2P2UA

Crystal structure of putative host-nuclease inhibitor protein gam from desulfovibrio vulgaris
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
150
Chain Sequence
VIVADIRQAEGALAEIATIDRKVGEIEAQMNEAIDAAKARASQKSAPLLARRKELEDGVATFATLNKTEMFKSLDLGFGTIGFRLSTQIVQMSKITKDMTLERLRQFGISEGIRIKEDVNKEAMQGWPDERLEMVGLKRRTTDAFYIEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Host-nuclease inhibitor protein Gam, putative
publication title Crystal structure of putative host-nuclease inhibitor protein Gam from Desulfovibrio vulgaris
rcsb
source organism Desulfovibrio vulgaris
molecule tags Dna binding protein
total genus 26
structure length 150
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07352 Phage_Mu_Gam Bacteriophage Mu Gam like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p2uA01
2YO3A 1X8YA 3HE5A 5AW8B 3M91A 3TNUA 2ZFCA 3KDPB 3LIEA 1H8AA 1OWAA 2XU6A 2R3CA 3MD0A 5AVZB 2IPPA 1H89A 3A5TA 5AW3B 1J2JB 1H88A 2ZXEB 3M9HA 2P7JA 2BASA 5AVRB 3V4QA 3VMYA 3A3YB 4DZOA 1S9KD 3M9BA 2XZRA 1S9KE 2Q5UA 4XE5B 1MV8A 1JUNA 5APQA 4B86A 3L35A 5AW6B 1KQLA 3V5BA 2JJLA 1A02F 3IR9A 2R32A 3O8ZA 5APUA 5APXA 5AVSB 3VTPC 5AW0B 3VN0A 1GU4A 2YNYA 5AW5B 2WPQA 5AW2B 5AVYB 3V4WA 2P2UA 3I5CA 4LC1A 5AW1B 3VMZA 1G2CB 3NXSA 1FOSE 2QM8A 3HE4B 1NWQA 1DH3A 2R5DA 5APYA 3SWFA 3HE4A 2W27A 3HTKA 1HBWA 4AQRD 3TK1A 1CZQA 3P7KA 1GK4A 3L37A 3M06A 1NAFA 3LIDA 2W6AA 5AVQB 2Z5HA 2R5BA 3NFQA 4KHXA 3KQGA 1HWTC 4RESB 1CI6B 1CSBA 4I2LC 5AVVB 1GK6A 2N9BA 4I6MC 5AVUB 1FAVA 4C7NB 3M0AA 4JYBA 1GD2E 1CI6A 2WTYA 1YYCA 2Q7CA 1IO4A 3TYYA 4AUWA 3T97A 4C7NA 2WWWA 3P32A 2WT7B 5AVXB 5APTA 3M0DA 1SLQA 5APWA 5AVTB 1GU5A 2WT7A 5AVWB 2Q3IA 3VMXA 2H7HA 1T2KD 1MUUA 2YO2A 3P8MC 5AW7B 4AYCA 2E42A 1MFZA 1FOSF 4JYCA 4HYTB 5AW9B 3MGNA 2C9LY 4GT1A 2QM7A 3L36A 3A7OA 4C46A 2WPSA 1T2KC 1JNMA 2E43A 1HJBA 1HUCA 2WPRA 2XV5A 4GKGA 1SP4A 3VYIA 2C9NY 2P67A 3B8EB 1GTWA 5APSA 3UIAA 1OXZA 2VRSA 2Z5IA 3A2AA 4EOTA 5APVA 4M3LA 3NMDA 5AW4B 3HE5B 2KP8A 1GZLA 1A02J 3NTNA 3OAKA 3TNUB 5CMZA
chains in the Genus database with same CATH superfamily
2FY8A 5AW8B 3LIEA 5AW3B 1SFCC 4ASWA 2W90A 1FJKA 1S72P 3JCUE 1KQLA 1A02F 1AVOA 1GL2C 2HYNA 4RJTA 4BXLA 1DH3A 1GW3A 1L0LJ 1URQB 2H8PD 2W27A 5KAIH 1EC5A 2OQQA 1M57D 1HBWA 2QJKB 1BSNA 1GMJA 1EDJA 1VL2A 1CI6B 1GK6A 1K05A 1P84I 4DJGA 4NPEA 4C7NA 3H1IG 5APWA 2HODA 2H7HA 4BRYA 2PP6A 2E42A 2GA1A 2Q9IA 3E7KA 1MZ9A 2FYNB 1LTJB 3CCJP 1K9MQ 3A7OA 2WVRA 4C46A 5KKZB 3CPWO 2WPRA 4PD4I 1S1CX 2ZXXA 5AW4B 4UB6H 1DD3A 1RE4A 3CX5E 1OWAA 3C9IA 1USEA 2FYUG 3OA7A 2ZVOB 1PPJD 3G9RA 1N2DC 4XE5B 2C0WA 3L74D 5APQA 4L76A 2GUSA 1AQTA 2YKPA 2M8RA 3E1IA 1M1JC 5APUA 5AVSB 3V6IA 2IZ0A 1YJNP 2NPSB 1K73Q 5APYA 1PZQA 1RQVA 4AQRD 2KZIA 1CZQA 1IFNA 3O6QA 2QJPC 5KAFE 1NAFA 2K1AA 4UB8H 1SFCB 1R5SA 2ZT9D 4JQ0D 4JYBA 1AA0A 2FBWC 1GL2B 1LWUC 4OGQD 3A0HE 3AEGC 1EZVD 4XFJA 3PRJA 5DJUB 2ZT9C 2QG4A 3RK3D 1LT9B 4GT1A 2XNDH 2HG5D 4OGQC 3L36A 1HJBA 3QH9A 3SWYA 2CPBA 3HUSA 3AEDC 2BEQD 1H0TB 5TJHA 2B87A 3EWKA 3KDPB 1BGYD 2N1TD 3S9OA 4H0LD 3FGAD 3KPEA 4IFDK 1NKZB 1Q86Q 1S9KE 2Q5UA 3CC4P 2L91A 5AW6B 2N1TC 2P10A 4H0LC 3MUDA 1KILD 5AW1B 5BU8B 4ZMDA 4RO0A 2OYHA 2V7QH 3L74J 5L8RJ 3WUUA 5CCHD 2QJYC 1KILC 3L37A 3M06A 1VQOP 4KT0J 2A45G 1KYOH 3H1LJ 1ZRTD 1NTME 2QSIA 1QGKB 2ZJSE 1Q2NA 1Y9BA 2AXTH 2Q7CA 3TGUE 1QL2A 1HVVA 4YPCA 1KV4A 3KXDA 2M3BA 1NTKE 1GU5A 1KYOD 1N73C 3H1HG 4C7RA 3GF3A 5KLVK 3B4SA 3HRNA 2C9NY 2KXPB 2P67A 2QJPB 3TF5A 1GZLA 1KN7A 1X8YA 1PFIA 3CCLP 3A5TA 3CXHH 3H1JE 3ABVC 3M9BA 4RKUJ 1ZMEC 4JF7A 2IX7C 3TGUG 2PFXA 1NH4A 2O1JA 4OGQB 3N4XA 2WPQA 4R4MA 3CCRP 3CXHD 3VMZA 4D6TD 2CPSA 2BCCD 1L4AC 1LJ2A 3S4RA 5B66E 1PL5A 4L75A 2IYOA 2Y9YA 3V2NA 2I1KA 2KYVA 3HD7A 4YTPC 2LXBA 3CC2P 1YI2P 5KLVJ 1CW5A 2HPCA 3L71D 3VMAA 1KB9H 4OWFA 3CWBE 3KHUA 2LKMA 4H0LB 3H1JG 1EZVI 2R44A 3CD6P 5H2FH 2KS1B 1P84H 1OFCX 3MGNA 2FFDB 1FDOA 4WWIA 2K9JB 2KZJA 2QJYB 5B5EE 1JNMA 2FXMA 3VYIA 1P84D 4W7YA 5CJ4A 3L75E 1OXZA 1S5LX 3JCUH 1Y47A 1DEEG 1VPCA 4EIJA 2QVAA 2P1JA 2XU6A 1URQD 3AE4C 2E75C 2BASA 2KNCB 1N73B 3CWBG 1FE6A 1PP9E 1YIJP 3V5BA 1URQC 2J59M 3L73G 3CCEP 1HTLC 1GU4A 2YXRB 1DIPA 2KOGA 2H88C 1SQBE 1SQPD 5KJ7A 1LP1B 1X0TA 3EFFK 3MP7B 3H32A 1M56D 1PIXA 3L75G 3LIDA 4D6TJ 4HH2A 1LTGC 1OVVA 1NKNA 1RE4C 1VF5C 2FYNC 2WTYA 3CMEP 1L0ND 2NZ2A 1JY3N 3TYYA 1OVRA 1WMKA 3WUTA 2Y0CA 1KYOI 1W2BO 2WSFH 3ITKA 1NU1E 2YO2A 3G6EP 3L71J 1MFZA 2WSCJ 2H89C 1L4AB 3LW5H 3L72E 1NVOA 2N9YB 3GF7A 3CX5H 1W2EA 1FZFA 2E43A 2RN0A 4LLHA 1FJPA 4WY4A 4U3FE 3AE3C 1SQPK 1SQVD 2MJZA 1A02J 1BCCE 5CMZA 2NPSD 1G1IA 3L70D 3M91A 1FZGA 2K37A 1IK7A 3II6A 2ZXEB 2J58A 5M1BA 4N78D 3C1LA 1L0NK 1N7SA 3O8ZA 3VTPC 1NU1G 3CXHI 3AECC 5KAFH 3G71P 1FS0E 5AVYB 3L72G 1FDMA 1L2PA 1GL2D 2I1JA 1OX3A 4MN4C 3H1IE 3H1KG 3CLQA 1ZR2A 1NTZE 3HUSC 3TDKA 2YIUC 3A0BE 5KTBA 4U3FG 3E1RA 3A0HH 3G4SP 1SQVK 3W67A 3SWKA 3WMM0 4GDOA 1IJDB 3EFGA 3R4YA 1BE3G 2E75B 1BCCG 1FC2C 1SQPJ 1NAYA 1EDKA 4C7NB 1NO4A 3IF4A 3L4FA 1LT9C 2HFED 2HODB 2LXCB 1Q90D 3M0DA 4BRYB 4U7JA 2IBZE 1QVGO 1KB9I 2A45H 1EXJA 2A06D 3IAOA 4HYTB 1JY2P 3RBZA 5KLIB 3MUDC 2C9LY 1VQNP 1L0NJ 5C39A 1KC8Q 2FYUE 2IFMA 2G3AA 5CBNA 1VQ8P 3AE6C 3AEAC 2YKQA 4OVNF 4PJ0E 4EOTA 1NTZG 2W83C 1S4XA 1E5WA 1VF5B 3AE8C 2XDJA 2WSFJ 5K5GB 1OIPA 1SQVJ 2AEFA 4ZNCA 1S9KD 3M9QA 1RF1A 3BCCD 4H44B 1ZN5A 1VQ5P 1SQQD 3FX0A 3L70J 3VP9A 2IBZG 4BWNA 5AW5B 1S3JA 2IYPA 3W68A 1R8EA 2P58A 2OYOA 3U59A 3CCMP 4NPFX 4I7ZC 1HH0A 3ZDMA 3O6QB 1FBMA 4Y28J 1XTCC 1L0LG 1NTMD 3NFQA 1BDDA 1JY2N 1ZR4A 1ZP0C 1ZXGA 2N9BA 5AVUB 3B5NA 1SVFA 5CJ0A 1IO4A 3P32A 5AVXB 5APTA 1S2EA 1NTKD 3GHGA 5AVTB 3EQ2A 2XNXA 3VMXA 1MFTA 1FZCA 1NOHA 1SQQK 2M0BA 2KUBA 3CI9A 3HUSB 2YIUB 1ZOYC 2W6BA 2WMMA 2IZ1A 2B87B 3CX5I 2YO3A 1JY2O 2JKVA 2KK7A 1RF0A 1H8AA 3MD0A 1NTMK 4JBZA 1JMBA 1AFOA 2L5GB 3V4QA 1VQKP 2R32A 1LTAC 1NTKK 3AE9C 3VN0A 2YNYA 3KZIE 2OYIA 2OYHB 5CCGA 3I56P 4W80A 2O1KA 3BCCJ 1SQQJ 2IDBA 3TK1A 3H1HE 1AQ5A 2D2CC 1KTMA 1OW7A 2W6AA 1SQXD 2DW3A 2ZYDA 4DCKA 4I6MC 3RBXA 1EQ7A 2FFDC 2KI7B 1GW4A 3Q5SA 5B5EH 5TISE 3RL0C 2JP3A 2E74D 1PGOA 5AVWB 5AW7B 1NTMJ 5GTIE 3VOPA 4I7ZB 2E74C 1LTBC 2PRRA 2H43A 3D71A 2A45I 1AVYA 1NTKJ 3PH0A 3L74E 1JTHA 3OJAB 3CCQP 3WU2E 1NJIQ 3H1LE 2WPVB 4KJMA 4EDFA 1SQXK 2O01H 1PP9D 1RE3A 1UIXA 3Q5PA 1JUNA 3F5HA 3GLMA 3AE5C 5APXA 1RH5B 1FOSE 4CPGA 1SQBD 1G2CA 4HB1A 3HE4A 3HD7B 2UWJE 1L4AD 3FXEA 1M1JA 1PPJG 1VQMP 2HPCB 2OARA 3RK3E 3L74G 2B88A 3MHVA 1BGYJ 1S5LE 3AEFC 3N7NA 2YKOA 3QWOC 2K9YA 3H1LG 2WSEH 4AUWA 3T97A 2B9BA 2KLUA 3AE2C 2LR2A 2PGDA 5CBOA 1U7MA 1KFNA 1RHZB 1YJ9P 1SQXJ 1FOSF 2K88A 2SPZA 3VP8A 2QM7A 2JWDA 2M5AA 3RK2C 2E5TA 4GKGA 1Q81Q 1LWUA 4WBAA 1SQBK 2D2CB 5APSA 3L73E 3A2AA 2QRXA 2RH0A 2I8DA 3OAKA 2ITAA 1KB9D 3HE5A 1KILE 2V7QJ 3TNUA 5KLVE 5AVZB 4DT0A 3RL0B 1J2JB 1H88A 3P8CE 1JY3P 2POHA 1VQ9P 5AVRB 1OVUA 3M0DC 1YTZT 3F89A 1N8RQ 2W8ZA 2E75D 2E74B 2YMYA 1ZRTE 5AW2B 2G8YA 3JSVC 2KB7P 1PP9J 2W6JH 3H1ID 1EDLA 1K04A 3SFDC 2IFNA 3H32B 2N1TA 1HF9A 4XA4A 3S1KA 3B71A 4RESB 1SQBJ 1CSBA 1LTTC 4I2LC 1VQ7P 1GD2E 5KLIC 1ZV8A 5KLVG 2WZ7A 1E79H 3RL0g 1KILA 1T3JA 2WITA 3C8VA 1RF1C 1VF5D 2WT7A 1ZLLA 3P8MC 1ZW0A 2AXCA 4PV1D 2E5YA 5CCHA 2BCCJ 2XKMA 2FYUD 1HGVA 2WPSA 4WY4B 4Y99C 4PV1C 4H44D 3PP5A 1BDCA 1QX8A 4Z1MH 1SS1A 1G1JA 3PTZA 2WSEJ 4H44C 3WUVA 1IFMA 4D6TE 3H1KE 2RMZA 5GTHE 3BVHA 1N7SB 3A3YB 3I55P 3MZWB 1QEXA 2E76D 1BE3E 1NHLA 1FZCC 3L71E 3RK2B 2P2UA 3I5CA 3CX5D 1DEBA 4H13B 2E76C 2J5UA 1JY3O 3SWFA 2FYUK 1KQSO 1J1DC 3HTKA 5DJTB 1LTIC 3P7KA 2QE7H 3USSA 3CCUP 3R2PA 1VDFA 1JCCA 3V2QA 1JO5A 1OW6A 1PGJA 1RF0C 3H1IJ 1FZBA 4D6TG 2Y0EA 1HGZA 1PGPA 2WWWA 2QEXP 1P84E 1IC2A 5CCGD 2Q3IA 1T2KD 3V2PA 1MKMA 3AEEC 2OYIC 3L71G 5CCGC 4GIFA 1T2KC 3FXDA 2OTLP 2ZAEB 2AEJA 4PD4E 4I1LA 2FYUJ 1X79B 3GMAA 5E79E 1K8AQ 3KZIH 2KSJA 1X22A 4IL6E 1XTGB 1SQPE 1RF1B 1D7MA 2OYHC 3D70A 3BATA 2JDIH 2QIWA 1L0LE 4DOJA 2JO1A 5AW0B 5BU5A 4LC1A 4Y99B 3FWLA 4PV1B 3NXSA 2Z4EA 4IOIH 2GM4A 1L0NE 4IFFA 3LW5J 3H1HD 5TISH 1URQA 1FZAA 3PHLA 3AE1C 4GODA 1U7JA 5GTIH 2R5BA 3B5NB 1T3UA 2HLOA 1FAVA 1CI6A 1GDTA 3BASA 1OZHA 3GHGB 2IBZI 1DD4A 2O3JA 2R3SA 1RE3C 1SQPG 1SQVE 1FZCB 1MUUA 4HJGH 4AYCA 4IL6X 5AW9B 2E76B 1YTZI 1KFMA 3L70E 4WB4A 3WU2H 1J1EB 1LTJA 4IFMA 1J1DB 3TGUD 4TLFA 2RKLA 4N78E 1GTWA 1L0NG 1PV3A 4EYYQ 2NRGA 4M3LA 3NMDA 1KQFB 1Q7YQ 1FDIA 5EFWB 3H1LD 1VQPP 3HD7D 3M9HA 1QVFO 2ZYAA 1KZUB 2JJLA 3MTUE 2OYIB 3HD7C 1SQVG 3V4WA 2V4HA 1FZEA 1S5LH 1VQ6P 2QM8A 3L70G 2R5DA 3H1JD 2NPSA 1QL1A 5B66H 1YJWP 3BRTB 2A06E 5CHXA 5AVQB 2Z5HA 3AE7C 3CCSP 2WSSH 1YHQP 1SFCA 3M0AA 2AEMA 2C0XA 2D2CD 3RK3C 5KAIE 3H1HJ 2O01N 1OW8A 1LNQA 1SLQA 3RGUA 3JC22 1GL2A 3Q3DA 3RL0D 3U1CA 1PGQA 1LT9A 1QLED 3CWBD 1YQ4C 1HUCA 1JB0J 3L73D 3GG2A 3BCCE 2WQYC 3UIAA 1SQQE 5APVA 1JTHB 1H0TA 5KJ7D 2A06G 3V2RA 3CC7P 5KLVD 4WVZA 3TGUJ 1EDIA 2IPPA 1HJ0A 3CL3D 3P8CD 2CK3H 1JEKA 4DZOA 5KJ7C 1PPJE 3L75D 3FWNA 1OMIA 1M8OB 4UB6E 3IR9A 3SSUA 1VQ4P 3BRVB 5CCHC 1G2CB 3HE4B 4NPDA 3Q5RA 2YXQB 2FKWB 2KLVA 1M1JB 1JOCA 1IFIA 2JR8A 4A7PA 2HR3A 1KORA 1GK4A 3BCCG 1IFJA 1SQQG 1T8ZA 4W7ZA 4WY4D 3KQGA 3H1JJ 3GW6A 3T97B 3CMAP 4GOEA 4WY4C 1JCDA 1EZVE 1WT6A 2PAJA 3Q2YA 4UB8E 4JYCA 1DX7A 3K5BA 2M5AB 1NTMG 1N7SD 1LWUB 3MIWA 5GTHH 2ZT9B 1NGMB 1NU1D 2Z5IA 1RQUA 4YXWH 1N7SC 1M90Q 3RK2D 3HE5B 4TT3H 1NTKG 3TNUB 4H13D 2JWAA 3L72D 1LTSC 3CWBJ 3RK3B 4LGDE 1R5LA 1BGYE 2R3CA 2WSCH 3H1KD 1Z56A 2P7JA 2M3EA 3L73J 3VMYA 4H13C 4U3FD 2XZRA 2QA4P 4B86A 3L35A 4ZKUA 1N7LA 3KYQA 2BEZF 1BE3D 1BCCD 2FXOA 1NYHA 1BSHA 1EZVG 1SQXE 2Y9ZA 1IFDA 1NWQA 4HKZH 2N1TB 3L75J 3IN6A 1AJYA 1UIIA 3PJSK 2FYZA 2YMKA 1JM0A 1VQLP 3G3ZA 3A0BH 1NU1K 4GOFA 2KIKA 1KD1Q 2Y0DA 2Q3EA 3D6YA 1KILB 1YYCA 4K3AA 1BGYG 2WT7B 1NTZD 1IFPA 1AV1A 1KQGB 1KYOE 2KS1A 2FXPA 4PD4H 2O01J 4OH8B 3IFMA 2B89A 2FFDA 2AXTE 5E79H 1SQXG 4IL6H 1M1KQ 2K9JA 2XV5A 5BVZA 1RY3A 4EI2A 2VRSA 2IBZD 4PJ0H 1YITP 4PD4D 2KSEA 3NTNA 2QJKC 1WRGA 2ZFCA 1LGHB 1IZNB 1YBKA 1H89A 1W5CE 1NU1J 1T6AA 4L74A 2KNCA 4K35A 1MV8A 4N3YB 4R4LA 1N73A 1L0LD 3B5ND 1NTZK 3L72J 2GUVA 2OTKE 1TU3F 3H1KJ 3OW2O 3CXHE 2BCCE 1LTJC 2ZVNB 1YQ3C 4U3FJ 3AEBC 3B5NC 3HTKB 1FU1A 2Q6QA 3PLNA 5KKZC 1BE3J 1Y8AA 1BCCJ 1PP9G 4N6JA 1LP1A 3GHGC 3H25A 3Q1MA 3CCVP 1JMMA 1M7LA 4KHXA 1HWTC 1LT1A 5AVVB 1U57A 2ZYGA 4ASVA 4JPZB 3D6ZA 4YXDC 1J1EC 1SQBG 2OTJP 4ZKPA 1EXIA 1L0LK 2Q1KA 1X9VA 1USDA 1KB9E 4QMAA 3SFEC 3H6PA 1IK9A 1L4AA 1N86A 2JEEA 1KMIZ 1NTZJ 1Q82Q 4L73A 2NPSC 2BCCG 1SP4A 2MKVA 5H2FE 3U1AA 3B8EB 2K3RA 2OGUA 3TSIA 1SFCD 4O9BA 2KP8A
chains in the Genus database with same CATH topology
1JTHA 1VPCA 3OJAB 4EIJA 5AW8B 3LIEA 2P1JA 2XU6A 1URQD 3HD7D 5AW3B 1SFCC 1SQXK 3M9HA 2O01H 2BASA 1N73B 1KZUB 1FJKA 1RE3A 1JUNA 1KQLA 3V5BA 2JJLA 3MTUE 1URQC 1A02F 2OYIB 2J59M 3HD7C 1GL2C 5APXA 2HYNA 1HTLC 1GU4A 3V4WA 2KOGA 1FZEA 1FOSE 2QM8A 1DH3A 2R5DA 1G2CA 2NPSA 1GW3A 5KJ7A 3HE4A 1QL1A 1URQB 2H8PD 2W27A 3HD7B 1HBWA 1L4AD 3H32A 1M1JA 3BRTB 2HPCB 2OARA 3LIDA 5CHXA 5AVQB 2Z5HA 4HH2A 1LTGC 1NKNA 1CI6B 3N7NA 1RE4C 1GK6A 2YKOA 1SFCA 3M0AA 2WTYA 2C0XA 3RK3C 2WSEH 1JY3N 3TYYA 4AUWA 3T97A 4C7NA 2WSFH 1SLQA 2HODA 5APWA 1KFNA 2H7HA 2YO2A 1GL2A 2PP6A 2E42A 1MFZA 1FOSF 2Q9IA 1L4AB 1MZ9A 3LW5H 1LTJB 3RL0D 3VP8A 3U1CA 2QM7A 1LT9A 3A7OA 3RK2C 4C46A 1W2EA 1FZFA 2E43A 1HUCA 2WPRA 4LLHA 4GKGA 1FJPA 4WY4A 1LWUA 4WBAA 1SQBK 5APSA 3UIAA 1SQPK 2MJZA 3A2AA 5APVA 1JTHB 5AW4B 1A02J 3OAKA 5CMZA 2NPSD 1G1IA 5KJ7D 3HE5A 3V2RA 3M91A 1RE4A 3TNUA 1FZGA 1OWAA 5AVZB 2IPPA 3CL3D 3P8CD 3RL0B 1J2JB 3C9IA 3II6A 3P8CE 1JY3P 2ZXEB 1H88A 2POHA 2J58A 5AVRB 4DZOA 3OA7A 5KJ7C 4N78D 1N2DC 4XE5B 2C0WA 3M0DC 1L0NK 1YTZT 1N7SA 5APQA 2GUSA 2YKPA 2M8RA 3E1IA 3IR9A 1M1JC 3O8ZA 5APUA 5AVSB 3VTPC 2YMYA 5AW2B 3BRVB 5AVYB 5CCHC 1G2CB 2NPSB 1FDMA 2KB7P 3HE4B 1GL2D 2I1JA 5APYA 2FKWB 2KLVA 2IFNA 3CLQA 1ZR2A 3H32B 1M1JB 1JOCA 1IFIA 3HUSC 2N1TA 4AQRD 1CZQA 5KTBA 1IFNA 1GK4A 1NAFA 1SQVK 4XA4A 1IFJA 3WMM0 1IJDB 3EFGA 1T8ZA 4W7ZA 4WY4D 1SFCB 3KQGA 4RESB 1CSBA 1LTTC 4I2LC 4C7NB 1GD2E 4JYBA 1NO4A 1ZV8A 3L4FA 1LT9C 2HFED 2HODB 2WZ7A 1KILA 3M0DA 1GL2B 4WY4C 1LWUC 1T3JA 2WITA 1RF1C 2WT7A 1ZLLA 2A45H 3P8MC 1JCDA 1WT6A 2PAJA 3RK3D 4JYCA 4HYTB 5CCHA 1JY2P 1DX7A 2XKMA 2C9LY 1LT9B 4GT1A 2HG5D 1N7SD 1HGVA 3L36A 2WPSA 4WY4B 1LWUB 2IFMA 4Y99C 1HJBA 3PP5A 3MIWA 2YKQA 3SWYA 2CPBA 3HUSA 2Z5IA 1G1JA 4EOTA 1N7SC 3RK2D 3HE5B 3TNUB 1E5WA 1LTSC 1IFMA 3RK3B 2XDJA 3KDPB 4LGDE 2N1TD 2R3CA 2WSCH 3KPEA 1Z56A 2P7JA 3BVHA 4IFDK 1N7SB 1NKZB 3VMYA 3A3YB 1S9KD 3M9QA 2XZRA 1S9KE 2Q5UA 1RF1A 4B86A 3L35A 5AW6B 2N1TC 1ZN5A 4ZKUA 1N7LA 3KYQA 3VP9A 1NHLA 3MUDA 1FZCC 5AW5B 3RK2B 1KILD 2P2UA 3I5CA 5AW1B 5BU8B 1DEBA 1IFDA 3U59A 1NWQA 2OYHA 2N1TB 1JY3O 3SWFA 2FYUK 5CCHD 2FYZA 1HH0A 1J1DC 1KILC 3HTKA 1FBMA 1LTIC 1XTCC 3P7KA 3G3ZA 3L37A 3M06A 2A45G 3R2PA 1VDFA 1NU1K 1JCCA 3V2QA 1JO5A 3NFQA 1JY2N 1ZR4A 1RF0C 1FZBA 2N9BA 5AVUB 3B5NA 1KILB 1SVFA 1YYCA 5CJ0A 2Q7CA 1IO4A 1QL2A 1HGZA 1HVVA 2WWWA 3P32A 2WT7B 5AVXB 5APTA 1IC2A 3GHGA 5AVTB 2M3BA 5CCGD 1GU5A 3EQ2A 2XNXA 2Q3IA 3VMXA 1N73C 1T2KD 3V2PA 1NOHA 1FZCA 1SQQK 4C7RA 4OH8B 2OYIC 3IFMA 2FFDA 5CCGC 4GIFA 1T2KC 3CI9A 3HUSB 2XV5A 5BVZA 1RY3A 5KLVK 3HRNA 2C9NY 2W6BA 2P67A 2VRSA 1GZLA 4I1LA 3NTNA 2YO3A 1X8YA 1X79B 1WRGA 1JY2O 1PFIA 1RF0A 2ZFCA 1H8AA 1LGHB 3MD0A 2KSJA 1NTMK 1H89A 3A5TA 1AFOA 1XTGB 1RF1B 2L5GB 3V4QA 2OYHC 3M9BA 4JF7A 2IX7C 4N3YB 1MV8A 3BATA 1N73A 1NH4A 3B5ND 1NTZK 2GUVA 4DOJA 2R32A 2O1JA 1LTAC 1NTKK 5AW0B 3VN0A 5BU5A 2YNYA 3N4XA 2WPQA 2OYIA 4LC1A 4Y99B 3VMZA 2OYHB 3NXSA 2CPSA 5CCGA 1L4AC 4W80A 2Z4EA 1LTJC 2GM4A 3B5NC 2O1KA 3HTKB 1FU1A 4IFFA 3V2NA 2I1KA 3TK1A 1URQA 3HD7A 2KYVA 4N6JA 3GHGC 1AQ5A 1FZAA 2W6AA 1CW5A 2HPCA 2R5BA 3B5NB 1JMMA 1M7LA 4KHXA 1HWTC 1T3UA 2HLOA 5AVVB 4I6MC 1FAVA 1EQ7A 2FFDC 1CI6A 1GW4A 1GDTA 3BASA 3GHGB 1J1EC 2LKMA 3RL0C 1RE3C 4ZKPA 5AVWB 1FZCB 1MUUA 5AW7B 4AYCA 1L0LK 1X9VA 5AW9B 3MGNA 2FFDB 3H6PA 1YTZI 1KFMA 3VOPA 1IK9A 1L4AA 1N86A 2JEEA 4WB4A 1J1EB 1LTJA 1LTBC 4IFMA 1JNMA 1J1DB 2H43A 2A45I 2FXMA 2NPSC 1SP4A 3VYIA 4N78E 3U1AA 4W7YA 3B8EB 1GTWA 5CJ4A 1OXZA 3TSIA 1SFCD 4M3LA 3NMDA 4O9BA 2KP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YO3 A;  1X8Y A;  3HE5 A;  5AW8 B;  3M91 A;  3TNU A;  2ZFC A;  3KDP B;  3LIE A;  1H8A A;  1OWA A;  2XU6 A;  2R3C A;  3MD0 A;  5AVZ B;  2IPP A;  1H89 A;  3A5T A;  5AW3 B;  1J2J B;  1H88 A;  2ZXE B;  3M9H A;  2P7J A;  2BAS A;  5AVR B;  3V4Q A;  3VMY A;  3A3Y B;  4DZO A;  1S9K D;  3M9B A;  2XZR A;  1S9K E;  2Q5U A;  4XE5 B;  1MV8 A;  1JUN A;  5APQ A;  4B86 A;  3L35 A;  5AW6 B;  1KQL A;  3V5B A;  2JJL A;  1A02 F;  3IR9 A;  2R32 A;  3O8Z A;  5APU A;  5APX A;  5AVS B;  3VTP C;  5AW0 B;  3VN0 A;  1GU4 A;  2YNY A;  5AW5 B;  2WPQ A;  5AW2 B;  5AVY B;  3V4W A;  2P2U A;  3I5C A;  4LC1 A;  5AW1 B;  3VMZ A;  1G2C B;  3NXS A;  1FOS E;  2QM8 A;  3HE4 B;  1NWQ A;  1DH3 A;  2R5D A;  5APY A;  3SWF A;  3HE4 A;  2W27 A;  3HTK A;  1HBW A;  4AQR D;  3TK1 A;  1CZQ A;  3P7K A;  1GK4 A;  3L37 A;  3M06 A;  1NAF A;  3LID A;  2W6A A;  5AVQ B;  2Z5H A;  2R5B A;  3NFQ A;  4KHX A;  3KQG A;  1HWT C;  4RES B;  1CI6 B;  1CSB A;  4I2L C;  5AVV B;  1GK6 A;  2N9B A;  4I6M C;  5AVU B;  1FAV A;  4C7N B;  3M0A A;  4JYB A;  1GD2 E;  1CI6 A;  2WTY A;  1YYC A;  2Q7C A;  1IO4 A;  3TYY A;  4AUW A;  3T97 A;  4C7N A;  2WWW A;  3P32 A;  2WT7 B;  5AVX B;  5APT A;  3M0D A;  1SLQ A;  5APW A;  5AVT B;  1GU5 A;  2WT7 A;  5AVW B;  2Q3I A;  3VMX A;  2H7H A;  1T2K D;  1MUU A;  2YO2 A;  3P8M C;  5AW7 B;  4AYC A;  2E42 A;  1MFZ A;  1FOS F;  4JYC A;  4HYT B;  5AW9 B;  3MGN A;  2C9L Y;  4GT1 A;  2QM7 A;  3L36 A;  3A7O A;  4C46 A;  2WPS A;  1T2K C;  1JNM A;  2E43 A;  1HJB A;  1HUC A;  2WPR A;  2XV5 A;  4GKG A;  1SP4 A;  3VYI A;  2C9N Y;  2P67 A;  3B8E B;  1GTW A;  5APS A;  3UIA A;  1OXZ A;  2VRS A;  2Z5I A;  3A2A A;  4EOT A;  5APV A;  4M3L A;  3NMD A;  5AW4 B;  3HE5 B;  2KP8 A;  1GZL A;  1A02 J;  3NTN A;  3OAK A;  3TNU B;  5CMZ A; 
#chains in the Genus database with same CATH topology
 2FY8 A;  5AW8 B;  3LIE A;  5AW3 B;  1SFC C;  4ASW A;  2W90 A;  1FJK A;  1S72 P;  3JCU E;  1KQL A;  1A02 F;  1AVO A;  1GL2 C;  2HYN A;  4RJT A;  4BXL A;  1DH3 A;  1GW3 A;  1L0L J;  1URQ B;  2H8P D;  2W27 A;  5KAI H;  1EC5 A;  2OQQ A;  1M57 D;  1HBW A;  2QJK B;  1BSN A;  1GMJ A;  1EDJ A;  1VL2 A;  1CI6 B;  1GK6 A;  1K05 A;  1P84 I;  4DJG A;  4NPE A;  4C7N A;  3H1I G;  5APW A;  2HOD A;  2H7H A;  4BRY A;  2PP6 A;  2E42 A;  2GA1 A;  2Q9I A;  3E7K A;  1MZ9 A;  2FYN B;  1LTJ B;  3CCJ P;  1K9M Q;  3A7O A;  2WVR A;  4C46 A;  5KKZ B;  3CPW O;  2WPR A;  4PD4 I;  1S1C X;  2ZXX A;  5AW4 B;  4UB6 H;  1DD3 A;  1RE4 A;  3CX5 E;  1OWA A;  3C9I A;  1USE A;  2FYU G;  3OA7 A;  2ZVO B;  1PPJ D;  3G9R A;  1N2D C;  4XE5 B;  2C0W A;  3L74 D;  5APQ A;  4L76 A;  2GUS A;  1AQT A;  2YKP A;  2M8R A;  3E1I A;  1M1J C;  5APU A;  5AVS B;  3V6I A;  2IZ0 A;  1YJN P;  2NPS B;  1K73 Q;  5APY A;  1PZQ A;  1RQV A;  4AQR D;  2KZI A;  1CZQ A;  1IFN A;  3O6Q A;  2QJP C;  5KAF E;  1NAF A;  2K1A A;  4UB8 H;  1SFC B;  1R5S A;  2ZT9 D;  4JQ0 D;  4JYB A;  1AA0 A;  2FBW C;  1GL2 B;  1LWU C;  4OGQ D;  3A0H E;  3AEG C;  1EZV D;  4XFJ A;  3PRJ A;  5DJU B;  2ZT9 C;  2QG4 A;  3RK3 D;  1LT9 B;  4GT1 A;  2XND H;  2HG5 D;  4OGQ C;  3L36 A;  1HJB A;  3QH9 A;  3SWY A;  2CPB A;  3HUS A;  3AED C;  2BEQ D;  1H0T B;  5TJH A;  2B87 A;  3EWK A;  3KDP B;  1BGY D;  2N1T D;  3S9O A;  4H0L D;  3FGA D;  3KPE A;  4IFD K;  1NKZ B;  1Q86 Q;  1S9K E;  2Q5U A;  3CC4 P;  2L91 A;  5AW6 B;  2N1T C;  2P10 A;  4H0L C;  3MUD A;  1KIL D;  5AW1 B;  5BU8 B;  4ZMD A;  4RO0 A;  2OYH A;  2V7Q H;  3L74 J;  5L8R J;  3WUU A;  5CCH D;  2QJY C;  1KIL C;  3L37 A;  3M06 A;  1VQO P;  4KT0 J;  2A45 G;  1KYO H;  3H1L J;  1ZRT D;  1NTM E;  2QSI A;  1QGK B;  2ZJS E;  1Q2N A;  1Y9B A;  2AXT H;  2Q7C A;  3TGU E;  1QL2 A;  1HVV A;  4YPC A;  1KV4 A;  3KXD A;  2M3B A;  1NTK E;  1GU5 A;  1KYO D;  1N73 C;  3H1H G;  4C7R A;  3GF3 A;  5KLV K;  3B4S A;  3HRN A;  2C9N Y;  2KXP B;  2P67 A;  2QJP B;  3TF5 A;  1GZL A;  1KN7 A;  1X8Y A;  1PFI A;  3CCL P;  3A5T A;  3CXH H;  3H1J E;  3ABV C;  3M9B A;  4RKU J;  1ZME C;  4JF7 A;  2IX7 C;  3TGU G;  2PFX A;  1NH4 A;  2O1J A;  4OGQ B;  3N4X A;  2WPQ A;  4R4M A;  3CCR P;  3CXH D;  3VMZ A;  4D6T D;  2CPS A;  2BCC D;  1L4A C;  1LJ2 A;  3S4R A;  5B66 E;  1PL5 A;  4L75 A;  2IYO A;  2Y9Y A;  3V2N A;  2I1K A;  2KYV A;  3HD7 A;  4YTP C;  2LXB A;  3CC2 P;  1YI2 P;  5KLV J;  1CW5 A;  2HPC A;  3L71 D;  3VMA A;  1KB9 H;  4OWF A;  3CWB E;  3KHU A;  2LKM A;  4H0L B;  3H1J G;  1EZV I;  2R44 A;  3CD6 P;  5H2F H;  2KS1 B;  1P84 H;  1OFC X;  3MGN A;  2FFD B;  1FDO A;  4WWI A;  2K9J B;  2KZJ A;  2QJY B;  5B5E E;  1JNM A;  2FXM A;  3VYI A;  1P84 D;  4W7Y A;  5CJ4 A;  3L75 E;  1OXZ A;  1S5L X;  3JCU H;  1Y47 A;  1DEE G;  1VPC A;  4EIJ A;  2QVA A;  2P1J A;  2XU6 A;  1URQ D;  3AE4 C;  2E75 C;  2BAS A;  2KNC B;  1N73 B;  3CWB G;  1FE6 A;  1PP9 E;  1YIJ P;  3V5B A;  1URQ C;  2J59 M;  3L73 G;  3CCE P;  1HTL C;  1GU4 A;  2YXR B;  1DIP A;  2KOG A;  2H88 C;  1SQB E;  1SQP D;  5KJ7 A;  1LP1 B;  1X0T A;  3EFF K;  3MP7 B;  3H32 A;  1M56 D;  1PIX A;  3L75 G;  3LID A;  4D6T J;  4HH2 A;  1LTG C;  1OVV A;  1NKN A;  1RE4 C;  1VF5 C;  2FYN C;  2WTY A;  3CME P;  1L0N D;  2NZ2 A;  1JY3 N;  3TYY A;  1OVR A;  1WMK A;  3WUT A;  2Y0C A;  1KYO I;  1W2B O;  2WSF H;  3ITK A;  1NU1 E;  2YO2 A;  3G6E P;  3L71 J;  1MFZ A;  2WSC J;  2H89 C;  1L4A B;  3LW5 H;  3L72 E;  1NVO A;  2N9Y B;  3GF7 A;  3CX5 H;  1W2E A;  1FZF A;  2E43 A;  2RN0 A;  4LLH A;  1FJP A;  4WY4 A;  4U3F E;  3AE3 C;  1SQP K;  1SQV D;  2MJZ A;  1A02 J;  1BCC E;  5CMZ A;  2NPS D;  1G1I A;  3L70 D;  3M91 A;  1FZG A;  2K37 A;  1IK7 A;  3II6 A;  2ZXE B;  2J58 A;  5M1B A;  4N78 D;  3C1L A;  1L0N K;  1N7S A;  3O8Z A;  3VTP C;  1NU1 G;  3CXH I;  3AEC C;  5KAF H;  3G71 P;  1FS0 E;  5AVY B;  3L72 G;  1FDM A;  1L2P A;  1GL2 D;  2I1J A;  1OX3 A;  4MN4 C;  3H1I E;  3H1K G;  3CLQ A;  1ZR2 A;  1NTZ E;  3HUS C;  3TDK A;  2YIU C;  3A0B E;  5KTB A;  4U3F G;  3E1R A;  3A0H H;  3G4S P;  1SQV K;  3W67 A;  3SWK A;  3WMM 0;  4GDO A;  1IJD B;  3EFG A;  3R4Y A;  1BE3 G;  2E75 B;  1BCC G;  1FC2 C;  1SQP J;  1NAY A;  1EDK A;  4C7N B;  1NO4 A;  3IF4 A;  3L4F A;  1LT9 C;  2HFE D;  2HOD B;  2LXC B;  1Q90 D;  3M0D A;  4BRY B;  4U7J A;  2IBZ E;  1QVG O;  1KB9 I;  2A45 H;  1EXJ A;  2A06 D;  3IAO A;  4HYT B;  1JY2 P;  3RBZ A;  5KLI B;  3MUD C;  2C9L Y;  1VQN P;  1L0N J;  5C39 A;  1KC8 Q;  2FYU E;  2IFM A;  2G3A A;  5CBN A;  1VQ8 P;  3AE6 C;  3AEA C;  2YKQ A;  4OVN F;  4PJ0 E;  4EOT A;  1NTZ G;  2W83 C;  1S4X A;  1E5W A;  1VF5 B;  3AE8 C;  2XDJ A;  2WSF J;  5K5G B;  1OIP A;  1SQV J;  2AEF A;  4ZNC A;  1S9K D;  3M9Q A;  1RF1 A;  3BCC D;  4H44 B;  1ZN5 A;  1VQ5 P;  1SQQ D;  3FX0 A;  3L70 J;  3VP9 A;  2IBZ G;  4BWN A;  5AW5 B;  1S3J A;  2IYP A;  3W68 A;  1R8E A;  2P58 A;  2OYO A;  3U59 A;  3CCM P;  4NPF X;  4I7Z C;  1HH0 A;  3ZDM A;  3O6Q B;  1FBM A;  4Y28 J;  1XTC C;  1L0L G;  1NTM D;  3NFQ A;  1BDD A;  1JY2 N;  1ZR4 A;  1ZP0 C;  1ZXG A;  2N9B A;  5AVU B;  3B5N A;  1SVF A;  5CJ0 A;  1IO4 A;  3P32 A;  5AVX B;  5APT A;  1S2E A;  1NTK D;  3GHG A;  5AVT B;  3EQ2 A;  2XNX A;  3VMX A;  1MFT A;  1FZC A;  1NOH A;  1SQQ K;  2M0B A;  2KUB A;  3CI9 A;  3HUS B;  2YIU B;  1ZOY C;  2W6B A;  2WMM A;  2IZ1 A;  2B87 B;  3CX5 I;  2YO3 A;  1JY2 O;  2JKV A;  2KK7 A;  1RF0 A;  1H8A A;  3MD0 A;  1NTM K;  4JBZ A;  1JMB A;  1AFO A;  2L5G B;  3V4Q A;  1VQK P;  2R32 A;  1LTA C;  1NTK K;  3AE9 C;  3VN0 A;  2YNY A;  3KZI E;  2OYI A;  2OYH B;  5CCG A;  3I56 P;  4W80 A;  2O1K A;  3BCC J;  1SQQ J;  2IDB A;  3TK1 A;  3H1H E;  1AQ5 A;  2D2C C;  1KTM A;  1OW7 A;  2W6A A;  1SQX D;  2DW3 A;  2ZYD A;  4DCK A;  4I6M C;  3RBX A;  1EQ7 A;  2FFD C;  2KI7 B;  1GW4 A;  3Q5S A;  5B5E H;  5TIS E;  3RL0 C;  2JP3 A;  2E74 D;  1PGO A;  5AVW B;  5AW7 B;  1NTM J;  5GTI E;  3VOP A;  4I7Z B;  2E74 C;  1LTB C;  2PRR A;  2H43 A;  3D71 A;  2A45 I;  1AVY A;  1NTK J;  3PH0 A;  3L74 E;  1JTH A;  3OJA B;  3CCQ P;  3WU2 E;  1NJI Q;  3H1L E;  2WPV B;  4KJM A;  4EDF A;  1SQX K;  2O01 H;  1PP9 D;  1RE3 A;  1UIX A;  3Q5P A;  1JUN A;  3F5H A;  3GLM A;  3AE5 C;  5APX A;  1RH5 B;  1FOS E;  4CPG A;  1SQB D;  1G2C A;  4HB1 A;  3HE4 A;  3HD7 B;  2UWJ E;  1L4A D;  3FXE A;  1M1J A;  1PPJ G;  1VQM P;  2HPC B;  2OAR A;  3RK3 E;  3L74 G;  2B88 A;  3MHV A;  1BGY J;  1S5L E;  3AEF C;  3N7N A;  2YKO A;  3QWO C;  2K9Y A;  3H1L G;  2WSE H;  4AUW A;  3T97 A;  2B9B A;  2KLU A;  3AE2 C;  2LR2 A;  2PGD A;  5CBO A;  1U7M A;  1KFN A;  1RHZ B;  1YJ9 P;  1SQX J;  1FOS F;  2K88 A;  2SPZ A;  3VP8 A;  2QM7 A;  2JWD A;  2M5A A;  3RK2 C;  2E5T A;  4GKG A;  1Q81 Q;  1LWU A;  4WBA A;  1SQB K;  2D2C B;  5APS A;  3L73 E;  3A2A A;  2QRX A;  2RH0 A;  2I8D A;  3OAK A;  2ITA A;  1KB9 D;  3HE5 A;  1KIL E;  2V7Q J;  3TNU A;  5KLV E;  5AVZ B;  4DT0 A;  3RL0 B;  1J2J B;  1H88 A;  3P8C E;  1JY3 P;  2POH A;  1VQ9 P;  5AVR B;  1OVU A;  3M0D C;  1YTZ T;  3F89 A;  1N8R Q;  2W8Z A;  2E75 D;  2E74 B;  2YMY A;  1ZRT E;  5AW2 B;  2G8Y A;  3JSV C;  2KB7 P;  1PP9 J;  2W6J H;  3H1I D;  1EDL A;  1K04 A;  3SFD C;  2IFN A;  3H32 B;  2N1T A;  1HF9 A;  4XA4 A;  3S1K A;  3B71 A;  4RES B;  1SQB J;  1CSB A;  1LTT C;  4I2L C;  1VQ7 P;  1GD2 E;  5KLI C;  1ZV8 A;  5KLV G;  2WZ7 A;  1E79 H;  3RL0 g;  1KIL A;  1T3J A;  2WIT A;  3C8V A;  1RF1 C;  1VF5 D;  2WT7 A;  1ZLL A;  3P8M C;  1ZW0 A;  2AXC A;  4PV1 D;  2E5Y A;  5CCH A;  2BCC J;  2XKM A;  2FYU D;  1HGV A;  2WPS A;  4WY4 B;  4Y99 C;  4PV1 C;  4H44 D;  3PP5 A;  1BDC A;  1QX8 A;  4Z1M H;  1SS1 A;  1G1J A;  3PTZ A;  2WSE J;  4H44 C;  3WUV A;  1IFM A;  4D6T E;  3H1K E;  2RMZ A;  5GTH E;  3BVH A;  1N7S B;  3A3Y B;  3I55 P;  3MZW B;  1QEX A;  2E76 D;  1BE3 E;  1NHL A;  1FZC C;  3L71 E;  3RK2 B;  2P2U A;  3I5C A;  3CX5 D;  1DEB A;  4H13 B;  2E76 C;  2J5U A;  1JY3 O;  3SWF A;  2FYU K;  1KQS O;  1J1D C;  3HTK A;  5DJT B;  1LTI C;  3P7K A;  2QE7 H;  3USS A;  3CCU P;  3R2P A;  1VDF A;  1JCC A;  3V2Q A;  1JO5 A;  1OW6 A;  1PGJ A;  1RF0 C;  3H1I J;  1FZB A;  4D6T G;  2Y0E A;  1HGZ A;  1PGP A;  2WWW A;  2QEX P;  1P84 E;  1IC2 A;  5CCG D;  2Q3I A;  1T2K D;  3V2P A;  1MKM A;  3AEE C;  2OYI C;  3L71 G;  5CCG C;  4GIF A;  1T2K C;  3FXD A;  2OTL P;  2ZAE B;  2AEJ A;  4PD4 E;  4I1L A;  2FYU J;  1X79 B;  3GMA A;  5E79 E;  1K8A Q;  3KZI H;  2KSJ A;  1X22 A;  4IL6 E;  1XTG B;  1SQP E;  1RF1 B;  1D7M A;  2OYH C;  3D70 A;  3BAT A;  2JDI H;  2QIW A;  1L0L E;  4DOJ A;  2JO1 A;  5AW0 B;  5BU5 A;  4LC1 A;  4Y99 B;  3FWL A;  4PV1 B;  3NXS A;  2Z4E A;  4IOI H;  2GM4 A;  1L0N E;  4IFF A;  3LW5 J;  3H1H D;  5TIS H;  1URQ A;  1FZA A;  3PHL A;  3AE1 C;  4GOD A;  1U7J A;  5GTI H;  2R5B A;  3B5N B;  1T3U A;  2HLO A;  1FAV A;  1CI6 A;  1GDT A;  3BAS A;  1OZH A;  3GHG B;  2IBZ I;  1DD4 A;  2O3J A;  2R3S A;  1RE3 C;  1SQP G;  1SQV E;  1FZC B;  1MUU A;  4HJG H;  4AYC A;  4IL6 X;  5AW9 B;  2E76 B;  1YTZ I;  1KFM A;  3L70 E;  4WB4 A;  3WU2 H;  1J1E B;  1LTJ A;  4IFM A;  1J1D B;  3TGU D;  4TLF A;  2RKL A;  4N78 E;  1GTW A;  1L0N G;  1PV3 A;  4EYY Q;  2NRG A;  4M3L A;  3NMD A;  1KQF B;  1Q7Y Q;  1FDI A;  5EFW B;  3H1L D;  1VQP P;  3HD7 D;  3M9H A;  1QVF O;  2ZYA A;  1KZU B;  2JJL A;  3MTU E;  2OYI B;  3HD7 C;  1SQV G;  3V4W A;  2V4H A;  1FZE A;  1S5L H;  1VQ6 P;  2QM8 A;  3L70 G;  2R5D A;  3H1J D;  2NPS A;  1QL1 A;  5B66 H;  1YJW P;  3BRT B;  2A06 E;  5CHX A;  5AVQ B;  2Z5H A;  3AE7 C;  3CCS P;  2WSS H;  1YHQ P;  1SFC A;  3M0A A;  2AEM A;  2C0X A;  2D2C D;  3RK3 C;  5KAI E;  3H1H J;  2O01 N;  1OW8 A;  1LNQ A;  1SLQ A;  3RGU A;  3JC2 2;  1GL2 A;  3Q3D A;  3RL0 D;  3U1C A;  1PGQ A;  1LT9 A;  1QLE D;  3CWB D;  1YQ4 C;  1HUC A;  1JB0 J;  3L73 D;  3GG2 A;  3BCC E;  2WQY C;  3UIA A;  1SQQ E;  5APV A;  1JTH B;  1H0T A;  5KJ7 D;  2A06 G;  3V2R A;  3CC7 P;  5KLV D;  4WVZ A;  3TGU J;  1EDI A;  2IPP A;  1HJ0 A;  3CL3 D;  3P8C D;  2CK3 H;  1JEK A;  4DZO A;  5KJ7 C;  1PPJ E;  3L75 D;  3FWN A;  1OMI A;  1M8O B;  4UB6 E;  3IR9 A;  3SSU A;  1VQ4 P;  3BRV B;  5CCH C;  1G2C B;  3HE4 B;  4NPD A;  3Q5R A;  2YXQ B;  2FKW B;  2KLV A;  1M1J B;  1JOC A;  1IFI A;  2JR8 A;  4A7P A;  2HR3 A;  1KOR A;  1GK4 A;  3BCC G;  1IFJ A;  1SQQ G;  1T8Z A;  4W7Z A;  4WY4 D;  3KQG A;  3H1J J;  3GW6 A;  3T97 B;  3CMA P;  4GOE A;  4WY4 C;  1JCD A;  1EZV E;  1WT6 A;  2PAJ A;  3Q2Y A;  4UB8 E;  4JYC A;  1DX7 A;  3K5B A;  2M5A B;  1NTM G;  1N7S D;  1LWU B;  3MIW A;  5GTH H;  2ZT9 B;  1NGM B;  1NU1 D;  2Z5I A;  1RQU A;  4YXW H;  1N7S C;  1M90 Q;  3RK2 D;  3HE5 B;  4TT3 H;  1NTK G;  3TNU B;  4H13 D;  2JWA A;  3L72 D;  1LTS C;  3CWB J;  3RK3 B;  4LGD E;  1R5L A;  1BGY E;  2R3C A;  2WSC H;  3H1K D;  1Z56 A;  2P7J A;  2M3E A;  3L73 J;  3VMY A;  4H13 C;  4U3F D;  2XZR A;  2QA4 P;  4B86 A;  3L35 A;  4ZKU A;  1N7L A;  3KYQ A;  2BEZ F;  1BE3 D;  1BCC D;  2FXO A;  1NYH A;  1BSH A;  1EZV G;  1SQX E;  2Y9Z A;  1IFD A;  1NWQ A;  4HKZ H;  2N1T B;  3L75 J;  3IN6 A;  1AJY A;  1UII A;  3PJS K;  2FYZ A;  2YMK A;  1JM0 A;  1VQL P;  3G3Z A;  3A0B H;  1NU1 K;  4GOF A;  2KIK A;  1KD1 Q;  2Y0D A;  2Q3E A;  3D6Y A;  1KIL B;  1YYC A;  4K3A A;  1BGY G;  2WT7 B;  1NTZ D;  1IFP A;  1AV1 A;  1KQG B;  1KYO E;  2KS1 A;  2FXP A;  4PD4 H;  2O01 J;  4OH8 B;  3IFM A;  2B89 A;  2FFD A;  2AXT E;  5E79 H;  1SQX G;  4IL6 H;  1M1K Q;  2K9J A;  2XV5 A;  5BVZ A;  1RY3 A;  4EI2 A;  2VRS A;  2IBZ D;  4PJ0 H;  1YIT P;  4PD4 D;  2KSE A;  3NTN A;  2QJK C;  1WRG A;  2ZFC A;  1LGH B;  1IZN B;  1YBK A;  1H89 A;  1W5C E;  1NU1 J;  1T6A A;  4L74 A;  2KNC A;  4K35 A;  1MV8 A;  4N3Y B;  4R4L A;  1N73 A;  1L0L D;  3B5N D;  1NTZ K;  3L72 J;  2GUV A;  2OTK E;  1TU3 F;  3H1K J;  3OW2 O;  3CXH E;  2BCC E;  1LTJ C;  2ZVN B;  1YQ3 C;  4U3F J;  3AEB C;  3B5N C;  3HTK B;  1FU1 A;  2Q6Q A;  3PLN A;  5KKZ C;  1BE3 J;  1Y8A A;  1BCC J;  1PP9 G;  4N6J A;  1LP1 A;  3GHG C;  3H25 A;  3Q1M A;  3CCV P;  1JMM A;  1M7L A;  4KHX A;  1HWT C;  1LT1 A;  5AVV B;  1U57 A;  2ZYG A;  4ASV A;  4JPZ B;  3D6Z A;  4YXD C;  1J1E C;  1SQB G;  2OTJ P;  4ZKP A;  1EXI A;  1L0L K;  2Q1K A;  1X9V A;  1USD A;  1KB9 E;  4QMA A;  3SFE C;  3H6P A;  1IK9 A;  1L4A A;  1N86 A;  2JEE A;  1KMI Z;  1NTZ J;  1Q82 Q;  4L73 A;  2NPS C;  2BCC G;  1SP4 A;  2MKV A;  5H2F E;  3U1A A;  3B8E B;  2K3R A;  2OGU A;  3TSI A;  1SFC D;  4O9B A;  2KP8 A; 
#chains in the Genus database with same CATH homology
 1JTH A;  1VPC A;  3OJA B;  4EIJ A;  5AW8 B;  3LIE A;  2P1J A;  2XU6 A;  1URQ D;  3HD7 D;  5AW3 B;  1SFC C;  1SQX K;  3M9H A;  2O01 H;  2BAS A;  1N73 B;  1KZU B;  1FJK A;  1RE3 A;  1JUN A;  1KQL A;  3V5B A;  2JJL A;  3MTU E;  1URQ C;  1A02 F;  2OYI B;  2J59 M;  3HD7 C;  1GL2 C;  5APX A;  2HYN A;  1HTL C;  1GU4 A;  3V4W A;  2KOG A;  1FZE A;  1FOS E;  2QM8 A;  1DH3 A;  2R5D A;  1G2C A;  2NPS A;  1GW3 A;  5KJ7 A;  3HE4 A;  1QL1 A;  1URQ B;  2H8P D;  2W27 A;  3HD7 B;  1HBW A;  1L4A D;  3H32 A;  1M1J A;  3BRT B;  2HPC B;  2OAR A;  3LID A;  5CHX A;  5AVQ B;  2Z5H A;  4HH2 A;  1LTG C;  1NKN A;  1CI6 B;  3N7N A;  1RE4 C;  1GK6 A;  2YKO A;  1SFC A;  3M0A A;  2WTY A;  2C0X A;  3RK3 C;  2WSE H;  1JY3 N;  3TYY A;  4AUW A;  3T97 A;  4C7N A;  2WSF H;  1SLQ A;  2HOD A;  5APW A;  1KFN A;  2H7H A;  2YO2 A;  1GL2 A;  2PP6 A;  2E42 A;  1MFZ A;  1FOS F;  2Q9I A;  1L4A B;  1MZ9 A;  3LW5 H;  1LTJ B;  3RL0 D;  3VP8 A;  3U1C A;  2QM7 A;  1LT9 A;  3A7O A;  3RK2 C;  4C46 A;  1W2E A;  1FZF A;  2E43 A;  1HUC A;  2WPR A;  4LLH A;  4GKG A;  1FJP A;  4WY4 A;  1LWU A;  4WBA A;  1SQB K;  5APS A;  3UIA A;  1SQP K;  2MJZ A;  3A2A A;  5APV A;  1JTH B;  5AW4 B;  1A02 J;  3OAK A;  5CMZ A;  2NPS D;  1G1I A;  5KJ7 D;  3HE5 A;  3V2R A;  3M91 A;  1RE4 A;  3TNU A;  1FZG A;  1OWA A;  5AVZ B;  2IPP A;  3CL3 D;  3P8C D;  3RL0 B;  1J2J B;  3C9I A;  3II6 A;  3P8C E;  1JY3 P;  2ZXE B;  1H88 A;  2POH A;  2J58 A;  5AVR B;  4DZO A;  3OA7 A;  5KJ7 C;  4N78 D;  1N2D C;  4XE5 B;  2C0W A;  3M0D C;  1L0N K;  1YTZ T;  1N7S A;  5APQ A;  2GUS A;  2YKP A;  2M8R A;  3E1I A;  3IR9 A;  1M1J C;  3O8Z A;  5APU A;  5AVS B;  3VTP C;  2YMY A;  5AW2 B;  3BRV B;  5AVY B;  5CCH C;  1G2C B;  2NPS B;  1FDM A;  2KB7 P;  3HE4 B;  1GL2 D;  2I1J A;  5APY A;  2FKW B;  2KLV A;  2IFN A;  3CLQ A;  1ZR2 A;  3H32 B;  1M1J B;  1JOC A;  1IFI A;  3HUS C;  2N1T A;  4AQR D;  1CZQ A;  5KTB A;  1IFN A;  1GK4 A;  1NAF A;  1SQV K;  4XA4 A;  1IFJ A;  3WMM 0;  1IJD B;  3EFG A;  1T8Z A;  4W7Z A;  4WY4 D;  1SFC B;  3KQG A;  4RES B;  1CSB A;  1LTT C;  4I2L C;  4C7N B;  1GD2 E;  4JYB A;  1NO4 A;  1ZV8 A;  3L4F A;  1LT9 C;  2HFE D;  2HOD B;  2WZ7 A;  1KIL A;  3M0D A;  1GL2 B;  4WY4 C;  1LWU C;  1T3J A;  2WIT A;  1RF1 C;  2WT7 A;  1ZLL A;  2A45 H;  3P8M C;  1JCD A;  1WT6 A;  2PAJ A;  3RK3 D;  4JYC A;  4HYT B;  5CCH A;  1JY2 P;  1DX7 A;  2XKM A;  2C9L Y;  1LT9 B;  4GT1 A;  2HG5 D;  1N7S D;  1HGV A;  3L36 A;  2WPS A;  4WY4 B;  1LWU B;  2IFM A;  4Y99 C;  1HJB A;  3PP5 A;  3MIW A;  2YKQ A;  3SWY A;  2CPB A;  3HUS A;  2Z5I A;  1G1J A;  4EOT A;  1N7S C;  3RK2 D;  3HE5 B;  3TNU B;  1E5W A;  1LTS C;  1IFM A;  3RK3 B;  2XDJ A;  3KDP B;  4LGD E;  2N1T D;  2R3C A;  2WSC H;  3KPE A;  1Z56 A;  2P7J A;  3BVH A;  4IFD K;  1N7S B;  1NKZ B;  3VMY A;  3A3Y B;  1S9K D;  3M9Q A;  2XZR A;  1S9K E;  2Q5U A;  1RF1 A;  4B86 A;  3L35 A;  5AW6 B;  2N1T C;  1ZN5 A;  4ZKU A;  1N7L A;  3KYQ A;  3VP9 A;  1NHL A;  3MUD A;  1FZC C;  5AW5 B;  3RK2 B;  1KIL D;  2P2U A;  3I5C A;  5AW1 B;  5BU8 B;  1DEB A;  1IFD A;  3U59 A;  1NWQ A;  2OYH A;  2N1T B;  1JY3 O;  3SWF A;  2FYU K;  5CCH D;  2FYZ A;  1HH0 A;  1J1D C;  1KIL C;  3HTK A;  1FBM A;  1LTI C;  1XTC C;  3P7K A;  3G3Z A;  3L37 A;  3M06 A;  2A45 G;  3R2P A;  1VDF A;  1NU1 K;  1JCC A;  3V2Q A;  1JO5 A;  3NFQ A;  1JY2 N;  1ZR4 A;  1RF0 C;  1FZB A;  2N9B A;  5AVU B;  3B5N A;  1KIL B;  1SVF A;  1YYC A;  5CJ0 A;  2Q7C A;  1IO4 A;  1QL2 A;  1HGZ A;  1HVV A;  2WWW A;  3P32 A;  2WT7 B;  5AVX B;  5APT A;  1IC2 A;  3GHG A;  5AVT B;  2M3B A;  5CCG D;  1GU5 A;  3EQ2 A;  2XNX A;  2Q3I A;  3VMX A;  1N73 C;  1T2K D;  3V2P A;  1NOH A;  1FZC A;  1SQQ K;  4C7R A;  4OH8 B;  2OYI C;  3IFM A;  2FFD A;  5CCG C;  4GIF A;  1T2K C;  3CI9 A;  3HUS B;  2XV5 A;  5BVZ A;  1RY3 A;  5KLV K;  3HRN A;  2C9N Y;  2W6B A;  2P67 A;  2VRS A;  1GZL A;  4I1L A;  3NTN A;  2YO3 A;  1X8Y A;  1X79 B;  1WRG A;  1JY2 O;  1PFI A;  1RF0 A;  2ZFC A;  1H8A A;  1LGH B;  3MD0 A;  2KSJ A;  1NTM K;  1H89 A;  3A5T A;  1AFO A;  1XTG B;  1RF1 B;  2L5G B;  3V4Q A;  2OYH C;  3M9B A;  4JF7 A;  2IX7 C;  4N3Y B;  1MV8 A;  3BAT A;  1N73 A;  1NH4 A;  3B5N D;  1NTZ K;  2GUV A;  4DOJ A;  2R32 A;  2O1J A;  1LTA C;  1NTK K;  5AW0 B;  3VN0 A;  5BU5 A;  2YNY A;  3N4X A;  2WPQ A;  2OYI A;  4LC1 A;  4Y99 B;  3VMZ A;  2OYH B;  3NXS A;  2CPS A;  5CCG A;  1L4A C;  4W80 A;  2Z4E A;  1LTJ C;  2GM4 A;  3B5N C;  2O1K A;  3HTK B;  1FU1 A;  4IFF A;  3V2N A;  2I1K A;  3TK1 A;  1URQ A;  3HD7 A;  2KYV A;  4N6J A;  3GHG C;  1AQ5 A;  1FZA A;  2W6A A;  1CW5 A;  2HPC A;  2R5B A;  3B5N B;  1JMM A;  1M7L A;  4KHX A;  1HWT C;  1T3U A;  2HLO A;  5AVV B;  4I6M C;  1FAV A;  1EQ7 A;  2FFD C;  1CI6 A;  1GW4 A;  1GDT A;  3BAS A;  3GHG B;  1J1E C;  2LKM A;  3RL0 C;  1RE3 C;  4ZKP A;  5AVW B;  1FZC B;  1MUU A;  5AW7 B;  4AYC A;  1L0L K;  1X9V A;  5AW9 B;  3MGN A;  2FFD B;  3H6P A;  1YTZ I;  1KFM A;  3VOP A;  1IK9 A;  1L4A A;  1N86 A;  2JEE A;  4WB4 A;  1J1E B;  1LTJ A;  1LTB C;  4IFM A;  1JNM A;  1J1D B;  2H43 A;  2A45 I;  2FXM A;  2NPS C;  1SP4 A;  3VYI A;  4N78 E;  3U1A A;  4W7Y A;  3B8E B;  1GTW A;  5CJ4 A;  1OXZ A;  3TSI A;  1SFC D;  4M3L A;  3NMD A;  4O9B A;  2KP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...