2P2UA

Crystal structure of putative host-nuclease inhibitor protein gam from desulfovibrio vulgaris
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
150
Chain Sequence
b'VIVADIRQAEGALAEIATIDRKVGEIEAQMNEAIDAAKARASQKSAPLLARRKELEDGVATFATLNKTEMFKSLDLGFGTIGFRLSTQIVQMSKITKDMTLERLRQFGISEGIRIKEDVNKEAMQGWPDERLEMVGLKRRTTDAFYIEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Host-nuclease inhibitor protein Gam, putative
publication title Crystal structure of putative host-nuclease inhibitor protein Gam from Desulfovibrio vulgaris
rcsb
source organism Desulfovibrio vulgaris
molecule tags Dna binding protein
total genus 26
structure length 150
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07352 Phage_Mu_Gam Bacteriophage Mu Gam like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p2uA01
2R5DA 3NXSA 3P7KA 4RESB 5APVA 2H7HA 1NAFA 3A7OA 2WPRA 2R3CA 3TNUA 1HWTC 1T2KD 4C7NB 1NWQA 1GK4A 1OWAA 2W27A 1GU4A 2ZXEB 1J2JB 3P32A 5AVQB 3NMDA 1OXZA 3O8ZA 5AVWB 2WPSA 2Z5HA 5AW9B 4C7NA 3VMZA 2YNYA 5AVRB 2P2UA 1H88A 1CI6B 3L37A 4JYBA 3VTPC 3MD0A 3OAKA 5AVXB 1G2CB 3NTNA 1IO4A 2XZRA 5AW5B 4I2LC 2P67A 1GK6A 5AW1B 3M0DA 3UIAA 4LC1A 4XE5B 3V4QA 5AVUB 3VYIA 1A02J 2WWWA 3L36A 3LIEA 5CMZA 4GT1A 5APYA 1FAVA 1CSBA 1X8YA 1JUNA 4I6MC 3KDPB 3V5BA 3LIDA 4KHXA 3TYYA 5AW2B 4AQRD 1SLQA 4AYCA 5AW0B 3TK1A 2JJLA 3HE4B 1HJBA 3A5TA 3M9BA 3P8MC 2R32A 4DZOA 2E42A 2YO3A 2Z5IA 3M0AA 1YYCA 4M3LA 5AVTB 1H8AA 2BASA 1CZQA 1FOSF 2XV5A 5APUA 3M9HA 2IPPA 2ZFCA 1CI6A 1S9KE 2E43A 1DH3A 3KQGA 5AVYB 5AW7B 2XU6A 1JNMA 5AW6B 3SWFA 5AVSB 3VN0A 1FOSE 3HE5B 3HTKA 5AVZB 2YO2A 1MUUA 2KP8A 1A02F 3VMXA 3V4WA 2R5BA 2C9NY 5AVVB 1S9KD 3I5CA 1SP4A 3M06A 5APSA 3HE4A 1KQLA 4JYCA 2VRSA 2Q5UA 4HYTB 3TNUB 4EOTA 2P7JA 5APWA 2W6AA 3L35A 5APXA 2C9LY 4B86A 1T2KC 4AUWA 3NFQA 3B8EB 5AW3B 1H89A 5APQA 1GTWA 1HUCA 2WTYA 5AW8B 3M91A 4GKGA 3A3YB 1GD2E 2WT7B 1GZLA 1MV8A 2QM8A 5APTA 1GU5A 3T97A 3VMYA 1HBWA 2Q3IA 3A2AA 3HE5A 2WT7A 2N9BA 2Q7CA 1MFZA 4C46A 5AW4B 2QM7A 2WPQA 3IR9A 3MGNA
chains in the Genus database with same CATH superfamily
1N73B 2YMYA 3NXSA 2K3RA 3R2PA 2JWDA 2LKMA 1JCCA 5AW9B 2OYHB 4WY4D 3L37A 3KXDA 4OH8B 3HUSA 2D2CC 4I2LC 1NTME 1OZHA 2QSIA 5APYA 1FZCB 1VQ5P 4HJGH 1KB9D 3H25A 4D6TJ 4WWIA 4W80A 1RE3C 1BDCA 4H44B 4WY4B 1KORA 2QJPC 3JCUH 3G6EP 1E5WA 1FS0E 2KK7A 1ZW0A 3G3ZA 1S5LX 4H13B 1H0TB 2DW3A 1LT9A 2Y0CA 5CHXA 2Q5UA 2PGDA 3H1ID 2C9LY 1SFCC 3O6QA 2XNXA 3TGUG 4OGQB 1FZGA 2O3JA 2GA1A 3A3YB 1X22A 1ZV8A 2QM8A 1K8AQ 4ASWA 4PD4H 2H88C 1SQPK 2WZ7A 1PPJD 1NU1J 2ZVNB 3IR9A 3TNUA 1UIXA 1NTKE 1KILC 3B5NA 2IZ1A 1OXZA 1VQKP 1IFNA 3L72G 3OAKA 3CMEP 4L74A 3TF5A 2N1TB 3V5BA 1Y47A 5AW0B 1NOHA 2KS1B 3CLQA 2E75C 5AVTB 3ITKA 5E79H 1N73C 3AE1C 1FZEA 3F5HA 3RGUA 5APUA 2XKMA 2L91A 3KPEA 3O6QB 4N78D 1KV4A 3KQGA 2H89C 1LTJA 4L75A 1L0LJ 2AEMA 2OYHC 1ZP0C 3AE2C 4PD4I 2V4HA 1OW6A 1PP9J 3S9OA 1FDMA 1URQD 3I5CA 1NHLA 2W8ZA 1PFIA 3TNUB 1GL2B 1EDKA 1FZBA 1FZCC 1IC2A 1NTZD 1T8ZA 1RQVA 4PJ0H 1BCCJ 4MN4C 2HODA 4H44C 4WY4C 1SQVE 1HTLC 1E79H 3H1HG 2OYIA 3CCMP 1URQB 1NAFA 4H13C 5B66E 2R3CA 3OA7A 1NWQA 1NO4A 3E1IA 1L4AA 2K37A 1USDA 2WSSH 2JR8A 1YQ3C 4ZMDA 2I8DA 1SQPG 1LP1B 1SQBJ 2WWWA 5CMZA 4OGQC 1OW8A 4I6MC 1IFDA 1BGYG 1SLQA 1RE4A 3HD7B 2YO3A 3L73G 3H32B 1T3JA 1JM0A 2KB7P 2O01J 2O01H 1MFTA 2O1JA 1R5LA 4H0LB 1OVVA 2FYZA 4D6TE 4YXWH 2BCCJ 3U1AA 3ABVC 3JCUE 3SFEC 2C0WA 1QVFO 1S1CX 2ZXXA 1HH0A 5KAFH 2N1TC 1PGPA 1M90Q 4AUWA 3MZWB 2A06G 4L73A 1SQXK 1U7JA 1GZLA 3VMYA 2Y0EA 3H1KG 2N9BA 1YJ9P 3QH9A 1GMJA 2Q9IA 1NJIQ 2ZT9B 4DT0A 4U3FG 2ZXEB 4LLHA 4PD4E 2WPSA 3H1HD 3TSIA 2PFXA 1GL2C 1ZRTD 1NU1E 3AE3C 2YIUB 3H1LJ 5CCHD 1IK9A 1FDIA 2P67A 1N7SA 4N3YB 1VQ6P 3CL3D 4NPFX 1P84H 1TU3F 3VP9A 1X9VA 3P8MC 2M5AB 1URQC 2Z5IA 3L71E 2XV5A 1SQPD 1NAYA 2IPPA 2JDIH 4ZKPA 1BGYD 4DCKA 3CX5D 1YTZI 2IX7C 2W6BA 3A0HH 2OTLP 5KJ7D 2PRRA 5E79E 1IJDB 1NYHA 2HPCA 1PGQA 1SVFA 1SQQK 1RHZB 2FBWC 2CPBA 3AEDC 3RK3D 4UB6H 1YIJP 1L0LE 2SPZA 3V6IA 3HD7C 3Q5RA 1AVYA 1GTWA 3SWKA 3GW6A 1PZQA 1PP9E 5DJUB 2WVRA 5KLIB 2A45G 1FE6A 1KFNA 1KB9H 2WT7A 2R44A 4H0LC 4KJMA 3MGNA 4W7ZA 4RESB 2A06D 1M1JB 3B4SA 4PJ0E 3RK3B 4IFDK 1BCCE 2JWAA 2XDJA 2ZVOB 3RK2D 2CPSA 1M57D 3H1KD 1AFOA 1S5LH 4XFJA 1RF0C 5AVUB 1S3JA 3LIEA 1BSHA 1LTSC 2ZYGA 1KMIZ 4GIFA 3VOPA 1XTCC 3FWLA 3RK2B 3H1IJ 2YKQA 1JCDA 3M0AA 1KFMA 2ZT9C 3V2PA 1SQBE 2E43A 5AW7B 1RQUA 4HKZH 3CCJP 1BE3E 5AW6B 1EXJA 2ZYDA 4GODA 2YIUC 4Z1MH 5CCGD 1KILD 1KB9I 5GTHH 3AE4C 1S9KD 3BRTB 2QE7H 2HG5D 4NPDA 2OGUA 3WMM0 2BCCE 1FJPA 3LW5J 3H1JD 3LW5H 5KLVJ 2C0XA 4BRYA 1JMBA 3T97A 5KAFE 5CCHC 1MFZA 3P8CD 2FXOA 1SQQG 2P10A 1N7LA 1T2KD 2YKOA 2FFDA 2NPSA 2E76D 2YXRB 1WT6A 2M3EA 3CCLP 4R4LA 2IBZE 2I1JA 3VTPC 3AE9C 4JBZA 1YJWP 4R4MA 1KD1Q 1FJKA 1X79B 5AW5B 5K5GB 2BEZF 1EZVG 5KJ7C 4EIJA 4HB1A 2HYNA 5KLIC 3FXDA 1NTZJ 2L5GB 1SQXD 2ZYAA 4DZOA 4H44D 2E76B 3GHGB 3H1LE 1XTGB 1M1JC 3RK3C 2WMMA 1U57A 1CI6A 1P84E 3WUUA 2B88A 2GUVA 4H13D 2JKVA 1L0NK 4WB4A 3HTKA 5AVZB 4I1LA 1A02F 5CJ0A 1IFIA 4WVZA 1AV1A 2OARA 3HE4A 3L75D 2PP6A 1EDJA 2NPSB 3A0HE 3RK2C 4OGQD 2OYOA 3RL0g 5APQA 3CXHD 3BCCG 3OW2O 3TDKA 1EXIA 1LTIC 2K9YA 4UB6E 2BEQD 1OFCX 3KYQA 3USSA 5APVA 4L76A 2IYOA 1Q7YQ 1VF5B 1OWAA 4Y28J 1GU4A 3NMDA 2W83C 4C7NA 1KB9E 4RO0A 3HUSB 3VMZA 1DX7A 1JTHA 5AVRB 3AE6C 1CI6B 2FYUK 3H6PA 1SQQD 1QX8A 3CWBJ 1A02J 2N1TD 4GT1A 1SS1A 3FGAD 3PTZA 3HTKB 1ZN5A 1T6AA 5AW2B 4IL6X 5CCGC 2POHA 3HE4B 1S5LE 4N6JA 2E74B 1QEXA 1Y9BA 3M9HA 3L71J 5GTIH 1EZVD 1WRGA 2HR3A 1USEA 3G9RA 3H1IE 2PAJA 3II6A 3W68A 1LT9B 3MUDC 3W67A 2C9NY 3PRJA 1GL2D 1G1JA 4EYYQ 1KQLA 3L4FA 3H1HJ 3B5ND 1PPJE 4UB8H 1T2KC 2Q6QA 1K9MQ 5GTHE 2E76C 3GHGC 2G3AA 1Y8AA 1EDIA 1FZAA 2J59M 3WUTA 1L0NG 1NU1G 3I55P 4TLFA 4GOFA 4W7YA 2QM7A 1KYOD 3B5NB 3BCCD 1LTBC 1SQPJ 1AJYA 5KLVE 1BGYJ 3GF7A 2WPVB 3CX5H 1H88A 3EFFK 5AVXB 1YHQP 3NTNA 2NPSC 1VPCA 1HGVA 2AXCA 3U1CA 1OVRA 1FAVA 1PL5A 3TGUD 4N78E 4K35A 2E5TA 4KHXA 1DEEG 4OVNF 3CCRP 2B9BA 3HD7D 2M3BA 1HJBA 4KT0J 1H8AA 3MHVA 1FOSF 1LTJB 2FYUG 1PGJA 1VF5C 4H0LD 2RH0A 4RJTA 5AVYB 3SWFA 5AVSB 4BXLA 3HUSC 1NTZE 5KTBA 1BE3J 1PP9G 3R4YA 1QVGO 3L72D 1MUUA 1OVUA 2R5BA 1QL1A 2OQQA 4ASVA 3G4SP 3H1KJ 1L4AD 1BCCG 3B8EB 2HODB 2XNDH 3CX5I 2WSFJ 2Q1KA 2WSFH 1T3UA 2E74C 4A7PA 3L74J 2OYIB 1NTMK 2Q3EA 4U7JA 4GDOA 2Q7CA 3BRVB 2ZT9D 2HFED 2B87A 3A7OA 3ZDMA 4JPZB 1HWTC 1LT9C 1K04A 1L4AB 3L70G 3AEAC 2J5UA 1L0ND 4DJGA 2K88A 3GMAA 2MJZA 3S4RA 4EI2A 1SQBG 1HF9A 2Y0DA 3E7KA 1GK6A 3M0DA 4XE5B 1NH4A 3L36A 1QLED 2GM4A 3C1LA 2QJYB 4AQRD 4CPGA 1R5SA 2KOGA 3U59A 3M9BA 4OWFA 2KUBA 2E42A 3CWBE 3H1JJ 3B5NC 2P1JA 1HGZA 4HH2A 2JEEA 2BCCG 2LXBA 4O9BA 1VQPP 3BATA 3EWKA 1LWUA 1UIIA 2FYUD 5GTIE 4HYTB 1NTKK 1OMIA 2A45H 4K3AA 1W5CE 1JB0J 1KQFB 4BWNA 1KZUB 3S1KA 3AEGC 5EFWB 1N7SD 3L73D 1IFMA 2IBZG 2QJKB 1LTJC 5BU8B 3AE5C 3H1HE 2IZ0A 1ZRTE 4UB8E 3Q5PA 1SQXJ 1M56D 1PGOA 3V2RA 1RE3A 3GF3A 5AVQB 3O8ZA 3H1LG 1MZ9A 1N7SB 5C39A 2Y9ZA 1YTZT 1NTMG 5AW1B 1G2CA 1SQPE 3V4QA 3L70D 1LTAC 3L75J 1X8YA 3KHUA 2OYIC 1VDFA 1BGYE 3TYYA 3CX5E 1IZNB 1HJ0A 5BU5A 4LGDE 2R32A 1NGMB 3AEEC 1SFCA 1QGKB 2A45I 1CZQA 2K9JA 3CPWO 1JY3O 5H2FH 3CCUP 5KAIH 3AE7C 1L4AC 3AE8C 1HVVA 3RK3E 4U3FD 1SQVK 4YXDC 2E5YA 1YJNP 2W90A 2HPCB 3VMXA 3V4WA 2IDBA 1N8RQ 3IAOA 1RY3A 2P58A 2QJYC 1RE4C 1J1DB 3PH0A 2QVAA 5AW3B 1J1EB 3CC7P 2QRXA 2KNCA 2A06E 3WU2H 4ZNCA 2WTYA 1JO5A 5AW8B 1LGHB 2QIWA 2WT7B 3RL0B 3Q2YA 4IL6H 2Q3IA 4PV1B 3H1KE 1AQTA 2IYPA 3CC4P 4TT3H 2WPRA 2JP3A 1NTKG 1LT1A 1DEBA 1K05A 3KZIH 3L74E 4GOEA 3CXHI 3JSVC 2AEFA 1PIXA 1FBMA 2KLUA 1LTTC 1FOSE 1EDLA 4WBAA 3H1IG 4IFFA 2QJKC 1FZCA 4JF7A 3A5TA 4M3LA 1GW4A 1AVOA 1KILE 1P84D 1NTMD 4YTPC 2OTJP 1S9KE 4WY4A 3RBXA 5TJHA 3GG2A 3V2QA 1S2EA 1N7SC 3BCCJ 2YO2A 3K5BA 1NVOA 5AVVB 3H1JE 3Q1MA 2I1KA 4JYCA 1H0TA 2RKLA 5APWA 2NPSD 1YBKA 2O1KA 3P8CE 2FKWB 1LWUC 1S72P 1EZVI 5KLVG 1H89A 4BRYB 4I7ZC 1NU1K 4JQ0D 3T97B 3MP7B 1SQVG 3TGUJ 3PJSK 1W2BO 5APTA 5TISH 2H8PD 2OTKE 1LJ2A 2IFMA 2WPQA 3CC2P 2H7HA 2FFDB 1VF5D 3WUVA 3SSUA 3N4XA 2ZAEB 1X0TA 2W27A 3BASA 3OJAB 2Z5HA 2P2UA 1SQXE 1IO4A 2ITAA 1J1DC 3L72J 1JY2O 1J1EC 1NTKD 2GUSA 3MIWA 1VQOP 3CI9A 1KYOI 1NTZG 1AA0A 3IFMA 3LIDA 3RL0C 3VMAA 4EDFA 2N1TA 5L8RJ 4PV1C 2E74D 5CBOA 2KS1A 1L0LK 1KC8Q 2ZFCA 1DH3A 3L75E 2KYVA 4D6TG 3CXHE 5H2FE 5KAIE 1L0NJ 5M1BA 1GL2A 1Q82Q 1IFPA 1ZR4A 3M91A 2H43A 1KQSO 1VQLP 1RH5B 3B71A 5KLVD 1SQQE 3WU2E 1URQA 2K1AA 1SQVD 5B5EH 4C7NB 1GK4A 1JTHB 2LXCB 4IL6E 1M8OB 3A0BH 1SQBK 1VQ9P 3CWBG 1W2EA 3MD0A 2LR2A 3M9QA 1VQ8P 1EC5A 3C8VA 3BVHA 3KZIE 2FYUJ 1JUNA 2HLOA 4C7RA 1EZVE 1LP1A 3F89A 3EQ2A 1VQ4P 5BVZA 1VL2A 1U7MA 3Q3DA 3L71G 4QMAA 2BASA 1OW7A 1PV3A 3HD7A 2FFDC 1WMKA 3L73J 3H32A 2N9YB 3D71A 1R8EA 2MKVA 5DJTB 2QEXP 1ZMEC 3CCQP 1IK7A 3FWNA 1N2DC 5CBNA 1SP4A 3M06A 3MTUE 2P7JA 1L0LG 3L35A 5APXA 4D6TD 4B86A 1ZLLA 1KYOE 1OIPA 1RF0A 3BCCE 2RN0A 3L70J 1ZR2A 1D7MA 3IF4A 1HBWA 3A2AA 5AW4B 2R5DA 2AXTH 3GLMA 2M0BA 2FY8A 3TGUE 2KSEA 1J2JB 2ZJSE 3P32A 1JOCA 5TISE 1DD3A 1N86A 2KLVA 1CW5A 2YNYA 3SWYA 4U3FJ 1M1KQ 2KIKA 3JC22 4IOIH 1YITP 2V7QJ 2V7QH 1YQ4C 1RF1A 4PD4D 2QG4A 1JY3N 4AYCA 1NU1D 2Z4EA 3TK1A 3CWBD 1IFJA 3L72E 5KKZB 2M5AA 1KN7A 1Q90D 1KQGB 3PP5A 1BE3G 2IFNA 1FZFA 3PHLA 5CCHA 4Y99B 3L71D 3QWOC 1L2PA 2KXPB 2VRSA 3FXEA 3RBZA 1JEKA 1FC2C 1Q86Q 2Y9YA 1ZXGA 3AECC 3NFQA 2YXQB 2J58A 1GW3A 3L74G 3V2NA 3D6ZA 2FXMA 4GKGA 1L0NE 1MV8A 5CJ4A 1GU5A 1K73Q 2B89A 5KJ7A 2B87B 1L0LD 1BSNA 1RF1B 2WSCJ 3P7KA 3SFDC 2WSCH 1NTMJ 1JY3P 2JO1A 2NRGA 1VQ7P 1PP9D 1M1JA 5AVWB 3Q5SA 1M7LA 3N7NA 1BCCD 4LC1A 1LNQA 3VYIA 5B5EE 1LTGC 2FXPA 1CSBA 2WSEJ 3KDPB 3FX0A 2WSEH 2UWJE 2KI7B 3A0BE 2NZ2A 3CCEP 2JJLA 2O01N 2QA4P 2IBZI 3H1JG 2RMZA 1YYCA 1VQNP 2FYNB 2FYUE 2D2CD 1JNMA 2R3SA 3AEBC 4ZKUA 3CD6P 1Q2NA 1LWUB 1SQBD 4I7ZB 3PLNA 3L73E 3CXHH 3C9IA 3IN6A 4EOTA 3EFGA 1P84I 1BE3D 2G8YA 5KLVK 1DD4A 2D2CB 1JMMA 1NTKJ 3RL0D 1HUCA 2KZIA 4RKUJ 5KKZC 1G1IA 1GD2E 1NKNA 4PV1D 1SQXG 3CCSP 3HE5A 3CCVP 4XA4A 1BDDA 4C46A 5CCGA 1KILA 4Y99C 2BCCD 1GDTA 1OX3A 2QJPB 3L74D 1AQ5A 1SFCD 3L70E 1SQQJ 4YPCA 2KSJA 3VP8A 3CMAP 3AEFC 3I56P 1QL2A 1JY2N 4JYBA 1G2CB 2AXTE 2XZRA 3L75G 3UIAA 1NTZK 3MUDA 1DIPA 1N73A 2W6JH 1VQMP 1SFCB 2IBZD 4U3FE 1S4XA 4DOJA 2K9JB 1KTMA 1MKMA 1RF1C 2WITA 2YMKA 2OYHA 3D6YA 3GHGA 1Z56A 1YI2P 2AEJA 2XU6A 4IFMA 3E1RA 3D70A 3H1LD 3VN0A 1EQ7A 3M0DC 3HE5B 3G71P 2KP8A 1FU1A 1KILB 1SQVJ 2E75D 5APSA 1PPJG 1ZOYC 2KNCB 2W6AA 2YKPA 1NKZB 2M8RA 2WQYC 3HRNA 1FDOA 4NPEA 1JY2P 5B66H 2CK3H 2KZJA 1KYOH 2FYNC 2E75B 1Q81Q
chains in the Genus database with same CATH topology
1N73B 2HFED 2YMYA 3NXSA 4RESB 4W7ZA 1M1JB 3A7OA 3RK3B 4IFDK 1URQA 1HWTC 1LT9C 3R2PA 1L4AB 2XDJA 3RK2D 4C7NB 1GK4A 1JTHB 2LKMA 1JCCA 2CPSA 5AW9B 2OYHB 4WY4D 1SQBK 2MJZA 1AFOA 3L37A 1W2EA 3MD0A 3M9QA 4OH8B 1RF0C 3HUSA 4I2LC 1GK6A 3M0DA 4XE5B 1NH4A 5AVUB 3BVHA 5APYA 3L36A 3LIEA 1LTSC 1JUNA 1FZCB 4GIFA 3VOPA 1XTCC 2HLOA 4C7RA 2GM4A 4AQRD 2KOGA 3EQ2A 5BVZA 3U59A 3RK2B 2YKQA 3M9BA 4W80A 2E42A 1JCDA 3M0AA 1RE3C 2BASA 1KFMA 4WY4B 3HD7A 2FFDC 3B5NC 3V2PA 2P1JA 1HGZA 4HH2A 3H32A 2E43A 5AW7B 1E5WA 2JEEA 5AW6B 4O9BA 3G3ZA 5CCGD 1KILD 1N2DC 1S9KD 3BATA 1LT9A 1SP4A 3M06A 1LWUA 5CHXA 3BRTB 2Q5UA 4HYTB 3MTUE 2P7JA 1NTKK 2HG5D 2A45H 3L35A 5APXA 2C9LY 3WMM0 4B86A 1ZLLA 1SFCC 2XNXA 1KZUB 1RF0A 1FJPA 1FZGA 1ZR2A 3LW5H 2C0XA 3A3YB 1N7SD 1ZV8A 1IFMA 2QM8A 1HBWA 1LTJC 3T97A 5BU8B 5CCHC 1SQPK 2WZ7A 3A2AA 1MFZA 5AW4B 3P8CD 3IR9A 2R5DA 3TNUA 3V2RA 1RE3A 1N7LA 1T2KD 2YKOA 2FFDA 1KILC 3B5NA 2NPSA 1J2JB 3P32A 5AVQB 1JOCA 1OXZA 3O8ZA 1N86A 2KLVA 1WT6A 1IFNA 1CW5A 1MZ9A 2YNYA 3SWYA 2I1JA 1N7SB 3VTPC 3OAKA 1YTZT 1FJKA 1X79B 5AW5B 5AW1B 1G2CA 3V4QA 1LTAC 1X8YA 2N1TB 1RF1A 3V5BA 2OYIC 1VDFA 5KJ7C 3TYYA 4EIJA 2HYNA 5BU5A 1JY3N 4AYCA 2Z4EA 4LGDE 5AW0B 3TK1A 1NOHA 2L5GB 1IFJA 2R32A 4DZOA 3CLQA 1SFCA 3GHGB 5AVTB 2A45I 1N73C 1CZQA 1FZEA 1XTGB 1M1JC 5APUA 1JY3O 3RK3C 2XKMA 3KPEA 4N78D 1CI6A 1L4AC 3KQGA 1HVVA 2GUVA 3PP5A 2IFNA 1FZFA 1LTJA 5CCHA 4Y99B 1SQVK 2OYHC 1L0NK 4WB4A 3HTKA 5AVZB 4I1LA 2HPCB 1A02F 5CJ0A 3VMXA 3V4WA 1IFIA 1FDMA 1URQD 3I5CA 1NHLA 3HE4A 2OARA 2VRSA 1PFIA 3TNUB 1GL2B 1FZBA 1FZCC 1IC2A 1RY3A 1RE4C 2PP6A 2NPSB 1T8ZA 3NFQA 1J1DB 2J58A 3RK2C 5AW3B 1J1EB 1GW3A 5APQA 2HODA 3V2NA 2WTYA 2FXMA 1JO5A 5AW8B 4WY4C 1LGHB 4GKGA 2WT7B 3RL0B 5CJ4A 1MV8A 1HTLC 1GU5A 1LTIC 2Q3IA 2OYIA 5KJ7A 1URQB 1RF1B 1NAFA 3KYQA 3P7KA 5APVA 2WSCH 2WPRA 2R3CA 1JY3P 3OA7A 1DEBA 1NWQA 1M1JA 1NO4A 1OWAA 1GU4A 3E1IA 3NMDA 1L4AA 5AVWB 4C7NA 3HUSB 3VMZA 1DX7A 1JTHA 5AVRB 1CI6B 2FYUK 3H6PA 1M7LA 1FBMA 3N7NA 1LTTC 4LC1A 1A02J 1FOSE 2N1TD 3VYIA 2WWWA 5CMZA 4GT1A 4WBAA 1LTGC 1CSBA 4I6MC 1IFDA 3HTKB 1ZN5A 3KDPB 2WSEH 4IFFA 5AW2B 5CCGC 1SLQA 1FZCA 2JJLA 2POHA 3HE4B 4JF7A 3A5TA 4N6JA 1RE4A 3HD7B 2YO3A 1YYCA 4M3LA 1GW4A 3H32B 1T3JA 2KB7P 3M9HA 1S9KE 4WY4A 1WRGA 2O01H 2O1JA 1JNMA 2FYZA 2PAJA 4ZKUA 3V2QA 3II6A 1N7SC 3U1AA 1LT9B 1LWUB 2YO2A 2C9NY 2C0WA 5AVVB 2I1KA 1GL2D 1G1JA 1KQLA 4JYCA 3C9IA 4EOTA 3L4FA 1HH0A 2N1TC 3EFGA 3B5ND 5APWA 2NPSD 5KLVK 1T2KC 4AUWA 2O1KA 3P8CE 2FKWB 1LWUC 1JMMA 1H89A 3GHGC 1NU1K 3RL0D 1HUCA 1FZAA 1SQXK 2J59M 1G1IA 1GD2E 1GZLA 1NKNA 5APTA 3VMYA 2H8PD 3HE5A 2N9BA 4W7YA 4XA4A 4C46A 5CCGA 2QM7A 1KILA 2Q9IA 2WPQA 2IFMA 4Y99C 1GDTA 2H7HA 2FFDB 3B5NB 1LTBC 1AQ5A 1SFCD 3N4XA 2W27A 2ZXEB 2KSJA 3VP8A 3BASA 4LLHA 1QL2A 2WPSA 3OJAB 2Z5HA 3TSIA 1JY2N 1GL2C 2P2UA 1H88A 4JYBA 5AVXB 1G2CB 3NTNA 1IO4A 5CCHD 2NPSC 1IK9A 1VPCA 1J1DC 2XZRA 1HGVA 1JY2O 2P67A 1N7SA 1J1EC 2GUSA 3UIAA 3U1CA 4N3YB 1NTZK 3MIWA 3MUDA 1FAVA 3CI9A 3CL3D 4N78E 3IFMA 3LIDA 4KHXA 1N73A 3RL0C 2N1TA 1SFCB 3VP9A 3HD7D 2M3BA 1HJBA 4DOJA 1X9VA 3P8MC 1URQC 2Z5IA 1RF1C 1H8AA 1FOSF 2XV5A 2WITA 1L0LK 2OYHA 3GHGA 2IPPA 2ZFCA 1LTJB 1DH3A 1Z56A 4ZKPA 5AVYB 2XU6A 4IFMA 2KYVA 3SWFA 5AVSB 1YTZI 3HUSC 2IX7C 2W6BA 5KTBA 5KJ7D 3VN0A 1EQ7A 3M0DC 3HE5B 1MUUA 2KP8A 1IJDB 1FU1A 1KILB 2R5BA 5APSA 1QL1A 2HPCA 1SVFA 1SQQK 2CPBA 3RK3D 2W6AA 1L4AD 2YKPA 1GL2A 1NKZB 2M8RA 3HRNA 3B8EB 2HODB 1JY2P 3HD7C 2WSFH 1T3UA 1GTWA 1ZR4A 3M91A 2H43A 2OYIB 1NTMK 2A45G 1KFNA 2WT7A 2Q7CA 3BRVB 3MGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5D A;  3NXS A;  3P7K A;  4RES B;  5APV A;  2H7H A;  1NAF A;  3A7O A;  2WPR A;  2R3C A;  3TNU A;  1HWT C;  1T2K D;  4C7N B;  1NWQ A;  1GK4 A;  1OWA A;  2W27 A;  1GU4 A;  2ZXE B;  1J2J B;  3P32 A;  5AVQ B;  3NMD A;  1OXZ A;  3O8Z A;  5AVW B;  2WPS A;  2Z5H A;  5AW9 B;  4C7N A;  3VMZ A;  2YNY A;  5AVR B;  2P2U A;  1H88 A;  1CI6 B;  3L37 A;  4JYB A;  3VTP C;  3MD0 A;  3OAK A;  5AVX B;  1G2C B;  3NTN A;  1IO4 A;  2XZR A;  5AW5 B;  4I2L C;  2P67 A;  1GK6 A;  5AW1 B;  3M0D A;  3UIA A;  4LC1 A;  4XE5 B;  3V4Q A;  5AVU B;  3VYI A;  1A02 J;  2WWW A;  3L36 A;  3LIE A;  5CMZ A;  4GT1 A;  5APY A;  1FAV A;  1CSB A;  1X8Y A;  1JUN A;  4I6M C;  3KDP B;  3V5B A;  3LID A;  4KHX A;  3TYY A;  5AW2 B;  4AQR D;  1SLQ A;  4AYC A;  5AW0 B;  3TK1 A;  2JJL A;  3HE4 B;  1HJB A;  3A5T A;  3M9B A;  3P8M C;  2R32 A;  4DZO A;  2E42 A;  2YO3 A;  2Z5I A;  3M0A A;  1YYC A;  4M3L A;  5AVT B;  1H8A A;  2BAS A;  1CZQ A;  1FOS F;  2XV5 A;  5APU A;  3M9H A;  2IPP A;  2ZFC A;  1CI6 A;  1S9K E;  2E43 A;  1DH3 A;  3KQG A;  5AVY B;  5AW7 B;  2XU6 A;  1JNM A;  5AW6 B;  3SWF A;  5AVS B;  3VN0 A;  1FOS E;  3HE5 B;  3HTK A;  5AVZ B;  2YO2 A;  1MUU A;  2KP8 A;  1A02 F;  3VMX A;  3V4W A;  2R5B A;  2C9N Y;  5AVV B;  1S9K D;  3I5C A;  1SP4 A;  3M06 A;  5APS A;  3HE4 A;  1KQL A;  4JYC A;  2VRS A;  2Q5U A;  4HYT B;  3TNU B;  4EOT A;  2P7J A;  5APW A;  2W6A A;  3L35 A;  5APX A;  2C9L Y;  4B86 A;  1T2K C;  4AUW A;  3NFQ A;  3B8E B;  5AW3 B;  1H89 A;  5APQ A;  1GTW A;  1HUC A;  2WTY A;  5AW8 B;  3M91 A;  4GKG A;  3A3Y B;  1GD2 E;  2WT7 B;  1GZL A;  1MV8 A;  2QM8 A;  5APT A;  1GU5 A;  3T97 A;  3VMY A;  1HBW A;  2Q3I A;  3A2A A;  3HE5 A;  2WT7 A;  2N9B A;  2Q7C A;  1MFZ A;  4C46 A;  5AW4 B;  2QM7 A;  2WPQ A;  3IR9 A;  3MGN A; 
#chains in the Genus database with same CATH topology
 1N73 B;  2YMY A;  3NXS A;  2K3R A;  3R2P A;  2JWD A;  2LKM A;  1JCC A;  5AW9 B;  2OYH B;  4WY4 D;  3L37 A;  3KXD A;  4OH8 B;  3HUS A;  2D2C C;  4I2L C;  1NTM E;  1OZH A;  2QSI A;  5APY A;  1FZC B;  1VQ5 P;  4HJG H;  1KB9 D;  3H25 A;  4D6T J;  4WWI A;  4W80 A;  1RE3 C;  1BDC A;  4H44 B;  4WY4 B;  1KOR A;  2QJP C;  3JCU H;  3G6E P;  1E5W A;  1FS0 E;  2KK7 A;  1ZW0 A;  3G3Z A;  1S5L X;  4H13 B;  1H0T B;  2DW3 A;  1LT9 A;  2Y0C A;  5CHX A;  2Q5U A;  2PGD A;  3H1I D;  2C9L Y;  1SFC C;  3O6Q A;  2XNX A;  3TGU G;  4OGQ B;  1FZG A;  2O3J A;  2GA1 A;  3A3Y B;  1X22 A;  1ZV8 A;  2QM8 A;  1K8A Q;  4ASW A;  4PD4 H;  2H88 C;  1SQP K;  2WZ7 A;  1PPJ D;  1NU1 J;  2ZVN B;  3IR9 A;  3TNU A;  1UIX A;  1NTK E;  1KIL C;  3B5N A;  2IZ1 A;  1OXZ A;  1VQK P;  1IFN A;  3L72 G;  3OAK A;  3CME P;  4L74 A;  3TF5 A;  2N1T B;  3V5B A;  1Y47 A;  5AW0 B;  1NOH A;  2KS1 B;  3CLQ A;  2E75 C;  5AVT B;  3ITK A;  5E79 H;  1N73 C;  3AE1 C;  1FZE A;  3F5H A;  3RGU A;  5APU A;  2XKM A;  2L91 A;  3KPE A;  3O6Q B;  4N78 D;  1KV4 A;  3KQG A;  2H89 C;  1LTJ A;  4L75 A;  1L0L J;  2AEM A;  2OYH C;  1ZP0 C;  3AE2 C;  4PD4 I;  2V4H A;  1OW6 A;  1PP9 J;  3S9O A;  1FDM A;  1URQ D;  3I5C A;  1NHL A;  2W8Z A;  1PFI A;  3TNU B;  1GL2 B;  1EDK A;  1FZB A;  1FZC C;  1IC2 A;  1NTZ D;  1T8Z A;  1RQV A;  4PJ0 H;  1BCC J;  4MN4 C;  2HOD A;  4H44 C;  4WY4 C;  1SQV E;  1HTL C;  1E79 H;  3H1H G;  2OYI A;  3CCM P;  1URQ B;  1NAF A;  4H13 C;  5B66 E;  2R3C A;  3OA7 A;  1NWQ A;  1NO4 A;  3E1I A;  1L4A A;  2K37 A;  1USD A;  2WSS H;  2JR8 A;  1YQ3 C;  4ZMD A;  2I8D A;  1SQP G;  1LP1 B;  1SQB J;  2WWW A;  5CMZ A;  4OGQ C;  1OW8 A;  4I6M C;  1IFD A;  1BGY G;  1SLQ A;  1RE4 A;  3HD7 B;  2YO3 A;  3L73 G;  3H32 B;  1T3J A;  1JM0 A;  2KB7 P;  2O01 J;  2O01 H;  1MFT A;  2O1J A;  1R5L A;  4H0L B;  1OVV A;  2FYZ A;  4D6T E;  4YXW H;  2BCC J;  3U1A A;  3ABV C;  3JCU E;  3SFE C;  2C0W A;  1QVF O;  1S1C X;  2ZXX A;  1HH0 A;  5KAF H;  2N1T C;  1PGP A;  1M90 Q;  4AUW A;  3MZW B;  2A06 G;  4L73 A;  1SQX K;  1U7J A;  1GZL A;  3VMY A;  2Y0E A;  3H1K G;  2N9B A;  1YJ9 P;  3QH9 A;  1GMJ A;  2Q9I A;  1NJI Q;  2ZT9 B;  4DT0 A;  4U3F G;  2ZXE B;  4LLH A;  4PD4 E;  2WPS A;  3H1H D;  3TSI A;  2PFX A;  1GL2 C;  1ZRT D;  1NU1 E;  3AE3 C;  2YIU B;  3H1L J;  5CCH D;  1IK9 A;  1FDI A;  2P67 A;  1N7S A;  4N3Y B;  1VQ6 P;  3CL3 D;  4NPF X;  1P84 H;  1TU3 F;  3VP9 A;  1X9V A;  3P8M C;  2M5A B;  1URQ C;  2Z5I A;  3L71 E;  2XV5 A;  1SQP D;  1NAY A;  2IPP A;  2JDI H;  4ZKP A;  1BGY D;  4DCK A;  3CX5 D;  1YTZ I;  2IX7 C;  2W6B A;  3A0H H;  2OTL P;  5KJ7 D;  2PRR A;  5E79 E;  1IJD B;  1NYH A;  2HPC A;  1PGQ A;  1SVF A;  1SQQ K;  1RHZ B;  2FBW C;  2CPB A;  3AED C;  3RK3 D;  4UB6 H;  1YIJ P;  1L0L E;  2SPZ A;  3V6I A;  3HD7 C;  3Q5R A;  1AVY A;  1GTW A;  3SWK A;  3GW6 A;  1PZQ A;  1PP9 E;  5DJU B;  2WVR A;  5KLI B;  2A45 G;  1FE6 A;  1KFN A;  1KB9 H;  2WT7 A;  2R44 A;  4H0L C;  4KJM A;  3MGN A;  4W7Z A;  4RES B;  2A06 D;  1M1J B;  3B4S A;  4PJ0 E;  3RK3 B;  4IFD K;  1BCC E;  2JWA A;  2XDJ A;  2ZVO B;  3RK2 D;  2CPS A;  1M57 D;  3H1K D;  1AFO A;  1S5L H;  4XFJ A;  1RF0 C;  5AVU B;  1S3J A;  3LIE A;  1BSH A;  1LTS C;  2ZYG A;  1KMI Z;  4GIF A;  3VOP A;  1XTC C;  3FWL A;  3RK2 B;  3H1I J;  2YKQ A;  1JCD A;  3M0A A;  1KFM A;  2ZT9 C;  3V2P A;  1SQB E;  2E43 A;  5AW7 B;  1RQU A;  4HKZ H;  3CCJ P;  1BE3 E;  5AW6 B;  1EXJ A;  2ZYD A;  4GOD A;  2YIU C;  4Z1M H;  5CCG D;  1KIL D;  1KB9 I;  5GTH H;  3AE4 C;  1S9K D;  3BRT B;  2QE7 H;  2HG5 D;  4NPD A;  2OGU A;  3WMM 0;  2BCC E;  1FJP A;  3LW5 J;  3H1J D;  3LW5 H;  5KLV J;  2C0X A;  4BRY A;  1JMB A;  3T97 A;  5KAF E;  5CCH C;  1MFZ A;  3P8C D;  2FXO A;  1SQQ G;  2P10 A;  1N7L A;  1T2K D;  2YKO A;  2FFD A;  2NPS A;  2E76 D;  2YXR B;  1WT6 A;  2M3E A;  3CCL P;  4R4L A;  2IBZ E;  2I1J A;  3VTP C;  3AE9 C;  4JBZ A;  1YJW P;  4R4M A;  1KD1 Q;  1FJK A;  1X79 B;  5AW5 B;  5K5G B;  2BEZ F;  1EZV G;  5KJ7 C;  4EIJ A;  4HB1 A;  2HYN A;  5KLI C;  3FXD A;  1NTZ J;  2L5G B;  1SQX D;  2ZYA A;  4DZO A;  4H44 D;  2E76 B;  3GHG B;  3H1L E;  1XTG B;  1M1J C;  3RK3 C;  2WMM A;  1U57 A;  1CI6 A;  1P84 E;  3WUU A;  2B88 A;  2GUV A;  4H13 D;  2JKV A;  1L0N K;  4WB4 A;  3HTK A;  5AVZ B;  4I1L A;  1A02 F;  5CJ0 A;  1IFI A;  4WVZ A;  1AV1 A;  2OAR A;  3HE4 A;  3L75 D;  2PP6 A;  1EDJ A;  2NPS B;  3A0H E;  3RK2 C;  4OGQ D;  2OYO A;  3RL0 g;  5APQ A;  3CXH D;  3BCC G;  3OW2 O;  3TDK A;  1EXI A;  1LTI C;  2K9Y A;  4UB6 E;  2BEQ D;  1OFC X;  3KYQ A;  3USS A;  5APV A;  4L76 A;  2IYO A;  1Q7Y Q;  1VF5 B;  1OWA A;  4Y28 J;  1GU4 A;  3NMD A;  2W83 C;  4C7N A;  1KB9 E;  4RO0 A;  3HUS B;  3VMZ A;  1DX7 A;  1JTH A;  5AVR B;  3AE6 C;  1CI6 B;  2FYU K;  3H6P A;  1SQQ D;  1QX8 A;  3CWB J;  1A02 J;  2N1T D;  4GT1 A;  1SS1 A;  3FGA D;  3PTZ A;  3HTK B;  1ZN5 A;  1T6A A;  5AW2 B;  4IL6 X;  5CCG C;  2POH A;  3HE4 B;  1S5L E;  4N6J A;  2E74 B;  1QEX A;  1Y9B A;  3M9H A;  3L71 J;  5GTI H;  1EZV D;  1WRG A;  2HR3 A;  1USE A;  3G9R A;  3H1I E;  2PAJ A;  3II6 A;  3W68 A;  1LT9 B;  3MUD C;  3W67 A;  2C9N Y;  3PRJ A;  1GL2 D;  1G1J A;  4EYY Q;  1KQL A;  3L4F A;  3H1H J;  3B5N D;  1PPJ E;  4UB8 H;  1T2K C;  2Q6Q A;  1K9M Q;  5GTH E;  2E76 C;  3GHG C;  2G3A A;  1Y8A A;  1EDI A;  1FZA A;  2J59 M;  3WUT A;  1L0N G;  1NU1 G;  3I55 P;  4TLF A;  4GOF A;  4W7Y A;  2QM7 A;  1KYO D;  3B5N B;  3BCC D;  1LTB C;  1SQP J;  1AJY A;  5KLV E;  1BGY J;  3GF7 A;  2WPV B;  3CX5 H;  1H88 A;  3EFF K;  5AVX B;  1YHQ P;  3NTN A;  2NPS C;  1VPC A;  1HGV A;  2AXC A;  3U1C A;  1OVR A;  1FAV A;  1PL5 A;  3TGU D;  4N78 E;  4K35 A;  2E5T A;  4KHX A;  1DEE G;  4OVN F;  3CCR P;  2B9B A;  3HD7 D;  2M3B A;  1HJB A;  4KT0 J;  1H8A A;  3MHV A;  1FOS F;  1LTJ B;  2FYU G;  1PGJ A;  1VF5 C;  4H0L D;  2RH0 A;  4RJT A;  5AVY B;  3SWF A;  5AVS B;  4BXL A;  3HUS C;  1NTZ E;  5KTB A;  1BE3 J;  1PP9 G;  3R4Y A;  1QVG O;  3L72 D;  1MUU A;  1OVU A;  2R5B A;  1QL1 A;  2OQQ A;  4ASV A;  3G4S P;  3H1K J;  1L4A D;  1BCC G;  3B8E B;  2HOD B;  2XND H;  3CX5 I;  2WSF J;  2Q1K A;  2WSF H;  1T3U A;  2E74 C;  4A7P A;  3L74 J;  2OYI B;  1NTM K;  2Q3E A;  4U7J A;  4GDO A;  2Q7C A;  3BRV B;  2ZT9 D;  2HFE D;  2B87 A;  3A7O A;  3ZDM A;  4JPZ B;  1HWT C;  1LT9 C;  1K04 A;  1L4A B;  3L70 G;  3AEA C;  2J5U A;  1L0N D;  4DJG A;  2K88 A;  3GMA A;  2MJZ A;  3S4R A;  4EI2 A;  1SQB G;  1HF9 A;  2Y0D A;  3E7K A;  1GK6 A;  3M0D A;  4XE5 B;  1NH4 A;  3L36 A;  1QLE D;  2GM4 A;  3C1L A;  2QJY B;  4AQR D;  4CPG A;  1R5S A;  2KOG A;  3U59 A;  3M9B A;  4OWF A;  2KUB A;  2E42 A;  3CWB E;  3H1J J;  3B5N C;  2P1J A;  1HGZ A;  4HH2 A;  2JEE A;  2BCC G;  2LXB A;  4O9B A;  1VQP P;  3BAT A;  3EWK A;  1LWU A;  1UII A;  2FYU D;  5GTI E;  4HYT B;  1NTK K;  1OMI A;  2A45 H;  4K3A A;  1W5C E;  1JB0 J;  1KQF B;  4BWN A;  1KZU B;  3S1K A;  3AEG C;  5EFW B;  1N7S D;  3L73 D;  1IFM A;  2IBZ G;  2QJK B;  1LTJ C;  5BU8 B;  3AE5 C;  3H1H E;  2IZ0 A;  1ZRT E;  4UB8 E;  3Q5P A;  1SQX J;  1M56 D;  1PGO A;  3V2R A;  1RE3 A;  3GF3 A;  5AVQ B;  3O8Z A;  3H1L G;  1MZ9 A;  1N7S B;  5C39 A;  2Y9Z A;  1YTZ T;  1NTM G;  5AW1 B;  1G2C A;  1SQP E;  3V4Q A;  3L70 D;  1LTA C;  3L75 J;  1X8Y A;  3KHU A;  2OYI C;  1VDF A;  1BGY E;  3TYY A;  3CX5 E;  1IZN B;  1HJ0 A;  5BU5 A;  4LGD E;  2R32 A;  1NGM B;  3AEE C;  1SFC A;  1QGK B;  2A45 I;  1CZQ A;  2K9J A;  3CPW O;  1JY3 O;  5H2F H;  3CCU P;  5KAI H;  3AE7 C;  1L4A C;  3AE8 C;  1HVV A;  3RK3 E;  4U3F D;  1SQV K;  4YXD C;  2E5Y A;  1YJN P;  2W90 A;  2HPC B;  3VMX A;  3V4W A;  2IDB A;  1N8R Q;  3IAO A;  1RY3 A;  2P58 A;  2QJY C;  1RE4 C;  1J1D B;  3PH0 A;  2QVA A;  5AW3 B;  1J1E B;  3CC7 P;  2QRX A;  2KNC A;  2A06 E;  3WU2 H;  4ZNC A;  2WTY A;  1JO5 A;  5AW8 B;  1LGH B;  2QIW A;  2WT7 B;  3RL0 B;  3Q2Y A;  4IL6 H;  2Q3I A;  4PV1 B;  3H1K E;  1AQT A;  2IYP A;  3CC4 P;  4TT3 H;  2WPR A;  2JP3 A;  1NTK G;  1LT1 A;  1DEB A;  1K05 A;  3KZI H;  3L74 E;  4GOE A;  3CXH I;  3JSV C;  2AEF A;  1PIX A;  1FBM A;  2KLU A;  1LTT C;  1FOS E;  1EDL A;  4WBA A;  3H1I G;  4IFF A;  2QJK C;  1FZC A;  4JF7 A;  3A5T A;  4M3L A;  1GW4 A;  1AVO A;  1KIL E;  1P84 D;  1NTM D;  4YTP C;  2OTJ P;  1S9K E;  4WY4 A;  3RBX A;  5TJH A;  3GG2 A;  3V2Q A;  1S2E A;  1N7S C;  3BCC J;  2YO2 A;  3K5B A;  1NVO A;  5AVV B;  3H1J E;  3Q1M A;  2I1K A;  4JYC A;  1H0T A;  2RKL A;  5APW A;  2NPS D;  1YBK A;  2O1K A;  3P8C E;  2FKW B;  1LWU C;  1S72 P;  1EZV I;  5KLV G;  1H89 A;  4BRY B;  4I7Z C;  1NU1 K;  4JQ0 D;  3T97 B;  3MP7 B;  1SQV G;  3TGU J;  3PJS K;  1W2B O;  5APT A;  5TIS H;  2H8P D;  2OTK E;  1LJ2 A;  2IFM A;  2WPQ A;  3CC2 P;  2H7H A;  2FFD B;  1VF5 D;  3WUV A;  3SSU A;  3N4X A;  2ZAE B;  1X0T A;  2W27 A;  3BAS A;  3OJA B;  2Z5H A;  2P2U A;  1SQX E;  1IO4 A;  2ITA A;  1J1D C;  3L72 J;  1JY2 O;  1J1E C;  1NTK D;  2GUS A;  3MIW A;  1VQO P;  3CI9 A;  1KYO I;  1NTZ G;  1AA0 A;  3IFM A;  3LID A;  3RL0 C;  3VMA A;  4EDF A;  2N1T A;  5L8R J;  4PV1 C;  2E74 D;  5CBO A;  2KS1 A;  1L0L K;  1KC8 Q;  2ZFC A;  1DH3 A;  3L75 E;  2KYV A;  4D6T G;  3CXH E;  5H2F E;  5KAI E;  1L0N J;  5M1B A;  1GL2 A;  1Q82 Q;  1IFP A;  1ZR4 A;  3M91 A;  2H43 A;  1KQS O;  1VQL P;  1RH5 B;  3B71 A;  5KLV D;  1SQQ E;  3WU2 E;  1URQ A;  2K1A A;  1SQV D;  5B5E H;  4C7N B;  1GK4 A;  1JTH B;  2LXC B;  4IL6 E;  1M8O B;  3A0B H;  1SQB K;  1VQ9 P;  3CWB G;  1W2E A;  3MD0 A;  2LR2 A;  3M9Q A;  1VQ8 P;  1EC5 A;  3C8V A;  3BVH A;  3KZI E;  2FYU J;  1JUN A;  2HLO A;  4C7R A;  1EZV E;  1LP1 A;  3F89 A;  3EQ2 A;  1VQ4 P;  5BVZ A;  1VL2 A;  1U7M A;  3Q3D A;  3L71 G;  4QMA A;  2BAS A;  1OW7 A;  1PV3 A;  3HD7 A;  2FFD C;  1WMK A;  3L73 J;  3H32 A;  2N9Y B;  3D71 A;  1R8E A;  2MKV A;  5DJT B;  2QEX P;  1ZME C;  3CCQ P;  1IK7 A;  3FWN A;  1N2D C;  5CBN A;  1SP4 A;  3M06 A;  3MTU E;  2P7J A;  1L0L G;  3L35 A;  5APX A;  4D6T D;  4B86 A;  1ZLL A;  1KYO E;  1OIP A;  1RF0 A;  3BCC E;  2RN0 A;  3L70 J;  1ZR2 A;  1D7M A;  3IF4 A;  1HBW A;  3A2A A;  5AW4 B;  2R5D A;  2AXT H;  3GLM A;  2M0B A;  2FY8 A;  3TGU E;  2KSE A;  1J2J B;  2ZJS E;  3P32 A;  1JOC A;  5TIS E;  1DD3 A;  1N86 A;  2KLV A;  1CW5 A;  2YNY A;  3SWY A;  4U3F J;  1M1K Q;  2KIK A;  3JC2 2;  4IOI H;  1YIT P;  2V7Q J;  2V7Q H;  1YQ4 C;  1RF1 A;  4PD4 D;  2QG4 A;  1JY3 N;  4AYC A;  1NU1 D;  2Z4E A;  3TK1 A;  3CWB D;  1IFJ A;  3L72 E;  5KKZ B;  2M5A A;  1KN7 A;  1Q90 D;  1KQG B;  3PP5 A;  1BE3 G;  2IFN A;  1FZF A;  3PHL A;  5CCH A;  4Y99 B;  3L71 D;  3QWO C;  1L2P A;  2KXP B;  2VRS A;  3FXE A;  3RBZ A;  1JEK A;  1FC2 C;  1Q86 Q;  2Y9Y A;  1ZXG A;  3AEC C;  3NFQ A;  2YXQ B;  2J58 A;  1GW3 A;  3L74 G;  3V2N A;  3D6Z A;  2FXM A;  4GKG A;  1L0N E;  1MV8 A;  5CJ4 A;  1GU5 A;  1K73 Q;  2B89 A;  5KJ7 A;  2B87 B;  1L0L D;  1BSN A;  1RF1 B;  2WSC J;  3P7K A;  3SFD C;  2WSC H;  1NTM J;  1JY3 P;  2JO1 A;  2NRG A;  1VQ7 P;  1PP9 D;  1M1J A;  5AVW B;  3Q5S A;  1M7L A;  3N7N A;  1BCC D;  4LC1 A;  1LNQ A;  3VYI A;  5B5E E;  1LTG C;  2FXP A;  1CSB A;  2WSE J;  3KDP B;  3FX0 A;  2WSE H;  2UWJ E;  2KI7 B;  3A0B E;  2NZ2 A;  3CCE P;  2JJL A;  2O01 N;  2QA4 P;  2IBZ I;  3H1J G;  2RMZ A;  1YYC A;  1VQN P;  2FYN B;  2FYU E;  2D2C D;  1JNM A;  2R3S A;  3AEB C;  4ZKU A;  3CD6 P;  1Q2N A;  1LWU B;  1SQB D;  4I7Z B;  3PLN A;  3L73 E;  3CXH H;  3C9I A;  3IN6 A;  4EOT A;  3EFG A;  1P84 I;  1BE3 D;  2G8Y A;  5KLV K;  1DD4 A;  2D2C B;  1JMM A;  1NTK J;  3RL0 D;  1HUC A;  2KZI A;  4RKU J;  5KKZ C;  1G1I A;  1GD2 E;  1NKN A;  4PV1 D;  1SQX G;  3CCS P;  3HE5 A;  3CCV P;  4XA4 A;  1BDD A;  4C46 A;  5CCG A;  1KIL A;  4Y99 C;  2BCC D;  1GDT A;  1OX3 A;  2QJP B;  3L74 D;  1AQ5 A;  1SFC D;  3L70 E;  1SQQ J;  4YPC A;  2KSJ A;  3VP8 A;  3CMA P;  3AEF C;  3I56 P;  1QL2 A;  1JY2 N;  4JYB A;  1G2C B;  2AXT E;  2XZR A;  3L75 G;  3UIA A;  1NTZ K;  3MUD A;  1DIP A;  1N73 A;  2W6J H;  1VQM P;  1SFC B;  2IBZ D;  4U3F E;  1S4X A;  4DOJ A;  2K9J B;  1KTM A;  1MKM A;  1RF1 C;  2WIT A;  2YMK A;  2OYH A;  3D6Y A;  3GHG A;  1Z56 A;  1YI2 P;  2AEJ A;  2XU6 A;  4IFM A;  3E1R A;  3D70 A;  3H1L D;  3VN0 A;  1EQ7 A;  3M0D C;  3HE5 B;  3G71 P;  2KP8 A;  1FU1 A;  1KIL B;  1SQV J;  2E75 D;  5APS A;  1PPJ G;  1ZOY C;  2KNC B;  2W6A A;  2YKP A;  1NKZ B;  2M8R A;  2WQY C;  3HRN A;  1FDO A;  4NPE A;  1JY2 P;  5B66 H;  2CK3 H;  2KZJ A;  1KYO H;  2FYN C;  2E75 B;  1Q81 Q; 
#chains in the Genus database with same CATH homology
 1N73 B;  2HFE D;  2YMY A;  3NXS A;  4RES B;  4W7Z A;  1M1J B;  3A7O A;  3RK3 B;  4IFD K;  1URQ A;  1HWT C;  1LT9 C;  3R2P A;  1L4A B;  2XDJ A;  3RK2 D;  4C7N B;  1GK4 A;  1JTH B;  2LKM A;  1JCC A;  2CPS A;  5AW9 B;  2OYH B;  4WY4 D;  1SQB K;  2MJZ A;  1AFO A;  3L37 A;  1W2E A;  3MD0 A;  3M9Q A;  4OH8 B;  1RF0 C;  3HUS A;  4I2L C;  1GK6 A;  3M0D A;  4XE5 B;  1NH4 A;  5AVU B;  3BVH A;  5APY A;  3L36 A;  3LIE A;  1LTS C;  1JUN A;  1FZC B;  4GIF A;  3VOP A;  1XTC C;  2HLO A;  4C7R A;  2GM4 A;  4AQR D;  2KOG A;  3EQ2 A;  5BVZ A;  3U59 A;  3RK2 B;  2YKQ A;  3M9B A;  4W80 A;  2E42 A;  1JCD A;  3M0A A;  1RE3 C;  2BAS A;  1KFM A;  4WY4 B;  3HD7 A;  2FFD C;  3B5N C;  3V2P A;  2P1J A;  1HGZ A;  4HH2 A;  3H32 A;  2E43 A;  5AW7 B;  1E5W A;  2JEE A;  5AW6 B;  4O9B A;  3G3Z A;  5CCG D;  1KIL D;  1N2D C;  1S9K D;  3BAT A;  1LT9 A;  1SP4 A;  3M06 A;  1LWU A;  5CHX A;  3BRT B;  2Q5U A;  4HYT B;  3MTU E;  2P7J A;  1NTK K;  2HG5 D;  2A45 H;  3L35 A;  5APX A;  2C9L Y;  3WMM 0;  4B86 A;  1ZLL A;  1SFC C;  2XNX A;  1KZU B;  1RF0 A;  1FJP A;  1FZG A;  1ZR2 A;  3LW5 H;  2C0X A;  3A3Y B;  1N7S D;  1ZV8 A;  1IFM A;  2QM8 A;  1HBW A;  1LTJ C;  3T97 A;  5BU8 B;  5CCH C;  1SQP K;  2WZ7 A;  3A2A A;  1MFZ A;  5AW4 B;  3P8C D;  3IR9 A;  2R5D A;  3TNU A;  3V2R A;  1RE3 A;  1N7L A;  1T2K D;  2YKO A;  2FFD A;  1KIL C;  3B5N A;  2NPS A;  1J2J B;  3P32 A;  5AVQ B;  1JOC A;  1OXZ A;  3O8Z A;  1N86 A;  2KLV A;  1WT6 A;  1IFN A;  1CW5 A;  1MZ9 A;  2YNY A;  3SWY A;  2I1J A;  1N7S B;  3VTP C;  3OAK A;  1YTZ T;  1FJK A;  1X79 B;  5AW5 B;  5AW1 B;  1G2C A;  3V4Q A;  1LTA C;  1X8Y A;  2N1T B;  1RF1 A;  3V5B A;  2OYI C;  1VDF A;  5KJ7 C;  3TYY A;  4EIJ A;  2HYN A;  5BU5 A;  1JY3 N;  4AYC A;  2Z4E A;  4LGD E;  5AW0 B;  3TK1 A;  1NOH A;  2L5G B;  1IFJ A;  2R32 A;  4DZO A;  3CLQ A;  1SFC A;  3GHG B;  5AVT B;  2A45 I;  1N73 C;  1CZQ A;  1FZE A;  1XTG B;  1M1J C;  5APU A;  1JY3 O;  3RK3 C;  2XKM A;  3KPE A;  4N78 D;  1CI6 A;  1L4A C;  3KQG A;  1HVV A;  2GUV A;  3PP5 A;  2IFN A;  1FZF A;  1LTJ A;  5CCH A;  4Y99 B;  1SQV K;  2OYH C;  1L0N K;  4WB4 A;  3HTK A;  5AVZ B;  4I1L A;  2HPC B;  1A02 F;  5CJ0 A;  3VMX A;  3V4W A;  1IFI A;  1FDM A;  1URQ D;  3I5C A;  1NHL A;  3HE4 A;  2OAR A;  2VRS A;  1PFI A;  3TNU B;  1GL2 B;  1FZB A;  1FZC C;  1IC2 A;  1RY3 A;  1RE4 C;  2PP6 A;  2NPS B;  1T8Z A;  3NFQ A;  1J1D B;  2J58 A;  3RK2 C;  5AW3 B;  1J1E B;  1GW3 A;  5APQ A;  2HOD A;  3V2N A;  2WTY A;  2FXM A;  1JO5 A;  5AW8 B;  4WY4 C;  1LGH B;  4GKG A;  2WT7 B;  3RL0 B;  5CJ4 A;  1MV8 A;  1HTL C;  1GU5 A;  1LTI C;  2Q3I A;  2OYI A;  5KJ7 A;  1URQ B;  1RF1 B;  1NAF A;  3KYQ A;  3P7K A;  5APV A;  2WSC H;  2WPR A;  2R3C A;  1JY3 P;  3OA7 A;  1DEB A;  1NWQ A;  1M1J A;  1NO4 A;  1OWA A;  1GU4 A;  3E1I A;  3NMD A;  1L4A A;  5AVW B;  4C7N A;  3HUS B;  3VMZ A;  1DX7 A;  1JTH A;  5AVR B;  1CI6 B;  2FYU K;  3H6P A;  1M7L A;  1FBM A;  3N7N A;  1LTT C;  4LC1 A;  1A02 J;  1FOS E;  2N1T D;  3VYI A;  2WWW A;  5CMZ A;  4GT1 A;  4WBA A;  1LTG C;  1CSB A;  4I6M C;  1IFD A;  3HTK B;  1ZN5 A;  3KDP B;  2WSE H;  4IFF A;  5AW2 B;  5CCG C;  1SLQ A;  1FZC A;  2JJL A;  2POH A;  3HE4 B;  4JF7 A;  3A5T A;  4N6J A;  1RE4 A;  3HD7 B;  2YO3 A;  1YYC A;  4M3L A;  1GW4 A;  3H32 B;  1T3J A;  2KB7 P;  3M9H A;  1S9K E;  4WY4 A;  1WRG A;  2O01 H;  2O1J A;  1JNM A;  2FYZ A;  2PAJ A;  4ZKU A;  3V2Q A;  3II6 A;  1N7S C;  3U1A A;  1LT9 B;  1LWU B;  2YO2 A;  2C9N Y;  2C0W A;  5AVV B;  2I1K A;  1GL2 D;  1G1J A;  1KQL A;  4JYC A;  3C9I A;  4EOT A;  3L4F A;  1HH0 A;  2N1T C;  3EFG A;  3B5N D;  5APW A;  2NPS D;  5KLV K;  1T2K C;  4AUW A;  2O1K A;  3P8C E;  2FKW B;  1LWU C;  1JMM A;  1H89 A;  3GHG C;  1NU1 K;  3RL0 D;  1HUC A;  1FZA A;  1SQX K;  2J59 M;  1G1I A;  1GD2 E;  1GZL A;  1NKN A;  5APT A;  3VMY A;  2H8P D;  3HE5 A;  2N9B A;  4W7Y A;  4XA4 A;  4C46 A;  5CCG A;  2QM7 A;  1KIL A;  2Q9I A;  2WPQ A;  2IFM A;  4Y99 C;  1GDT A;  2H7H A;  2FFD B;  3B5N B;  1LTB C;  1AQ5 A;  1SFC D;  3N4X A;  2W27 A;  2ZXE B;  2KSJ A;  3VP8 A;  3BAS A;  4LLH A;  1QL2 A;  2WPS A;  3OJA B;  2Z5H A;  3TSI A;  1JY2 N;  1GL2 C;  2P2U A;  1H88 A;  4JYB A;  5AVX B;  1G2C B;  3NTN A;  1IO4 A;  5CCH D;  2NPS C;  1IK9 A;  1VPC A;  1J1D C;  2XZR A;  1HGV A;  1JY2 O;  2P67 A;  1N7S A;  1J1E C;  2GUS A;  3UIA A;  3U1C A;  4N3Y B;  1NTZ K;  3MIW A;  3MUD A;  1FAV A;  3CI9 A;  3CL3 D;  4N78 E;  3IFM A;  3LID A;  4KHX A;  1N73 A;  3RL0 C;  2N1T A;  1SFC B;  3VP9 A;  3HD7 D;  2M3B A;  1HJB A;  4DOJ A;  1X9V A;  3P8M C;  1URQ C;  2Z5I A;  1RF1 C;  1H8A A;  1FOS F;  2XV5 A;  2WIT A;  1L0L K;  2OYH A;  3GHG A;  2IPP A;  2ZFC A;  1LTJ B;  1DH3 A;  1Z56 A;  4ZKP A;  5AVY B;  2XU6 A;  4IFM A;  2KYV A;  3SWF A;  5AVS B;  1YTZ I;  3HUS C;  2IX7 C;  2W6B A;  5KTB A;  5KJ7 D;  3VN0 A;  1EQ7 A;  3M0D C;  3HE5 B;  1MUU A;  2KP8 A;  1IJD B;  1FU1 A;  1KIL B;  2R5B A;  5APS A;  1QL1 A;  2HPC A;  1SVF A;  1SQQ K;  2CPB A;  3RK3 D;  2W6A A;  1L4A D;  2YKP A;  1GL2 A;  1NKZ B;  2M8R A;  3HRN A;  3B8E B;  2HOD B;  1JY2 P;  3HD7 C;  2WSF H;  1T3U A;  1GTW A;  1ZR4 A;  3M91 A;  2H43 A;  2OYI B;  1NTM K;  2A45 G;  1KFN A;  2WT7 A;  2Q7C A;  3BRV B;  3MGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...