2P2UA

Crystal structure of putative host-nuclease inhibitor protein gam from desulfovibrio vulgaris
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
153
structure length
150
Chain Sequence
VIVADIRQAEGALAEIATIDRKVGEIEAQMNEAIDAAKARASQKSAPLLARRKELEDGVATFATLNKTEMFKSLDLGFGTIGFRLSTQIVQMSKITKDMTLERLRQFGISEGIRIKEDVNKEAMQGWPDERLEMVGLKRRTTDAFYIEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Host-nuclease inhibitor protein Gam, putative
publication title Crystal structure of putative host-nuclease inhibitor protein Gam from Desulfovibrio vulgaris
rcsb
source organism Desulfovibrio vulgaris
total genus 26
structure length 150
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07352 Phage_Mu_Gam Bacteriophage Mu Gam like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2p2uA01
5AW8B 1JNMA 2YO2A 3T97A 1GD2E 3VMZA 2ZXEB 3NFQA 3NMDA 3L35A 5AVYB 2QM7A 2WPSA 1GTWA 4GKGA 2Q3IA 1YYCA 5AVTB 1IO4A 4AUWA 2QM8A 2IPPA 1HBWA 3VMYA 2BASA 3P8MC 3M0AA 1A02F 1MV8A 4B86A 2P2UA 1FAVA 2Z5IA 3P32A 2JJLA 3HE5B 2C9LY 1H8AA 3O8ZA 2WPRA 3TYYA 4C46A 3M9HA 1H89A 4LC1A 1NAFA 5APXA 2E42A 5AW5B 3A7OA 1T2KC 2WWWA 1CI6B 2WTYA 2WT7B 2R5BA 5AVZB 2XZRA 2Q5UA 4JYBA 1CSBA 5AW7B 5AW6B 4KHXA 1J2JB 1HJBA 5AVRB 5AW2B 1FOSE 5AW9B 4C7NA 2WPQA 5AVVB 1SP4A 3HE5A 3NXSA 4XE5B 4M3LA 1GZLA 2N9BA 5APQA 2H7HA 3IR9A 5CMZA 4C7NB 5AVUB 3A2AA 3M0DA 3NTNA 1X8YA 1CI6A 3LIDA 3KDPB 3OAKA 3TK1A 1GU4A 2YO3A 2Z5HA 2WT7A 4RESB 2R32A 1JUNA 1GK4A 3HE4A 2XU6A 1OXZA 4EOTA 3M9BA 1OWAA 2KP8A 2VRSA 1H88A 3SWFA 2W27A 3I5CA 3HE4B 5AVQB 2P7JA 2R5DA 1GU5A 3M91A 1NWQA 5APYA 3L37A 5AW1B 5AW4B 2C9NY 3UIAA 2P67A 5AW3B 4AYCA 2YNYA 3M06A 4JYCA 3TNUA 4GT1A 4DZOA 4HYTB 4I2LC 5AW0B 3VYIA 3HTKA 3V4QA 1MUUA 3MD0A 3V4WA 1MFZA 5AVWB 3TNUB 4I6MC 3VN0A 2E43A 3P7KA 3VMXA 1DH3A 4AQRD 1HWTC 5APSA 2R3CA 3VTPC 1A02J 3MGNA 1S9KE 1T2KD 1G2CB 5APTA 5APWA 3KQGA 2ZFCA 3B8EB 1S9KD 2W6AA 3LIEA 5AVXB 5AVSB 2XV5A 5APVA 1GK6A 1HUCA 2Q7CA 1CZQA 3L36A 1FOSF 1SLQA 3A3YB 3V5BA 5APUA 3A5TA 1KQLA
chains in the Genus database with same CATH superfamily
2E76C 2FFDA 2YO2A 2H89C 5CCHC 3L72J 1NTME 3NMDA 2KI7B 3AEGC 3QH9A 2XKMA 1KILE 2FY8A 1KD1Q 3LW5J 1FAVA 3H1LJ 4BRYB 3WUUA 4C46A 2OYHC 3IAOA 1H89A 2ZT9D 4ASWA 1GL2B 1M57D 1S4XA 3MTUE 3E1IA 3CWBG 1Q90D 1VQMP 3V2RA 5AW9B 1KB9I 2KK7A 1CI6A 3KDPB 1N8RQ 2RH0A 2O3JA 5E79H 2WITA 1ZN5A 1QVFO 1X0TA 4PJ0E 2RN0A 3CC4P 3CI9A 3L75G 1NTKE 2P67A 1U7MA 1N73A 3AE5C 3PJSK 3V4QA 3I55P 4NPEA 3RGUA 3P7KA 3VMXA 4WY4C 1VQPP 1LTIC 4PD4I 1L0LJ 1JEKA 3VTPC 2O1KA 3AE1C 1S9KE 2UWJE 3FXEA 3FWLA 1AVYA 1PP9E 3V5BA 4D6TD 3WU2H 1YTZT 5KLVD 4BXLA 1GTWA 1IO4A 1BCCD 2QM8A 3P8MC 2ZJSE 3CPWO 3B71A 1X22A 3EFGA 1NAFA 2BEZF 1T2KC 2JKVA 1HGZA 1BGYG 2PRRA 2KS1A 3H1KG 1CSBA 5AW7B 1JTHA 2CPBA 2HLOA 2I1KA 1FZEA 3CCRP 4XE5B 1NTMK 2B88A 1ZOYC 5APQA 1SQQG 3CCUP 4EI2A 2XU6A 1URQC 2MKVA 4EOTA 3SFDC 1K8AQ 1QLED 5KLVK 3F5HA 3IF4A 5BVZA 2POHA 3H1LG 4R4MA 2GM4A 3HTKA 1MFZA 2IFMA 2L91A 3JC22 4OWFA 3KZIH 3CCLP 2YXQB 3A0HE 2IYOA 1HTLC 2IBZG 2AEFA 4GOEA 3Q3DA 1SQXD 1LT1A 2ZFCA 3V2QA 5M1BA 1FDIA 2E76B 1BSNA 3H1IG 1SLQA 2LXCB 1FE6A 2KLUA 1SQVD 2ZYDA 3L71G 1NTKK 3Q5SA 1GD2E 3AE8C 3RK3E 3O6QB 3VMZA 3L74D 2QIWA 4N3YB 1G2CA 1NGMB 3MUDA 3Q1MA 3PTZA 1JY3P 3KHUA 4AUWA 1USEA 4OVNF 3S1KA 2OYHB 3IFMA 1ZR4A 1RF1C 1W5CE 3JCUH 1ZV8A 2E42A 3CMAP 2PFXA 4Z1MH 1FZBA 1FZGA 3BCCG 5DJUB 3M0DC 1ZRTD 1VQ5P 3RK2D 1SQPE 2M3BA 1GZLA 2B87A 3H32B 4C7NB 3WU2E 4H13D 2K9JB 5K5GB 3P8CD 3AE2C 5CBNA 1NAYA 2W27A 4XA4A 1W2EA 1R5SA 1PL5A 2OQQA 4WB4A 3TGUE 3CX5H 5CJ4A 2YNYA 4WY4B 4DZOA 1IZNB 1SFCC 2O01N 1BDCA 3T97B 3HUSC 1L0NE 3LIEA 5AVXB 3WUVA 3F89A 3L70E 3CWBD 3I56P 3D71A 5KAIH 1IJDB 1LNQA 1VQLP 4H44D 1P84I 1KYOI 1IFPA 1VL2A 1SQXJ 2QVAA 2NRGA 2E74C 1KMIZ 1SQVJ 3CXHH 3GLMA 1ZP0C 3OA7A 3L75D 3L74J 3C9IA 1X79B 4BWNA 2M8RA 1OMIA 1LP1A 1ZXGA 4A7PA 2C0XA 3H1JG 4ZMDA 1SQBE 4K3AA 2IZ1A 5GTHH 1URQB 3IR9A 3HRNA 1NU1E 4ASVA 1NTMG 5CHXA 2WT7A 1GK4A 3L72E 1ZR2A 1JY2O 2P7JA 2R44A 3M91A 3AE4C 2B9BA 1YITP 4D6TG 2RMZA 5KLVG 3JCUE 3TNUA 4IL6H 3V4WA 2Y9ZA 2E75D 1SQPK 1BCCG 1K9MQ 1PGJA 1J1EC 5APTA 3AEFC 3MHVA 1NKZB 5KAFH 1BGYD 2FFDC 3H1KD 3FGAD 1RE3A 3KYQA 4H0LC 2WSCH 3ZDMA 4YXDC 4W7ZA 1JM0A 1TU3F 1BSHA 1NTKG 1RF1B 1IFIA 1LTJA 5AVTB 1VQKP 1KN7A 5KJ7C 2N9YB 2IZ0A 3CWBJ 1VQ7P 5CCGC 2P2UA 2A45G 2WSEJ 1S5LH 1HF9A 1SVFA 4EIJA 3RL0C 1G1IA 3SWKA 2BCCD 2Q5UA 2O01H 2QJYC 3B5ND 1YI2P 1FOSE 4PJ0H 1PP9G 2D2CC 5CMZA 3NTNA 1QGKB 3L75J 5KLIC 1GW4A 4RESB 1JUNA 3HE4A 1W2BO 3H1ID 1VQ8P 3CCMP 1IFJA 1N73C 3L71D 1N7SC 2HR3A 4RKUJ 5C39A 3UIAA 3G9RA 5AW3B 3CXHE 2MJZA 1SFCB 4JYCA 1T3UA 1Y9BA 2K1AA 1GL2D 1SQBK 1FJPA 1H0TB 2M0BA 3HUSB 2KZIA 1HWTC 1NU1K 1EDLA 1NTZE 2H43A 2JWDA 3B5NA 2IBZI 3CX5D 1RY3A 1J1DC 1GK6A 4ZNCA 4N78E 1NH4A 2ZXEB 2E74B 4PD4E 4GDOA 3S9OA 2QRXA 1BGYJ 3H25A 3W68A 3H1KJ 2LKMA 1OW6A 3HE5B 4IL6E 1GL2A 1SQQJ 2K9YA 2M3EA 2WWWA 1GDTA 3A0BE 2R5BA 1RE4A 2XZRA 1Y8AA 3AE3C 1L2PA 5KAFE 2WMMA 1XTGB 5B66H 2JDIH 2P58A 4JBZA 2SPZA 2C0WA 1OZHA 1JOCA 3A0HH 3EFFK 2QSIA 5APYA 2QA4P 1AQTA 2DW3A 2HODB 1S5LE 4UB8H 5KKZC 2OGUA 2YKQA 2H8PD 1YIJP 3H1IJ 1J1EB 2E43A 2NZ2A 2A06E 2FFDB 3L71J 2YKOA 1SQPG 3PRJA 5APWA 2W6JH 1FZFA 5AVSB 3H1JD 2I8DA 1EZVE 3CCVP 2XNDH 3TGUG 1U7JA 2Z4EA 2WPSA 3BRVB 1NTMD 3ITKA 5CJ0A 1LTSC 1DEEG 3BCCJ 3RL0B 1KILD 3M0AA 3PH0A 4K35A 3WMM0 1FBMA 1NTZK 3P32A 2C9LY 2HPCB 2LR2A 3D6ZA 1EXJA 2QJYB 3E7KA 4IFDK 1CI6B 3R4YA 1M56D 2G8YA 4U7JA 3L70G 1VQOP 2D2CB 5KLIB 5AVVB 3OW2O 4YTPC 2PP6A 2Y0DA 2JWAA 1N73B 4NPDA 1KFMA 1N7SB 4O9BA 3N4XA 3CCQP 1M8OB 1KILA 2N1TC 1NTKD 3USSA 2YMKA 5AW0B 3RBZA 1JMBA 2FXMA 3RK2C 1JCDA 1SQBG 1J1DB 3H6PA 4C7RA 1S9KD 1NU1G 5B66E 2FBWC 3HD7C 2K3RA 2BCCG 1PP9D 2YKPA 5AW8B 1AV1A 2WSFJ 3H1HE 4JQ0D 3CC2P 1K05A 2OYHA 1G1JA 1E79H 1USDA 4WY4D 3H1JJ 1JY2P 2WSSH 4UB8E 1JTHB 5CBOA 1JCCA 2W90A 2RKLA 2YMYA 4LLHA 4L76A 2A45I 1T8ZA 1UIXA 1P84E 1KYOE 4UB6E 1OW8A 1RF0C 2J5UA 1NTMJ 1FZCC 4OH8B 1FZAA 2FKWB 3AEAC 4EDFA 1OFCX 1HJBA 4C7NA 1LWUA 2K9JA 1EDJA 1KQGB 4D6TJ 2WZ7A 1LT9A 5KLVJ 3LIDA 1YQ3C 3HTKB 3CCSP 1OXZA 2OARA 1DD3A 1EDIA 1BCCJ 5KKZB 3AEDC 1GU5A 1QVGO 4DJGA 3M06A 2AEJA 2Q1KA 1PFIA 2FYUE 4L73A 1N86A 3BASA 3GW6A 2E5YA 2ZVNB 1A02J 3CD6P 1HJ0A 1RE3C 1PV3A 2WQYC 1G2CB 1URQD 1NTKJ 3EWKA 1PPJE 1HUCA 1S2EA 4U3FE 1VQNP 1HVVA 1RQVA 3MIWA 3RK3D 4GKGA 2K88A 4WWIA 3G6EP 2E75C 2BASA 2NPSC 2AEMA 1K04A 1RQUA 1PP9J 1H8AA 3G3ZA 2KUBA 2IX7C 5AW5B 3A7OA 1NTZG 1BE3E 2BEQD 4YPCA 3L73E 1KC8Q 5AW6B 5AVRB 5AW2B 1URQA 1K73Q 1SQPD 3VP9A 5AVUB 4WVZA 1KB9H 2FYUD 2QE7H 2V7QJ 1VF5C 1OWAA 3KPEA 2N1TB 3SSUA 3PLNA 5AVQB 2CK3H 1NWQA 3TGUD 3GHGA 1YQ4C 3CC7P 5BU8B 4U3FD 1SQQE 3B5NC 5GTIH 1M1JC 3RL0g 3AEBC 4PD4H 3HD7B 1Q82Q 1L0ND 2KSEA 1T6AA 1WRGA 2Q7CA 3L70D 3H1LE 3A3YB 3B4SA 5H2FH 1RF1A 3V2PA 1PZQA 3CL3D 1EXIA 4OGQC 2PGDA 3A0BH 2FYUK 2M5AA 2Q3IA 1R8EA 1LP1B 2IBZE 2W83C 4QMAA 2QJKC 1OW7A 1RE4C 3TYYA 1FZCB 3E1RA 5APXA 1EC5A 1L4AD 2FXOA 2WTYA 2WT7B 4IOIH 1JO5A 1Y47A 2Q3EA 3BRTB 1EZVG 1SQBD 1HGVA 4M3LA 1IFDA 2KLVA 4IL6X 3PHLA 1L0NK 2E74D 1NU1D 4PV1D 1DIPA 1FJKA 1LTTC 1DD4A 2KP8A 1H88A 3L72D 1L0LE 3KXDA 1DEBA 4I1LA 1IK9A 1KQFB 3BCCE 1SQPJ 4GODA 1H0TA 2Y9YA 2ZYGA 3HUSA 3IN6A 3SFEC 2KNCA 3K5BA 1L4AA 4I6MC 1FDOA 3G4SP 2OYIA 1RH5B 1Z56A 3TGUJ 5TISE 3GF7A 2HG5D 1AQ5A 3U1CA 2ZT9C 3G71P 1CZQA 1S5LX 1KB9E 2J59M 3AE6C 1LTGC 3A5TA 1OVVA 2LXBA 2E75B 2NPSB 5AVYB 1JY2N 1YYCA 3C1LA 3S4RA 1A02F 3L70J 4HB1A 2XNXA 2OYOA 5L8RJ 1BDDA 2JJLA 1FC2C 3O8ZA 3FX0A 2GUVA 1QL2A 5GTIE 4HKZH 2P10A 4DOJA 4JPZB 3GG2A 1S1CX 1UIIA 1QX8A 1YJ9P 4BRYA 4KT0J 2AXCA 2JP3A 4RJTA 3H1HG 3VP8A 1VF5B 5KJ7D 1X9VA 5H2FE 5CCGD 1KILC 3QWOC 4IFMA 3RL0D 3V6IA 1YJNP 2HODA 2E5TA 1SQBJ 3CX5I 3L37A 5AW4B 5KTBA 3B5NB 4DT0A 4AYCA 1VPCA 3CXHD 1M1JB 4HYTB 1NU1J 2IDBA 4JF7A 2BCCJ 1VDFA 2D2CD 2R3CA 1NTZD 4W80A 4ZKUA 1VQ9P 1S72P 2W6AA 1KV4A 1L0LK 4D6TE 5KJ7A 5KLVE 4OGQB 1N7SD 5CCGA 2HFED 2B89A 1P84H 1KYOH 4N78D 4UB6H 4PD4D 2QJKB 1BCCE 2KB7P 3VMYA 2HPCA 2FYUG 4H0LB 3CXHI 3VOPA 2ZAEB 1LTAC 3MUDC 1ZLLA 5DJTB 1LWUC 3AECC 2XDJA 1PPJG 1LT9C 1PIXA 4U3FG 2WVRA 4L75A 2IYPA 1YJWP 1VQ6P 3C8VA 2WSEH 1N7SA 1R5LA 1L0NG 2P1JA 2WPVB 3U1AA 2E76D 1PGOA 2ZVOB 5CCHD 1NKNA 4GT1A 1BE3G 1MFTA 3EQ2A 3L73G 1IC2A 1WMKA 3PP5A 2ZT9B 2A06D 2K37A 1SQXE 2AXTH 4XFJA 4DCKA 1OVRA 2QG4A 1SQVE 1EZVD 2QJPC 2JR8A 3L74E 2JO1A 3RBXA 3L35A 1NTZJ 2QM7A 2W6BA 4MN4C 3CCEP 4H13C 5CCHA 2Z5IA 5B5EH 3O6QA 3L72G 2KZJA 1N2DC 4YXWH 4HJGH 1YTZI 1ZRTE 2KYVA 4N6JA 2KS1B 1XTCC 3NXSA 3MZWB 3Q5RA 3RK3C 2H7HA 1EZVI 1KILB 1X8YA 2YO3A 1FU1A 2R32A 1GMJA 3P8CE 3GHGC 2VRSA 2YXRB 2G3AA 2R5DA 3H32A 2C9NY 2I1JA 4H44C 4I7ZC 2WSCJ 3LW5H 5E79E 2GA1A 2FYNC 4AQRD 5APSA 1OVUA 3MP7B 3AEEC 2V4HA 1N7LA 1T2KD 4CPGA 1NVOA 4WY4A 2XV5A 3CWBE 2GUSA 1S3JA 3SWYA 1YHQP 3II6A 1AJYA 3D6YA 2N1TD 1L0LG 3T97A 1SS1A 2O01J 3H1HD 3Q2YA 4Y99C 2OTKE 2OTLP 2IPPA 1HBWA 1AA0A 1IFMA 1LWUB 1SQXK 3L75E 2ZYAA 3GF3A 1M1KQ 4LC1A 2YIUC 1LTJC 1OIPA 1LT9B 1P84D 1KYOD 1T3JA 3HD7D 1EDKA 1SQVK 4W7YA 3N7NA 3W67A 1MZ9A 2AXTE 1J2JB 3TF5A 2WPQA 1NOHA 4R4LA 3WUTA 2Q9IA 3A2AA 2JEEA 3TK1A 1GU4A 2B87B 2N1TA 1FS0E 3Q5PA 1YBKA 3OJAB 3TSIA 3SWFA 4GOFA 3U59A 3AE9C 2OTJP 4L74A 1L4AC 2ZXXA 5TISH 1WT6A 5B5EE 3VYIA 2OYIC 2KXPB 2W8ZA 3AE7C 5AVWB 1IFNA 1LGHB 3HD7A 3CCJP 2O1JA 3CLQA 1BGYE 3B8EB 3H1KE 2QJPB 3ABVC 4PV1C 5APVA 1Q7YQ 3L36A 1FOSF 1PPJD 3RK2B 1FDMA 5APUA 3KZIE 1JNMA 3NFQA 4H13B 1LTBC 1PGQA 3FWNA 2HYNA 1RF0A 4TT3H 1ZW0A 1FZCA 4HH2A 1MV8A 4B86A 3FXDA 2Y0CA 3TDKA 3H1HJ 3R2PA 2KSJA 2R3SA 2BCCE 2WSFH 1BE3D 1PGPA 4IFFA 1QEXA 3RK3B 1M7LA 3L73D 1GL2C 1SFCD 1SP4A 3BATA 1KZUB 4TLFA 2N9BA 3GHGB 2PAJA 1GW3A 3M0DA 2KOGA 2ITAA 3OAKA 2NPSD 2A06G 2KIKA 2Z5HA 3H1IE 1KFNA 2J58A 1JY3O 3M9BA 1DX7A 4H44B 1Q86Q 3L71E 4I7ZB 1AFOA 1QL1A 4NPFX 1U57A 4GIFA 4WBAA 2FYZA 2FYNB 1MUUA 3MD0A 3TNUB 2IFNA 1SQQD 3VN0A 1DH3A 3BVHA 4EYYQ 1NHLA 5TJHA 3MGNA 3CX5E 1SFCA 1VF5D 2M5AB 1CW5A 1NYHA 3CMEP 3V2NA 2FYUJ 3H1LD 2NPSA 3D70A 4Y99B 1Q81Q 1OX3A 5EFWB 1LJ2A 4KJMA 1KORA 2QEXP 2IBZD 2YIUB 1LTJB 4ZKPA 5KAIE 3JSVC 4U3FJ 2WPRA 3M9HA 1M90Q 4Y28J 2A45H 1EQ7A 1SQXG 5AVZB 2CPSA 4JYBA 4KHXA 1SQQK 1L0NJ 1SQVG 1E5WA 3GMAA 3HE5A 4OGQD 2Q6QA 3L74G 2H88C 2KNCB 1NO4A 1BE3J 1L4AB 4LGDE 3L73J 3I5CA 3HE4B 4H0LD 1L0LD 1RHZB 2FXPA 1M1JA 2OYIB 5AW1B 1JMMA 3BCCD 1Q2NA 5GTHE 1JB0J 3L4FA 1IK7A 1HH0A 4I2LC 1JY3N 5BU5A 1NJIQ 1D7MA 1AVOA 2V7QH 4PV1B 1KQSO 3M9QA 3KQGA 3VMAA 1MKMA 3H1JE 1VQ4P 1ZMEC 1KTMA 2L5GB 2Y0EA 1KB9D 4RO0A 1KQLA
chains in the Genus database with same CATH topology
2FFDA 2YO2A 3MIWA 4W7ZA 3RK3D 5CCHC 3NMDA 3L35A 2QM7A 2W6BA 1RF1B 4GKGA 1IFIA 1LTJA 5AVTB 2XKMA 5KJ7C 2NPSC 2BASA 5CCHA 5CCGC 2P2UA 2A45G 1FAVA 2Z5IA 1HVVA 1H8AA 1SVFA 3G3ZA 4EIJA 4C46A 3RL0C 2OYHC 1H89A 2IX7C 5AW5B 3A7OA 1G1IA 1N2DC 1GL2B 2Q5UA 2O01H 3MTUE 3E1IA 1YTZI 3V2RA 5AW6B 3B5ND 5AVRB 5AW2B 1FOSE 2KYVA 4N6JA 1URQA 5AW9B 1XTCC 3NXSA 3RK3C 3VP9A 2H7HA 1KILB 5CMZA 5AVUB 3NTNA 1X8YA 1CI6A 3KDPB 2YO3A 1FU1A 1GW4A 4RESB 2R32A 1JUNA 2WITA 3P8CE 3HE4A 1ZN5A 3GHGC 1OWAA 2VRSA 3KPEA 1IFJA 2N1TB 5AVQB 1N73C 2R5DA 1NWQA 1N7SC 3CI9A 3GHGA 3H32A 2C9NY 3UIAA 2I1JA 2P67A 5AW3B 2MJZA 1SFCB 4JYCA 1N73A 5BU8B 1T3UA 1GL2D 3LW5H 1SQBK 1FJPA 3V4QA 3HUSB 3B5NC 1M1JC 3P7KA 4WY4C 3VMXA 4AQRD 1HWTC 1LTIC 5APSA 1NU1K 3VTPC 2O1KA 2H43A 3HD7B 3B5NA 1N7LA 1S9KE 1T2KD 4WY4A 2XV5A 1RY3A 2GUSA 1WRGA 1J1DC 1GK6A 2Q7CA 3SWYA 3A3YB 3II6A 3V5BA 1YTZT 2N1TD 1RF1A 3T97A 4N78E 3V2PA 3CL3D 1NH4A 2ZXEB 2FYUK 4Y99C 1GTWA 2Q3IA 1IO4A 2QM8A 2IPPA 1HBWA 2LKMA 3P8MC 1IFMA 1LWUB 1SQXK 3HE5B 1RE4C 3TYYA 1GL2A 3EFGA 1FZCB 4LC1A 1NAFA 5APXA 1LTJC 1L4AD 1T2KC 1LT9B 2WWWA 1GDTA 1HGZA 1T3JA 3HD7D 2WTYA 1SQVK 2WT7B 2R5BA 4W7YA 1JO5A 1RE4A 2XZRA 3N7NA 1CSBA 5AW7B 3BRTB 1MZ9A 1JTHA 1J2JB 2CPBA 2HLOA 2WPQA 2I1KA 1FZEA 1XTGB 1NOHA 4XE5B 1NTMK 1HGVA 4M3LA 5APQA 1IFDA 2Q9IA 3A2AA 2KLVA 1L0NK 2JEEA 3TK1A 1GU4A 2N1TA 2C0WA 2XU6A 1FJKA 1URQC 4EOTA 1LTTC 1JOCA 2KP8A 3OJAB 3TSIA 1H88A 5KLVK 3SWFA 5BVZA 2POHA 1DEBA 4I1LA 3U59A 5APYA 1IK9A 1L4AC 2HODB 1WT6A 3HUSA 2YKQA 3VYIA 2GM4A 2OYIC 2H8PD 3HTKA 1MFZA 2IFMA 5AVWB 1L4AA 1IFNA 1J1EB 4I6MC 1LGHB 2E43A 3HD7A 2O1JA 2FFDB 1HTLC 2OYIA 2YKOA 1Z56A 3CLQA 5APWA 2ZFCA 3B8EB 3V2QA 2HG5D 1FZFA 1AQ5A 5AVSB 3U1CA 5APVA 1CZQA 3L36A 1FOSF 1SLQA 2J59M 3RK2B 1FDMA 5APUA 1LTGC 3A5TA 1NTKK 1JNMA 1GD2E 3VMZA 2NPSB 3NFQA 1LTBC 2Z4EA 5AVYB 4N3YB 1JY2N 1G2CA 2WPSA 3BRVB 3MUDA 5CJ0A 1YYCA 1LTSC 1JY3P 4AUWA 2HYNA 1RF0A 3RL0B 1KILD 2OYHB 3M0AA 1A02F 3IFMA 1FZCA 1ZR4A 4HH2A 3WMM0 1MV8A 4B86A 2XNXA 1RF1C 1FBMA 1NTZK 3P32A 2JJLA 2C9LY 2HPCB 3O8ZA 1ZV8A 2GUVA 1QL2A 2E42A 4IFDK 3R2PA 2KSJA 1CI6B 2WSFH 1FZBA 4DOJA 1FZGA 4IFFA 3RK3B 1M7LA 3M0DC 1GL2C 1SFCD 5AVVB 1SP4A 3RK2D 3BATA 1KZUB 2M3BA 1GZLA 2N9BA 3GHGB 2PP6A 3H32B 2PAJA 3VP8A 4C7NB 1GW3A 3M0DA 2KOGA 5KJ7D 3OAKA 1X9VA 2NPSD 2Z5HA 1N73B 1KFNA 1KFMA 5CCGD 1KILC 2J58A 3P8CD 1N7SB 1JY3O 3M9BA 1DX7A 4O9BA 4IFMA 3N4XA 3RL0D 1AFOA 2W27A 4XA4A 1W2EA 1QL1A 2HODA 4WB4A 4GIFA 3L37A 5AW4B 1KILA 5CJ4A 2N1TC 5KTBA 3B5NB 4AYCA 2YNYA 1VPCA 4WBAA 1M1JB 2FYZA 4WY4B 4DZOA 4HYTB 5AW0B 1MUUA 3MD0A 4JF7A 3TNUB 2IFNA 1SFCC 3VN0A 2FXMA 1DH3A 3RK2C 1JCDA 1VDFA 2R3CA 3BVHA 1J1DB 1NHLA 3H6PA 3HUSC 4W80A 3MGNA 4ZKUA 1SFCA 4C7RA 1S9KD 2W6AA 3LIEA 5AVXB 1CW5A 1L0LK 3HD7C 3V2NA 5KJ7A 1IJDB 1N7SD 2NPSA 4Y99B 2YKPA 5AW8B 5CCGA 2HFED 4N78D 2OYHA 1G1JA 2KB7P 3VMYA 4WY4D 2HPCA 1JY2P 1JTHB 1LTJB 3VOPA 1JCCA 4ZKPA 2WPRA 2YMYA 3M9HA 4LLHA 1LTAC 2A45I 1ZLLA 1T8ZA 3OA7A 2A45H 1EQ7A 3C9IA 1LWUC 1X79B 2M8RA 1RF0C 1FZCC 2XDJA 5AVZB 2CPSA 4JYBA 4OH8B 1FZAA 2C0XA 2FKWB 1LT9C 1SQQK 4KHXA 1HJBA 1E5WA 4C7NA 1LWUA 3HE5A 1URQB 3IR9A 3HRNA 2WZ7A 1LT9A 2WSEH 1N7SA 3LIDA 5CHXA 2WT7A 1NO4A 1GK4A 3HTKB 1OXZA 2OARA 1L4AB 1ZR2A 2P1JA 4LGDE 1JY2O 3I5CA 3HE4B 3U1AA 2P7JA 1GU5A 3M91A 1M1JA 2OYIB 5AW1B 1JMMA 5CCHD 3L4FA 1NKNA 3M06A 3TNUA 4GT1A 1HH0A 1PFIA 4I2LC 3V4WA 3EQ2A 1SQPK 1N86A 1JY3N 3BASA 1IC2A 5BU5A 3PP5A 1A02J 3M9QA 1J1EC 1RE3C 1G2CB 5APTA 3KQGA 1URQD 1NKZB 2FFDC 1HUCA 2L5GB 1RE3A 3KYQA 2WSCH 1KQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW8 B;  1JNM A;  2YO2 A;  3T97 A;  1GD2 E;  3VMZ A;  2ZXE B;  3NFQ A;  3NMD A;  3L35 A;  5AVY B;  2QM7 A;  2WPS A;  1GTW A;  4GKG A;  2Q3I A;  1YYC A;  5AVT B;  1IO4 A;  4AUW A;  2QM8 A;  2IPP A;  1HBW A;  3VMY A;  2BAS A;  3P8M C;  3M0A A;  1A02 F;  1MV8 A;  4B86 A;  2P2U A;  1FAV A;  2Z5I A;  3P32 A;  2JJL A;  3HE5 B;  2C9L Y;  1H8A A;  3O8Z A;  2WPR A;  3TYY A;  4C46 A;  3M9H A;  1H89 A;  4LC1 A;  1NAF A;  5APX A;  2E42 A;  5AW5 B;  3A7O A;  1T2K C;  2WWW A;  1CI6 B;  2WTY A;  2WT7 B;  2R5B A;  5AVZ B;  2XZR A;  2Q5U A;  4JYB A;  1CSB A;  5AW7 B;  5AW6 B;  4KHX A;  1J2J B;  1HJB A;  5AVR B;  5AW2 B;  1FOS E;  5AW9 B;  4C7N A;  2WPQ A;  5AVV B;  1SP4 A;  3HE5 A;  3NXS A;  4XE5 B;  4M3L A;  1GZL A;  2N9B A;  5APQ A;  2H7H A;  3IR9 A;  5CMZ A;  4C7N B;  5AVU B;  3A2A A;  3M0D A;  3NTN A;  1X8Y A;  1CI6 A;  3LID A;  3KDP B;  3OAK A;  3TK1 A;  1GU4 A;  2YO3 A;  2Z5H A;  2WT7 A;  4RES B;  2R32 A;  1JUN A;  1GK4 A;  3HE4 A;  2XU6 A;  1OXZ A;  4EOT A;  3M9B A;  1OWA A;  2KP8 A;  2VRS A;  1H88 A;  3SWF A;  2W27 A;  3I5C A;  3HE4 B;  5AVQ B;  2P7J A;  2R5D A;  1GU5 A;  3M91 A;  1NWQ A;  5APY A;  3L37 A;  5AW1 B;  5AW4 B;  2C9N Y;  3UIA A;  2P67 A;  5AW3 B;  4AYC A;  2YNY A;  3M06 A;  4JYC A;  3TNU A;  4GT1 A;  4DZO A;  4HYT B;  4I2L C;  5AW0 B;  3VYI A;  3HTK A;  3V4Q A;  1MUU A;  3MD0 A;  3V4W A;  1MFZ A;  5AVW B;  3TNU B;  4I6M C;  3VN0 A;  2E43 A;  3P7K A;  3VMX A;  1DH3 A;  4AQR D;  1HWT C;  5APS A;  2R3C A;  3VTP C;  1A02 J;  3MGN A;  1S9K E;  1T2K D;  1G2C B;  5APT A;  5APW A;  3KQG A;  2ZFC A;  3B8E B;  1S9K D;  2W6A A;  3LIE A;  5AVX B;  5AVS B;  2XV5 A;  5APV A;  1GK6 A;  1HUC A;  2Q7C A;  1CZQ A;  3L36 A;  1FOS F;  1SLQ A;  3A3Y B;  3V5B A;  5APU A;  3A5T A;  1KQL A; 
#chains in the Genus database with same CATH topology
 2E76 C;  2FFD A;  2YO2 A;  2H89 C;  5CCH C;  3L72 J;  1NTM E;  3NMD A;  2KI7 B;  3AEG C;  3QH9 A;  2XKM A;  1KIL E;  2FY8 A;  1KD1 Q;  3LW5 J;  1FAV A;  3H1L J;  4BRY B;  3WUU A;  4C46 A;  2OYH C;  3IAO A;  1H89 A;  2ZT9 D;  4ASW A;  1GL2 B;  1M57 D;  1S4X A;  3MTU E;  3E1I A;  3CWB G;  1Q90 D;  1VQM P;  3V2R A;  5AW9 B;  1KB9 I;  2KK7 A;  1CI6 A;  3KDP B;  1N8R Q;  2RH0 A;  2O3J A;  5E79 H;  2WIT A;  1ZN5 A;  1QVF O;  1X0T A;  4PJ0 E;  2RN0 A;  3CC4 P;  3CI9 A;  3L75 G;  1NTK E;  2P67 A;  1U7M A;  1N73 A;  3AE5 C;  3PJS K;  3V4Q A;  3I55 P;  4NPE A;  3RGU A;  3P7K A;  3VMX A;  4WY4 C;  1VQP P;  1LTI C;  4PD4 I;  1L0L J;  1JEK A;  3VTP C;  2O1K A;  3AE1 C;  1S9K E;  2UWJ E;  3FXE A;  3FWL A;  1AVY A;  1PP9 E;  3V5B A;  4D6T D;  3WU2 H;  1YTZ T;  5KLV D;  4BXL A;  1GTW A;  1IO4 A;  1BCC D;  2QM8 A;  3P8M C;  2ZJS E;  3CPW O;  3B71 A;  1X22 A;  3EFG A;  1NAF A;  2BEZ F;  1T2K C;  2JKV A;  1HGZ A;  1BGY G;  2PRR A;  2KS1 A;  3H1K G;  1CSB A;  5AW7 B;  1JTH A;  2CPB A;  2HLO A;  2I1K A;  1FZE A;  3CCR P;  4XE5 B;  1NTM K;  2B88 A;  1ZOY C;  5APQ A;  1SQQ G;  3CCU P;  4EI2 A;  2XU6 A;  1URQ C;  2MKV A;  4EOT A;  3SFD C;  1K8A Q;  1QLE D;  5KLV K;  3F5H A;  3IF4 A;  5BVZ A;  2POH A;  3H1L G;  4R4M A;  2GM4 A;  3HTK A;  1MFZ A;  2IFM A;  2L91 A;  3JC2 2;  4OWF A;  3KZI H;  3CCL P;  2YXQ B;  3A0H E;  2IYO A;  1HTL C;  2IBZ G;  2AEF A;  4GOE A;  3Q3D A;  1SQX D;  1LT1 A;  2ZFC A;  3V2Q A;  5M1B A;  1FDI A;  2E76 B;  1BSN A;  3H1I G;  1SLQ A;  2LXC B;  1FE6 A;  2KLU A;  1SQV D;  2ZYD A;  3L71 G;  1NTK K;  3Q5S A;  1GD2 E;  3AE8 C;  3RK3 E;  3O6Q B;  3VMZ A;  3L74 D;  2QIW A;  4N3Y B;  1G2C A;  1NGM B;  3MUD A;  3Q1M A;  3PTZ A;  1JY3 P;  3KHU A;  4AUW A;  1USE A;  4OVN F;  3S1K A;  2OYH B;  3IFM A;  1ZR4 A;  1RF1 C;  1W5C E;  3JCU H;  1ZV8 A;  2E42 A;  3CMA P;  2PFX A;  4Z1M H;  1FZB A;  1FZG A;  3BCC G;  5DJU B;  3M0D C;  1ZRT D;  1VQ5 P;  3RK2 D;  1SQP E;  2M3B A;  1GZL A;  2B87 A;  3H32 B;  4C7N B;  3WU2 E;  4H13 D;  2K9J B;  5K5G B;  3P8C D;  3AE2 C;  5CBN A;  1NAY A;  2W27 A;  4XA4 A;  1W2E A;  1R5S A;  1PL5 A;  2OQQ A;  4WB4 A;  3TGU E;  3CX5 H;  5CJ4 A;  2YNY A;  4WY4 B;  4DZO A;  1IZN B;  1SFC C;  2O01 N;  1BDC A;  3T97 B;  3HUS C;  1L0N E;  3LIE A;  5AVX B;  3WUV A;  3F89 A;  3L70 E;  3CWB D;  3I56 P;  3D71 A;  5KAI H;  1IJD B;  1LNQ A;  1VQL P;  4H44 D;  1P84 I;  1KYO I;  1IFP A;  1VL2 A;  1SQX J;  2QVA A;  2NRG A;  2E74 C;  1KMI Z;  1SQV J;  3CXH H;  3GLM A;  1ZP0 C;  3OA7 A;  3L75 D;  3L74 J;  3C9I A;  1X79 B;  4BWN A;  2M8R A;  1OMI A;  1LP1 A;  1ZXG A;  4A7P A;  2C0X A;  3H1J G;  4ZMD A;  1SQB E;  4K3A A;  2IZ1 A;  5GTH H;  1URQ B;  3IR9 A;  3HRN A;  1NU1 E;  4ASV A;  1NTM G;  5CHX A;  2WT7 A;  1GK4 A;  3L72 E;  1ZR2 A;  1JY2 O;  2P7J A;  2R44 A;  3M91 A;  3AE4 C;  2B9B A;  1YIT P;  4D6T G;  2RMZ A;  5KLV G;  3JCU E;  3TNU A;  4IL6 H;  3V4W A;  2Y9Z A;  2E75 D;  1SQP K;  1BCC G;  1K9M Q;  1PGJ A;  1J1E C;  5APT A;  3AEF C;  3MHV A;  1NKZ B;  5KAF H;  1BGY D;  2FFD C;  3H1K D;  3FGA D;  1RE3 A;  3KYQ A;  4H0L C;  2WSC H;  3ZDM A;  4YXD C;  4W7Z A;  1JM0 A;  1TU3 F;  1BSH A;  1NTK G;  1RF1 B;  1IFI A;  1LTJ A;  5AVT B;  1VQK P;  1KN7 A;  5KJ7 C;  2N9Y B;  2IZ0 A;  3CWB J;  1VQ7 P;  5CCG C;  2P2U A;  2A45 G;  2WSE J;  1S5L H;  1HF9 A;  1SVF A;  4EIJ A;  3RL0 C;  1G1I A;  3SWK A;  2BCC D;  2Q5U A;  2O01 H;  2QJY C;  3B5N D;  1YI2 P;  1FOS E;  4PJ0 H;  1PP9 G;  2D2C C;  5CMZ A;  3NTN A;  1QGK B;  3L75 J;  5KLI C;  1GW4 A;  4RES B;  1JUN A;  3HE4 A;  1W2B O;  3H1I D;  1VQ8 P;  3CCM P;  1IFJ A;  1N73 C;  3L71 D;  1N7S C;  2HR3 A;  4RKU J;  5C39 A;  3UIA A;  3G9R A;  5AW3 B;  3CXH E;  2MJZ A;  1SFC B;  4JYC A;  1T3U A;  1Y9B A;  2K1A A;  1GL2 D;  1SQB K;  1FJP A;  1H0T B;  2M0B A;  3HUS B;  2KZI A;  1HWT C;  1NU1 K;  1EDL A;  1NTZ E;  2H43 A;  2JWD A;  3B5N A;  2IBZ I;  3CX5 D;  1RY3 A;  1J1D C;  1GK6 A;  4ZNC A;  4N78 E;  1NH4 A;  2ZXE B;  2E74 B;  4PD4 E;  4GDO A;  3S9O A;  2QRX A;  1BGY J;  3H25 A;  3W68 A;  3H1K J;  2LKM A;  1OW6 A;  3HE5 B;  4IL6 E;  1GL2 A;  1SQQ J;  2K9Y A;  2M3E A;  2WWW A;  1GDT A;  3A0B E;  2R5B A;  1RE4 A;  2XZR A;  1Y8A A;  3AE3 C;  1L2P A;  5KAF E;  2WMM A;  1XTG B;  5B66 H;  2JDI H;  2P58 A;  4JBZ A;  2SPZ A;  2C0W A;  1OZH A;  1JOC A;  3A0H H;  3EFF K;  2QSI A;  5APY A;  2QA4 P;  1AQT A;  2DW3 A;  2HOD B;  1S5L E;  4UB8 H;  5KKZ C;  2OGU A;  2YKQ A;  2H8P D;  1YIJ P;  3H1I J;  1J1E B;  2E43 A;  2NZ2 A;  2A06 E;  2FFD B;  3L71 J;  2YKO A;  1SQP G;  3PRJ A;  5APW A;  2W6J H;  1FZF A;  5AVS B;  3H1J D;  2I8D A;  1EZV E;  3CCV P;  2XND H;  3TGU G;  1U7J A;  2Z4E A;  2WPS A;  3BRV B;  1NTM D;  3ITK A;  5CJ0 A;  1LTS C;  1DEE G;  3BCC J;  3RL0 B;  1KIL D;  3M0A A;  3PH0 A;  4K35 A;  3WMM 0;  1FBM A;  1NTZ K;  3P32 A;  2C9L Y;  2HPC B;  2LR2 A;  3D6Z A;  1EXJ A;  2QJY B;  3E7K A;  4IFD K;  1CI6 B;  3R4Y A;  1M56 D;  2G8Y A;  4U7J A;  3L70 G;  1VQO P;  2D2C B;  5KLI B;  5AVV B;  3OW2 O;  4YTP C;  2PP6 A;  2Y0D A;  2JWA A;  1N73 B;  4NPD A;  1KFM A;  1N7S B;  4O9B A;  3N4X A;  3CCQ P;  1M8O B;  1KIL A;  2N1T C;  1NTK D;  3USS A;  2YMK A;  5AW0 B;  3RBZ A;  1JMB A;  2FXM A;  3RK2 C;  1JCD A;  1SQB G;  1J1D B;  3H6P A;  4C7R A;  1S9K D;  1NU1 G;  5B66 E;  2FBW C;  3HD7 C;  2K3R A;  2BCC G;  1PP9 D;  2YKP A;  5AW8 B;  1AV1 A;  2WSF J;  3H1H E;  4JQ0 D;  3CC2 P;  1K05 A;  2OYH A;  1G1J A;  1E79 H;  1USD A;  4WY4 D;  3H1J J;  1JY2 P;  2WSS H;  4UB8 E;  1JTH B;  5CBO A;  1JCC A;  2W90 A;  2RKL A;  2YMY A;  4LLH A;  4L76 A;  2A45 I;  1T8Z A;  1UIX A;  1P84 E;  1KYO E;  4UB6 E;  1OW8 A;  1RF0 C;  2J5U A;  1NTM J;  1FZC C;  4OH8 B;  1FZA A;  2FKW B;  3AEA C;  4EDF A;  1OFC X;  1HJB A;  4C7N A;  1LWU A;  2K9J A;  1EDJ A;  1KQG B;  4D6T J;  2WZ7 A;  1LT9 A;  5KLV J;  3LID A;  1YQ3 C;  3HTK B;  3CCS P;  1OXZ A;  2OAR A;  1DD3 A;  1EDI A;  1BCC J;  5KKZ B;  3AED C;  1GU5 A;  1QVG O;  4DJG A;  3M06 A;  2AEJ A;  2Q1K A;  1PFI A;  2FYU E;  4L73 A;  1N86 A;  3BAS A;  3GW6 A;  2E5Y A;  2ZVN B;  1A02 J;  3CD6 P;  1HJ0 A;  1RE3 C;  1PV3 A;  2WQY C;  1G2C B;  1URQ D;  1NTK J;  3EWK A;  1PPJ E;  1HUC A;  1S2E A;  4U3F E;  1VQN P;  1HVV A;  1RQV A;  3MIW A;  3RK3 D;  4GKG A;  2K88 A;  4WWI A;  3G6E P;  2E75 C;  2BAS A;  2NPS C;  2AEM A;  1K04 A;  1RQU A;  1PP9 J;  1H8A A;  3G3Z A;  2KUB A;  2IX7 C;  5AW5 B;  3A7O A;  1NTZ G;  1BE3 E;  2BEQ D;  4YPC A;  3L73 E;  1KC8 Q;  5AW6 B;  5AVR B;  5AW2 B;  1URQ A;  1K73 Q;  1SQP D;  3VP9 A;  5AVU B;  4WVZ A;  1KB9 H;  2FYU D;  2QE7 H;  2V7Q J;  1VF5 C;  1OWA A;  3KPE A;  2N1T B;  3SSU A;  3PLN A;  5AVQ B;  2CK3 H;  1NWQ A;  3TGU D;  3GHG A;  1YQ4 C;  3CC7 P;  5BU8 B;  4U3F D;  1SQQ E;  3B5N C;  5GTI H;  1M1J C;  3RL0 g;  3AEB C;  4PD4 H;  3HD7 B;  1Q82 Q;  1L0N D;  2KSE A;  1T6A A;  1WRG A;  2Q7C A;  3L70 D;  3H1L E;  3A3Y B;  3B4S A;  5H2F H;  1RF1 A;  3V2P A;  1PZQ A;  3CL3 D;  1EXI A;  4OGQ C;  2PGD A;  3A0B H;  2FYU K;  2M5A A;  2Q3I A;  1R8E A;  1LP1 B;  2IBZ E;  2W83 C;  4QMA A;  2QJK C;  1OW7 A;  1RE4 C;  3TYY A;  1FZC B;  3E1R A;  5APX A;  1EC5 A;  1L4A D;  2FXO A;  2WTY A;  2WT7 B;  4IOI H;  1JO5 A;  1Y47 A;  2Q3E A;  3BRT B;  1EZV G;  1SQB D;  1HGV A;  4M3L A;  1IFD A;  2KLV A;  4IL6 X;  3PHL A;  1L0N K;  2E74 D;  1NU1 D;  4PV1 D;  1DIP A;  1FJK A;  1LTT C;  1DD4 A;  2KP8 A;  1H88 A;  3L72 D;  1L0L E;  3KXD A;  1DEB A;  4I1L A;  1IK9 A;  1KQF B;  3BCC E;  1SQP J;  4GOD A;  1H0T A;  2Y9Y A;  2ZYG A;  3HUS A;  3IN6 A;  3SFE C;  2KNC A;  3K5B A;  1L4A A;  4I6M C;  1FDO A;  3G4S P;  2OYI A;  1RH5 B;  1Z56 A;  3TGU J;  5TIS E;  3GF7 A;  2HG5 D;  1AQ5 A;  3U1C A;  2ZT9 C;  3G71 P;  1CZQ A;  1S5L X;  1KB9 E;  2J59 M;  3AE6 C;  1LTG C;  3A5T A;  1OVV A;  2LXB A;  2E75 B;  2NPS B;  5AVY B;  1JY2 N;  1YYC A;  3C1L A;  3S4R A;  1A02 F;  3L70 J;  4HB1 A;  2XNX A;  2OYO A;  5L8R J;  1BDD A;  2JJL A;  1FC2 C;  3O8Z A;  3FX0 A;  2GUV A;  1QL2 A;  5GTI E;  4HKZ H;  2P10 A;  4DOJ A;  4JPZ B;  3GG2 A;  1S1C X;  1UII A;  1QX8 A;  1YJ9 P;  4BRY A;  4KT0 J;  2AXC A;  2JP3 A;  4RJT A;  3H1H G;  3VP8 A;  1VF5 B;  5KJ7 D;  1X9V A;  5H2F E;  5CCG D;  1KIL C;  3QWO C;  4IFM A;  3RL0 D;  3V6I A;  1YJN P;  2HOD A;  2E5T A;  1SQB J;  3CX5 I;  3L37 A;  5AW4 B;  5KTB A;  3B5N B;  4DT0 A;  4AYC A;  1VPC A;  3CXH D;  1M1J B;  4HYT B;  1NU1 J;  2IDB A;  4JF7 A;  2BCC J;  1VDF A;  2D2C D;  2R3C A;  1NTZ D;  4W80 A;  4ZKU A;  1VQ9 P;  1S72 P;  2W6A A;  1KV4 A;  1L0L K;  4D6T E;  5KJ7 A;  5KLV E;  4OGQ B;  1N7S D;  5CCG A;  2HFE D;  2B89 A;  1P84 H;  1KYO H;  4N78 D;  4UB6 H;  4PD4 D;  2QJK B;  1BCC E;  2KB7 P;  3VMY A;  2HPC A;  2FYU G;  4H0L B;  3CXH I;  3VOP A;  2ZAE B;  1LTA C;  3MUD C;  1ZLL A;  5DJT B;  1LWU C;  3AEC C;  2XDJ A;  1PPJ G;  1LT9 C;  1PIX A;  4U3F G;  2WVR A;  4L75 A;  2IYP A;  1YJW P;  1VQ6 P;  3C8V A;  2WSE H;  1N7S A;  1R5L A;  1L0N G;  2P1J A;  2WPV B;  3U1A A;  2E76 D;  1PGO A;  2ZVO B;  5CCH D;  1NKN A;  4GT1 A;  1BE3 G;  1MFT A;  3EQ2 A;  3L73 G;  1IC2 A;  1WMK A;  3PP5 A;  2ZT9 B;  2A06 D;  2K37 A;  1SQX E;  2AXT H;  4XFJ A;  4DCK A;  1OVR A;  2QG4 A;  1SQV E;  1EZV D;  2QJP C;  2JR8 A;  3L74 E;  2JO1 A;  3RBX A;  3L35 A;  1NTZ J;  2QM7 A;  2W6B A;  4MN4 C;  3CCE P;  4H13 C;  5CCH A;  2Z5I A;  5B5E H;  3O6Q A;  3L72 G;  2KZJ A;  1N2D C;  4YXW H;  4HJG H;  1YTZ I;  1ZRT E;  2KYV A;  4N6J A;  2KS1 B;  1XTC C;  3NXS A;  3MZW B;  3Q5R A;  3RK3 C;  2H7H A;  1EZV I;  1KIL B;  1X8Y A;  2YO3 A;  1FU1 A;  2R32 A;  1GMJ A;  3P8C E;  3GHG C;  2VRS A;  2YXR B;  2G3A A;  2R5D A;  3H32 A;  2C9N Y;  2I1J A;  4H44 C;  4I7Z C;  2WSC J;  3LW5 H;  5E79 E;  2GA1 A;  2FYN C;  4AQR D;  5APS A;  1OVU A;  3MP7 B;  3AEE C;  2V4H A;  1N7L A;  1T2K D;  4CPG A;  1NVO A;  4WY4 A;  2XV5 A;  3CWB E;  2GUS A;  1S3J A;  3SWY A;  1YHQ P;  3II6 A;  1AJY A;  3D6Y A;  2N1T D;  1L0L G;  3T97 A;  1SS1 A;  2O01 J;  3H1H D;  3Q2Y A;  4Y99 C;  2OTK E;  2OTL P;  2IPP A;  1HBW A;  1AA0 A;  1IFM A;  1LWU B;  1SQX K;  3L75 E;  2ZYA A;  3GF3 A;  1M1K Q;  4LC1 A;  2YIU C;  1LTJ C;  1OIP A;  1LT9 B;  1P84 D;  1KYO D;  1T3J A;  3HD7 D;  1EDK A;  1SQV K;  4W7Y A;  3N7N A;  3W67 A;  1MZ9 A;  2AXT E;  1J2J B;  3TF5 A;  2WPQ A;  1NOH A;  4R4L A;  3WUT A;  2Q9I A;  3A2A A;  2JEE A;  3TK1 A;  1GU4 A;  2B87 B;  2N1T A;  1FS0 E;  3Q5P A;  1YBK A;  3OJA B;  3TSI A;  3SWF A;  4GOF A;  3U59 A;  3AE9 C;  2OTJ P;  4L74 A;  1L4A C;  2ZXX A;  5TIS H;  1WT6 A;  5B5E E;  3VYI A;  2OYI C;  2KXP B;  2W8Z A;  3AE7 C;  5AVW B;  1IFN A;  1LGH B;  3HD7 A;  3CCJ P;  2O1J A;  3CLQ A;  1BGY E;  3B8E B;  3H1K E;  2QJP B;  3ABV C;  4PV1 C;  5APV A;  1Q7Y Q;  3L36 A;  1FOS F;  1PPJ D;  3RK2 B;  1FDM A;  5APU A;  3KZI E;  1JNM A;  3NFQ A;  4H13 B;  1LTB C;  1PGQ A;  3FWN A;  2HYN A;  1RF0 A;  4TT3 H;  1ZW0 A;  1FZC A;  4HH2 A;  1MV8 A;  4B86 A;  3FXD A;  2Y0C A;  3TDK A;  3H1H J;  3R2P A;  2KSJ A;  2R3S A;  2BCC E;  2WSF H;  1BE3 D;  1PGP A;  4IFF A;  1QEX A;  3RK3 B;  1M7L A;  3L73 D;  1GL2 C;  1SFC D;  1SP4 A;  3BAT A;  1KZU B;  4TLF A;  2N9B A;  3GHG B;  2PAJ A;  1GW3 A;  3M0D A;  2KOG A;  2ITA A;  3OAK A;  2NPS D;  2A06 G;  2KIK A;  2Z5H A;  3H1I E;  1KFN A;  2J58 A;  1JY3 O;  3M9B A;  1DX7 A;  4H44 B;  1Q86 Q;  3L71 E;  4I7Z B;  1AFO A;  1QL1 A;  4NPF X;  1U57 A;  4GIF A;  4WBA A;  2FYZ A;  2FYN B;  1MUU A;  3MD0 A;  3TNU B;  2IFN A;  1SQQ D;  3VN0 A;  1DH3 A;  3BVH A;  4EYY Q;  1NHL A;  5TJH A;  3MGN A;  3CX5 E;  1SFC A;  1VF5 D;  2M5A B;  1CW5 A;  1NYH A;  3CME P;  3V2N A;  2FYU J;  3H1L D;  2NPS A;  3D70 A;  4Y99 B;  1Q81 Q;  1OX3 A;  5EFW B;  1LJ2 A;  4KJM A;  1KOR A;  2QEX P;  2IBZ D;  2YIU B;  1LTJ B;  4ZKP A;  5KAI E;  3JSV C;  4U3F J;  2WPR A;  3M9H A;  1M90 Q;  4Y28 J;  2A45 H;  1EQ7 A;  1SQX G;  5AVZ B;  2CPS A;  4JYB A;  4KHX A;  1SQQ K;  1L0N J;  1SQV G;  1E5W A;  3GMA A;  3HE5 A;  4OGQ D;  2Q6Q A;  3L74 G;  2H88 C;  2KNC B;  1NO4 A;  1BE3 J;  1L4A B;  4LGD E;  3L73 J;  3I5C A;  3HE4 B;  4H0L D;  1L0L D;  1RHZ B;  2FXP A;  1M1J A;  2OYI B;  5AW1 B;  1JMM A;  3BCC D;  1Q2N A;  5GTH E;  1JB0 J;  3L4F A;  1IK7 A;  1HH0 A;  4I2L C;  1JY3 N;  5BU5 A;  1NJI Q;  1D7M A;  1AVO A;  2V7Q H;  4PV1 B;  1KQS O;  3M9Q A;  3KQG A;  3VMA A;  1MKM A;  3H1J E;  1VQ4 P;  1ZME C;  1KTM A;  2L5G B;  2Y0E A;  1KB9 D;  4RO0 A;  1KQL A; 
#chains in the Genus database with same CATH homology
 2FFD A;  2YO2 A;  3MIW A;  4W7Z A;  3RK3 D;  5CCH C;  3NMD A;  3L35 A;  2QM7 A;  2W6B A;  1RF1 B;  4GKG A;  1IFI A;  1LTJ A;  5AVT B;  2XKM A;  5KJ7 C;  2NPS C;  2BAS A;  5CCH A;  5CCG C;  2P2U A;  2A45 G;  1FAV A;  2Z5I A;  1HVV A;  1H8A A;  1SVF A;  3G3Z A;  4EIJ A;  4C46 A;  3RL0 C;  2OYH C;  1H89 A;  2IX7 C;  5AW5 B;  3A7O A;  1G1I A;  1N2D C;  1GL2 B;  2Q5U A;  2O01 H;  3MTU E;  3E1I A;  1YTZ I;  3V2R A;  5AW6 B;  3B5N D;  5AVR B;  5AW2 B;  1FOS E;  2KYV A;  4N6J A;  1URQ A;  5AW9 B;  1XTC C;  3NXS A;  3RK3 C;  3VP9 A;  2H7H A;  1KIL B;  5CMZ A;  5AVU B;  3NTN A;  1X8Y A;  1CI6 A;  3KDP B;  2YO3 A;  1FU1 A;  1GW4 A;  4RES B;  2R32 A;  1JUN A;  2WIT A;  3P8C E;  3HE4 A;  1ZN5 A;  3GHG C;  1OWA A;  2VRS A;  3KPE A;  1IFJ A;  2N1T B;  5AVQ B;  1N73 C;  2R5D A;  1NWQ A;  1N7S C;  3CI9 A;  3GHG A;  3H32 A;  2C9N Y;  3UIA A;  2I1J A;  2P67 A;  5AW3 B;  2MJZ A;  1SFC B;  4JYC A;  1N73 A;  5BU8 B;  1T3U A;  1GL2 D;  3LW5 H;  1SQB K;  1FJP A;  3V4Q A;  3HUS B;  3B5N C;  1M1J C;  3P7K A;  4WY4 C;  3VMX A;  4AQR D;  1HWT C;  1LTI C;  5APS A;  1NU1 K;  3VTP C;  2O1K A;  2H43 A;  3HD7 B;  3B5N A;  1N7L A;  1S9K E;  1T2K D;  4WY4 A;  2XV5 A;  1RY3 A;  2GUS A;  1WRG A;  1J1D C;  1GK6 A;  2Q7C A;  3SWY A;  3A3Y B;  3II6 A;  3V5B A;  1YTZ T;  2N1T D;  1RF1 A;  3T97 A;  4N78 E;  3V2P A;  3CL3 D;  1NH4 A;  2ZXE B;  2FYU K;  4Y99 C;  1GTW A;  2Q3I A;  1IO4 A;  2QM8 A;  2IPP A;  1HBW A;  2LKM A;  3P8M C;  1IFM A;  1LWU B;  1SQX K;  3HE5 B;  1RE4 C;  3TYY A;  1GL2 A;  3EFG A;  1FZC B;  4LC1 A;  1NAF A;  5APX A;  1LTJ C;  1L4A D;  1T2K C;  1LT9 B;  2WWW A;  1GDT A;  1HGZ A;  1T3J A;  3HD7 D;  2WTY A;  1SQV K;  2WT7 B;  2R5B A;  4W7Y A;  1JO5 A;  1RE4 A;  2XZR A;  3N7N A;  1CSB A;  5AW7 B;  3BRT B;  1MZ9 A;  1JTH A;  1J2J B;  2CPB A;  2HLO A;  2WPQ A;  2I1K A;  1FZE A;  1XTG B;  1NOH A;  4XE5 B;  1NTM K;  1HGV A;  4M3L A;  5APQ A;  1IFD A;  2Q9I A;  3A2A A;  2KLV A;  1L0N K;  2JEE A;  3TK1 A;  1GU4 A;  2N1T A;  2C0W A;  2XU6 A;  1FJK A;  1URQ C;  4EOT A;  1LTT C;  1JOC A;  2KP8 A;  3OJA B;  3TSI A;  1H88 A;  5KLV K;  3SWF A;  5BVZ A;  2POH A;  1DEB A;  4I1L A;  3U59 A;  5APY A;  1IK9 A;  1L4A C;  2HOD B;  1WT6 A;  3HUS A;  2YKQ A;  3VYI A;  2GM4 A;  2OYI C;  2H8P D;  3HTK A;  1MFZ A;  2IFM A;  5AVW B;  1L4A A;  1IFN A;  1J1E B;  4I6M C;  1LGH B;  2E43 A;  3HD7 A;  2O1J A;  2FFD B;  1HTL C;  2OYI A;  2YKO A;  1Z56 A;  3CLQ A;  5APW A;  2ZFC A;  3B8E B;  3V2Q A;  2HG5 D;  1FZF A;  1AQ5 A;  5AVS B;  3U1C A;  5APV A;  1CZQ A;  3L36 A;  1FOS F;  1SLQ A;  2J59 M;  3RK2 B;  1FDM A;  5APU A;  1LTG C;  3A5T A;  1NTK K;  1JNM A;  1GD2 E;  3VMZ A;  2NPS B;  3NFQ A;  1LTB C;  2Z4E A;  5AVY B;  4N3Y B;  1JY2 N;  1G2C A;  2WPS A;  3BRV B;  3MUD A;  5CJ0 A;  1YYC A;  1LTS C;  1JY3 P;  4AUW A;  2HYN A;  1RF0 A;  3RL0 B;  1KIL D;  2OYH B;  3M0A A;  1A02 F;  3IFM A;  1FZC A;  1ZR4 A;  4HH2 A;  3WMM 0;  1MV8 A;  4B86 A;  2XNX A;  1RF1 C;  1FBM A;  1NTZ K;  3P32 A;  2JJL A;  2C9L Y;  2HPC B;  3O8Z A;  1ZV8 A;  2GUV A;  1QL2 A;  2E42 A;  4IFD K;  3R2P A;  2KSJ A;  1CI6 B;  2WSF H;  1FZB A;  4DOJ A;  1FZG A;  4IFF A;  3RK3 B;  1M7L A;  3M0D C;  1GL2 C;  1SFC D;  5AVV B;  1SP4 A;  3RK2 D;  3BAT A;  1KZU B;  2M3B A;  1GZL A;  2N9B A;  3GHG B;  2PP6 A;  3H32 B;  2PAJ A;  3VP8 A;  4C7N B;  1GW3 A;  3M0D A;  2KOG A;  5KJ7 D;  3OAK A;  1X9V A;  2NPS D;  2Z5H A;  1N73 B;  1KFN A;  1KFM A;  5CCG D;  1KIL C;  2J58 A;  3P8C D;  1N7S B;  1JY3 O;  3M9B A;  1DX7 A;  4O9B A;  4IFM A;  3N4X A;  3RL0 D;  1AFO A;  2W27 A;  4XA4 A;  1W2E A;  1QL1 A;  2HOD A;  4WB4 A;  4GIF A;  3L37 A;  5AW4 B;  1KIL A;  5CJ4 A;  2N1T C;  5KTB A;  3B5N B;  4AYC A;  2YNY A;  1VPC A;  4WBA A;  1M1J B;  2FYZ A;  4WY4 B;  4DZO A;  4HYT B;  5AW0 B;  1MUU A;  3MD0 A;  4JF7 A;  3TNU B;  2IFN A;  1SFC C;  3VN0 A;  2FXM A;  1DH3 A;  3RK2 C;  1JCD A;  1VDF A;  2R3C A;  3BVH A;  1J1D B;  1NHL A;  3H6P A;  3HUS C;  4W80 A;  3MGN A;  4ZKU A;  1SFC A;  4C7R A;  1S9K D;  2W6A A;  3LIE A;  5AVX B;  1CW5 A;  1L0L K;  3HD7 C;  3V2N A;  5KJ7 A;  1IJD B;  1N7S D;  2NPS A;  4Y99 B;  2YKP A;  5AW8 B;  5CCG A;  2HFE D;  4N78 D;  2OYH A;  1G1J A;  2KB7 P;  3VMY A;  4WY4 D;  2HPC A;  1JY2 P;  1JTH B;  1LTJ B;  3VOP A;  1JCC A;  4ZKP A;  2WPR A;  2YMY A;  3M9H A;  4LLH A;  1LTA C;  2A45 I;  1ZLL A;  1T8Z A;  3OA7 A;  2A45 H;  1EQ7 A;  3C9I A;  1LWU C;  1X79 B;  2M8R A;  1RF0 C;  1FZC C;  2XDJ A;  5AVZ B;  2CPS A;  4JYB A;  4OH8 B;  1FZA A;  2C0X A;  2FKW B;  1LT9 C;  1SQQ K;  4KHX A;  1HJB A;  1E5W A;  4C7N A;  1LWU A;  3HE5 A;  1URQ B;  3IR9 A;  3HRN A;  2WZ7 A;  1LT9 A;  2WSE H;  1N7S A;  3LID A;  5CHX A;  2WT7 A;  1NO4 A;  1GK4 A;  3HTK B;  1OXZ A;  2OAR A;  1L4A B;  1ZR2 A;  2P1J A;  4LGD E;  1JY2 O;  3I5C A;  3HE4 B;  3U1A A;  2P7J A;  1GU5 A;  3M91 A;  1M1J A;  2OYI B;  5AW1 B;  1JMM A;  5CCH D;  3L4F A;  1NKN A;  3M06 A;  3TNU A;  4GT1 A;  1HH0 A;  1PFI A;  4I2L C;  3V4W A;  3EQ2 A;  1SQP K;  1N86 A;  1JY3 N;  3BAS A;  1IC2 A;  5BU5 A;  3PP5 A;  1A02 J;  3M9Q A;  1J1E C;  1RE3 C;  1G2C B;  5APT A;  3KQG A;  1URQ D;  1NKZ B;  2FFD C;  1HUC A;  2L5G B;  1RE3 A;  3KYQ A;  2WSC H;  1KQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...