1JUNA

Nmr study of c-jun homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
43
structure length
43
Chain Sequence
CGGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High resolution NMR solution structure of the leucine zipper domain of the c-Jun homodimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords C-JUN HOMODIMER
total genus 19
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1junA00
1GZLA 3NXSA 2C9NY 2Q3IA 1GTWA 3HE4B 2E43A 2WPRA 1CI6B 2XU6A 4C46A 3L35A 3O8ZA 2XV5A 4I6MC 4KHXA 5AW2B 2R5DA 1NAFA 2Z5IA 1H8AA 1JNMA 4GKGA 5AW5B 4AQRD 2P67A 5AW4B 5AVWB 1MFZA 2ZXEB 5AVZB 2Q5UA 5AW8B 4M3LA 2WTYA 1CZQA 4EOTA 3TNUB 1OWAA 2R32A 3B8EB 5AW7B 3HE5A 3M0AA 2P7JA 3VYIA 2YO2A 2WT7B 3T97A 2E42A 5AVUB 2C9LY 1HUCA 3NTNA 1OXZA 3L36A 1FOSF 3UIAA 1JUNA 3VMYA 5AVRB 2Z5HA 2WT7A 3NFQA 1CI6A 2W6AA 5CMZA 3HE5B 4RESB 5AVSB 3LIEA 3A7OA 3M0DA 1S9KE 1KQLA 1YYCA 3KDPB 1T2KD 3MD0A 1T2KC 4B86A 3V5BA 2YO3A 1A02J 1SP4A 3VTPC 2QM8A 2WPQA 3TYYA 5AVXB 5AW0B 2H7HA 5AW3B 5AW1B 3V4QA 1SLQA 3LIDA 2IPPA 3P7KA 1MV8A 2VRSA 4JYBA 3HE4A 5APXA 4AYCA 3L37A 1CSBA 5AVTB 3TNUA 3MGNA 1FAVA 2YNYA 3A2AA 2R3CA 1GU5A 1H88A 3OAKA 1H89A 3A5TA 1HJBA 2WPSA 5APVA 3A3YB 1G2CB 5APYA 3VMZA 1DH3A 3P32A 1X8YA 3IR9A 2R5BA 5AW6B 1J2JB 2XZRA 2QM7A 3TK1A 3HTKA 2ZFCA 2P2UA 5AW9B 3V4WA 1S9KD 1A02F 1NWQA 4AUWA 3I5CA 4XE5B 3M06A 1HWTC 4C7NB 2KP8A 4GT1A 5AVYB 5APTA 4JYCA 5AVVB 1GK4A 5APUA 1FOSE 4HYTB 3SWFA 3KQGA 3M9BA 1HBWA 1MUUA 3VN0A 3NMDA 1GU4A 2BASA 5APWA 1IO4A 2W27A 5APQA 4C7NA 2WWWA 2JJLA 4DZOA 5AVQB 3M91A 1GD2E 2Q7CA 4LC1A 2N9BA 4I2LC 1GK6A 3P8MC 3M9HA 5APSA 3VMXA
chains in the Genus database with same CATH superfamily
3WMM0 3NXSA 1PPJG 2Y0DA 2A45I 2Q3IA 1IC2A 2CPBA 2V7QH 3HE4B 4ASVA 3H1JJ 1CI6B 1NTZK 4PD4H 4PJ0E 4C7RA 2GUVA 2NPSB 2RN0A 4PD4I 1NAYA 1IFNA 4NPDA 3MZWB 1SQBJ 2E76B 1OFCX 4I6MC 1HGZA 4KHXA 2FXOA 4GKGA 3TGUE 2NPSC 1GW3A 5AW5B 4AQRD 1RF0C 2GM4A 3CD6P 2Y0CA 1RH5B 1KMIZ 2E76C 2KZJA 1K04A 3JCUH 1VQ5P 2I1JA 3CX5H 4IOIH 5AW8B 1ZW0A 4WY4B 5CJ4A 1JTHA 1QEXA 1YQ3C 1IFIA 5BU8B 4EOTA 1YITP 2BCCJ 2KNCB 5AW7B 3BCCD 1J1DC 2WQYC 3P8CE 3RK2B 4DCKA 3CCMP 1ZR2A 2FYUE 1KYOD 1QLED 3H1IE 2WT7B 4U7JA 2PGDA 4BRYB 4EDFA 1LT1A 4PD4E 2O3JA 1LJ2A 2W6BA 2E42A 1PGQA 1KN7A 1NTZE 3CWBG 3H1KD 1ZN5A 5CCGA 2B87B 1S5LE 2OYHB 4H13B 1FBMA 2ZVNB 5CCGC 1BGYD 2FYNB 2Z5HA 3FWNA 3L74J 4N3YB 3GHGB 3HD7A 3RL0B 1VQOP 1NTMJ 1ZP0C 1X0TA 2E74D 1FJKA 2O01N 1RE3A 1S9KE 4GIFA 1T2KD 2ZT9B 1NU1K 1L0LE 3PHLA 3MD0A 1IFPA 4W7YA 1EDLA 1A02J 4GDOA 1S2EA 5EFWB 3IFMA 1PP9E 3SFDC 3L71E 1EQ7A 3TYYA 3H1JE 4N6JA 5TJHA 2HPCB 2A45H 4HB1A 1KV4A 1SVFA 1NOHA 1QX8A 2N1TB 5AW3B 1M1KQ 5KAFE 1YJWP 2K9JA 2HFED 2RH0A 1SQPE 1U57A 1MV8A 3L72E 4HKZH 2IZ1A 3AEBC 5APXA 4N78E 3L37A 1Q81Q 1JCDA 1Q2NA 3AE7C 4OGQC 5AVTB 1AA0A 1OIPA 1UIXA 3MGNA 3TNUA 4DJGA 1YQ4C 3BCCG 5KAFH 2IFMA 2BEZF 3K5BA 1HH0A 1JY3O 3FWLA 1VL2A 3JCUE 1PFIA 3H1HD 2YXRB 2WSSH 2H43A 5H2FH 4D6TD 1BE3J 2JDIH 1SQVD 1VDFA 2KS1A 2E76D 3B71A 1WT6A 2IFNA 3EQ2A 3L74E 2LXBA 2WPSA 3N4XA 3A3YB 1VQKP 3H32B 5APYA 2NPSD 1BSHA 1NTME 4KT0J 1EC5A 2Z4EA 1HVVA 1FZCC 3AE6C 5GTIH 4Y28J 3CLQA 1R8EA 1QVGO 1SFCC 1X8YA 1USEA 3ABVC 5AW6B 5KLVJ 1S5LH 1K9MQ 2ZFCA 2P2UA 2J59M 3L75E 2FYUK 5AW9B 1FZGA 1EZVE 3W68A 1SFCD 1VQ7P 1JEKA 1A02F 2KSEA 3CCQP 2K3RA 3LW5H 1OVUA 1BSNA 2C0XA 4C7NB 4GT1A 1KB9D 5AVYB 4JYCA 2O1KA 4QMAA 4XA4A 3GW6A 1LNQA 4PV1C 2N1TD 2J5UA 1NJIQ 1KILC 1PP9J 2FKWB 2B9BA 1KFNA 1RF0A 1HBWA 1MUUA 1KC8Q 3GHGC 2C0WA 2M5AA 3H32A 1EDIA 1GL2B 2BASA 3L70J 4PV1B 3RL0C 1LWUB 1NTKD 1NTKJ 1RY3A 2NZ2A 2YIUC 2A45G 5APQA 1VQ6P 1LTGC 1IJDB 1JCCA 2JJLA 1NGMB 1JY2O 1S4XA 4IFMA 3TSIA 4I2LC 3N7NA 1JMBA 2N9YB 2AXCA 3FGAD 2YIUB 4JPZB 3AEAC 3H1HG 5APSA 1GZLA 5TISH 1GMJA 1NO4A 2KSJA 2P1JA 2CPSA 5M1BA 4YXWH 1LWUA 1URQC 2E43A 2K9YA 1SQXK 2OARA 2WPRA 4NPFX 2XU6A 1S1CX 1BE3E 2IBZE 3H1IG 4C46A 1IFMA 4ZKPA 3L35A 2QEXP 1FC2C 5KLVD 1OVVA 2JP3A 2KK7A 5AW2B 3SWYA 5KLVE 1H8AA 1SQPJ 2KUBA 3L72J 2E5TA 1FDIA 1JNMA 2P67A 1G1IA 1JMMA 2QVAA 2WSCH 1MFTA 1J1DB 4OGQD 1NTKG 4H13D 4WY4D 2E74C 4UB8E 4R4LA 3H25A 1FDOA 2AXTH 3H1LG 1CZQA 1SQVJ 3EFFK 1HJ0A 1OWAA 3USSA 1YHQP 2YKPA 3R2PA 1PL5A 3A0HE 5CJ0A 3HD7B 3GHGA 1IZNB 3VOPA 1NKZB 1LTAC 1OX3A 1NTKE 2A06G 5KKZC 1H0TA 2D2CD 1NTKK 3RK2D 2HODA 1FE6A 1SQBG 1KFMA 4OH8B 1SQVK 1PV3A 3CMEP 3BVHA 2ZYAA 4XFJA 3VMYA 2KOGA 1KYOH 4BRYA 1JY3N 3L70E 4ZNCA 5KLVG 3NFQA 2WT7A 1BDCA 1VPCA 3L75J 5AVSB 2ZVOB 2KNCA 2XKMA 3CX5E 3G6EP 1HF9A 1EZVD 1N8RQ 3D71A 1M57D 2OYIB 4WY4A 3L75D 1WRGA 1NH4A 2M8RA 2GA1A 1N7SA 1XTGB 2KIKA 3Q2YA 2YO3A 1N7SC 2OGUA 5KLVK 1EXJA 2B89A 1KILB 3AE1C 3CXHH 3TGUJ 3JC22 1OVRA 2N1TA 3BRTB 3TDKA 4NPEA 5AW0B 1NTMD 2ZYGA 3AEEC 3WU2E 1QVFO 3G4SP 3I55P 1U7JA 4OGQB 3L74D 4ASWA 5KJ7C 2E75B 2AEMA 1SLQA 1SQVE 2P10A 3B5NB 2BCCE 2VRSA 3LIDA 4H44C 4IL6H 5CCHC 1DD4A 2G3AA 3D6ZA 2I8DA 3H1HE 3HE4A 4AYCA 3CCVP 2WSCJ 3RK3C 1M1JB 1SQBK 3OJAB 1FAVA 4HH2A 2R3CA 1JY2N 1URQB 3KYQA 1GU5A 1FU1A 1Y47A 1ZXGA 2H8PD 3OAKA 1J1EC 3B4SA 4N78D 2M3BA 1LT9A 1NVOA 3E7KA 5DJUB 3L73G 5H2FE 2BCCD 1HJBA 1SQPD 3IAOA 1X79B 2OQQA 3L72D 1G1JA 1L0NK 1G2CB 1N73A 3F89A 3V2NA 3VMZA 3TGUG 2FYUG 1HGVA 3C9IA 4RJTA 3OW2O 1YI2P 5KLIB 1P84I 3L71D 1PP9D 4K3AA 5C39A 2E75D 2CK3H 1BDDA 1KZUB 2IBZG 1M7LA 2B88A 2K1AA 4Z1MH 3AE2C 1Z56A 1LT9B 3TK1A 2QM7A 2BCCG 1L4AB 3ZDMA 1TU3F 3L4FA 3L71J 1HTLC 1URQA 3CX5D 3G3ZA 3SSUA 1Q86Q 2RKLA 1M1JA 4XE5B 2Y9ZA 3L70D 4JBZA 2LXCB 4W7ZA 5APTA 3Q1MA 3Q5SA 2KLVA 3CCSP 4Y99B 5AVVB 1LTIC 3RBXA 3B5NA 5KAIE 3U59A 2K37A 2SPZA 3SWFA 3KQGA 4HJGH 2AXTE 1DEBA 1Q90D 3A0BE 3NMDA 2HR3A 3A0BH 5APWA 3KPEA 4PD4D 1IO4A 3V2QA 1NYHA 2W27A 3VP9A 2FYUD 2WWWA 5KAIH 2ZT9C 3M91A 1AJYA 1KILA 2WMMA 1BGYG 3WUTA 3SWKA 3H1HJ 2FXMA 1GK6A 1N7SB 3KHUA 3P8MC 1SQPK 3VMXA 5CBOA 1ZR4A 2OYIA 2C9NY 1PZQA 1L0NJ 3II6A 1GTWA 1AQ5A 1L0LG 1SS1A 2E5YA 1IFJA 3SFEC 2FXPA 2K88A 1ZOYC 3H1KG 2W8ZA 3TGUD 5B66E 1CW5A 1RE3C 5BU5A 2E75C 3CC2P 2QJYB 1PP9G 4EI2A 1N73B 2YMYA 3KZIE 2R5DA 1NAFA 3HUSA 2IBZD 1BE3D 3AE8C 2IZ0A 3TF5A 2KB7P 1RF1B 1SQQK 3I56P 1YIJP 1M1JC 4UB6E 3Q5RA 2BEQD 4U3FG 2YKQA 5AVWB 1SQXG 2FYZA 5AW4B 3CCUP 3Q5PA 1KD1Q 2HPCA 1N73C 2WSEH 1GW4A 1N2DC 1RHZB 1VF5C 3AE4C 3G9RA 3KZIH 2FY8A 2Y9YA 1K05A 4M3LA 5DJTB 5KKZB 1DX7A 3AEGC 1KTMA 4H0LD 1ZV8A 1SQQE 2R32A 3B8EB 1L4AD 3GLMA 4RKUJ 3HE5A 1AV1A 1FZAA 1VF5B 3M0AA 3VYIA 2YO2A 2O01H 1KB9H 1PPJD 3T97A 2QRXA 4R4MA 4H44D 2Y0EA 2C9LY 2V4HA 2QJKC 3EWKA 4IL6E 2HLOA 1W2BO 3H1KJ 3NTNA 1GDTA 3L36A 1OW8A 2NRGA 3VMAA 1FOSF 1T6AA 3H6PA 5AVRB 1KB9E 2OYIC 3CC4P 2IDBA 2UWJE 3GG2A 1KQFB 2W6AA 4LGDE 5CMZA 4YXDC 3A7OA 3M0DA 3CI9A 1VF5D 1XTCC 1YYCA 3BCCJ 4RO0A 5CBNA 4GOFA 1SQVG 2ZAEB 3GMAA 2QE7H 2XNXA 3CL3D 3V5BA 1SP4A 3AECC 4YPCA 1JY2P 3VTPC 2W90A 1RE4C 3E1IA 3CPWO 3H1LD 2Q1KA 4YTPC 2WPQA 1BCCG 2IYOA 1GL2C 1IK9A 3B5ND 1W2EA 1ZRTD 1LTJC 1GL2A 2MJZA 4TT3H 2HODB 4IFDK 2OYOA 1QL1A 3PRJA 1WMKA 5AW1B 3RK3B 2WSFH 4WB4A 1H0TB 1OW6A 1PGJA 4L74A 5B66H 1KQSO 4D6TE 4H0LB 4JYBA 2QIWA 1J1EB 3QH9A 4W80A 2YMKA 4H0LC 2POHA 4EYYQ 2XDJA 1X22A 1EZVI 1H89A 3KXDA 1SQQJ 4UB8H 4WY4C 3A5TA 2QJYC 2OTJP 3PJSK 1VQPP 2RMZA 5KLIC 1DEEG 1P84D 3MTUE 1RF1C 1LTTC 1FJPA 4U3FJ 3H1JD 3AE9C 2FFDA 1U7MA 1PGPA 1DH3A 2D2CB 2QJPC 2WZ7A 5GTHH 5K5GB 3P32A 1YJ9P 2Q9IA 1SQBE 2JWDA 2R5BA 3HD7D 1SFCA 3IR9A 3RGUA 3L74G 1L0LD 1S5LX 1X9VA 1M56D 2ZJSE 3C8VA 1JY3P 3HTKA 3HD7C 1UIIA 3L73E 5E79H 5CCHA 3V4WA 1VQMP 1S9KD 1NWQA 2GUSA 4AUWA 3M06A 3AEDC 5GTIE 1R5LA 2JR8A 2KP8A 3H1JG 1BGYE 2P58A 3FXDA 1K8AQ 3CXHD 1BE3G 4JF7A 4OVNF 2M5AB 1FZEA 2KXPB 3U1AA 4D6TJ 3JSVC 4HYTB 3H1KE 4GODA 1RE4A 4D6TG 1SQXD 2K9JB 3M9QA 1NTZD 2YKOA 1SQPG 3IN6A 3L72G 1GU4A 3S1KA 1LTJA 3GF3A 2WSFJ 1AVOA 1FS0E 1KYOE 3H1ID 4IFFA 2KYVA 4JQ0D 4PV1D 4C7NA 4DZOA 1M90Q 4UB6H 1QGKB 3BCCE 1MKMA 3P8CD 1JOCA 4LC1A 2N9BA 2Q7CA 3FXEA 1USDA 4I1LA 4PJ0H 3RK3D 1KB9I 2WVRA 5L8RJ 5CCHD 4LLHA 1EZVG 2YXQB 1QL2A 4I7ZB 1BCCJ 2H89C 1LTJB 1LTSC 1PGOA 2HYNA 4OWFA 3V2PA 2R44A 3CWBJ 3MIWA 1S72P 1E5WA 4GOEA 3CCLP 1JB0J 1OMIA 1YBKA 4L75A 2Q6QA 1GL2D 3B5NC 3O8ZA 1N7LA 3MUDA 2PRRA 2XV5A 4H44B 3WU2H 1VQ8P 1EDJA 2Z5IA 1NU1G 3S4RA 1NTMG 1FZFA 2KS1B 1Q82Q 1FDMA 1NTZG 1MFZA 2ZXEB 3L75G 2Q5UA 3M0DC 3C1LA 5AVZB 1MZ9A 1BGYJ 3WUUA 2QA4P 1AQTA 5CHXA 3HTKB 1FZBA 2M0BA 2WTYA 3RK3E 1SFCB 2WPVB 1VQ9P 3TNUB 3L73J 3WUVA 1YTZI 2W83C 2P7JA 4MN4C 1NU1D 3PTZA 2FFDB 5B5EH 2KLUA 1KILE 5BVZA 5AVUB 1D7MA 5TISE 5KTBA 3CC7P 4A7PA 4KJMA 3RK2C 1AFOA 1AVYA 4U3FE 1SQXE 2D2CC 1HUCA 1N86A 2PP6A 2AEJA 2QJPB 1OXZA 3BASA 4TLFA 5KJ7D 3S9OA 1ZLLA 2MKVA 3AEFC 3UIAA 1LT9C 1DIPA 3CXHE 1JUNA 2KI7B 2M3EA 2NPSA 1L4AC 3BRVB 1Q7YQ 3D6YA 1CI6A 1L0NE 2IBZI 1NU1J 3CCJP 3HE5B 4RESB 1LWUC 1KQGB 2ZXXA 3LIEA 2I1KA 1N7SD 3OA7A 1KQLA 4H13C 3VP8A 2H88C 3KDPB 2FYNC 3L73D 3H1LJ 1JM0A 2IX7C 3HRNA 4B86A 1T2KC 4Y99C 2JWAA 1SQBD 2J58A 3E1RA 3MUDC 3LW5J 4ZKUA 4ZMDA 3CMAP 3Q3DA 4CPGA 3PP5A 3CCRP 1Y9BA 2B87A 1BCCE 2OYHA 2QM8A 1IFDA 1RF1A 3O6QB 5CCGD 5AVXB 2H7HA 3RL0g 2A06D 4L76A 1YJNP 3V4QA 1DD3A 4DT0A 1P84E 1ZMEC 1P84H 3P7KA 1NKNA 2IPPA 1EDKA 1VQLP 4O9BA 3CWBD 1YTZT 1OW7A 1CSBA 2WSEJ 5GTHE 1JTHB 3L71G 1L0NG 2YNYA 2DW3A 1OZHA 3A2AA 3MHVA 4I7ZC 2ZT9D 2G8YA 1Y8AA 2QSIA 1H88A 2W6JH 2V7QJ 3F5HA 2E74B 3CWBE 1T3JA 2ZYDA 3IF4A 1FZCA 3CCEP 2OTKE 1NTMK 3PLNA 2O01J 3RL0D 4DOJA 2LR2A 1PIXA 2PFXA 5APVA 2A06E 3FX0A 1NHLA 1VQ4P 1ZRTE 2HG5D 1NTZJ 3T97B 1W5CE 1SQXJ 2AEFA 3L70G 1K73Q 2R3SA 1BCCD 2KZIA 3H1LE 1T8ZA 3V2RA 2L5GB 1JO5A 4EIJA 3RBZA 1URQD 1J2JB 2XZRA 2OYHC 3ITKA 2ITAA 2O1JA 1FZCB 2JEEA 4L73A 5B5EE 3BATA 3HUSC 3CXHI 3AE3C 1L4AA 4K35A 1LTBC 1T3UA 4WVZA 2FFDC 2L91A 3I5CA 3H1IJ 5KJ7A 1L0LJ 1HWTC 3V6IA 1L0ND 2JO1A 2QJKB 2XNDH 1SQQG 3G71P 2PAJA 1LP1B 1LGHB 2Q3EA 3HUSB 1RQVA 3A0HH 3D70A 1GK4A 1R5SA 5APUA 1S3JA 1IK7A 1E79H 4WBAA 1FOSE 4BXLA 3GF7A 1KORA 3EFGA 3M9BA 4U3FD 1M8OB 3VN0A 1G2CA 2FYUJ 1KYOI 2JKVA 3QWOC 4BWNA 3U1CA 2OTLP 1LP1A 1KILD 1PPJE 2LKMA 3O6QA 1L0LK 2N1TC 1NU1E 5E79E 3W67A 2IYPA 1EXIA 3CX5I 5AVQB 1GD2E 3MP7B 1L2PA 1SQQD 4WWIA 3PH0A 1VQNP 2WITA 3R4YA 3AE5C 4IL6X 3M9HA 2QG4A 2FBWC 1RQUA
chains in the Genus database with same CATH topology
3WMM0 3NXSA 2A45I 2Q3IA 1IC2A 2CPBA 3HE4B 1CI6B 1NTZK 4C7RA 2GUVA 2NPSB 1IFNA 4I6MC 4KHXA 1HGZA 4GKGA 2NPSC 1GW3A 5AW5B 4AQRD 1RF0C 2GM4A 2I1JA 5AW8B 4WY4B 5CJ4A 1JTHA 5BU8B 1IFIA 4EOTA 5AW7B 3P8CE 1J1DC 3RK2B 1ZR2A 2WT7B 2E42A 2W6BA 1ZN5A 5CCGA 2OYHB 1FBMA 5CCGC 2Z5HA 4N3YB 3GHGB 3HD7A 3RL0B 1S9KE 1FJKA 1RE3A 4GIFA 1T2KD 1NU1K 3MD0A 4W7YA 1A02J 3IFMA 2HPCB 1EQ7A 3TYYA 4N6JA 2A45H 1SVFA 1NOHA 2N1TB 5AW3B 2HFED 1MV8A 5APXA 4N78E 3L37A 1JCDA 5AVTB 3TNUA 3MGNA 2IFMA 1HH0A 1JY3O 1PFIA 2H43A 1VDFA 1WT6A 2IFNA 3EQ2A 2WPSA 3N4XA 3A3YB 3H32B 5APYA 2NPSD 2Z4EA 1HVVA 1FZCC 3CLQA 1SFCC 1X8YA 5AW6B 2ZFCA 2P2UA 2J59M 5AW9B 2FYUK 1FZGA 1SFCD 1A02F 3LW5H 4C7NB 2C0XA 4GT1A 5AVYB 4JYCA 2O1KA 4XA4A 2N1TD 1KILC 2FKWB 1KFNA 1RF0A 1HBWA 1MUUA 3GHGC 2C0WA 3H32A 3RL0C 1GL2B 2BASA 1LWUB 1RY3A 5APQA 2A45G 1LTGC 1IJDB 1JCCA 2JJLA 1JY2O 4IFMA 3TSIA 4I2LC 3N7NA 5APSA 1GZLA 1NO4A 2KSJA 2P1JA 2CPSA 1LWUA 1URQC 2E43A 2OARA 1SQXK 2WPRA 2XU6A 4C46A 4ZKPA 1IFMA 3L35A 1H8AA 5AW2B 3SWYA 1JNMA 2P67A 1G1IA 1JMMA 2WSCH 1J1DB 4WY4D 1CZQA 1OWAA 2YKPA 3R2PA 5CJ0A 3HD7B 3GHGA 3VOPA 1NKZB 1LTAC 1NTKK 3RK2D 2HODA 1KFMA 4OH8B 1SQVK 3BVHA 3VMYA 2KOGA 1JY3N 2WT7A 3NFQA 1VPCA 5AVSB 2XKMA 2OYIB 4WY4A 1WRGA 1NH4A 2M8RA 1N7SA 1XTGB 2YO3A 1N7SC 5KLVK 1KILB 2N1TA 3BRTB 5AW0B 5KJ7C 1SLQA 3B5NB 3LIDA 2VRSA 5CCHC 3HE4A 4AYCA 3RK3C 1M1JB 1SQBK 3OJAB 1FAVA 4HH2A 2R3CA 1JY2N 1URQB 3KYQA 1GU5A 1FU1A 2H8PD 3OAKA 1J1EC 4N78D 2M3BA 1LT9A 1HJBA 1X79B 1G1JA 1L0NK 1G2CB 1N73A 3V2NA 3VMZA 1HGVA 3C9IA 1KZUB 1M7LA 1Z56A 1LT9B 3TK1A 2QM7A 1L4AB 3L4FA 1HTLC 1URQA 3G3ZA 4XE5B 1M1JA 4W7ZA 5APTA 2KLVA 4Y99B 5AVVB 1LTIC 3B5NA 3U59A 3SWFA 3KQGA 1DEBA 3NMDA 5APWA 3KPEA 1IO4A 3V2QA 2W27A 3VP9A 2WWWA 3M91A 1KILA 2FXMA 1GK6A 1N7SB 3P8MC 1SQPK 3VMXA 1ZR4A 2OYIA 2C9NY 3II6A 1GTWA 1AQ5A 1IFJA 1CW5A 1RE3C 5BU5A 1N73B 2YMYA 2R5DA 1NAFA 3HUSA 2KB7P 1RF1B 1SQQK 1M1JC 2YKQA 5AVWB 5AW4B 2FYZA 1N73C 2WSEH 1GW4A 1N2DC 1DX7A 4M3LA 1ZV8A 2R32A 3B8EB 1L4AD 3HE5A 1FZAA 3M0AA 3VYIA 2YO2A 2O01H 3T97A 2C9LY 2HLOA 3NTNA 1GDTA 3L36A 1FOSF 3H6PA 5AVRB 2OYIC 2W6AA 4LGDE 5CMZA 3M0DA 3A7OA 3CI9A 1XTCC 1YYCA 3CL3D 2XNXA 3V5BA 1SP4A 1JY2P 3VTPC 1RE4C 3E1IA 2WPQA 3B5ND 1GL2C 1IK9A 1W2EA 2MJZA 1LTJC 1GL2A 2HODB 4IFDK 1QL1A 5AW1B 3RK3B 2WSFH 4WB4A 4JYBA 1J1EB 4W80A 2POHA 2XDJA 1H89A 3A5TA 4WY4C 3MTUE 1RF1C 1LTTC 2FFDA 1DH3A 2WZ7A 3P32A 2Q9IA 3IR9A 2R5BA 3HD7D 1SFCA 1X9VA 3HTKA 5CCHA 1JY3P 3HD7C 3V4WA 1S9KD 1NWQA 2GUSA 4AUWA 3M06A 2KP8A 4JF7A 1FZEA 3U1AA 4HYTB 1RE4A 3M9QA 2YKOA 1GU4A 1LTJA 2HPCA 4IFFA 2KYVA 4C7NA 4DZOA 3P8CD 2Q7CA 1JOCA 4LC1A 2N9BA 4I1LA 3RK3D 5CCHD 4LLHA 1QL2A 3V2PA 1LTJB 1LTSC 2HYNA 3MIWA 1E5WA 1GL2D 3B5NC 3O8ZA 1N7LA 3MUDA 2XV5A 2Z5IA 1FZFA 1FDMA 1MFZA 2ZXEB 5AVZB 2Q5UA 3M0DC 1MZ9A 5CHXA 3HTKB 1FZBA 2WTYA 1SFCB 3TNUB 1YTZI 2P7JA 2FFDB 5BVZA 5AVUB 5KTBA 1AFOA 3RK2C 2PP6A 1HUCA 1N86A 5KJ7D 3BASA 1OXZA 1ZLLA 3UIAA 1LT9C 1JUNA 2NPSA 3BRVB 1L4AC 1CI6A 3HE5B 4RESB 1LWUC 3LIEA 2I1KA 1N7SD 3OA7A 1KQLA 3VP8A 3KDPB 2IX7C 3HRNA 4B86A 1T2KC 4Y99C 1FJPA 2J58A 4ZKUA 3PP5A 2OYHA 2QM8A 1IFDA 1RF1A 5CCGD 5AVXB 2H7HA 3V4QA 3P7KA 1NKNA 2IPPA 4O9BA 1YTZT 1CSBA 1JTHB 2YNYA 3A2AA 1H88A 1T3JA 1FZCA 1NTMK 4DOJA 3RL0D 5APVA 1NHLA 2HG5D 1T8ZA 3V2RA 2L5GB 1JO5A 4EIJA 2OYHC 1URQD 1J2JB 2XZRA 1FZCB 2O1JA 2JEEA 3BATA 3HUSC 2FFDC 1L4AA 1LTBC 1T3UA 3I5CA 5KJ7A 1HWTC 2PAJA 1LGHB 3HUSB 1GK4A 5APUA 1FOSE 4WBAA 3EFGA 3M9BA 3VN0A 1G2CA 3U1CA 1KILD 2LKMA 1L0LK 2N1TC 5AVQB 1GD2E 2WITA 3M9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZL A;  3NXS A;  2C9N Y;  2Q3I A;  1GTW A;  3HE4 B;  2E43 A;  2WPR A;  1CI6 B;  2XU6 A;  4C46 A;  3L35 A;  3O8Z A;  2XV5 A;  4I6M C;  4KHX A;  5AW2 B;  2R5D A;  1NAF A;  2Z5I A;  1H8A A;  1JNM A;  4GKG A;  5AW5 B;  4AQR D;  2P67 A;  5AW4 B;  5AVW B;  1MFZ A;  2ZXE B;  5AVZ B;  2Q5U A;  5AW8 B;  4M3L A;  2WTY A;  1CZQ A;  4EOT A;  3TNU B;  1OWA A;  2R32 A;  3B8E B;  5AW7 B;  3HE5 A;  3M0A A;  2P7J A;  3VYI A;  2YO2 A;  2WT7 B;  3T97 A;  2E42 A;  5AVU B;  2C9L Y;  1HUC A;  3NTN A;  1OXZ A;  3L36 A;  1FOS F;  3UIA A;  1JUN A;  3VMY A;  5AVR B;  2Z5H A;  2WT7 A;  3NFQ A;  1CI6 A;  2W6A A;  5CMZ A;  3HE5 B;  4RES B;  5AVS B;  3LIE A;  3A7O A;  3M0D A;  1S9K E;  1KQL A;  1YYC A;  3KDP B;  1T2K D;  3MD0 A;  1T2K C;  4B86 A;  3V5B A;  2YO3 A;  1A02 J;  1SP4 A;  3VTP C;  2QM8 A;  2WPQ A;  3TYY A;  5AVX B;  5AW0 B;  2H7H A;  5AW3 B;  5AW1 B;  3V4Q A;  1SLQ A;  3LID A;  2IPP A;  3P7K A;  1MV8 A;  2VRS A;  4JYB A;  3HE4 A;  5APX A;  4AYC A;  3L37 A;  1CSB A;  5AVT B;  3TNU A;  3MGN A;  1FAV A;  2YNY A;  3A2A A;  2R3C A;  1GU5 A;  1H88 A;  3OAK A;  1H89 A;  3A5T A;  1HJB A;  2WPS A;  5APV A;  3A3Y B;  1G2C B;  5APY A;  3VMZ A;  1DH3 A;  3P32 A;  1X8Y A;  3IR9 A;  2R5B A;  5AW6 B;  1J2J B;  2XZR A;  2QM7 A;  3TK1 A;  3HTK A;  2ZFC A;  2P2U A;  5AW9 B;  3V4W A;  1S9K D;  1A02 F;  1NWQ A;  4AUW A;  3I5C A;  4XE5 B;  3M06 A;  1HWT C;  4C7N B;  2KP8 A;  4GT1 A;  5AVY B;  5APT A;  4JYC A;  5AVV B;  1GK4 A;  5APU A;  1FOS E;  4HYT B;  3SWF A;  3KQG A;  3M9B A;  1HBW A;  1MUU A;  3VN0 A;  3NMD A;  1GU4 A;  2BAS A;  5APW A;  1IO4 A;  2W27 A;  5APQ A;  4C7N A;  2WWW A;  2JJL A;  4DZO A;  5AVQ B;  3M91 A;  1GD2 E;  2Q7C A;  4LC1 A;  2N9B A;  4I2L C;  1GK6 A;  3P8M C;  3M9H A;  5APS A;  3VMX A; 
#chains in the Genus database with same CATH topology
 3WMM 0;  3NXS A;  1PPJ G;  2Y0D A;  2A45 I;  2Q3I A;  1IC2 A;  2CPB A;  2V7Q H;  3HE4 B;  4ASV A;  3H1J J;  1CI6 B;  1NTZ K;  4PD4 H;  4PJ0 E;  4C7R A;  2GUV A;  2NPS B;  2RN0 A;  4PD4 I;  1NAY A;  1IFN A;  4NPD A;  3MZW B;  1SQB J;  2E76 B;  1OFC X;  4I6M C;  1HGZ A;  4KHX A;  2FXO A;  4GKG A;  3TGU E;  2NPS C;  1GW3 A;  5AW5 B;  4AQR D;  1RF0 C;  2GM4 A;  3CD6 P;  2Y0C A;  1RH5 B;  1KMI Z;  2E76 C;  2KZJ A;  1K04 A;  3JCU H;  1VQ5 P;  2I1J A;  3CX5 H;  4IOI H;  5AW8 B;  1ZW0 A;  4WY4 B;  5CJ4 A;  1JTH A;  1QEX A;  1YQ3 C;  1IFI A;  5BU8 B;  4EOT A;  1YIT P;  2BCC J;  2KNC B;  5AW7 B;  3BCC D;  1J1D C;  2WQY C;  3P8C E;  3RK2 B;  4DCK A;  3CCM P;  1ZR2 A;  2FYU E;  1KYO D;  1QLE D;  3H1I E;  2WT7 B;  4U7J A;  2PGD A;  4BRY B;  4EDF A;  1LT1 A;  4PD4 E;  2O3J A;  1LJ2 A;  2W6B A;  2E42 A;  1PGQ A;  1KN7 A;  1NTZ E;  3CWB G;  3H1K D;  1ZN5 A;  5CCG A;  2B87 B;  1S5L E;  2OYH B;  4H13 B;  1FBM A;  2ZVN B;  5CCG C;  1BGY D;  2FYN B;  2Z5H A;  3FWN A;  3L74 J;  4N3Y B;  3GHG B;  3HD7 A;  3RL0 B;  1VQO P;  1NTM J;  1ZP0 C;  1X0T A;  2E74 D;  1FJK A;  2O01 N;  1RE3 A;  1S9K E;  4GIF A;  1T2K D;  2ZT9 B;  1NU1 K;  1L0L E;  3PHL A;  3MD0 A;  1IFP A;  4W7Y A;  1EDL A;  1A02 J;  4GDO A;  1S2E A;  5EFW B;  3IFM A;  1PP9 E;  3SFD C;  3L71 E;  1EQ7 A;  3TYY A;  3H1J E;  4N6J A;  5TJH A;  2HPC B;  2A45 H;  4HB1 A;  1KV4 A;  1SVF A;  1NOH A;  1QX8 A;  2N1T B;  5AW3 B;  1M1K Q;  5KAF E;  1YJW P;  2K9J A;  2HFE D;  2RH0 A;  1SQP E;  1U57 A;  1MV8 A;  3L72 E;  4HKZ H;  2IZ1 A;  3AEB C;  5APX A;  4N78 E;  3L37 A;  1Q81 Q;  1JCD A;  1Q2N A;  3AE7 C;  4OGQ C;  5AVT B;  1AA0 A;  1OIP A;  1UIX A;  3MGN A;  3TNU A;  4DJG A;  1YQ4 C;  3BCC G;  5KAF H;  2IFM A;  2BEZ F;  3K5B A;  1HH0 A;  1JY3 O;  3FWL A;  1VL2 A;  3JCU E;  1PFI A;  3H1H D;  2YXR B;  2WSS H;  2H43 A;  5H2F H;  4D6T D;  1BE3 J;  2JDI H;  1SQV D;  1VDF A;  2KS1 A;  2E76 D;  3B71 A;  1WT6 A;  2IFN A;  3EQ2 A;  3L74 E;  2LXB A;  2WPS A;  3N4X A;  3A3Y B;  1VQK P;  3H32 B;  5APY A;  2NPS D;  1BSH A;  1NTM E;  4KT0 J;  1EC5 A;  2Z4E A;  1HVV A;  1FZC C;  3AE6 C;  5GTI H;  4Y28 J;  3CLQ A;  1R8E A;  1QVG O;  1SFC C;  1X8Y A;  1USE A;  3ABV C;  5AW6 B;  5KLV J;  1S5L H;  1K9M Q;  2ZFC A;  2P2U A;  2J59 M;  3L75 E;  2FYU K;  5AW9 B;  1FZG A;  1EZV E;  3W68 A;  1SFC D;  1VQ7 P;  1JEK A;  1A02 F;  2KSE A;  3CCQ P;  2K3R A;  3LW5 H;  1OVU A;  1BSN A;  2C0X A;  4C7N B;  4GT1 A;  1KB9 D;  5AVY B;  4JYC A;  2O1K A;  4QMA A;  4XA4 A;  3GW6 A;  1LNQ A;  4PV1 C;  2N1T D;  2J5U A;  1NJI Q;  1KIL C;  1PP9 J;  2FKW B;  2B9B A;  1KFN A;  1RF0 A;  1HBW A;  1MUU A;  1KC8 Q;  3GHG C;  2C0W A;  2M5A A;  3H32 A;  1EDI A;  1GL2 B;  2BAS A;  3L70 J;  4PV1 B;  3RL0 C;  1LWU B;  1NTK D;  1NTK J;  1RY3 A;  2NZ2 A;  2YIU C;  2A45 G;  5APQ A;  1VQ6 P;  1LTG C;  1IJD B;  1JCC A;  2JJL A;  1NGM B;  1JY2 O;  1S4X A;  4IFM A;  3TSI A;  4I2L C;  3N7N A;  1JMB A;  2N9Y B;  2AXC A;  3FGA D;  2YIU B;  4JPZ B;  3AEA C;  3H1H G;  5APS A;  1GZL A;  5TIS H;  1GMJ A;  1NO4 A;  2KSJ A;  2P1J A;  2CPS A;  5M1B A;  4YXW H;  1LWU A;  1URQ C;  2E43 A;  2K9Y A;  1SQX K;  2OAR A;  2WPR A;  4NPF X;  2XU6 A;  1S1C X;  1BE3 E;  2IBZ E;  3H1I G;  4C46 A;  1IFM A;  4ZKP A;  3L35 A;  2QEX P;  1FC2 C;  5KLV D;  1OVV A;  2JP3 A;  2KK7 A;  5AW2 B;  3SWY A;  5KLV E;  1H8A A;  1SQP J;  2KUB A;  3L72 J;  2E5T A;  1FDI A;  1JNM A;  2P67 A;  1G1I A;  1JMM A;  2QVA A;  2WSC H;  1MFT A;  1J1D B;  4OGQ D;  1NTK G;  4H13 D;  4WY4 D;  2E74 C;  4UB8 E;  4R4L A;  3H25 A;  1FDO A;  2AXT H;  3H1L G;  1CZQ A;  1SQV J;  3EFF K;  1HJ0 A;  1OWA A;  3USS A;  1YHQ P;  2YKP A;  3R2P A;  1PL5 A;  3A0H E;  5CJ0 A;  3HD7 B;  3GHG A;  1IZN B;  3VOP A;  1NKZ B;  1LTA C;  1OX3 A;  1NTK E;  2A06 G;  5KKZ C;  1H0T A;  2D2C D;  1NTK K;  3RK2 D;  2HOD A;  1FE6 A;  1SQB G;  1KFM A;  4OH8 B;  1SQV K;  1PV3 A;  3CME P;  3BVH A;  2ZYA A;  4XFJ A;  3VMY A;  2KOG A;  1KYO H;  4BRY A;  1JY3 N;  3L70 E;  4ZNC A;  5KLV G;  3NFQ A;  2WT7 A;  1BDC A;  1VPC A;  3L75 J;  5AVS B;  2ZVO B;  2KNC A;  2XKM A;  3CX5 E;  3G6E P;  1HF9 A;  1EZV D;  1N8R Q;  3D71 A;  1M57 D;  2OYI B;  4WY4 A;  3L75 D;  1WRG A;  1NH4 A;  2M8R A;  2GA1 A;  1N7S A;  1XTG B;  2KIK A;  3Q2Y A;  2YO3 A;  1N7S C;  2OGU A;  5KLV K;  1EXJ A;  2B89 A;  1KIL B;  3AE1 C;  3CXH H;  3TGU J;  3JC2 2;  1OVR A;  2N1T A;  3BRT B;  3TDK A;  4NPE A;  5AW0 B;  1NTM D;  2ZYG A;  3AEE C;  3WU2 E;  1QVF O;  3G4S P;  3I55 P;  1U7J A;  4OGQ B;  3L74 D;  4ASW A;  5KJ7 C;  2E75 B;  2AEM A;  1SLQ A;  1SQV E;  2P10 A;  3B5N B;  2BCC E;  2VRS A;  3LID A;  4H44 C;  4IL6 H;  5CCH C;  1DD4 A;  2G3A A;  3D6Z A;  2I8D A;  3H1H E;  3HE4 A;  4AYC A;  3CCV P;  2WSC J;  3RK3 C;  1M1J B;  1SQB K;  3OJA B;  1FAV A;  4HH2 A;  2R3C A;  1JY2 N;  1URQ B;  3KYQ A;  1GU5 A;  1FU1 A;  1Y47 A;  1ZXG A;  2H8P D;  3OAK A;  1J1E C;  3B4S A;  4N78 D;  2M3B A;  1LT9 A;  1NVO A;  3E7K A;  5DJU B;  3L73 G;  5H2F E;  2BCC D;  1HJB A;  1SQP D;  3IAO A;  1X79 B;  2OQQ A;  3L72 D;  1G1J A;  1L0N K;  1G2C B;  1N73 A;  3F89 A;  3V2N A;  3VMZ A;  3TGU G;  2FYU G;  1HGV A;  3C9I A;  4RJT A;  3OW2 O;  1YI2 P;  5KLI B;  1P84 I;  3L71 D;  1PP9 D;  4K3A A;  5C39 A;  2E75 D;  2CK3 H;  1BDD A;  1KZU B;  2IBZ G;  1M7L A;  2B88 A;  2K1A A;  4Z1M H;  3AE2 C;  1Z56 A;  1LT9 B;  3TK1 A;  2QM7 A;  2BCC G;  1L4A B;  3ZDM A;  1TU3 F;  3L4F A;  3L71 J;  1HTL C;  1URQ A;  3CX5 D;  3G3Z A;  3SSU A;  1Q86 Q;  2RKL A;  1M1J A;  4XE5 B;  2Y9Z A;  3L70 D;  4JBZ A;  2LXC B;  4W7Z A;  5APT A;  3Q1M A;  3Q5S A;  2KLV A;  3CCS P;  4Y99 B;  5AVV B;  1LTI C;  3RBX A;  3B5N A;  5KAI E;  3U59 A;  2K37 A;  2SPZ A;  3SWF A;  3KQG A;  4HJG H;  2AXT E;  1DEB A;  1Q90 D;  3A0B E;  3NMD A;  2HR3 A;  3A0B H;  5APW A;  3KPE A;  4PD4 D;  1IO4 A;  3V2Q A;  1NYH A;  2W27 A;  3VP9 A;  2FYU D;  2WWW A;  5KAI H;  2ZT9 C;  3M91 A;  1AJY A;  1KIL A;  2WMM A;  1BGY G;  3WUT A;  3SWK A;  3H1H J;  2FXM A;  1GK6 A;  1N7S B;  3KHU A;  3P8M C;  1SQP K;  3VMX A;  5CBO A;  1ZR4 A;  2OYI A;  2C9N Y;  1PZQ A;  1L0N J;  3II6 A;  1GTW A;  1AQ5 A;  1L0L G;  1SS1 A;  2E5Y A;  1IFJ A;  3SFE C;  2FXP A;  2K88 A;  1ZOY C;  3H1K G;  2W8Z A;  3TGU D;  5B66 E;  1CW5 A;  1RE3 C;  5BU5 A;  2E75 C;  3CC2 P;  2QJY B;  1PP9 G;  4EI2 A;  1N73 B;  2YMY A;  3KZI E;  2R5D A;  1NAF A;  3HUS A;  2IBZ D;  1BE3 D;  3AE8 C;  2IZ0 A;  3TF5 A;  2KB7 P;  1RF1 B;  1SQQ K;  3I56 P;  1YIJ P;  1M1J C;  4UB6 E;  3Q5R A;  2BEQ D;  4U3F G;  2YKQ A;  5AVW B;  1SQX G;  2FYZ A;  5AW4 B;  3CCU P;  3Q5P A;  1KD1 Q;  2HPC A;  1N73 C;  2WSE H;  1GW4 A;  1N2D C;  1RHZ B;  1VF5 C;  3AE4 C;  3G9R A;  3KZI H;  2FY8 A;  2Y9Y A;  1K05 A;  4M3L A;  5DJT B;  5KKZ B;  1DX7 A;  3AEG C;  1KTM A;  4H0L D;  1ZV8 A;  1SQQ E;  2R32 A;  3B8E B;  1L4A D;  3GLM A;  4RKU J;  3HE5 A;  1AV1 A;  1FZA A;  1VF5 B;  3M0A A;  3VYI A;  2YO2 A;  2O01 H;  1KB9 H;  1PPJ D;  3T97 A;  2QRX A;  4R4M A;  4H44 D;  2Y0E A;  2C9L Y;  2V4H A;  2QJK C;  3EWK A;  4IL6 E;  2HLO A;  1W2B O;  3H1K J;  3NTN A;  1GDT A;  3L36 A;  1OW8 A;  2NRG A;  3VMA A;  1FOS F;  1T6A A;  3H6P A;  5AVR B;  1KB9 E;  2OYI C;  3CC4 P;  2IDB A;  2UWJ E;  3GG2 A;  1KQF B;  2W6A A;  4LGD E;  5CMZ A;  4YXD C;  3A7O A;  3M0D A;  3CI9 A;  1VF5 D;  1XTC C;  1YYC A;  3BCC J;  4RO0 A;  5CBN A;  4GOF A;  1SQV G;  2ZAE B;  3GMA A;  2QE7 H;  2XNX A;  3CL3 D;  3V5B A;  1SP4 A;  3AEC C;  4YPC A;  1JY2 P;  3VTP C;  2W90 A;  1RE4 C;  3E1I A;  3CPW O;  3H1L D;  2Q1K A;  4YTP C;  2WPQ A;  1BCC G;  2IYO A;  1GL2 C;  1IK9 A;  3B5N D;  1W2E A;  1ZRT D;  1LTJ C;  1GL2 A;  2MJZ A;  4TT3 H;  2HOD B;  4IFD K;  2OYO A;  1QL1 A;  3PRJ A;  1WMK A;  5AW1 B;  3RK3 B;  2WSF H;  4WB4 A;  1H0T B;  1OW6 A;  1PGJ A;  4L74 A;  5B66 H;  1KQS O;  4D6T E;  4H0L B;  4JYB A;  2QIW A;  1J1E B;  3QH9 A;  4W80 A;  2YMK A;  4H0L C;  2POH A;  4EYY Q;  2XDJ A;  1X22 A;  1EZV I;  1H89 A;  3KXD A;  1SQQ J;  4UB8 H;  4WY4 C;  3A5T A;  2QJY C;  2OTJ P;  3PJS K;  1VQP P;  2RMZ A;  5KLI C;  1DEE G;  1P84 D;  3MTU E;  1RF1 C;  1LTT C;  1FJP A;  4U3F J;  3H1J D;  3AE9 C;  2FFD A;  1U7M A;  1PGP A;  1DH3 A;  2D2C B;  2QJP C;  2WZ7 A;  5GTH H;  5K5G B;  3P32 A;  1YJ9 P;  2Q9I A;  1SQB E;  2JWD A;  2R5B A;  3HD7 D;  1SFC A;  3IR9 A;  3RGU A;  3L74 G;  1L0L D;  1S5L X;  1X9V A;  1M56 D;  2ZJS E;  3C8V A;  1JY3 P;  3HTK A;  3HD7 C;  1UII A;  3L73 E;  5E79 H;  5CCH A;  3V4W A;  1VQM P;  1S9K D;  1NWQ A;  2GUS A;  4AUW A;  3M06 A;  3AED C;  5GTI E;  1R5L A;  2JR8 A;  2KP8 A;  3H1J G;  1BGY E;  2P58 A;  3FXD A;  1K8A Q;  3CXH D;  1BE3 G;  4JF7 A;  4OVN F;  2M5A B;  1FZE A;  2KXP B;  3U1A A;  4D6T J;  3JSV C;  4HYT B;  3H1K E;  4GOD A;  1RE4 A;  4D6T G;  1SQX D;  2K9J B;  3M9Q A;  1NTZ D;  2YKO A;  1SQP G;  3IN6 A;  3L72 G;  1GU4 A;  3S1K A;  1LTJ A;  3GF3 A;  2WSF J;  1AVO A;  1FS0 E;  1KYO E;  3H1I D;  4IFF A;  2KYV A;  4JQ0 D;  4PV1 D;  4C7N A;  4DZO A;  1M90 Q;  4UB6 H;  1QGK B;  3BCC E;  1MKM A;  3P8C D;  1JOC A;  4LC1 A;  2N9B A;  2Q7C A;  3FXE A;  1USD A;  4I1L A;  4PJ0 H;  3RK3 D;  1KB9 I;  2WVR A;  5L8R J;  5CCH D;  4LLH A;  1EZV G;  2YXQ B;  1QL2 A;  4I7Z B;  1BCC J;  2H89 C;  1LTJ B;  1LTS C;  1PGO A;  2HYN A;  4OWF A;  3V2P A;  2R44 A;  3CWB J;  3MIW A;  1S72 P;  1E5W A;  4GOE A;  3CCL P;  1JB0 J;  1OMI A;  1YBK A;  4L75 A;  2Q6Q A;  1GL2 D;  3B5N C;  3O8Z A;  1N7L A;  3MUD A;  2PRR A;  2XV5 A;  4H44 B;  3WU2 H;  1VQ8 P;  1EDJ A;  2Z5I A;  1NU1 G;  3S4R A;  1NTM G;  1FZF A;  2KS1 B;  1Q82 Q;  1FDM A;  1NTZ G;  1MFZ A;  2ZXE B;  3L75 G;  2Q5U A;  3M0D C;  3C1L A;  5AVZ B;  1MZ9 A;  1BGY J;  3WUU A;  2QA4 P;  1AQT A;  5CHX A;  3HTK B;  1FZB A;  2M0B A;  2WTY A;  3RK3 E;  1SFC B;  2WPV B;  1VQ9 P;  3TNU B;  3L73 J;  3WUV A;  1YTZ I;  2W83 C;  2P7J A;  4MN4 C;  1NU1 D;  3PTZ A;  2FFD B;  5B5E H;  2KLU A;  1KIL E;  5BVZ A;  5AVU B;  1D7M A;  5TIS E;  5KTB A;  3CC7 P;  4A7P A;  4KJM A;  3RK2 C;  1AFO A;  1AVY A;  4U3F E;  1SQX E;  2D2C C;  1HUC A;  1N86 A;  2PP6 A;  2AEJ A;  2QJP B;  1OXZ A;  3BAS A;  4TLF A;  5KJ7 D;  3S9O A;  1ZLL A;  2MKV A;  3AEF C;  3UIA A;  1LT9 C;  1DIP A;  3CXH E;  1JUN A;  2KI7 B;  2M3E A;  2NPS A;  1L4A C;  3BRV B;  1Q7Y Q;  3D6Y A;  1CI6 A;  1L0N E;  2IBZ I;  1NU1 J;  3CCJ P;  3HE5 B;  4RES B;  1LWU C;  1KQG B;  2ZXX A;  3LIE A;  2I1K A;  1N7S D;  3OA7 A;  1KQL A;  4H13 C;  3VP8 A;  2H88 C;  3KDP B;  2FYN C;  3L73 D;  3H1L J;  1JM0 A;  2IX7 C;  3HRN A;  4B86 A;  1T2K C;  4Y99 C;  2JWA A;  1SQB D;  2J58 A;  3E1R A;  3MUD C;  3LW5 J;  4ZKU A;  4ZMD A;  3CMA P;  3Q3D A;  4CPG A;  3PP5 A;  3CCR P;  1Y9B A;  2B87 A;  1BCC E;  2OYH A;  2QM8 A;  1IFD A;  1RF1 A;  3O6Q B;  5CCG D;  5AVX B;  2H7H A;  3RL0 g;  2A06 D;  4L76 A;  1YJN P;  3V4Q A;  1DD3 A;  4DT0 A;  1P84 E;  1ZME C;  1P84 H;  3P7K A;  1NKN A;  2IPP A;  1EDK A;  1VQL P;  4O9B A;  3CWB D;  1YTZ T;  1OW7 A;  1CSB A;  2WSE J;  5GTH E;  1JTH B;  3L71 G;  1L0N G;  2YNY A;  2DW3 A;  1OZH A;  3A2A A;  3MHV A;  4I7Z C;  2ZT9 D;  2G8Y A;  1Y8A A;  2QSI A;  1H88 A;  2W6J H;  2V7Q J;  3F5H A;  2E74 B;  3CWB E;  1T3J A;  2ZYD A;  3IF4 A;  1FZC A;  3CCE P;  2OTK E;  1NTM K;  3PLN A;  2O01 J;  3RL0 D;  4DOJ A;  2LR2 A;  1PIX A;  2PFX A;  5APV A;  2A06 E;  3FX0 A;  1NHL A;  1VQ4 P;  1ZRT E;  2HG5 D;  1NTZ J;  3T97 B;  1W5C E;  1SQX J;  2AEF A;  3L70 G;  1K73 Q;  2R3S A;  1BCC D;  2KZI A;  3H1L E;  1T8Z A;  3V2R A;  2L5G B;  1JO5 A;  4EIJ A;  3RBZ A;  1URQ D;  1J2J B;  2XZR A;  2OYH C;  3ITK A;  2ITA A;  2O1J A;  1FZC B;  2JEE A;  4L73 A;  5B5E E;  3BAT A;  3HUS C;  3CXH I;  3AE3 C;  1L4A A;  4K35 A;  1LTB C;  1T3U A;  4WVZ A;  2FFD C;  2L91 A;  3I5C A;  3H1I J;  5KJ7 A;  1L0L J;  1HWT C;  3V6I A;  1L0N D;  2JO1 A;  2QJK B;  2XND H;  1SQQ G;  3G71 P;  2PAJ A;  1LP1 B;  1LGH B;  2Q3E A;  3HUS B;  1RQV A;  3A0H H;  3D70 A;  1GK4 A;  1R5S A;  5APU A;  1S3J A;  1IK7 A;  1E79 H;  4WBA A;  1FOS E;  4BXL A;  3GF7 A;  1KOR A;  3EFG A;  3M9B A;  4U3F D;  1M8O B;  3VN0 A;  1G2C A;  2FYU J;  1KYO I;  2JKV A;  3QWO C;  4BWN A;  3U1C A;  2OTL P;  1LP1 A;  1KIL D;  1PPJ E;  2LKM A;  3O6Q A;  1L0L K;  2N1T C;  1NU1 E;  5E79 E;  3W67 A;  2IYP A;  1EXI A;  3CX5 I;  5AVQ B;  1GD2 E;  3MP7 B;  1L2P A;  1SQQ D;  4WWI A;  3PH0 A;  1VQN P;  2WIT A;  3R4Y A;  3AE5 C;  4IL6 X;  3M9H A;  2QG4 A;  2FBW C;  1RQU A; 
#chains in the Genus database with same CATH homology
 3WMM 0;  3NXS A;  2A45 I;  2Q3I A;  1IC2 A;  2CPB A;  3HE4 B;  1CI6 B;  1NTZ K;  4C7R A;  2GUV A;  2NPS B;  1IFN A;  4I6M C;  4KHX A;  1HGZ A;  4GKG A;  2NPS C;  1GW3 A;  5AW5 B;  4AQR D;  1RF0 C;  2GM4 A;  2I1J A;  5AW8 B;  4WY4 B;  5CJ4 A;  1JTH A;  5BU8 B;  1IFI A;  4EOT A;  5AW7 B;  3P8C E;  1J1D C;  3RK2 B;  1ZR2 A;  2WT7 B;  2E42 A;  2W6B A;  1ZN5 A;  5CCG A;  2OYH B;  1FBM A;  5CCG C;  2Z5H A;  4N3Y B;  3GHG B;  3HD7 A;  3RL0 B;  1S9K E;  1FJK A;  1RE3 A;  4GIF A;  1T2K D;  1NU1 K;  3MD0 A;  4W7Y A;  1A02 J;  3IFM A;  2HPC B;  1EQ7 A;  3TYY A;  4N6J A;  2A45 H;  1SVF A;  1NOH A;  2N1T B;  5AW3 B;  2HFE D;  1MV8 A;  5APX A;  4N78 E;  3L37 A;  1JCD A;  5AVT B;  3TNU A;  3MGN A;  2IFM A;  1HH0 A;  1JY3 O;  1PFI A;  2H43 A;  1VDF A;  1WT6 A;  2IFN A;  3EQ2 A;  2WPS A;  3N4X A;  3A3Y B;  3H32 B;  5APY A;  2NPS D;  2Z4E A;  1HVV A;  1FZC C;  3CLQ A;  1SFC C;  1X8Y A;  5AW6 B;  2ZFC A;  2P2U A;  2J59 M;  5AW9 B;  2FYU K;  1FZG A;  1SFC D;  1A02 F;  3LW5 H;  4C7N B;  2C0X A;  4GT1 A;  5AVY B;  4JYC A;  2O1K A;  4XA4 A;  2N1T D;  1KIL C;  2FKW B;  1KFN A;  1RF0 A;  1HBW A;  1MUU A;  3GHG C;  2C0W A;  3H32 A;  3RL0 C;  1GL2 B;  2BAS A;  1LWU B;  1RY3 A;  5APQ A;  2A45 G;  1LTG C;  1IJD B;  1JCC A;  2JJL A;  1JY2 O;  4IFM A;  3TSI A;  4I2L C;  3N7N A;  5APS A;  1GZL A;  1NO4 A;  2KSJ A;  2P1J A;  2CPS A;  1LWU A;  1URQ C;  2E43 A;  2OAR A;  1SQX K;  2WPR A;  2XU6 A;  4C46 A;  4ZKP A;  1IFM A;  3L35 A;  1H8A A;  5AW2 B;  3SWY A;  1JNM A;  2P67 A;  1G1I A;  1JMM A;  2WSC H;  1J1D B;  4WY4 D;  1CZQ A;  1OWA A;  2YKP A;  3R2P A;  5CJ0 A;  3HD7 B;  3GHG A;  3VOP A;  1NKZ B;  1LTA C;  1NTK K;  3RK2 D;  2HOD A;  1KFM A;  4OH8 B;  1SQV K;  3BVH A;  3VMY A;  2KOG A;  1JY3 N;  2WT7 A;  3NFQ A;  1VPC A;  5AVS B;  2XKM A;  2OYI B;  4WY4 A;  1WRG A;  1NH4 A;  2M8R A;  1N7S A;  1XTG B;  2YO3 A;  1N7S C;  5KLV K;  1KIL B;  2N1T A;  3BRT B;  5AW0 B;  5KJ7 C;  1SLQ A;  3B5N B;  3LID A;  2VRS A;  5CCH C;  3HE4 A;  4AYC A;  3RK3 C;  1M1J B;  1SQB K;  3OJA B;  1FAV A;  4HH2 A;  2R3C A;  1JY2 N;  1URQ B;  3KYQ A;  1GU5 A;  1FU1 A;  2H8P D;  3OAK A;  1J1E C;  4N78 D;  2M3B A;  1LT9 A;  1HJB A;  1X79 B;  1G1J A;  1L0N K;  1G2C B;  1N73 A;  3V2N A;  3VMZ A;  1HGV A;  3C9I A;  1KZU B;  1M7L A;  1Z56 A;  1LT9 B;  3TK1 A;  2QM7 A;  1L4A B;  3L4F A;  1HTL C;  1URQ A;  3G3Z A;  4XE5 B;  1M1J A;  4W7Z A;  5APT A;  2KLV A;  4Y99 B;  5AVV B;  1LTI C;  3B5N A;  3U59 A;  3SWF A;  3KQG A;  1DEB A;  3NMD A;  5APW A;  3KPE A;  1IO4 A;  3V2Q A;  2W27 A;  3VP9 A;  2WWW A;  3M91 A;  1KIL A;  2FXM A;  1GK6 A;  1N7S B;  3P8M C;  1SQP K;  3VMX A;  1ZR4 A;  2OYI A;  2C9N Y;  3II6 A;  1GTW A;  1AQ5 A;  1IFJ A;  1CW5 A;  1RE3 C;  5BU5 A;  1N73 B;  2YMY A;  2R5D A;  1NAF A;  3HUS A;  2KB7 P;  1RF1 B;  1SQQ K;  1M1J C;  2YKQ A;  5AVW B;  5AW4 B;  2FYZ A;  1N73 C;  2WSE H;  1GW4 A;  1N2D C;  1DX7 A;  4M3L A;  1ZV8 A;  2R32 A;  3B8E B;  1L4A D;  3HE5 A;  1FZA A;  3M0A A;  3VYI A;  2YO2 A;  2O01 H;  3T97 A;  2C9L Y;  2HLO A;  3NTN A;  1GDT A;  3L36 A;  1FOS F;  3H6P A;  5AVR B;  2OYI C;  2W6A A;  4LGD E;  5CMZ A;  3M0D A;  3A7O A;  3CI9 A;  1XTC C;  1YYC A;  3CL3 D;  2XNX A;  3V5B A;  1SP4 A;  1JY2 P;  3VTP C;  1RE4 C;  3E1I A;  2WPQ A;  3B5N D;  1GL2 C;  1IK9 A;  1W2E A;  2MJZ A;  1LTJ C;  1GL2 A;  2HOD B;  4IFD K;  1QL1 A;  5AW1 B;  3RK3 B;  2WSF H;  4WB4 A;  4JYB A;  1J1E B;  4W80 A;  2POH A;  2XDJ A;  1H89 A;  3A5T A;  4WY4 C;  3MTU E;  1RF1 C;  1LTT C;  2FFD A;  1DH3 A;  2WZ7 A;  3P32 A;  2Q9I A;  3IR9 A;  2R5B A;  3HD7 D;  1SFC A;  1X9V A;  3HTK A;  5CCH A;  1JY3 P;  3HD7 C;  3V4W A;  1S9K D;  1NWQ A;  2GUS A;  4AUW A;  3M06 A;  2KP8 A;  4JF7 A;  1FZE A;  3U1A A;  4HYT B;  1RE4 A;  3M9Q A;  2YKO A;  1GU4 A;  1LTJ A;  2HPC A;  4IFF A;  2KYV A;  4C7N A;  4DZO A;  3P8C D;  2Q7C A;  1JOC A;  4LC1 A;  2N9B A;  4I1L A;  3RK3 D;  5CCH D;  4LLH A;  1QL2 A;  3V2P A;  1LTJ B;  1LTS C;  2HYN A;  3MIW A;  1E5W A;  1GL2 D;  3B5N C;  3O8Z A;  1N7L A;  3MUD A;  2XV5 A;  2Z5I A;  1FZF A;  1FDM A;  1MFZ A;  2ZXE B;  5AVZ B;  2Q5U A;  3M0D C;  1MZ9 A;  5CHX A;  3HTK B;  1FZB A;  2WTY A;  1SFC B;  3TNU B;  1YTZ I;  2P7J A;  2FFD B;  5BVZ A;  5AVU B;  5KTB A;  1AFO A;  3RK2 C;  2PP6 A;  1HUC A;  1N86 A;  5KJ7 D;  3BAS A;  1OXZ A;  1ZLL A;  3UIA A;  1LT9 C;  1JUN A;  2NPS A;  3BRV B;  1L4A C;  1CI6 A;  3HE5 B;  4RES B;  1LWU C;  3LIE A;  2I1K A;  1N7S D;  3OA7 A;  1KQL A;  3VP8 A;  3KDP B;  2IX7 C;  3HRN A;  4B86 A;  1T2K C;  4Y99 C;  1FJP A;  2J58 A;  4ZKU A;  3PP5 A;  2OYH A;  2QM8 A;  1IFD A;  1RF1 A;  5CCG D;  5AVX B;  2H7H A;  3V4Q A;  3P7K A;  1NKN A;  2IPP A;  4O9B A;  1YTZ T;  1CSB A;  1JTH B;  2YNY A;  3A2A A;  1H88 A;  1T3J A;  1FZC A;  1NTM K;  4DOJ A;  3RL0 D;  5APV A;  1NHL A;  2HG5 D;  1T8Z A;  3V2R A;  2L5G B;  1JO5 A;  4EIJ A;  2OYH C;  1URQ D;  1J2J B;  2XZR A;  1FZC B;  2O1J A;  2JEE A;  3BAT A;  3HUS C;  2FFD C;  1L4A A;  1LTB C;  1T3U A;  3I5C A;  5KJ7 A;  1HWT C;  2PAJ A;  1LGH B;  3HUS B;  1GK4 A;  5APU A;  1FOS E;  4WBA A;  3EFG A;  3M9B A;  3VN0 A;  1G2C A;  3U1C A;  1KIL D;  2LKM A;  1L0L K;  2N1T C;  5AVQ B;  1GD2 E;  2WIT A;  3M9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...