5AW7B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 11.3 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw7B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw7B02
3WGVB 5AW7B 5AW0B 1FOSF 4RETB 4EOTA 1JNMA 5AW9B 3V4WA 1GK6A 1SP4A 2Q7CA 2XZRA 3KDPB 2JJLA 3A2AA 5APTA 5AVWB 3VMYA 2KP8A 2W6AA 1FOSE 4KHXA 3M0AA 3TNUB 3HE5A 2QM7A 2Z5IA 1A02F 5AVRB 1CI6A 2XU6A 3L35A 3TK1A 3P8MC 1CI6B 5AVZB 3VMZA 2WWWA 3NFQA 4AYCA 3KQGA 3VTPC 3A7OA 2P2UA 3SWFA 2H7HA 3HE4A 3MGNA 1A02J 3LIDA 2C9NY 1HWTC 4XE5B 2QM8A 2Q5UA 2WPQA 2W27A 1CZQA 2R5DA 1MFZA 1KQLA 4I6MC 3MD0A 5AW5B 3V5BA 5AW4B 3VMXA 2WPSA 2WPRA 3A3YB 2WT7B 5APQA 5AW8B 2WT7A 1GU5A 1NWQA 2R3CA 4C7NB 1H8AA 2ZFCA 3TYYA 5AW3B 2E43A 2R5BA 5APVA 2P7JA 3NTNA 1JUNA 1CSBA 2IPPA 4M3LA 5APXA 5AVUB 2WTYA 4B86A 2XV5A 5AW2B 1OWAA 3V4QA 2Z5HA 5AW1B 3VN0A 3M06A 1NAFA 3A5TA 5APWA 5AVYB 1GK4A 3OAKA 3UIAA 1GD2E 1MUUA 1YYCA 3M91A 3HE5B 3M9HA 3L36A 5CMZA 1SLQA 1GU4A 3L37A 3P32A 4RESB 4I2LC 4DZOA 1GZLA 4HYTB 4LC1A 2YO2A 2R32A 5AW6B 5AVTB 3NXSA 2BASA 3TNUA 3HE4B 3I5CA 3M9BA 1IO4A 1J2JB 3O8ZA 3P7KA 1OXZA 3LIEA 5APYA 5APUA 4AUWA 5AVQB 2Q3IA 2ZXEB 2VRSA 1H89A 3HTKA 1S9KE 5APSA 2E42A 3T97A 1S9KD 2YO3A 4GT1A 1FAVA 3M0DA 4JYCA 4AQRD 1H88A 1HJBA 3VYIA 3WGUB 1G2CB 1GTWA 1T2KD 1MV8A 2N9BA 4GKGA 1X8YA 1T2KC 3IR9A 5AVVB 3B8EB 5AVXB 1HBWA 1HUCA 4C7NA 2YNYA 3NMDA 4JYBA 1DH3A 2C9LY 4C46A 5AVSB 2P67A
chains in the Genus database with same CATH superfamily
1BZEA 2R2CA 2X2YA 1ULVA 4R84A 3KR3L 4NUJA 4QHLA 3V8OA 4CSTA 4F9PC 3H1LJ 3D87B 4P4KA 5E0FA 3D9AL 1JDCA 5F7BA 1L9OA 4L8CA 1RLWA 2V2TB 1EC5A 1S7XB 4X6DF 3DETD 3QPQC 4M1CC 2IAND 3A2AA 3CJJA 1QYGL 4L2YA 4NZRH 2W9LA 4GW1A 4IJ3C 5IJVB 3BD4A 2X0UA 3N85H 4ODTL 1JHKL 2J1YA 3AAZA 2OJ1A 4N8VA 4LHQB 4JGJA 4OF8A 1T4KB 3Q2WA 2JEEA 4HFWA 1KCRH 1MLCB 3HG1B 5H94A 3H9SB 3H7BB 3VXNA 1MFMA 2ZUWA 4LLQB 5E2UH 4OCNC 2FWOB 1LD9A 1RUMH 3OKLA 2XA8L 4XAKD 4XPFL 1L4AA 1CF8H 3ARSA 3B6SB 1KCUH 4MRCA 1FZCB 5H2FE 4LGRB 4X4ME 5BV7L 4FHKA 1MRCH 1NFIA 4LKXB 4ODBD 3H1LE 4DP1X 3CX5D 1MFZA 4DP6X 3JWDL 5HHVL 5AW5B 1P6AB 1IM3D 2UYLA 4R4NC 3VMXA 1AQMA 5FDYA 4YNYA 3IMSA 1XTGB 2WQRA 3NIFF 4ONHB 2ZZUT 4Q0XL 5F9JA 4BQ8A 1XGUB 3DX6B 4KNTA 3IAQA 1T0MA 4XNUH 2X28A 1R5LA 4JFOA 1JF1B 3PJSA 3F3HA 2WSFJ 3ECBB 3P11H 1QSED 3DUSB 2FQDA 1DBBL 2UUDK 1EEZB 4E2OA 2M3BA 5JIKA 4RJTA 1VZGA 1S7SB 5DUPH 2VXTL 3WL9A 1AXSA 2BVTA 2O6CA 3UG3A 4UTAH 1GS6X 1NKZB 2BOBB 1HIMH 4RISL 5BUPA 2X6VA 3KPLB 3L5WB 4KFMA 2XN2A 4ZW3A 1SVCP 5GGSY 3L13A 3L3DA 4LLAA 1QSZA 1KELL 5DMKA 2GY5A 3FJTA 4KK9D 4AL8H 4F8OA 1RE4A 3QC5X 1OM9A 3HN8A 3MREB 5I0VA 1ACCA 4OLEA 1TJIL 3K6NA 1EAQA 2AJ3A 3FQRB 1MJJB 4QXUH 2YXFA 3RI5K 3W9DB 2J55A 1OGAB 3K4ZA 1JI1A 5C0IA 4F7TA 5I66B 5LCVL 2X88A 1USEA 3H42L 5EO0B 2VKWA 1QR1A 2O1JA 3W11C 2WXGA 4M3HA 2OMWB 5C0AE 4DZBA 4JG0L 2FEEI 3KM2A 1GJIA 1R75A 2V9QA 1JF1A 3PJSB 5CUSH 4D9RD 1PGOA 2RHEA 1GGIL 3F7PC 4K3DL 4KK5D 3LTVA 2CK2A 4J3OC 4OZFB 3FXIC 3V7MA 4YNYB 4N2KA 1JWMA 3TVMB 5HD8C 2D03L 4RMWA 2BFVL 3QHZL 2MFNA 4LT7A 3FT3B 2Y07H 4OI9A 2H2PD 1YEEH 5EU3A 3NDYE 1G6RL 3BD5A 1FAIL 2K0RA 4Y5YC 1QQDA 2NY2C 2Z4QB 1N6VA 4EOTA 4A2HA 1LP9F 2CCLA 3EFFK 2FWOA 2X9XA 2EXTA 3PU7A 1SFCC 1I9JL 3GSUB 4ORGA 2DQFB 2PO6D 1QLEL 2PCPA 4G8AC 4I5BB 4WU7B 4MA3A 1VQ9P 2ESVE 3CDZB 3G04B 4OLZL 2IDBA 1D9KA 2FO8A 1QR1B 4ZQKB 1NBZA 2L5GB 3MLZL 4N6JA 3Q5RA 5CHXA 1NWOA 3CFIC 3DI2B 3N43F 1UT1A 3T04D 5JPNA 1A02F 2HLEB 2WD0A 3CH1B 4RFOL 2BINA 2JTDA 3NAAH 2CMRH 2XZQL 2O4EA 3MJ9L 5C7XL 5JDSB 4HPYL 5TE7H 2W0FA 4I7ZB 1FL3B 4I18A 2O26U 5F0JB 1ZXQA 2ICES 4Y4HC 2IFMA 3SDCB 3WO4C 1D5IL 1PLCA 2PABA 4OZHF 2WQYC 4JZNB 2JJSC 3RBXA 1AXSB 5A7EA 2FQGA 1NFKA 4LSSH 4XMUA 4WIQA 3MLRH 4QRRB 5E6IC 3STZA 3L5JA 4RLDA 5A6IA 4FXKC 5I5RA 1FNHA 3C6SA 2FWUA 4OF3A 4PB9L 2CR0A 5ESVB 2HFGH 3MRJB 1DBML 2P7TA 5GJTL 1AHWC 3IRZA 3SQOH 3B4SA 4UB8H 1T0MB 2DQFA 4N6QA 3RY5A 5JHLH 4MMZC 1LXMA 4X6DE 5E5MA 4RWHA 1DBKH 4PJ7E 3L45A 3L6FA 5AB0A 1I9RL 3MRKB 1BOGA 3DTUB 3CCMP 3IS1X 4RDQG 4MD5A 3HW7A 3T0EA 5BW7A 3B2MA 2AXTH 2W1NA 3ULUC 2GFBB 1AZCA 1MCBA 2B15A 4YHIA 4ALAH 4CJ0A 1YZZA 3TSIA 5E2TL 2AXGB 2DLFL 2AEQH 4BFIA 4AGNA 1O7DC 2PO6C 1A9BB 4OCSH 4DO6A 3KPRB 2W07A 5J13B 3KZIH 4NO0A 2XDJA 3W68A 1XEDA 2C4FU 3VXNB 3U9UA 2R4RL 2VN5A 3AS2A 5HVGB 4LC1A 1RD6A 4ALAC 5I28A 1RZGB 4N85A 3O6LH 4JM4H 2P49B 1GMEA 3QE5A 4P5MA 4DGIH 1X6NA 3RK3D 1CD8A 4N6RA 1EZVX 4FQJH 2CM6A 2QHRH 1MW1A 5DA4A 5L2KA 3SOTA 4GAGH 1BZ9B 1DD4A 1BM3H 3ASWA 1ES0B 2ZOLA 3JWOC 4XGZA 4I48B 4XMPL 3G5YB 3Q6GH 3IVKB 1QI4A 3PV6A 4MJ2A 4WVRA 2ZVNB 1E5UI 3U1CA 1JB0J 1SFDA 3HRZB 2OK0H 4PWJA 3P3RA 5DYFA 1LWUA 4H1LA 1MV8A 1KGXA 3IM1A 1ZHKB 4RISH 3BEWA 3TV3H 2JQAA 4G43B 2OSWA 3GJEB 2X89D 3VD2A 4WV1C 5D1ZD 1ILSA 2MPAH 4HAFA 2BDNH 2YLKA 4XHJD 5TDNB 5DZOA 2WSFH 1MH5A 2E4TA 4GOEA 2P8MA 3BKYH 3JT0A 3WL9B 5IJBC 3RB5A 5J8OA 4NYLB 1DJYA 2E7MA 5DJ6A 3WE6A 5KLVD 1PD1A 2H8PB 1WCQA 3FN3A 4HUMB 2PPCA 3FQXB 1PGJA 3H42H 4UQEA 4F7MA 2XV3A 1U6AL 1KYOD 3Q8EA 4K2UL 4K35A 4RGOL 1BF8A 3OAZK 12E8L 4JY6A 2QGEA 5MP6H 1N0LB 1FJKA 1CXLA 1J8KA 4L1TA 1IFNA 2KUTA 4NDMB 1U58B 4FP8H 4D0CB 4X4XB 3ZYZA 1WBZA 2OYIA 3BISA 4AQEA 1T20B 2VJ8A 2V0AA 5EOQH 4HBCH 5F1NA 2BO0A 4LLMA 3U2IA 2FL5B 2PP7A 5I74B 1D5BA 3CFJA 4FFZH 1I1CA 5D2NC 1QATA 4LCIH 3SCMD 4PJXE 2X2HA 2QSTA 1BZDA 3V5BA 1T4KA 3H2QA 2IFGA 4LLWB 5GGTH 2B59B 1MW3A 1P1VA 2GEQA 2E76D 4N8VB 4P46A 1WEJL 3TO2A 2AK4D 1B4JL 1L0LE 3V0HA 5F96L 3TCXA 1OVZA 3PDGA 2E43A 4BUGA 3CZLA 4EN3C 1EPFA 2K78A 3PHSA 2AV1B 1YNKH 5KVFE 2XG5B 3EYSL 1A6TB 1U91A 4IMKC 3LIUA 2NDGA 5IR1B 2D7TL 1HWWA 2PP6A 1ADQL 4M6MH 1MIMH 4LXFA 4HPYH 4GOFA 1WPCA 1SM3H 2DQCL 5BPPA 5T1JA 4DVRL 1LP1B 4ZZKA 1RZIA 2BNRE 5DHVA 3LD8C 3KNBA 1YEIH 4IYKA 1L6XA 4XCNB 4WNJA 2ZYIA 1TOXA 1ID5I 4LVEA 4HZLB 2QTEA 1TR7A 3SGKA 4LDOB 4BSJA 3MIWA 3CQPA 1CXFA 4L37A 4A7PA 4AQ1B 5I73C 1UKSA 4QT5A 1M2VB 3I9GL 2XKMA 5DJAB 1K3ZA 1SQQD 1AKPA 1U8LB 1CE1L 4PBXA 5KVMC 2A6IB 3II1A 3P7KA 1BDYA 4AUWA 4DH2A 3KHQA 1U33A 2E8YA 4R8WL 1IJDB 5B4MD 5D5MB 3KYQA 6FABL 2KLRA 1MFNA 5EDSA 2WCPA 3I6GA 2X4NB 1MCOL 3IN6A 3SBPA 1Q0YH 3IGAA 2WY3B 4K73A 5C3TA 2HTLD 3KAAA 3K5SA 1HE8A 2A2QT 3X12A 1GTWA 3QFGA 4YQXH 4HZAA 3H56A 4JFHE 4R4LA 4TNVF 2WUCL 4GAYA 4UT6L 3TWYA 2FYNB 1MF2H 2PPDA 1N7SB 4GG8A 2B0SL 3T1FB 1NU1E 2WQUA 3MRQA 5DEFB 3JTSB 1PIFA 2J6WA 1WZ1L 1GAFL 2E56A 3VXMD 3SDYL 5HI3C 3VD1A 1FHGA 5JTWA 1G7MB 2CUMA 1Z3GH 3MMEB 3TZVB 3ZY7A 1KBPA 5AEAA 1X5XA 1BGYE 4YBLB 5I19H 1FC1A 3ASNB 1CGWA 1RXLA 3KPQA 2PYEA 4WGWB 3P0VH 2BSSA 4X9HA 2GBUA 2CHXA 1DVFD 3Q8CA 4ELMA 1MNUL 3T6VA 2FZ3A 3TX4A 2VC2L 3LZQA 4OM0H 4DK5A 4TM9A 5IOKA 4RFNC 2FGZA 3FOLB 3SD5A 4NQQA 4ZQTA 2K9FB 5JZ7C 2JB6A 4CC4A 1IEAA 4IBSA 3TPUA 1YY9C 4JPWH 4YHOH 2WPQA 2Q5UA 4P4KD 4HKZH 3O0RL 2P4AB 3KL5A 3ULVE 4HQQL 1W2BO 1EBAA 3I56P 4W6YB 5AW4B 5FKAB 1Z9OA 3V4VL 2FNWA 3UX9B 3OA7A 1SLXA 4Z7VB 2FBOJ 2WXHA 4XC1L 2M1KA 5CP7A 4MCNA 3OGCB 4E0RB 4P8QA 4PJ5E 5EUOE 1SF3A 2I1JA 3C09B 3MA9L 1ED3A 4PGZA 4U6VL 1QMUA 1D5ZB 1TYJA 4GG8B 4K5LA 2WZ0A 1SJMA 2F1BA 4KJWC 4S2SA 3D25B 4ZXBC 2IG2H 3D71A 1B3JA 5KTBA 1T5KA 4FLRA 3KPTA 5IHUL 4MS8C 4X9IA 4FCAA 4PJ8C 2WW8A 3VM5A 2LOEA 1M1XB 1WSST 4AM0Q 2GSIA 3ZYOA 5CCKH 2ATKA 2QZ5A 2OYIB 4AQEB 3NA9L 1GGBL 1QEWA 2NX5A 5I1GL 2BH0A 3HFMH 2DJSA 3BUPA 1BCCJ 2L7EA 4QEGA 1OE3A 2WIIA 1U8LA 4PJFE 1NIAA 4TV3A 1NAMB 2ITDB 5E00A 3QG6B 1BIIA 2HP4A 2FQFA 1EXIA 4UOJA 2L8AA 2OJZH 3D50A 1KTDB 3N1MC 4YDVB 3ZTNL 1XGYH 4FFYH 5IB4B 2UY7A 3AE3C 3IE9A 3TFKD 4DCKA 1SYSB 1HL5A 4UTCA 3RA7H 3U2SA 3EJZC 4MMXC 5LNDA 3T8VA 1OAXL 2FECL 2XWCA 3WTVA 1RJLB 1E28A 3ULVC 3SPHA 3DK2A 4O58L 1FDLL 3QUXA 4IU3A 2V5SA 2XG5A 4I3RH 4NHUB 4UZUA 3N40P 4R5XA 2XUWA 5IOPA 1V3KA 5DVMA 4OKDA 4J39A 5KAQG 3FUEA 4PG9A 1RJCA 3FF7A 4PCSA 4NPFX 3UYOD 2M3EA 1UJ3A 2FH6A 2V7HB 1V7MH 1LDPH 2NNCA 4CADB 1TZOA 4HAKA 4N87A 5BS0A 1MCOH 3LVTA 4K15A 4MQXD 3II2A 2FO4A 4W9ZA 3QAZB 4AQAA 1NUGA 3K6OA 4QRUB 1ACYH 5LBSH 2DWYA 1U93B 5TE7L 2OYLA 5C08E 3PWPE 5FGCB 4WY4A 4JFDD 1AJ7H 4UILL 1U36A 1SLWA 4P0DA 3AM8A 1TTGA 3RAJH 1VLXA 1AQKL 2FUQA 1BQHG 3T0EB 4H1LG 3OR7A 3B5HA 4NOFA 5DRZB 4GFXA 1A2YB 2JKSA 2IVFC 3L71E 2LHAA 2VZ1A 2WTRA 3BAYA 4ZFZB 5I6OA 3PHQB 2NZ9D 3CWBG 3V2QA 1H0DA 1U8CA 2W59A 1BWMA 2NY3C 4PJCF 1YBKA 1NAYA 1NC4A 1MCFA 3SGJA 1OP5K 2BHYA 3ARXA 4TVPD 1FZJB 1TQBC 3L73E 3DTDA 4JFFB 4EI5B 5D1XD 4CN6A 2DQUL 3BLBA 4PS4H 4R2GD 4X7CC 1OM3L 4KKRA 3VGAB 4AVIA 4G7RB 3TURA 2IPTH 1MJ7L 3MJ9A 3HUSA 2FX8H 3LB6D 4OFIA 1N73A 2QJKB 2OMYA 5DJYA 1OIPA 4X6EB 2FXOA 1B3IA 1MJ8L 1G43A 1XF4B 3ARDB 3PJLA 4Z7UE 5C2UB 2Y7QB 5DFAA 3MV8D 3L71J 4R7VA 2EDEA 3HC4H 4HGWA 3S2CA 5BO0D 2ZWLT 4Z7QE 4IMKA 2OTKE 1PZSA 4V1DD 5I6MA 2R2EB 3ELAT 3P3TA 1PPJG 2H3NB 2M83A 5DI8A 2NW3B 1F0LA 4DEUA 4ENED 5I8OL 3O4LA 3RP1A 2FUTA 1M42A 1DVFB 1H3TA 1BXXA 2I60H 3MYZA 5E1GA 3CPLB 2YMTA 4JCMA 5E8NB 5GIRA 4GAGL 4Z78B 5B38G 1VENA 3ATFA 1S7VA 4OJFH 5DO2D 1DUYA 2Z4QA 4QHPA 4PCKA 3WBDA 2P8PB 2ZUTA 5DJZB 2OR8A 3CFDB 5JORA 2OXGB 3GTNA 1D5RA 2GFBA 3CV5A 4JQXC 3SBRA 3WI9A 1NGMB 4X5QA 4MD5B 3FB8B 4G8EA 1NAML 4GBXD 4FQPA 1NIEA 2APTA 2BMKB 4KXAA 3UTPE 4NUMA 5DTFB 3WFCL 3SFDC 4NQUA 4NIYE 3SPVA 5GZNC 1K6QH 3BT2L 5C92A 1TTBA 2JXMA 3N7NA 5KN5B 1GGBH 1KB9J 4DO4A 3WIHH 1IZNB 4WWIA 3SOBH 4Y99B 1J9TA 1BCCD 3MV7A 4LOUD 4D0DB 1UHVA 3SB3A 3NGBB 4N9GB 2PCFB 3ATEA 4YL4A 3K0WA 4KKLD 2A9DA 2R29L 3JTBA 4KRMB 5LG1A 3TEYA 5D8JL 1A3LL 2FKWB 2DQHL 4RAUA 5DGQA 4JRYA 3MFFA 2Z6FA 1KTBA 4E9VA 3Q5OA 5EZJA 4V1DA 1BE3E 4AVKA 4R26H 4X6CA 5CEZH 3KHUA 3E6FA 5ALCL 5CCGA 3I75A 4EZKA 4PGBB 1EBPA 3PP4L 1RZ7H 3IFLL 1KB9E 2BOBA 2XDHA 4LCWA 1RPKA 2EKJA 3V8CA 1R9FA 1Q1JL 2JB5L 3P3SA 1OOWA 5GHWH 1HTLC 3DV6A 4HEPG 4C8XA 2WWKT 4ABWA 4QYAA 1T83A 3GS7A 3HPLA 5M7QA 5F6IB 1LEIB 1UYWL 3C5ZA 1YN6A 4NNYB 2QR0A 4IRSD 3RNKB 2AF2A 1MLBA 2R5BA 4PUBL 1IRAY 1F13A 4RBPK 3VXSB 4XXDB 3G5VA 4NKOA 1DEEA 5FGRA 3CCSP 4AC2A 1ZDSA 1G0XA 4PJAB 3QFDB 4PREA 2GG1A 1IM9D 4JMNA 4XC3H 1T6AA 4KQ4H 3P0GB 4NNPL 4EF3A 4L3EB 2QHRL 3WFBL 3IJ8A 5LNEA 3L4CA 4KI5D 2OR9L 2FB4H 1T0PB 4K7PX 4O5LL 3ZUNC 7FABL 4A1RA 4R4MA 5CMZA 3SCMB 3GT6A 3OKDB 4W4NA 1H9DA 4KAQL 2DIEA 1CI3M 3C6LB 5F9WC 4NQTA 4AUJA 3N3EA 1HXMA 5I9QC 2BLFA 2FO4B 3NZHL 5EEUA 1IL1A 2L4OA 1ORSB 4JN2B 3M8OH 5DUBB 1A3QA 4GW1B 4DPAX 4CU8A 3UTQB 5E23A 1SQXD 5G4OA 5KYWB 1NCJA 4OLUH 1G94A 2HN7B 5C0ND 3WKNA 1AGBA 2C1OB 4IRJC 2A6JA 5DRWA 4X6FA 4F37K 4AX3A 4BGDA 2ESVA 3GMPA 1S7XA 3Q1SH 2V7QJ 3MREA 3QYCA 2E9JA 3ARRA 4PJGA 5CZXD 1WQVT 1E27A 3RAJL 1YQVH 3CZUB 1L0XA 2JJSA 4DSYA 1AZNA 2GCYA 4YHKL 3ESPA 5I0WA 4PMFA 1RJLA 5A3IC 4X50A 1LK2A 1AIFB 1N10A 5TDPA 3FU9A 1F6FB 2YAOA 4B9ZA 4MFHA 1NMAH 5KW9H 2RBLA 5EOQL 2X0WA 3O81A 4HUVB 5EV7A 3L3IA 5ID1A 2Q86B 4MN4C 4N24A 3BWUF 4RGMC 1FVDB 1KILB 2CBTA 2WBJD 1W5CE 2PR4H 5E00B 3TLRA 1WK0A 2VDNB 3GM0A 3WEXB 1OAKH 2F1EA 2CK0H 5KEZA 3CLEH 3VA6A 4JFEE 2FBRA 3GBNL 2YBGA 1KB5H 2F2HA 3W0WA 4HUWA 4DUWA 3B6SA 2BCCJ 4JFXA 5CZRA 1SFCD 3VFNA 4MA1B 4JLRA 4R4BA 4M48L 2GSIB 1UACH 4EIBA 4MCYB 1Q0XH 3KPRD 1JXKA 3QFJA 2WLNA 1JF6A 2VMCA 1ZTMA 2PGDA 1VDFA 5IJVA 4KRLB 3JTTA 1B90A 2H89C 3NRFA 4ZBJA 1JZ4A 4O2EB 3SWKA 1U41A 1R5VB 4N68A 1T2QL 3HKZA 4OJFL 2VOTA 4ECNA 4IIQA 4Y5XA 1NTKD 1NUFA 5EU6E 1Q86Q 3VFGH 3VQ1C 2OSLB 1LQBC 2F08A 4U0QB 3O8XD 3ZDZE 2V2XB 1GZHC 1SN2A 1AAJA 1S8DB 2C3GA 5GS3A 5BVJA 4HJGB 2Z5HA 2DQHH 3E8VA 3M7OA 4L9LC 4TQEH 5KYYB 1E9QA 3IF1B 5B3JE 2WLJA 2C1PA 5DHVH 2X05A 3WFCH 3W11D 3WU2H 1U4FA 2WNXA 3GXMA 5HHPB 3RWIB 2WVSA 2GAZB 4YXDC 2Y9YA 3EYQD 5GQBA 5MHSE 5GRYA 1OVVA 1RE4C 4BCZA 4M7KH 5AL0A 4X98B 1N3NA 3GM8A 3MGTA 3HB3C 5IB2A 1SEQH 2X4SA 4QRPA 5I1IH 2YO2A 1UGKA 2BP5M 3HHSB 4UZSA 1MRFL 1D3CA 1L0LJ 5AVTB 3H3PH 5T33H 1WHOA 3H7LA 3ESNA 3T3MB 1WVZA 1QABA 3G3ZA 1LWHA 1WGVA 2GTWA 1ZV2A 3F64A 3KR3H 4WHTB 1GYUA 5GGTA 2YOAA 2F0CA 3O6KL 4PRBB 4N2NA 1EXGA 4RA3A 5FA4A 5FLUA 4QJ5B 1HJBA 5B38A 4FFZA 1OVUA 1QWHA 5DD0H 4AGLA 3WHXB 5KVDE 1L7TL 4GDOA 5IROA 5ABAA 2VDQH 1CFSB 2UXVA 3NBNA 4IU2B 4WFGE 1S5IH 2GSMB 1K3IA 5J4MA 1IAIM 4XMLL 1A14H 4MNGA 3WN5C 4WW2C 4RRPG 5CGYC 4OM0L 3K5BA 1KDIA 3OKOA 4GSUA 2VDLB 3GF8A 3NN8A 3QUYC 1KN7A 2IH9A 3P4OB 4FI8A 4OJDH 4QTHB 4A7TA 1NWPA 4YXKL 3MX0B 4N4YB 5EIVA 2E7HA 3FZUC 3TCLA 5JQ6H 4L1DA 2XZRA 2X70B 5E6ZA 2A9CA 5E9NA 4D9LH 5ADPL 3EFGA 2ZUVA 4HA1A 5F88B 2DF3A 2A77L 5F72S 3TNUB 3VB9A 2DWXA 1G87A 3FOMB 4L23A 3ZRSA 3II6A 1JPFA 2JE8A 2X7LA 1E5CA 3ZL1A 3QNXA 1G4MA 3VJ6B 4CVXA 1HQ4A 1XGTA 5L6YL 1NGXB 2K6WA 1OGAD 4KRPD 5G5DB 4HZLA 2Q3XA 3R7RA 1TFHA 2HPCB 3AG4B 4H1LH 4IBTA 4PJBB 1RCYA 3MLSH 2PAJA 1NU1J 2WKLA 2FX9H 2C9NY 3DGDA 4OLVH 1RE3C 1RV6X 1PKQB 4KT0J 1NH6A 1U8JA 2HB0A 3EH5B 1A9EB 2PWGA 1PCSA 2HX7A 4J27A 2I9LB 3H9ZA 1QNIA 4DOHB 3PAVA 3VRLE 4NUGH 3TFBA 1MQ8A 2RALA 3M1BB 3H1LG 1YEGL 2IV9A 3NSYA 3NUKA 3CWGA 3NA9H 1TJIH 1RMFH 1S7UB 3GXFA 3K8MA 4LKCB 3QYMA 3TCLB 3O8XB 5DUJA 4IOIB 1EA9C 1ZV8A 3VRLF 2JELL 5AW2B 2C0XA 3HZVA 1IGCH 3ATBA 2FIRT 3EGSA 5E08L 3VNZA 3VN0A 2IPTL 3GBNH 3T77B 2A9AA 4D8PA 2D4DA 2Q6WB 4X4YA 4LLWA 4JNXA 3PXJA 5APWA 2PXYD 1FZBA 3FO1B 1AQHA 2H26B 2KZWA 3P2DA 1HESA 4XX1G 2DM4A 5TPWH 1UA3A 1S5LE 2FL5A 2AEQL 2YQBA 4PRPD 4PV8B 3W0WB 5F1NB 2KL6A 4NGHH 5SWZA 3WNIA 4HU8A 4HKXB 4MDIA 4ZOBA 2AQTA 4CVZB 4XPAL 5KUKA 2YUWA 1SFCB 2VNCA 4L18A 2AK1L 3T4AA 3VH8G 1FVEB 2CGZA 4OLWH 3X1FA 5K9JH 2ARJB 1NFDB 2L7JA 1BBDH 1HAUA 2Y1ZA 1RIHH 4PGCA 2BJML 2GC7C 2YMXH 1CLYH 1T3FB 3TA3C 5CHNA 5HI5C 2HPOA 4L3AA 3DLQR 4XBEL 5FFOA 3C08H 4PRIA 1CFVL 2ED6A 5EIQA 5I76A 5JHDB 1J0HA 3U7WL 1YAZA 5AB1A 4BSVB 2PTVA 4CJ1A 5JA9A 1XH0A 2DYSB 2GJZB 2CO7A 3MRFB 3D85B 2H9GB 3BH9A 2IFFL 1A5FL 5IEKB 4N90D 2EUWA 1LDPL 1IJNA 4UIMA 2VXVL 3HD7A 1T5WB 5GRXG 3T2QA 3DMMC 3VFPA 2IC2A 1VEPA 3C12A 4YL9A 3HUSC 4XI5C 3JYCA 3RVWD 3KWXA 1E9QB 3IF1A 4YLCA 5LBSL 3ZHLA 2Q8BH 3BT2H 4HDIB 1FORH 2OKMA 3FFOA 3HS8A 5AAWA 3DTXB 4JJHA 3RG1C 3SKNB 2PW1A 1FH5L 1IBHA 4NPDA 3UAJD 5DWUL 5A40E 4HUUA 4EDWL 4AK2A 4GI9A 1EHKB 2WXRA 2K1AA 5AZ2L 1IGYB 3FB7A 4XX1E 5B1KA 4JFPA 2DTMH 3JTTB 4R9HA 5E0QA 1UXSB 3R2PA 4EXKA 3F6LA 5IMOB 4N6RB 1DUZB 3R8QA 4P5MB 2WSCJ 1B4LA 3HI1B 2VXUH 3DHPA 3IFNH 4PRHB 3T2LA 4C4BA 1SVBA 4HIQA 1J8HE 1Z6JT 2PTTB 3I02B 3QS3A 3U9UB 2G9KA 3ZOAA 3C6LD 3FRPA 3IMTA 3MO1B 2Y23A 1OARH 1UWEH 4JO4H 5E6RB 3ZHFA 2KMWA 3Q01A 3B2DC 2DMCA 4NO0D 2J6EL 1MAJA 4W9DC 3FT2B 2NUPA 4ZZFA 3D5OF 2EYRA 2CDEA 4K9EH 3RWGA 1N0XL 5B39A 4JM2D 5C09D 3MNWA 1UJ3C 5GGTL 5D6DC 3G6JB 1U3HB 3MUDC 5IW6B 4MBRA 2A74C 5BO1H 4NX0A 3QRGL 4FA6A 3UZVA 1NOLA 1L9RA 3AZUA 4P2QE 3HS0B 3EJQA 4GXVH 2X10A 3HRZC 3MLYH 4D3CL 3KMDA 4JM4L 3BWUC 4I18C 1SQQK 4Q58C 1TLKA 3V4QA 3C9NA 3H1IE 1PZ5B 1VQNP 2KS1B 4OD3H 3HMWL 1ETA1 5D7IA 1KIQB 1YO4A 2D7TH 4L1BA 4YDMA 5IEHB 4FNRA 1O6VA 2ADIB 4UTAA 3ZO0A 4J12A 4X6CB 5CS7A 3M9HA 1KPRA 1Z32X 2ZXCA 2CJTA 5DCCA 3PH0A 3AG2B 4HT1H 4PQXA 4V1DB 5T3XD 4JJOA 4NZFA 5EZJB 2BRRL 4A2EA 4X0KB 5E1IA 2X1WL 4PJGB 1J1XH 1MREH 2JKJA 3H0TB 5AALA 1EHAA 4UIKL 3MLUL 2LXCB 5E56A 2VM9A 1AH1A 1QFWH 3PWUB 3OB0H 4YDLB 1VFBA 2QPFA 1AS8A 4PTUA 4TF4A 4D6TG 1QD0A 4C55A 2HFFA 3L75J 4WK0B 2YAQA 3BAEL 4XCCL 4MCZB 4X8CA 1YITP 5FW6A 2DY2A 2JCCE 3I85A 5IBTL 4DIXA 1X5KA 2WBXA 1S9KD 2R0LL 1GL4B 4LPVA 2WBJA 4UB8E 2JK5A 5AYUL 5HGHB 3BP5B 2D3JA 4MQSB 1T2KD 4E9XA 3LW5H 5DWUH 3ZKSD 2VLJE 3MLWL 4LOUC 1C5BH 5FYLL 1EEQA 1JZ6A 1MCQA 2R0ZH 1HN1A 5D7KD 5MP6L 2AJUL 1NU1D 2PKDA 3QIWD 4JZJC 4G6AC 1ZLLA 2OQJA 4OCXH 2P67A 4H2CA 1MCRA 2AZAA 1NCGA 1UC6A 2P47B 3BO8A 3ISWA 4KVCL 3P77B 5HYQA 1BVZA 4JO2H 1FNSH 1QZ1A 3HC0B 4QRRE 1EZSA 2C9SA 3ZYIA 4JK0D 4YGVA 3ML8A 1D7DA 3L4XA 3VFTB 5ITBH 4UAHA 2DM7A 2IJ0C 1ZMYA 2BVQA 1Q7YQ 3V4UL 1W0YT 4BM7A 1JZ8A 4KHXA 1RU9H 2G3NA 3S96A 4H20H 3CWBE 3HE5A 4XZUB 2ATAA 2FFDA 1F42A 1W91A 1SQBJ 4CRPA 5FW8A 3ULSB 4PV1B 3WSQL 1NGQH 3LD8B 3KJ4C 1F4AA 1VQ8P 4ZOCA 1KB5L 3KL3A 3E6FB 4PG2A 3CX5K 4PP2B 2OTJP 2K9JB 1MHEB 1UD4A 2E9IA 3QUGA 1SHMA 2R69H 3NCJL 3AU1B 1UACL 1N73B 1VESA 1VZIA 4GT7A 4NEHB 5CSGA 5EZLB 4P3WA 1MFTA 1OF2A 2V2WB 1OGPA 3FB6A 1V3LA 2P5ED 4KRNA 5ETUA 5J12C 2VDKL 3MUZ1 5KSAC 3NN8B 1ZJBA 2VXQH 1E8YA 1KXTB 2IPKA 2XWJB 4AZ8B 1TTCA 2Z91B 3HMXL 5M95B 1E3ZA 4NKMA 1HGZA 2BC4A 3CDGA 5AW3B 1HOCA 3K71A 5E1AA 3AE7C 5CU5A 2R1WA 2FD6H 1KIPA 4NQSA 5JUEL 3CWBJ 4K3JH 3MV7B 1I8IA 3NPSC 5DUPL 4LIQE 3ROOB 1L4AC 5KANI 1IKNC 1AHMA 1VF5D 3MA9H 1YEDA 3W57A 4W9FC 3HNTH 4OZGB 2QIWA 2AXFB 3G9AB 4PJEF 2K6ZA 3ELQA 1QPXA 3V6OA 1N6QL 1NGYA 1JPEA 2PTUA 2Y7OA 1D5MA 5D1QC 2GITB 3IDMA 2PFXA 3NIGE 4JFDB 1F3DJ 2XVGA 1DCLA 2VDRB 3AMKA 4DKEH 1E8XA 5JW4Q 5L4FA 3FUFA 3QI9C 4IK6A 3TZVC 3NCWA 3HE6B 3VFMA 4HFWB 2DWSA 3CX5I 3LMJL 5ENWB 2H32B 2NXYD 1P84H 4NUQA 2OMVA 5C0CB 3AE1C 3EO9L 5D4HA 2Z4TA 2YD8A 3L95B 3D8MA 2AMGA 5MEND 5I1DB 1DBJH 3LSOB 1KTCA 4F24A 4JDEA 1XB8A 2D0FA 3SGKC 1MAMH 4LVNC 1YC7A 3VG9C 1O6TA 4U1KB 2DBLH 3QXWA 2R39A 2X4QB 4FFYL 2NX5D 1L7TH 2EXWD 2VJXA 4JG0H 1S1CX 2E74B 4WUUE 4N0UE 4AC4A 2AQRA 2KZ1B 3X17A 1M1JC 4XPGH 4IOFD 3ARBD 2KT6A 1WP6A 5I75B 4KO6A 2AP2A 1R5IB 4N8VG 3ZIYA 3TO4D 4WWPA 4G8GD 4LCCC 2B88A 1OP3H 1F11B 1BIIB 2BP0B 4X4MA 3EFOA 3VYNA 1KOAA 2GTQA 1NZRA 3GO1H 4HHWA 2AI0H 4JLRB 1Q90D 4L4TB 4A7QA 1YTZT 1E6JL 3VI3E 1M57B 2EYRB 3LEYL 1XVSA 2XVBA 3PWLA 5CILL 1RZJH 1XSIA 1A4AA 4AQOA 2HTKC 3BEVB 3ZTDC 4K94H 2R3SA 3HG1E 3NJKA 2RKLA 5I1KH 2WPVB 2Z64C 3H9HB 4UTBL 5D2NA 3PGDB 3EXJA 1NJ9B 1AJ7L 4UILH 4JCLA 4XNYL 4HPOL 1EAPA 1FVDA 1QA9A 4Z7NB 1F11A 1J1DB 2E3VA 4OCWL 2G5RA 3AXLB 4MXWH 4F9LA 1C16A 1D2PA 4CVUA 2QTVA 1UXSA 4PWKA 3BOVA 4Y2LA 3IT8D 4Q9CA 4JM2A 1OGTB 3UAFA 1YQ2A 5D7JC 1TJGL 3QH3A 1LTAC 1J9CT 1MCCA 4GB9A 4K7PH 2X4QA 5E95B 2Z65C 4Z7VA 5C0BA 2FX7L 3K81A 5DJ8B 2O5XL 2FEEL 3BKJL 1Y18B 4LEBA 4OB5H 1Q4NX 4PYGA 1L4AD 3KPOB 2BIIA 1HH9A 3BGFB 5EZOL 5TE6H 4PJ0H 5T8IA 2MNWA 1LTIC 3EF7A 2NZ2A 2AJZB 4N22A 3RFZB 4JBZA 4JGNA 5HGAA 1L9NA 3AREB 3WY1A 2OMVB 4UIMB 3RWCA 3SE4A 3WSQH 2BCMA 1KACB 4ZUTB 4L76A 2X9ZA 3BFWA 3UIAA 3BPLC 5L9DL 3L7EA 4BSVA 5TPWL 1PQZB 4LCYB 4G7YL 2GY7B 5CEZE 3FWNA 1D5MB 3N44F 2ZOOA 3AXLA 3G5ZA 1J8HA 2WV3A 3GS4A 3LS4H 5JZ7D 3ZMRA 1UB5B 4IBUA 1FVCA 4JM2F 2D3NA 2BASA 1KT2B 2C7FA 1JV5B 2W6BA 4QYOB 5HI4D 1F90L 1HKLH 2FYVA 1IAKB 5EORH 1JO5A 1HYRC 4XO8A 3BSZL 3JCUE 3MSPA 5E79H 4I85A 1HCVA 3OTTA 5GGRY 3U6XS 2PCYA 1SQMA 3QDGA 2XA8H 3IMVA 4XPFH 2HZHA 3WUTA 3RX9A 1X7SA 1MRDL 4XP1H 4B27A 1RI8A 3VXMB 1A5FH 4WW1B 3MOBL 3FFCD 4PRPA 3RVUD 2VDLL 4FQHA 4HIHA 1I8KA 3JZYA 1MKFA 1I7TA 3QUXD 4K55A 3BASA 4NQEB 3GPEA 5FK9B 4WGKA 3X14B 5FV2A 2DTSA 2P46B 5E51A 3RGVD 1DJZA 1W80A 1Z9SA 3FT0A 3JYBA 4HKBB 5H2FH 1XF3A 4PP2A 4WSJA 2GK0B 4MMZA 1BZQK 5EEXA 1TFPA 3R4DA 2VSMB 3H1HJ 3B83A 5CP7B 1YMHA 4Z77A 2O1AA 4GUQA 3LQMA 3OKKA 4OD1H 1HGVA 2RCSL 2XX1A 3C75A 3H1HG 2VL5B 1YUHB 4HSQA 4KTYA 4E5XB 4JRYB 4YZWA 3BVWA 2H6PA 2C3VA 4BINA 3ETBJ 3LH2L 3FSAA 1PEWA 1IQWL 1EHLH 3VFTA 4I4WB 3VFMB 2WZPD 1ODAA 2CBMA 4PJCE 4E41E 2CJUH 3AE8C 1HHKB 3O3BA 1IIKA 1KEML 1RUKL 4KMLB 2Z1KA 1G1JA 2YUZA 1WEJH 1CU4H 1KYDA 3MNZA 5C0FB 1I1YB 3GBLA 5BVPH 2QGBA 3LZFH 5MEPB 2V5TA 2YXWA 5I1CL 4JREB 5KVEL 2VAAB 1CFNB 1T22B 3JSVC 4M1GL 3HG2A 4Y88A 2OXGA 1IUZA 3H1KE 3CFDA 1DJSA 3THMH 5KBPA 1AD9B 4LRIC 4AE1A 3GB7B 1WFIA 4U05A 2GEEA 4HJSA 4KI5E 5T1KB 4H5SA 2HRHA 4PJIF 1CLZH 2SEBA 1E7UA 5CU9A 3OAKA 2EIZA 4L8BA 4GKNA 4OU3A 1P9MC 3QS2A 4L3ED 4LCVA 2JP3A 2O01H 1ZVYA 1S7TB 5T1KD 1GTFA 1V7NH 2G3AA 5BOZG 1E5WA 1U8OA 1YUKB 4U1IA 3BZEB 3ATAA 2JJWA 2E46A 2EO7A 5BRZE 4LCCA 5H2BA 3T3PE 1TCRA 3L74G 3EH2A 3MBXH 4IKLA 3T0BA 4GEJA 4AGPA 4G1MA 4Z7OF 5APSA 3SD2A 4BZ2H 4EKJA 2R2BB 4H26B 2X1PA 4X98A 1R6VA 1RURL 2BZCA 3Q43A 4KXCA 2JJTC 4KUCF 4HD9A 2A06G 3IJEB 4OQTA 1ZY9A 5IHWA 4HFUH 1DJXA 1SMDA 3OXRB 4G43A 5TH2B 1OAQH 2X4RA 1E43A 1JRHL 4JQIH 4UV4L 1XTCC 5ANHA 2WLKA 2ITAA 4ZFZA 3RL2B 4HS3B 1QBBA 3WMM0 1BWWA 1SY6H 2WWMC 3O9WD 1CGXA 2A4EA 4N28A 5FS5A 3SE8H 3AT0A 1D7CA 3PV6B 1QEXA 1YEFL 5HY9A 3JCUH 1UWEL 2X44D 4JO4L 4KROB 4RH4A 3U0TB 2AV1A 3W5NA 1Q72L 5GGVH 2F68X 3CFQA 2D03H 4XNMB 2K7QA 3LRGA 2Z92A 3HN3A 4XVJL 4YO0A 4FQ2L 1BVKB 3CSTA 4X6BA 4I87A 1DUZA 5H37H 4F7EB 3PRJA 1I7ZA 3TVMC 3GI9H 1C8QA 4JJ5A 4MDJB 2DLGA 2CLVB 4JFUA 2RB8A 3EHBB 3NZUA 3TT3H 4OI7A 2KHAA 4QOKD 2P45B 1UUSA 1CICA 3IGLA 1N2RB 2B89A 3MLYL 4EOWH 1QFOA 1NCWL 2VDQB 4F8TA 4BXLA 1DJWA 1SQXK 3VP8A 5E8EA 3JWOL 2D7OA 2WVVB 2W5PA 5CLWA 4EDXB 2NY4D 2XACC 2Y5QA 3CVHA 3LV3A 4U0RC 3RJQB 2NNXA 4JY6B 2IGFL 1AS7A 3S4SA 3QFJD 2MHAB 4WHYG 4HK3N 4C7NB 1CR9L 1CG9A 2N7BA 4B9KC 4PJ5D 4FFTA 1MREL 3VGGA 4F92B 1SQVJ 4ZUSA 1E30A 1EK3A 4I7ZC 1E9PB 1V7NL 4MQTB 3VI3F 2H6UA 3IU4L 3MKKA 4HK3J 4TQEL 4KKNA 4Y4HB 4F58L 1FV1B 3MV8B 5IHLB 2UZXA 1RLBA 5LDSA 4PWFA 3TXAA 1IO4C 2Y06H 2KIKA 1IC5H 3QJFB 3SKOB 5IQMA 3GMQA 3TEUA 4BKLA 3HAEB 2GBVA 3MUHL 5F3HB 3RZCC 4B6ZA 3L36A 1H3GA 2J12B 4LBAA 2FWLB 2Y6TE 3APMA 1THCA 3GLMA 4JHWL 4DZOA 4NP9A 1GZLA 4BH7B 2F6AA 2IH1B 3G6DL 1IEBA 3MO1A 2L91A 1CU4L 3IAGC 4WAFA 3BSHA 2E7LC 4LE8A 2VUYA 3X13B 3UG5A 1DVQA 5KW9L 3L5IA 4XMWA 1GPOH 1G5AA 2IV8A 4IOIA 3OXSA 2AGJH 1V54B 2JTYA 2PO6B 3FQ4A 3O8XA 2W81C 1BSHA 1TTUA 4M62L 4J5VA 4MA1C 4HWBA 5B1JC 3VU1A 4IBYA 3OGCA 4E0RA 3DDGA 3GSXA 4MD0A 1JV2B 1IBGH 4YHIB 3O6FB 1IGML 5DLLA 3APFA 4PJIE 4C46A 3IMUA 5AKTA 5FKAA 4F20A 1HHIB 1ZPUA 2D3VA 1A14L 5IVXB 4M6OH 2UWEE 3VI3B 1UQSB 4XNXL 1G1IA 3L6FB 3WLWD 2QA4P 1J9RA 1MLBB 2YBRA 5E4IA 1LMIA 2YMKA 2W0PA 5D70H 5B3NA 2VR9A 4OGYL 3HBZA 5F7FA 2CO7B 3MRFA 2JJLA 1I8UA 3NJJA 3CX5E 2J5UA 2WSCH 2BFGA 1ECZA 2AFNA 3GHGC 3ZVVA 5LKNA 4KK8C 3L4ZA 1G7PA 2Y72A 4QAWA 4W1TA 3JUYA 1KJVB 1JZGA 5PCYA 1CI5A 5CILH 3PXHA 4WI4A 4HV8B 2CWRA 4AJVA 4OZIE 3D0AA 1JGVL 3D2TA 3DHUA 4G7VL 1TJMA 2AXWA 2BERA 2P5WB 3L1GA 5JPMA 2DOCA 1OK0A 1H0TA 3ZHDA 4LCWD 4X8JB 2CGRH 2QT6A 4GW5B 2IBZG 1EO7A 1OO2A 1AR2A 4R4FH 1EFXD 2FDBP 5DO8A 3DPBA 2FGWL 4FG6D 2VYRE 3EBGA 3DX0A 4P06A 1P53A 1JAEA 4PWIA 4A6YL 5D7SL 5AOMA 5C2BH 4NN5B 5IBLC 3NCXA 2YRZA 3QCVH 2XPGA 3DX2A 5AW8B 3M0DC 1QTPA 3LH9A 5FUOL 1USQA 1GU5A 3ZE0F 3CX5J 4M7ZC 2NXYB 1MDTA 1INQA 3L75G 5HHOB 4NZRL 5I16B 3CFMA 4J3OH 3TO4C 1U6AH 2QSQA 3QNFA 3OV6A 2OTLP 1OQOA 4CDHA 1I8LA 2PPAA 4WHDA 3TDKA 3KS0J 3NTCH 3EO9H 4F2MB 5I82A 4G5ZH 3MV9E 2WTOA 2I5YH 4IBVA 3WCYA 2ZWZA 2NNAA 2D2CB 1HKFA 3R1GL 4WW2B 2IXQA 1NO4A 2AEPH 3U1QA 1W72A 2BNUA 4R4ND 4FDWA 4HC1A 3QUYB 4OVVA 5IB2B 1VF5B 1MRCL 3FUDA 4TLFA 1C5CL 1A6AA 2YD0A 3ZW3A 1UXWB 3S4RA 4XVJH 4TLKA 2OPCA 2P24B 1T04B 1RIHL 1S3RA 2HPCA 4XOBA 1UVQB 1WCBB 4G6FB 1M1SA 2E6PA 1IILE 5KSVA 3WUUA 2A6KA 1I4FB 3KPEA 1RUPH 1TTFA 1UOLA 4RRPA 3QNYA 3VJ6A 4YPCA 2G4EA 3FN0L 1VAHA 3TT3L 5BV7C 1PDKA 1LEGA 3OAYK 2VE6A 2E9BA 4ABUA 2J44A 1CQYA 1A22B 2DV6A 3MTXA 3PJNA 1MJJA 1SUHA 1BGYG 3CMOL 3IJSB 1ZV5A 2BNQA 4P4KB 4P5TD 4Y19E 5CIPB 6TAAA 5H4ZA 5DZPA 2WB7A 1AC0A 4M1CD 4KI5F 2YSTA 3PWPB 5JIPA 3UEQA 3W9EB 2VLRA 2I25N 2Y5TA 5AVXB 3D39E 3BXNB 1G7LB 1L0ND 4P2RD 3D4GA 4U1GC 3FCTB 5CKGA 3WS6C 2DICA 4DP7X 5J11C 1G9MC 4JFFA 2FJGB 2WINB 4YXHL 4CILA 5JXEA 1ZK9A 3V6BR 1H8LA 4DEPB 1MOEA 1W6WA 2P44B 4GAFB 4XC1H 1DSYA 3D12B 3SE9H 5HHXH 4KQ3L 3OKYA 3K46A 3GMNB 2JWDA 5AOJA 4JANA 1VGEL 1XR8B 4OD1L 2JKXA 4RX4D 4U7SA 3S5LA 5GGQH 1F1DA 2B77A 1P7QD 2V8LA 3TGXA 2XTJB 4O51B 2NSXA 3RU8H 1YNTB 6FABH 1N0LA 1JWSA 3LKSA 3NEXA 3HG4A 4UNTA 1G7QA 2YD1A 2YPLA 3QORB 1A6WL 3RX8A 4TUUA 4CN4A 3REVB 2J6EH 4M1DH 4J3OF 4UT7H 1IGMH 4PJ9D 3GTTA 4Z3EA 1I9RH 1LK2B 3B9DA 3FRUB 1A4BA 3KYKH 2ZWSA 3C8HA 3AREA 3FCTA 4ZJ9A 2EINB 4FS0A 1DEDA 3OPZL 4GBXA 4LLYA 4OKVB 1INDL 5BQ7A 1ZRTD 3CBRA 1EXUB 4MA7L 1LE5A 3LJ3A 3OR6A 4KDTA 4YDKL 3BVHA 2XFGB 3S48A 4RFNB 5HVHB 4KTGA 1X5HA 1LO2H 4KO7A 3OMNB 4LSTL 5IQNA 4KH2A 5DD6B 3RWHB 5K9JL 1SMAA 3NCYS 1EGJA 2BFVH 4YSSA 2CNZA 1VFOA 3O2VL 4BFFA 2WKGA 4NHCH 2VWEE 3UZEA 2PUQT 1M7LA 3NJVA 1X4ZA 5C09A 1P6FA 1PG7L 5I1HL 1S9YA 4KC3B 4NFCA 1H3UA 1A6UH 1DVZA 3N43B 1GU4A 1YEKL 4FC3E 4PJCB 4WI6A 4G80B 4PWGA 4TVPH 3LHPH 1KZYA 1T7YA 2BRRH 4J4PC 1MNNA 3HOGA 2IYOA 5B1AB 3I3EA 1SHWA 2D31A 5D2NE 1KQGB 3VXUD 2F53A 4FJZA 3C09C 5FX3A 5A2BA 1SS1A 3OJDB 2DN7A 3OKNA 3O8ZA 1JVKA 1BVLA 4BFIB 4P3DB 1F8TL 3K0YA 1QL1A 4IRZH 5HYJD 2E76B 1JMXA 4R0LC 1WF5A 3GJFH 3AXIA 4HIIA 4QHUB 1I1RA 1EZVG 2AKRA 4NI3A 1DQIA 2GSGB 2OZNA 4Q9RL 1P7HL 5LXGH 1KCVH 2YPKA 3LDBB 3VXSA 1RZPA 1FGNH 1WFJA 3PL6C 2QE7H 1J87A 2Q86A 4HGMA 2XYBA 2P26A 3BGAA 3D25A 4MJ4A 1IBFA 4L05A 4M56A 2Q1KA 1JZ7A 4YIQB 3QEQA 3ZTCC 1U3YA 2CU9A 1AZBA 1RHFA 1QKZH 4M7LT 4BZ1A 1PMYA 1TZ8A 2EIBA 5TJWK 5IBLD 4Y16C 2WHVA 4ZXBD 2OV0A 5INCA 5CCHD 3DX7A 4JG9A 4ZSOE 1ZR2A 5SWZE 3F7VB 3NA4A 3SDCA 3UIZA 4FXGA 2OZ4A 3US9A 1OAKL 5GZOA 5I2IB 1N64H 4LQFL 1KIRB 3MP7B 1ZLVK 4MMXB 3CH1A 4FJYA 3K2IA 1GCYA 3RGUA 2DLFH 1OCWL 5HPOA 4JHAH 4ELME 3L81A 1PZQA 3SN6N 5GZOD 2WQWA 5DUBA 8CGTA 4QRSB 2FJUB 4PBVC 2CPBA 2NY1B 2QKIB 4P59H 1OF0A 4AYCA 1TJHL 5JHMA 1CL7H 4EVNA 1KLUB 2BXZA 4NFDA 4F57L 5HJ3B 4LRNH 4Y5XC 3LAFA 3T4YB 4YDKH 5E8PB 2CJ3A 4U1LA 1DLHB 2XJLA 4F91B 1Q2NA 2ZSWB 3SPVB 1H6EA 1DJIA 1V3MA 2ZKHL 3CHPA 2DQJH 1ETB1 4HEPA 4YDLC 1SQVD 4PD4K 1ZHNB 5D7LE 2F54A 4U6YA 3V4PB 3QULB 1JPSL 4EYYQ 5FKPA 4RSYA 2VW4A 7PCYA 4YS4A 1F41A 1BBJA 1GKOA 5IWLA 4TUJB 3WMQA 1OXYA 2AZUA 4KGJA 1TVHA 5IV2B 1DUYB 1IFHL 1PD0A 3KCPB 4L74A 4U3FG 1PNCA 5D71L 1VCAA 2FBJL 5BU8B 3BKCL 1CYXA 3HG5A 3BLKA 5FM5M 43CAB 4GG6F 4GAYB 2NW3A 1NMBH 5HI3D 4MKMA 4DW2L 3HPLB 5K9QG 3AGWA 3N50A 5EU7E 1TSHA 4XMTA 3LQZA 5FFLA 5FYJH 2YXQB 1DANU 3G7TA 1X5YA 3MRNB 3M17A 3BYYA 1QFUH 3A0HE 2E5YA 1EIBA 1OP4A 1LO4H 3AE4C 2W83C 3QWRA 3S5YA 4F8QA 1X9VA 3EAKA 3TA3D 1ZOYC 4NN7C 4FQQA 3TPKA 1E5BA 1Z5YD 4YFLF 4XP9L 5DMKB 1LTSC 4PB0L 3ZKXC 1DQDH 3KYOA 4FEIA 4RAUB 4Y9EA 4YLQT 5E03A 3EDEA 5E9DE 3L9RA 2DM3A 4N0FA 2E42A 1TZGL 4LSTH 1TEFA 2MSPA 1LT1A 1F5WA 4LK4A 1BGYD 4F15C 1EDLA 1YRKA 4BFGA 3QORD 2N9BA 2Y1VA 1R5WA 4M6ML 3VQMA 1HCYA 3L54A 1T7ZA 1F6LL 4ODXA 15C8H 1KYOH 5C3IA 2YRPA 4C7NA 3A22A 3CFBB 3PP4H 3TBVA 1DHKA 4IJ3B 4S1SH 5GSRA 4ONHA 5CBEA 3PREA 5LJYH 1RIVH 4ICXA 5E8DH 1AO7E 4L8DA 4N0CD 5F6HJ 3NH7L 1RULH 1JZFA 2ZXBA 4KVNL 4MJ6B 2YARA 4IBLT 2V17L 1DQJB 2VTFA 1E6JH 1X7TA 5M1BA 2Z7ZA 4GUPB 1BQHB 3INUH 4MJ5A 3WNNA 5F1OB 3I9PA 2O3JA 1LWRA 3NSFA 4L4VA 1IAIH 5AYQA 4NHCL 3M0AA 3WMPA 4G59C 4UQ3B 1JFHA 1KYOE 4Z78A 4ADJA 4MDJA 4QKXB 3SDAB 1F56A 1KGWA 1DVFA 1UIXA 2JMRA 3JUZA 4IBQA 4ZPTA 5EFIA 3D39B 4Y5VC 4NENA 3PWPD 1UWYA 3NIGB 4JFDE 3SKUD 4PM1A 4OLVL 2Z8VC 3BN9C 4CAGA 2WLIB 3LKRA 4AYEC 2FEDD 4ZW7A 2QADC 4IS6B 1DN0B 2H3KA 3NGBC 4KJQC 3QI9B 5DEZA 1EANA 5GGSA 4XPTL 3CCHB 4ZOAA 3UABA 1YEJH 1L9PA 1SMOA 2N56A 1NAKL 5SWQB 3P9LA 4MS8D 3O3DA 1O75A 2G75B 2B4CL 5DJYB 1AR1D 3RHWK 4DEWA 4PI0A 3RUGB 2XXGA 1WV7T 4KPHH 1C5DA 3C5SB 2R9HD 3MA7A 2W9DH 4HCIA 5CCGC 5F7KC 1KYOJ 1GGTA 1KTDA 1I1AB 2V7NA 2B20A 1BOYA 4HJ0C 3STLB 1TSRA 5TFSH 2X38A 5D8JH 1T80A 3FK3A 1NEZG 2PP9A 5ISZA 3RWGB 2D73A 4FQQB 3KPSD 2XQYK 4G7YH 2FATL 4UNUA 4NGHL 5GISH 1NDGB 4FKHA 1KQFB 1VQKP 5KVDH 3M17B 5EIIA 4FHJA 4NNPH 3EG9B 4F1SA 2J59M 4C56B 1XXDC 4FQXA 4BA8A 3U9PH 5EORL 2X9YA 1SDDB 4NM8H 4IFDK 2PPEA 1RUPL 3DBSA 4A6YA 3LW5J 2EVGA 3S3JA 1XD0A 4JQVA 2WLLA 1FYTA 1KGCD 5F7NC 4ETQB 1UM6H 3IKCA 4AQRD 1AVAA 1MQKH 2QQNH 2NY2B 2BW5A 1RVFL 2PW1B 4Y4FC 1FA4A 1BBJB 4MLSA 1DQJA 2HX9A 1RUAL 2JKTM 1DVTA 3E1RA 4ZS7H 1W72L 1RZJL 1JL8A 4Z7OB 2WTPA 3RTQB 3BVVA 1BOGB 4M93B 3WU2E 2V9UA 3RDJA 1OE1A 3V5KA 1OW6A 1I7UB 25C8L 3IETB 3QCUH 3V5HA 4FFVC 1KILE 1LNUA 4NM4H 1YECH 1KLUA 1GS8A 1KILD 3WD5L 2EDJA 4GSQA 5DZJA 2NQCA 3OMAB 3ASOB 4PD4I 2XQYG 4JFQA 1WAEA 1NGPL 3VFGL 4HWUA 4GRLD 4LSSL 5CIPH 3WO4B 5IEHA 2EIDA 1KLFB 1U3ZA 1KC5L 2MIZA 1PY4A 3FHAA 4Y1AE 2H6PB 1JN6B 4GYBA 1KXVC 1K05A 1E4KA 2MOVA 1EH9A 5ADOH 3GSQB 5B4MC 1XAUA 3MBEC 2Q6QA 1EDHA 5D1XE 4CVZA 2ICWI 2RJMA 3F6IA 2LW3A 5CJOH 4HALA 2YN5A 1A02J 4X6CE 5IJKC 4GRMB 3CCUP 3HAEH 3J8F7 5I26A 7CGTA 1N5YH 2ZKYA 1NBZB 3BZDA 3JV0A 3CVDA 4ZQKA 5C07E 5J1TC 3S34L 4CGUB 1OTUC 3BC9A 3X14A 5D1ZA 4OCSL 4JDTL 3ARFB 3HNSH 2Z31D 3IDIA 5DF0A 3V9CA 1ODUA 4FQHB 1UOKA 1A25A 1W15A 1F4WL 4P2QB 5IY5B 4WUUB 1DSFH 1ZRTE 2GSGA 3MBED 5I17A 4LKCA 2PWHA 4GXUN 2ZOKB 4LGPB 2K9YA 3O2DH 1HC1A 1XO8A 4CC0A 4DGIL 1UD8A 2WGXA 5IQ9A 1LO2L 1NUDA 4M3KB 4N20A 4P4RA 4EQ2A 1CE6A 1UZ6F 2HKFH 2VXSL 4P3DA 3K72A 4KZCA 5DJXB 4NBZB 5AB9A 1G9EA 1TQWA 4JMXA 1K5WA 4YHZH 2CO1A 4OZIF 3FCUB 1A7OH 1YYMH 1UZ8B 4JBSA 5C0CE 5I1JH 1XZ0A 4KMQA 1A6ZB 3VX0A 5ERWB 4WFFD 3EYUH 4N1EA 2NXZC 1ZAGA 4DCQB 1IGTB 1J8HB 1S4XA 3VXSE 4PW3A 1MRDH 1PLAA 1ZSDB 1RZKC 4W4OC 7PAZA 2G5BA 3QG7H 3U46B 5L4JA 3GXPA 3QUXC 3JWNC 4NZUH 2BSEA 4AYID 4S1RH 2YD2A 5HYJE 4XCCH 3FOMA 2J21A 4MJIA 1AGDB 3O41A 2A1WH 3ISYA 1A1MB 2Z7YA 2NY4B 3A0BE 2CMRL 2W90A 1MCLA 1U8KB 1HAWA 4EBQL 5IT2H 5ALBH 3FSOA 2COQA 4LVHC 3CU1A 4JO1H 4UOQA 4H13B 3S3SA 3C5JB 4LESA 4KY1H 4ODUA 5F71A 2KUBA 2BSRB 4LHJB 2WYIA 2QMKA 5CGYD 5D7HA 4TNWF 3KYMA 1R24A 3KXFA 3VDAA 4UQBA 1GW4A 2C34A 2XC8A 4YSQA 1QVFO 1XR9B 2JO1A 3F85A 3Q2NA 4WVZA 1E7VA 3D6ZA 4Z8FL 1TZHA 4XHJC 1VFAA 2OTWA 4KPHL 1NTZK 1XF5B 5CBOA 4LLMB 3QORA 3QHTC 4B9CA 3V2RA 5IVOA 4X5RA 4BFRA 1PP9G 3GXNA 2AJYH 2X41A 2FEDC 5T33L 4I0KA 2NW2A 2UYLB 4KWUA 4H20L 2B1AH 3LIZA 1FIGL 5EIIB 1IQDA 1XDTT 2EEAA 2J4WH 3GI9L 1P7BA 4PJ8A 4WHTA 5DD5L 4H44D 1KTLA 4PW4A 2ICWA 4BSWA 3CXHK 3QEUA 5GHWL 4QKTA 3UAAA 2F53E 3RL0D 2YA1A 5EOCH 4F7PB 4NQXB 4A37A 4L8SA 4PV9B 5E2UL 2OP4L 2J25A 3ZT5A 4DP0X 2VDMH 3DOHA 5IW3A 2BVYA 4U4IA 1JHLL 2MRYA 1HQRB 4PRDA 4XPAH 1R0AL 4I6MC 1K6QL 1JOIA 4U7JA 5TDNA 1R5IA 4QXVA 4QIRA 1NOAA 4NO2A 1Z9NA 1F4XL 2AMUA 2C1PB 3VXRE 1RZIB 5L6YH 3Q3GB 1NTKK 4YX2L 4ABVA 2CUAA 2J58A 5F1IA 2K3RA 1SEBB 2A83A 1LP9E 1BQLL 1OW8A 2BNQB 4PRNA 2R56H 1DP0A 4AL8C 4DCQA 1ONQA 1P5UA 2ICWJ 4FZEL 4WNQA 1NBQA 2F58L 2V5MA 4D9LL 4LSUL 1K4DA 1DE4B 4YLBA 1FI8C 3MROB 4N2OA 3UYRL 3V0AC 3N55A 1M7IB 4IRZL 2A45H 2GQHA 3DHMA 3QNZB 3EFDH 1FQ9C 4BXSV 4LLDB 4ZX3A 1BSIA 5EBWB 4JRXA 1L0QA 2I27N 1NVOA 4LSQH 5DZAA 2PRRA 3AABA 3DVGA 2MNJB 1D5BB 1NGWA 4WY4D 4JFDA 4KKQA 2Z8WC 4K8RL 5AAMC 5A7BA 5KZCD 1BSNA 1XSJA 2EDKA 1BQHA 3H1ID 2Y0SA 4HIJA 4F2MA 5IBUB 4NKIL 5C0AD 9PCYA 3DIFA 1UXLA 1EZUA 1YHPA 1U7JA 1GPOL 1J0YA 1DBJL 1E50A 4MSWA 3WEXA 4YAQA 3SDYH 4IOSD 4L8DB 5GZND 2BNRD 3HA0A 3X1GA 1B9KA 4XVUC 1VADB 3IYLW 5C9KA 4U1HB 3ZDXF 4GUCA 3RIFF 2CRZA 3JV5A 4WCYH 3BIKA 4PJDA 1MELA 1ZS8A 1V27A 4JHUA 3ILPA 2PNDA 3UBXG 3OVUB 2R1WB 1N64L 3LPPA 1NM4A 5BRZD 3OHXC 1Q1JH 1I1FA 1CD1B 1X5IA 1U0QA 4NKMB 3OF6D 1X5GA 4TVSa 3FW6A 3S34H 1NDMA 4FNSA 1P84I 1DH3A 4MQ7B 2IPKB 2XWJA 2W8CA 2VRKA 3D0VB 3QWRD 2VDRH 5B8CA 1BECA 2N7AA 5D1XC 1TJHH 5K59F 2G4GA 3DI3B 3PWJA 1LTJB 1NBVH 2CM5A 4LB8A 5DFTA 5FCSH 2Q7CA 1H0TB 3EJYD 4IRJD 5DK0A 4TSCH 3EZJB 1FBMA 4LPWA 4UM9B 1URLA 3NCMA 2CZNA 3RGVB 2ZKHH 4QF1A 4YDZA 5KVGE 2OGUA 5H35A 1BVOA 4V2CB 1TZIA 5IFAH 4P23C 1Y1DA 5KYXA 1MVYA 1UH3A 1RJYB 3PABA 1QVOB 4OZGF 1E4WL 5BJTB 2YA0A 3P8MC 1P2CB 2CO6B 3BAWA 2HCZX 1TNNA 3INOA 4ZTPL 3ESUF 1IBBA 4Q2ZA 4AGOA 1XIWB 2LR4A 2ZXQA 4LGDE 3IDXH 5ITFB 1X5AA 1OL0A 1YJDC 5ESQB 5BZWB 2EIJB 4W9KC 2JDIH 3HE7A 4YSEA 5I0XA 2WUBL 4PJFB 1ZVHA 5LAXA 5FYJE 3SYQA 2VISA 5L8JB 3T0AA 3QUZC 2Z93A 4FX5A 4NB7A 5KAIH 4LLVB 5C0EB 2WQ8A 3DVNA 3UJTL 2PR4L 3WY3A 2HJFB 1I82A 1O7VA 2OYIC 5F0MB 2GBAA 1BP3B 4UT9L 2F54E 4K8RH 1DQTA 2EACA 2IQ9H 4MX7B 5BJTA 5BMFH 3EJRA 1UA6L 3ARED 4MB3A 1QVOA 4Z7VF 1BLNB 3IDNB 3OLGA 3C6SB 4HSAC 4HETA 3G9RA 5HHNA 5T3ZH 3SPGA 2AQPA 4IKKA 5L0QB 2B9BA 4OCXL 5CFHA 1Y0LB 3LZFL 1GGIH 1NFDE 4RESB 1JPST 1SDAB 4NQCA 4OZHE 1SNRA 2J20A 2YKLH 1HILB 2FQEA 1ZLUK 2DLEA 5AW6B 4BV1A 4LARL 4S0SD 1TKWB 4ZPVB 3I5CA 3BP6B 4HHAB 1CTOA 2V33A 3LRLA 3DUUA 4GG6A 1YEEL 2WKOF 2RN0A 3V0EA 2ZXEB 1UOWA 2IZ0A 2A9MH 4I9XA 1YVLA 1QFHA 4O9HL 3T2NH 4WWOA 1HL8A 5HDBB 2XKNA 3T71A 5CP3H 4X99B 1G6VK 1I85A 4JYCA 4PR5B 4R90H 2KSEA 5DZNA 3ECBA 1N7ML 1LWUC 3BQUD 3SDDA 2BK8A 3CDZA 1DDTA 2PCPB 5C0BD 2YUVA 3GSUA 5EOTA 1YJDH 4PJ0E 3ZO9A 3D69A 3AEAC 3FH8A 1KXQE 3VB8A 3V4VB 3OWEA 1HUCA 2G3MA 3VTAA 1XH3A 5IW6A 5GS1C 4B9IA 4NUPA 3TBYA 5BUAA 4JYBA 1GY2A 2BMKA 1PZBA 5ICYA 4LLVA 4E9SA 3VXPA 1SYVA 4BRYA 1WUZA 1Q0EA 2PF6A 3OZKA 5CLYA 1BQSA 3B9AA 1BCCE 4YHLL 4EI6A 3E3QC 1CFQA 2NXYC 5DJZA 4L4TE 2LLGA 4EUPH 3ZSTA 2E6QA 2ZX5A 3QT2A 3PGCB 3ARGB 1P69B 2H2SD 2YUXA 4GXFA 5ITFA 1OSYA 3GUTB 2BHFA 1HHGA 4EIUA 3CFEB 4XPHH 3JV4B 4GEIA 3SQBA 2K6YA 3IN2A 1F2QA 1M7XA 4JDVB 3VU2A 4NCC1 1NFAA 3T0EC 4PJ8D 1P2CA 3ZDXB 5CN2A 5E5RB 2EDQA 2XIBA 2LV4A 2R29A 5HDWA 1QTSA 5EHFA 1E3FA 5AKRA 4ERSL 5E6SB 5GS0D 3H9YA 3O11B 5HY9B 3W9DA 1HYSC 3VSTA 5HJDA 3NIGF 3L9EA 1TQBB 4N78D 4UB0H 5C07D 4ZS6D 2B9AA 4ELKB 4TTDC 1YDPA 1E3XA 5CWSB 4AWJC 3CN3A 3ARBA 3GSVA 1SQXG 4R2GC 1G2CA 2P9RA 3RE0A 3LPGA 1UB6A 3D0VA 3NJMA 3KBPA 3MACH 2A6DA 1EEYB 1ACZA 3KL0A 3DMMD 3P9MA 1P4UA 2A9NL 3D85A 4AUYA 1MAML 3L3OA 5IGXH 1GZQB 5L2JA 2ZUYA 4HUXB 4JUTA 2XN9A 1RF1A 3CUPA 5DS8A 1P7QA 1VPCA 2BNRB 4XMLH 1RPQA 2KK7A 3GIVA 4JO8A 2ZNXA 2EDHA 2R59A 3HMXH 1A2YA 5EF1A 1YEIL 4LSPH 2CBOA 2IGFH 1VADA 4OZGE 5I0ZA 2MTPA 3R0NA 1JWSB 3LXBA 3H4HA 1YYML 1I8AA 1WFUA 5K69A 5J11B 4KI1A 2YQGA 4I88A 4WY4B 1UA7A 3S98A 4B9FA 5KZCB 5GRJH 3GFUA 2H41A 5DJDB 4RMQA 2OYHA 5KYUB 2CPUA 3MRLB 5FC9A 2CR6A 5I8KH 2DMGA 4ZUVB 4P5TA 3NXSA 3ULVF 4OUUB 2BW4A 1U30A 5H94B 1MLCA 3PRZA 1YECL 5C70A 4PJXB 1NTZD 1BX2B 1FC2D 4LLDA 1FZFA 4Z7WB 3J27A 3NK4A 1ZR4A 4HCRL 1DX7A 3ARPA 3MR9A 3RURA 4K3JL 4KXZI 1SQBE 1AJYA 1KLGB 2NY1D 4KKBD 3LQAL 2P1JA 3MGOA 3UBXA 4OM1H 2OS7A 3LZOA 2WANA 3OLIA 2F5AH 2NUTA 1WC7A 1N7LA 2YNYA 1E28B 4HS3A 3PIQB 1CS6A 2CHWA 4N2FA 4MWFA 2MOQA 4Z0XB 1A7NL 3EJPA 3FSWA 1CGUA 4JHVA 3S35H 1NCCL 3A0HH 1NH4A 3FHEA 3VG9B 3L4TA 5DUMH 2E27L 4PJBA 2BIPA 4PRDB 1FN4A 1ZVSA 2CKBB 2PXYC 4YXWH 4LHUB 1XGPA 3P0VL 1IJ9A 2DMHA 4PN6A 3VTTA 5KBLA 1R33A 4UUJA 5DYOB 4K9EL 3HRNA 4JFEB 2IXQB 5I75C 4UQCA 3RWEB 3EBAA 1QEWB 4LCCB 3EYSH 5H2BB 2RFXA 4GRWE 3WLBB 1OWRM 4Z7UB 5K9OA 1AGCA 2A9NH 2XVLA 5EZPA 4ODSH 1E2ZA 3KLSA 3QUMH 4OD2A 2WN3A 4R96A 2YFOA 1BEYL 2HXAA 3BLPX 3LN9A 1EV2E 2IOOA 2YSSB 3O0RH 4YHZL 4L8BB 4OFPA 5J1AA 3Q48A 3ZE2F 4LCUB 5IHZB 3TJHD 3PPEA 2Y22A 3U36B 3NFPA 1ZHLA 2VDOB 1SXNA 5AVUB 1IK9A 5LGJA 4MZ3A 1ZHBB 4UYPA 3SDXA 3UAJA 3QUKA 3Q5PA 1J05A 2V3EA 3C6LC 3K80A 2ZP9A 3SQRA 1OQXA 3BVDB 2AHIA 1JY2O 2FCBA 3L2NA 1JN6A 4LOEA 4J3WA 4UTBH 1K8DA 3ZMNA 4E41A 3AWGA 3D51A 2HFTA 3SKMA 5JW3L 4EVNB 2NZIA 3P02A 1G7PB 3F5HA 1AE6L 3P4MA 5DT1H 5CBAB 3GKWL 5CSZA 4E5XG 3BP7A 3U0WL 3V55A 3E3QE 2R4SH 3BGFC 2W0LA 3MJ6A 1N67A 3DXAD 5EA0L 4WJG3 3GK8L 1SQPG 5F9DC 3CIAA 3OKEA 3CXDH 2I24N 4ZO7A 1GAFH 3RVWC 2AVFA 1XGQA 1K8IA 1TEYA 2YD5A 4GT1A 3KPOA 5BU5A 3B5ND 3OAWA 4R26L 5GGRB 3MMEA 2EO9A 2K45A 4ILDA 3TZVA 5JXAL 2X3AA 4WKXA 2JCCF 1AHWB 1X8YA 5D1QA 1UG9A 1A6VH 1O7DE 3ZBMA 2Q10A 4JEGB 3QJHB 3IK2A 3MV11 3DYMA 2ZOKA 1ZK5A 2XTJD 4QNPF 4YIQA 5AOZA 3U36A 1OAUH 3ULUE 2VUOA 3TTSA 4IDJL 4N9OB 5LGYA 3UTPD 1ACXA 4M6AA 2Q3EA 2AERT 3OX8B 1YN7B 2OP4H 4P59L 3VVWA 4XBPA 2OSYA 4XWGH 1NCBL 1KJ3H 3Q5TA 5TJHA 3EG9A 3ABLB 5L4IA 4QRAA 5AAMA 3LS4L 2IQAA 2YFNA 3ATDA 3CCQP 2FNBA 2KP8A 3CC5A 2IH1A 1FBIL 2WMPA 5CMAB 3FO2B 4EN3D 4ZMPA 4JFEA 3CZFA 2R1YB 1KN2L 3QIUA 3W1ZA 4L4VD 1ML0A 2W65B 5F3HA 5ISZB 5DRXA 1N8ZB 2HLFD 3PXLA 1JS4A 5EB9A 2EVIA 2EE0A 5DMJB 1CW5A 1SF5A 1BE3D 4IMLB 3K6DA 2ENYA 2CO3A 3L4VA 3M86A 3EOBB 3L3IB 5J57B 4JFTA 1FL5B 1N9PA 1MZZA 2YPLE 3P30H 3NZHH 4MJJA 4M8UA 4QI3A 3F6JA 4W9HC 3B9EA 5CEXB 1CICD 2JWYA 1P84E 2IWEA 3S0PA 3S35X 5KJ7C 3C8KB 1F1GA 2YD7A 3HS9A 2Q7YB 3B71A 4JDZA 4PGEB 3R8BB 1ZT1B 1PZDA 4D94A 1VA9A 5AZEH 3MVSA 5F7WC 4G6FD 2WUBH 5CD3A 1INEL 2M8XA 3IFOB 1N6QH 2XZCL 4ZFOB 3KXFE 3Q44A 1L0LD 3QDMB 4EAEA 2P7JA 3OAUL 3IDGB 4CBZA 4L3CA 1GOFA 4XCYA 2DQTL 3GHEL 3CPWO 5T1MA 1F86A 1MRFH 4HHGA 3QUYD 3HFML 4Z7VE 4ZNEA 1KLGA 1B4TA 4P2QD 5HYEA 1QFWI 3GSNH 3QQ4B 3W0WE 4PRID 3GEFA 1XGRB 2CBPA 4GT0A 3GKWH 5BXFB 3ULUL 1NAFA 3TO2B 3D05A 4MMYB 1NFDF 3FRUA 5KYWA 4KJYB 1URZA 2BX5A 3A67H 5LQBL 2GIYA 3QFJE 4UQ3A 4MNQE 1QASA 3MV8E 1OT2A 3JC22 1BFVL 1Z1WA 5B3JF 1B2WL 4AW4A 4G8IB 1FZKA 1P84J 1WRFA 5JHLL 3TM6A 4YXLL 3RBSA 5IROD 2N1KA 4JZOB 3D08A 3O9WA 4YO0B 4HW6A 4K7FA 1LTBC 5I74C 2ICEA 1IFJA 2B39A 3KPSB 2ZOUA 4WI0B 2IADB 3H1HE 2ROXA 5H8DA 1JGDB 1RIVL 4AYFA 3QUMA 4CMMA 3RL2A 3BAIA 2FJFB 1LK3H 1PKQE 2CBQA 4WEUD 1FLRL 3GMLB 3MFGB 3OMZA 3CNKA 4L4TA 1WJ3A 3INUL 2DW5A 2LU3A 1SLUA 3FONB 1KF9B 4J3OD 4XXDA 1JI2A 3STLA 2MQCA 2QADB 3EJUA 5MI0B 4AT6A 5C9JA 1WMKA 3H9SD 1BXUA 2AANA 3BXNA 1R47A 2EEXA 2ZWNA 3C5SA 3KYOB 3MA7B 4KJQD 4LDLB 3FFCA 3N42F 5C08D 3BUYA 1OT1A 1IMHC 1UEYA 3MLSL 5DR5H 3B8SA 1J18A 3HRZA 5LBGA 4XNYH 4HFUL 3V6ZA 4CKQA 5I6LA 3DWTA 3FT1A 4H25A 4U1KA 3O11A 1I1AC 1BFSA 3MUY1 5IM7B 3K6SB 4WY7H 3CG8A 3AITA 5ISZD 5HHQB 5ILTL 3V4PL 4IEFA 1PX3A 3A23A 4PYHA 1OE2A 3QO0A 3QW9A 4Y9BA 3DGGB 3TBSB 1NLDL 4KKPA 4OZHB 4ZI8A 5EF2A 3TBCA 1J86A 1N68A 3FQNA 3VTPC 5JNYB 1B2YA 2P2UA 1H5BC 4YGVB 1RZ7L 3IFLH 4N9GA 2AXHA 3C8VA 3KEDA 3VFSA 4M8RA 1GYCA 2EH8H 4PTTA 4I1NB 1RJZA 1A7QH 3ZDYB 5JLZA 1MWAH 3HHRB 4XP6H 1ZDQA 1NGYB 2I32A 2YPVH 3CXDL 4LEOA 5DZ9A 2VMDA 3VQLA 5I18H 1NWQA 5EMYA 1OCWH 3H1JD 4P2YA 5SWSB 3PG2A 2V3FA 3QXDA 4JDTH 5KVDL 1S9VB 1Y6KR 1XBDA 5I16A 5HJ3A 4LL9A 3QDMD 4F1ZA 4AEHH 3L3GA 4JVUA 4Y4FB 4N2AA 3MLTB 3H1JG 2MH4A 1WZLA 4XNQB 1WZMA 3PQYB 4POYA 1KN2H 4YBLC 4QRBA 1EUTA 1EJ6A 1OAYH 2OW7A 3IJYA 3WUZA 3EYOA 5GS1A 2WNGA 35C8H 4RWYL 3FH7A 3HUJB 4A55A 3HKFA 1JK8A 3P11L 3TA3B 3H0TA 1SN5A 4JL2A 5AG9A 1AG6A 3K6SA 2GHWB 1XXFC 2R32A 1X5ZA 2VR8A 5D71H 2BM3A 3OKKB 4NO5A 2HT2D 2R2HA 3D39D 4FG4A 1IGJA 4O2CA 1QLEH 1C1EL 5LBVA 3B2UD 3PFUA 4MNQA 4QHNB 3K3QA 2E8ZA 1DJGA 3QZWB 3UG4A 3QEQB 1TNMA 1DO6A 4U6TA 4EBQH 1X5FA 2WSEJ 4NM4L 4HJJL 4OB5L 4IIZA 5FUZH 1RK1B 4AYBA 4YK4C 3RZCB 4CDGC 2DIAA 3NAAL 4YQXL 1PLGH 4A7VA 2VLJD 3QHFH 3NFSH 1HVXA 2R29H 1ADWA 1T3JA 3L3GB 4Y4FA 4Y7MA 4KY1L 5F7DA 3WNJA 3WNLA 3DIDA 3LEXB 4Y1AD 1IC5L 2CDEB 2PMZA 1VJSA 4AGMA 5HD8D 3FT3A 3QXDB 3BO8B 3FBKA 3IFNL 4JQVC 4TL5A 4XP9H 4Y8DC 4ZT1A 5LAXB 2P10A 1LGVA 1MVFA 4ZAKA 5JHBA 1Z3GL 2Q0ZX 4LNRB 3EGXB 2DQTH 3GHEH 2ZPKL 2X2UA 1G4RA 2X4OB 3WDHA 1NOFA 3G6AA 4LSRH 4XN7A 1J5IA 4EUPA 2CKNA 1UB5A 5IQ7L 4JZOA 1UT2A 1VACB 5MENA 5IVNA 3LRHA 4W7YA 5EC1B 1J0KA 1CN4A 4FN0A 2CRMA 1IZKA 3L35A 1AHKA 2A4ZA 4OV5A 1N6UA 4FLSA 2WWWA 4UB6H 2XY2A 3O6QB 4GI8A 3H53A 4KV5E 4DN4H 5LUMA 3SKNA 4HJGH 3U59A 3J2PA 2BWDA 3V0FA 3UH8A 3EUUA 4BJLA 5IMMA 2AK1H 4XVSL 1NC2D 1BCIA 5CP3A 5JMRA 4N0YL 3L70J 1YEWA 4V33A 1D2OA 1VSCA 4KJPC 1HF9A 4P2RA 5B8CB 4HLZG 1F3DH 2H7WA 4B9GA 2ZG1A 4HG4K 2X3CA 2ADJA 5DR5L 1DQQA 1RZFH 2VB5A 3EFFA 3TYGH 2CGRL 1AD0B 4G8FB 4G5AA 2J1KA 5ECJE 1LP9B 3AB0C 5I15L 1JD9A 1ZW0A 3G3LA 1SYSA 3MJ7B 4H13C 2ZXWB 4IDLA 5D7SH 1WFTA 3FONA 1OWAA 2NPLX 4AYMC 4MZ2A 3APCA 3MCKB 4O9BA 4YFLI 1PAMA 2JI1A 3GBML 5HTSA 2WAQA 4E9RA 3AY4C 3WN5A 1MUUA 5FECB 3N1GC 1SLQA 1BVNT 1KTKE 4LU5L 1A47A 4J8QA 4EJ1C 3GSOA 3NG5A 4M7ZB 4X5PA 3MLPA 3VGEA 4K3HA 3WUWG 4GRWH 5JW3H 4P2OD 4YHML 1OAJA 4R7XA 4UINL 3UPAA 5F3FA 5TD4A 1N5AA 1TTRA 1GCFA 4BFEA 3MAWA 2M8RA 1OAQL 2I07B 4NO3A 4RX4A 5GGVY 1M05B 1QUNB 1FAVA 2RD0A 2F18A 3LKQA 3GUFA 4QJ3B 3O6LL 1S7UA 1A4KA 5DUML 1XL4A 2NDFA 4HIEB 4XN2A 4HUUB 2B1HH 2VQ1A 3B3IA 5DWPA 2GJRA 4EI5C 3IE4A 3AWEA 3EIFA 35C8L 2H1XA 1ZE3H 2ZXXA 4TUOB 3VGAC 5GJSH 3NEEA 4G8GE 4I3RL 5DC2A 3T6XA 1MFCL 1T89C 3QNYB 4WGVB 1RAMA 1T89A 1PP9D 4OKVA 1U8HB 4IGBB 3DJRA 3O3AB 1EO8L 5BV7B 2VDRL 3K2UH 1PJ9A 3L75E 3VFOB 1E4HA 1SQBD 1NM9A 2ZUQC 3A6OA 1IAIL 4MBOA 2YEZB 1A9VA 3IDYB 1HNGA 1T6WA 5FDWA 4APQB 4N2MA 4WHYH 4YDIH 4ONGL 1YJ9P 2EYTB 1G9MH 5HYJB 1NC4D 4I1RA 1SJVA 5T1LB 3VH8B 1PG7W 3VW3H 3I3BA 2YZ8A 3BCCE 5TISE 1XD1A 3VVVA 3O2VH 3RILA 4ODHH 5CHNB 2ICWB 4O58H 1TF4A 1U92A 3A0BH 1V10A 5EBGA 4U1GB 3QIBC 2GW5A 2P5EA 1RPUA 4Z76B 4R7NA 4ZG1A 1ZTXL 1AZZC 2JSFA 4Z23A 3BZ4A 3AEFC 1PL3A 4UV4H 4OFVA 3W39B 2OJEB 3WS3A 1CZQA 5F97E 1SXZA 1GL2A 2WNKA 1WHPA 4NPYA 4WDIB 1AGFB 4XBGA 1QFWM 3A3YB 2X12A 4FD0A 3MRQB 4H5SB 1MAKA 4M6NL 3VDCA 5DZLA 1XTMA 3KXFD 2H1PH 4Y89A 1UGNA 3TYYA 1C08A 5BS0D 2VH5H 4M1DL 2YMYA 4GRLA 2UXGA 3L72E 2IDSA 3FAWA 3TEXA 1UATA 2IWGA 4H0IA 2WXPA 1D6VL 2ENSA 3W9EA 4BH8B 5AWNH 1RF1C 2CDFA 2OR7A 3L4UA 3G6DH 3C87A 3O4OC 2GTWB 5FUCE 1ZOXA 1KY6A 1NSNH 1PX8A 1RFDH 3T8MA 4KHTL 1GD2E 2DBJA 3HFFA 3P9WB 5CJXC 1KJVA 1UA6H 4PJ9B 5K33A 2C9AA 5D72H 3VYOA 2WXIA 3KS0H 4XFJA 2CHDA 4Z3HA 2QG4A 2TRHA 5HVWA 4ZS6C 2NYYD 3NJFA 4D9QD 4LBEB 4HF5H 3VMPA 1LTJC 4L37B 5B7FA 4H8PA 4J6RL 1FN4B 3UO8B 4LAJH 2P24A 4G9DB 5GGUB 3S9OA 1GIGL 1CLYL 2C3VB 2EDRA 2IWFA 4GW4B 3UTZA 2A9ML 4O9HH 4UOZA 5DHVB 1CDUA 1BBDL 2D7PA 5E4AA 1MVUA 3VRJA 2E74C 5CLTA 3ZRFC 1M1JB 3OM3B 4HH9B 3P54A 2OMZB 2Q5BA 1M6OA 2KS0A 5FB8B 4UM8A 1NLBH 4JHAL 4PVNA 4H8WL 4IIQB 3HZYA 3PL6A 4R90L 1P5VB 2VR5A 5DD3L 5HYSA 3ZL4H 5KBKA 1G9NH 5EH1A 2XBTA 4MNGE 3TBWA 4HIHB 4KJWD 8FABB 3BPCA 4LAQL 1E4WH 5G4NA 5IHZA 1JZEA 2OA9A 5AUMA 2E76C 4R0LB 3IWUA 1UH4A 2KQMA 4FQIH 4FYSA 5GTIH 1DBBH 5GS0H