2P2UA

Crystal structure of putative host-nuclease inhibitor protein gam from desulfovibrio vulgaris
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
150
Chain Sequence
VIVADIRQAEGALAEIATIDRKVGEIEAQMNEAIDAAKARASQKSAPLLARRKELEDGVATFATLNKTEMFKSLDLGFGTIGFRLSTQIVQMSKITKDMTLERLRQFGISEGIRIKEDVNKEAMQGWPDERLEMVGLKRRTTDAFYIEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative host-nuclease inhibitor protein Gam from Desulfovibrio vulgaris
rcsb
source organism Desulfovibrio vulgaris
molecule tags Dna binding protein
molecule keywords Host-nuclease inhibitor protein Gam, putative
total genus 26
structure length 150
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07352 Phage_Mu_Gam Bacteriophage Mu Gam like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p2uA01
4KHXA 1HUCA 3MGNA 1A02F 2P67A 4XE5B 3P7KA 3A2AA 2XU6A 3LIDA 3M9BA 1GU5A 3UIAA 4C46A 1OXZA 2JJLA 2ZFCA 3A7OA 1GK6A 4DZOA 3M06A 3A5TA 1HJBA 1FOSE 1IO4A 4GT1A 1FAVA 3OAKA 5AVSB 2N9BA 4AQRD 2WT7A 3VMYA 3P8MC 5APYA 1GK4A 4AYCA 4JYBA 5AW8B 3NFQA 1CI6A 5AW6B 1S9KE 3O8ZA 5AVZB 1SLQA 1MV8A 2QM8A 5APTA 3IR9A 1A02J 2WPQA 3VMZA 3P32A 3KDPB 2YO3A 4M3LA 2E42A 1T2KD 3NMDA 3VTPC 2Z5HA 4JYCA 5APUA 2BASA 1DH3A 2WTYA 2P7JA 5AW7B 1HBWA 1H8AA 5APQA 2IPPA 5AVRB 3VYIA 3L35A 3M91A 3TYYA 3V4QA 1GD2E 1X8YA 2C9LY 2ZXEB 2H7HA 1JUNA 3B8EB 2WWWA 1H89A 4AUWA 4RESB 3M9HA 5APSA 3I5CA 2W27A 5AVWB 1CZQA 1J2JB 1MUUA 4GKGA 4I2LC 1HWTC 2XV5A 2Q3IA 3HE4B 3NXSA 4I6MC 5AW5B 3VMXA 3V5BA 2YO2A 3VN0A 5AW0B 2C9NY 5AVTB 5AW9B 3V4WA 3M0DA 5AVQB 5AVUB 3MD0A 1MFZA 2WPSA 3A3YB 5AW4B 4C7NA 3SWFA 3TNUA 1KQLA 1S9KD 5AVXB 1GZLA 5APWA 1JNMA 3NTNA 2P2UA 2E43A 4C7NB 2KP8A 2QM7A 1G2CB 5AW3B 3TNUB 5AW1B 1YYCA 3HTKA 5AVYB 4EOTA 1NWQA 1GU4A 3L36A 1FOSF 5APXA 2WPRA 2Q7CA 2Q5UA 2YNYA 2R32A 3HE5A 5APVA 2R5BA 1T2KC 3M0AA 3HE4A 2W6AA 3L37A 4HYTB 4LC1A 3KQGA 1SP4A 3HE5B 5AVVB 3TK1A 2R3CA 2Z5IA 5CMZA 2XZRA 2R5DA 1CI6B 1H88A 4B86A 3T97A 1OWAA 5AW2B 2VRSA 1CSBA 1NAFA 1GTWA 2WT7B 3LIEA
chains in the Genus database with same CATH superfamily
1VF5D 2W83C 1BGYE 2ITAA 3AE1C 3VOPA 3CC2P 1A02F 2FFDA 2A06G 5EFWB 4R4MA 3AE4C 1Q82Q 1FS0E 1G1IA 1AA0A 2PAJA 4H44B 1S1CX 2XU6A 1ZR2A 3CI9A 2QRXA 1X79B 2ZYDA 3KZIH 4BRYA 1GU5A 2IX7C 5CCHC 1KYOH 2G8YA 2FXOA 4NPFX 1LWUA 2QJKC 3D6ZA 1EXIA 1OXZA 1SQPG 3H1LD 2KZJA 2ZFCA 4H0LB 4L73A 5KLVD 3RBZA 4DZOA 3L71E 3CCSP 1HJBA 1YQ3C 3BCCD 3W68A 2OYHA 2WZ7A 3AECC 4YPCA 2IFNA 2E5YA 3ABVC 2N9BA 2KK7A 1KQSO 4AQRD 2V4HA 2HLOA 3MTUE 1YJNP 2QA4P 1GK4A 1NH4A 1URQB 1FZAA 5AW8B 3NFQA 3V2NA 2O3JA 4IFFA 2K9JB 1CI6A 1S9KE 1BE3G 1NYHA 1GL2C 2XNDH 1HTLC 1MV8A 2ZAEB 1L0NG 3FXDA 3PP5A 1SQXD 3KPEA 4JQ0D 3WMM0 1NTKK 3H6PA 1BGYD 2H88C 1VQ7P 1HGZA 2A45I 3LW5J 2POHA 2LR2A 4L76A 4DOJA 1U57A 1HGVA 1JY2O 1NJIQ 1BGYG 3H1HD 4M3LA 2PGDA 2OGUA 2Y9ZA 1T2KD 1LTSC 2N1TD 1DD4A 1BE3D 2BASA 2WSSH 3AE7C 2P7JA 2OQQA 4H44C 4U3FG 3WUUA 4IL6E 1KORA 1L0NJ 1URQD 3ZDMA 4DJGA 1VQ8P 1AV1A 1NU1E 2YMKA 1H8AA 4OH8B 1RE4A 5AVRB 2W6BA 4JF7A 3L35A 3M91A 1EZVI 3SSUA 2KI7B 2W6JH 1HF9A 4XFJA 1X8YA 2C9LY 5KJ7C 2RH0A 1L0NK 1U7MA 1MFTA 2NRGA 3V2RA 1KB9I 1M90Q 1OMIA 1SQPD 1HVVA 3H1LG 4U3FJ 2WWWA 1GW4A 3IFMA 1RF1C 3H32B 1DEBA 3KYQA 4RESB 3L73G 4IFMA 1N7LA 2PP6A 3H1LE 1HWTC 2ZT9C 5KAFE 3GW6A 1G1JA 1RY3A 1WRGA 3HUSC 3VMXA 1MZ9A 4ZKPA 1QEXA 4U3FE 1VQ6P 5KKZB 1OW6A 1T8ZA 1X22A 3AE3C 3CWBD 3II6A 5DJTB 5AVTB 5TJHA 2JWAA 4YXDC 1L0LD 3CXHD 1MFZA 1SQQJ 2BCCG 3QH9A 3RL0g 3CWBE 3V2PA 3CMAP 3W67A 1S9KD 1JCDA 3H1KJ 5GTIH 3JC22 1JNMA 3BRVB 4IL6X 5KAIH 2WVRA 1GW3A 2P2UA 4RO0A 1YJWP 1FZGA 1JMMA 3N4XA 2K37A 4ZKUA 4C7NB 2N9YB 2KP8A 4PV1D 5AW3B 3T97B 1PGJA 5AW1B 4PJ0H 3TNUB 2QJKB 4C7RA 3HTKA 3CWBJ 4ASWA 1NGMB 3L72E 2R44A 3WUVA 2WPRA 3G6EP 1H0TA 3CX5H 4MN4C 2FYUG 3L74J 1ZR4A 3BRTB 1M8OB 2Q7CA 2Q5UA 2KNCA 5KLVE 2O1KA 2R5BA 3IF4A 1S4XA 1RH5B 1L4AC 2FBWC 2YXRB 3HRNA 4HYTB 4PD4E 2AEFA 2QE7H 4IOIH 5TISE 5KTBA 5DJUB 1J1DB 2A45G 1AVYA 5B66H 3TGUE 3SWYA 1FC2C 2RMZA 3CWBG 2V7QJ 5CMZA 4UB8E 4EIJA 2XZRA 1BCCG 2R5DA 4PJ0E 3SFDC 3AE8C 4D6TG 1AJYA 1YI2P 4Y99B 2ZYAA 1K04A 4BRYB 1CSBA 1PL5A 1NAFA 2M8RA 3EQ2A 4DT0A 1KILA 1LWUB 1GTWA 1IK9A 3IN6A 2UWJE 3KZIE 2WT7B 3LIEA 3PLNA 1OX3A 2H43A 1SQQK 1NTKD 2CPBA 3E1IA 1N73B 2D2CB 2QIWA 1OW7A 2P67A 3S9OA 3RL0C 1LT9C 3A0HH 3A2AA 1ZW0A 2KS1A 3H1ID 3LIDA 3H1HJ 1NKNA 2E75B 4N78D 3PRJA 1W5CE 4C46A 1BGYJ 1EZVE 1SQBD 2DW3A 1K8AQ 2JJLA 1UIXA 4I7ZB 4W7YA 1RQUA 1SQXJ 4WY4D 1USDA 2N1TB 1T3UA 3HUSA 1SFCC 1FAVA 2QSIA 4GODA 1BSHA 1JMBA 3O6QB 1JTHA 1G2CA 2KSJA 2YMYA 5KLVK 2FYZA 4PD4I 3SFEC 5H2FH 3I56P 5APYA 2OYIA 2E5TA 3BVHA 1PV3A 1KYOD 1N7SA 1R5SA 4TT3H 3JSVC 3AEGC 1P84D 3O8ZA 5AVZB 1FJKA 3C8VA 4OGQC 3TF5A 2QM8A 1BDCA 3IR9A 3VMZA 1YQ4C 3AEFC 4R4LA 1RF0A 2M3EA 3H1LJ 1SQBJ 4Y99C 3CCQP 2FFDB 3OA7A 2O1JA 1LT9A 3FWNA 2YO3A 3V2QA 3H1IJ 2H8PD 3C9IA 3CCRP 2I1KA 2E42A 4EI2A 2HODA 3VTPC 1YTZT 1PP9G 3B71A 1M1JA 3RK2C 1N2DC 1VQKP 3CCJP 2GUVA 1NTKJ 3L70J 4HB1A 1SQBE 4RKUJ 1RE3A 1PGQA 5AW7B 4NPEA 1N7SD 3GF7A 1JO5A 3L75D 1JY3P 2JDIH 2IPPA 2JWDA 4N6JA 1VL2A 2W90A 1SQVG 1S2EA 4N3YB 1NU1D 2QJYB 2OYIB 3V4QA 3L75E 2WMMA 5BU5A 3H1IG 4HJGH 2A45H 1OVRA 1EDIA 1JY3N 1GL2A 1L0NE 1PPJE 2P58A 3H1JJ 1NU1J 2A06D 1L4AB 2M0BA 3EWKA 5KAFH 5KLVG 1VF5B 1NTKG 4RJTA 4BWNA 1H89A 1LTIC 4AUWA 1PZQA 1K05A 2SPZA 4H13C 1R5LA 3HD7D 1KILD 4I1LA 3CPWO 1FZBA 1IZNB 1YBKA 2W27A 1CZQA 1IC2A 4GKGA 1NAYA 2E76D 5B5EH 2Q3IA 3KHUA 1R8EA 2BCCE 4GOFA 4OGQB 2OTJP 1ZV8A 4JPZB 1OFCX 1NTZE 3V5BA 4Z1MH 5KAIE 1L2PA 2AXCA 4PD4D 4YXWH 3G9RA 1LWUC 5AVQB 5AVUB 3V4WA 5BU8B 3GG2A 2WPSA 1YTZI 3A3YB 3PHLA 2RN0A 4C7NA 3TNUA 1KQLA 1NTMG 4OVNF 3D71A 2M5AA 2WITA 1RF0C 3RL0B 1EZVG 1SFCB 1RQVA 1KV4A 3HD7A 3H32A 2AXTE 1GMJA 2E75C 2WSFH 4LLHA 3WU2H 2KNCB 1BSNA 1L0LJ 3GHGB 1M1KQ 2H89C 2BEZF 2PFXA 3N7NA 1GDTA 1N7SC 4PD4H 5CJ0A 5TISH 2QJPC 4EOTA 1URQC 2GA1A 4H44D 1PPJG 2J58A 2QJYC 1LT1A 4N78E 2N1TC 4OWFA 2KUBA 3AE5C 5B66E 3RK2D 2XDJA 3BATA 3FXEA 3A0BH 1N8RQ 3M0AA 2Y0DA 1LP1A 2Q3EA 3M9QA 2P10A 1RF1A 1AQ5A 1L0LE 1T6AA 2IBZE 4LC1A 3CLQA 3MUDA 3R2PA 1EDLA 3CX5E 1DD3A 3L72J 4H13B 5AVVB 2R3SA 3TK1A 4CPGA 3CD6P 1LGHB 1XTCC 3B4SA 2AXTH 2R3CA 2IBZG 4IFDK 2Z5IA 4OGQD 2OYOA 3G71P 1GL2D 1Q81Q 1RE4C 3VP8A 2E76B 2KSEA 2JKVA 3T97A 5AW2B 1SQPE 1LJ2A 2VRSA 4QMAA 3HD7B 4WVZA 3A0HE 2O01H 2KLUA 1VQNP 1IFDA 1JOCA 2NPSB 4K35A 1EQ7A 4WBAA 5GTHH 3Q5SA 1N73A 1QLED 1FOSE 3D70A 1FDOA 1FBMA 1NHLA 2B87B 1HUCA 4A7PA 3CXHH 2L91A 2HR3A 1J1EB 1EDJA 4O9BA 2IYPA 4WY4C 1AVOA 1VQ5P 2QG4A 1FE6A 3L72D 3M9BA 1JEKA 3EFGA 1RF1B 3UIAA 1BE3E 2OTKE 3L70E 3O6QA 3USSA 1ZXGA 5CCHD 1M57D 1PFIA 3A7OA 3M06A 4L75A 1PGPA 2FYUK 2GUSA 3RL0D 3AE6C 2O01N 2YIUB 1OIPA 2C0XA 3L70G 4D6TE 2HFED 2KLVA 2LXBA 3BASA 1VF5C 3E1RA 2WT7A 1Z56A 1SQBK 3CXHE 1KC8Q 3P8MC 1NTMK 3TGUG 2CPSA 2G3AA 2FXMA 4JYBA 1KTMA 1IK7A 1IFNA 3LW5H 3CCLP 1M1JC 3L73J 1LTTC 1OZHA 2P1JA 1E5WA 3Q5PA 3H1KD 1KYOE 3BCCJ 2ZVOB 5APTA 1CW5A 5CCHA 1A02J 2WPQA 3B5NC 5KLVJ 1KILB 1SQQD 2E74C 2HODB 3RK3D 1JM0A 2XKMA 3KDPB 3L75G 3VMAA 4WY4A 3GHGC 2NPSC 2ZXXA 1LTJA 1YHQP 1L4AD 3JCUH 4ZMDA 2QJPB 1N86A 2B88A 3ITKA 4KT0J 3E7KA 3NMDA 1N73C 3H1KG 2Z5HA 1VDFA 5APUA 1NTME 1ZRTD 2J5UA 2WTYA 1FZCA 3CCMP 4L74A 4Y28J 1HBWA 4LGDE 5APQA 1N7SB 1SQPJ 2E75D 3FX0A 1P84I 1GD2E 1KD1Q 2QEXP 2ZXEB 1JTHB 2FYUJ 2HYNA 3F5HA 3H1HG 3L74G 3MIWA 2I1JA 4HH2A 1KB9H 5BVZA 1X0TA 5E79E 2IBZI 4JBZA 5KJ7A 2IFMA 2Y0EA 2YXQB 3CX5I 1ZLLA 1SQXG 3CXHI 3H1HE 2Q9IA 5APSA 3I5CA 5AVWB 1MUUA 1J2JB 2NZ2A 1BE3J 3L70D 1K9MQ 2JP3A 1EC5A 2FXPA 2D2CC 2JO1A 3HE4B 1SFCA 2E76C 5AW5B 3AEAC 1LT9B 2IZ1A 2J59M 1JB0J 1KILC 2I8DA 2YO2A 3HD7C 1KB9D 4H0LD 3TDKA 5AW9B 3VN0A 4GDOA 1L0LK 1OVVA 4HKZH 1FJPA 5AW4B 3U59A 3R4YA 1KB9E 5E79H 3SWFA 3Q2YA 3GHGA 4ASVA 4I7ZC 1S5LE 1GL2B 5L8RJ 1J1EC 3NTNA 1IFIA 1FU1A 2YIUC 5CBOA 4ZNCA 1SVFA 2E43A 2YKPA 3CC7P 3Q1MA 1W2BO 2FY8A 2MJZA 2GM4A 1G2CB 4UB8H 5CCGA 1YYCA 1L4AA 1KILE 1SQVK 4EDFA 5AVYB 3G4SP 2L5GB 2Y0CA 4YTPC 3RGUA 1K73Q 5APXA 1S3JA 1DX7A 1P84E 2K3RA 4DCKA 2WQYC 2A06E 2IBZD 3WU2E 1ZMEC 1KFNA 1EDKA 1Y47A 3OJAB 4XA4A 5CBNA 1LTGC 3HE4A 2W6AA 2LXCB 3B5NB 3L37A 5CCGC 1ZOYC 1U7JA 4BXLA 1HJ0A 1FZEA 2OYHC 3D6YA 2WSCH 1FDMA 2IZ0A 3HE5B 3P8CE 1KQGB 2E74D 3L71G 3A0BE 1LTAC 1X9VA 1KYOI 2IDBA 5C39A 1PPJD 2K9JA 1CI6B 2B87A 3RK2B 1LTJB 3MP7B 4B86A 2E74B 1ZP0C 1JCCA 1Q2NA 1RE3C 2FYUE 3AEEC 1PP9E 3TGUJ 3Q3DA 3G3ZA 1HH0A 1KQFB 2M3BA 1KMIZ 2M5AB 4KHXA 1QGKB 1JY3O 3AEDC 3RK3E 5K5GB 1QX8A 2ZT9B 2JR8A 3MGNA 1SFCD 1IFMA 1RHZB 3L71J 3RBXA 3TSIA 3MZWB 4XE5B 3P7KA 4TLFA 3MHVA 1Y8AA 1OVUA 3U1AA 2BCCD 2MKVA 5GTHE 2QVAA 1SS1A 3OW2O 1KFMA 3L4FA 1LP1B 3GMAA 3L74E 1FZFA 1BDDA 1NTMJ 1NVOA 3CC4P 1SQVJ 3A5TA 1GK6A 2WPVB 2HG5D 1YIJP 1QVGO 2OTLP 1IO4A 3FWLA 1BCCE 3L74D 4GOEA 3OAKA 4GT1A 5AVSB 3KXDA 2AEMA 1L0LG 1IFPA 3AE2C 3CX5D 3L73D 1EXJA 2V7QH 1AFOA 1NU1G 1IFJA 1NOHA 3VMYA 3WUTA 2OYHB 1QL2A 3H1JE 1SQXE 3EFFK 4AYCA 3FGAD 1E79H 2K9YA 3U1CA 1BCCJ 1SQQG 1NO4A 4UB6H 4D6TJ 3CCEP 1PP9D 1SLQA 2XNXA 3CMEP 3I55P 1LTJC 1SQVD 2NPSA 2PRRA 2FYNC 3P32A 3PH0A 3Q5RA 1NTKE 4WWIA 1J1DC 2KB7P 2ZYGA 5CCGD 2IYOA 4K3AA 1VQ4P 3GF3A 1NKZB 3CCUP 3P8CD 3BCCE 1FZCC 2OARA 5KLIB 5H2FE 4JYCA 1DH3A 1S5LX 1AQTA 1USEA 1NTZG 2ZJSE 4EYYQ 2HPCA 2B9BA 3VP9A 1KN7A 2Q1KA 3JCUE 4UB6E 1NTZD 1M56D 1KZUB 4KJMA 3C1LA 4PV1C 4U3FD 3VYIA 3TGUD 3IAOA 1Q86Q 3TYYA 5M1BA 2OYIC 3B5NA 1OW8A 1PGOA 4IL6H 2YKQA 1ZN5A 2KS1B 2KYVA 3H25A 2H7HA 1WT6A 3B8EB 1JUNA 1VQPP 1H88A 1NTZJ 1UIIA 1SQPK 2Z4EA 1H0TB 3RK3B 3M9HA 1Y9BA 1L0ND 4H0LC 1QVFO 2YKOA 3L72G 4I2LC 3HTKB 1LNQA 1SQQE 2CK3H 3QWOC 2D2CD 2XV5A 2ZT9D 1SQVE 3NXSA 4I6MC 2K1AA 1DIPA 1WMKA 1S5LH 2O01J 1VQ9P 1SQBG 4WY4B 2AEJA 2ZVNB 2KOGA 3H1IE 4W80A 2KZIA 5AW0B 4H13D 3M0DA 3MD0A 1MKMA 2WSCJ 3GLMA 1DEEG 3BCCG 3PTZA 1PP9J 5AVXB 1GZLA 5APWA 5KJ7D 1XTGB 5KLIC 4D6TD 1BCCD 1FZCB 3V6IA 2FFDC 1YITP 1IJDB 3CCVP 3S4RA 3SWKA 1JY2P 3S1KA 3MUDC 2JEEA 1Q90D 3K5BA 2QM7A 2C9NY 5B5EE 1VQLP 2KXPB 5GTIE 2HPCB 2BEQD 1NWQA 1SQXK 1GU4A 3AE9C 3L36A 1S72P 1VQOP 1FOSF 2LKMA 1W2EA 1JY2N 1LTBC 1M1JB 1Q7YQ 2YNYA 3HE5A 2R32A 3H1JG 1EZVD 2K88A 4W7ZA 5APVA 1T2KC 1VPCA 5CHXA 3AEBC 1M7LA 4NPDA 2FKWB 1NTMD 1NU1K 1ZRTE 2NPSD 2KIKA 2Q6QA 2RKLA 2WSFJ 2Y9YA 3KQGA 1YJ9P 2WSEJ 1SP4A 1NTZK 2W8ZA 1P84H 3PJSK 2BCCJ 2C0WA 4WB4A 1QL1A 2WSEH 3B5ND 3RK3C 3H1JD 1T3JA 1PIXA 3L71D 2FYUD 2B89A 1D7MA 1FDIA 1VQMP 2N1TA 3F89A 3HUSB 2FYNB 1OWAA 3L73E 4GIFA 3M0DC 1URQA 5CJ4A 5KKZC 3H1KE 4U7JA 1TU3F 3L75J 3CL3D 4PV1B 5AW6B
chains in the Genus database with same CATH topology
3VOPA 1A02F 2FFDA 1ZR2A 1G1IA 2PAJA 2XU6A 3CI9A 1X79B 1GU5A 2IX7C 5CCHC 1LWUA 1OXZA 2ZFCA 1HJBA 4DZOA 2OYHA 2WZ7A 2IFNA 2N9BA 4AQRD 2HLOA 3MTUE 1GK4A 1NH4A 1URQB 1FZAA 5AW8B 3NFQA 3V2NA 4IFFA 1CI6A 1S9KE 1GL2C 1HTLC 1MV8A 3PP5A 3KPEA 3WMM0 1NTKK 3H6PA 1HGZA 2A45I 2POHA 4DOJA 1HGVA 1JY2O 4M3LA 1T2KD 1LTSC 2N1TD 5CJ0A 2BASA 2P7JA 1URQD 1H8AA 4OH8B 1RE4A 5AVRB 2W6BA 4JF7A 3L35A 3M91A 1X8YA 2C9LY 5KJ7C 1L0NK 3V2RA 1RF1C 1HVVA 2WWWA 1GW4A 3IFMA 3H32B 1DEBA 3KYQA 4RESB 4IFMA 1N7LA 2PP6A 1HWTC 1G1JA 1RY3A 1WRGA 3HUSC 3VMXA 1MZ9A 4ZKPA 1T8ZA 5AVTB 3II6A 2HPCB 1MFZA 3V2PA 1S9KD 1JCDA 1JNMA 3BRVB 1GW3A 2P2UA 1FZGA 1JMMA 3N4XA 4ZKUA 4C7NB 2KP8A 5AW3B 3TNUB 4C7RA 5AW1B 3HTKA 2WPRA 1N73B 1ZR4A 3BRTB 2Q7CA 2Q5UA 2O1KA 2R5BA 1L4AC 3HRNA 4HYTB 5KTBA 1J1DB 2A45G 3SWYA 5CMZA 4EIJA 2XZRA 2R5DA 4Y99B 1CSBA 1NAFA 2M8RA 3EQ2A 1KILA 1LWUB 1GTWA 1IK9A 2WT7B 3LIEA 2H43A 1SQQK 3E1IA 2CPBA 2P67A 3RL0C 1LT9C 3A2AA 3LIDA 1NKNA 4N78D 4C46A 2JJLA 4W7YA 4WY4D 2N1TB 1T3UA 3HUSA 1SFCC 1FAVA 1JTHA 1G2CA 2KSJA 2YMYA 5KLVK 2FYZA 5APYA 2OYIA 3BVHA 1N7SA 3O8ZA 5AVZB 1FJKA 2QM8A 3IR9A 3VMZA 4Y99C 2FFDB 1RF0A 3OA7A 2O1JA 1LT9A 2YO3A 3V2QA 2H8PD 3C9IA 2I1KA 2E42A 2HODA 3VTPC 1YTZT 3RK2C 1M1JA 1N2DC 2GUVA 1RE3A 5AW7B 1JO5A 1N7SD 1JY3P 2IPPA 4N6JA 4N3YB 2OYIB 3V4QA 5BU5A 2A45H 1JY3N 1GL2A 1L4AB 1H89A 1LTIC 4AUWA 3HD7D 1KILD 4I1LA 1FZBA 2W27A 1CZQA 1IC2A 4GKGA 2Q3IA 1ZV8A 3V5BA 3V4WA 1LWUC 5AVQB 5AVUB 5BU8B 2WPSA 1YTZI 3A3YB 4C7NA 3TNUA 1KQLA 2WITA 1RF0C 3RL0B 1SFCB 3HD7A 3H32A 4LLHA 2WSFH 3GHGB 1GDTA 3N7NA 1N7SC 4EOTA 1URQC 2OYIC 2J58A 4N78E 2N1TC 3RK2D 2XDJA 3BATA 3M0AA 3M9QA 1AQ5A 1RF1A 4LC1A 3CLQA 3MUDA 3R2PA 5AVVB 3TK1A 1LGHB 1XTCC 2R3CA 4IFDK 2Z5IA 1GL2D 1RE4C 3VP8A 3T97A 5AW2B 2VRSA 3HD7B 2O01H 1IFDA 1JOCA 2NPSB 4WBAA 1EQ7A 1FOSE 1N73A 1FBMA 1NHLA 1HUCA 1J1EB 4O9BA 4WY4C 3M9BA 3EFGA 1RF1B 3UIAA 5CCHD 1PFIA 3A7OA 3M06A 2FYUK 2GUSA 3RL0D 2C0XA 2HFED 2KLVA 3BASA 2WT7A 1Z56A 1SQBK 3P8MC 1NTMK 2CPSA 4JYBA 2FXMA 1IFNA 3LW5H 1M1JC 1LTTC 2P1JA 1E5WA 5APTA 1CW5A 5CCHA 1A02J 2WPQA 3B5NC 1KILB 2HODB 3RK3D 2XKMA 3KDPB 4WY4A 3GHGC 2NPSC 1LTJA 1L4AD 1N86A 3NMDA 1N73C 2Z5HA 1VDFA 5APUA 2WTYA 1FZCA 1HBWA 4LGDE 5APQA 1N7SB 1GD2E 2ZXEB 1JTHB 2HYNA 4HH2A 3MIWA 2I1JA 5BVZA 5KJ7A 2IFMA 2Q9IA 1ZLLA 5APSA 3I5CA 5AVWB 1MUUA 1J2JB 3HE4B 1SFCA 5AW5B 1LT9B 2J59M 2YO2A 1KILC 3VN0A 3HD7C 2C9NY 5AW9B 1FJPA 1L0LK 5AW4B 3U59A 3SWFA 3GHGA 1GL2B 1J1EC 3NTNA 1IFIA 1FU1A 1SVFA 2E43A 2YKPA 2GM4A 2MJZA 1G2CB 5CCGA 1YYCA 1L4AA 1SQVK 5AVYB 2L5GB 5APXA 1DX7A 1KFNA 3OJAB 4XA4A 1LTGC 3HE4A 2W6AA 3B5NB 3L37A 5CCGC 2OYHC 1FZEA 2WSCH 1FDMA 3HE5B 3P8CE 1LTAC 1X9VA 3RK2B 1CI6B 1H88A 1LTJB 4B86A 1JCCA 1RE3C 3G3ZA 1HH0A 2M3BA 4KHXA 1JY3O 3MGNA 1SFCD 1IFMA 3TSIA 4XE5B 3P7KA 3U1AA 1KFMA 3L4FA 1FZFA 3A5TA 1GK6A 2HG5D 1IO4A 4GT1A 3OAKA 5AVSB 1AFOA 1IFJA 1NOHA 3VMYA 2OYHB 1QL2A 4AYCA 3U1CA 1NO4A 1SLQA 2XNXA 1LTJC 2NPSA 3P32A 1J1DC 2KB7P 5CCGD 1NKZB 3P8CD 1FZCC 2OARA 4JYCA 1DH3A 2HPCA 3VP9A 1KZUB 3VYIA 3TYYA 3B5NA 2YKQA 1ZN5A 2KYVA 2H7HA 1JUNA 1WT6A 3B8EB 2Z4EA 1SQPK 3RK3B 3M9HA 2YKOA 4I2LC 3HTKB 2XV5A 3NXSA 4I6MC 4WY4B 2KOGA 4W80A 5AW0B 3M0DA 3MD0A 5AVXB 1GZLA 5APWA 5KJ7D 1XTGB 1FZCB 2FFDC 1IJDB 1JY2P 2JEEA 2QM7A 1NWQA 1SQXK 1GU4A 3L36A 1FOSF 2LKMA 1W2EA 1JY2N 1LTBC 1M1JB 2YNYA 3HE5A 2R32A 1T2KC 5APVA 4W7ZA 1VPCA 5CHXA 1M7LA 2FKWB 1NU1K 2NPSD 3KQGA 1SP4A 1NTZK 4WB4A 3RK3C 2C0WA 1QL1A 2WSEH 3B5ND 1T3JA 2N1TA 3HUSB 1OWAA 4GIFA 3M0DC 1URQA 5CJ4A 3CL3D 5AW6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHX A;  1HUC A;  3MGN A;  1A02 F;  2P67 A;  4XE5 B;  3P7K A;  3A2A A;  2XU6 A;  3LID A;  3M9B A;  1GU5 A;  3UIA A;  4C46 A;  1OXZ A;  2JJL A;  2ZFC A;  3A7O A;  1GK6 A;  4DZO A;  3M06 A;  3A5T A;  1HJB A;  1FOS E;  1IO4 A;  4GT1 A;  1FAV A;  3OAK A;  5AVS B;  2N9B A;  4AQR D;  2WT7 A;  3VMY A;  3P8M C;  5APY A;  1GK4 A;  4AYC A;  4JYB A;  5AW8 B;  3NFQ A;  1CI6 A;  5AW6 B;  1S9K E;  3O8Z A;  5AVZ B;  1SLQ A;  1MV8 A;  2QM8 A;  5APT A;  3IR9 A;  1A02 J;  2WPQ A;  3VMZ A;  3P32 A;  3KDP B;  2YO3 A;  4M3L A;  2E42 A;  1T2K D;  3NMD A;  3VTP C;  2Z5H A;  4JYC A;  5APU A;  2BAS A;  1DH3 A;  2WTY A;  2P7J A;  5AW7 B;  1HBW A;  1H8A A;  5APQ A;  2IPP A;  5AVR B;  3VYI A;  3L35 A;  3M91 A;  3TYY A;  3V4Q A;  1GD2 E;  1X8Y A;  2C9L Y;  2ZXE B;  2H7H A;  1JUN A;  3B8E B;  2WWW A;  1H89 A;  4AUW A;  4RES B;  3M9H A;  5APS A;  3I5C A;  2W27 A;  5AVW B;  1CZQ A;  1J2J B;  1MUU A;  4GKG A;  4I2L C;  1HWT C;  2XV5 A;  2Q3I A;  3HE4 B;  3NXS A;  4I6M C;  5AW5 B;  3VMX A;  3V5B A;  2YO2 A;  3VN0 A;  5AW0 B;  2C9N Y;  5AVT B;  5AW9 B;  3V4W A;  3M0D A;  5AVQ B;  5AVU B;  3MD0 A;  1MFZ A;  2WPS A;  3A3Y B;  5AW4 B;  4C7N A;  3SWF A;  3TNU A;  1KQL A;  1S9K D;  5AVX B;  1GZL A;  5APW A;  1JNM A;  3NTN A;  2P2U A;  2E43 A;  4C7N B;  2KP8 A;  2QM7 A;  1G2C B;  5AW3 B;  3TNU B;  5AW1 B;  1YYC A;  3HTK A;  5AVY B;  4EOT A;  1NWQ A;  1GU4 A;  3L36 A;  1FOS F;  5APX A;  2WPR A;  2Q7C A;  2Q5U A;  2YNY A;  2R32 A;  3HE5 A;  5APV A;  2R5B A;  1T2K C;  3M0A A;  3HE4 A;  2W6A A;  3L37 A;  4HYT B;  4LC1 A;  3KQG A;  1SP4 A;  3HE5 B;  5AVV B;  3TK1 A;  2R3C A;  2Z5I A;  5CMZ A;  2XZR A;  2R5D A;  1CI6 B;  1H88 A;  4B86 A;  3T97 A;  1OWA A;  5AW2 B;  2VRS A;  1CSB A;  1NAF A;  1GTW A;  2WT7 B;  3LIE A; 
#chains in the Genus database with same CATH topology
 1VF5 D;  2W83 C;  1BGY E;  2ITA A;  3AE1 C;  3VOP A;  3CC2 P;  1A02 F;  2FFD A;  2A06 G;  5EFW B;  4R4M A;  3AE4 C;  1Q82 Q;  1FS0 E;  1G1I A;  1AA0 A;  2PAJ A;  4H44 B;  1S1C X;  2XU6 A;  1ZR2 A;  3CI9 A;  2QRX A;  1X79 B;  2ZYD A;  3KZI H;  4BRY A;  1GU5 A;  2IX7 C;  5CCH C;  1KYO H;  2G8Y A;  2FXO A;  4NPF X;  1LWU A;  2QJK C;  3D6Z A;  1EXI A;  1OXZ A;  1SQP G;  3H1L D;  2KZJ A;  2ZFC A;  4H0L B;  4L73 A;  5KLV D;  3RBZ A;  4DZO A;  3L71 E;  3CCS P;  1HJB A;  1YQ3 C;  3BCC D;  3W68 A;  2OYH A;  2WZ7 A;  3AEC C;  4YPC A;  2IFN A;  2E5Y A;  3ABV C;  2N9B A;  2KK7 A;  1KQS O;  4AQR D;  2V4H A;  2HLO A;  3MTU E;  1YJN P;  2QA4 P;  1GK4 A;  1NH4 A;  1URQ B;  1FZA A;  5AW8 B;  3NFQ A;  3V2N A;  2O3J A;  4IFF A;  2K9J B;  1CI6 A;  1S9K E;  1BE3 G;  1NYH A;  1GL2 C;  2XND H;  1HTL C;  1MV8 A;  2ZAE B;  1L0N G;  3FXD A;  3PP5 A;  1SQX D;  3KPE A;  4JQ0 D;  3WMM 0;  1NTK K;  3H6P A;  1BGY D;  2H88 C;  1VQ7 P;  1HGZ A;  2A45 I;  3LW5 J;  2POH A;  2LR2 A;  4L76 A;  4DOJ A;  1U57 A;  1HGV A;  1JY2 O;  1NJI Q;  1BGY G;  3H1H D;  4M3L A;  2PGD A;  2OGU A;  2Y9Z A;  1T2K D;  1LTS C;  2N1T D;  1DD4 A;  1BE3 D;  2BAS A;  2WSS H;  3AE7 C;  2P7J A;  2OQQ A;  4H44 C;  4U3F G;  3WUU A;  4IL6 E;  1KOR A;  1L0N J;  1URQ D;  3ZDM A;  4DJG A;  1VQ8 P;  1AV1 A;  1NU1 E;  2YMK A;  1H8A A;  4OH8 B;  1RE4 A;  5AVR B;  2W6B A;  4JF7 A;  3L35 A;  3M91 A;  1EZV I;  3SSU A;  2KI7 B;  2W6J H;  1HF9 A;  4XFJ A;  1X8Y A;  2C9L Y;  5KJ7 C;  2RH0 A;  1L0N K;  1U7M A;  1MFT A;  2NRG A;  3V2R A;  1KB9 I;  1M90 Q;  1OMI A;  1SQP D;  1HVV A;  3H1L G;  4U3F J;  2WWW A;  1GW4 A;  3IFM A;  1RF1 C;  3H32 B;  1DEB A;  3KYQ A;  4RES B;  3L73 G;  4IFM A;  1N7L A;  2PP6 A;  3H1L E;  1HWT C;  2ZT9 C;  5KAF E;  3GW6 A;  1G1J A;  1RY3 A;  1WRG A;  3HUS C;  3VMX A;  1MZ9 A;  4ZKP A;  1QEX A;  4U3F E;  1VQ6 P;  5KKZ B;  1OW6 A;  1T8Z A;  1X22 A;  3AE3 C;  3CWB D;  3II6 A;  5DJT B;  5AVT B;  5TJH A;  2JWA A;  4YXD C;  1L0L D;  3CXH D;  1MFZ A;  1SQQ J;  2BCC G;  3QH9 A;  3RL0 g;  3CWB E;  3V2P A;  3CMA P;  3W67 A;  1S9K D;  1JCD A;  3H1K J;  5GTI H;  3JC2 2;  1JNM A;  3BRV B;  4IL6 X;  5KAI H;  2WVR A;  1GW3 A;  2P2U A;  4RO0 A;  1YJW P;  1FZG A;  1JMM A;  3N4X A;  2K37 A;  4ZKU A;  4C7N B;  2N9Y B;  2KP8 A;  4PV1 D;  5AW3 B;  3T97 B;  1PGJ A;  5AW1 B;  4PJ0 H;  3TNU B;  2QJK B;  4C7R A;  3HTK A;  3CWB J;  4ASW A;  1NGM B;  3L72 E;  2R44 A;  3WUV A;  2WPR A;  3G6E P;  1H0T A;  3CX5 H;  4MN4 C;  2FYU G;  3L74 J;  1ZR4 A;  3BRT B;  1M8O B;  2Q7C A;  2Q5U A;  2KNC A;  5KLV E;  2O1K A;  2R5B A;  3IF4 A;  1S4X A;  1RH5 B;  1L4A C;  2FBW C;  2YXR B;  3HRN A;  4HYT B;  4PD4 E;  2AEF A;  2QE7 H;  4IOI H;  5TIS E;  5KTB A;  5DJU B;  1J1D B;  2A45 G;  1AVY A;  5B66 H;  3TGU E;  3SWY A;  1FC2 C;  2RMZ A;  3CWB G;  2V7Q J;  5CMZ A;  4UB8 E;  4EIJ A;  2XZR A;  1BCC G;  2R5D A;  4PJ0 E;  3SFD C;  3AE8 C;  4D6T G;  1AJY A;  1YI2 P;  4Y99 B;  2ZYA A;  1K04 A;  4BRY B;  1CSB A;  1PL5 A;  1NAF A;  2M8R A;  3EQ2 A;  4DT0 A;  1KIL A;  1LWU B;  1GTW A;  1IK9 A;  3IN6 A;  2UWJ E;  3KZI E;  2WT7 B;  3LIE A;  3PLN A;  1OX3 A;  2H43 A;  1SQQ K;  1NTK D;  2CPB A;  3E1I A;  1N73 B;  2D2C B;  2QIW A;  1OW7 A;  2P67 A;  3S9O A;  3RL0 C;  1LT9 C;  3A0H H;  3A2A A;  1ZW0 A;  2KS1 A;  3H1I D;  3LID A;  3H1H J;  1NKN A;  2E75 B;  4N78 D;  3PRJ A;  1W5C E;  4C46 A;  1BGY J;  1EZV E;  1SQB D;  2DW3 A;  1K8A Q;  2JJL A;  1UIX A;  4I7Z B;  4W7Y A;  1RQU A;  1SQX J;  4WY4 D;  1USD A;  2N1T B;  1T3U A;  3HUS A;  1SFC C;  1FAV A;  2QSI A;  4GOD A;  1BSH A;  1JMB A;  3O6Q B;  1JTH A;  1G2C A;  2KSJ A;  2YMY A;  5KLV K;  2FYZ A;  4PD4 I;  3SFE C;  5H2F H;  3I56 P;  5APY A;  2OYI A;  2E5T A;  3BVH A;  1PV3 A;  1KYO D;  1N7S A;  1R5S A;  4TT3 H;  3JSV C;  3AEG C;  1P84 D;  3O8Z A;  5AVZ B;  1FJK A;  3C8V A;  4OGQ C;  3TF5 A;  2QM8 A;  1BDC A;  3IR9 A;  3VMZ A;  1YQ4 C;  3AEF C;  4R4L A;  1RF0 A;  2M3E A;  3H1L J;  1SQB J;  4Y99 C;  3CCQ P;  2FFD B;  3OA7 A;  2O1J A;  1LT9 A;  3FWN A;  2YO3 A;  3V2Q A;  3H1I J;  2H8P D;  3C9I A;  3CCR P;  2I1K A;  2E42 A;  4EI2 A;  2HOD A;  3VTP C;  1YTZ T;  1PP9 G;  3B71 A;  1M1J A;  3RK2 C;  1N2D C;  1VQK P;  3CCJ P;  2GUV A;  1NTK J;  3L70 J;  4HB1 A;  1SQB E;  4RKU J;  1RE3 A;  1PGQ A;  5AW7 B;  4NPE A;  1N7S D;  3GF7 A;  1JO5 A;  3L75 D;  1JY3 P;  2JDI H;  2IPP A;  2JWD A;  4N6J A;  1VL2 A;  2W90 A;  1SQV G;  1S2E A;  4N3Y B;  1NU1 D;  2QJY B;  2OYI B;  3V4Q A;  3L75 E;  2WMM A;  5BU5 A;  3H1I G;  4HJG H;  2A45 H;  1OVR A;  1EDI A;  1JY3 N;  1GL2 A;  1L0N E;  1PPJ E;  2P58 A;  3H1J J;  1NU1 J;  2A06 D;  1L4A B;  2M0B A;  3EWK A;  5KAF H;  5KLV G;  1VF5 B;  1NTK G;  4RJT A;  4BWN A;  1H89 A;  1LTI C;  4AUW A;  1PZQ A;  1K05 A;  2SPZ A;  4H13 C;  1R5L A;  3HD7 D;  1KIL D;  4I1L A;  3CPW O;  1FZB A;  1IZN B;  1YBK A;  2W27 A;  1CZQ A;  1IC2 A;  4GKG A;  1NAY A;  2E76 D;  5B5E H;  2Q3I A;  3KHU A;  1R8E A;  2BCC E;  4GOF A;  4OGQ B;  2OTJ P;  1ZV8 A;  4JPZ B;  1OFC X;  1NTZ E;  3V5B A;  4Z1M H;  5KAI E;  1L2P A;  2AXC A;  4PD4 D;  4YXW H;  3G9R A;  1LWU C;  5AVQ B;  5AVU B;  3V4W A;  5BU8 B;  3GG2 A;  2WPS A;  1YTZ I;  3A3Y B;  3PHL A;  2RN0 A;  4C7N A;  3TNU A;  1KQL A;  1NTM G;  4OVN F;  3D71 A;  2M5A A;  2WIT A;  1RF0 C;  3RL0 B;  1EZV G;  1SFC B;  1RQV A;  1KV4 A;  3HD7 A;  3H32 A;  2AXT E;  1GMJ A;  2E75 C;  2WSF H;  4LLH A;  3WU2 H;  2KNC B;  1BSN A;  1L0L J;  3GHG B;  1M1K Q;  2H89 C;  2BEZ F;  2PFX A;  3N7N A;  1GDT A;  1N7S C;  4PD4 H;  5CJ0 A;  5TIS H;  2QJP C;  4EOT A;  1URQ C;  2GA1 A;  4H44 D;  1PPJ G;  2J58 A;  2QJY C;  1LT1 A;  4N78 E;  2N1T C;  4OWF A;  2KUB A;  3AE5 C;  5B66 E;  3RK2 D;  2XDJ A;  3BAT A;  3FXE A;  3A0B H;  1N8R Q;  3M0A A;  2Y0D A;  1LP1 A;  2Q3E A;  3M9Q A;  2P10 A;  1RF1 A;  1AQ5 A;  1L0L E;  1T6A A;  2IBZ E;  4LC1 A;  3CLQ A;  3MUD A;  3R2P A;  1EDL A;  3CX5 E;  1DD3 A;  3L72 J;  4H13 B;  5AVV B;  2R3S A;  3TK1 A;  4CPG A;  3CD6 P;  1LGH B;  1XTC C;  3B4S A;  2AXT H;  2R3C A;  2IBZ G;  4IFD K;  2Z5I A;  4OGQ D;  2OYO A;  3G71 P;  1GL2 D;  1Q81 Q;  1RE4 C;  3VP8 A;  2E76 B;  2KSE A;  2JKV A;  3T97 A;  5AW2 B;  1SQP E;  1LJ2 A;  2VRS A;  4QMA A;  3HD7 B;  4WVZ A;  3A0H E;  2O01 H;  2KLU A;  1VQN P;  1IFD A;  1JOC A;  2NPS B;  4K35 A;  1EQ7 A;  4WBA A;  5GTH H;  3Q5S A;  1N73 A;  1QLE D;  1FOS E;  3D70 A;  1FDO A;  1FBM A;  1NHL A;  2B87 B;  1HUC A;  4A7P A;  3CXH H;  2L91 A;  2HR3 A;  1J1E B;  1EDJ A;  4O9B A;  2IYP A;  4WY4 C;  1AVO A;  1VQ5 P;  2QG4 A;  1FE6 A;  3L72 D;  3M9B A;  1JEK A;  3EFG A;  1RF1 B;  3UIA A;  1BE3 E;  2OTK E;  3L70 E;  3O6Q A;  3USS A;  1ZXG A;  5CCH D;  1M57 D;  1PFI A;  3A7O A;  3M06 A;  4L75 A;  1PGP A;  2FYU K;  2GUS A;  3RL0 D;  3AE6 C;  2O01 N;  2YIU B;  1OIP A;  2C0X A;  3L70 G;  4D6T E;  2HFE D;  2KLV A;  2LXB A;  3BAS A;  1VF5 C;  3E1R A;  2WT7 A;  1Z56 A;  1SQB K;  3CXH E;  1KC8 Q;  3P8M C;  1NTM K;  3TGU G;  2CPS A;  2G3A A;  2FXM A;  4JYB A;  1KTM A;  1IK7 A;  1IFN A;  3LW5 H;  3CCL P;  1M1J C;  3L73 J;  1LTT C;  1OZH A;  2P1J A;  1E5W A;  3Q5P A;  3H1K D;  1KYO E;  3BCC J;  2ZVO B;  5APT A;  1CW5 A;  5CCH A;  1A02 J;  2WPQ A;  3B5N C;  5KLV J;  1KIL B;  1SQQ D;  2E74 C;  2HOD B;  3RK3 D;  1JM0 A;  2XKM A;  3KDP B;  3L75 G;  3VMA A;  4WY4 A;  3GHG C;  2NPS C;  2ZXX A;  1LTJ A;  1YHQ P;  1L4A D;  3JCU H;  4ZMD A;  2QJP B;  1N86 A;  2B88 A;  3ITK A;  4KT0 J;  3E7K A;  3NMD A;  1N73 C;  3H1K G;  2Z5H A;  1VDF A;  5APU A;  1NTM E;  1ZRT D;  2J5U A;  2WTY A;  1FZC A;  3CCM P;  4L74 A;  4Y28 J;  1HBW A;  4LGD E;  5APQ A;  1N7S B;  1SQP J;  2E75 D;  3FX0 A;  1P84 I;  1GD2 E;  1KD1 Q;  2QEX P;  2ZXE B;  1JTH B;  2FYU J;  2HYN A;  3F5H A;  3H1H G;  3L74 G;  3MIW A;  2I1J A;  4HH2 A;  1KB9 H;  5BVZ A;  1X0T A;  5E79 E;  2IBZ I;  4JBZ A;  5KJ7 A;  2IFM A;  2Y0E A;  2YXQ B;  3CX5 I;  1ZLL A;  1SQX G;  3CXH I;  3H1H E;  2Q9I A;  5APS A;  3I5C A;  5AVW B;  1MUU A;  1J2J B;  2NZ2 A;  1BE3 J;  3L70 D;  1K9M Q;  2JP3 A;  1EC5 A;  2FXP A;  2D2C C;  2JO1 A;  3HE4 B;  1SFC A;  2E76 C;  5AW5 B;  3AEA C;  1LT9 B;  2IZ1 A;  2J59 M;  1JB0 J;  1KIL C;  2I8D A;  2YO2 A;  3HD7 C;  1KB9 D;  4H0L D;  3TDK A;  5AW9 B;  3VN0 A;  4GDO A;  1L0L K;  1OVV A;  4HKZ H;  1FJP A;  5AW4 B;  3U59 A;  3R4Y A;  1KB9 E;  5E79 H;  3SWF A;  3Q2Y A;  3GHG A;  4ASV A;  4I7Z C;  1S5L E;  1GL2 B;  5L8R J;  1J1E C;  3NTN A;  1IFI A;  1FU1 A;  2YIU C;  5CBO A;  4ZNC A;  1SVF A;  2E43 A;  2YKP A;  3CC7 P;  3Q1M A;  1W2B O;  2FY8 A;  2MJZ A;  2GM4 A;  1G2C B;  4UB8 H;  5CCG A;  1YYC A;  1L4A A;  1KIL E;  1SQV K;  4EDF A;  5AVY B;  3G4S P;  2L5G B;  2Y0C A;  4YTP C;  3RGU A;  1K73 Q;  5APX A;  1S3J A;  1DX7 A;  1P84 E;  2K3R A;  4DCK A;  2WQY C;  2A06 E;  2IBZ D;  3WU2 E;  1ZME C;  1KFN A;  1EDK A;  1Y47 A;  3OJA B;  4XA4 A;  5CBN A;  1LTG C;  3HE4 A;  2W6A A;  2LXC B;  3B5N B;  3L37 A;  5CCG C;  1ZOY C;  1U7J A;  4BXL A;  1HJ0 A;  1FZE A;  2OYH C;  3D6Y A;  2WSC H;  1FDM A;  2IZ0 A;  3HE5 B;  3P8C E;  1KQG B;  2E74 D;  3L71 G;  3A0B E;  1LTA C;  1X9V A;  1KYO I;  2IDB A;  5C39 A;  1PPJ D;  2K9J A;  1CI6 B;  2B87 A;  3RK2 B;  1LTJ B;  3MP7 B;  4B86 A;  2E74 B;  1ZP0 C;  1JCC A;  1Q2N A;  1RE3 C;  2FYU E;  3AEE C;  1PP9 E;  3TGU J;  3Q3D A;  3G3Z A;  1HH0 A;  1KQF B;  2M3B A;  1KMI Z;  2M5A B;  4KHX A;  1QGK B;  1JY3 O;  3AED C;  3RK3 E;  5K5G B;  1QX8 A;  2ZT9 B;  2JR8 A;  3MGN A;  1SFC D;  1IFM A;  1RHZ B;  3L71 J;  3RBX A;  3TSI A;  3MZW B;  4XE5 B;  3P7K A;  4TLF A;  3MHV A;  1Y8A A;  1OVU A;  3U1A A;  2BCC D;  2MKV A;  5GTH E;  2QVA A;  1SS1 A;  3OW2 O;  1KFM A;  3L4F A;  1LP1 B;  3GMA A;  3L74 E;  1FZF A;  1BDD A;  1NTM J;  1NVO A;  3CC4 P;  1SQV J;  3A5T A;  1GK6 A;  2WPV B;  2HG5 D;  1YIJ P;  1QVG O;  2OTL P;  1IO4 A;  3FWL A;  1BCC E;  3L74 D;  4GOE A;  3OAK A;  4GT1 A;  5AVS B;  3KXD A;  2AEM A;  1L0L G;  1IFP A;  3AE2 C;  3CX5 D;  3L73 D;  1EXJ A;  2V7Q H;  1AFO A;  1NU1 G;  1IFJ A;  1NOH A;  3VMY A;  3WUT A;  2OYH B;  1QL2 A;  3H1J E;  1SQX E;  3EFF K;  4AYC A;  3FGA D;  1E79 H;  2K9Y A;  3U1C A;  1BCC J;  1SQQ G;  1NO4 A;  4UB6 H;  4D6T J;  3CCE P;  1PP9 D;  1SLQ A;  2XNX A;  3CME P;  3I55 P;  1LTJ C;  1SQV D;  2NPS A;  2PRR A;  2FYN C;  3P32 A;  3PH0 A;  3Q5R A;  1NTK E;  4WWI A;  1J1D C;  2KB7 P;  2ZYG A;  5CCG D;  2IYO A;  4K3A A;  1VQ4 P;  3GF3 A;  1NKZ B;  3CCU P;  3P8C D;  3BCC E;  1FZC C;  2OAR A;  5KLI B;  5H2F E;  4JYC A;  1DH3 A;  1S5L X;  1AQT A;  1USE A;  1NTZ G;  2ZJS E;  4EYY Q;  2HPC A;  2B9B A;  3VP9 A;  1KN7 A;  2Q1K A;  3JCU E;  4UB6 E;  1NTZ D;  1M56 D;  1KZU B;  4KJM A;  3C1L A;  4PV1 C;  4U3F D;  3VYI A;  3TGU D;  3IAO A;  1Q86 Q;  3TYY A;  5M1B A;  2OYI C;  3B5N A;  1OW8 A;  1PGO A;  4IL6 H;  2YKQ A;  1ZN5 A;  2KS1 B;  2KYV A;  3H25 A;  2H7H A;  1WT6 A;  3B8E B;  1JUN A;  1VQP P;  1H88 A;  1NTZ J;  1UII A;  1SQP K;  2Z4E A;  1H0T B;  3RK3 B;  3M9H A;  1Y9B A;  1L0N D;  4H0L C;  1QVF O;  2YKO A;  3L72 G;  4I2L C;  3HTK B;  1LNQ A;  1SQQ E;  2CK3 H;  3QWO C;  2D2C D;  2XV5 A;  2ZT9 D;  1SQV E;  3NXS A;  4I6M C;  2K1A A;  1DIP A;  1WMK A;  1S5L H;  2O01 J;  1VQ9 P;  1SQB G;  4WY4 B;  2AEJ A;  2ZVN B;  2KOG A;  3H1I E;  4W80 A;  2KZI A;  5AW0 B;  4H13 D;  3M0D A;  3MD0 A;  1MKM A;  2WSC J;  3GLM A;  1DEE G;  3BCC G;  3PTZ A;  1PP9 J;  5AVX B;  1GZL A;  5APW A;  5KJ7 D;  1XTG B;  5KLI C;  4D6T D;  1BCC D;  1FZC B;  3V6I A;  2FFD C;  1YIT P;  1IJD B;  3CCV P;  3S4R A;  3SWK A;  1JY2 P;  3S1K A;  3MUD C;  2JEE A;  1Q90 D;  3K5B A;  2QM7 A;  2C9N Y;  5B5E E;  1VQL P;  2KXP B;  5GTI E;  2HPC B;  2BEQ D;  1NWQ A;  1SQX K;  1GU4 A;  3AE9 C;  3L36 A;  1S72 P;  1VQO P;  1FOS F;  2LKM A;  1W2E A;  1JY2 N;  1LTB C;  1M1J B;  1Q7Y Q;  2YNY A;  3HE5 A;  2R32 A;  3H1J G;  1EZV D;  2K88 A;  4W7Z A;  5APV A;  1T2K C;  1VPC A;  5CHX A;  3AEB C;  1M7L A;  4NPD A;  2FKW B;  1NTM D;  1NU1 K;  1ZRT E;  2NPS D;  2KIK A;  2Q6Q A;  2RKL A;  2WSF J;  2Y9Y A;  3KQG A;  1YJ9 P;  2WSE J;  1SP4 A;  1NTZ K;  2W8Z A;  1P84 H;  3PJS K;  2BCC J;  2C0W A;  4WB4 A;  1QL1 A;  2WSE H;  3B5N D;  3RK3 C;  3H1J D;  1T3J A;  1PIX A;  3L71 D;  2FYU D;  2B89 A;  1D7M A;  1FDI A;  1VQM P;  2N1T A;  3F89 A;  3HUS B;  2FYN B;  1OWA A;  3L73 E;  4GIF A;  3M0D C;  1URQ A;  5CJ4 A;  5KKZ C;  3H1K E;  4U7J A;  1TU3 F;  3L75 J;  3CL3 D;  4PV1 B;  5AW6 B; 
#chains in the Genus database with same CATH homology
 3VOP A;  1A02 F;  2FFD A;  1ZR2 A;  1G1I A;  2PAJ A;  2XU6 A;  3CI9 A;  1X79 B;  1GU5 A;  2IX7 C;  5CCH C;  1LWU A;  1OXZ A;  2ZFC A;  1HJB A;  4DZO A;  2OYH A;  2WZ7 A;  2IFN A;  2N9B A;  4AQR D;  2HLO A;  3MTU E;  1GK4 A;  1NH4 A;  1URQ B;  1FZA A;  5AW8 B;  3NFQ A;  3V2N A;  4IFF A;  1CI6 A;  1S9K E;  1GL2 C;  1HTL C;  1MV8 A;  3PP5 A;  3KPE A;  3WMM 0;  1NTK K;  3H6P A;  1HGZ A;  2A45 I;  2POH A;  4DOJ A;  1HGV A;  1JY2 O;  4M3L A;  1T2K D;  1LTS C;  2N1T D;  5CJ0 A;  2BAS A;  2P7J A;  1URQ D;  1H8A A;  4OH8 B;  1RE4 A;  5AVR B;  2W6B A;  4JF7 A;  3L35 A;  3M91 A;  1X8Y A;  2C9L Y;  5KJ7 C;  1L0N K;  3V2R A;  1RF1 C;  1HVV A;  2WWW A;  1GW4 A;  3IFM A;  3H32 B;  1DEB A;  3KYQ A;  4RES B;  4IFM A;  1N7L A;  2PP6 A;  1HWT C;  1G1J A;  1RY3 A;  1WRG A;  3HUS C;  3VMX A;  1MZ9 A;  4ZKP A;  1T8Z A;  5AVT B;  3II6 A;  2HPC B;  1MFZ A;  3V2P A;  1S9K D;  1JCD A;  1JNM A;  3BRV B;  1GW3 A;  2P2U A;  1FZG A;  1JMM A;  3N4X A;  4ZKU A;  4C7N B;  2KP8 A;  5AW3 B;  3TNU B;  4C7R A;  5AW1 B;  3HTK A;  2WPR A;  1N73 B;  1ZR4 A;  3BRT B;  2Q7C A;  2Q5U A;  2O1K A;  2R5B A;  1L4A C;  3HRN A;  4HYT B;  5KTB A;  1J1D B;  2A45 G;  3SWY A;  5CMZ A;  4EIJ A;  2XZR A;  2R5D A;  4Y99 B;  1CSB A;  1NAF A;  2M8R A;  3EQ2 A;  1KIL A;  1LWU B;  1GTW A;  1IK9 A;  2WT7 B;  3LIE A;  2H43 A;  1SQQ K;  3E1I A;  2CPB A;  2P67 A;  3RL0 C;  1LT9 C;  3A2A A;  3LID A;  1NKN A;  4N78 D;  4C46 A;  2JJL A;  4W7Y A;  4WY4 D;  2N1T B;  1T3U A;  3HUS A;  1SFC C;  1FAV A;  1JTH A;  1G2C A;  2KSJ A;  2YMY A;  5KLV K;  2FYZ A;  5APY A;  2OYI A;  3BVH A;  1N7S A;  3O8Z A;  5AVZ B;  1FJK A;  2QM8 A;  3IR9 A;  3VMZ A;  4Y99 C;  2FFD B;  1RF0 A;  3OA7 A;  2O1J A;  1LT9 A;  2YO3 A;  3V2Q A;  2H8P D;  3C9I A;  2I1K A;  2E42 A;  2HOD A;  3VTP C;  1YTZ T;  3RK2 C;  1M1J A;  1N2D C;  2GUV A;  1RE3 A;  5AW7 B;  1JO5 A;  1N7S D;  1JY3 P;  2IPP A;  4N6J A;  4N3Y B;  2OYI B;  3V4Q A;  5BU5 A;  2A45 H;  1JY3 N;  1GL2 A;  1L4A B;  1H89 A;  1LTI C;  4AUW A;  3HD7 D;  1KIL D;  4I1L A;  1FZB A;  2W27 A;  1CZQ A;  1IC2 A;  4GKG A;  2Q3I A;  1ZV8 A;  3V5B A;  3V4W A;  1LWU C;  5AVQ B;  5AVU B;  5BU8 B;  2WPS A;  1YTZ I;  3A3Y B;  4C7N A;  3TNU A;  1KQL A;  2WIT A;  1RF0 C;  3RL0 B;  1SFC B;  3HD7 A;  3H32 A;  4LLH A;  2WSF H;  3GHG B;  1GDT A;  3N7N A;  1N7S C;  4EOT A;  1URQ C;  2OYI C;  2J58 A;  4N78 E;  2N1T C;  3RK2 D;  2XDJ A;  3BAT A;  3M0A A;  3M9Q A;  1AQ5 A;  1RF1 A;  4LC1 A;  3CLQ A;  3MUD A;  3R2P A;  5AVV B;  3TK1 A;  1LGH B;  1XTC C;  2R3C A;  4IFD K;  2Z5I A;  1GL2 D;  1RE4 C;  3VP8 A;  3T97 A;  5AW2 B;  2VRS A;  3HD7 B;  2O01 H;  1IFD A;  1JOC A;  2NPS B;  4WBA A;  1EQ7 A;  1FOS E;  1N73 A;  1FBM A;  1NHL A;  1HUC A;  1J1E B;  4O9B A;  4WY4 C;  3M9B A;  3EFG A;  1RF1 B;  3UIA A;  5CCH D;  1PFI A;  3A7O A;  3M06 A;  2FYU K;  2GUS A;  3RL0 D;  2C0X A;  2HFE D;  2KLV A;  3BAS A;  2WT7 A;  1Z56 A;  1SQB K;  3P8M C;  1NTM K;  2CPS A;  4JYB A;  2FXM A;  1IFN A;  3LW5 H;  1M1J C;  1LTT C;  2P1J A;  1E5W A;  5APT A;  1CW5 A;  5CCH A;  1A02 J;  2WPQ A;  3B5N C;  1KIL B;  2HOD B;  3RK3 D;  2XKM A;  3KDP B;  4WY4 A;  3GHG C;  2NPS C;  1LTJ A;  1L4A D;  1N86 A;  3NMD A;  1N73 C;  2Z5H A;  1VDF A;  5APU A;  2WTY A;  1FZC A;  1HBW A;  4LGD E;  5APQ A;  1N7S B;  1GD2 E;  2ZXE B;  1JTH B;  2HYN A;  4HH2 A;  3MIW A;  2I1J A;  5BVZ A;  5KJ7 A;  2IFM A;  2Q9I A;  1ZLL A;  5APS A;  3I5C A;  5AVW B;  1MUU A;  1J2J B;  3HE4 B;  1SFC A;  5AW5 B;  1LT9 B;  2J59 M;  2YO2 A;  1KIL C;  3VN0 A;  3HD7 C;  2C9N Y;  5AW9 B;  1FJP A;  1L0L K;  5AW4 B;  3U59 A;  3SWF A;  3GHG A;  1GL2 B;  1J1E C;  3NTN A;  1IFI A;  1FU1 A;  1SVF A;  2E43 A;  2YKP A;  2GM4 A;  2MJZ A;  1G2C B;  5CCG A;  1YYC A;  1L4A A;  1SQV K;  5AVY B;  2L5G B;  5APX A;  1DX7 A;  1KFN A;  3OJA B;  4XA4 A;  1LTG C;  3HE4 A;  2W6A A;  3B5N B;  3L37 A;  5CCG C;  2OYH C;  1FZE A;  2WSC H;  1FDM A;  3HE5 B;  3P8C E;  1LTA C;  1X9V A;  3RK2 B;  1CI6 B;  1H88 A;  1LTJ B;  4B86 A;  1JCC A;  1RE3 C;  3G3Z A;  1HH0 A;  2M3B A;  4KHX A;  1JY3 O;  3MGN A;  1SFC D;  1IFM A;  3TSI A;  4XE5 B;  3P7K A;  3U1A A;  1KFM A;  3L4F A;  1FZF A;  3A5T A;  1GK6 A;  2HG5 D;  1IO4 A;  4GT1 A;  3OAK A;  5AVS B;  1AFO A;  1IFJ A;  1NOH A;  3VMY A;  2OYH B;  1QL2 A;  4AYC A;  3U1C A;  1NO4 A;  1SLQ A;  2XNX A;  1LTJ C;  2NPS A;  3P32 A;  1J1D C;  2KB7 P;  5CCG D;  1NKZ B;  3P8C D;  1FZC C;  2OAR A;  4JYC A;  1DH3 A;  2HPC A;  3VP9 A;  1KZU B;  3VYI A;  3TYY A;  3B5N A;  2YKQ A;  1ZN5 A;  2KYV A;  2H7H A;  1JUN A;  1WT6 A;  3B8E B;  2Z4E A;  1SQP K;  3RK3 B;  3M9H A;  2YKO A;  4I2L C;  3HTK B;  2XV5 A;  3NXS A;  4I6M C;  4WY4 B;  2KOG A;  4W80 A;  5AW0 B;  3M0D A;  3MD0 A;  5AVX B;  1GZL A;  5APW A;  5KJ7 D;  1XTG B;  1FZC B;  2FFD C;  1IJD B;  1JY2 P;  2JEE A;  2QM7 A;  1NWQ A;  1SQX K;  1GU4 A;  3L36 A;  1FOS F;  2LKM A;  1W2E A;  1JY2 N;  1LTB C;  1M1J B;  2YNY A;  3HE5 A;  2R32 A;  1T2K C;  5APV A;  4W7Z A;  1VPC A;  5CHX A;  1M7L A;  2FKW B;  1NU1 K;  2NPS D;  3KQG A;  1SP4 A;  1NTZ K;  4WB4 A;  3RK3 C;  2C0W A;  1QL1 A;  2WSE H;  3B5N D;  1T3J A;  2N1T A;  3HUS B;  1OWA A;  4GIF A;  3M0D C;  1URQ A;  5CJ4 A;  3CL3 D;  5AW6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...