2P2UA

Crystal structure of putative host-nuclease inhibitor protein gam from desulfovibrio vulgaris
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
150
Chain Sequence
b'VIVADIRQAEGALAEIATIDRKVGEIEAQMNEAIDAAKARASQKSAPLLARRKELEDGVATFATLNKTEMFKSLDLGFGTIGFRLSTQIVQMSKITKDMTLERLRQFGISEGIRIKEDVNKEAMQGWPDERLEMVGLKRRTTDAFYIEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Host-nuclease inhibitor protein Gam, putative
molecule tags Dna binding protein
source organism Desulfovibrio vulgaris
publication title Crystal structure of putative host-nuclease inhibitor protein Gam from Desulfovibrio vulgaris
rcsb
total genus 26
structure length 150
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07352 Phage_Mu_Gam Bacteriophage Mu Gam like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p2uA01
2XZRA 2C9LY 2QM7A 3VMYA 5APYA 3P8MC 1GD2E 2P67A 2Q3IA 2VRSA 1X8YA 1J2JB 3IR9A 4M3LA 5AVYB 2C9NY 3M06A 2XV5A 5APVA 1MV8A 5AW9B 2WT7A 3TNUA 1SLQA 1JNMA 3TNUB 5AVQB 2W6AA 3A3YB 3M9BA 2R32A 5AW7B 4JYBA 4KHXA 2WWWA 5AVTB 1S9KD 2P2UA 2WPRA 3NMDA 3LIEA 2H7HA 4AYCA 5APUA 4XE5B 4DZOA 1NWQA 3NFQA 4GKGA 1A02F 3L37A 1DH3A 2WPQA 5AVZB 3TYYA 2WPSA 1HBWA 5AW6B 5AW5B 3M91A 3P7KA 1KQLA 3NTNA 1GU4A 3HE4B 2Q5UA 2Z5HA 4I2LC 1MFZA 3HE5B 3L36A 1A02J 3B8EB 5AW0B 5AW3B 5AVRB 2YO3A 5AW4B 4AQRD 5CMZA 1FOSE 2R5BA 5AVUB 1T2KC 2QM8A 4C7NA 2JJLA 3VYIA 1GU5A 4JYCA 2YNYA 1H88A 1SP4A 2R3CA 3VTPC 3KDPB 5APQA 3A2AA 3VMXA 2WT7B 3LIDA 4B86A 3VMZA 1IO4A 1GTWA 1FOSF 2R5DA 5AVSB 4I6MC 1H8AA 2Z5IA 2YO2A 3HTKA 3KQGA 3TK1A 2XU6A 2IPPA 1CZQA 1YYCA 2E43A 3VN0A 2WTYA 3L35A 3M9HA 3OAKA 4EOTA 1H89A 5AW8B 5AVWB 2ZFCA 5AW1B 3I5CA 3NXSA 4LC1A 3HE4A 5APWA 4C46A 1GK6A 1HJBA 5APSA 3MGNA 5APTA 3HE5A 1OWAA 2P7JA 2Q7CA 1CI6A 1CSBA 1JUNA 1HUCA 2ZXEB 3A7OA 5APXA 1GZLA 3M0AA 2KP8A 5AW2B 4HYTB 3P32A 3M0DA 5AVVB 3T97A 3SWFA 4GT1A 3V5BA 3A5TA 2W27A 1S9KE 3V4QA 2N9BA 3V4WA 1GK4A 1MUUA 1G2CB 1CI6B 2E42A 1OXZA 4RESB 1HWTC 1FAVA 3O8ZA 2BASA 1NAFA 4C7NB 1T2KD 3UIAA 3MD0A 5AVXB 4AUWA
chains in the Genus database with same CATH superfamily
1RH5B 2XZRA 2M0BA 1VF5C 2Y9YA 2HFED 2XNXA 1HVVA 1N86A 2OTKE 2KNCA 3AE9C 4PD4H 5KLVE 4HH2A 1VQLP 2IFMA 3CMAP 4DT0A 3G3ZA 2JDIH 5M1BA 4N6JA 1VQ9P 1AFOA 1X8YA 1SQPG 2AEMA 3IR9A 2FKWB 1USEA 2KK7A 2FYUG 5C39A 3L71J 1UIXA 1URQB 4GODA 2ZVOB 2N1TC 3V2NA 2O1JA 3L73E 1MV8A 2IDBA 4WY4B 5AW9B 3W68A 1L0NE 5AVQB 3P8MC 3M9BA 4KJMA 2QG4A 2R32A 4A7PA 1LT9C 5AVTB 3L73G 1XTCC 1BE3D 1PGQA 3OJAB 2JEEA 4AYCA 1SQQJ 4PD4D 1NTZD 1ZV8A 2OGUA 5GTIH 2E74C 3F89A 1SQBG 3GMAA 1KORA 1K8AQ 3WUUA 1OMIA 3GHGB 2FYUD 2E5TA 3L74J 2HLOA 2NPSB 2WPQA 2A45I 3NFQA 5CBOA 1ZR4A 1M1JB 1A02F 1HBWA 2OQQA 4L74A 5AW6B 1M8OB 1PP9G 2J59M 1QVGO 1SQXJ 3V2PA 1OW7A 3NTNA 5KLVD 2AEFA 1VQPP 2Q5UA 1EXIA 4UB6H 1NTZJ 4RO0A 1NTKE 1BDCA 3A0BE 3L74G 1T8ZA 3B8EB 2GUVA 1LTJB 1W2EA 2N1TB 1L0NJ 2ZAEB 2N9YB 3JC22 4K3AA 1N73B 3B5NA 2E76C 5AW3B 3GF3A 2HODA 2XNDH 5AVRB 3AE6C 1NAYA 2CPBA 2FBWC 3ABVC 1U7MA 3CX5D 1EDIA 2R5BA 2UWJE 2K3RA 1M56D 5L8RJ 1MFTA 3D71A 4PV1B 2OYHC 5KLIB 3ITKA 5KLVK 4HJGH 3C8VA 2E74D 3H6PA 4JYCA 2HR3A 1H88A 1SP4A 4IL6E 2LR2A 1VF5D 1SQPE 5CCHC 3CCVP 1NGMB 3CWBD 3PH0A 1JY3N 4BXLA 3PP5A 4WVZA 1H0TB 3VMZA 1IO4A 2L91A 1GL2C 4U3FD 5CCGC 1YJWP 2GA1A 4IOIH 3MHVA 5AVSB 1HJ0A 1EZVD 2K9YA 3GHGC 3QWOC 1SQQE 2Z5IA 1DEBA 3AE7C 2YO2A 3HUSA 3HTKA 3H1KG 3B5ND 3S1KA 3PRJA 3WUVA 1PGOA 3KHUA 4ZNCA 1R8EA 2N1TD 3L74D 2M5AA 1EC5A 3AE8C 3VP8A 1RQUA 3B71A 3EFFK 4IFFA 4L75A 2O3JA 1QLED 3M9HA 4RJTA 1X79B 2OYIC 2I1JA 1ZOYC 2ZYDA 4H44D 5AVWB 1RE4C 1L2PA 2V7QJ 2GUSA 1SQVD 4H0LB 4LC1A 1AV1A 1GK6A 4LLHA 2BCCJ 2YMYA 1L0LG 2JWAA 1NJIQ 1SQBD 3KZIH 2G8YA 2KLVA 3R4YA 4Y28J 1CI6A 3HUSC 4BRYB 1JUNA 1FZCA 2QJKB 2ZXEB 1G2CA 5KLIC 1LP1A 1BE3G 2RMZA 3AE3C 3L73D 3M0AA 1IFIA 1N7LA 1JMMA 1NH4A 4HYTB 5CHXA 1NTKJ 3EQ2A 2XDJA 4GT1A 5E79H 3V5BA 3CC2P 1L0LJ 1OX3A 2M5AB 2Y0DA 2K9JB 1RF0C 3H1HG 3L75J 1LJ2A 3V4WA 2DW3A 2IBZD 3WMM0 1N73A 1L4AD 3H1ID 1RE3A 1LTIC 1IFNA 2FXOA 3A0BH 2QRXA 3L74E 1SS1A 3O8ZA 2H8PD 3PJSK 4NPEA 2BASA 2MJZA 3JCUE 4YTPC 5B66H 1YJNP 1DEEG 1HH0A 4GOFA 1SQVJ 3PLNA 1KTMA 1KZUB 3MD0A 1PIXA 2FXMA 3H1IE 4CPGA 4DJGA 3H1LD 4GIFA 2BEQD 1GDTA 3HD7C 2C9LY 4N78D 3VMYA 3L73J 4U7JA 1L4AB 2Q3IA 3H32B 3GF7A 4M3LA 1LTGC 1ZN5A 5AVYB 2C0XA 2NZ2A 3MZWB 1RF1A 3CD6P 1YQ3C 2FY8A 2C9NY 1NO4A 1IFMA 2ITAA 3CXHD 3TSIA 3CCSP 1RF0A 1IFDA 2KSJA 3OW2O 2YIUB 4PJ0H 1CW5A 1P84D 1SLQA 3WU2E 3TNUB 3KPEA 3A3YB 5AW7B 3MTUE 1EDKA 1WT6A 4ZKUA 2LXBA 2H7HA 2WSFJ 2P2UA 2WPRA 3NMDA 1LT9A 2Y0CA 1VQNP 5APUA 3C9IA 1VQMP 1T3UA 3CXHH 2IX7C 4DZOA 2FYNC 1BE3E 2QSIA 2YXRB 3L75D 1PP9E 4O9BA 1NOHA 1EZVE 2D2CD 2WSEH 1HGVA 1S1CX 3AEGC 3LW5H 4GKGA 2AXTE 3B5NB 4H13B 4BRYA 4EI2A 1RE4A 3BATA 1ZRTD 3L70G 1WMKA 1M7LA 2WPSA 3O6QA 5AVZB 5GTHH 3TYYA 1L0LK 5TISH 2Z4EA 1KYOH 2QJKC 1EZVG 3BCCG 3CXHI 3P7KA 1KQLA 3VMAA 3HUSB 1RY3A 2HPCA 1AVOA 3HE4B 1N7SA 2Z5HA 2HG5D 3L70E 4LGDE 2E75D 1FZCC 3TGUD 5H2FH 1MFZA 4YPCA 1A02J 1FBMA 1LTAC 2BCCD 2KS1A 1D7MA 3L72D 3SSUA 1ZP0C 1U57A 2K1AA 2NPSA 1Q86Q 1QVFO 1SQXE 1BCCD 1N7SC 3A0HH 4AQRD 1KYOE 3BCCJ 2Y9ZA 1KILC 4W80A 1FOSE 3H1HE 1QGKB 5CCGA 3H1JE 3CMEP 1NU1D 2WSFH 5TJHA 3T97B 2JJLA 3H1KJ 1OFCX 2Y0EA 1BCCE 1Z56A 1EXJA 2D2CC 2YNYA 3GLMA 1LP1B 4IL6X 1ZLLA 5APQA 1E5WA 1SFCB 3VMXA 1N2DC 1FU1A 1SQQG 4GDOA 4B86A 3KXDA 3AEAC 1GTWA 1AQ5A 1RQVA 5KJ7C 4H13C 4I6MC 5KLVG 4UB8E 3BRTB 1KYOI 2E75C 3I56P 2M8RA 1KFMA 3KQGA 3TK1A 1NTZK 3L71E 2K88A 1FJPA 3RBXA 1KC8Q 2KNCB 5KJ7A 1R5LA 1URQC 2RKLA 1KFNA 1NTZG 4DOJA 5CJ0A 5KLVJ 4EOTA 2HPCB 1H89A 1MKMA 1Q81Q 2ZFCA 4NPFX 1N73C 1FDMA 1GW4A 1L0NG 2Q1KA 2Q3EA 3TGUJ 1FS0E 1FZEA 2ZYAA 3HE4A 5APWA 3U1AA 1NTZE 1JTHA 1EZVI 1XTGB 5APSA 3SFEC 2CK3H 1PL5A 2D2CB 1OWAA 3SWYA 2FYNB 1ZR2A 1VDFA 3CXHE 2ZYGA 1URQD 5APXA 3RL0B 1SQBE 1KILA 3CI9A 2O1KA 1P84E 2HYNA 2J58A 2IYPA 4IFMA 2NPSC 2M3EA 3P32A 5KTBA 2PP6A 1JY3O 5DJUB 3A5TA 3SWKA 2W27A 5TISE 2NRGA 3RGUA 2KB7P 1Y8AA 2JO1A 1GK4A 3Q5RA 1CI6B 3AEFC 4IFDK 1FZCB 2JKVA 1HWTC 4N3YB 3RK2C 3K5BA 1S2EA 1FAVA 5K5GB 3IAOA 2E76B 3Q5SA 1T3JA 1S72P 1BGYD 1ZXGA 2FYUK 4JF7A 2H43A 4Y99C 5CCGD 4W7ZA 2WMMA 1M1KQ 2YKQA 1S4XA 5AVXB 2WSEJ 4GOEA 2FYUJ 2IZ0A 2QM7A 3O6QB 1FZGA 2QE7H 1VQ5P 1VQ8P 2IBZE 2JR8A 1DX7A 1KV4A 2FFDB 1BCCG 2AXCA 1AA0A 3GG2A 3H1LE 1LNQA 3L72E 2P67A 1IJDB 1SFCC 2VRSA 2P10A 4L73A 4R4LA 2A06E 2BCCG 2C0WA 2M3BA 2ZXXA 1PFIA 1NTKD 2O01N 3AE1C 2W6JH 1OVVA 3H1JD 2XV5A 4RKUJ 3E7KA 3CCLP 3A0HE 3N7NA 1T6AA 1PGJA 2ZT9D 1LTSC 1JCDA 3P8CD 2WZ7A 5APVA 1BCCJ 3TNUA 3GHGA 2W6AA 3H1KE 3CL3D 3L71G 3RK2B 4KHXA 1KQGB 2WWWA 5BU5A 2PRRA 3OA7A 3SFDC 3H1HJ 3HD7A 3L75G 3M9QA 4TLFA 4XE5B 4DCKA 1QL1A 2IBZI 5CCHA 2ZVNB 1S5LE 4H13D 3H25A 1Q82Q 1NWQA 1X0TA 1IK9A 3CPWO 1M57D 1RF1C 1MZ9A 3G4SP 2MKVA 3BASA 1ZMEC 2WPVB 2OYHA 1RE3C 3M0DC 1ZW0A 4PD4I 2AEJA 3USSA 2B9BA 5BVZA 1URQA 3CCJP 5KAFE 4W7YA 1IFJA 1YQ4C 1N7SB 3D6ZA 3FXDA 1NTMK 3HE5B 2A06D 2KS1B 2PAJA 4HB1A 2I8DA 1KB9H 4JQ0D 1HTLC 1PP9J 2B87A 4PV1C 3TF5A 2KIKA 5AW4B 2YO3A 1OW8A 5CBNA 3Q2YA 1SQVK 4UB8H 1VQOP 3HD7D 3L4FA 1FC2C 1KB9E 2FFDA 1VL2A 1SQXD 1QX8A 5AVUB 1PZQA 2QM8A 4D6TD 1G1IA 3CLQA 2JWDA 3VYIA 1GU5A 1NU1E 1VF5B 3MIWA 2E5YA 4K35A 1NU1K 1FJKA 2R3CA 2KOGA 5B5EH 3Q5PA 3II6A 4XA4A 2BCCE 3AEDC 4WY4A 1EDJA 3RL0D 1Q90D 2FYUE 4N78E 1W2BO 4ASVA 2A45H 2OYIB 1JY3P 1TU3F 4OH8B 1GD2E 1S3JA 3H1HD 3CC4P 2KZIA 2YKOA 4QMAA 4D6TJ 4OGQD 2QJYC 1Q2NA 2XU6A 2IPPA 2YIUC 4ZKPA 1LTJC 1YYCA 2A06G 3R2PA 4EYYQ 1Q7YQ 2E43A 1AVYA 1L0ND 2Q9IA 2W90A 3I55P 1JO5A 2R3SA 1GMJA 2QJYB 2KZJA 1KB9I 2PFXA 2OYIA 2V4HA 1KILB 3OAKA 4H44B 1NU1J 1L4AC 1GL2B 2FXPA 4PD4E 5AW8B 2WSSH 3AE4C 3LW5J 3RL0C 3I5CA 1LTTC 3NXSA 3S9OA 2RN0A 3CC7P 2XKMA 2Q6QA 3RK3B 1SQPJ 4H0LD 3V2QA 3CCRP 2RH0A 1JTHB 3BCCE 3L72J 3HE5A 3MGNA 3L75E 5APTA 2Q7CA 1GL2D 3WU2H 1CSBA 1PPJG 1HUCA 2SPZA 4JBZA 4OGQC 5E79E 3V2RA 3VOPA 5CCHD 3Q1MA 1YTZI 1GL2A 1Y47A 2ZT9C 1DD3A 3CX5H 5AW2B 3RK3E 4OVNF 5EFWB 3AE2C 3B5NC 1K73Q 1YITP 1KILD 1NTMJ 1PPJE 3H1KD 1HJBA 1FE6A 2KYVA 3SWFA 1DH3A 1KQSO 1FZFA 4WY4C 3BRVB 2B89A 1QEXA 3KZIE 3Q3DA 3BVHA 2WITA 1NTME 3MUDA 3H1JG 1OVRA 1UIIA 4MN4C 1G2CB 3VP9A 2QEXP 1H8AA 4UB6E 1NTKG 3CX5E 3CWBG 1PGPA 2ZJSE 1N8RQ 4KT0J 1KYOD 1NTMG 3G9RA 2QIWA 1BSHA 1NAFA 1H0TA 5BU8B 4C7NB 1EDLA 1NTMD 1YTZT 1M1JC 3PTZA 3G6EP 1RF1B 3UIAA 1W5CE 4AUWA 1BGYE 2H88C 2KXPB 5KKZB 3EFGA 3RBZA 2WQYC 4I7ZC 5APYA 2OARA 3BCCD 2J5UA 3AEEC 4PV1D 2BEZF 3GW6A 2YKPA 1IZNB 1J2JB 1KMIZ 3L70D 4HKZH 1KD1Q 1IC2A 3HD7B 1BGYJ 3CX5I 3TGUE 1P84H 2N1TA 2WVRA 3RK3D 2B87B 3M06A 1JOCA 3JSVC 1JEKA 1KILE 1PPJD 2KI7B 3H1LJ 2OTLP 1NTKK 1SVFA 1PP9D 1AQTA 5KAIE 2WT7A 5DJTB 1JNMA 4OWFA 1VQ6P 2IFNA 3H32A 2AXTH 1IK7A 1X9VA 4ZMDA 1NKZB 1DD4A 4JYBA 1P84I 1S9KD 1K04A 3L70J 3LIEA 1FDIA 3CCMP 1OIPA 1SQPK 1J1DB 4PJ0E 5GTHE 1T2KC 2OYOA 2V7QH 3EWKA 3L37A 5B5EE 2HODB 1LGHB 4Y99B 2W6BA 1LWUA 1JY2N 3IFMA 2H89C 5AW5B 1FZAA 3M91A 1BDDA 2OYHB 4I7ZB 1NVOA 1SFCA 1GU4A 5KKZC 3RK2D 4NPDA 1YIJP 3JCUH 3U59A 3AE5C 2KSEA 3W67A 1NHLA 3CCUP 3MP7B 4U3FJ 1M90Q 2G3AA 2E74B 3L36A 1JM0A 1LTJA 4I2LC 1X22A 1SQPD 5KJ7D 3TDKA 3WUTA 5AW0B 4EDFA 1SQBJ 4L76A 1LWUB 2K37A 4I1LA 1U7JA 1QL2A 5CMZA 3RL0g 1VPCA 2KUBA 4R4MA 1L4AA 2W83C 1K05A 3H1IG 1KQFB 4D6TG 4WWIA 1LWUC 1FDOA 1SQQD 1SQXG 2QJPB 4U3FG 5H2FE 4C7NA 2POHA 2IBZG 4YXDC 3AECC 3FWNA 5KAFH 1OZHA 2QVAA 5B66E 4D6TE 2QA4P 1E79H 3PHLA 1VQ7P 1OVUA 1JY2P 2E76D 3IN6A 3KDPB 4TT3H 3V6IA 3IF4A 3VTPC 3A2AA 1G1JA 2WT7B 2QJPC 1NU1G 1HGZA 2IYOA 2O01H 3H1IJ 3LIDA 2FFDC 2OTJP 3C1LA 1FOSF 2R5DA 1S5LH 1SQVE 1OW6A 1L0NK 3FGAD 2PGDA 3E1IA 4WB4A 1L0LD 3L72G 3RK3C 1YBKA 2NPSD 1N7SD 3HTKB 1CZQA 3FWLA 1YJ9P 2W8ZA 1SQVG 1NKNA 2YMKA 3VN0A 3TGUG 2CPSA 2WTYA 2E75B 2JP3A 1VQKP 2A45G 1HF9A 3L35A 4JPZB 5GTIE 2WSCH 2IZ1A 3D6YA 1AJYA 1L0LE 2WSCJ 3E1RA 2ZT9B 1VQ4P 2YXQB 1NYHA 5AW1B 1PV3A 3L71D 1LT1A 1WRGA 4C46A 4EIJA 3U1CA 3H1JJ 4WY4D 1JCCA 4OGQB 3ZDMA 1K9MQ 1KN7A 1SQQK 2P7JA 3G71P 1J1DC 1GW3A 1ZRTE 3KYQA 2P1JA 1M1JA 1RHZB 1USDA 1JB0J 3AEBC 3CWBJ 3FXEA 3A7OA 4H0LC 4IL6H 5CJ4A 1GZLA 2R44A 1IFPA 3D70A 2KP8A 1SQBK 2O01J 4XFJA 2I1KA 1LTBC 4H44C 1YI2P 3M0DA 1JMBA 3N4XA 5AVVB 3T97A 2P58A 1SQXK 1J1EB 4ASWA 1SFCD 4Z1MH 2LKMA 1FZBA 3MUDC 3CWBE 5KAIH 1S5LX 3P8CE 3V4QA 3S4RA 1S9KE 2N9BA 1YHQP 1R5SA 1MUUA 2FYZA 2LXCB 3FX0A 2E42A 4U3FE 1J1EC 1OXZA 4RESB 2L5GB 4BWNA 2GM4A 1EQ7A 1LT9B 3F5HA 4WBAA 1Y9BA 3CCEP 1DIPA 2B88A 1BSNA 3CCQP 1BE3J 1BGYG 1KB9D 3HRNA 4C7RA 1T2KD 3QH9A 3B4SA 4YXWH 2KLUA 1JY2O 2K9JA 3H1LG
chains in the Genus database with same CATH topology
2XZRA 5CCHD 2HFED 2XNXA 1HVVA 1N86A 4HH2A 2IFMA 3G3ZA 1AFOA 4N6JA 1X8YA 3IR9A 2FKWB 1URQB 2N1TC 3V2NA 2O1JA 1MV8A 4WY4B 5AW9B 5AVQB 3M9BA 2R32A 1LT9C 5AVTB 1XTCC 3OJAB 2JEEA 4AYCA 1ZV8A 3GHGB 3NFQA 1A02F 2HLOA 2NPSB 2WPQA 2A45I 1ZR4A 1DH3A 1M1JB 1HBWA 5AW6B 2J59M 3V2PA 3NTNA 2Q5UA 1T8ZA 3B8EB 2GUVA 1LTJB 1W2EA 2N1TB 1N73B 3B5NA 5AW3B 2HODA 5AVRB 2CPBA 2R5BA 2OYHC 5KLVK 3H6PA 4JYCA 1H88A 1SP4A 5CCHC 1JY3N 3PP5A 3VMZA 1IO4A 5CCGC 1GL2C 5AVSB 3GHGC 1H8AA 2Z5IA 1DEBA 2YO2A 3HUSA 3HTKA 2HPCB 3B5ND 2N1TD 3VP8A 4IFFA 3M9HA 1X79B 2OYIC 2I1JA 5AVWB 1RE4C 2GUSA 4LC1A 1GK6A 4LLHA 2YMYA 2KLVA 1CI6A 3HUSC 1JUNA 1FZCA 2ZXEB 1G2CA 3M0AA 1IFIA 1N7LA 1JMMA 1NH4A 4HYTB 5CHXA 3EQ2A 2XDJA 4GT1A 3V5BA 1RF0C 3V4WA 3WMM0 1N73A 1L4AD 1RE3A 1LTIC 1IFNA 4GIFA 3O8ZA 2H8PD 2BASA 2MJZA 1HH0A 3MD0A 1KZUB 2FXMA 1GDTA 2C9LY 3HD7C 4N78D 3VMYA 1L4AB 2Q3IA 3H32B 4M3LA 1LTGC 1ZN5A 5AVYB 2C0XA 1RF1A 2C9NY 1NO4A 1IFMA 3TSIA 1RF0A 1IFDA 2KSJA 1SLQA 3TNUB 3KPEA 3A3YB 5AW7B 3MTUE 1WT6A 4ZKUA 2H7HA 2P2UA 2WPRA 3NMDA 1LT9A 5APUA 3C9IA 1T3UA 4DZOA 2IX7C 4O9BA 1NOHA 2WSEH 1HGVA 3LW5H 4GKGA 3B5NB 1RE4A 3BATA 5AVZB 3TYYA 1M7LA 2WPSA 2Z4EA 1L0LK 3P7KA 1KQLA 3HUSB 1RY3A 2HPCA 3HE4B 1N7SA 2Z5HA 2HG5D 4LGDE 1FZCC 1MFZA 1A02J 1FBMA 1LTAC 2NPSA 1N7SC 4AQRD 1FOSE 1KILC 4W80A 5CCGA 2WSFH 2JJLA 1Z56A 2YNYA 1ZLLA 5APQA 1E5WA 1SFCB 3VMXA 1N2DC 1FU1A 4B86A 1GTWA 1AQ5A 5KJ7C 4I6MC 3BRTB 2M8RA 1KFMA 3KQGA 3TK1A 1NTZK 1FJPA 5KJ7A 1URQC 1KFNA 4DOJA 5CJ0A 4EOTA 1H89A 2ZFCA 1N73C 1FDMA 1GW4A 1CW5A 1FZEA 3HE4A 5APWA 3U1AA 1JTHA 1XTGB 5APSA 3SWYA 1OWAA 1ZR2A 1VDFA 1URQD 5APXA 3RL0B 1KILA 3CI9A 2O1KA 2HYNA 4IFMA 2J58A 3P32A 2NPSC 5KTBA 2PP6A 1JY3O 3A5TA 2W27A 2KB7P 1GK4A 1CI6B 4IFDK 1FZCB 1HWTC 4N3YB 3RK2C 1FAVA 1T3JA 2H43A 4JF7A 2FYUK 4Y99C 5CCGD 4W7ZA 2YKQA 5AVXB 1FZGA 2QM7A 1DX7A 2FFDB 3RL0D 3P8MC 3VOPA 1GD2E 2P67A 1IJDB 1SFCC 2VRSA 2C0WA 2M3BA 1PFIA 2XV5A 3N7NA 5APVA 3P8CD 1LTSC 1JCDA 2WZ7A 3TNUA 3GHGA 2W6AA 3CL3D 3RK2B 4KHXA 2WWWA 5BU5A 3OA7A 3HD7A 3M9QA 4XE5B 1QL1A 5CCHA 1NWQA 1IK9A 1RF1C 1MZ9A 3BASA 2OYHA 1RE3C 3M0DC 5BVZA 1URQA 4W7YA 1IFJA 1N7SB 1NTMK 3HE5B 2PAJA 1HTLC 5AW4B 2YO3A 1SQVK 3HD7D 3L4FA 2FFDA 5AVUB 2QM8A 1G1IA 3CLQA 3VYIA 1GU5A 3MIWA 1NU1K 1FJKA 2R3CA 2KOGA 3II6A 4XA4A 4WY4A 4N78E 2A45H 2OYIB 1JY3P 4OH8B 2YKOA 2XU6A 2IPPA 4ZKPA 1LTJC 1YYCA 3R2PA 2E43A 1JO5A 2Q9IA 2OYIA 1KILB 3OAKA 1L4AC 1GL2B 5AW8B 3RL0C 3I5CA 1LTTC 3NXSA 2XKMA 3RK3B 3V2QA 1HJBA 1JTHB 3MGNA 5APTA 3HE5A 2Q7CA 1GL2D 1CSBA 3V2RA 1HUCA 1YTZI 1GL2A 5AW2B 3B5NC 1KILD 2KYVA 3SWFA 1FZFA 4WY4C 3BRVB 3BVHA 2WITA 3MUDA 3VP9A 1G2CB 1NAFA 5BU8B 4C7NB 1YTZT 1M1JC 1RF1B 3UIAA 4AUWA 3EFGA 5APYA 2OARA 2YKPA 1J2JB 1IC2A 3HD7B 2N1TA 3RK3D 3M06A 1JOCA 1NTKK 1SVFA 2WT7A 1JNMA 2IFNA 3H32A 1X9VA 1NKZB 4JYBA 1S9KD 3LIEA 1SQPK 1J1DB 3L37A 2HODB 1LGHB 4Y99B 2W6BA 1LWUA 1JY2N 3IFMA 5AW5B 1FZAA 3M91A 2OYHB 1SFCA 1GU4A 3RK2D 3U59A 1NHLA 4I2LC 3L36A 5KJ7D 1LTJA 5AW0B 1LWUB 4I1LA 1QL2A 5CMZA 1VPCA 1L4AA 1T2KC 1LWUC 4C7NA 2POHA 1JY2P 3VTPC 3KDPB 3A2AA 1G1JA 2WT7B 3LIDA 1HGZA 2O01H 2FFDC 1FOSF 2R5DA 1L0NK 3E1IA 4WB4A 3RK3C 2GM4A 2NPSD 1N7SD 3HTKB 1CZQA 3VN0A 1NKNA 2CPSA 2WTYA 2A45G 3L35A 2WSCH 5AW1B 4EIJA 1WRGA 4C46A 3U1CA 4WY4D 1JCCA 1SQQK 2P7JA 1J1DC 1GW3A 3KYQA 2P1JA 1M1JA 5CJ4A 3A7OA 1GZLA 2KP8A 1SQBK 2I1KA 1LTBC 3M0DA 3N4XA 5AVVB 3T97A 1SQXK 1J1EB 1SFCD 2LKMA 1FZBA 1S9KE 3V4QA 3P8CE 2N9BA 1MUUA 2FYZA 2E42A 1J1EC 1OXZA 4RESB 2L5GB 1EQ7A 1LT9B 4WBAA 3HRNA 4C7RA 1T2KD 1JY2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZR A;  2C9L Y;  2QM7 A;  3VMY A;  5APY A;  3P8M C;  1GD2 E;  2P67 A;  2Q3I A;  2VRS A;  1X8Y A;  1J2J B;  3IR9 A;  4M3L A;  5AVY B;  2C9N Y;  3M06 A;  2XV5 A;  5APV A;  1MV8 A;  5AW9 B;  2WT7 A;  3TNU A;  1SLQ A;  1JNM A;  3TNU B;  5AVQ B;  2W6A A;  3A3Y B;  3M9B A;  2R32 A;  5AW7 B;  4JYB A;  4KHX A;  2WWW A;  5AVT B;  1S9K D;  2P2U A;  2WPR A;  3NMD A;  3LIE A;  2H7H A;  4AYC A;  5APU A;  4XE5 B;  4DZO A;  1NWQ A;  3NFQ A;  4GKG A;  1A02 F;  3L37 A;  1DH3 A;  2WPQ A;  5AVZ B;  3TYY A;  2WPS A;  1HBW A;  5AW6 B;  5AW5 B;  3M91 A;  3P7K A;  1KQL A;  3NTN A;  1GU4 A;  3HE4 B;  2Q5U A;  2Z5H A;  4I2L C;  1MFZ A;  3HE5 B;  3L36 A;  1A02 J;  3B8E B;  5AW0 B;  5AW3 B;  5AVR B;  2YO3 A;  5AW4 B;  4AQR D;  5CMZ A;  1FOS E;  2R5B A;  5AVU B;  1T2K C;  2QM8 A;  4C7N A;  2JJL A;  3VYI A;  1GU5 A;  4JYC A;  2YNY A;  1H88 A;  1SP4 A;  2R3C A;  3VTP C;  3KDP B;  5APQ A;  3A2A A;  3VMX A;  2WT7 B;  3LID A;  4B86 A;  3VMZ A;  1IO4 A;  1GTW A;  1FOS F;  2R5D A;  5AVS B;  4I6M C;  1H8A A;  2Z5I A;  2YO2 A;  3HTK A;  3KQG A;  3TK1 A;  2XU6 A;  2IPP A;  1CZQ A;  1YYC A;  2E43 A;  3VN0 A;  2WTY A;  3L35 A;  3M9H A;  3OAK A;  4EOT A;  1H89 A;  5AW8 B;  5AVW B;  2ZFC A;  5AW1 B;  3I5C A;  3NXS A;  4LC1 A;  3HE4 A;  5APW A;  4C46 A;  1GK6 A;  1HJB A;  5APS A;  3MGN A;  5APT A;  3HE5 A;  1OWA A;  2P7J A;  2Q7C A;  1CI6 A;  1CSB A;  1JUN A;  1HUC A;  2ZXE B;  3A7O A;  5APX A;  1GZL A;  3M0A A;  2KP8 A;  5AW2 B;  4HYT B;  3P32 A;  3M0D A;  5AVV B;  3T97 A;  3SWF A;  4GT1 A;  3V5B A;  3A5T A;  2W27 A;  1S9K E;  3V4Q A;  2N9B A;  3V4W A;  1GK4 A;  1MUU A;  1G2C B;  1CI6 B;  2E42 A;  1OXZ A;  4RES B;  1HWT C;  1FAV A;  3O8Z A;  2BAS A;  1NAF A;  4C7N B;  1T2K D;  3UIA A;  3MD0 A;  5AVX B;  4AUW A; 
#chains in the Genus database with same CATH topology
 1RH5 B;  2XZR A;  2M0B A;  1VF5 C;  2Y9Y A;  2HFE D;  2XNX A;  1HVV A;  1N86 A;  2OTK E;  2KNC A;  3AE9 C;  4PD4 H;  5KLV E;  4HH2 A;  1VQL P;  2IFM A;  3CMA P;  4DT0 A;  3G3Z A;  2JDI H;  5M1B A;  4N6J A;  1VQ9 P;  1AFO A;  1X8Y A;  1SQP G;  2AEM A;  3IR9 A;  2FKW B;  1USE A;  2KK7 A;  2FYU G;  5C39 A;  3L71 J;  1UIX A;  1URQ B;  4GOD A;  2ZVO B;  2N1T C;  3V2N A;  2O1J A;  3L73 E;  1MV8 A;  2IDB A;  4WY4 B;  5AW9 B;  3W68 A;  1L0N E;  5AVQ B;  3P8M C;  3M9B A;  4KJM A;  2QG4 A;  2R32 A;  4A7P A;  1LT9 C;  5AVT B;  3L73 G;  1XTC C;  1BE3 D;  1PGQ A;  3OJA B;  2JEE A;  4AYC A;  1SQQ J;  4PD4 D;  1NTZ D;  1ZV8 A;  2OGU A;  5GTI H;  2E74 C;  3F89 A;  1SQB G;  3GMA A;  1KOR A;  1K8A Q;  3WUU A;  1OMI A;  3GHG B;  2FYU D;  2E5T A;  3L74 J;  2HLO A;  2NPS B;  2WPQ A;  2A45 I;  3NFQ A;  5CBO A;  1ZR4 A;  1M1J B;  1A02 F;  1HBW A;  2OQQ A;  4L74 A;  5AW6 B;  1M8O B;  1PP9 G;  2J59 M;  1QVG O;  1SQX J;  3V2P A;  1OW7 A;  3NTN A;  5KLV D;  2AEF A;  1VQP P;  2Q5U A;  1EXI A;  4UB6 H;  1NTZ J;  4RO0 A;  1NTK E;  1BDC A;  3A0B E;  3L74 G;  1T8Z A;  3B8E B;  2GUV A;  1LTJ B;  1W2E A;  2N1T B;  1L0N J;  2ZAE B;  2N9Y B;  3JC2 2;  4K3A A;  1N73 B;  3B5N A;  2E76 C;  5AW3 B;  3GF3 A;  2HOD A;  2XND H;  5AVR B;  3AE6 C;  1NAY A;  2CPB A;  2FBW C;  3ABV C;  1U7M A;  3CX5 D;  1EDI A;  2R5B A;  2UWJ E;  2K3R A;  1M56 D;  5L8R J;  1MFT A;  3D71 A;  4PV1 B;  2OYH C;  5KLI B;  3ITK A;  5KLV K;  4HJG H;  3C8V A;  2E74 D;  3H6P A;  4JYC A;  2HR3 A;  1H88 A;  1SP4 A;  4IL6 E;  2LR2 A;  1VF5 D;  1SQP E;  5CCH C;  3CCV P;  1NGM B;  3CWB D;  3PH0 A;  1JY3 N;  4BXL A;  3PP5 A;  4WVZ A;  1H0T B;  3VMZ A;  1IO4 A;  2L91 A;  1GL2 C;  4U3F D;  5CCG C;  1YJW P;  2GA1 A;  4IOI H;  3MHV A;  5AVS B;  1HJ0 A;  1EZV D;  2K9Y A;  3GHG C;  3QWO C;  1SQQ E;  2Z5I A;  1DEB A;  3AE7 C;  2YO2 A;  3HUS A;  3HTK A;  3H1K G;  3B5N D;  3S1K A;  3PRJ A;  3WUV A;  1PGO A;  3KHU A;  4ZNC A;  1R8E A;  2N1T D;  3L74 D;  2M5A A;  1EC5 A;  3AE8 C;  3VP8 A;  1RQU A;  3B71 A;  3EFF K;  4IFF A;  4L75 A;  2O3J A;  1QLE D;  3M9H A;  4RJT A;  1X79 B;  2OYI C;  2I1J A;  1ZOY C;  2ZYD A;  4H44 D;  5AVW B;  1RE4 C;  1L2P A;  2V7Q J;  2GUS A;  1SQV D;  4H0L B;  4LC1 A;  1AV1 A;  1GK6 A;  4LLH A;  2BCC J;  2YMY A;  1L0L G;  2JWA A;  1NJI Q;  1SQB D;  3KZI H;  2G8Y A;  2KLV A;  3R4Y A;  4Y28 J;  1CI6 A;  3HUS C;  4BRY B;  1JUN A;  1FZC A;  2QJK B;  2ZXE B;  1G2C A;  5KLI C;  1LP1 A;  1BE3 G;  2RMZ A;  3AE3 C;  3L73 D;  3M0A A;  1IFI A;  1N7L A;  1JMM A;  1NH4 A;  4HYT B;  5CHX A;  1NTK J;  3EQ2 A;  2XDJ A;  4GT1 A;  5E79 H;  3V5B A;  3CC2 P;  1L0L J;  1OX3 A;  2M5A B;  2Y0D A;  2K9J B;  1RF0 C;  3H1H G;  3L75 J;  1LJ2 A;  3V4W A;  2DW3 A;  2IBZ D;  3WMM 0;  1N73 A;  1L4A D;  3H1I D;  1RE3 A;  1LTI C;  1IFN A;  2FXO A;  3A0B H;  2QRX A;  3L74 E;  1SS1 A;  3O8Z A;  2H8P D;  3PJS K;  4NPE A;  2BAS A;  2MJZ A;  3JCU E;  4YTP C;  5B66 H;  1YJN P;  1DEE G;  1HH0 A;  4GOF A;  1SQV J;  3PLN A;  1KTM A;  1KZU B;  3MD0 A;  1PIX A;  2FXM A;  3H1I E;  4CPG A;  4DJG A;  3H1L D;  4GIF A;  2BEQ D;  1GDT A;  3HD7 C;  2C9L Y;  4N78 D;  3VMY A;  3L73 J;  4U7J A;  1L4A B;  2Q3I A;  3H32 B;  3GF7 A;  4M3L A;  1LTG C;  1ZN5 A;  5AVY B;  2C0X A;  2NZ2 A;  3MZW B;  1RF1 A;  3CD6 P;  1YQ3 C;  2FY8 A;  2C9N Y;  1NO4 A;  1IFM A;  2ITA A;  3CXH D;  3TSI A;  3CCS P;  1RF0 A;  1IFD A;  2KSJ A;  3OW2 O;  2YIU B;  4PJ0 H;  1CW5 A;  1P84 D;  1SLQ A;  3WU2 E;  3TNU B;  3KPE A;  3A3Y B;  5AW7 B;  3MTU E;  1EDK A;  1WT6 A;  4ZKU A;  2LXB A;  2H7H A;  2WSF J;  2P2U A;  2WPR A;  3NMD A;  1LT9 A;  2Y0C A;  1VQN P;  5APU A;  3C9I A;  1VQM P;  1T3U A;  3CXH H;  2IX7 C;  4DZO A;  2FYN C;  1BE3 E;  2QSI A;  2YXR B;  3L75 D;  1PP9 E;  4O9B A;  1NOH A;  1EZV E;  2D2C D;  2WSE H;  1HGV A;  1S1C X;  3AEG C;  3LW5 H;  4GKG A;  2AXT E;  3B5N B;  4H13 B;  4BRY A;  4EI2 A;  1RE4 A;  3BAT A;  1ZRT D;  3L70 G;  1WMK A;  1M7L A;  2WPS A;  3O6Q A;  5AVZ B;  5GTH H;  3TYY A;  1L0L K;  5TIS H;  2Z4E A;  1KYO H;  2QJK C;  1EZV G;  3BCC G;  3CXH I;  3P7K A;  1KQL A;  3VMA A;  3HUS B;  1RY3 A;  2HPC A;  1AVO A;  3HE4 B;  1N7S A;  2Z5H A;  2HG5 D;  3L70 E;  4LGD E;  2E75 D;  1FZC C;  3TGU D;  5H2F H;  1MFZ A;  4YPC A;  1A02 J;  1FBM A;  1LTA C;  2BCC D;  2KS1 A;  1D7M A;  3L72 D;  3SSU A;  1ZP0 C;  1U57 A;  2K1A A;  2NPS A;  1Q86 Q;  1QVF O;  1SQX E;  1BCC D;  1N7S C;  3A0H H;  4AQR D;  1KYO E;  3BCC J;  2Y9Z A;  1KIL C;  4W80 A;  1FOS E;  3H1H E;  1QGK B;  5CCG A;  3H1J E;  3CME P;  1NU1 D;  2WSF H;  5TJH A;  3T97 B;  2JJL A;  3H1K J;  1OFC X;  2Y0E A;  1BCC E;  1Z56 A;  1EXJ A;  2D2C C;  2YNY A;  3GLM A;  1LP1 B;  4IL6 X;  1ZLL A;  5APQ A;  1E5W A;  1SFC B;  3VMX A;  1N2D C;  1FU1 A;  1SQQ G;  4GDO A;  4B86 A;  3KXD A;  3AEA C;  1GTW A;  1AQ5 A;  1RQV A;  5KJ7 C;  4H13 C;  4I6M C;  5KLV G;  4UB8 E;  3BRT B;  1KYO I;  2E75 C;  3I56 P;  2M8R A;  1KFM A;  3KQG A;  3TK1 A;  1NTZ K;  3L71 E;  2K88 A;  1FJP A;  3RBX A;  1KC8 Q;  2KNC B;  5KJ7 A;  1R5L A;  1URQ C;  2RKL A;  1KFN A;  1NTZ G;  4DOJ A;  5CJ0 A;  5KLV J;  4EOT A;  2HPC B;  1H89 A;  1MKM A;  1Q81 Q;  2ZFC A;  4NPF X;  1N73 C;  1FDM A;  1GW4 A;  1L0N G;  2Q1K A;  2Q3E A;  3TGU J;  1FS0 E;  1FZE A;  2ZYA A;  3HE4 A;  5APW A;  3U1A A;  1NTZ E;  1JTH A;  1EZV I;  1XTG B;  5APS A;  3SFE C;  2CK3 H;  1PL5 A;  2D2C B;  1OWA A;  3SWY A;  2FYN B;  1ZR2 A;  1VDF A;  3CXH E;  2ZYG A;  1URQ D;  5APX A;  3RL0 B;  1SQB E;  1KIL A;  3CI9 A;  2O1K A;  1P84 E;  2HYN A;  2J58 A;  2IYP A;  4IFM A;  2NPS C;  2M3E A;  3P32 A;  5KTB A;  2PP6 A;  1JY3 O;  5DJU B;  3A5T A;  3SWK A;  2W27 A;  5TIS E;  2NRG A;  3RGU A;  2KB7 P;  1Y8A A;  2JO1 A;  1GK4 A;  3Q5R A;  1CI6 B;  3AEF C;  4IFD K;  1FZC B;  2JKV A;  1HWT C;  4N3Y B;  3RK2 C;  3K5B A;  1S2E A;  1FAV A;  5K5G B;  3IAO A;  2E76 B;  3Q5S A;  1T3J A;  1S72 P;  1BGY D;  1ZXG A;  2FYU K;  4JF7 A;  2H43 A;  4Y99 C;  5CCG D;  4W7Z A;  2WMM A;  1M1K Q;  2YKQ A;  1S4X A;  5AVX B;  2WSE J;  4GOE A;  2FYU J;  2IZ0 A;  2QM7 A;  3O6Q B;  1FZG A;  2QE7 H;  1VQ5 P;  1VQ8 P;  2IBZ E;  2JR8 A;  1DX7 A;  1KV4 A;  2FFD B;  1BCC G;  2AXC A;  1AA0 A;  3GG2 A;  3H1L E;  1LNQ A;  3L72 E;  2P67 A;  1IJD B;  1SFC C;  2VRS A;  2P10 A;  4L73 A;  4R4L A;  2A06 E;  2BCC G;  2C0W A;  2M3B A;  2ZXX A;  1PFI A;  1NTK D;  2O01 N;  3AE1 C;  2W6J H;  1OVV A;  3H1J D;  2XV5 A;  4RKU J;  3E7K A;  3CCL P;  3A0H E;  3N7N A;  1T6A A;  1PGJ A;  2ZT9 D;  1LTS C;  1JCD A;  3P8C D;  2WZ7 A;  5APV A;  1BCC J;  3TNU A;  3GHG A;  2W6A A;  3H1K E;  3CL3 D;  3L71 G;  3RK2 B;  4KHX A;  1KQG B;  2WWW A;  5BU5 A;  2PRR A;  3OA7 A;  3SFD C;  3H1H J;  3HD7 A;  3L75 G;  3M9Q A;  4TLF A;  4XE5 B;  4DCK A;  1QL1 A;  2IBZ I;  5CCH A;  2ZVN B;  1S5L E;  4H13 D;  3H25 A;  1Q82 Q;  1NWQ A;  1X0T A;  1IK9 A;  3CPW O;  1M57 D;  1RF1 C;  1MZ9 A;  3G4S P;  2MKV A;  3BAS A;  1ZME C;  2WPV B;  2OYH A;  1RE3 C;  3M0D C;  1ZW0 A;  4PD4 I;  2AEJ A;  3USS A;  2B9B A;  5BVZ A;  1URQ A;  3CCJ P;  5KAF E;  4W7Y A;  1IFJ A;  1YQ4 C;  1N7S B;  3D6Z A;  3FXD A;  1NTM K;  3HE5 B;  2A06 D;  2KS1 B;  2PAJ A;  4HB1 A;  2I8D A;  1KB9 H;  4JQ0 D;  1HTL C;  1PP9 J;  2B87 A;  4PV1 C;  3TF5 A;  2KIK A;  5AW4 B;  2YO3 A;  1OW8 A;  5CBN A;  3Q2Y A;  1SQV K;  4UB8 H;  1VQO P;  3HD7 D;  3L4F A;  1FC2 C;  1KB9 E;  2FFD A;  1VL2 A;  1SQX D;  1QX8 A;  5AVU B;  1PZQ A;  2QM8 A;  4D6T D;  1G1I A;  3CLQ A;  2JWD A;  3VYI A;  1GU5 A;  1NU1 E;  1VF5 B;  3MIW A;  2E5Y A;  4K35 A;  1NU1 K;  1FJK A;  2R3C A;  2KOG A;  5B5E H;  3Q5P A;  3II6 A;  4XA4 A;  2BCC E;  3AED C;  4WY4 A;  1EDJ A;  3RL0 D;  1Q90 D;  2FYU E;  4N78 E;  1W2B O;  4ASV A;  2A45 H;  2OYI B;  1JY3 P;  1TU3 F;  4OH8 B;  1GD2 E;  1S3J A;  3H1H D;  3CC4 P;  2KZI A;  2YKO A;  4QMA A;  4D6T J;  4OGQ D;  2QJY C;  1Q2N A;  2XU6 A;  2IPP A;  2YIU C;  4ZKP A;  1LTJ C;  1YYC A;  2A06 G;  3R2P A;  4EYY Q;  1Q7Y Q;  2E43 A;  1AVY A;  1L0N D;  2Q9I A;  2W90 A;  3I55 P;  1JO5 A;  2R3S A;  1GMJ A;  2QJY B;  2KZJ A;  1KB9 I;  2PFX A;  2OYI A;  2V4H A;  1KIL B;  3OAK A;  4H44 B;  1NU1 J;  1L4A C;  1GL2 B;  2FXP A;  4PD4 E;  5AW8 B;  2WSS H;  3AE4 C;  3LW5 J;  3RL0 C;  3I5C A;  1LTT C;  3NXS A;  3S9O A;  2RN0 A;  3CC7 P;  2XKM A;  2Q6Q A;  3RK3 B;  1SQP J;  4H0L D;  3V2Q A;  3CCR P;  2RH0 A;  1JTH B;  3BCC E;  3L72 J;  3HE5 A;  3MGN A;  3L75 E;  5APT A;  2Q7C A;  1GL2 D;  3WU2 H;  1CSB A;  1PPJ G;  1HUC A;  2SPZ A;  4JBZ A;  4OGQ C;  5E79 E;  3V2R A;  3VOP A;  5CCH D;  3Q1M A;  1YTZ I;  1GL2 A;  1Y47 A;  2ZT9 C;  1DD3 A;  3CX5 H;  5AW2 B;  3RK3 E;  4OVN F;  5EFW B;  3AE2 C;  3B5N C;  1K73 Q;  1YIT P;  1KIL D;  1NTM J;  1PPJ E;  3H1K D;  1HJB A;  1FE6 A;  2KYV A;  3SWF A;  1DH3 A;  1KQS O;  1FZF A;  4WY4 C;  3BRV B;  2B89 A;  1QEX A;  3KZI E;  3Q3D A;  3BVH A;  2WIT A;  1NTM E;  3MUD A;  3H1J G;  1OVR A;  1UII A;  4MN4 C;  1G2C B;  3VP9 A;  2QEX P;  1H8A A;  4UB6 E;  1NTK G;  3CX5 E;  3CWB G;  1PGP A;  2ZJS E;  1N8R Q;  4KT0 J;  1KYO D;  1NTM G;  3G9R A;  2QIW A;  1BSH A;  1NAF A;  1H0T A;  5BU8 B;  4C7N B;  1EDL A;  1NTM D;  1YTZ T;  1M1J C;  3PTZ A;  3G6E P;  1RF1 B;  3UIA A;  1W5C E;  4AUW A;  1BGY E;  2H88 C;  2KXP B;  5KKZ B;  3EFG A;  3RBZ A;  2WQY C;  4I7Z C;  5APY A;  2OAR A;  3BCC D;  2J5U A;  3AEE C;  4PV1 D;  2BEZ F;  3GW6 A;  2YKP A;  1IZN B;  1J2J B;  1KMI Z;  3L70 D;  4HKZ H;  1KD1 Q;  1IC2 A;  3HD7 B;  1BGY J;  3CX5 I;  3TGU E;  1P84 H;  2N1T A;  2WVR A;  3RK3 D;  2B87 B;  3M06 A;  1JOC A;  3JSV C;  1JEK A;  1KIL E;  1PPJ D;  2KI7 B;  3H1L J;  2OTL P;  1NTK K;  1SVF A;  1PP9 D;  1AQT A;  5KAI E;  2WT7 A;  5DJT B;  1JNM A;  4OWF A;  1VQ6 P;  2IFN A;  3H32 A;  2AXT H;  1IK7 A;  1X9V A;  4ZMD A;  1NKZ B;  1DD4 A;  4JYB A;  1P84 I;  1S9K D;  1K04 A;  3L70 J;  3LIE A;  1FDI A;  3CCM P;  1OIP A;  1SQP K;  1J1D B;  4PJ0 E;  5GTH E;  1T2K C;  2OYO A;  2V7Q H;  3EWK A;  3L37 A;  5B5E E;  2HOD B;  1LGH B;  4Y99 B;  2W6B A;  1LWU A;  1JY2 N;  3IFM A;  2H89 C;  5AW5 B;  1FZA A;  3M91 A;  1BDD A;  2OYH B;  4I7Z B;  1NVO A;  1SFC A;  1GU4 A;  5KKZ C;  3RK2 D;  4NPD A;  1YIJ P;  3JCU H;  3U59 A;  3AE5 C;  2KSE A;  3W67 A;  1NHL A;  3CCU P;  3MP7 B;  4U3F J;  1M90 Q;  2G3A A;  2E74 B;  3L36 A;  1JM0 A;  1LTJ A;  4I2L C;  1X22 A;  1SQP D;  5KJ7 D;  3TDK A;  3WUT A;  5AW0 B;  4EDF A;  1SQB J;  4L76 A;  1LWU B;  2K37 A;  4I1L A;  1U7J A;  1QL2 A;  5CMZ A;  3RL0 g;  1VPC A;  2KUB A;  4R4M A;  1L4A A;  2W83 C;  1K05 A;  3H1I G;  1KQF B;  4D6T G;  4WWI A;  1LWU C;  1FDO A;  1SQQ D;  1SQX G;  2QJP B;  4U3F G;  5H2F E;  4C7N A;  2POH A;  2IBZ G;  4YXD C;  3AEC C;  3FWN A;  5KAF H;  1OZH A;  2QVA A;  5B66 E;  4D6T E;  2QA4 P;  1E79 H;  3PHL A;  1VQ7 P;  1OVU A;  1JY2 P;  2E76 D;  3IN6 A;  3KDP B;  4TT3 H;  3V6I A;  3IF4 A;  3VTP C;  3A2A A;  1G1J A;  2WT7 B;  2QJP C;  1NU1 G;  1HGZ A;  2IYO A;  2O01 H;  3H1I J;  3LID A;  2FFD C;  2OTJ P;  3C1L A;  1FOS F;  2R5D A;  1S5L H;  1SQV E;  1OW6 A;  1L0N K;  3FGA D;  2PGD A;  3E1I A;  4WB4 A;  1L0L D;  3L72 G;  3RK3 C;  1YBK A;  2NPS D;  1N7S D;  3HTK B;  1CZQ A;  3FWL A;  1YJ9 P;  2W8Z A;  1SQV G;  1NKN A;  2YMK A;  3VN0 A;  3TGU G;  2CPS A;  2WTY A;  2E75 B;  2JP3 A;  1VQK P;  2A45 G;  1HF9 A;  3L35 A;  4JPZ B;  5GTI E;  2WSC H;  2IZ1 A;  3D6Y A;  1AJY A;  1L0L E;  2WSC J;  3E1R A;  2ZT9 B;  1VQ4 P;  2YXQ B;  1NYH A;  5AW1 B;  1PV3 A;  3L71 D;  1LT1 A;  1WRG A;  4C46 A;  4EIJ A;  3U1C A;  3H1J J;  4WY4 D;  1JCC A;  4OGQ B;  3ZDM A;  1K9M Q;  1KN7 A;  1SQQ K;  2P7J A;  3G71 P;  1J1D C;  1GW3 A;  1ZRT E;  3KYQ A;  2P1J A;  1M1J A;  1RHZ B;  1USD A;  1JB0 J;  3AEB C;  3CWB J;  3FXE A;  3A7O A;  4H0L C;  4IL6 H;  5CJ4 A;  1GZL A;  2R44 A;  1IFP A;  3D70 A;  2KP8 A;  1SQB K;  2O01 J;  4XFJ A;  2I1K A;  1LTB C;  4H44 C;  1YI2 P;  3M0D A;  1JMB A;  3N4X A;  5AVV B;  3T97 A;  2P58 A;  1SQX K;  1J1E B;  4ASW A;  1SFC D;  4Z1M H;  2LKM A;  1FZB A;  3MUD C;  3CWB E;  5KAI H;  1S5L X;  3P8C E;  3V4Q A;  3S4R A;  1S9K E;  2N9B A;  1YHQ P;  1R5S A;  1MUU A;  2FYZ A;  2LXC B;  3FX0 A;  2E42 A;  4U3F E;  1J1E C;  1OXZ A;  4RES B;  2L5G B;  4BWN A;  2GM4 A;  1EQ7 A;  1LT9 B;  3F5H A;  4WBA A;  1Y9B A;  3CCE P;  1DIP A;  2B88 A;  1BSN A;  3CCQ P;  1BE3 J;  1BGY G;  1KB9 D;  3HRN A;  4C7R A;  1T2K D;  3QH9 A;  3B4S A;  4YXW H;  2KLU A;  1JY2 O;  2K9J A;  3H1L G; 
#chains in the Genus database with same CATH homology
 2XZR A;  5CCH D;  2HFE D;  2XNX A;  1HVV A;  1N86 A;  4HH2 A;  2IFM A;  3G3Z A;  1AFO A;  4N6J A;  1X8Y A;  3IR9 A;  2FKW B;  1URQ B;  2N1T C;  3V2N A;  2O1J A;  1MV8 A;  4WY4 B;  5AW9 B;  5AVQ B;  3M9B A;  2R32 A;  1LT9 C;  5AVT B;  1XTC C;  3OJA B;  2JEE A;  4AYC A;  1ZV8 A;  3GHG B;  3NFQ A;  1A02 F;  2HLO A;  2NPS B;  2WPQ A;  2A45 I;  1ZR4 A;  1DH3 A;  1M1J B;  1HBW A;  5AW6 B;  2J59 M;  3V2P A;  3NTN A;  2Q5U A;  1T8Z A;  3B8E B;  2GUV A;  1LTJ B;  1W2E A;  2N1T B;  1N73 B;  3B5N A;  5AW3 B;  2HOD A;  5AVR B;  2CPB A;  2R5B A;  2OYH C;  5KLV K;  3H6P A;  4JYC A;  1H88 A;  1SP4 A;  5CCH C;  1JY3 N;  3PP5 A;  3VMZ A;  1IO4 A;  5CCG C;  1GL2 C;  5AVS B;  3GHG C;  1H8A A;  2Z5I A;  1DEB A;  2YO2 A;  3HUS A;  3HTK A;  2HPC B;  3B5N D;  2N1T D;  3VP8 A;  4IFF A;  3M9H A;  1X79 B;  2OYI C;  2I1J A;  5AVW B;  1RE4 C;  2GUS A;  4LC1 A;  1GK6 A;  4LLH A;  2YMY A;  2KLV A;  1CI6 A;  3HUS C;  1JUN A;  1FZC A;  2ZXE B;  1G2C A;  3M0A A;  1IFI A;  1N7L A;  1JMM A;  1NH4 A;  4HYT B;  5CHX A;  3EQ2 A;  2XDJ A;  4GT1 A;  3V5B A;  1RF0 C;  3V4W A;  3WMM 0;  1N73 A;  1L4A D;  1RE3 A;  1LTI C;  1IFN A;  4GIF A;  3O8Z A;  2H8P D;  2BAS A;  2MJZ A;  1HH0 A;  3MD0 A;  1KZU B;  2FXM A;  1GDT A;  2C9L Y;  3HD7 C;  4N78 D;  3VMY A;  1L4A B;  2Q3I A;  3H32 B;  4M3L A;  1LTG C;  1ZN5 A;  5AVY B;  2C0X A;  1RF1 A;  2C9N Y;  1NO4 A;  1IFM A;  3TSI A;  1RF0 A;  1IFD A;  2KSJ A;  1SLQ A;  3TNU B;  3KPE A;  3A3Y B;  5AW7 B;  3MTU E;  1WT6 A;  4ZKU A;  2H7H A;  2P2U A;  2WPR A;  3NMD A;  1LT9 A;  5APU A;  3C9I A;  1T3U A;  4DZO A;  2IX7 C;  4O9B A;  1NOH A;  2WSE H;  1HGV A;  3LW5 H;  4GKG A;  3B5N B;  1RE4 A;  3BAT A;  5AVZ B;  3TYY A;  1M7L A;  2WPS A;  2Z4E A;  1L0L K;  3P7K A;  1KQL A;  3HUS B;  1RY3 A;  2HPC A;  3HE4 B;  1N7S A;  2Z5H A;  2HG5 D;  4LGD E;  1FZC C;  1MFZ A;  1A02 J;  1FBM A;  1LTA C;  2NPS A;  1N7S C;  4AQR D;  1FOS E;  1KIL C;  4W80 A;  5CCG A;  2WSF H;  2JJL A;  1Z56 A;  2YNY A;  1ZLL A;  5APQ A;  1E5W A;  1SFC B;  3VMX A;  1N2D C;  1FU1 A;  4B86 A;  1GTW A;  1AQ5 A;  5KJ7 C;  4I6M C;  3BRT B;  2M8R A;  1KFM A;  3KQG A;  3TK1 A;  1NTZ K;  1FJP A;  5KJ7 A;  1URQ C;  1KFN A;  4DOJ A;  5CJ0 A;  4EOT A;  1H89 A;  2ZFC A;  1N73 C;  1FDM A;  1GW4 A;  1CW5 A;  1FZE A;  3HE4 A;  5APW A;  3U1A A;  1JTH A;  1XTG B;  5APS A;  3SWY A;  1OWA A;  1ZR2 A;  1VDF A;  1URQ D;  5APX A;  3RL0 B;  1KIL A;  3CI9 A;  2O1K A;  2HYN A;  4IFM A;  2J58 A;  3P32 A;  2NPS C;  5KTB A;  2PP6 A;  1JY3 O;  3A5T A;  2W27 A;  2KB7 P;  1GK4 A;  1CI6 B;  4IFD K;  1FZC B;  1HWT C;  4N3Y B;  3RK2 C;  1FAV A;  1T3J A;  2H43 A;  4JF7 A;  2FYU K;  4Y99 C;  5CCG D;  4W7Z A;  2YKQ A;  5AVX B;  1FZG A;  2QM7 A;  1DX7 A;  2FFD B;  3RL0 D;  3P8M C;  3VOP A;  1GD2 E;  2P67 A;  1IJD B;  1SFC C;  2VRS A;  2C0W A;  2M3B A;  1PFI A;  2XV5 A;  3N7N A;  5APV A;  3P8C D;  1LTS C;  1JCD A;  2WZ7 A;  3TNU A;  3GHG A;  2W6A A;  3CL3 D;  3RK2 B;  4KHX A;  2WWW A;  5BU5 A;  3OA7 A;  3HD7 A;  3M9Q A;  4XE5 B;  1QL1 A;  5CCH A;  1NWQ A;  1IK9 A;  1RF1 C;  1MZ9 A;  3BAS A;  2OYH A;  1RE3 C;  3M0D C;  5BVZ A;  1URQ A;  4W7Y A;  1IFJ A;  1N7S B;  1NTM K;  3HE5 B;  2PAJ A;  1HTL C;  5AW4 B;  2YO3 A;  1SQV K;  3HD7 D;  3L4F A;  2FFD A;  5AVU B;  2QM8 A;  1G1I A;  3CLQ A;  3VYI A;  1GU5 A;  3MIW A;  1NU1 K;  1FJK A;  2R3C A;  2KOG A;  3II6 A;  4XA4 A;  4WY4 A;  4N78 E;  2A45 H;  2OYI B;  1JY3 P;  4OH8 B;  2YKO A;  2XU6 A;  2IPP A;  4ZKP A;  1LTJ C;  1YYC A;  3R2P A;  2E43 A;  1JO5 A;  2Q9I A;  2OYI A;  1KIL B;  3OAK A;  1L4A C;  1GL2 B;  5AW8 B;  3RL0 C;  3I5C A;  1LTT C;  3NXS A;  2XKM A;  3RK3 B;  3V2Q A;  1HJB A;  1JTH B;  3MGN A;  5APT A;  3HE5 A;  2Q7C A;  1GL2 D;  1CSB A;  3V2R A;  1HUC A;  1YTZ I;  1GL2 A;  5AW2 B;  3B5N C;  1KIL D;  2KYV A;  3SWF A;  1FZF A;  4WY4 C;  3BRV B;  3BVH A;  2WIT A;  3MUD A;  3VP9 A;  1G2C B;  1NAF A;  5BU8 B;  4C7N B;  1YTZ T;  1M1J C;  1RF1 B;  3UIA A;  4AUW A;  3EFG A;  5APY A;  2OAR A;  2YKP A;  1J2J B;  1IC2 A;  3HD7 B;  2N1T A;  3RK3 D;  3M06 A;  1JOC A;  1NTK K;  1SVF A;  2WT7 A;  1JNM A;  2IFN A;  3H32 A;  1X9V A;  1NKZ B;  4JYB A;  1S9K D;  3LIE A;  1SQP K;  1J1D B;  3L37 A;  2HOD B;  1LGH B;  4Y99 B;  2W6B A;  1LWU A;  1JY2 N;  3IFM A;  5AW5 B;  1FZA A;  3M91 A;  2OYH B;  1SFC A;  1GU4 A;  3RK2 D;  3U59 A;  1NHL A;  4I2L C;  3L36 A;  5KJ7 D;  1LTJ A;  5AW0 B;  1LWU B;  4I1L A;  1QL2 A;  5CMZ A;  1VPC A;  1L4A A;  1T2K C;  1LWU C;  4C7N A;  2POH A;  1JY2 P;  3VTP C;  3KDP B;  3A2A A;  1G1J A;  2WT7 B;  3LID A;  1HGZ A;  2O01 H;  2FFD C;  1FOS F;  2R5D A;  1L0N K;  3E1I A;  4WB4 A;  3RK3 C;  2GM4 A;  2NPS D;  1N7S D;  3HTK B;  1CZQ A;  3VN0 A;  1NKN A;  2CPS A;  2WTY A;  2A45 G;  3L35 A;  2WSC H;  5AW1 B;  4EIJ A;  1WRG A;  4C46 A;  3U1C A;  4WY4 D;  1JCC A;  1SQQ K;  2P7J A;  1J1D C;  1GW3 A;  3KYQ A;  2P1J A;  1M1J A;  5CJ4 A;  3A7O A;  1GZL A;  2KP8 A;  1SQB K;  2I1K A;  1LTB C;  3M0D A;  3N4X A;  5AVV B;  3T97 A;  1SQX K;  1J1E B;  1SFC D;  2LKM A;  1FZB A;  1S9K E;  3V4Q A;  3P8C E;  2N9B A;  1MUU A;  2FYZ A;  2E42 A;  1J1E C;  1OXZ A;  4RES B;  2L5G B;  1EQ7 A;  1LT9 B;  4WBA A;  3HRN A;  4C7R A;  1T2K D;  1JY2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...