA 3A2AA 5APQA 3V4QA 1J2JB 4C46A 1JNMA 2ZXEB 1IO4A 3SWFA 4AYCA 2Z5IA 5APUA 1T2KD 2ZFCA 3M0DA 2WWWA 2WPQA 2XV5A 3P8MC 4GKGA 4KHXA 3NFQA 5AW4B 5CMZA 3VMYA 2YO3A 1MV8A 3OAKA 1H88A 3B8EB 1JUNA 3HE5A 1T2KC 3M9BA 2YNYA 4RESB 2P67A 3P32A 5AVXB 3VTPC 4DZOA 5APXA 5AW0B 2R3CA 5AW6B 2WTYA 2QM8A 1HWTC 2VRSA 5AW1B 2KP8A 2Q5UA 3P7KA 5AW3B 3L37A
chains in the Genus database with same CATH superfamily
5T1DH 1DQIA 1F58L 2YHGA 4D0BA 2GTWB 3RWDB 1WFMA 5JIDA 5B7FA 3RLSA 5FW7A 3TO4B 4BH7A 1X6NA 3OHXB 5D2NE 1JE6A 3ULUE 3L75E 3FS9A 3ZE0F 5CZXC 4BM7A 3UG3A 1QKZH 1A4JB 4PJ0H 3D06A 1CE6A 2EKJA 4X6EA 3RTQB 4Y2OA 1ASQA 2E59A 3GDBA 3ZYOA 4IMLB 2WCGA 5F8RC 4XNXH 4I0PA 4QTIH 3I74A 4OJFL 2ZXAA 3GXTA 5DJ8B 4IRZH 1IJNA 2VLKE 1KV4A 4HJGB 1MRCH 1ZD6A 3OLGA 5IFHH 1BGYD 2BOCB 4G5ZH 4MDJA 3L71E 4NC1C 5KEZA 3FCGA 4QMEA 3O3EB 4AUWA 1H6TA 1MY5A 2D7TL 3G3LA 3MGTA 4MAUL 5AB1A 3EG9A 2CK0H 3F7YB 3QUYD 5CGMA 9PCYA 2VW7A 4LNVA 1TIUA 4QY8B 2BDNH 3HMXH 5GHWL 1J5IA 2FR4A 1XCXA 4HPOH 1BXXA 5GRXG 2H88C 4H13C 2YBRA 1J0JA 1JDDA 1VRSA 4LEBA 1BE3G 1YYLL 4A7SA 4XP1L 2XU6A 2NPLX 4P2YA 3IB4A 2KNCB 3LKRA 2EABA 2JB5H 3H56A 3MUDA 4AQAB 4W6YB 3Q3GB 1T8ZA 5CU5A 2FB4H 5EA0L 3A0HE 1WZ1H 3VMAA 2VDPL 3BO8A 3DIVA 4QRUB 5EN3A 1IC4L 1UB5A 3HW7A 1ZHKA 4RAVB 5HDWA 4YFLF 5CEXB 1OGPA 5DVOA 2AAVA 5FUCC 3LIZH 1FE8H 1IB5A 4MCNA 1U3HC 3GMMB 2PW2B 4FFZA 1ZSHA 2D2CC 3QXUA 1UQSB 3AS2A 4N0FA 4UBDC 1CFVH 3X1FA 2DLIA 2WXOA 4G1EB 2O26U 2WLJA 3HS0A 2G3ZA 4IRSD 1JRHL 3QJXA 5EN2B 5DXWA 4XP5L 4DKFH 3DYPA 4PJXB 3CE1A 1DJGA 2XA8H 5F3HB 4E41E 2HT4D 4HZAA 3K3QA 1AVAA 5DQJB 3A2AA 2K9FB 5GS2D 4ALAL 1NU1K 2O01J 1FAKT 3PJSB 3GHGB 1X5KA 1N7ML 1IL1B 4HS6B 5JW4M 3OC8A 1HYRC 3T6QC 4UINL 3ARUA 4F7CB 3AQDA 4ELKB 1SPDA 2TSAA 3ATFA 3HPJB 3R4DA 4BWTA 1Q38A 3AQYA 5B8CB 2NX5E 4QHNA 5KJ7C 4WF7A 3LKSB 2PWGA 3SBPA 3KXFE 3L5IA 3WUWB 3N2JA 4OF7A 3ULUF 3DX8B 1TJIH 3HNTL 2Y9RT 3GXIA 1PPJG 1QI3A 2Y9YA 1WAEA 2J7LA 5CLYA 3FB5A 3KW8A 3VXUA 4CA4A 5JTWA 1EAJA 5CO1A 2B20A 3VRIA 1A47A 2APTA 2X6UA 3H0TA 5JIPA 2IYOA 3TK1A 2I5YH 3T0EE 4JLRA 2FSEA 4NQCD 1YHQP 4D0CB 3TBWA 1UM6H 4DIXA 3O8XD 2N1KA 2WBXA 3AG1B 1OT4A 4K94C 3C60C 3MSPA 5EIIA 2NYZA 1MCWM 1FRGH 1FYTE 1TZOA 1E4KC 1U8NA 3HVNA 4X42A 1U3JA 2FCBA 4JG0H 2X28A 5DEZA 2YN3A 3WEXB 3S2AA 3FB8A 3MTXA 3P0VH 4HFWB 3SDDC 5SV3A 3QJHB 2JQZA 3D3VE 4ILDA 1XZ0B 2AQNA 3PHLA 2Y5EA 1FZAA 2X6BA 4Y99B 3L74D 1P7KB 3T0EC 1CC3A 1DZBA 1S72P 5KBKA 1BOGB 2M8RA 3IDUA 2R2EA 1XH2A 3FN9A 2C9XA 2WZAA 2Z7UA 4U1KA 4E9QA 3W5MA 4HWZB 4UB0L 3HI1B 4KH2A 5DJXB 1N2RA 2BLFA 1KWKA 1S8DB 4AV0A 3QUXC 3CMEP 4YWGH 3DSFH 1TU2A 2JKRM 4PWEA 5IB2A 2J5LB 5AD0B 2VLLA 2EADA 1J1DB 4OTXH 4AUYA 3KPLB 3KVDD 2AJYH 3V9EA 3FTWA 3HC0A 4X7SH 3JT0A 4HMCA 5HY9A 4OCXL 1JS4A 3O2WH 3OHMB 4JB9H 5LBSL 4R2GD 5JPNC 1YEIL 2ITAA 2AJXH 3GJEB 3X12A 4XE0A 2V4LA 3TM6A 3AWGA 4ZBJA 3BSGA 1OTTC 1QBML 4JO1L 2YGVA 1E5CA 1H8OA 5T1KB 2X1XR 1RZ7L 1F4AA 3PWLB 3RWGB 1CXKA 4JJOA 2PP7A 3QQ4B 1SXAA 3CCHA 2K37A 3H54A 5G4NA 3CZJA 4UTBL 1OLLA 3JV4B 1M71A 4GFTB 3MLYL 4O58H 3TLRA 3VVWA 4CKVX 1GAFH 2H32H 3LN5A 1NJ9A 5TE7H 3TVMC 3BIKB 3NCJL 2JDIH 4JN2A 1HDMB 1OP4A 2BZ7A 4IRJB 1PFIA 5FK9B 1IO4C 4WO4B 2N1TD 1MEXH 5F1KC 1UIIA 5HHXL 5AVZB 4G72B 1FAIL 1T80A 1N0XH 2Q7YA 3BAEL 4BBWA 5F9WB 4FFYL 1KIUA 2SODB 3D2UA 5DK0A 3CLFH 2CLRA 3DWTA 4JFEB 4XXCC 5CLZA 2BNUB 3GSXA 3QDMA 4Y7OC 5TDPB 4CSSA 3BE1L 1S7WB 3ETTA 3TH2T 2R1XB 1G7MA 5A2KH 4UTAH 3CZLA 3FO1B 5AL0A 1UXLA 5I19L 1DL7H 1ZA6B 4UWQB 5K39A 4K8RL 1NTZK 4FFWD 2POHA 4LHUB 4AQRD 3O4LD 2X9YA 1TO5A 4X5WA 5ENWA 1R3KB 4J2QA 4AQ1B 1BF2A 4YSQA 5AAPA 1E7VA 4JPIA 3QDGB 4GT1A 4PJ8B 4OR1A 4XVUD 3VYPA 3M7OA 4YBQC 5ERWA 3MCKB 4I18B 4XVSH 4RISH 4M3LA 2VN6A 4MJID 4N86A 4EIJA 1GC1H 1T1WA 3LQZA 3SPVA 5GTHE 4PCTA 2LXCB 4WWNA 4FHBD 5DJYB 1FVDA 4NO3B 3V6FB 3X3FH 2WXQA 4PV9A 4J3OF 2CA4A 1OWAA 1WJ3A 2MTPA 2ZKWA 1SQQG 2HRPL 2VDPB 2XFXB 2ZSVA 5J6GA 5FGSA 5BRPA 1FZKA 1HZKA 1OW7A 4OAWB 2G8YA 3B2DC 4DN3H 2CHWA 3KPRB 5I0DA 4JFXA 3TA4D 4Q0XL 4MCZB 3GHBL 3KLHD 4EDXB 4R8WH 3TO2A 5HYSB 1JYWA 2LTQB 5I6LA 4JYBA 2AXFA 4JJ5A 4A39A 3B9KD 4HHAA 1PZ3A 4PD4J 3ULVH 4JHVA 1KIRA 1DJWA 5GS3A 3UTTD 1QX1A 4HB1A 3KLQA 3TH4T 3APDA 1XIWA 1IGFH 5F7DA 1B4JH 1XSIA 2FEJA 4QAMB 1OM3H 4XCFH 1BE3E 4FXKB 3D34A 5IVZB 4HOWA 4EUPB 4YHNA 4OGQD 4R83A 3VXUE 5KSAD 4A6YL 1WTGT 4XVTH 2BH0A 2XWJA 3U82B 4AZ8A 1RHFA 2PYFA 1AE6L 4X6DA 4XMPL 5CP7A 5IESH 4RAHA 3I75A 2Q76B 4CNIA 4OSUH 4H44D 1HHGA 4FJYA 3HMWH 3LZOA 2VMDA 2ZG2A 1NM4A 2YOAA 2IOMA 3DX9B 4ICWA 4LARL 4Z78B 2P8LB 5HHOB 5GGUB 2QLYA 4K4KA 4Z7OB 4AYCA 4X8GA 4LSVH 3FU6A 3IYLW 1MZ9A 2D7PA 3BVXA 4UILL 3VMYA 1EJ6A 3E6FB 2DQGL 3BJ91 3MRMB 4LPYA 1UZ6E 4ZS7H 4ZNEA 2R0WL 2D03H 2GIYA 3ZPDA 2JF1A 5J1TC 1ZT1A 4I3SL 4WHTA 3EFDH 4LPWA 2X0VA 3WJLA 4BFEA 2YXQB 1BIIA 2EC9U 5IF0B 3U0TB 2ICES 5E6UB 3DV4B 1VIWA 4WI2A 5EORH 2Q5UA 1ZS2A 4QWWC 1URQB 3US1A 2FJUB 3RDTC 3EBIA 3HZYA 3EYFA 2GUVA 4KQ3L 4NRXA 3LW5J 1A02N 2WO2B 1SDDB 3K4AA 4L1LA 1FL6A 3KPPB 2NNRA 3D71A 1AJ7H 3RPBA 4B5ZA 3GMRB 1UWFA 5IQ7L 4Y4KB 2F5AL 1E90A 4ZUVB 5C9JB 3LB6D 1G7HB 2HWZH 4C7RA 2WCPA 1JGDA 1SHMA 2ZUYA 4AYFA 2GSGB 5ACZA 2OARA 2XQYK 4AVKA 3BXNB 1UYWH 3L6FB 5DC2A 4LLMB 1SF5A 2BPBA 1TTGA 1TENA 4M8UA 5C07A 2AW2A 5DHVH 3VQMA 3HE7B 3WBDA 2XWDA 4OF3A 1SEQL 5FFGA 1GS6X 5CCHD 2H8PB 3A4EA 4KJQC 3MNZB 3TC9A 1E28B 4TPRL 3WIHA 1NMCB 2V17L 3GB7B 4UQ2B 2Q0ZX 3CWBE 2J25A 3CX5K 4Z7WA 2R29A 2MKVA 3FU5A 4M8QB 1E5BA 1IQDA 4JMNA 3CDFA 1MNUH 1KDJA 1EEZA 1ZP0C 4X4MA 1AGBB 3BGFC 4BKTC 4ENED 1A9BA 1VFUA 1GU5A 1ZVNA 4NI6A 2BP5M 4GIAA 4NQUA 3W3BA 3MOBH 4QRTA 5T1MA 2BS71 4QRPA 2XZCL 5DQ9A 3AC0A 1FJPA 2GI0A 3L1OH 4ADIA 4FZEL 1EANA 4MLIA 3AY4C 4KJYA 3T4AC 2EUZA 1GD2E 1NKRA 3IMTA 1OIOA 5CGYD 1LGVA 5L6YH 4HUUB 5DD3H 1SXNA 1NTMJ 1BPVA 2H89C 4RKUJ 3MOQA 3QO0B 3VXPB 4RFNC 3GMQA 1D9KC 5HGGS 2R39A 3A23A 1GGYA 3WNPA 2FRGP 5TK2A 3FQNB 4PM1A 2AJVL 2VIRA 4M5YH 2ZE0A 5I17A 1H0DB 2R3SA 3BZEB 1Q1PA 5HP5A 2JFCA 3V0VA 5K5YA 1UZ6F 4K9EC 1YY8A 4HKBB 3KHOA 4N87A 2XX1A 4GLRI 1T5XA 4L73A 3DX6B 1PEZA 4DOHE 5JHLA 3HUJE 4CMHB 1IC5L 2FZ3B 1WSST 5DD6A 2V7HB 3T3PE 1BF5A 1WC7B 3W0WA 2QQNH 5JLZB 1A6VL 1OCWL 4A7VA 3ECVA 3TS8A 3CAFA 1NIDA 1BQHA 4PWJA 1L0QA 1H88A 2CR3A 1CDCA 1VKXA 1MRFH 2GJRA 3H9HB 4LEOA 2P67A 5AYUL 4EN3A 3PWPB 2EZ0C 2AQPA 4JY6B 4JHWL 4K7PY 1AR2A 1ZV9A 4KH9A 3WKNA 2FT8A 1FC2C 1CL7H 3JUZA 3W5NA 5CBOA 4BHUA 2ZZUT 1ONQB 4HIIB 3RP1A 4FFVD 5MERA 4YX2H 1TJGH 5E5LA 4FNLL 4HUCA 2ZKYA 4PB9H 4PP1C 4WI0B 3H1ID 3DYMA 4JY4A 4U3SA 4ZT1A 3MRCB 3WN6A 1P69B 3OKOA 4ONFL 3NDZE 5DLML 2Z8VC 4JFFB 1P84H 2ZOTA 3AREA 4XMVA 4FYTA 4YR6B 2XDHA 5AB9A 3GRWA 2BVOA 4NO2B 2VLRA 4MMXC 3BWAA 5T1DL 3OX8A 4JO2H 3VOPA 3V95A 5I30H 4QYAA 3JWOL 1CURA 5ESAB 3WU1A 3QH3A 4J3SA 1BZ7B 2X2IA 4IKLA 3FRPB 1IC1A 2OMTA 4LCWD 3KNBA 2PWHA 2R9HD 4Z7UA 3BQUD 1UC6A 2APBA 3MUZ1 3FAWA 4ZXBB 1RURH 2FJGA 3FKUS 5BVZA 3RK3D 4CVXB 3PJLA 3O3UN 5KVEL 5DZPA 3G71P 4R26H 5DHXB 1UD6A 2NXYC 3VTAA 2HMIC 2ICWJ 3OJVC 4HGMA 2OMUA 3TEZA 4XNXL 4MA1C 5JHMA 3WTYA 2BY3A 4LSUL 3C5JB 2QZ5A 4KK9C 5FDYA 3UJTH 3SBQA 2CCWA 2WZ0A 3VWJA 2E7CA 2OQJA 4K94H 2GQHA 1MRCL 5CKAA 3FF7A 2CGRL 3IJ7A 2P8PB 2D7QA 2OX5B 4UANA 4WUUD 4ZNEE 5CZVL 4HAFA 4MD5A 1A1OB 3TA3C 2JJVA 3RTLA 5EEVA 3WNNA 1MI5D 2AJZA 2WZ5A 2CK0L 1NKZB 3VGDA 3HD7A 2WXKA 1HXMA 3OAWA 5HYQB 1ZMEC 2QPEB 4AITA 1XWVA 3GSNA 4F1ZA 3WFHB 1KTMA 4AK2A 2Z0BA 5EU6D 5SWZA 3RWHB 3T3PF 1EBPA 1ADQH 4XB7A 4AYID 1SYVB 2GBUA 4TN9A 2W8CA 2WBJC 3KYNA 2JB5L 1NU1E 2R0ZL 3NOIA 2W60A 3IGAA 4M6MH 3PNRB 5D7HA 1WZ1L 4S2SB 3BHBB 4ORZC 5DS2A 4K3EH 1GGTA 3QEQA 3FSZA 2DYSB 1HS6A 4UQ3B 5IFJB 5C0JB 3EH4B 4IBQA 2X4PA 4Y8DC 1UURA 5DZLA 2FBWC 4F15C 4L29A 4ONGL 2VRAA 3QRFM 4LF3B 1P2CA 1DVXA 3BAXA 4YK4B 4N78E 3BPOB 2XV5A 1Q0XH 3CVIL 5C07E 1L7IL 4NO5B 4ZMAT 4FD0A 2IWFA 4ODVH 5DDHA 2AC0A 1HNFA 3ARVA 3QXWA 4NPYB 1TNMA 1J05A 1GYVA 5BW7A 2ZCKH 5L4IA 3ZT5A 2Y7QA 5TJHA 1RZJH 2FD6H 5E8PB 5KANG 1KCRH 4Z7WE 3OR6B 2C9SA 4HH9B 5D6CA 3U0WH 1G0DA 3SE3C 4NAMA 4Y9EA 4RX4A 1DVFA 1HZHL 5C0EB 4WB4A 4J6IA 1GL2B 5AALA 4KOCA 1WT5A 1OZUA 5KTBA 2CR0A 2WNKA 4YQXH 3SYPA 3NBNA 2OJZH 2IANB 5F6IB 4JHUA 3TBCA 1UXMA 4CL7A 4K5PA 4JW3A 1BM3L 4ELMB 4F7MB 5KYXB 3WDHA 3GZQA 3VAEA 1BIHA 4XAKD 1VEOA 3BYYA 4D0DB 4BFGA 4FS0A 4MMZC 5ITFA 2EXYC 4G7VL 4MX7B 3S88L 1M42A 2ZAGA 4X6DF 1NPJA 5HHQB 1ZVSA 3G6EP 1CTOA 3VD4A 3I55P 3NCYP 2NZ9C 4O51B 3GSUB 5ADOH 4U05A 1HESA 2NTFB 3PWNB 5IG7B 2QLVB 2RGSA 1GGBL 1J88A 3FOMA 2UXVA 4KV5F 4K23L 1XGUA 3NCXA 2MHAA 2ZVNB 4AT6B 1OF2A 3BRDA 1NCUA 4KGLA 5E9DA 1ZW0A 4FX5A 1WMKA 4BQCA 1FRGL 5CJBA 1JPTH 3TIEA 3GIVA 2XBZA 2XQYA 3IFNH 3KWXA 3LSOB 5DUBB 5EUKB 5B39B 3W0WE 2EDFA 4XNAA 4BWUA 1RH5B 2OK0H 3CU7A 1XL4A 1TVHB 5JR1L 1K4CB 4GP8B 3RK2B 1O9ZA 4BD4A 3FXEA 1YJNP 3IU3A 2Y0DA 1OW0C 2OMVB 3HZ3A 2VDOB 1U8MA 3L4WA 3NA9H 4R90L 1KB3A 1MHHA 2ICEC 1NIBA 1QSEB 2EYSA 4FG4A 1ZHBB 3MACL 1FJKA 4OZHB 1CGVA 3ARFB 5KYWA 4ZMZA 5D93C 5DS1A 4IBLT 3UCRA 1YSOA 4NKOB 1EEYA 1JZJA 3SCMB 4A2FA 5BVJA 2BS8A 2PO6D 5J6SA 3RVXC 2X41A 2Q6QA 1AKJA 2HVJA 4OCRL 4QO1B 5EU7E 1WWWX 4LAJH 5B1CA 4FA8A 4WU5B 1MJJB 3IFPB 3CH1B 3N06B 4RA0C 3MNMA 2H2SC 2Q86A 2UX7A 4PRPA 4TLTA 2QGCA 1P5UC 4YWGL 1J2JB 4L8DA 4PGJA 3MV01 4Z7WF 2VR6A 4PJDB 2LABA 4P2OD 4ZKUA 3CFBA 5IW3A 4JM2B 5EEWA 2VLRE 1VERA 4JGJA 5D6DA 5DJZA 2ARJB 2AJYL 4TVPD 4X7SL 2IBBA 3R06A 4KROD 1Q9OA 4F3FA 1D5BA 5FDWB 4DP6X 4PPTA 4JB9L 3PP3H 3ATDA 1MAKA 3L73G 1A8JH 3ATEA 4Z7UE 3L4CA 1R3JA 4G82A 2YGNA 4UQAA 3BWUF 5GRJL 1HHHB 1UFGA 1ZE3H 3FCBA 2RQ8A 3B8YA 2WWMD 3SBWA 5JMOC 4NZUH 4GEJA 2X70A 4L37A 1A1NB 3NJJA 2QVAA 1T0PB 1F4XH 4U1LA 5FB8B 2FECL 3WMSA 4L8BB 1FBMA 2VXTL 5EF3A 3GGWB 3VQ1C 1EZVY 4WW2B 5DURB 1A1MB 2KT6A 1JVKA 3SE9L 1O7SA 3C5ZB 3EHBD 4YDJA 3REVB 2VQ1A 1U41A 2XPGB 2CHNA 4TL4A 3UPCA 5JPMB 3GS0A 5D1QE 1NTZE 1AXSB 3COOA 4D9RD 4PJGB 3RGHA 1FVCB 1GAFL 4LLYA 4QRRD 1ZT4A 1SQVJ 2YO2A 3C6LD 4HWBH 3QCVH 5F7LB 2JR8A 3ATAA 5TE7L 3K8KA 4Y4FA 2IFGA 3AY2A 2EDTA 4ZMOA 4WY4D 1ANUA 1MEXL 4UU9B 1KZYA 4S1SL 1N0XL 3DRQB 4F9PA 3EOTL 5SWZE 2VL5B 5AVTB 1ZGLM 3T04D 1J1OL 1M2VA 4N90E 3SDCD 5CBAA 1ECYA 3GKWH 4TSBH 4M4RB 1KN2H 1CN4A 3QUHA 5EHFA 1ZLWH 3HC4L 1XTGB 1S7UA 2UV3A 3QULA 4LSDA 4R9HA 5I66B 3Q9PA 3VN0A 4XA4A 3QAZB 1GW4A 3QEQE 1HCZA 3QZBA 1RUQL 2AANA 3UAJD 5L8RJ 1MJ7H 5D1QC 4APXA 5ICYB 1D7CA 1DL7L 2VABA 5CP3A 3LD8C 1NTDA 3FQYA 2R8SL 2YXWA 3RZCB 4LRNH 1L4IA 3O6QB 3UACA 3Q6GH 4M1DH 1UM4H 2C4FT 4AW4A 4I87A 3FQRA 4M7LT 5FLUA 2G3MA 5A2AA 3RX8A 3SKOB 4XVSL 4LSSH 3U25A 1F6LL 4NQQA 1OV8A 3H9SD 4K3DL 1OB0A 2IXQB 5FKPA 3OXSA 1N18A 4J7RA 1J8HD 3AEBC 4YL9A 2KPNA 1MW2A 1OM9A 1TZIA 1MCLA 4ANUA 1T04B 3WAKA 2KZJA 2F7QA 1U30A 3STLB 3BDBA 4TSAL 4NKDB 2YARA 3MRKA 4P46C 4R8WL 4WV1C 3EJJX 2OYHA 1KTLA 4ZMDA 2NY0B 1GOGA 3JWNE 4NOFA 4YDZA 4B97A 1EFQA 1RP8A 5K59E 3ZE1B 2DWXA 4PRHD 3H7BA 4PG2C 43C9A 1IKFH 1PG7X 2VM4A 4Y5XA 4QXVA 1WRFA 4MBOA 3QFJA 1S9VB 1IGFL 4JGMA 1F3RB 4WWID 2ICCA 3EBAA 3L13A 1OM3L 1UUSA 2AI0H 5JNYA 2BXYA 2EEAA 3DURB 1EQ7A 1UCBL 3HB3D 4MKTA 3QO1A 4IGBD 4EJ1C 2YUZA 2YQ3A 4XVTL 2ENPA 1ED3A 4GQ9H 1BZ8A 3MBWA 1SXSA 2B39A 1L0LD 2O5YL 4ODXA 1ADWA 2B14A 4DZOA 3ETBJ 4GO8A 4R5XA 3PL6C 4OSUL 2JKLA 5J6HB 4N6JA 3T2OA 3P77B 2NRDA 3HMWL 3BVVA 4BRYB 3JWNC 4QI3A 3VI4A 3P11H 4K9EH 4EO5A 2W9DH 5E9DE 4HIHB 3R0MA 3TFBA 5BQ7A 5LN8A 3B71A 4K0OA 3KH4A 3OKKA 2Q3IA 2VNCA 4QR7A 4NO0D 5D4IA 3BUIA 3FQ2A 1NCIA 4PY8J 2GI7A 4FQHA 3OPUA 4XPBH 4FXGB 3JBG7 5KW9H 4JO5A 3T4YA 5HD8D 4DPCX 4RH4A 3B7RL 1EVUA 2DQTH 1N8ZA 2K3TA 5IKCB 1PZ2A 3RILA 1JXGA 1NGWA 2YKKA 2WLIB 4DVRL 4A2LA 2R0LH 3L4VA 3CX5E 1D5MA 3K6SB 2KQNA 4DKFL 3BKYL 2ROYA 2Z34A 4TRPL 1P1VA 2H0EA 3WHXB 5IBLD 3VFSB 4MA3A 4YFEA 2X42A 1AJ7L 5KBNC 1NAMH 1PY9A 3K5SA 4PAZA 3D6YA 5IB1A 1D7BA 1JV2B 4UI2A 1WAAA 2AABL 3ESMA 3UG5A 4XMLL 2DQEH 1VESA 5AKSA 1DBKL 5FWRA 4PRPE 2IG2L 1KJMB 3HN8A 3PHQA 4OV5A 3LN4B 3FB7B 1RHHB 2PN5A 4JO4L 2Y2TA 4LCYA 2NNAB 4MBRA 3KWTA 5A2BA 1I1RA 2G2RA 2SPZA 1TYJA 3GBNH 4P23B 3FPYA 4Z7IA 1JGUL 4LSPH 2ZF9A 3GBEA 4YIQB 1QFPA 1ERNA 1YYMH 4JDVB 4OM0H 3SPHA 5BJTB 4XODA 1GU4A 1MNUL 2B0SH 5HI3D 1HOCA 1XBDA 2ZX9A 1I9RH 4KNSA 1AYOA 2BP8B 4ZFGH 2VLJB 3MOBL 4PWKA 4X80H 3SE8H 3BH4A 4AM0B 1NTKD 1KCUH 4V11A 2IAAC 1AP2B 3L1OL 4YXDC 4Y2DB 3ARXA 4DFHA 3W39A 4LSRL 1QLFB 4GBXD 1C5DB 5LNDA 1ZGLP 3O9WB 1DDHA 4W9GC 1O0VA 5L6YL 1F4WL 1UENA 2XXMB 2WPVB 5DD3L 3UBXG 2CALA 1MG2C 1TTRA 4BDVA 1F4HA 3E9UA 3CCMP 4FLHA 4ENZA 3PWJB 2LAGB 1MCIA 3VXQB 2ZFCA 1J12A 1W0WA 3NN8A 2WPQA 4M5YL 1JTPA 4JBZA 4KKAC 4C4BA 2VJ8A 5J5EA 3ZKSD 4PV1D 3TO4D 1DEEB 1UHVA 1ASPA 2VYRE 5C0RL 4NWUL 1B0RA 4OFQA 2WPGA 4LEXL 5DI8B 5DYOA 2EDXA 4KKZA 1HHIA 4PJIB 1O5DT 4YHZL 3U46B 1KLGA 1SLUA 3RTQD 5IBUB 3KLAA 1T0NB 3IJSA 5E2VL 1SQ2N 5FYJH 5DRWB 3NSDA 1HK6A 2QQNL 2R69A 4ANVA 3WUTA 1DSYA 2CZNA 2DWYA 3BZ4A 5KG9A 4XCCL 4JVWA 4URKA 4PP2B 4LSQH 5AVSB 3G6JA 4B7LA 4XC3H 4IIZA 2NUPB 2ADIB 2BJML 1RK0A 1A66A 2A73B 2ZUXA 2ZG1A 1T6VN 4IFDK 3TWCL 3C8KA 3K2MC 4NHUA 3NJVA 4Y4HB 5GGSA 1OPGL 4C83A 1S78D 1GMIA 2YD8A 5E79H 4KRLB 3IM1A 5DRZA 1EDHA 3QPQC 1FL3B 5IROA 4AJVA 5IFAH 2A74C 2QADC 2P80A 2XETA 1LT9A 1AQKH 5KLIB 1A7RH 1TJGL 4DCKA 3UBXA 3L9RA 3N0AA 1FGNH 1UKSA 4PB9L 1T20B 3AE5C 1ETA1 2DLGA 3Q13A 5TQ2L 4V2CB 5LCVA 3O3BB 3BKMH 1KJVB 1YMMB 3K6OA 3O2DA 4XNQA 4Z7QB 4G8EB 1R4XA 5MEQA 2P5WD 4U4BA 4ES9A 4YXKH 1T66D 3L74G 1QTSA 3VXNA 4S0SD 5FYKD 4NAQA 2BSTB 4PMFA 4RGNE 3MN8A 3ZRSA 2YFNA 2BY2A 2D31B 5ESVA 3VFGH 3BUQA 1RURL 3OAZH 1M7IA 4DAGL 4Z3JA 1ETB1 3MLVH 2HLAB 2BM3A 5DJAB 5AWNH 3F62A 3TGUD 2X1PA 3QIBB 4ZW6A 3UJTL 1DR9A 3CFDA 4Y1SA 1B2YA 3VI4E 3BLPX 2CIIA 5GZOC 3HG1E 4NRZB 3MO1B 2VSKB 5FO7A 5I1EH 1UJ3A 1KMIZ 1AHWB 1R33A 2Y7NA 4BFNA 4ISVA 4RDQG 1O5PA 5FOJA 3MZGB 4OD1H 1YEFH 1HU8A 3REWA 3AWEA 3CVHH 3HTKB 5HDBB 1KTKE 1THCA 5DMKA 5F1NB 1ACYH 2OI9C 2RB8A 2XVLA 4O2FA 1ADQL 2YA0A 3T2NL 3TP4A 5DMIL 1NAKH 2BXZA 3HUSC 2WYHA 4LLVA 2WGNB 3HE5A 1T4KB 1BQLH 1RK1B 2MPVA 4RJTA 1CS6A 3ZU8A 4K3EL 2UUDH 2LHAA 4HGKC 1ZEAH 2HP4A 4UT7H 5K9QG 4RIRA 1Q86Q 3NIGF 4LPUA 4AY0A 3X13A 5G55A 1BV8A 1B9KA 1WAAE 2RHEA 5HDRA 4YUEL 1A7QL 1T0MA 3MGAA 1EV2E 4I2XA 4JZNB 3OW2O 2A5UA 4LLDB 1JI1A 1Q0XL 3M07A 4G8FA 1G1CA 2J8UE 1RZFL 3SKUD 3V79C 3TWYA 3RGVB 3V0AC 1J86A 2ICWA 1UWEH 5H35B 1NGYA 1MWAL 2ZCKL 1PX4A 3U0WL 2QKIB 3GG2A 4HJ1A 3L9BA 1SM3H 1EDKA 4HT1H 4JG1L 3O6FC 4YE0A 3V6ZA 1INQB 4ODTH 2QJYC 4G9DB 5FO9A 1ZANH 4YQXL 1X5FA 2OJZL 4HCFA 4X9FA 4K3AA 1SDAB 4U7SA 1S4IA 5ECGA 1S7XA 2EUWA 1A7NH 3Q3DA 2A45H 4PJ9B 1I1YA 1QLED 1HINH 3ZR5A 3ZHDA 2V0AA 4HSQA 4WFFD 2B89A 2YGPA 3N7NA 3I6KB 2B1AL 2IFFH 4NKIH 4EBQH 4LRIC 4HC1H 1A9EB 3V6OA 3MV8A 4QIRA 2ZXQA 1RJLB 1WCBB 3FTGB 2YPVH 2D0FA 2VTFA 3VFRB 1BVKB 3RAJH 3VB8A 5CIPA 1BD2D 5M7QA 4E5XG 1TJHH 5ADOL 3VI4F 4U6XB 3AWFA 1N7SD 2WIIA 4HIQA 1ZV2A 2QKSA 3VD7A 4AYDC 1YC7A 5HHMD 5D9SA 5D4QA 3IXAB 1J5DA 4YPJA 3TJHC 1JB0J 1S1CX 5ADPL 1CO1A 1X4XA 4KKPA 5IMLA 1KNOA 1JZIA 4OF8A 3QUKA 1JPTL 4Z76A 1FLTX 1LTJC 2N1TA 3IFNL 4WJ5B 5DS8A 3FCUB 3V5HA 3MZWB 4P4RA 3TPKA 3JTTB 1MVUA 1L6PA 2W6JH 2OK0L 5E8DH 3O3AB 4Y9FA 2GSIA 1AFOA 3UO1H 4AIXA 1DVZA 1AR1D 3GRGA 3G6JE 1C5CL 3HBPA 4BZ1A 4C55A 1QAWA 1PIGA 4NNYB 1KEGH 1X9VA 3DO7B 1JZHA 5KKZC 4JMXA 2W9LA 3TBYA 2OULB 4FQQA 1N7LA 3IEAA 2YMKA 1MFAH 1KQFB 4IRJD 4FQJH 5J06A 4H13B 3TBVA 4AX3A 3ZTJH 1WAAF 2R23A 2DL9A 2WKGA 1UB6B 4P5TD 3C08L 4WW1B 2UXFA 3MQIA 2A77H 1S2EA 4JFED 2E56A 4JKWA 4ODHH 2BNRA 1GGIH 5HHNB 1KF9B 3T2LA 4LL9A 2VLKB 1D5IL 3KG5A 1NFIA 2CH8A 2G4GA 4L4JA 4IOIA 5DMYA 3B1TA 5L4JA 2ZJSE 4Q6IA 1BCIA 3RJDA 2YKPA 4E5XA 1U3HB 1GMJA 2OYOA 2J44A 4Z3FA 3KPOA 1MHPL 1HJBA 2NCMA 2D2CB 1PDKB 3E7KA 3F7RA 1F3DJ 3MV9D 4FTVB 2JE8A 3Q2VA 2P1JA 3QDGD 4PU2A 5MENA 4DH2A 3SGDI 3KYOB 1A7OH 4HUXA 1DBML 2Z92A 4ANKA 2Z4QB 2A6IA 3FUHA 1FNHA 1VA9A 1Q0YL 4J2XA 1KC5H 4XO4A 3ZRFC 1QBBA 4I9WD 4NZUL 4F80A 4Q9CA 5IOPA 3F12B 3QZLA 5B1JA 2X6VA 1NGXB 1JEKA 2CIKB 3QJFA 5CR8A 3U4AA 4D2NA 1YN7A 5L4MA 4DSYA 4C56A 4EZLA 2BSBA 5I18H 4Y1AA 1SOQA 3BKCH 2GM4A 3IRPX 3ZDZB 2IMMA 4P4KA 2WP3O 4AL8C 1CFSA 2XG5B 3ZYIA 3BJLA 1XF5A 2WYTA 3V52H 1VQLP 4D9QE 1F11A 8FABA 2OTJP 2BIPA 3PFUA 3QCVL 4TQ8A 2P48B 4YXHL 3T2PA 3EO9H 3UYRH 4HDIA 1P9MC 1OT1A 5I1DB 4BQ9A 3SKNB 3FT0A 3MTRA 5DFAA 4L4TA 3QQ9C 3GLZA 2Z4EA 2DJSA 4FNTA 3ZIYA 2KDYA 1MQ8A 4TSBL 3OB0H 2C34A 1R1CA 4A67A 1KN2L 4HP5A 4MDIB 3RB7A 1ZSDB 1MCJA 1WICA 2CA3A 4ZFOA 3L70D 1MPAL 2VLMD 3C60B 3G6JF 2BCKA 3MREB 1WS8A 4TSCH 3VTTA 2XTJC 2ZYSA 4G6JL 4PV8A 3MRJA 1MJ7L 3HZMB 4QOKA 3HAEH 1R19A 2PCFA 2R5BA 3FCSA 4LRNL 2FJHA 3Q6GL 1L6ZA 2JKNA 3ZKMD 1EO8H 4I2XE 5I73C 1UM4L 1WZLA 3DX3A 3SDDB 4A2DA 1YNTB 2YN5A 1KBWA 5L8LB 2KC0A 1M9WA 4M5SA 4HSCX 2J8OA 4H1LH 1BCCD 4WHCA 3FH8A 3ABLB 4UYPA 3V4LA 3WD5L 1SQBJ 3Q2NA 3JWDC 2OTLP 3LEXB 3T0EB 2NW3B 2CM6A 1PZAA 1N6UA 2NY2D 1R3IL 3QHFH 2ZXEB 4XGZA 1FZBA 3WJMB 5CFAA 1THAA 3BVTA 2APVA 4XMWA 1TG8A 3P8MC 1WT6A 3NFQA 3LQAC 1AJYA 4OGYH 4F5CA 3DXAA 2F53B 2OXGB 1UWXK 3EGXA 4ZYKB 3U59A 1WIUA 4NUGH 3VWKC 4O5LH 4KXBA 4Y4KD 1I8UA 4RESB 1FF5A 3Q43A 3GRBA 4KKCD 3U1PA 1LTBC 1JFQH 3KXDA 4MMYB 3QUXB 3AEGC 1WGVA 2C7UB 1HEZA 1XGQB 3A0BH 1H5BA 4LMQE 4ODUB 2DWDA 2VKWA 1XR9B 2X6MA 1G7JA 5E1HB 3V6OE 1I8MA 1J9RA 1KYOH 3MV8E 2H3NB 2KERA 1X22A 2H8PD 2FX7L 3L8QA 5M95B 1JY2P 3BRGC 2ZPKH 1NCAH 2E6JA 3UGEA 2Q2LA 2W6AA 1U8HB 3MR9B 3WUVA 1SNRA 2UYLB 5JPNB 2UXTA 5IK3A 3MRDA 3V8CA 3H32B 5EUOB 4MA8H 2IADA 3LRGA 4L5FE 3QUZA 1RUKH 3QWQB 1QPPA 2P5ED 5C7XL 2C7FA 4B27A 5GSVB 4JFVA 1B0IA 4DZBA 2CDFB 4JZJA 1OTSD 3CC5B 3GINA 1S9KC 4F58H 1BWWA 4H25A 5DYFA 3MU3A 2ZCHH 4PLJD 4NUPA 3MNWB 1K6QH 4XPBL 3V6OC 1K9MQ 2WLYA 2XXCB 4GW4B 4I88A 4K73A 3I56P 4MD0A 4XO9A 1RF0C 2W81C 4Q4IA 4KK8D 1DLFL 2DQTL 3GBMH 1UXSA 3N85L 1J1PH 4TS6A 5D7IA 3TVMB 5L9DL 4YLCA 2R0LL 2FQGA 3PWUB 1V54B 5HHVL 1HQ4B 2ITEA 1G7QB 3QORA 3B9AA 1NAML 1NO4A 3L72D 1DANU 1FNSL 1NM9A 1CD1B 2GG1A 2BK8A 2NY5C 2ODHA 4EIBA 1SP4A 3ZKNC 1YEWA 2BNRE 3IMBA 1K8IA 4XHJD 1SFDA 4HKJB 2YSSB 5IHUH 3A22A 2EACA 2BRRL 4GMTL 1RJZA 3PQYD 5TE6L 2Y25A 4LVOC 5KVDH 2MCPH 3DNKA 3CQFA 3CUPB 1M90Q 4E2OA 4KTEL 1MFDL 3EJYC 3EG9B 2XX0A 4ELDA 5LDSA 4JVUA 4FADA 1RVFL 5JO5B 2EXWC 4HISA 3SY0A 4LSPL 5MENE 1GTFA 4Y1TA 1YYML 1SOXA 3PWPD 5A3ID 2A06D 3KM1A 3KPMB 1JD9A 2X88A 4NLHA 2B0SL 5EU3B 3FF8A 1NFDA 1JWSB 4MNGE 3T2QA 3VQLA 5JOPE 2OCJA 1SFHA 2VAAB 3WKQA 3IPEA 3UROR 4ZFGL 4X80L 4M6NH 2Y23A 3SE8L 5DD0L 4TUUA 5C0FA 1ND0B 4DP0X 2WLNA 2EVIA 4L4VB 2O93L 3JTSA 1DVSA 4C56E 1FC1A 5FHAL 2N56A 2VITA 4Y1AE 4K8RD 3IS0X 1IZKA 1IM9A 3FU7A 5CGTA 5JW5A 1HWTC 2YAMA 1N73A 1H3VA 3MC0A 4MS8C 5EOCH 4EVNB 2IX7C 3IMUA 1FG9C 3UZVA 5HGBA 2PABA 3H1JJ 3EFGA 5IOKA 3DPDA 5CXPA 1TETH 2A9BA 1QASA 3OZ9H 1J0IA 4NYLA 5E00B 3IF1B 3MLXL 4L4TE 4CPGA 4XN1A 1XEDA 1CD0A 2JCCB 2IOIA 4N5UA 1XB8A 4AQZA 1XFPA 4OJEH 3PAVA 3WNJA 1VAHA 2YPLB 3MMEB 4G8AC 2V5TA 4H0GA 5E6IA 3D87B 4LLWB 1ZT7A 3BD4A 2HXAA 4U0QB 3V2PA 3AMKA 2VDKH 1DUYB 1SQXK 4N8VG 1H6FA 4QOKE 2ADGB 4JY5L 4IJ3C 3ZT7A 4LSQL 4HOXA 1Q94A 4YSUA 3IU4H 2VE6A 4R97C 3OG4B 4X5RA 3WFDH 2ZT9D 2Y7SA 1OAZH 1QEWB 2IIJA 3IDNA 3Q1SH 2XN0A 1SF3A 5APWA 2DTML 3ILDA 3VE0A 4U3FD 2AMGA 4RDBA 2VQUA 1DE4B 3Q2WA 4CC4C 3LXUX 4LLAA 3D85B 1M1JC 2H47C 3PHSA 4LIQH 4U31A 3Q1MA 2F5BL 3KPSD 4NQEA 3RDTB 4M5TA 3TF5A 2YBGA 3X14A 1D6VL 1IBBA 3M17B 4PD4H 4F5CE 2OYIA 3DXAE 5I76A 1FGNL 5EU5A 3DA0A 3EYQD 5FUOL 4F8OA 5DZJA 3DOSB 4JPVL 2NY4D 4PCYA 4LCCA 3EJPA 1IGJA 1SJHB 5ETUB 1PG7L 2IZ0A 4E9LA 4DEPC 1MZZA 2XY1A 3Q6FA 1ETJA 2VL4A 3HA0A 2DQ6A 4QYOA 3BUYB 5J11C 5D7LB 5FKAB 4JS7A 5F72S 2X4SA 4XVJH 2FFDC 3AU1B 3QZOA 2HR3A 1KCLA 2R29L 1OWWA 3QIWA 2JMRA 3ISWA 3MLVL 4MZ3A 5HYEA 3LZFH 5GRZA 2IGLA 1BSIA 1IM3B 1N8RQ 1QSFA 4GNKB 4WNQB 2FBOJ 5AWNL 3BGFB 1VACB 3FTSA 3G5VB 3VXSB 5T3XE 3S0PA 3VH8B 4JRYD 4U6HA 2Z5IA 1NGZA 1PZ5B 1UT9A 1EGJA 1AI1L 4R7DA 4HKZH 5DO2D 1P7QA 1M05B 1YEJL 4JK0D 2Q20A 3HE6C 3MX0B 5I1EL 3CFJA 3T4AB 2F15A 1WHOA 4MYPA 3C2AL 5ABAA 3THMH 4IKIA 2DLTA 3WMPA 1AG0A 1AS6A 4LU5L 3CVHL 3FH5A 4DEUA 3GKZA 1JZ8A 4RFNB 4IOSA 1D9KB 2ESVB 4WTXA 3O2VL 4Z7NE 5BRZA 2JKIS 2JQAA 1KLFA 3LW5H 5D7IE 5KVMC 1SFCC 4FJ6A 4EXPX 1NAKL 5ALBL 5FW6A 1KGWA 5GGQL 5DFTA 3RA7L 5L88L 1BQLL 3NP3A 4ZUTB 4L8CB 1BYNA 2J8HA 3D4GA 1KXVA 5IJVA 2HFEA 4UT7L 4OGAD 4OQTH 2WSCJ 1MFVA 3DX7B 3GDCA 3OMIB 1FYHB 1JJUA 1I1FB 4MB3A 5FO8A 3MLRH 4UT9H 4F8NA 2J57A 2HRLA 3MYZA 3QWOA 4BSVB 2VM9A 4GP5B 1KN4H 4Y5YC 4GDOA 5B7EA 1M71B 1SQBK 2PXYD 1QHOA 2VMJA 4R0LC 2VDQH 3SDXA 1A0QH 5DK3A 2Y2YA 1NJ9B 2HKFH 2B16A 2XWBB 4Q8BA 2A83A 1A7PL 4JUTA 1PAMA 4RAUB 4ZW8A 3RL1B 3OKLA 3SQBB 1TUPA 3RK2D 3SDAA 5M1BA 5CMAB 2IEPA 4NEHB 1AGCB 4NZFA 1UWEL 3ME0B 4FG2A 3SIKA 2ZSWB 2WPSA 2Y0SA 4YSCA 1QSED 4FULA 4HT1L 3ZVVA 5A2CA 1MIMH 1OXZA 1NFKA 1NAMB 4A7PA 4ODTL 2DQJH 1AHKA 3ARFD 3QDJB 1ZANL 1NFDE 3QQ3A 4P0DA 2P26A 3FQTB 3SCMD 3HUJB 1CFTB 5H4YA 4DKAA 1U8QB 3BKJL 4M7KL 2PWEA 2ITFA 3ARGA 3E8UH 3N40P 4Y19A 1A7NL 1P84I 12E8H 2DM2A 1VEMA 3II2A 4KZDH 5HYJE 3CZNA 3R7QA 2V3DA 1CR9L 4CC0A 3BLKA 2IFFL 4TNWK 5B3SB 1AD9B 3AROA 4NKIL 3TV3H 4YO0B 4ZPTB 4QHLB 2OA9A 3DARA 4J28A 4JZOA 2X2JA 4L3EE 5DZAA 2WT7A 1QRNA 1CGWA 3U83A 4AL8H 4MMXB 2GK0B 3GRWL 5C08D 5F7UA 3HBZA 4AIZB 4PBDA 4MNQD 4JM2D 1V3KA 3BUTA 1BGYJ 1TJHL 2WLLB 2IF7A 2WTRA 4BEIA 2FT6A 3WYRA 1NOFA 1FZMA 2EDLA 3FQUB 3MRFA 2D7MA 3NFPA 5KAFE 1BHGA 2H26B 2DYPB 3HVDA 1QL1A 1V3MA 4JREC 3C6LA 2NXYB 1A6ZA 3LRLA 2EE2A 1T89A 3OSKA 4MA1B 2R1WA 3U9UB 2AITA 3B5NA 2A6KA 4Z0BH 2R7EB 4TYUA 4XP6L 4X5QA 1XD0A 1XF3B 4UB6E 1Y7VA 4Z7NF 5ID1B 5IIEB 5D7IF 3OKNB 1WDAA 1BVLB 3C5ZD 3MRBB 2F6AA 5FA4B 3VG9C 1AIFB 1YY9D 3S6CA 5AVXB 3D6ZA 1NIFA 3TA3B 3PJSK 5LBVA 1JZ5A 1L0LG 5CWSB 1L6XA 4NT6B 4YHNB 1WZKA 4U7JA 2Y72A 2Y1YA 2VR5A 3DI3B 2CKBH 1MFAL 3NVQA 3DUHA 2XWXA 3H8NA 4XVOA 3V55A 1DJSA 5DZ9A 3RVUC 3SB3A 3V4VA 1HILA 3CZSA 3JWDH 4WLCA 3HKFA 4NQEE 2WBJB 1BREA 5CD3A 3QXVA 5C0ND 2A77L 2K9YA 3S96A 3FUEA 4HXAL 4J1UA 5E99H 4OB5L 4G43A 1GGIL 4A55A 1S9YB 3X1NA 1VADB 3L4YA 3TFKD 2X4UB 5GZND 2UZYB 1WBYB 3LQAH 1LP9B 3DBSA 3OMNB 2WQ8A 5HGHB 3CSYB 4LFHD 4F15B 2Z8RA 4TUJA 5AVRB 2KLVA 2PP9A 4D9LH 1IGTB 4WHTB 1SHXA 1JN6A 3DSNA 4KJWC 1NFDF 5F9OL 4B6ZA 1DJZA 1JCDA 4N2AA 4N6RA 1HI6B 4XXWC 5EIQA 4Z8FH 3BAJA 4JRXB 4FMKA 5KLVK 4GOEA 1IJDB 2DF3A 5GJSL 5ABZA 2IH3B 1KC5L 1NBYA 4W9IC 1I1AA 3WE6A 3DVGA 4PH8A 4GKSB 4DF9A 4A2HA 1LNUA 3GUTB 1FGVL 1QSFE 3R4RA 4U33A 3VNZA 4J4PA 4GRLA 1W2KT 3FHQA 4KI5E 1AVOA 5DJ6A 3ARDA 1DO5A 1IAOB 1XCQA 4XRCB 1OAYH 3O41B 4N2MA 5ILTL 5I18L 4PGBB 3VFVA 2CO1A 1BJ1J 4AYBA 3CZUB 5IQ9A 1WYJA 2NY0D 2ROXA 5IMOA 2JIXB 3K6DA 4XCYB 1V27A 1T7VA 4XHQA 4WGWB 1TO4A 5GS1A 5FEBA 3RBZA 3NSCA 1UATA 2NPSC 4MMZB 4Y16C 2WMPA 2XVKA 1JF5A 2DAVA 3EO9L 3UYRL 2X89D 3M7FB 4NRYA 3NZUA 1R3HA 2GJZB 4QHMB 1YN6A 3WHE1 5B38G 4LDEB 2J1WA 5BRZE 4NQXB 2V2WA 3RJQB 3EO0B 4LHJB 2Y3AA 1RUPL 1FZCC 4Q2ZA 1EDJA 4F7TA 1OHZA 2DM3A 1NTKG 4KMTL 3IWVA 2M2DA 5C09D 3MLTB 4AH2A 2ENSA 1JYVA 1K8DB 1PFCA 2X4QA 5I1GH 4G8GA 4YBHA 5DWUL 2NY5H 4KJYB 3BW9A 3CZFA 3G9AB 1XGTB 3T3MB 1GZHA 2Y36H 3MA9H 3IDGA 4GRMB 4J39A 2EIZA 2K1MA 3CVHB 1EO8L 3DETD 2R2BA 2W9EL 5KSUA 2BSRB 3SDXE 3UDWC 3L3GA 2BP0B 2FHFA 4XMXA 3C9NB 2SEBB 4OFDA 1BQUA 2ICEB 3D7PA 3GMOB 4BWNA 1KBKA 3QNZB 3GPSA 2FE0A 2YAFA 5EZOH 4Z95L 1J5OH 4YN3A 4GS7C 2GB2A 5D93B 4NNXB 3EUDA 5E9AA 5AAMA 3GI9L 1S5LH 3SKJH 3DGGB 3C6SA 1LTXA 1Z5LB 3IJ9A 1OMIA 1NEZG 2LR2A 4HVBA 3CC1A 3RVVD 1ZIBA 2OCCB 1N59A 5F6HI 4U6YB 5H2BA 2VDML 1R9FA 4Y19E 5B1BB 4KY1L 5T3ZE 1TLMA 1A6AA 1IAIH 2V5RA 1NOAA 2J72A 3HNSH 4UNVA 5B38A 2BFVL 1P5UB 3NDYE 1Z3RA 4PVBA 4JQXC 2ZX6A 5E8EB 1LO2H 4BK8A 1QW8A 3QS3A 1RF1A 3G9RA 2UWEA 3QI9D 3MLUH 4CVWA 1BSNA 1QRNE 3JT2A 3HR6A 2O6CA 2Q5BA 1NMBH 4YDVA 2FSDA 4MVBD 2ZPKL 4JFQB 4GBXA 2NR6C 3LS4H 4DFIA 1A4KB 1GGCH 3HKZA 3OXRA 4KI5F 4K9JA 3U2SA 2PPEA 4BA8A 5IJDC 1ZTMA 2IBZX 2WSEJ 3LS5L 3JVGC 2ERJB 3FX0A 3ARBA 1C8PA 4YE4H 5F9AC 5D8JL 3BEWB 2JK5A 5MERB 2FUTA 1OLZA 5EFIB 1KQGB 4ZAKA 1A6TB 5JUEH 4JY4B 4U3SB 2WZPD 2X10A 2GTWA 1WUNT 1Z5HA 3RWDA 5D1ZD 4Y2DD 4HH2A 4GEIA 4KO9A 3TO4A 3W2DL 2Z35B 3UAFA 1MREL 1K6QL 2EO9A 1I53A 2I07B 3NABL 2F54B 3OHXA 4GRWF 1S7SB 5CHNB 5GS0L 1PD1A 1A4JA 3FZUC 4D6TD 2JJLA 3BN9C 5E94B 1J1PL 4W93A 1CLOH 3ZHLA 3BPNC 1PL5A 4IMLA 4DPRA 2CPBA 4Z7UB 2FO1A 4NSKB 2C3HA 5B4MC 1JZ3A 1OP9A 4E68A 5TISE 1D5RA 3DUUB 4HJGA 3GHEH 5JHDD 3T8VA 1Z9NA 2FWOB 2BOCA 4Z23A 5I23A 3OKEB 4N2EA 4KUCF 2EC9T 4UB8H 3O3EA 2E27H 4NPFX 4FQ1H 2UX6A 3F7YA 1B0GB 3M86A 2D0HA 5IJKC 3A5TA 2NMSA 3BVUA 4QY8A 1JCCA 5KYUB 5D1QB 1LD9B 5EBMB 4M56A 3LD8B 1V5JA 4C8XA 3LPFA 4JFPB 5FYLH 5HJBA 3VFNB 4TKWA 1PLAA 5K1VA 2XKUA 5K9JH 2KNCA 4XNYH 3SZKC 3DMMC 4AQAA 3Q3GA 1OZHA 2JB6B 4QRUA 1QFWL 4CW1B 3BESR 4WEEA 5CS7A 3LNDA 4RAVA 2DV6A 4W80A 1OGAB 4JFUA 5CEXA 4GKZB 4R96B 2PWDA 2LAAA 5IR1B 3G5WA 4Y4HD 4U1HB 3N1MC 5DZNA 1QW9A 4MZ2A 1G6RH 1I7TA 3GWJA 2C0XA 3GMMA 3QUMH 2PW2A 2Z4TA 3BH8B 2ZUTA 5KLVG 3NG5A 1UQSA 4DW2H 1K5NA 2XI9A 2C1OB 4G1EA 1XVSA 4P46B 5HYIA 1URLA 3DOHA 3LZNA 4WV1B 4YDKH 3F58H 2XZRA 1OHQA 2ZCLH 5BQDA 2BVPB 3K2KA 5DD1H 5EN2A 3VA6A 4LP5A 1YG9A 3OAYK 2XG4B 5IMMB 3FO9B 4S1QL 5F3HA 1SQXE 1CLYH 3SDYH 3GD1C 5DQJA 2GIXA 1YMMD 2HZHA 3PJSA 5CCGE 1XDTT 2EDJA 1IL1A 4HS6A 3BISA 4Z77B 5C2UB 3R4YA 3CLWA 4F7CA 2AJ3B 4ELKA 3C8DA 4TUOB 3HPJA 2H7WA 5B8CA 4HUWB 3MKKA 5EOTB 5BOZG 3LKSA 4O4YL 3WUWA 3PL6B 3C87A 4P2CG 5GGSY 3Q5PA 2FO4B 5ICUA 4BJLA 4ZQTA 2QVIA 3DX8A 4J4PC 3GMAA 3NXSA 3N1QC 1BA9A 3NCYS 5HJGA 4D94A 4WEBL 4EQ3A 3QIBD 1LXMA 2EJ1A 5LVEA 4G8GE 5E8OB 1NEPA 4JQIH 3EJTA 4LT7A 2GJPA 2VDKL 2VOTA 2R83A 3VO0A 5AZUA 4U1NB 3VA2C 5CCGC 1BDCA 1CICD 1U6AL 3IU4L 4KRNA 4U7KA 1N9PA 3GMPB 2IPTH 2OLDA 1WA0X 3RY6A 2YD4A 1MH5B 3SQRA 2L0DA 2G4EA 4QRSB 4UIMB 4BCZA 1CTMA 4MQXD 1KB9H 5DJ2B 3L9EA 3WE1A 2J1KA 3QIUC 4F92B 3WEXA 3GSOB 3D48R 1VQ7P 1RJCA 2XWEA 1IC7H 1K9TA 1QHPA 4NQTA 3VGEA 4HFWA 3KGRA 3QJUB 4LCVA 1W15A 3QJHA 4HLZG 5T1LD 5F0PB 2WTPA 4GG8B 4HD9A 5KUKA 1XZ0A 2X40A 4NDMB 4JYCA 2HH0L 1P7KA 2NYYC 1W6LA 5B66E 1UOVA 2AJUH 3T0XA 3AE3C 2BCCG 5FGBC 1BOGA 2WP3T 2AK4B 4H1LB 1TZHB 2DQMA 3UAAA 1JTHB 1SBSH 1UD5A 2UWEE 3NK4A 1UEYA 3HI1A 4HWZA 4N26A 4XVJL 5DJXA 4APQD 3ARRA 3VTPC 4RWHA 1G5GA 3P4LA 5FC9A 1G94A 2I85A 1DD4A 3EFOB 2QVMA 3LZFL 3WFZA 5BVJB 4FHKA 2DIBA 3LRMA 1WD9A 3CXHD 2WW8A 4MXQD 4XBEL 5HDQH 3RFRA 5AD0A 2O1KA 2VDMB 1TVBB 1KTCA 3HFMH 4MD4B 1TNNA 3FT1A 3TDKA 3KPLA 2ZOWA 3BWSA 1YRKA 5D1XD 2QMJA 4DNLA 2O1JA 1NCJA 3WGVB 4L0ZA 1TQCC 3Q7JA 5EC1B 2AQ2A 1SQBE 3GJEA 1FZOB 3S3JA 5TQ0H 4PQXA 2ZX7A 3T8XB 1L9OA 5AYQA 4HWNA 5EO0B 4M1CD 4DZ8B 1HWWA 1W91A 1A3RH 5T1KA 1ZRTD 4RSVA 3PWLA 1YUHB 3CBJB 3GLDA 2N01B 3QQ4A 2K88A 5AW9B 1J0ZA 4Y88A 4ABQA 1LWHA 3P4OA 2R5DA 1YO4A 2ZWYA 3GNMH 2MCAA 6CGTA 3ALPA 5B5EH 1E4XL 3JV4A 2HTLC 2HG5B 5DK2B 2VZTA 5F97E 5KZCB 4OQTL 2FJFB 1ILUA 5HYSG 3U6RB 3GLAA 3N43B 1DO6A 3HZVB 3LIDA 5K33A 2FIKB 3BIKA 3LQMA 4NXKA 1SDYA 1HDMA 3R1GH 4IRJA 2Z8WC 4NUJB 5FK9A 4W81A 4WO4A 4DETA 3WO4C 4AG4L 2R69L 2RD0A 3MV7D 2VDQL 4H8WL 3IPFA 3QVAA 4IBWA 3ZTCC 2HKFL 1A2YB 3KGTA 4OKVB 1NDGB 3H1IJ 2BNUA 3LH9A 5TDPA 1UKQA 3GXDA 1S7WA 4MNHB 2R2CA 2R1XA 4DTGH 2Q7CA 2G5RA 2PCPB 3FO1A 3KR3L 3ZGIA 2X44D 2A9MH 4Q9QH 1E6JH 4GJTB 3L75D 2UZXB 3L70G 1H3WM 1DBBL 3TZVD 5JDJA 1G1IA 3ULUD 1ZA6A 1P6WA 4LHUA 1R3KA 4KXDA 4AQ1A 3FC8A 2A74B 2EYTB 2QADB 2B4CC 1NBVL 1HCVA 1Y8AA 4PJ8A 4O9BA 1N5YH 3MCKA 4I18A 1OE2A 1M56B 5JIQA 2UWEF 9CGTA 2VLKD 2ZJSL 5K1NA 4KKNA 5FYJU 5MI0C 1USQA 5DJYA 1FS0E 3V6FA 2FQFA 3L71D 4XCNB 2EH7L 4XN5A 1BCCG 1GJWA 3O2DL 1XXFC 4YSTA 3BPLC 4XP4L 1U3HD 2XFXA 2DDQH 5E0QA 2KQMA 2NXZC 5SX5H 3T08A 4OAWA 4PRBB 2YIUC 3NJKA 3QZWB 3KPRA 4WK4B 4BZYA 1BVNT 3E1RA 2VSDA 4MCZA 2GUOB 3NT0A 4C4KO 4EDXA 4JF7A 2LR4A 3KDMB 5HYSA 1D7FA 3EYUH 5I1HH 4KQ0A 3QJZA 1O7VA 3DHMA 2N3JA 3A6OA 3GXFA 4CILA 2QHRL 5FS5A 4B9JA 2CM5A 1IGYB 3L16A 1K2DA 1VF5C 2BCMA 1HJCA 4H5SB 3ZYZA 4FXKA 4AUJA 5IVZA 3V5DB 3WDIA 3UYOD 4EI5C 4EUPA 1OAKH 1LTSC 4FQXD 3TN0D 3W82A 1UJTA 3VDBA 1MW1A 3IJ8A 3UBHA 3K46A 2AEIT 1FPTL 2Q76A 3K74B 5CEZH 5EMYA 3O81A 1LVEA 1LO3H 4LL4A 3DX9A 5HHOA 4KGJA 3HR5B 5GGUA 1CI5A 2OI9B 5KLVE 1NEUA 4YSPA 2XXGA 4HUNB 4E41D 4F7PA 2DQHH 3OV6A 3E6FA 3MRMA 1JGIA 4JL1A 5GGTL 3HUSB 3RGBA 1IV8A 5D70H 3BWZA 5DD5H 3MLZH 4X6FB 3PAZA 2VDRH 3KM2A 4WHDA 4NPDA 3HG1B 3TNUB 4GYBA 4HXBH 5IF0A 2VDKB 3CSTA 3LQAL 3DV4A 4XPTH 3HIZA 3U0TA 4B9GA 1N6QH 5MEOB 4YAQB 2NX5D 3H1JE 3GMLB 4A7TA 1URQA 1IE4A 3KXFD 4J27A 1OARL 1SLWA 3K6FA 4LHQB 4D9LL 5BOJA 4X7DC 1KOAA 2XPZA 2YC1B 3LEYL 1SDDA 2Y6SD 3QNXB 3KPPA 1PF3A 1ZJBA 4HCRH 3A6CH 3EH2A 3GMRA 4MAYC 4M7JL 1AFVL 4HWUA 4Y4KA 3TF4A 1KILC 1NGWB 3ESVF 2HX8A 3NZHL 4PB0L 5DZOA 4ZUVA 5C9JA 3RL0C 1G7HA 2N7SA 1D5MB 2XV0A 5APYA 3BT0A 2GSGA 4GIOA 4P05A 2B08A 1ZAGA 4EAEA 3BXNA 3T0ED 3L6FA 3O6FB 1RQ5A 4LLMA 2QJYB 3TH3T 2Z31C 3HE7A 2B7DT 3DTXB 2IDBA 2HYNA 1J9CT 1SVZA 3BAYA 5IB1B 1KT2B 3ABZA 2VXSH 3FSOA 5D4JA 3MNZA 1E28A 4NPEA 5DJ0B 1FYTD 3Q44A 1BEXA 3EYVB 3GB7A 3HC3H 5TDNB 3N5AA 4UQ2A 4AGNA 4M8QA 4OV5B 1B4RA 2J8UB 1KELL 3EJUA 1HIMH 3IGFA 4FG6D 4M1GH 4JFWA 5DQDL 4OCSH 5DWPA 5FX3A 4PW9A 3TYGH 2OW7A 4RWYH 3D3VD 5EF1A 1AGBA 5K9OB 1GZQB 4HEPA 2E8ZA 2A06G 4N2CA 5FGCE 2NT1A 3DX2A 5A6MA 3AADB 2FX8H 4KHXA 2Q7AA 4DK3A 5HI5C 1NIEA 1Q9LB 2EE6A 3R0NA 1AV1A 1OE1A 1I1CA 4KK5D 3S4SB 4Q6KA 3R8QA 1Q9WB 4BZ2H 4EOWH 4WFGE 4NWTH 3G04B 3BYTA 3GZPA 4X83A 2JKWA 3P4NB 4L5FL 4HUUA 1GZPB 4HLJA 1RZ8B 1N8OE 4RVBA 1CUOA 5JIMA 1MAML 2CKNA 1E9OB 3QO0A 3VXPA 5I1GL 4QLRA 3F89A 2NY5L 4Y7MA 2BCCE 1E50A 2APFA 2KSEA 1TQWA 1Z3GL 3CHXA 4HEMA 1LTJB 1DFXA 5HJDA 5LBSA 2EDQA 2XCMC 3FQNA 4BFJA 3MA9L 4J3OD 3QRBA 2E75C 4RSYA 4KWUA 5GGRB 1H0DA 2COVD 2B9AA 3BZEA 2J2ZB 2YMTA 3TSIA 4HKBA 3KPQB 3RURA 1PVHA 3FRPG 3RWEB 4BZ1L 1HL5A 3VGGA 3G08B 2E86A 3Q2YA 3DX6A 3WNOA 3NN8B 5KKZB 2YZ8A 3EDFA 1J5OL 1JMMA 2E76C 4UTBA 1UIXA 2V7HA 3NH7H 1WC7A 2G5BB 1ZMYA 1EJOH 5JLZA 1J1XL 4M3KB 2CD0A 2NDGA 2WB7A 1NH6A 4HIXH 3KZ8A 2GJJA 2EDWA 2V9RA 2VN7A 1Z9OA 2WSDA 1KLGB 1W72H 4TQEH 4RFOH 1KFNA 1B3JA 3VXMB 1ILSA 3H9HA 4MQ7B 4N20A 5J0BA 5KS9F 1AYRA 3PWPA 1IBYA 1HCYA 2KZKA 3HNSL 4JY6A 5KG9B 3WTWA 1TT6A 4FFYA 1DQML 2VDQB 3VXRB 2AXHA 4U3FG 4FFTA 2VUYA 5C0CB 3F65A 1M1KQ 1FH5H 1RK0B 3HHSB 3P9MB 3P73B 1X6LA 1F4YH 1N4XH 3MLUL 2AEFA 1ONQA 2BVUA 2XN2A 4HIIA 1TCRB 4N0RA 2KI6A 3LXBA 3MXVH 3KPRE 4D8PA 4IFMA 4WI0A 2QDVA 3S98A 4AVHA 1V7NH 4GUCA 1IEAB 3MRCA 1BMWA 5L0QC 4LOUD 2MWCA 5CEYB 4WWKC 1LTGC 3S8GB 4JFFA 2FGWH 2KYIA 2X0UA 4YR6A 1NFAA 2XVBA 3L2LA 5KAQF 4NO2A 1JK9B 1U9KA 3L9RB 5JUEL 1QX8A 3SEPA 2D4DA 5ESAA 3CBRA 4QXUL 1BZ7A 3FRPA 1ZLDA 2E9JA 3BCFA 3D4YA 5I26A 3APNA 3EAKA 3S34H 4ZXBA 4XMKH 2VW6A 4CVXA 4CC1A 1Y0LB 5E4IA 2G60L 3FOLA 1IAKB 1MCQA 1SMAA 2YKOA 2AV1B 4ESKA 3TXAA 1LEIB 3KJ4C 4KRMB 4MXWL 5JDSB 1WWCA 2JEEA 3D0AA 3C5JA 5CCJA 1EQWA 3H9ZA 2DMKA 5HHOE 3GHEL 2YO3A 4OCMC 1MV8A 4R4NC 4QPEA 3O4OC 2P8PA 3U0PA 5AZEL 1ZLVH 1YNLH 2OX5A 2GFBB 3CVBA 3VW3L 1A1OA 3KLSA 4BFRA 4I0KA 3WI9A 2E27L 1WUZA 4JPWH 4FQ1L 5AW0B 4JGUA 3SQOH 4PJCA 3FFDB 5HYQA 4GQRA 1X0TA 1CLZH 2XTJB 3MYJB 4N2IA 4AEIH 2QQLH 1F3DH 3WFHA 3WEOA 3CHPA 3O6LL 3P54A 3ALWA 3RWHA 1REIA 4O00A 1SYVA 2O6FA 5I73B 2UY7B 4XNYL 5K9JL 1K05A 1T1XB 2ZF8A 2CKBB 3BHBA 1BE3D 3G5XB 4S2SA 3JUYA 1X9UA 4H88H 3VXUD 2HN7B 3T97B 4UQ3A 3V0WL 5IFJA 4XPGL 5GRUH 5C0JA 3BZDA 5DHMC 1A3LH 2QEXP 2CLVB 3FFCB 1N6VA 4ZFZB 3IFLL 3AZUA 4N2NA 1EJ8A 3QUML 1WIPA 4LF3A 4U3HA 3RDTD 1M1XB 4DW2L 3PRJA 3CFKB 2WLZA 4ORGB 1GTWA 1E5ZA 4NO5A 2QSVA 5F70A 4UM9B 1GYAA 4WI9A 3VWKB 4RMUA 4YDKL 3F58L 2ZCLL 3MJ8B 4F1SA 4N85A 4HS3B 5DD1L 3P9WB 4NPYA 3LPGA 3TYYA 5E8PA 4X8XA 3DGCR 1VL2A 1XF1A 3OR6A 4HH9A 3GTNA 3QUYC 3HNVH 4ZUSB 1GSMA 5C0EA 1GL2A 3IE9A 4PYGA 3TBSB 1BPLB 3QB7C 1X8YA 2ICWB 2IANA 5AUMB 1NGYB 3WLWD 5LG6A 1NUNB 2J20A 5KYXA 3AEAC 2LU4A 2ZP8A 4ELMA 4F7MA 1MRDL 3RYMA 3L1GA 1U3YA 5C6WH 1OVRA 4OLZH 4D0DA 1OP3H 5IWLA 3FPXA 4MX7A 3MDJA 1EMTH 3Q8AA 3ZJAA 4CVZB 4OM1H 3KEHA 4P5KB 4P2RB 4JQIL 1CLVA 1P5VA 4HEME 5IZ7A 4O51A 4Z1MH 3GSUA 1WF5A 3HCVB 2NTFA 3PWNA 2I1KA 5F44A 3ASOB 5IG7A 2IPTL 4Z7OF 1M9SA 3TEUA 3UIYA 3UYPB 4IRSC 5DFWH 4NQDE 1IC0A 4AT6A 2V9TA 3N1FC 1D9KD 1H19A 3CWBD 1HAWA 4ONOA 3D0LB 2AGJL 2QVFB 2KUBA 5DUBA 5EUKA 2VMCA 4GKGA 1SN2A 4G9FB 5B39A 1X5YA 1U8IB 2WVTA 3DX4A 4BCXA 1AZVA 3B34A 2W80C 1SJEB 4EI6B 1Q90A 1XF2B 1TVHA 1K4CA 1BFVL 3UJJL 3USSA 3OGOE 3FWLA 1CU4L 2BP3A 4OLYL 2OMVA 4M29A 4O9HL 3B3BA 1QR4A 3SYCA 1P84J 1QTYT 4NGHH 3V10A 4QJ4B 4OBRA 4PGEB 2B4CH 4K7FB 3WSQL 1L7TH 2CR6A 1QSEA 3PPEA 5E4OA 4ETYA 1ZHBA 1PYWB 4OZHA 4QT5B 3ARFA 4LVOB 3J07A 1SY6H 4NKOA 3SCMA 5I9QC 5GISH 4OD3H 1SBSL 2XT1B 3TBYB 4YGVB 1WWBX 1BMZA 3WTVA 4BK4A 2J1ZA 1S3KH 4WU5A 3FO0L 1MJJA 3CDGB 3CH1A 3IFPA 5JZ7C 2DMCA 4Y9CA 2EIMB 1KJ3H 3U1SL 4GQPH 2JI2A 1GZLA 3O8XC 5H2FH 1QVOB 3K6NA 4K71C 1KFMA 1QBLL 3CDYA 3D2UD 4FQLH 3HE4B 2H0FA 2VZ1A 3I85A 1QFUH 2FLRT 4JFFE 4M7LH 2WKLA 4N3TA 4PJDA 3RI5K 1OALA 4XPFH 1EHAA 4LFHG 5CJXA 3BDYH 1TEYA 3CVCA 4JM2A 4YH6A 4KTDH 2ADFL 4UNUA 2ARJA 2NY7L 4WI4A 5C0BB 5FDWA 1SEBB 2QR0B 5C92A 2AKRB 4MJ6B 1ACCA 3K5RA 1UXWB 4PRIB 4XPAH 4XNUH 2MQ0A 3IWUA 3L4XA 5TQ0L 1HHHA 2XRAH 2E0PA 2JLLA 3II3A 3LXAA 3P69A 4L9LC 1RPUA 5D1ZI 5CZKA 1A1NA 4P57B 2HKHH 1BG9A 3GMNB 5FB8A 1AZBA 1BQ5A 4L8BA 5GGVL 4CU6A 3GGWA 2ISDA 4FRWA 2FQDA 4WW2A 1A1MA 3NMEA 4MNGB 5JIIA 3WXVH 1ZLSH 4GAJH 2EAEA 3REVA 4JDTH 2XPGA 2ZOUA 5JPMA 1AMYA 5F96L 1AXSA 5JA8B 3FUDA 4PJGA 2I9TB 1FFOB 2B5IC 4KZCA 2AP2A 2NXYD 5CKGA 1UD2A 3ZL2A 2CXKA 5HHPB 4PJCE 1T3UA 2F61A 1NWOA 5MEPB 4JANA 4UU9A 1G9NL 1WBXB 1CF8L 3PPSA 1PZBA 1SHWA 3DRQA 1KGXA 5JQHC 4IJ3B 3ZZ1A 5LDUA 2VL5A 2WWNA 3BMVA 3S5LG 3NJLA 4R97B 2YQGA 3QZMA 4M4RA 3TA3D 1XIWD 5EO9B 5GZNA 4KUZH 4DTGL 1BFTA 4FLSA 1S7QB 5I66A 1CI3M 2OR9L 1EAPB 4XC1H 1M1JB 3RBSA 3RPIB 4XX1G 2CJTA 1W9XA 3V4UH 1KYDA 3SWFA 1JPSH 2BVEA 5ICYA 3I50H 2CQVA 3RZCA 2NSQA 2YQ2A 3O6QA 2ZXCA 4P3CL 3UIZA 1N5YL 2QTVA 3APFA 2G0LA 3HMXA 3SKOA 4WAFA 3N1PC 5JW3H 1YECL 3QJRB 2BHZA 2YD3A 4YBLC 3SOTA 1QMUA 1PG7W 2PCFB 3L7FB 4NJAH 2IXQA 2TAAA 2Z7WA 3TGUJ 3NSYA 1NSNH 4DEPB 2BSCA 1T04A 1XH3B 1EDLA 3B7TA 3BCCG 1HH6B 3ROLB 2DDQL 1QL2A 1E2VA 3EYOB 4Z0XB 3STLA 3SGJA 5E24E 2IDCA 3RVTD 1A22B 2WUBL 4NKDA 4AENB 5B21A 3BMWA 2IANE 2FFDB 3DOIA 2NZ2A 2X2HA 1G6RB 3LIZA 4L1DA 2RJMA 5EZPA 3QUMB 3L1FA 4ELME 4OZGB 2FY8A 2K9UA 1WFUA 1NU1D 1W0YT 4Z9KB 3MTUE 2EILB 4UDUA 2ADJB 2WK2A 1ACXA 5JOFB 2RIKA 1KYFA 1FIEA 4OLWH 1S9VA 3F04A 3BSZL 1FUNA 1RZGB 4LKCB 3LKQB 4OZFG 4YSAA 7PCYA 4M6OL 4XAWH 3DURA 1A64A 2ZUSA 3L81A 4I6MC 4N1CA 5C6PB 4FFWC 4XNZC 4AMKH 1JCKA 2WQRA 5FOBA 4GSDL 4Q7DA 4N78D 4XVUC 5C07D 2XSKA 2AJSL 2VR4A 3ELQA 4JCWA 4BV1A 5J6HA 2GUYA 1N70A 4J12A 3P77A 3V6IA 2EXYD 1F90H 1KB5L 4BRYA 2YRLA 2PCYA 3MBEC 5EOQL 3NIFB 3QS2A 2FUQA 4HIHA 3T09A 2JCWA 2WTOA 3IAGC 4FMFA 3KZIE 1IFHH 1AGDB 2BSDA 4OCYH 2O30A 2DQHL 5IK3B 1Q9KB 3MRDB 5B1KA 3TT3H 3W56A 1MCDA 5DD5L 1FFTB 4G6ML 4PLOB 4B50A 2HG0A 3KYKL 2V4HA 4FXGA 5J4MA 3OB8A 2HLEB 4FNUA 1JY2N 1TQBC 1ZVYA 3KLHC 2CO3A 4HXBL 2DQFB 2VT0A 1ZK5A 2AEPH 2FATH 3R19A 3QAQA 5F6HJ 1EZSA 2XU9A 5IKCA 1N6QL 4G7YH 3WFEH 3B9KC 2ZYAA 1M6OB 4DN4H 2WLIA 3IGUA 4D6TG 3QT2A 1JGVL 3OGCB 4Y5YB 3K6SA 2VGLM 1XGYH 4R0LB 1DCLA 2A7BA 3A67H 2A1WH 4KJPC 1YEGL 4OZHE 1GH7A 4QGTA 3VFSA 3WHXA 1SOKA 1QVFO 4KO5A 3QDAA 1UXSB 2YD9A 1EHXA 1ML0A 4OGQC 5KSAC 3VQ2C 1PPIA 1ZDQA 3J27A 5KBLA 1E6OL 1JXFA 1DEEG 5CJOH 1JV2A 1HNGA 3CPUA 2YRZA 5BO1H 1PZSA 1PIFA 4OGZA 2YD6A 5LAXB 1KJMA 5IBUG 2PUQT 3LN4A 1AAJA 4XO3A 3FB7A 1RHHA 3ZBMA 3RVXD 2VXSL 2NNAA 2L3BA 4PJDE 1GMEA 2OL3H 3HG5A 3WCYA 1FSKC 4P23A 3LEVH 4K55A 2PP8A 3HC3L 4N2FA 4AKPA 1OWRM 5T3ZL 1BEYH 1BFOB 2X9WA 2I60H 3NQKA 4YIQA 1NC4B 3W0WD 4HFUL 4JDVA 4M1GL 1HIML 2WTYA 4PLNC 1EZVI 1XV8A 3BH9B 4OCSL 5BJTA 5BZDB 4RWYL 1KJ2H 1NL0H 1PNCA 1JZGA 1NLDL 4ELMF 3L37A 1J0HA 2BP8A 1KUMA 2VLJA 3NQIA 4FQ2H 4AM0A 3N1GC 1Z9LA 4EN3D 5FF6B 4LSTH 5L2KB 1LP1B 1AP2A 4Y2DA 1I9EA 4OF0A 3X1GA 1QEXA 1LHZA 1QLFA 2CRZA 3P4MB 1IFMA 1C5DA 1OSPL 2F74B 2RAMA 2E43A 1GOHA 3O9WA 3NJMA 1KQLA 4QLWA 2IQ9H 4JREB 5CJ8A 2VXVH 1WBZB 4Q56A 3LB6C 1ZOYC 4PJGE 4U6VH 5HYJB 1MJUL 2XZAL 3C8VA 2AMUA 3JTSB 3PWJA 2EDEA 3VXQA 5KJRH 4YNYB 4TLFA 4KNQA 1HSBB 1X44A 3Q48A 1C16B 1QSVA 3VYNA 1IM9B 3JXAA 5TF1L 4L3EB 2OZ4H 4OFVA 1DEEA 3VG9B 5CCHC 3DVIA 5F7AA 4PJ0E 5KYNA 4KBPA 1TITA 2JJTA 3FTUA 2IYPA 1NCGA 1J8KA 5AOLA 1RHZB 5DI8A 1MCEA 2VLRD 1VQMP 4PJIA 1OD9A 4KU1A 3U46A 2DQIL 3P2BA 3AAZB 1UCTA 2WYZA 3ZQ9A 2JELL 1EX0A 1T0NA 4NCC1 3EZJB 4NZDA 1IAIM 4GSUA 4A2EA 3QFDB 4TNEA 5DRWA 4Z3TA 1P84K 2PTTB 4RMSA 1A3QA 1A6UL 3RHWF 4HIXL 2C9LY 3LNEA 4PP2A 8CGTA 4J3XA 3V4VL 1DJIA 2KHAA 2NUPA 2ADIA 4OZHF 4GAAA 4Q74A 1PQZB 3P0GB 4N1HB 2HPTA 4BFBD 3V2NA 2ENJA 2A73A 1VFAB 2ATKB 3D50A 4H2CA 3LMJL 5HYFA 5CGYC 4JQVC 3VWJD 1WEJH 1F86A 1I9IH 3RNQB 1INEH 2V7QJ 5IB3B 1PGPA 4LPTA 1BP3B 5ANMB 1I8IB 5D1QD 1NTZD 1FH5L 4QXGH 2XTLA 2BNQB 4IKNA 1FL3A 4IL6E 5LHDA 3DV6B 1N2DC 1NKNA 1WA2X 1LMIA 5ANHA 3MXVL 4AYSA 2NQDA 4PJDF 1KDIA 2XHNA 1T20A 2HJKB 1V7NL 4JM2F 2QEJA 1FAVA 5SWZD 1LWUC 3O3BA 5H37G 3ZE1E 2FGWL 3D0VB 4N90D 3V7AE 1KJVA 4G8EA 5SWSB 2D73A 3RZWA 2VDLL 1DVTA 2MFNA 5JYLA 2VC2H 5I76B 2WLMA 4G6AD 4NERA 1CG9B 2BSTA 5CN1A 2X05A 1CDGA 1MHEB 4BXSV 1RE4C 1E4WH 1S7VB 3QEQD 5CJ0A 2WSSH 4F9LC 3B8EB 2DB8A 3SSUA 2D31A 4LCCB 2PYEB 2YR3A 4XMKL 2UY6B 2Y4SA 2ZXBA 3FN0H 3OLDA 3HI6H 3L70J 5AW3B 3TNNB 3OF6A 4WW2F 3CC2P 2HLAA 4QRQB 5FV1L 2NPSB 4Y16B 5DJAA 5BNXD 1BZ9B 1XR8B 4X7TB 3FU0A 3QIBA 2Z93B 3BGAA 5I8KL 4PJGF 3L4TA 5AOJA 3MLSH 2ZWSA 3I2CL 4NRZA 4R7VA 5E7FA 3P8CE 1FZCB 1AHWA 5CBEB 5IV2B 4ZSOA 5GS2H 4R84A 3T8MA 1SQPJ 1V3JA 1DVFD 4RX4D 4FFVC 1G9ML 3PL6D 1CE1L 4M3JA 3UTSB 5IHZA 1U8CB 2X3CA 3HTKA 4GXVH 2NSMA 1J9SA 4M7ZC 1CGTA 1HHKA 4NNPH 1CLZL 5IVXE 4AEIL 2QQLL 2QVTA 3BCCE 1YQVH 5F1NA 1KBGL 5J89A 4LCIL 4XZ4A 1DANT 2YMXH 4NKMB 2BMKB 3PGDB 1KB5B 3MUGB 1T4KA 1RK1A 4E9VA 1KLFB 2GAZB 2R9HC 4WCYH 3BQUC 3KGSA 4BQ6A 3RK3C 1PX3A 3CN2A 4IBTA 4W6XB 5J9PB 1A3LL 1JXJA 4NZTH 3BRFA 3U7AA 2F7OA 4GS7B 3CCJP 2D3JA 3ETSA 2VDRB 4DO4A 4BXVA 4JZNA 1BF8A 4LLDA 3WNMA 3GHPA 1RJYB 4DP2X 4OUUB 1S5HA 5JQ6H 5GSRB 3ZDYE 5E9DD 3RWCB 5C3TA 4X7CC 3RGVA 5EDSA 3B3IB 3I9PA 5H35A 3QEHB 5K1JA 3KWVA 2BW4A 2QKIA 4UQDA 2JXMB 4MHHI 4P99A 3V4PH 1H8SA 4X2UA 3H1HG 3SDXB 1INQA 3HNVL 4G9DA 4XI5D 4OH2A 3ZE1F 3TONA 2CUAA 1E5YA 2NY3D 3AT8A 3L75G 1LMKA 1DEBA 5C0IB 2QG4A 2VLJE 4N28A 4XMUA 1K72A 5HDLA 4N2BA 3OKDB 3ZKXC 1HE7A 4IS6B 5LNEA 4PJ9A 3ASWA 3CX5D 3L5WB 5D7JC 1KY6A 4CGUB 5E2UL 2J55A 3SJVB 4L74A 4M43L 3I6KA 1I8LA 3U79A 4TNVK 4DGUA 3AE4C 4HGWB 1A9EA 4ZS6D 3AU0A 1SRDA 4J3TA 3MOAL 3VD1A 2C4XA 4KDTC 2ZWKA 2F58H 3FTGA 1RJLA 1WCBA 4OM1L 3V2AR 1IFPA 1T83A 4DGIL 3L71G 1WH0A 2J73A 3VP9A 3VFRA 2ATAA 1BVKA 4XN4A 1FZFA 2E4FA 2NZIA 3OD3A 3L17A 3NA4A 3L72J 3M1CA 4PRPD 1SXCA 4U6XA 4EZJA 3FSVA 1EXHA 2OGUA 1VPOH 3JV6B 1UM5H 3W11D 3U36B 1VHPA 1P7HL 3IXAA 3S3SA 3A0OA 1MCPL 2YD0A 3HC2A 2HYMA 1IK7A 3BPNB 4PJIE 1IBDA 3FXDA 3KLKA 4PG9B 4F7EB 3DIDA 4WJ5A 3V8OA 3VCLB 1TR7A 3I3EA 5EULV 4QKXB 3JTTA 1L3WA 4LDCA 4X0NA 1SBBA 4XWGH 2J6EH 4WWPA 3O3AA 2ZYHA 3FQXB 2WN2A 4L76A 2R1WB 4NNYA 3NAAL 1X7TA 3DO7A 2B4CL 3PP3K 4FYQA 4PJ7E 3RIAK 1IUZA 4HPYL 3JYCA 1SVCP 2X87A 1W16A 3Q5OA 35C8H 1CSBA 4ACPA 5GS0D 4M03A 3HRZC 3MJ6A 3KYAA 2CBOA 3DMMB 2WSEH 1EFXB 3W81A 4G83A 1S3KL 2DI8A 2FL5B 2YSTA 3S1KA 3IE4A 4Y4FD 5HHNA 3ZK0A 4KVNH 1PD0A 1M2OA 4OZIB 4Y28J 4QXTB 3JZ7A 1HUCA 4NBYB 3U9PL 3NPZB 1W72B 4FQLL 1D7MA 1G6VK 5KUMA 4GY4A 1QFUL 4LAQH 1QPKA 1U3HA 2CBQA 2W90A 2G3AA 1LO4H 4Z7QE 1CBVL 3BDYL 1PDKA 4FTVA 3OWRA 1T2JA 4NP9A 4R7LA 2L4OA 4YXWH 5EIVA 3I3BA 3CD6P 1Z1WA 5A7EA 3MRLB 5TE4H 3GK8L 2HT3D 3KYOA 4LP4A 1JF1A 4JPSA 2Z4QA 1M56D 3ILEA 3T6ZA 4XNUL 4K3JH 3C5SB 4RCAA 4CU7A 5BOPA 2JJSC 3BAKA 1ZLWK 4GMSH 25C8H 2DKMA 3VJ6B 4IL6X 1KCSL 3F12A 2HKHL 4KFZC 2ZOOA 1NGXA 5IQLA 1OAUH 5LGYA