5AW7B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 11.3 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw7B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw7B02
1X8YA 2JJLA 2YO2A 1MUUA 2Q3IA 5AW5B 1GD2E 2QM8A 2WT7B 2C9LY 5APQA 5AVXB 4XE5B 2WT7A 3A3YB 1HUCA 2WPRA 3HE4B 4B86A 1OWAA 1J2JB 1GU5A 3M06A 1H89A 2VRSA 3HTKA 3M9BA 5AVRB 5AVQB 4JYBA 4RESB 3B8EB 5AVSB 3KDPB 2R5DA 4EOTA 5AW4B 3IR9A 1JUNA 5APYA 1NWQA 5AW2B 1SLQA 1FOSE 2P67A 5AW1B 1GK4A 2WPQA 2E42A 2QM7A 1A02J 3NXSA 1S9KE 3VYIA 3L36A 3M0DA 1YYCA 3M0AA 5AVZB 3UIAA 2WWWA 1CSBA 3NFQA 5AVUB 4AUWA 4LC1A 5AW6B 4RETB 4M3LA 2R32A 2WPSA 5AVYB 1H8AA 3A5TA 5AW9B 3P32A 4I6MC 3HE4A 1HBWA 2XU6A 3LIEA 1A02F 5APWA 4JYCA 3V5BA 1HJBA 3WGUB 3TYYA 1MV8A 3L37A 1JNMA 3SWFA 1G2CB 3P7KA 3KQGA 5APXA 3V4WA 3A2AA 3V4QA 2BASA 5AVVB 2Z5HA 3HE5B 1GK6A 4HYTB 3HE5A 2IPPA 2R3CA 1SP4A 1T2KD 3T97A 2YO3A 2E43A 2H7HA 3VMZA 2Q7CA 1FAVA 1T2KC 3M91A 3I5CA 1NAFA 4DZOA 3NTNA 3M9HA 5AW3B 3MGNA 2P2UA 3A7OA 5AVTB 2XV5A 1S9KD 5AW7B 5CMZA 5APSA 5APVA 3VTPC 3OAKA 3L35A 1GTWA 4GT1A 2YNYA 3WGVB 1GZLA 1GU4A 4AYCA 2WTYA 3VMYA 2Q5UA 1CZQA 3VMXA 2C9NY 5APUA 3LIDA 3O8ZA 1MFZA 1HWTC 2N9BA 2W6AA 5APTA 2W27A 1H88A 3NMDA 4KHXA 3TK1A 3VN0A 2R5BA 5AW8B 3TNUB 1DH3A 4I2LC 4C7NB 3TNUA 2KP8A 2Z5IA 1OXZA 5AW0B 4GKGA 2XZRA 4AQRD 4C7NA 2ZFCA 2ZXEB 3P8MC 1FOSF 4C46A 1CI6B 5AVWB 1KQLA 2P7JA 3MD0A 1IO4A 1CI6A
chains in the Genus database with same CATH superfamily
1SQPE 2OYHA 1HSAA 1TLKA 1YDPB 4GRWE 4MYWB 4WJG3 5SX4I 1IE5A 3EDJA 1U3YA 3II3A 5B66H 3CDGB 4WJKB 1I1FA 1HQ4A 4O58H 4H0LD 5GSVB 5HDRA 1J05A 1T5XB 1FIGH 2ZVNB 3UJIL 2HVKA 4L29B 2GTWB 3A47A 2GCYA 1CDBA 2XFGB 3HHMA 2J1ZA 5HYSA 2FQFA 4XBEH 2FQEA 3NXSA 5HGDB 3L16A 4P2RE 3SGKC 1JSYA 2P9RA 4WFED 3CSBA 2W9LA 5DK2A 1JZ5A 3OJMB 4QRSB 1FVEA 1G7QB 4BE5A 8FABB 4ADJA 1NFDE 3G5YB 1RJYB 1HSBA 1ZDQA 2ATKB 4PB0L 1NU1K 5D7JC 3IE9A 3T3MF 1U8OA 1OAQL 5E1GA 2NZIA 4UBDC 4QRTA 4X4ME 5CEYA 5F21B 1HH9B 1IL1B 2BXYA 3EGSA 2VR8A 2GABA 4B9IA 3SWFA 1OVVA 3UXFA 3NQKA 4OUUA 2Q7YB 2C9VA 4Z3JA 5D1XA 3VMOA 5FGCE 1I1AC 5HYJA 1ZHKA 4WTZA 1U8QA 1DVFA 2B87B 4TSCL 3MNDA 2ZX6A 4MMZB 2AK4B 2XN9B 3MV7A 3QDHA 4Y16D 1KGXA 2LU4A 1PF3A 2IDTA 3QUZC 2EDRA 3EJPA 3B7UX 1DN0B 5KVDH 2GITA 1KLGB 5EEYA 2VLJD 4ZMWA 3M91A 1MI5D 3WNKA 1BOYA 2WQAA 3NJFA 4M62H 4JL2A 5D1QB 1A1OA 2I07A 4M00A 4UWQB 5KVEE 1B2WL 2X9ZA 3GMAA 1F4XH 3B9KC 2Q87A 2EO9A 3TC9A 3W3BA 1JXKA 2AQPA 2ZZUT 2J73A 3CWBE 2KZBA 5E00A 4G43B 1EZVX 2B5IB 1KEGH 2OTWB 4L4VA 3ALXA 1A6VL 2JKJA 1H3XA 5DHDA 5F0LB 2LE9A 1D5XA 2CR6A 3JT2A 3VFMB 4M6MH 1OFCX 3E9UA 3KZIE 4D2NA 1G84A 3WJJC 4OZFB 2FX7H 2D4FA 4D0CA 3KBPA 4GRLA 3P3YA 2IAND 1F13A 2DQDL 4JM4L 2FO1A 1MCEA 1NMAH 5D7EA 5FF6A 4GOSA 4WI2A 1KEMH 1P4BH 4RA0C 1ASPA 4Q0XH 2KLUA 1Z9NA 4GI6A 4ODBD 4UTCA 2CUAA 3D39B 5DRNB 1UOWA 2PP7A 4U1IA 3L73E 5H94B 2K70A 2A06E 5JMRA 2PO6A 1UCTA 5TE7H 2AQ1A 2AJUL 1GAFH 2GTZB 4JQ0D 3KPSD 3MRPB 4MMXC 3L45A 5IW6B 2JTYA 1P4IH 3OJDB 4PGCB 1N7SB 4PVBA 3DVGB 1KACB 3G5ZB 3K4AA 3ZDWA 1FZGA 1T2QH 1AIFB 1BEYH 4BFFA 1PFOA 3BPOC 2AFNA 2DYPA 5EPMA 4UTAL 2EYTA 3AS0A 3S48A 3L74J 1NTKK 2VWEC 4H26A 2DQFB 4LIQH 4UILH 2AXHA 1NBYA 1PCSA 2R0ZL 4UCFA 5HHQA 4X5RA 2DI8A 5E1AA 3F84A 5HHPB 1S9XB 3H3KA 1UD2A 4LL1A 1RIVL 1Y6KR 2WMPA 4M3LA 3IDMA 4PRPB 2ENSA 2Z7YA 5SWSA 1HXMA 1TDQA 1JGDB 3C9NB 1U3HB 3U0WH 4FJZA 2VL5B 4GW5A 3CDZB 1NUGA 3V6BR 2UVFA 3DPBA 3LKNA 3NSXA 1HJBA 2UXGA 4L3FA 1ZLUK 5CJXA 1GC1H 3O81A 1MVUB 4R4FL 5EC2B 2WLHA 1P69B 4NPEA 3BUPA 3P77B 1KB5B 3RL1A 1C9SA 4JN1H 4WUUE 2YAMA 2N4IA 2GJ6B 3BUDA 1HFUA 3T6WA 3AZUA 1HXYB 3CZSA 1T0PB 1ADQA 1M7LA 5B8CC 3Q01A 5D7HA 4Q9QL 1FFPB 4BHUI 4I4WB 4F1ZA 2K6WA 3VXUE 1X7QB 4GO8A 5AAPA 1NLDH 4XAKD 3CZGA 3FO9A 1KYOI 4JPIB 4WCYH 3PHOA 3LNGA 4LOFA 1EJOH 3ZDZB 2BVYA 5CEZH 4NP4L 1E6OL 1JGEB 5IGXH 1MIMH 5C2BH 1GGIH 4WV1A 1GYAA 1GC1C 2G3ZA 4HZ1A 5DJCA 2QVAA 4GBXC 1E9PA 4P2QB 4CW1A 5F7EH 2F6AA 1B4JH 4JJOA 2FGWH 3MLSL 3AWFA 4TOYL 3GDCA 4XE0A 1YEKH 1JPGB 4PJ5E 4FFWD 4DHLA 3UGEA 1CFVL 5DJYA 2RIKA 5ESVA 4OD1H 2XZCL 4LCYB 3SYQA 2YD6A 3GMNA 3S6CA 3SDDA 1AQDB 5DU7A 2AITA 4L2YA 4RX4A 3B5HA 2QPUA 1MH5A 1URQB 3GMQB 1W6LA 5I18H 2FCBA 1A1MA 4LLMB 3ZLQC 3Q5OA 3NA9L 1EFXD 2MOGA 5DJ2A 4I18C 5BS0E 5BRZA 2A7BA 4MQ7A 1LEGB 1W0VB 2D2CB 2D7NA 1XR9B 4Y7OC 1OAZH 3MRBB 4PRHB 5CIPA 3OKMA 4YUEH 2OYPA 5IVZB 2FJGB 2K7QA 5J12C 3PP3H 1OSPH 2PUQT 4P23C 4H88H 3BO8A 3QIBA 3VMNA 2CZNA 5JHAA 4Y2NA 1IBYA 5HHVH 1GYVA 1TO5A 3NEXA 1N6QL 2YKLL 4WZ9A 5TGBB 2ZKWA 5EA0H 3VQLA 1A02N 2K3RA 2CK0L 3M06A 1EO8L 3BP4B 1TKWA 3GWJA 1TR7A 2A9NH 2R9HC 3F8UB 3BD3A 3N9GH 5K9KA 2YA0A 3K5BA 1DQKA 5DS8A 4X42A 3SE3A 3CFDB 1IKNC 1WT5A 1KBGL 2AZUA 3SZ6A 1G7LB 2YK1H 1FOSE 4JFWA 3R06B 3IFOB 3QIUC 3PREA 2KBGA 1F90H 2B77A 4FN0A 1BVKB 7TAAA 1F6FB 5SWZB 2QM7A 1FZBA 4XFJA 1KLFB 2W91A 2YD4A 1H3VA 5LN8A 5BZDB 4XXDA 1CE1L 1LTJA 1U8KB 4UB8H 4MASA 4PQXA 1D3CA 4HHGA 2HT2D 3V52H 3WKML 2ADGB 3RK2D 2CQVA 4N0YH 3HG4A 5C0BD 1XH1A 3SDCC 3PP4H 1VQOP 1URZA 4HXBH 1YIJP 2CO6A 5D1XE 3U4AA 1EZSA 5HYJE 2JLLA 3APCA 4Z7QF 3IPFA 1AA0A 3TV3H 5GGVL 1MV8A 3G5XA 5KANI 3MV7E 4A37A 2R29H 4JO4L 3VXRA 3O9WC 3F7QA 4M61B 4NQVB 4MB1A 4TNWK 2ICWJ 4G80B 5JUEH 4EJ1C 1A7OH 2VJ0A 4NWTL 1RUPH 4WWKB 1A21A 3BZ5A 1U93A 1LE5B 1Q81Q 1L4AD 2O5XL 4JQIL 1QBLL 1LEKA 4CBPA 3QO1B 4YSCA 1BCCD 4K3EH 1L7TH 4W68A 1JB0J 5TH2A 3HMWL 5E4AA 3O6FD 5LAXA 3P8CD 1BJ8A 3HC2A 3MLZH 5I8EB 5CJ4A 3RX7A 1Q8MA 3O2VL 1NAMB 3F58L 5E2JA 3Q9QA 5F8RC 2EYRA 4L4VE 1GW4A 4W9ZA 5DFVD 3O3AB 1FZCB 2FFDB 4IBVA 1VGEL 3ILQC 2C1OA 1JD7A 4PD4J 43C9B 4TRPH 4KDVA 4XP4H 4LOEA 1E27B 1V8HA 3FF7A 5IQLA 1Q9OA 4XP9L 3D50A 2WWKO 4RJTA 3L2LA 1QRNB 1MNUH 1KCBA 3TT1H 3GO1L 1UZ6E 3V6ZB 4L3CA 4CMHC 3V4VL 2KT6A 1RZQA 3BQUB 3TA3A 4AIEA 3HRNA 2DKMA 3BH9A 1W9XA 1IGJA 2MNUA 1JGLL 2VDKB 2X10A 2WSCH 1MHHB 3U9PH 2GSIA 3NESA 1E79H 1WZKA 3L72D 3SGEH 1J1DC 2GQHA 3EOYG 4PRNA 1GGCL 3ZX1A 1E43A 4JREC 3EH2A 2J88L 1RF0A 3TEYA 2ICWA 2EIBA 1JZ3A 3N40F 1RIUL 1O6TA 3MRJB 4XI5C 4KKAC 2EC9U 1WS8A 3MLUH 4MNQB 3QPKA 4EDWL 1OAYL 3ETSA 3GXMA 3VTTA 5KW9H 4K94H 2DH3A 5D96C 2G75A 4Z7VB 1EAQA 1ZTXH 4NKMB 5I9QC 2WGXA 3KEDA 5JW4Q 3CXHH 4WVRA 5BJTB 2AK4D 3AQXA 2XN9D 1E7UA 1PGPA 1U6AL 5T8IA 4GSRA 2ZJSL 2QHRH 3Q2YA 3VI4A 4HKBB 4H44C 1IGMH 4OLEA 3SYPA 4ZMNA 1JMBA 3CBJB 3FB6B 3WBDA 4ZUWB 5SWSE 2AJVH 1EO5A 3DX4A 4CU8A 2PTUA 3ETBJ 4XNMA 4Y19D 5GZNC 4OFPA 5D1QD 2NXZD 3NN8A 1R34A 1U8NA 3B2PA 1JK9A 4NKQB 5MEOA 4X50A 6FABH 4G8EB 2XT1B 4NI3A 2QR0B 5C9JA 4K94C 4H0IA 4OH8B 1UD8A 1JNHA 5FKPA 3STZB 4E41A 1CGSL 1N18A 1G1KA 4HWZA 1UC6A 2EO7A 4OGQD 2LVCA 5DFWH 3KXFD 3L70D 1JXJA 4YDZA 4CA4A 3TO4C 3CWBG 1EAPA 3TWCL 4HFWB 3AE8C 5C92A 3IVKB 3FONA 1KLUA 4H20H 3RUGB 3ZE0F 1INEH 5B1JC 4LESA 2YIUC 4K3JL 3FQWA 3H85A 3ZW3A 2GFBA 1YEFL 2FWUA 4ANKA 4XPFL 1ZRTD 4YXHL 3I84A 4MS8C 3UTSB 4HX1B 3ILEA 4JCMA 4HUNB 4LSRH 1U8IB 3UBGA 3NCYS 3D39D 1CQYA 5DRZB 4U33A 4B97A 3K7UA 15C8H 2W81C 1M1JC 3L74E 3HE6B 1FZMA 4KOBA 3B2UD 4PBVC 3VG0L 4F15B 3MCLH 1Q9LA 3OZLA 2X2UA 4XBPA 3CX5J 1YNTF 4PLKC 3H4FA 1C7TA 2HYMA 2IH9A 5K39B 1WBYA 3MSPA 4NQEA 5CMAB 2A06G 4NKDB 5FK9A 1CFNB 2APFA 4Y89A 4JG0H 1H8NA 3POHA 3GDBA 5BRZE 2J12B 5H37H 5FYKU 3W37A 2OBGA 1CB4A 3OXSA 4XNYL 3MNWA 2J5UA 3MXWH 1YY9D 1MDAA 1OCWH 4FJYA 4U6TA 4HWEH 5BU8B 3NCCB 4NRZA 3PWPB 4Z77B 1BW8A 3SQOH 4PYHA 2WVSA 2ATPB 5D7LE 1MFCH 1SQVK 5IUCA 4TVSa 1IM9A 4YWGL 3HG0A 3GM8A 5EZJA 4XCYA 1BVLA 1U3HD 1WC7A 5IB2B 5FM5M 5GGSA 2DQHH 1M7XA 1DO5A 3IJYA 1JEKA 4NLAA 1XL4A 1FO0L 4YHMH 3RVWD 1M1SA 2HLFD 1B0WA 5K9JH 1AYRA 5CLZA 3ZDYE 4FQ2H 5AVXB 4DJGA 3UO1H 3PWVA 1MSPA 1PLCA 4HV8B 1GL2D 3X14A 3IU4L 5TE4L 4BGDA 1TJIL 4Z7OE 4YXLL 4LPWA 4A7QA 4QLRA 5JW5B 5EZLB 5E1QA 3KLQA 3SKJL 4BZ2H 4G5ZH 4R2GD 1ZMYA 4M1DL 2CCVA 3FB5B 2ED6A 5EULV 2H1PL 3BKJH 3N1MC 1IEAB 4X5XB 5ID0A 4NSKB 4W4OC 2QJKC 3IMTA 4EXKA 4NCDA 2HKAA 3PWUA 2C9XA 5A6LA 5DHVB 1A02J 4HIHA 1PD1A 5DJXA 4X8CA 3IDNB 2VC2H 3DIDA 4J12A 3KZ8A 2XWTA 5LGKA 3ESPA 3LH2H 4LC1A 3VXRE 4KJPC 1HEJC 2EE3A 2B4CH 1SQMA 1ZHBA 4R0LA 2D9CA 2WO2B 2Y5QA 3V0IA 4P59H 3BT2L 2DJMA 5CILH 3DJSA 1LO3H 1HK6A 4PJ7B 1I9RL 3GINA 4MJIA 3S35X 1URQD 2R7EA 5C0EB 2F8IA 2BK8A 3L1EA 2XOTA 1ZOYC 2RTTA 3A23A 2KS1A 4W7ZA 3JXAA 2H6OA 2VLKA 5BNXD 1NBQA 2BFVL 3D34A 5KVFH 1EXUA 2K9UA 1MWAB 1X5XA 4L73A 1JPTH 1SLWA 3TSIA 4R7LA 5A2CA 5DRXA 1FAIL 2B4CC 2BNRB 4P2OC 3HG1D 3UTTA 1JZ4A 3ULUD 2I60L 1NCGA 3ATAA 2DOCA 3T1FB 3ZE1E 3F01A 2H45A 1JJUA 3F6IA 3QXDA 3HC4H 3WFDL 2CR3A 4YJZL 4GI9A 5DD5L 5IHZA 5C3TA 1LDSA 1NTZD 4WENB 3SFEC 1S9YA 1CFMA 2IWFA 1A64A 1K73Q 4FQ1L 3WTTA 4IQHA 1MFVA 3QJOA 2R56H 2LT9A 4J3OD 4QOKB 3AROA 2LAAA 2OP4L 2Y3NA 2E8YA 4NQSB 2IZ0A 4NKOB 5HYSG 4OQ1A 3HD7B 2YD8A 1NUNB 4K3HA 4TYUA 5J06A 5EIVA 1M42A 3PCYA 1R9FA 4QRUA 2SPZA 3RVXD 1FL6B 3PWLA 3PV6B 2YZ1A 4UOQA 5DD1H 1F3DH 1DQMH 4KHXA 3HMXL 4PG9B 1FZOB 3NT0A 2CKBA 3DPDA 1DANT 2BSTB 3NJGA 4PRDB 1I3VA 1IEBB 4KKCD 3RWJB 2FJHB 1BD2A 1MRFH 1OSZB 1REIA 1XGTA 5FYJE 2H41A 4UDTB 3MV8B 3N0PB 4XMKL 5IK3A 1BZEA 4GKZA 4W9GC 2M83A 4PUBH 2E7CA 1WFMA 2PCPA 4MJ4A 3HS0B 1K9TA 4PI2A 3ALPA 4ZXBB 3QWOC 4WTZG 5KAFE 4HIPA 4PD4E 4J3OF 3RWFB 4AGPA 4MCMA 1KT2B 4APQC 1A1NB 2F54D 3FN0L 5CWSB 4K9EH 2HPCA 4L0PB 5EORL 1HH6B 3WXWH 1Z7JA 1XZWA 3QQNA 5DTFB 2R5DA 3P3UA 4PJHF 4BV1A 3D71A 1S7VB 2EH7L 4PJBF 5C0NC 3Q5RA 2J3SA 3DVIA 4K5OA 2FR4B 3MNZA 4FC3E 5T5FH 5ABZA 4KRLB 4C56B 5IW1A 4E41E 3D7PA 3UYPA 1MXDA 1ZANL 3V0WH 2QELA 5A43C 2LHAA 1SYVA 4IIQC 4LLUB 3GXTA 3ZTDC 3I50H 2FZ3B 3NFPB 1FG2B 2FWOB 2E7DA 5AW6B 3V5DB 3O4LB 1J9QA 2HT3D 3AABA 4APXB 1H8AA 4K9EC 1U57A 5ITFB 1R3LB 4EI5D 4OV5B 4F37F 1BX2A 4LRIC 1J9CT 4OZGB 1R5WB 3Q2CA 5GGUA 2BRRL 4UOZA 1VGKA 4BFIB 4CN1A 4GXFA 1E42A 5B22A 3P0YH 4LVNC 4D9QE 4YAQB 5M1BA 1QFWI 4CDHA 4IGBD 3K2KA 1YJ9P 4Y1AD 4JFXA 2O5YL 4G9DA 3EGDA 1IAMA 3QJZA 4O02L 1LE9A 4AV0A 1DCEA 4LEOA 5F9WB 2VZSA 4LFHD 3D25B 2AXJA 2VERN 3H9HB 1VSCA 4L9LA 3VB9A 3CVHA 3GB7B 5CU9A 3KVPA 4YSSA 5E6ID 4KDWA 2FT7A 3QCTL 3MGNA 3ARDD 3KYOA 2Q9IA 4F5CA 4E9XA 2H0EA 1W2EA 4RISH 5KS9B 3VTPC 4X7CC 1SYSB 1OAKL 2A9ML 4ASWA 1Y0LB 2XBZA 3K6FA 5CCJA 1UA6H 2QT6A 3PL6B 3BH8B 4Y5YC 2A99A 1D2PA 5DJTB 2VDNH 5FUCC 3BKMH 4OZIB 4XPHH 5AKTA 4NUGL 5EF2A 2NXYD 3A6BH 3WHXA 5IJKC 1P84I 2WWKT 3NSJA 1HOEA 4DO6A 1GS7A 4HK3N 2E75B 2BLFA 2V4LA 5J1AA 5DMIH 1YTZT 1MCBA 2KYVA 1X5ZA 2ZOLB 4NHUB 2A6IB 5EU7C 1AZCA 2X7LA 4GP8B 2DTMH 5JR1L 3O2DL 5LNGA 2QQKH 2PXYA 4GO6B 4HJEA 4NJ9H 2X44D 3RK3D 4GOEA 3LN4A 3EYOA 2EDBA 3DX8B 3MRGB 4N8CH 3R7RA 4GW1A 4FTVD 5T1KA 1J86A 1M57D 3NCXA 1C16A 1OGAB 3P3RA 5AYUL 3CX5E 2AJYH 1F6AB 3LB6C 3UBHA 4M4PA 2NYYD 4HJGA 4TNGA 3UJTH 4ZFOL 5J56B 1JOCA 3DSFL 2EXTA 3BP7B 3E3QC 4KKPA 2YRPA 2C3GA 2W6JH 2HP4A 3C8KA 2X2HA 2WIIB 3IJ8A 3VCLA 4CU7A 3NAAL 1K3IA 1AG0A 1AZNA 5GGTL 2OMWA 1A2YA 3UTSD 5JPMA 4L05A 2Y25A 4UAHA 1OIPA 1GZHA 2KC0A 2XG4A 4GEIA 4H8UA 1JI2A 4HIIA 4ODUA 1Z9OA 3QUMB 3KYNA 3BAKA 1GK4A 1KB9H 3RU8H 4AQAB 3DC0A 4LDLB 4WTWA 5FIEA 3SYAA 4JAMB 1NMBL 1T0NA 5B1BB 1EZVE 2H6UA 4KX7A 2EINB 5I16A 3PDOB 3RX5A 1LWUC 1R24A 5AVZB 2NY7L 1JTHA 2DYRB 3IFMA 4DQOL 2OQJA 3EYVA 1LO2L 1V3LA 3GMMB 2FBOJ 2Y7NA 3NCEB 3CFIC 4FNRA 3C8VA 4YSEA 3O8XA 3EO0A 2F7PA 1RF1C 4HKZA 4LO9A 1KB5L 3B5GA 4X7SL 4CMMB 4AQEA 4G7YL 4KUZL 1JY3N 3MJ9A 1A9EB 2GIYA 3FU0A 2X0VA 3D1MC 5I8KL 3NH7H 4PR5B 1D7DA 4GEJA 4I2XA 3UTTE 5KG9B 3M88A 1MCOL 1BE3D 1NDGB 1F1AA 2GJZB 3PWPD 2GA1A 1X4ZA 5HHOD 3GJFH 1RU9H 1V3JA 3MROB 2VLRA 5C6TL 3ULSB 2VOTA 1CICD 4JFYB 1NCIA 2NTFB 4DTGL 1KIUB 4CL7A 3E0GA 4FQXB 1IO4C 3KWTA 3SE6A 4HOXA 2B15A 3D0VA 1YEDB 4TSAH 4XBMA 1Q9WB 3TPKA 1KJ2A 2A73B 5EIIA 5DVMA 3L4TA 3JSSA 4WWNA 1L0LG 4U7KA 4Q6YA 5IB1A 1N59A 1OK0A 1MUJA 1UURA 2FHBA 4M48L 2I32A 2C26A 3UCQA 2W0LA 3B5NA 1WO2A 2JJTA 3CUPA 3CC5A 5C09B 1G6RB 3L35A 3K2UH 1SQBG 1K05A 2XV3A 2KI7B 3AAZA 3FOMB 4H1LA 4P4KB 1E5BA 2VDLH 3BIKA 3K6SB 1T5KA 4J7RA 2J57A 2GUYA 4IU3A 1AXTL 4UT7L 4JVPA 2XI9A 5KSBB 5HVFB 5CGMA 5CCHA 4N2KA 3VN0A 2W0FB 1N7ML 1ACCA 1LJMA 1GDTA 5ETUB 2EILB 5E1IA 3BDBA 5E8OA 1DHKA 5LUMA 1CD1A 1LWJA 1IK7A 3RFZA 3WN5C 4M03A 2RKLA 3QPXH 3U2SB 3ULUL 3I6GB 4G8GB 5BOZG 4Z78B 2NY2B 4X9YA 1PY9A 1UZGA 1D7BA 1NH6A 4ZODA 4B7LA 5EEWA 1NANI 3ECUA 3OJAB 1NIBA 2X1OA 2R1XB 1R3HA 1NCJA 3HFMH 2W8CA 3CFKA 1VDFA 1MCKA 2H26B 25C8L 4NO2A 4X6BB 1PDKA 3SBWA 2EDKA 2CDEB 3OX8B 3JTBA 1GIGH 2F53B 1A6AB 4MXWL 3CLEL 4QRAA 5GZOA 2CJUH 4P9MH 3IR9A 3NPZB 2O61A 5I8CB 5BXFB 3H2QA 2HH0L 3CXFA 3W2DL 5KJ7C 4DCQB 2BZDA 1N5YH 2VDRL 3FMGH 1MIEL 5KAQG 3E2HC 1RE4C 2CIIB 1KG0B 4KZCA 3ZTJG 3FO1B 4WGWB 3ASNB 4NM8H 1SMOA 4AJWA 4QRPD 2NY0D 2FL5B 1QI4A 3UP6A 5H2BB 3VX0A 3UAFA 2R2BA 4A2FA 3QORB 3PRJA 2XRAL 4DP9X 4U1GB 5CCGD 1WHOA 3D07A 1MRCL 2UYLA 2XY2A 2VB5A 2VXSL 2VZOA 1BM3H 3A67H 2OSWA 4N5EC 4ACPA 4WU5A 4HUXB 3BQVA 1DUZA 3O6LH 5FECA 1N2DC 3AE4C 1JDCA 4GAJH 4S1RH 3CN4A 1RZGB 1BVNP 2ZG2A 3EJYC 2GW5A 2RCSH 1NM4A 2K6ZA 4KKNA 1D9KC 2XWCA 3D12B 3TZVA 4YX2L 3SEPA 3N42F 4GRWH 4X8JA 2P42B 5F9OL 2YKQA 2CUHA 4XB8A 3MV8D 1CXLA 1RE3A 4ZD3H 2IF7A 4W6XB 4WUKL 4F5CE 4GO9A 5IF0A 5IEHA 1IAKA 5I26A 1ZLWH 1WBXA 1KV3A 1W0WB 3WDJA 3T0AA 3X1GA 1PAMA 4ELMF 1R5IA 1X5IA 1S8DA 4ZXBD 3ZDMA 1CIDA 5AW7B 1MCCA 2BSSB 2HTLD 4PJEA 3ARGA 1J0JA 5B7FA 3MPCA 2E9JA 3F7VB 1S5LX 4MA3A 1T4KB 1Y18B 3DBXA 3MRHB 1NCWL 4JHWH 3UCRA 5EIQA 4AQ1A 4MJ5B 1EEZB 2IGTA 2PP9A 1QABA 4TLUA 3WTYA 1NCBH 2QQLH 3AE7C 4JDVA 2VDKL 1FNAA 1VQ7P 3AM8A 4Z7WF 3RG1C 1M71B 3PWNB 4ECNA 2RFXA 4JQVC 3CCSP 1NWOA 2R1WA 4I0PB 1AS8A 1IGTA 4MRBA 3V6FB 4K3AA 4F9LA 5BZZA 5D6CA 3DMMC 2KP8A 3FBQA 5AZEL 1H5BC 3HBQA 5CBAB 4NENA 2ERJC 3TH2T 1M7DA 1DBJH 2AANA 3T3MB 3BZDA 4OLYH 3L5WA 4DOJA 5DD0L 3RGHA 3WE1A 3GXUB 5DLML 2Y07H 3HNTH 2F18A 4XPBH 5DLLA 4HK3J 5ISZD 3HR6A 4RAVB 5D7JD 4WO4A 1QYGH 4UBDD 1JNNL 4OZ4B 3WAKA 5C0AA 2ZE0A 3JZYA 4IDJH 2ZKHL 3LKOA 2WSEJ 1L0LK 5KVEH 2YKOA 2X4SB 4H0GA 3LAFA 3BAEL 1I1AD 2J6EH 1TQWA 1SQBK 5CJQH 3MRNB 4OW6A 5HBBA 2VR7A 2CHWA 2D7TH 1ES0B 1WAAA 3CDFA 4PMFA 2AV7A 2X9XA 2VERA 4ABVA 4E9RA 2FBJL 4I0KA 3UIAA 3KZIH 4UTAA 1I3GH 3LKRB 3H1LG 1J11A 9CGTA 2ITDA 2YA1A 4FI7A 3SJVD 1FYTE 3DO3A 2AEPH 3B4NA 3ZRCC 5JXEC 3S34H 5E70A 4I2XE 3B9KD 5TD4A 5DEGB 5DEFB 4WDIA 3UYOD 5K5GB 2BMKB 4OJFH 1NCAH 4XO5A 3ZKND 1YVLA 4X99B 3NJXA 4NN7C 4JN2B 4RFOL 4YDJB 4M1CC 2VLRE 3CFEB 3IYLW 4PS7A 5IB3B 5JW4M 3QSKB 2X4QB 2B59B 3HG3A 3X3GH 3T8XB 2X12A 5APXA 3AEAC 1Y8AA 4YDVB 2KHAA 4HWBH 1VZHA 1N12A 2EXWC 3F85A 3R1GH 1I7RB 4MXVE 4PVLA 5E2WH 2JKVA 4MFHA 4XO3A 5CZVL 4QTIH 2O26U 2ITAA 2PR4H 1MG3C 1TQCB 4BCYA 3ABMB 1F4WH 2EDYA 4NZRH 1UM5H 4A2MA 4NI6A 3FN9A 1CFSA 2QL1A 3U0PA 3PJNA 2WSFJ 2P7TB 4FFTA 1U8JA 4LCCC 1OGAD 2DLEA 1TETL 4AKPA 2CO2A 3WTWA 1WDAA 5APVA 2ADJA 3T0EA 2C4XA 3KH3A 3NIDF 4CADA 2Q2EB 2C5DC 4FXGA 1BFVH 2XQYK 3OKOA 4NYLB 1GTWA 1ZA3B 3KBFA 5CCHE 3CPUA 1GKEA 3RPIA 4S1QL 1A47A 2HN7B 2R69H 2UWEA 4J4PA 3AREB 3D4YA 3HC0A 1MNNA 2ZG3A 3ARYA 2X3BA 1G9HA 3MV9A 1CLYH 1MQ8A 1EZUA 2J8UA 5IJVB 3T9WA 2JR8A 1FLRL 3MYJB 4WQOA 2W6AA 4IOIB 1BXVA 2Y06L 4QXGH 5FLVA 1WD8A 4FMVA 3SPVA 1SY6A 1S3JA 4QNPF 1CF8L 3LEYH 5T3ZH 2WXQA 4L75A 2VZ3A 3AT0A 1EZVG 4NZTH 2HCZX 2X6BA 2G9KA 4OQTA 2HG5D 1RIHL 4K55A 2YPLA 4HIJB 1KBBA 4QPEA 2Z0UA 3WEOA 1P84J 3VWKB 1GD2E 3ZK0A 3ZMEA 4OF0A 3U4KA 1IIKA 2EKSA 4F91B 4ZS6C 5HPMB 4IU2A 2IDQA 1AR2A 2GJJA 3FCGA 4XO9A 1DVUA 3PGFL 2XETA 5L4IA 4RDQF 3OAUH 32C2B 2H8PA 4OLZL 3MFFA 4PW4A 2A4ZA 2Q1KA 1R33A 4ZS7L 5FM5O 5H4ZA 1RUKH 4HK0B 2APSA 4XMXA 4PV1B 1PS3A 4IFDK 4KQ4L 3GSVA 4XVTL 3EOTL 2WCGA 2AQ3A 1HHIA 3MHZA 1BIIB 1JFHA 4MGXA 4AUYA 1CCZA 4ZFFA 4P57B 3Q3GB 3RWDA 4GAYA 4ATWA 4WKZB 4OFVA 1CLZL 5J11C 1VFUA 1MLCA 3KXDA 3EYSH 5C09D 1RVFL 1JTPA 4I13B 2G5UA 1TTAA 1NFIB 3CZFA 5D4IA 3T4AB 4WI5A 1DR9A 4PP1D 5IFJB 3US9A 3LX9A 2VT0A 3OAYK 1CG9B 4YDIH 2QKIC 4S1DD 2XXMB 3QRFM 3H1ZA 5GGQH 5K69A 1MWAL 3JTSA 2JJUA 4BWNA 2X42A 3P3TA 2JF1A 4HOWA 1JG9A 1XGZA 1GCFA 4OJCA 5CEZD 4NPJA 5ILTH 2Z4EA 4KH2A 1QAWA 4G8GD 1WLHA 2G60H 3OG6B 2I7SA 4KK6C 1UEMA 2LFGA 2XHNA 3L3DA 2Z31B 4N2OA 4PJEE 3V9EA 1AFVH 4PJDB 2Z8SA 1I85A 4KKZA 3IMBA 1OANA 3IFPB 4OLXH 1BZ7B 3D3VD 3M0DC 3NSYA 1OM3L 1PGJA 1RZIA 2FYYA 4JFZL 2E5YA 1D6VH 1QR1B 2PW1B 3NMEA 3LRSB 4X5WA 4XMTA 3L3KA 2WANA 4HBQA 4JW3A 2HFGH 3BVVA 2VN4A 4P23D 4D3CH 4OH2A 1ZGLM 1K4CA 2DQUH 2F53D 4UNIA 1SGKA 2DJUA 5I1DB 5SWQB 4WBAA 5LDSA 2CBPA 3LOWA 4KK8C 3HI5H 3VXNB 3DRQB 1PZ5B 3HI6H 3ZDXB 1RXLA 3KJ6H 4UTBL 3N1PC 2FSDA 4CU6A 3Q9PA 4LE8A 1C5CL 2XQBL 2NY4B 4AE1A 5EU5B 1HWTC 1OSEA 8CGTA 4UDUA 3ZHKA 1QO3A 3PJLA 3V4VA 1PGQA 4R5XA 3EHBC 4PRAA 4Z95L 1R3IL 1MJ7H 3QIUD 3Q1MA 2LTQC 3P73B 2XZRA 4NO5B 4UV7L 4J39A 3SD2A 3N1QC 1E4XH 4XCEB 5CNHA 1AGEB 3S9OA 1YEEH 1RHFA 2BM3A 1QBAA 3JYCA 1ZLSH 2KSEA 2ENPA 4I3SH 3MA7B 5CINH 1GS8A 5F2FA 4Z7QB 1S7TB 4OZHA 2MCMA 5C0AE 5DUBA 2HUEA 1NDTA 3PGDA 4AIZA 2QM8A 2PTTB 2DMBA 3P4MB 3NCMA 3L7FA 2QKSA 3FUJA 1CQKA 2AJSL 5DWUL 4EBQH 1WFJA 2DWDA 4YHPA 1WEJH 3MLVH 2WM0A 2A83B 2WXGA 2XWRA 5D1XC 4JJHA 2BOCB 4DN4H 5F6IC 1DVFC 5D2LF 1WAAE 3TJEL 4YHNB 1DO6A 4GMTL 3CHSA 3O9WD 5I19H 1I8MA 1KOAA 2EE0A 5E94A 4HB1A 3T0DA 5AUMB 4ZQKA 1VACA 1BZDA 1QKZH 3QDJD 2FX9H 4IOFD 1S9KE 5EO9B 1WIOA 2WTPA 5CP3A 5C0JB 2XKNB 4L8DB 3H7BA 4FKHA 2WPVB 1N8ZA 1RJLB 1WH0A 2IANA 1QEXA 4HC1A 2WXFA 2J2ZB 3L6FB 4X9FA 4H5SB 5EH1A 3UBFA 4F8NA 1ZY9A 3RLSA 5B39A 4PY7B 3KDMA 4JFOB 4O58L 2ZOKB 3WIIH 4UOJA 1MLBA 4N0RA 5EZOH 2MH4A 1VF5C 2UY7A 5SX5K 1J87A 1RPKA 2HTKC 1BAFH 3CZLA 1KSRA 1KYUA 4I0PD 4GRLC 2YUXA 3QJTB 2FNBA 4PWIA 5DYOA 4ODVH 4LLVA 1XWVA 3AE6C 1UACH 3FTSA 5A16A 3LQMA 3MOQA 4KUCD 1GL4B 3VFRA 3D0LB 1NKGA 4B9JA 5HHNA 1ZJAA 5FWQA 3T0EE 1D5IL 3U6RA 2VITB 3CCHA 3U6XA 4L8BA 2WVVA 1MHCB 3VRJA 1CDHA 4HS6B 5IMLB 2PLTA 2UWEE 3RTQB 2PO6C 2Y5EA 5DDHA 2X41A 5FS5A 3N91A 4W9IC 1BGXL 3MV9E 4XI5D 3FSVA 1E5AA 4JVWA 5EBMA 1I8IB 3C5XA 1OK8A 2AXFA 4FQLH 4PJXE 4BFRA 1NTMD 1U8LB 2YPVL 3IU3A 1QX1A 4PLJC 4YSAA 5C0FA 5I73C 4PJ9A 5L6YH 3UBXA 3WUTA 5C39A 5ERWA 1T6BX 1O6VA 5E4IA 3GG2A 1WZ1L 4HSCX 3EJUA 5F72S 2YR3A 5KVDL 2YPLE 1FORH 1S7UA 2VIRB 3V0FA 2COVD 5L2JA 4KUCF 4OIAA 4H44D 2PCFB 4WB4A 1ADQH 1FVDA 3WFZA 5CFAA 3JUYA 3NQIA 4M62L 1ORQA 3WS3B 4L3EB 2X6VA 5GZND 2DY2A 1AMYA 1F4XL 1AH1A 4Y5VC 4RSYA 1R46A 5GISL 3EBIA 1PQZA 4X8XA 1KEGL 4JKNA 5CJXC 4CNIB 2A77H 1YUHB 4OTXH 3D4CA 2Y9RT 3DHJA 4ONFH 3ZE0B 1QATA 4X80L 4M6ML 5CBEA 3GMOB 5GRVK 2AZAA 3EOBA 4PRID 4WW2B 1FO0A 2EYSA 1Q9KA 4OD2A 2FX7L 4CVXB 2HJFA 4RMRA 2JSFA 1F41A 3EIFA 3ZHNA 1LHZA 3L81A 4XP5H 3FQTB 1JXDA 3QUML 3BLKA 2BS8A 5D1ZB 4M7ZB 3HLKA 4LPYA 1HKLH 1IRAY 1KEML 4D6TD 3ZKSD 1IFGA 2E9IA 3F12B 3QH3B 5EIIG 3RVVD 3TX4A 1HILB 3QEQD 1KENL 4U0RB 2AQSA 5DZJA 1C5DA 4MS8D 1YNTB 5EFIB 4W6WB 4NO0D 4WV1C 4PJFA 2QE7H 3KW7A 2NRDA 4X6DB 1KYOK 1K72A 3PTZA 4XRCB 3D33A 5L9DH 1P5UB 4A7UA 3HE7B 1XCTB 1FV1A 3BP6A 4X6EA 5I0XA 4H1LG 4PJ8B 5CIPH 1JY3P 1T6AA 4ZO7A 5TE7L 4PP2A 4JCWA 3KYKL 1P84E 3UO8B 3STLA 1P4IL 3PUCA 4A6YB 2FYNC 1F2XK 3SDDC 3EYQD 1BWWA 2I27N 3Q7JA 2WO4A 4TLKA 3QQDB 2YHGA 1G2CB 2BCCJ 2YQBA 1LO5A 2PP6A 1CXFA 3ML8A 3FHEA 4LIQL 1QVGO 1GSMA 2TSBA 1LNUB 2OMZA 3OXRA 4L5FH 2NUTB 3L3IB 5ADOH 5EU3A 3L5XL 5IIEA 3OD3A 4WFEE 5DUPH 3T2QA 1QSZA 2ZUVA 4JRYD 3NTCH 3FJTA 4RFEB 1FFNA 3PY9A 5CAYB 3QIBC 3BSGA 4ENEC 3R4DA 3SD5A 1XCXA 3RPKA 3U0WL 3UABA 1LK2A 2IBZD 1G6RL 1SHSA 1BBDH 1GC1L 4BKSC 1ED3B 2G2RB 5D5MF 5BO1L 2JB6A 1ZWIB 5B3JE 4JN1L 4RIRA 3A4FA 3SE3C 3S37L 1WT5C 2QEXP 3FO2B 4X0KA 1VZIA 3RKDD 3OMAB 1ZV8A 5LNDA 1OTUC 4ABWA 3L72J 2HRPL 1NLDL 4BKLB 5D6DC 4WCYL 4GRMA 4HEMA 1LTXA 5E6YA 1IVLA 1EJOL 1T1ZB 4LF3A 4OZHE 3MCKA 3SDYL 1LTJC 2M26A 5IGXL 4NO3A 3DGGA 1S5HA 4EN3A 5C2BL 5LWYH 2VLJE 3K81A 3H1JD 2PYEB 2E9BA 1RUMH 3X12A 1L4AA 1JF1A 3GJEA 3OQRA 5ESQB 3QEHA 2FGWL 5CD5D 3DTUB 2OM5A 4MCZB 4OLVL 4X4XA 5CZRA 5E5LA 3JYBA 4L37B 2YO2A 2BNQA 1HDMA 4K8RH 5BVPH 8PAZA 1QBML 2C3WA 4KJPD 3QR2A 4WAFA 2FDBP 4FFVD 1LTSC 1RUQH 1YDPA 4TN9A 4OD1L 4QHUB 3ZTJH 2YC1B 4BXSV 1ASOA 1EDQA 1T1YB 4WK2B 4ALAH 2G0LA 4BQ9A 3AECC 3CDGA 2ZJSE 4LCVA 3RGVB 1QL1A 4HEPA 5GSVA 4M1GH 5IQ9B 1T5XA 2Z31D 2IANE 4YGAB 5FOJA 1SXZA 3Q1EA 4L29A 1DQQB 2GTWA 2CO3A 2CGRH 2EDJA 3RNQB 2G3NA 1U95B 1F1DA 5CSBA 1OSPL 2F19H 4EZKA 1OQXA 3GBMH 4LKCB 5HGDA 2NY5L 5HY9A 4JO5A 3MA9H 4HJSA 5DYFA 3QC5X 1A3RH 1UCBL 2Z8WC 3APFA 3HUJF 4QRSA 3W9EB 1G7QA 8FABA 5IT2H 4N26A 3CQQA 4ALAC 3IKKA 3HZMB 1S5IH 4R8WH 3G5YA 4M5SA 3S8WA 2OTKE 3EWKA 1RJYA 2ATKA 1ODAA 1WD9A 4IBYA 4OB5L 1YMMD 4LHUB 2A9NL 3TA3C 1GYCA 4HS8H 5FYJH 1YJDL 1INDL 3MLRL 2V5MA 2YMTA 2A74B 1HH9A 2OL3B 1IL1A 3C5ZC 3BAIA 4OY9A 3KPMB 3RL2B 1F90L 3MBEB 2PPCA 1KCRL 2Q7YA 2XVKA 3GXFA 4Q8BA 5CXPA 1A9BB 1R4XA 2Q9OA 1LGHB 3QNYB 4O2FB 4YIQB 1ZPUA 2BVOB 2B87A 3AT9A 4JMNA 5KYUB 3HHSB 4MMZA 3BGMB 2AK4A 5KAFH 4PD4H 3IS1X 1RF0C 1AQKH 2UY6A 3V52L 1RZJH 4WF7A 1MHPL 4N0YL 1DN0A 4FQIH 1KLGA 2XY1A 4XP1H 2F5AL 1KGWA 2NY6C 2DQGH 3DDFA 3O4OC 4KY2A 3IXAB 4Y8DC 5D1QA 3TV3L 2WC7A 4LQFH 1X22A 1YI2P 2OXHB 5HDQL 5BMFL 2R29L 4JY4B 1AV1A 2OTLP 4ZOCA 1NGXB 4G43A 4Z7UE 1A7OL 5F0PB 1F3JB 2OTWA 5EU6D 2BXZA 4PS4H 4KXZH 3FT4A 2VE6B 3H9ZA 3VFMA 4E2OA 2WQ8A 4EOWL 3P9WB 3ERXA 1RZJC 4JFEB 1A6PA 4OZFA 3ME0A 1CGYA 3MLZL 3Q2WA 2DF3A 3ULVH 1JE6A 2X4RB 1T3UA 1UGNA 4URKA 1XTLA 1NGZB 3NOIA 1MFBH 1JF6A 4G8FB 2ZSWB 5L8LB 3UYRH 1F3RB 4FHKA 1SUHA 3D39A 2RQEA 5DRNA 2PNDA 4Y4HB 1MNUL 5H94A 2XX1A 2WCPA 3TT1L 4K7PX 4WEBL 1TQUA 3IT8D 5L8JB 2Z9TA 1RD6A 1PJ9A 2KUTA 2P4AB 2JJVA 4HHAB 1XGQB 1OW6A 2GTZA 4FQJH 5IESL 1S1CX 3MRPA 4TMPA 5IW6A 5MI0B 3D85B 4W1TA 4B3EA 1XF1A 3PHAA 4PJFE 4PGCA 3OJDA 1N7SA 3DVGA 3G5ZA 5F7LB 3TIEB 1RZFL 1AIFA 2NW3B 1J9SA 1M3IA 3ESUF 1S5LE 3WNOA 2XKSA 5GGTA 4J6RH 1JDDA 4XZ4A 2X1PA 2DEXX 2V5RA 3BRTB 2DQFA 3WAJA 2BOBB 4NIKB 2GVYA 1P5VB 5HHPA 1MCWM 5IJBC 1S9XA 4GSDH 2ETWA 4YLCA 4UOW1 1FNLA 4Z18A 4AM0B 1UYWL 3ZPDA 4GS7B 1XFPA 4PRPA 1QLED 3WIHL 2O1KA 1T22B 1MCPH 2ZXAA 1PZDA 1ZTXL 3IWVA 3SSUA 1JGDA 1KBKA 3C08L 3C9NA 4MBOA 1U3HA 2X6AA 1M3JA 1M2VB 2VL5A 1N6VA 1KCSH 3CDZA 1DQDH 4AJYV 3G3ZA 1MVUA 2J5WA 2QHRL 3DJRA 5EC2A 1UG9A 2QGDA 4ZG1A 2Z64C 3PP5A 4X4YB 4NT6B 3WJMB 3P77A 1U9KA 1JHKL 1KB5A 1KF9B 1BZ9B 1GGBH 2RHEA 2AJVL 4JG5A 2O01N 2GJ6A 3KHOA 2IDBA 5FA4B 3CX5H 1HXYA 3QW9A 1A3LH 1UZ8A 5PAZA 2W9DL 5IV2B 5FUOL 5HD8D 1FFPA 4I4WA 5CBOA 1BXUA 1UA3A 5LCVL 5TTRA 1X7QA 1FAVA 1YQ3C 4M5YH 2UUDH 4XN5A 1NTZJ 1I9JH 2EIZB 4LGDE 1JGEA 5GS2D 2Y6TE 3AMKA 4DJMA 4F1SA 3H7LA 4A2GA 4HCRH 4Y28J 4P2QA 1H15B 3NJMA 1G4MA 4H20L 4XVSH 4ELDA 1INEL 1GR7A 1TJMA 1JRHL 3K6OA 5JHDB 5I1GH 1JPGA 4JFHE 5D1ZD 3T08A 1P7HL 3NABL 5SX5H 1YITP 4B9YA 3OPZL 3RL0g 4NPFX 1C5BL 2NR6A 2OARA 4LCYA 2IAAC 3FUDA 2EQDA 1KB3A 1AQDA 2W27A 4ANWA 2I9LB 2BCCE 4XPAL 1J0YA 3ET9F 3GMQA 3RKPA 5DR5H 15C8L 2BNQE 4LLMA 3GZPA 2TRHA 3OJ2C 3LJ3A 3REWB 1LEGA 4P05A 3OV6A 5B4MC 1XR9A 3MRBA 1CGWA 4MB3A 4PRHA 3U36B 5A40E 5HVWA 3DGDA 3B7YA 1FQ9C 5IVZA 2FJGA 3D9AL 2KUBA 4JG0L 4YSUA 3L2NA 1SMAA 2ZOTA 3UADA 1RZ7L 2ORBH 4ZUTB 5TGBA 1GU5A 2A4CA 1KIQB 4P5KB 3M9BA 2HG0A 1J5OH 4WTQA 2IQAB 3BP4A 4FZ8L 2FIRT 3V55A 3VRIB 2JWYA 2W0PA 4EEEA 3VFWB 3CFDA 1HI6B 5LG6A 1G7LA 1MFCL 4X9IA 3L72E 3R06A 2P44B 3IFOA 1Z56A 2CKBH 1BVKA 2VDMB 4J3SA 1QVOB 4R96B 2XUWA 2DQHL 2QGCA 2WAQA 4GQZA 1KLFA 4Z9KB 5SWZA 1PIGA 1SJVA 4JM2B 1KPUB 5BZDA 4YHML 4U6HB 5K9JL 3C1LA 1U8KA 1TCMA 3OLEA 2B88A 1J0ZA 1LTBC 3PQYB 4ODTH 1NL0H 1AHWB 5HDBE 3A5TA 3II2A 2ADGA 4PSRA 1A25A 4PLOB 2TAAA 1SF3A 2ZWLT 2PWEA 3LKSB 1CS6A 3B9DA 5E4EC 4XCFH 1E0OB 1F8TH 4G5ZL 1CIUA 2BW5A 3W56A 2ZYGA 1W72B 1D6EB 1UGKA 1TPXC 2AK4E 2GUOB 2XN9E 1FSKB 1S78C 2ED9A 2H32B 1IFMA 3IDXH 4M61A 4NFBA 4NQVA 4G80A 2PYED 4WWKA 1HS6A 4R26H 1FJ1B 1LE5A 2JQZA 1JTTA 2XNXA 1Q0EA 3LQAH 3P0VL 3QO1A 5D1QE 5FHAL 4DEUA 5JHBA 3T5WA 3LH2L 4KOCA 1B4TA 4U1JB 3VXSB 5C7XL 5I8EA 4OCLC 3S5YA 2KS0A 2JI2A 1XCQB 1NAMA 2A9DA 4P59L 3RFRA 3JCUE 5CILL 4NQDD 2ALWA 4NQTA 3UAJD 2E74B 5CMZA 3O3AA 1FZCA 3O2WL 2FFDA 1PZQA 2DKUA 2P5EB 2D8KA 3OL2A 4JFFD 4U1SB 1BQKA 43C9A 3W39B 4DP0X 1SJXA 2DQJH 3K80A 1E27A 3AJ7A 4UT9L 5EOTB 2WTYA 2MOVA 1IC5H 5KVFL 3GI9L 1QRNA 3LQAC 1NPNA 1NKZB 2V33A 3V6ZA 1JPTL 3ABGA 3BQUA 1UWFA 4N2BA 2M3BA 4HIXL 3MLYH 3U48A 1JNLH 5KJ7D 1MHHA 2G0KA 1HL4A 1PZ3A 5I1JH 3D39E 3US0A 2CXGA 1AKJD 4O2CB 4YDLB 3B2DC 4XXWA 2ZCKL 5B39G 4U1MB 3VI3F 4FYRA 2Q10A 1XX9C 3CVHH 4H8QA 2ZD0A 1PKOA 2NSQA 1FYHB 3LZPA 2FQDA 2NZ2A 3S4RA 3FPXA 1BVZA 3MRJA 3F7LA 4OGXH 1CURA 4MNQA 4M6OH 1NUDA 3MBED 3HPJA 5E08H 3HBPA 5CEYB 4Z7VA 1AZUA 3EQ2A 2JJSA 4NKMA 1U8HB 3H56A 3AGVA 5BJTA 5BUAA 1JZDC 4HWNA 5MP6L 1L6PA 1N0XL 2XWJB 1MRFL 1PNCA 4F93B 1SQVD 4HKBA 5J8OA 2ZYRA 3S37X 3FB6A 1TNNA 4L9LC 3BLPX 4PRPE 4ZUWA 4ELMB 2XVLA 3P69A 3PDGA 4IYKA 2XDJA 2Q8BH 3MOAL 1RK0B 5C0DB 2HRLA 2X9WA 2DQTL 2ZUQB 2ZONA 3F65A 4G8EA 2DMHA 1IV8A 2QR0A 3EBGA 2P10A 4K2UL 4P2YA 2HRHA 3STZA 5DXWA 4ZFQA 2Q0ZX 4R4MA 4M9OA 2MKLC 4K9EL 3IN2A 3UBXG 3CLQA 3WXWL 2BS9A 2GJ6E 2PYFB 2VZTA 1BE3J 2WQYC 3TNMB 3OZ9H 4DEPB 1JNMA 1SEQH 2B16A 4HFWA 4PTTB 3UG4A 1JZHA 4FNLL 4J8RB 3IVKA 3QRGH 3RUGA 1IQWL 3WKPA 4WHYG 4PWHA 3U1AA 3ZDZE 1P84K 3OSVA 1E9QB 4JRXB 2YO3A 5LQBL 2F58H 2PXYC 4LLWB 4N78D 2CKNA 2Z8RA 4RMUA 3SKMB 1OZTG 3UTSA 3DMMD 4HX1A 4H13B 4LEXH 4P2QE 3ZMNA 4YPJA 1TYEB 1U8IA 3LQZB 2XXGA 2XBDA 2Y5TB 4LBEB 4PWJA 4TULL 5DRZA 2DL9A 3NK4A 4Y4HD 4I9WE 4S2SB 3HE6A 1A3QA 3HB3B 3QWQB 4IBZA 2LOEA 3ROLB 4TNEA 3LKPB 4P2RD 2O01J 1U4EA 1QLEL 2N7SA 4Y1SA 1DZBA 3N50A 1H0TB 4H0HB 4ADGA 5DZPA 2FO8A 5T1DH 3P0YL 3WFEL 3D85D 5CMAA 1BOGB 2KZJA 5KTBA 1IM3B 1CFNA 4NKDA 4HKZH 1EMTH 5JPMC 2V4HA 4ZZFA 1GZHC 1FL5B 4F20A 2VN5A 3MJ9H 1HJ0A 4M4RB 1QFUL 5IBUG 3CVDA 6PCYA 2J1KA 4LK4A 2AXTE 4PRHE 4FS0A 1YRKA 4LHQB 2I8DA 4KVCH 1UFUA 5DF0A 2R0LL 4PMEA 4GQQA 5FHBH 3ISWA 1AOHA 4AJ0A 4OFDA 3ZT7A 1EC5A 2YUZA 3PWPA 1GVIA 4R5TA 5F88B 3UC2A 3NCJH 4DFHA 1RFDL 2ZYSA 5TDOA 2ATPA 5HHQB 1DE4B 1EVTC 3O8XC 2K9FB 5FA3B 3RY6A 4PJGB 5IB2A 1NTZE 4KTDH 4NOBA 1KJ2H 2WLJA 3BRGC 1N10A 4TS6A 5JXED 2Y6SC 4NUMA 2FNWA 3GIVB 4V2CB 3MCG1 4MZ3A 4XPHL 1NFDF 2QJPB 4HAFA 2BIMA 2DS4A 3LKNB 4HV8A 4YC2C 3KGSA 3KW8A 4H1LH 3CWBD 5D9SB 5G4OA 5JW5A 5SWZE 5DMIL 3HN3A 3LNHA 3QUZB 4KAQL 3RPBA 3FB5A 2YWZA 5DK3A 1IEAA 3HZVB 4X5XA 4IHBA 4NSKA 4YDNA 1G9EA 3GMPB 2HKHL 3INOA 5DHVA 1ID2A 4N8CL 5DD3L 2IAMB 1AXSB 4MZ2A 2BIQA 5JORB 3IDNA 3NIDB 3WIFB 1Z5YD 4O51B 3B5NC 1PBYA 2JJTC 3FRPB 1KELL 5JO5B 4A6YL 3BPLB 4HMCA 1UT1A 2B3IA 2C3XA 2NZ9C 5K59E 1H6EA 2L7JA 4PJ7A 4OM0H 4DW2H 2A06D 5CCHC 2RAMA 5C0EA 4YBQC 3V4QA 1CF1A 3HE5B 4UNTA 3ZTEA 5ABDE 1TQTA 3RFZC 5DT1L 4XBGB 2BCCG 2E4TA 5D8JH 1MWAA 1VADB 2XPGB 1H9VA 3L4VA 1FI8C 4MS6A 2BNRA 2WOBA 3UJIH 2EDQA 2WINB 3F7YB 3T1FA 4X5QA 2QSVA 1A0QL 3ZHDA 4QKTA 1QRNE 1M4KA 1KYAA 1A66A 1NGPL 3WS6A 4NWUH 1G7HB 3SBWC 3ZGIA 5CP7B 1G1CA 4HEPG 2XYCA 5GZOC 2UVEA 4ZS6D 3T2OA 4I7ZB 5CCGA 1M6UA 2VKWA 4UM8B 4AVIA 3ZYOA 4OV6F 4QOKA 1B0GB 5KWYC 1Q7YQ 1DSWA 1AOZA 1J8KA 4NQSA 4PB0H 4NKOA 1NCHA 5T3ZD 2B08A 3MC0A 3HD7A 3VGAC 1K2DB 2CJTA 4W9LC 3CVIL 5IOKA 1FL6A 3EH5B 3PV6A 3HRZB 3S5LB 1USDA 4PG9A 4I2LC 4JM2D 1FZOA 3AMLA 4TSAL 1FH5H 2BSTA 4YHOL 3L72G 4PRDA 4PS3A 2V7HA 3QXWA 4KTGA 3UAAA 1IEBA 3PQYD 5E7FA 3RWJA 1X9LA 2FJHA 4MNQE 3SO3C 3TM6A 1OSZA 2CPSA 4UDTA 2QPEB 3MV8A 4GQ9L 2WITA 3CMEP 3DK0A 5AENA 2WVRA 1HHKB 3FQNB 1JO5A 4Z7VE 4N4YB 4MBRA 3ZE2B 1E5CA 5JHLL 1IGCL 4DPAX 1ZSHA 1NPJA 3G3LA 3T0VA 2WPRA 3QNXB 5IMOB 2WP3O 4MCNA 1J2JB 1CDCA 1BQLH 1WPCA 3V4PB 4BZ1A 4ZXBA 3A0BE 2K8QA 1VFOA 3FFCB 2WXOA 1NCNA 5ALCL 4ZTPL 1KT2A 3RWFA 2BINA 1A1NA 1B2WH 2DIJA 1PIXA 2DMKA 4M7JL 4HXAL 5CWSA 5CR1A 1PG7L 1HH6A 5IVXB 4PJ5D 1J5IA 5DTFA 2VH5H 3NEOA 3TGUJ 1RE3C 3PAYA 1S7VA 1R47A 1FJPA 2FR4A 2DTSA 4OU3A 3QPXL 1A6VH 4HJ0D 4RDBA 1L9QA 1G87A 1ZA6B 2JXMB 4JFDB 4C56A 4B9KC 1BAWA 4BCXA 4LLUA 1IAII 2JK5B 3MJWA 3Q5YA 4WI6A 2AJXH 3ARGC 2MKWA 3TP4A 3IJ9A 2FZ3A 2VZUA 2WQXA 1FG2A 4WK0B 2FWOA 3LXUX 3VFOB 4AQ1C 3V5DA 3O4LA 1E90A 4O9BA 2DLGA 3RUGE 4APXA 3CG8A 1Q86Q 5ITFA 1R3LA 4OV5A 3MIWA 2OL3L 2IWGA 5D7IB 4E9WA 4OZGA 1R5WA 3AM8C 1G94A 4OZFG 4RMBA 4PYGA 3S35H 4BFIA 1QG3A 1Z32X 1JPST 3UTSE 1WICA 1XXDC 5M7QA 3N2JA 1N8RQ 4FGMA 1ZVYA 4BSWB 4F9LC 4YAQA 3TJHD 2R3SA 1ZLVK 3MACH 2WBJB 3C2AL 3BD5A 2PPFA 2AJUH 3DO7B 3EDKA 1CI3M 4L1DA 1YYLL 5CKAA 1FNSL 1GZQB 3QH9A 2GSIB 3EHBD 2HODB 1Z5LB 1FFQA 2C9SA 2Y22A 1RURH 3D25A 4UB0L 1DJXA 3H9HA 2K0RA 3DKHA 2Y69B 3GB7A 3IS0X 4QAMB 4I0CC 2FATH 4Y4KB 4UTAH 3IEAA 2Q7NA 3WL9B 3H1HD 1ACYH 4WO4C 5LG1A 1AR1B 1Z3RA 1QA9B 2R0ZH 4MNGB 4LHJB 1T1WB 1AZVA 3MXVH 4WY7H 5AQ0A 5KS9A 3ZGHA 5J6HB 1SYSA 2YBRB 1VEOA 1Y0LA 3JZ7A 2OCJA 3PL6A 3BH8A 3L4WA 1PNDA 3JUZA 1RIVH 4C55A 4BEIA 4WHTB 4JCLA 3UC0L 3WMPA 1IC4L 5HYJD 4GP5B 1BE3E 1DVFD 1F45A 3IN0A 4OZIA 3PWPE 2EC9T 1YEGH 3MV7D 4G70B 2J6WA 4YZFF 2FKWB 2YPVA 1TQBC 4BXLA 1OGTB 4YBLC 4R4FH 1WAEA 4HULB 1ICTA 2XU9A 1FBMA 1JYWA 3VU1A 1CLOL 3H6PA 4BRYB 2ZOLA 4FP8L 4NHUA 1FOSF 2A6IA 2FT6A 1IT9H 2W65B 3NZUA 1MW2A 1HHHB 1S9KC 3AUWB 4HFUH 4Q9QH 4JHWL 3O0LA 3DX8A 3MRGA 3R0NA 2WSEH 5APQA 2DMGA 2YAPA 1YEWA 5F7FA 1OGAA 4H4NA 2HA1A 4NP4H 1SLUA 1F6AA 1UJ3B 4J3VA 3QS2A 3FWNA 1HCZA 1YQ4C 3ARPA 2HB0A 2QV2A 3BP7A 2B89A 1VF5D 1E4KA 1QR4A 4W9CC 5A1AA 2WIIA 3MLSH 2DQMA 4TOYH 2MTPA 1RK7A 1ZP0C 4H13D 1OCCB 1A6TB 3MNVB 2OI9B 5DO2C 4LCIL 5JIKA 1CFVH 2E76C 1DBJL 3F00A 1L9OA 2I69A 4AQAA 2XZCH 3SCMB 1SY6H 3WNJA 4JAMA 2EUVA 2QVMA 3TF4A 1YYCA 2FSEB 3AGWA 3CFMA 5JA9A 2Y07L 3PDOA 4N24A 3BIAX 3T0EC 5LNEA 4PJ7E 3VE0B 3NA9H 3U30C 1ETA1 5KBNC 4FXGC 4OF8A 2WZ6A 1OVUA 3GMMA 2PO6D 3NZHL 1PTZA 4ICWA 3AS3A 4R7XA 3L17A 4R7DA 5EZIL 3IKCB 1XAKA 3H6JA 4J4PC 2V2TB 4CMHB 5D4HA 4IDJL 3TYYA 1TZOA 4NQEB 3H1KJ 1OWWA 2K3TA 5KVEL 4CMMA 3HNSL 1SF5A 2BOLA 1CL7L 4OF7A 1E7VA 1WTGT 2KZ1B 4ZX5A 3RDJA 1B4LA 1A9EA 3LZOA 4ZZKA 4A2HA 3Q06A 2WSSH 2LQRA 4PLJD 4PR5A 2WSFH 1UWXH 4HBCL 2BNRE 2YKLH 4J3UA 5KG9A 5A6IA 4HP5A 2N59A 2GJZA 1IX2A 1UZ6F 2JQMA 3NA4A 3QRLA 4WI3A 2E43A 3LHPH 3L71D 1EO8H 4IOSD 5EB9A 1XR8A 3MROA 4G6FD 4ZAKB 2NMSA 2RJMA 2H5UA 2WMMA 3VGEA 4JFYA 3NRFA 2NTFA 1KIUA 4AQOA 1O75A 3LXBA 4FQXA 1VAHA 3RP1A 4UM9B 2KH2B 1YEDA 5CCGE 1Q9WA 4OJFL 1DVSA 2VRKA 3TGXA 2A73A 4QOKE 4YL4A 1U33A 5AOKA 5E6ZA 3QC6X 1NTZG 1M56B 1I7UB 2J71A 4L1LA 1VQ6P 2NY1C 4KKLD 3X3GL 4N5UA 5AEAA 5C09A 4TVPD 1G6RA 3FOMA 4P4KA 3WKMH 1CZQA 2FE0A 4CAGA 5E2WL 3K6SA 3R1GL 3V0VB 1KIPB 1SNRA 1R5SA 2WWOA 5D72L 3VP8A 4IL6X 1SMDA 4ESKA 4KZDL 1D5BB 1F4WL 3RJDA 4NZRL 5KSBA 1H88A 2VJXA 3MV8E 3HCVB 1P84H 2WNKA 4UQ2B 2IAMD 2K78A 4UAOB 5GGVH 2IFFH 4JO4H 2W0FA 5ETUA 1LGVA 1KCKA 2HUHA 2FYUK 5DS1A 2UZIL 3N04A 4NWTH 4GOFA 3ESMA 2JDIH 3U2SA 2WJ7A 3I6GA 5CR8A 4CVZB 4Z78A 4JQIH 1QBLH 3GBDA 2CXKA 3N41F 4YZWA 1BFVL 1K9MQ 1V3MA 1K8AQ 2R1XA 5FCSH 2HJKA 5DJZB 2H26A 3O2VH 3F58H 2DEWX 4X6BA 2YIUB 2IGFL 1GZPB 5CHNB 4KMQA 3SDDD 1IBHA 2CDEA 2AF2A 3OX8A 4C56E 2F53A 3GXNA 1A6AA 4QXGL 4RX4D 3WE6B 4PHZA 5T3ZL 4K71B 4UZGA 5I8CA 1Y47A 2Y9YA 1NA8A 1OE2A 4XP9H 4WW1A 5BRZD 1HCYA 1I85C 2VDML 4U0QB 5B21A 1EXUB 4DETA 3ECBB 2EDWA 3O4LE 2FAUA 3GO1H 4OVNF 3V4VH 1S3KH 4KBPA 2CIIA 1YY8B 1KG0A 4QXUH 3FO1A 1NKRA 1JGLH 5D5MB 2WBXA 4KNSA 5IP4A 4OZGE 3QA3B 3QIBD 2FL5A 2AXCA 1FZKB 5H2BA 4ENED 1E4WL 3L3JB 5CLXA 4Z3GA 2QVFB 3MRLB 3QORA 3QZOA 4N6QA 6CGTA 2FHFA 5J7CC 2X0UA 2Z91B 3OAUL 2ZP0T 5CCKL 1GGCH 1QBBA 1L0LD 1JPFB 2VMCA 3H55A 2Z1KA 3IMSA 4FF9A 4Q2ZB 2NUPB 4B0MM 2VM9A 2NX5B 4HUXA 4B50A 2L3BA 1SQBD 2KL6A 1XV8A 3A4EA 3IAQA 5C3IA 1RZGA 3EXLA 4DOHB 3G7TA 1I8LA 3HAEB 3RWGB 4EDWH 1OAYH 1BF2A 1OTUD 3CH1B 5EWIH 2IO5A 5DQDH 3TGUE 1NSNH 4RBPH 1XH0A 5FUZH 4F33B 3EFFB 3WV0A 4IBQA 4G3YL 3W5NA 3VXMB 1X9QA 4NOFA 3EYSL 1U6AH 5KS9E 1L3NA 1AIZA 1MAJA 2ZJSH 4ZMAT 5I15L 3S2AA 3WSQL 1W0WA 5CP3H 4EIGB 4GUQA 3GSUB 1Z5HA 2YD2A 4HC1H 1E6JL 3KPRB 1N73B 5FLUA 1LMKA 1RSYA 1BZOA 5E79E 4YDIL 2BSSA 4OZIE 4HIEA 5CM1A 5GGQL 1NFAA 3F7VA 1T4KA 1Y18A 1PX3A 3MRHA 3AS2A 4MJ5A 1EEZA 3VGHA 1EK3A 3UZVB 4FD0A 5APUA 1CGSH 3ZDYF 1PPJD 2WTRB 3BPNC 3NJHA 4JFDD 1M71A 3PWNA 5C97A 4GQPH 4Z7OF 4W9DC 4I0PA 1HVXA 3V6FA 3MKGA 5F0JB 1ZV9A 1FDMA 4K8RD 3RAJL 5K9QI 4K3JH 1OGAE 5E95B 3VYOA 2V8LA 2HFGL 5CBAA 1YEFH 4GP4B 3PAVA 4YXHH 4QMEA 1BQHB 2NNCA 3HI5L 4JFTA 4MD5A 3TN0B 1BYPA 3K1KC 4B86A 2W94A 4RAVA 3VG0H 4NNPL 4W9KC 1L0NK 3TA3D 3GSWB 4YNYB 1G1YA 1UB6B 2WBJD 3S2CA 4OZ4A 1N68A 1R3KB 3BISA 2HVBA 3OB0K 1MJ7L 4X7EC 2X4SA 1NVOA 3GS7A 4P2OB 1E4XL 5DQJB 3WTUA 1YEEL 3L4UA 5T3XD 3MRNA 4RRPM 1ES0A 1FZFA 3F6LA 3H53A 5KAQF 3K6IA 4WHYH 4M56A 4KNQA 4CRPA 2OYIB 1AR1D 2Y4SA 3SE8L 1TTUA 1KN7A 1TLMA 3PFQA 2NY6D 3LKRA 4Y99B 2QTVA 5FYJD 5LGJB 1INQB 2GY5A 2YXFA 3ZE1F 4DN4L 5I6XC 1P53A 3INUH 4N3TA 4KMLB 4MAZA 2YMXH 5DEGA 3X13A 2BMKA 4UQEA 4YWGH 4PGEA 5I19L 3AUVA 3FFDB 3B2MA 4X99A 3WIHA 4JN2A 3RZCB 4YDJA 2NW2B 3CFEA 1DBBL 5IB3A 1FO0H 1ZVHA 2B59A 2X4QA 4Y9EA 1RERA 2EJ1A 4BK4A 1GPOL 2WQSA 3CH8A 1BE3G 3T8XA 4TQEL 2FX9L 2D7QA 2QRXA 4X5PA 4YDVA 2GK0B 3TJPA 2DWEB 1KN2H 3WHXB 1NU1J 1I7RA 5TE4H 1EHLH 2LR4A 1TJIH 1ZW0A 4JGMA 4YXLH 1JZEA 4XC1H 4ES9A 2D3JA 3OWEA 1BECA 4BA0A 1BJ1J 2OMXA 3K5RA 3PABB 3GXDA 2H1PH 4A68A 1LT9B 1UA7A 2P7TA 3BASA 2WUBH 4QRRB 4XHQA 5C09E 4BZYA 3FU9A 3NG5A 4TNFA 2XV5A 2V3EA 4YFLF 4GFTB 3P40A 5LCVA 4AYBA 5HVHB 2NQ3A 3L4FA 3QWOB 3H8NA 4P46B 1S5LH 5KSBE 1G5GA 1E3ZA 2VRAA 2AQNA 5DK0B 1SQXK 4NYLA 1ZA3A 4HJGB 4FFWC 2HN7A 2YRBA 1UACL 1TNMA 3H1KE 1M9SA 2Z4QB 3AREA 4ORGB 4XOCA 2A9BA 3H1JJ 1ECZA 4ZFGH 3N85H 3WXVL 5IJVA 4G8GE 3MYJA 1RUAL 4IOIA 1I9RH 3CMGA 3FCSB 1IQDB 4D9QD 3I3EA 5EN3A 3TESA 4LNRB 4Z3TA 2X1XR 3RDTB 3J27A 3ML9A 3BKYL 4KKBC 2BFVH 2UZYB 1DVTA 4YPGB 5JHMA 3QULB 1IJDB 3AQYA 2QA4P 4HGWB 2YUVA 1ZCRA 3NIFB 4HIJA 5FWRA 2F53E 4U6XB 3VWKA 4NQED 2XCMC 1FBIL 4FQLL 2EEBA 3H1LD 2WSPA 1R75A 4HZAA 5L6YL 2I60H 1M9WA 5HPMA 3L9EA 4TVPL 4Z3IA 2BSRB 1CXHA 5T33L 3WFDH 2I1KA 1RY7B 5DMKB 5DD5H 1T2JA 4ORZC 3G5VB 32C2A 5F1SA 5G4MA 4FOMA 2GYSA 5D71H 4PI0A 3B4SA 5K33A 4HK0A 3SYCA 1ZHNB 3JWDL 2B7DT 4XT1C 2OP4H 3EYUL 3LEXB 3M45A 1CZ8L 4MA1B 3E7JA 2FY8A 1QSFB 4NNXB 1MFAH 3APNA 1BIIA 1MKFA 4LKXB 4EIJA 4IDLA 3VGFA 4NGHL 4P57A 3IRPX 5DFTA 2K88A 2A77L 3GT6A 4NLHA 3RJQB 3HMXH 4EKXA 4WKZA 2WPSA 1TYJA 3U59A 5DVOA 5FDWB 4W70A 4Y5YB 3RK2C 2CE6A 3HE4A 4NHCL 1NFIA 1BJMA 3IAPA 3GZKA 4QJ5B 4XP5L 3GNML 3T4AA 1XB3A 1NTKJ 4X9GA 4XMKH 5LXGH 3CC5B 1CU4H 4AMXA 5IFJA 1CG9A 1HKLL 2O3JA 2XTSA 1HAUA 3CX5D 2DIAA 1FU1A 1RHZB 3HNVH 4IU3B 3HVDA 5DI8B 5C08B 4EN3C 1QHQA 2OKMA 2IPPA 5L9DL 1L4AC 3MREB 3FN0H 3EO1B 4L1HA 1KPVB 2H3XC 5EORH 3BGFB 3T65B 5BV7B 3HI1B 4EZLA 3JWNG 2EH7H 1U3JA 3QUKB 4PJDA 1ITCA 3IFPA 1BZ7A 1P9MA 5B4MD 5AVTB 1DD4A 1EZVD 1QR1A 2PW1A 5J89A 2AS5M 2EIJB 2AVFA 3LRSA 3JV4B 2DD8L 1ZANH 3ZIYA 4NX0A 3QR0A 2C4FT 1ZT1B 3GW6A 1UH2A 4PWEA 2VQUA 4MJID 4HCIA 1EJFA 3RIFK 2Q2LA 5I1DA 1GHFL 4K7PY 3MGOB 5SWQA 3VMYA 3FQ4A 2RBLA 3U2JA 3VXNA 2ZT9B 3DRQA 1WFTA 2VLKD 3FUEA 4LSSH 5JIMA 4TLSA 5HHMB 2HYNA 2J1XA 3MRRB 3OR7B 4UT9A 3RJOA 5ADOL 2ADIB 4H40A 5EU5A 3NIGB 2P5WA 2BRRH 5DZNA 3T3ME 1N64L 3DX6B 3TVMB 3I75A 3GZOA 3UTTD 1SS1A 2KQNA 1URIA 4NO5A 1U91B 3P73A 4MA7L 4IM8A 2QSTA 1BBDL 4L1SA 2O5YH 4XCEA 4F7MB 1SHMA 1AGEA 1EXHA 1IAOB 2WW8A 2QJYB 3MA7A 2WIMA 1RF1B 1A6UL 1GA2A 4RWHA 1S7TA 4Y88A 4NM4H 2J4WH 1KGCE 2PTTA 4D0DB 2C9QA 3P4MA 2BVEA 5E8PA 1HUCA 1FNEB 2ZUTA 1J0KA 5F7MC 3QCTH 2A83A 2HLAB 4JKKA 3CZUB 4WU5B 2BOCA 5LB1A 1SQQK 2D9QB 3G5WA 3VB8A 3JCUH 4YHNA 2MTAA 4MMZC 1S78D 1OAKH 2C9PA 2X4PB 2RR3A 1CR9H 3ZT6A 1MHEB 5AUMA 1U8PB 4N9GB 1BD2D 4OZFH 1PX4A 3TGUG 1JWMB 2D73A 2XBTA 5KTEL 4A7PA 5JIHA 2V5YA 2JV6A 5BVPL 2N1TB 4K8RL 5EO9A 3APDA 4NUGH 4IBWA 3KPRD 5D1QC 2WWWA 1MZYA 2XKNA 4L8DA 5C0JA 2IDCA 2KKQA 4JZJB 4C4BA 5IZ7A 2H47C 2P47B 2J2ZA 4KKRA 3L6FA 2BIOA 4I1RA 1AG6A 3P32A 3CNKA 2B5IC 5E9NA 3Q5TA 3ZHFA 1A02F 1KXTB 5JR1H 1JD9A 4N8UA 4PY7A 2F1AA 2VO8A 4IKIA 1OD7A 4JFOA 4KVNL 2ZOKA 3HFFA 5FGSA 2CR0A 1TTRA 4M1GL 1MJUL 3RWEB 3ZQXA 3VD0A 1LVEA 5EBLB 5F1IB 5FV1L 2B1HH 2G2NA 2IDUA 2WLIB 4P3CH 5AYUH 1HWWA 3FULA 4QGTA 3DSFH 3GBML 1T2KD 4IRJA 1K8DB 3D0LA 4KX8A 2WXKA 5T3XL 1FDIA 2AW2A 2A2QT 5GGTH 5IT2L 3KE0A 4R8WL 1S5IL 2VITA 3G6JB 3BGAA 2OTUB 1TMCB 3BE1H 1YAZA 3B2UC 1MHCA 3DIFB 5D93B 4TTGA 2GEQA 4HS6A 5IMLA 4X7TB 1NMBH 4HS8L 5FYJL 3RTQA 2XIIA 1U58B 4POZD 4OJAA 2XJLA 4MD4B 4I48B 2R39A 2NY7H 1QLRA 5GRWA 4Q58C 2D03L 1I8IA 3LRLA 3KL5A 3HJ0A 3RIFF 4JPWL 1U8LA 5ICYB 3AT8A 3OKYA 4X6CB 3QNFA 1JCCA 1AQKL 1KB5H 2ZP8A 4LVOB 2RMZA 2PPAA 4G7YH 4X7SH 4CVUA 3CV5A 1Q90A 2QFPA 3QIWB 3N43B 4FQIL 2I1JA 2VIRA 1YY9C 4BK8A 5I8KH 2PCFA 2Y9ZA 2DQGL 3ZO0A 4LBAA 3M7FB 1DJIA 4JBSA 1NU1E 1KGJA 1NEZB 2OX5B 3UMNA 3QJSB 4L3EA 3DRTB 3WS3A 4LQFL 1MCOH 4LB8A 1LT1A 4DP6X 5AVWB 4BCZA 2FXPA 4N8PA 2X70B 1NGQL 1W8NA 1E40A 1LXMA 4ONOA 2IBZE 4RFNB 5C6TH 3PHLA 2IX7C 4W9EC 1U3HC 5B1KA 5JMOC 2AQRA 4DTGH 4A38A 3RVWC 2XTJB 4CNIA 4RMQA 3RZCD 2HLFC 1YUHA 3BJLA 4WDIB 5KYYB 3GMOA 3FCBA 2C0WA 3TFKD 3JTTB 1HX0A 4WW2A 1BV8A 1VQKP 1S7QB 4MAUL 3U1SL 4CVXA 2EVGA 3JC22 4ZMQA 1AGDB 1FGVL 3GFUA 4M48H 3VOPA 3ZSTA 1KWKA 1JK8B 1NGMB 1WSST 3FQTA 3GUFA 2OYKA 2R2CA 3LDBC 5D1ZA 2V2XB 1NPUA 5IHHA 2K1AA 3V10A 1I31A 4WFHE 2E42A 1CD8A 3H1JE 3DO4A 3QFJB 4N6JA 3S3CB 3ULVF 2AVGA 1TITA 3F12A 3QH3A 2VR4A 1HILA 4QRRD 4DGIH 1AXTH 2PXYD 2GBAA 4ASVA 1YNTA 5EFIA 1ET7A 4X6DA 3QQ3B 4P46D 1ZT7B 4XRCA 1P5UA 1LP1B 5T1KD 3HE7A 2P43B 1N7MH 4JMXA 1DSYA 1R0AL 2AXTH 4PJ8A 2HKFH 3MUGB 3LIEA 1NJ9B 2F61A 5A2JH 3HN8A 5KUMA 1OZHA 4Y9BA 4CN6A 3BEWB 3TCTA 2DMCA 2NR6C 4KRPD 4A6YA 4BFEA 1OCRB 1X5MA 3WFCH 1URQC 1Q4NX 2PWHA 3QQDA 5JIQA 3H1KG 1G2CA 3BDXA 4P5TB 4PJDE 3FQYA 1WRFA 3BDYL 2WV3A 3RDTD 5INDB 2EDEA 2CLRB 4Q9RL 4PJCF 5EN2B 1LNUA 4DF9A 3OKDB 2NUTA 2D2CC 4MXWH 2ZWSA 3FDWA 4GSDL 4YSOA 2JQAA 5E51A 1LQBC 2HRGA 3NDYE 4DZOA 2WSKA 2HH0H 5EDSA 1DFXA 4RFEA 1MCPL 4XGZB 2KZIA 3KPLB 2PABA 1MIEH 3O8XD 4PU2A 2I85A 3OB8A 3MBWB 2DPKA 3DK2A 3M8OL 1S9WB 5AAWA 3ZDXE 3LHAA 1DBKH 2QBWA 4FLSA 1FDOA 1ED3A 1PD0A 2G2RA 3ZUCA 1ZWIA 2Y2WA 4UANA 3W9DA 1LK3L 1GU4A 2BHFA 1S7RB 4ICXA 2MSPA 2O6FA 5HGHB 3IMVA 2XRAH 4BWTA 1NTKE 1A3LL 1NEUA 2VXSH 5ECJE 1ZKAA 5F3BB 3TOPA 4QHLB 3NMDA 2VLRD 3VG9B 3FHAA 4GG6B 3RVXC 5EV7A 1SOSA 4BKLA 2K7PA 5KBMA 4K3DH 4Z7QE 4DGWC 1I9JL 1T1ZA 4BUQA 3VWJB 2PYEA 4KKCC 4UMSA 4FA8A 1HOCB 3GBLA 5F9OH 5ESQA 1IZJA 2D0GA 3GHBL 4MCZA 4L37A 3B5ND 1MLCB 1H8LA 1NAMH 1Q72H 4U1HB 3FU3A 4WUKH 3FSAA 2DB8A 2PCYA 3BWUC 4QHUA 4XB3A 2YC1A 2NZ9D 4JYBA 5A6MA 1W5CE 5IVXF 4QAWA 5E03A 5C08D 5JHLA 1T1YA 3GXPA 1SQVJ 3NFNB 3E8VA 5CFHA 4WWKC 4HJTA 4LCWB 1Z2KA 5CCHD 2WLLA 4QHKJ 3L5HA 3S7GA 3RGVA 1NCWH 1PU0A 2A45G 5DZVA 5IQ9A 1QRKA 3T04D 4DP1X 4NNYB 4FTDA 1YEJL 3HG5A 2EE2A 2SODB 1DQQA 2VDKH 3RNQA 1U95A 2L7UA 4MXVF 3ISYA 3N4XA 3L4YA 2VXQL 4LKCA 2FFDC 3L4ZA 1PZAA 2KLVA 1CC3A 1F4YH 3VM7A 3ZQWA 1RZIB 5BQ7B 4FNQA 3W9EA 2HT3C 4M8UA 2X1QA 3PNWB 5AZEH 3HZMA 5F7DB 3U4BH 2VDOB 5APWA 3SBQA 2JEEA 2W90A 1GOGA 2FEDD 1GTNA 3HC3L 4BQ8A 1JN6B 4LHUA 4WI9A 3BQUC 2ZWKA 4V33A 2QMKA 1I1YB 2ZYDA 5DD0H 2A74A 5DLMH 3W67A 2X9YA 4UINL 2OL3A 4RMSA 3IJEB 3FH8A 4KHXL 3KPMA 3RL2A 2HFTA 4LGRB 1O7DE 4IGBC 1I1CA 4ZUUA 1A9BA 4YIQA 3QNYA 4O2FA 3TEUA 3VFGL 2BVOA 4XOAA 1JNNH 4XXWC 5AL8A 5GIRB 2Q7CA 5KYUA 3HHSA 4KI5D 5KKZB 3B43A 1IFJA 3E1RA 3A0BH 4HALA 4IFMA 1NL0L 2QDVA 4ODTL 2WN3A 4TXVB 5LAPA 3VDBA 2ZUYA 2CJ3A 3BAEH 1OP5H 1BBJB 4L23A 5E8NB 4LDOB 1FIEA 5GRVL 2F1EA 1DEBA 3LKQB 4HGMA 5E6IC 1B9ZA 1WP6A 1F8TL 3IXAA 1I82A 4KT0J 4L4TB 5J6SA 2IGLA 5KYXA 2OXHA 3GS4A 1Q94B 5ALBL 1YLBB 2FBJH 1X79B 4JY4A 2JJSC 1DLHB 3O3UN 1I8KB 1JPEA 5IEKB 1NGXA 3WN6A 1ILSA 1U3NA 2CK3H 4FHJA 1F56A 1F3JA 4HOZA 4NXSA 1WFOA 4R26L 3TZVD 2VE6A 5I6MA 3LQAL 4L3EE 4P5SA 3LZLA 4I1PA 4JFEA 2QQQA 1GSKA 2N1TD 4MCYB 4ZFZB 3L4CA 4B3VA 5DC9B 2X4RA 1VACB 3DBSA 3OGOE 5FYLE 4P3WA 3QYMA 3FN3A 1NGZA 2KLRA 3FRUB 4NCC1 3BC9A 3VFTB 4G8FA 2ZSWA 2N56A 3ZE0E 4B9ZA 2X4NB 3RY5A 5JOFB 5CN3A 2HPOA 1YECH 5CU5A 4P2AA 3AEGC 1KBVA 5CZVH 1MRDL 2DQJL 3FT1A 2E6PA 3VVVA 2N3JA 3O3DB 5IHUL 4UIKL 3R4YA 4Y8AA 2QKIB 4LLAA 1IC5L 1QFHA 4QI3A 2WPGA 4Y4HA 3RURA 3VFUB 5T3ZE 2BVQB 2VN7A 2IPUG 3HVNA 3EZ8A 3QCUL 3EOAB 3VDAA 3C5JB 1TETH 2NYYC 3X1BA 1VEPA 4AK2A 3MLYL 2A1WL 2W9EL 3OC5A 4HHAA 5I1EL 1XGQA 1L0PA 3D2UA 3D85A 2Z1PA 2K9YA 4NPKA 2OMBA 4X6DE 1KBWA 4EYYQ 1H3TA 2CU9A 3ARRA 3IETA 4IMKA 4LARH 4X7DC 1FPTL 5IFAL 2M2DA 3CHOA 5DYOB 1QGKB 3TIEA 5BS0B 5FV2A 1J8HB 1OPGL 3FBKA 3HE6C 1RMFL 2MOQA 4NUJB 4F15C 2LU5A 3TBWB 2NY3B 4HH9B 1FLRH 2BOBA 1P5VA 3SKOB 5FM8A 1CF8H 4M6OL 1PP9D 4AM0A 3LIUA 3A6OA 4PBWD 5E08L 1T22A 3OQ3B 3IPBA 1TTBA 4YSQA 5C0AD 1M2VA 2F74B 1PD6A 3W0WB 1TJGL 3NYKA 4JO3H 1IE4A 2YS4A 3GKWL 1JIBA 5L2KB 1ZXGA 3QIWD 3IU3B 4X4YA 4NT6A 3WJMA 4PJ9B 4BH7B 1FFRA 2EDTA 4IKKA 1BZ9A 3GBEA 5IJCC 3DA0A 3PHSA 2YARA 3PGFH 5FA4A 2O01H 2KDYA 5IV2A 1BF8A 2FJUB 4XA4A 2ZPKL 5CGBA 3RTLA 3RY6C 4ZS7H 4OVUA 4NZ8A 4FLRA 1NU1G 2YD5A 2YPKB 1JPSL 3CK0L 5DHVH 4G82A 2EIZA 3BVXA 4HLJA 1S9KD 4KQ4H 4XVTH 3EOTH 2IBZG 5CGTA 2FHCA 1KY7A 1Q82Q 1IGIL 5FO7B 2HWZL 3BSZA 5E2VH