1SQBG

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqbG00
2A06G 3CXHH 1BGYG 3L70G 1NTKG 1SQVG 1SQQG 1L0LG 1EZVG 1SQBG 3H1LG 3L74G 1PPJG 2FYUG 1L0NG 4D6TG 2IBZG 1KYOH 1NTMG 1PP9G 3H1IG 1NTZG 3BCCG 1BE3G 3L73G 1SQPG 3CWBG 1NU1G 1P84H 1SQXG 3H1HG 2BCCG 3L72G 3H1KG 4PD4H 3L71G 5KLVG 3CX5H 1KB9H 1BCCG 3H1JG 3TGUG 3L75G 4U3FG
chains in the Genus database with same CATH superfamily
1UIXA 2W90A 3JSVC 3M9BA 5KTBA 2K3RA 2Q5UA 3G6EP 3L74E 3RBXA 1J2JB 1ZR2A 3CX5D 4AUWA 3MUDC 4I1LA 2KOGA 2YKOA 1G2CA 1X22A 3WU2H 1T2KD 1M7LA 2O1KA 4C7NB 3OAKA 5APUA 2KYVA 2G3AA 5EFWB 1NKZB 2QRXA 2WSFJ 3G9RA 4PD4H 5KLIB 5KJ7D 4EOTA 2AEMA 5AW4B 3L70J 1RE4C 2QJPC 1L0NG 1N73A 1PP9G 1SQVK 3TK1A 2IX7C 1DD4A 1FZFA 5KAFE 1PFIA 1GW3A 1K04A 2O3JA 2A06G 1BCCD 1QL2A 5CBNA 1S5LE 1PZQA 1KQFB 1PGQA 2KK7A 1M90Q 2IZ1A 4YPCA 3OA7A 2FYUK 1T8ZA 4MN4C 2Y0DA 3S1KA 2AXTE 3M9QA 2OYHC 3IN6A 1HF9A 3H1KD 3I5CA 1M56D 3L74G 4WY4B 2XZRA 3SWFA 4QMAA 3AEEC 5AVSB 1SQVD 1YIJP 1LP1A 1PPJE 2CPSA 3HE5B 1SVFA 2N1TC 2HYNA 3M06A 1OVRA 4DCKA 3TGUJ 5CMZA 5BU5A 4U3FG 2NPSD 2B87B 3CCQP 2ZT9C 4L74A 3AE1C 4L75A 1JY3P 2P58A 2MKVA 3H1IG 2OTJP 2NZ2A 1MKMA 2E76C 2FYUD 1N7SD 1EXIA 1DEBA 1GDTA 2PP6A 3QH9A 1KORA 3HUSC 4OGQC 2XDJA 5AW7B 2PRRA 1FZCB 3BASA 3F89A 3BVHA 2IBZI 3RK3B 3VMZA 1T3JA 3GHGB 3R2PA 3NTNA 5APYA 3Q5PA 2Y9YA 2SPZA 1W5CE 1RH5B 3H1LG 3PHLA 1NTMG 2OYIB 1JY2N 1FS0E 1N2DC 1SQPJ 3ZDMA 3CWBJ 3U1AA 1Q82Q 3AEBC 3FWNA 3L71J 3L73E 4PD4E 5KLVG 1KILC 5CCGD 2FY8A 2IDBA 3R4YA 4JPZB 2C0WA 3LW5J 2K9YA 2K1AA 1EDJA 3M9HA 3ITKA 5AVYB 3M0DA 1AV1A 2ZJSE 1FAVA 4ZNCA 3KQGA 2O01H 4H13C 2FYNC 4OH8B 3VYIA 2R32A 2M0BA 1GL2C 3CMEP 1FZEA 2OTLP 1NTZE 1SQPD 2N9YB 3CWBD 3P7KA 1BE3E 1SS1A 1IFIA 3L71D 2W6AA 2QM8A 1H0TA 3AEGC 2W6BA 1NYHA 2R3CA 2KIKA 2ZFCA 1GL2A 1NU1K 4I7ZC 3CCUP 5BVZA 5AVZB 1OWAA 1JY2O 1J1DB 2CPBA 2OQQA 4N3YB 1YTZI 5TISE 1EZVE 3L73G 3H1HG 3VOPA 2IYPA 1RQUA 1M57D 5APSA 3CC2P 1LT9B 2QJYB 3GLMA 1CSBA 2RKLA 2IBZD 4OWFA 1UIIA 1OMIA 1YHQP 4IOIH 2D2CB 1PIXA 1LTSC 1NU1D 1VPCA 3H1JG 2K88A 1HUCA 1NHLA 4GT1A 2M5AA 2YIUC 3TF5A 1FZAA 3HE4B 1LTBC 1NTZG 1NTKE 3CC4P 2YO3A 3PJSK 1T2KC 2WITA 3KYQA 3L72J 1P84I 1YQ3C 1FOSF 1JTHB 2UWJE 1VF5D 1FJKA 1A02F 5KJ7C 1SQBG 5GTIE 1L0LK 1ZOYC 4ASWA 1FBMA 1JMMA 4N78D 1EXJA 3AE4C 2KNCA 1X79B 1RE3A 3LIEA 1USEA 4WWIA 2IFNA 3H32A 1IK9A 4DJGA 2PAJA 1EZVG 1HGZA 1PGPA 2P7JA 1OZHA 3HD7A 2QJPB 3RK3E 1SQQK 4ZKPA 1KFNA 1HJ0A 1IO4A 1WRGA 1QVFO 1KB9E 1BCCE 1L0LD 1BE3J 1BGYE 2JP3A 5APVA 1EC5A 1QL1A 1VQ6P 2XU6A 2OYHB 1USDA 2C0XA 3RBZA 2KLVA 3TSIA 1NAFA 3FXEA 2E74D 3CCEP 1SQQD 1S2EA 2R5DA 2NPSC 1LTAC 1DH3A 1NWQA 1LWUA 1N7SC 2N1TB 2WSCH 2P10A 2ZT9B 3BCCJ 1CZQA 3KZIH 2WT7B 2E76B 2GA1A 1FDIA 3HUSB 1KB9I 4OGQB 1LJ2A 1M1JA 2Z4EA 1MZ9A 2POHA 1G1IA 4ZKUA 1P84D 1Y8AA 1OVUA 1L0NE 2A45G 3MD0A 5CJ4A 1PP9E 2GM4A 1W2EA 1MUUA 2QJKC 5AW9B 1HJBA 1BCCG 1JCCA 3SSUA 2KZIA 5APQA 2FBWC 1VQ9P 1BGYG 1NTKJ 1YQ4C 5AW3B 5CCGC 2KZJA 3V4QA 2A06E 4C7RA 1OIPA 1QEXA 3BCCD 4EDFA 1KQSO 1SQXJ 3A0HH 3H1KG 3HRNA 2L5GB 1URQA 2KS1A 1D7MA 4OVNF 2HODA 1KILB 3RL0D 2QE7H 1SQVG 4K35A 4D6TJ 1TU3F 4GOEA 1JUNA 2K9JB 2IYOA 2V7QJ 5M1BA 5CCGA 2ZYAA 3CCLP 1S5LX 2JKVA 2BCCD 3C8VA 1H0TB 1N73C 4JYBA 2QA4P 2RN0A 2FYUG 2YO2A 4H13B 4U3FE 2FYNB 1RHZB 1GL2B 3H1IE 3HD7D 5CBOA 1SQXD 2Q3EA 2QSIA 3Q5SA 3NMDA 1YJ9P 5AVTB 3L75D 3AE6C 3Q3DA 1LGHB 3T97A 3L36A 1IK7A 2RMZA 2W83C 4H0LD 4D6TD 4YXDC 3HTKA 4H44B 1E5WA 4I7ZB 1VQNP 4PJ0H 3IF4A 5B5EH 1BDDA 5AW5B 1HWTC 4M3LA 3KZIE 4N6JA 3H1LE 1Q81Q 1NH4A 1KC8Q 1NTME 1IFDA 1GMJA 4DOJA 2YXRB 1ZXGA 2YNYA 2W6JH 3KHUA 2M5AB 5KLVE 1JMBA 1KYOH 1HBWA 3L70D 3PH0A 1BDCA 3G3ZA 2QIWA 2LKMA 2ZXXA 4EIJA 3U1CA 1GK4A 2HLOA 2O01N 4GKGA 1S9KE 4BRYA 2Z5IA 3CXHH 2JWAA 1L0NJ 4HKZH 1VF5C 1PP9J 2YIUB 1U7MA 3KXDA 1VQKP 4LC1A 3H32B 3AEFC 1HVVA 3II6A 1GK6A 4O9BA 3W68A 2QEXP 1OW6A 2WVRA 1L4AD 3AE9C 4EI2A 4HYTB 3CCJP 4LGDE 3ABVC 2BEQD 3W67A 3TGUD 1URQD 3L74J 2WZ7A 2B9BA 3PLNA 1U7JA 2G8YA 3WU2E 4WVZA 1H8AA 2Q9IA 3M0DC 1N7LA 4RJTA 1WT6A 2W27A 1SQPK 1VQ8P 3CX5H 2P67A 2LXCB 4U3FJ 1EDLA 2M3EA 3H1HE 3VMXA 3O6QB 1FC2C 2YMYA 3H1IJ 2XNDH 3AECC 2E74C 1XTGB 1NU1G 4HB1A 1CI6A 1KILE 1YJWP 3D6ZA 3RK2C 1KV4A 3G71P 3TNUA 4PJ0E 3F5HA 3H1JE 3H6PA 3B5NA 5B5EE 2H43A 3L74D 4Z1MH 5APTA 2IFMA 2NPSB 2WSCJ 3UIAA 1X8YA 2A45H 2P1JA 3D71A 1N7SB 2BASA 4HH2A 2E75D 1KFMA 3H1LJ 1NTMJ 1KYOE 1VL2A 1Q86Q 4TLFA 1GTWA 2E42A 4C46A 1SQBE 4JF7A 3P8CE 1NJIQ 2Q1KA 3JCUH 5KLVJ 2Y0CA 3A7OA 4PD4I 3EQ2A 2IPPA 2WTYA 2WSFH 1R5LA 3CXHE 4UB8H 3IR9A 1QVGO 4EYYQ 1GU4A 2E5YA 3WUVA 1Z56A 3SFDC 3MIWA 1K05A 4C7NA 2KS1B 1LTGC 3C9IA 1K8AQ 4ZMDA 1DX7A 2QJKB 2I8DA 3TYYA 3L4FA 1ZRTE 4IL6H 3H25A 1YBKA 4I2LC 3RL0C 4Y99C 5AW1B 3FX0A 5KKZC 3G4SP 3VTPC 1YJNP 1G2CB 5AW2B 2VRSA 1KQLA 1KYOI 5E79H 1PPJD 1RE3C 1ZN5A 5KAIH 2JDIH 3CX5E 1QGKB 3HD7C 3T97B 1FJPA 3U59A 1N73B 2Z5HA 3AEDC 1RF1C 1GZLA 2N1TD 2ZVNB 2H7HA 4PV1D 3L73J 1EZVI 3H1HJ 4H0LC 3HE5A 2CK3H 2KP8A 1DEEG 5CCHD 4L76A 2B87A 4GODA 1ZMEC 2OYOA 2OGUA 2ZYDA 2HR3A 1RF1A 1SFCD 2AEFA 1QLED 1AA0A 3H1JJ 3L72D 1HGVA 2JWDA 2HFED 1AVYA 1NTZJ 1LP1B 2K37A 1XTCC 3N7NA 1LWUC 1S72P 1NTZK 1LTIC 3B5ND 3L73D 4PD4D 2MJZA 5AVVB 1EQ7A 3JCUE 1NO4A 2JO1A 2Q3IA 1OVVA 3GHGA 3H1KE 1SQBJ 3A3YB 4UB8E 1EDKA 1KN7A 3Q1MA 1JO5A 5B66H 4IFDK 1SQVE 2OYIA 3V2QA 1FZGA 2HPCA 1IFJA 1KD1Q 1ZV8A 3CCVP 2BCCG 3V4WA 1JB0J 1M1JC 2WPSA 2E5TA 2PFXA 3USSA 2R3SA 4Y28J 4IL6E 3AE3C 5DJUB 1VF5B 3E1IA 3V2PA 1NTZD 1Q7YQ 2FYUE 1BE3D 1L4AC 3B71A 3EFGA 2BEZF 1AJYA 2FFDC 1YTZT 3CL3D 2A45I 3L75G 3P8MC 1M1KQ 1SP4A 1KMIZ 3GMAA 5E79E 1OW7A 2J58A 1URQC 1LTTC 2IZ0A 2WQYC 4RKUJ 3V6IA 5KAIE 3VP8A 1EDIA 1BSHA 1L4AA 1L2PA 1PV3A 2JR8A 2FFDA 3KPEA 4H44D 1EZVD 1NTKK 1CI6B 1OFCX 1JY3N 2WPRA 2FKWB 2XNXA 1SQXK 1HH0A 1MFTA 2Q6QA 3L70G 4YTPC 5CJ0A 2H88C 3JC22 1LNQA 1FZBA 3GF3A 1R5SA 3L35A 5AVRB 4WY4D 5AVUB 2O01J 3RK2B 1JCDA 5CHXA 4RO0A 2KSEA 1LT9A 1NTKD 1AQ5A 2E75C 2NRGA 4WBAA 3CPWO 3MZWB 4KT0J 1SQPE 3CWBE 1BCCJ 1RY3A 4GOFA 3QWOC 4TT3H 3L71E 1BGYJ 4XA4A 5GTHH 4AQRD 3HE4A 5B66E 3BRVB 1OX3A 1IC2A 2WSEH 4UB6H 3RL0g 3V5BA 1RQVA 3H1KJ 3TGUG 1JTHA 2N9BA 1SQVJ 3MUDA 3RK3D 1JY3O 1OW8A 4IFMA 2P2UA 1T3UA 3PTZA 4R4LA 2ZYGA 4NPFX 2YKPA 1KB9D 2B89A 1S1CX 2DW3A 1ZR4A 1VQLP 3SWKA 2FYUJ 3E1RA 1BGYD 2FXMA 4R4MA 1RF0C 2KUBA 5DJTB 3LIDA 1RE4A 2IBZE 3RL0B 3KDPB 1DIPA 4Y99B 5K5GB 5KKZB 2JJLA 1FDMA 1NU1E 2B88A 1YI2P 3FXDA 2KSJA 5C39A 2KXPB 5APXA 1LTJC 3CI9A 1K73Q 1L0NK 2KNCB 1SQPG 3CWBG 1IFNA 1P84H 3AE8C 4PV1C 1RF0A 3A0HE 3L71G 3A5TA 2OYHA 1Y9BA 3HD7B 3B4SA 1PL5A 4DT0A 4GIFA 5TISH 1RF1B 5H2FH 4LLHA 5CCHC 3FWLA 2YKQA 2L91A 1LTJA 3VN0A 2QG4A 4N78E 1MFZA 4W7ZA 4H0LB 4AYCA 3WUTA 2N1TA 1SFCC 1AFOA 3MP7B 2OARA 2C9NY 3VP9A 2XV5A 3BATA 3D70A 1L0ND 1PP9D 3CLQA 3EFFK 1VDFA 2FYZA 2WT7A 1AVOA 1NVOA 3WMM0 1IFMA 1N86A 3OJAB 3V2RA 5CCHA 3D6YA 3B5NC 3L72E 2J5UA 3HUSA 1PGOA 1YYCA 5GTHE 2IBZG 2A06D 1E79H 1JEKA 2HPCB 3TDKA 1SFCA 1L0LE 1J1EC 1LWUB 3M91A 4UB6E 3CMAP 3Q5RA 1DD3A 1X9VA 2D2CD 5GTIH 4GDOA 3CD6P 1PPJG 2GUSA 1SQQE 3PRJA 3SWYA 1NKNA 3N4XA 1FU1A 3A2AA 3AE7C 1W2BO 3NXSA 2J59M 2V7QH 1M1JB 4A7PA 2H8PD 4U3FD 1KILA 2PGDA 2R5BA 4BWNA 3H1ID 1NTMK 2WMMA 5KLIC 2C9LY 3AEAC 1FE6A 1WMKA 2K9JA 4JYCA 2KLUA 1L4AB 1JM0A 1KB9H 1M8OB 2WWWA 2FFDB 5KLVK 1H88A 4K3AA 1JNMA 5AVQB 4KHXA 3L37A 3RGUA 3EWKA 1VQ4P 1NU1J 4H44C 1P84E 1URQB 4IFFA 3L72G 3CCMP 2HODB 1KTMA 1Q90D 3C1LA 2Y9ZA 1L0LG 1QX8A 5TJHA 1LT1A 1IZNB 2YXQB 3VMAA 3H1LD 1JOCA 5H2FE 1NTMD 4B86A 3A0BH 3BCCE 1KZUB 1PGJA 1ZW0A 1Q2NA 1KQGB 3P32A 5KLVD 2LXBA 1YITP 1FOSE 1G1JA 2GUVA 4WY4C 1SQQG 1S4XA 4XE5B 3GW6A 4RESB 1OXZA 4ASVA 1IJDB 4YXWH 2R44A 3FGAD 2WPVB 1S9KD 2HG5D 1CW5A 5AVXB 2BCCE 2KB7P 4JBZA 1JY2P 3CXHI 2I1KA 1HTLC 2ITAA 4L73A 1BE3G 2LR2A 4WY4A 3HTKB 3S4RA 2E75B 2ZT9D 1SQXE 4WB4A 1FZCC 3Q2YA 2E76D 1L0LJ 5BU8B 1SLQA 2WSEJ 3L75E 3OW2O 3M0AA 3WUUA 3CC7P 1N8RQ 3CCSP 4KJMA 4D6TE 4OGQD 3RK3C 4CPGA 3VMYA 1VQ5P 2ZXEB 3GHGC 4IL6X 2XKMA 2RH0A 1Y47A 2FXPA 3PP5A 1SQQJ 2QVAA 2OYIC 5AW8B 3BCCG 1FZCA 3MTUE 2FXOA 5KJ7A 2M8RA 1IFPA 2W8ZA 2I1JA 1S3JA 4BRYB 3H1HD 3BRTB 3CX5I 3MGNA 4JQ0D 1VQMP 1GD2E 1VQPP 1SQBK 3L70E 1KILD 4W7YA 3LW5H 2AEJA 5L8RJ 3GF7A 1MV8A 3I56P 1X0TA 3H1JD 3CCRP 1NTKG 3I55P 2H89C 2KI7B 3O6QA 3K5BA 3RK2D 1LTJB 3IFMA 2ZVOB 1NAYA 5KAFH 3A0BE 2V4HA 3AE2C 1SQXG 2QM7A 4XFJA 1T6AA 4H13D 2JEEA 4PV1B 2E43A 1VQOP 3MHVA 1BSNA 1FDOA 1GL2D 1S5LH 1H89A 1KYOD 4I6MC 5AVWB 1AQTA 4W80A 4D6TG 1R8EA 3NFQA 3AE5C 1U57A 1SQBD 3B8EB 3SFEC 4NPDA 2Y0EA 1NGMB 3P8CD 2Q7CA 2AXTH 4DZOA 4HJGH 1GU5A 1VQ7P 2OTKE 2NPSA 5AW0B 5APWA 2M3BA 1A02J 1J1DC 3CXHD 2O1JA 1K9MQ 1N7SA 1SFCB 4U7JA 3TGUE 1ZP0C 3GG2A 2WPQA 4BXLA 1GW4A 1ZLLA 5AW6B 2BCCJ 3V2NA 3TNUB 1ZRTD 4NPEA 1LT9C 2QJYC 1NOHA 3S9OA 3B5NB 3IAOA 3E7KA 2D2CC 1J1EB 2WSSH 2AXCA 2ZAEB 2E74B 2YMKA 3O8ZA 3L75J
chains in the Genus database with same CATH topology
2A06G 3CXHH 1BGYG 3L70G 1NTKG 1SQVG 1SQQG 1L0LG 1EZVG 1SQBG 3H1LG 3L74G 1PPJG 2FYUG 1L0NG 4D6TG 2IBZG 1KYOH 1NTMG 1PP9G 3H1IG 1NTZG 3BCCG 1BE3G 3L73G 1SQPG 3CWBG 1NU1G 1P84H 1SQXG 3H1HG 2BCCG 3L72G 3H1KG 4PD4H 3L71G 5KLVG 3CX5H 1KB9H 1BCCG 3H1JG 3TGUG 3L75G 4U3FG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  3CXH H;  1BGY G;  3L70 G;  1NTK G;  1SQV G;  1SQQ G;  1L0L G;  1EZV G;  1SQB G;  3H1L G;  3L74 G;  1PPJ G;  2FYU G;  1L0N G;  4D6T G;  2IBZ G;  1KYO H;  1NTM G;  1PP9 G;  3H1I G;  1NTZ G;  3BCC G;  1BE3 G;  3L73 G;  1SQP G;  3CWB G;  1NU1 G;  1P84 H;  1SQX G;  3H1H G;  2BCC G;  3L72 G;  3H1K G;  4PD4 H;  3L71 G;  5KLV G;  3CX5 H;  1KB9 H;  1BCC G;  3H1J G;  3TGU G;  3L75 G;  4U3F G; 
#chains in the Genus database with same CATH topology
 1UIX A;  2W90 A;  3JSV C;  3M9B A;  5KTB A;  2K3R A;  2Q5U A;  3G6E P;  3L74 E;  3RBX A;  1J2J B;  1ZR2 A;  3CX5 D;  4AUW A;  3MUD C;  4I1L A;  2KOG A;  2YKO A;  1G2C A;  1X22 A;  3WU2 H;  1T2K D;  1M7L A;  2O1K A;  4C7N B;  3OAK A;  5APU A;  2KYV A;  2G3A A;  5EFW B;  1NKZ B;  2QRX A;  2WSF J;  3G9R A;  4PD4 H;  5KLI B;  5KJ7 D;  4EOT A;  2AEM A;  5AW4 B;  3L70 J;  1RE4 C;  2QJP C;  1L0N G;  1N73 A;  1PP9 G;  1SQV K;  3TK1 A;  2IX7 C;  1DD4 A;  1FZF A;  5KAF E;  1PFI A;  1GW3 A;  1K04 A;  2O3J A;  2A06 G;  1BCC D;  1QL2 A;  5CBN A;  1S5L E;  1PZQ A;  1KQF B;  1PGQ A;  2KK7 A;  1M90 Q;  2IZ1 A;  4YPC A;  3OA7 A;  2FYU K;  1T8Z A;  4MN4 C;  2Y0D A;  3S1K A;  2AXT E;  3M9Q A;  2OYH C;  3IN6 A;  1HF9 A;  3H1K D;  3I5C A;  1M56 D;  3L74 G;  4WY4 B;  2XZR A;  3SWF A;  4QMA A;  3AEE C;  5AVS B;  1SQV D;  1YIJ P;  1LP1 A;  1PPJ E;  2CPS A;  3HE5 B;  1SVF A;  2N1T C;  2HYN A;  3M06 A;  1OVR A;  4DCK A;  3TGU J;  5CMZ A;  5BU5 A;  4U3F G;  2NPS D;  2B87 B;  3CCQ P;  2ZT9 C;  4L74 A;  3AE1 C;  4L75 A;  1JY3 P;  2P58 A;  2MKV A;  3H1I G;  2OTJ P;  2NZ2 A;  1MKM A;  2E76 C;  2FYU D;  1N7S D;  1EXI A;  1DEB A;  1GDT A;  2PP6 A;  3QH9 A;  1KOR A;  3HUS C;  4OGQ C;  2XDJ A;  5AW7 B;  2PRR A;  1FZC B;  3BAS A;  3F89 A;  3BVH A;  2IBZ I;  3RK3 B;  3VMZ A;  1T3J A;  3GHG B;  3R2P A;  3NTN A;  5APY A;  3Q5P A;  2Y9Y A;  2SPZ A;  1W5C E;  1RH5 B;  3H1L G;  3PHL A;  1NTM G;  2OYI B;  1JY2 N;  1FS0 E;  1N2D C;  1SQP J;  3ZDM A;  3CWB J;  3U1A A;  1Q82 Q;  3AEB C;  3FWN A;  3L71 J;  3L73 E;  4PD4 E;  5KLV G;  1KIL C;  5CCG D;  2FY8 A;  2IDB A;  3R4Y A;  4JPZ B;  2C0W A;  3LW5 J;  2K9Y A;  2K1A A;  1EDJ A;  3M9H A;  3ITK A;  5AVY B;  3M0D A;  1AV1 A;  2ZJS E;  1FAV A;  4ZNC A;  3KQG A;  2O01 H;  4H13 C;  2FYN C;  4OH8 B;  3VYI A;  2R32 A;  2M0B A;  1GL2 C;  3CME P;  1FZE A;  2OTL P;  1NTZ E;  1SQP D;  2N9Y B;  3CWB D;  3P7K A;  1BE3 E;  1SS1 A;  1IFI A;  3L71 D;  2W6A A;  2QM8 A;  1H0T A;  3AEG C;  2W6B A;  1NYH A;  2R3C A;  2KIK A;  2ZFC A;  1GL2 A;  1NU1 K;  4I7Z C;  3CCU P;  5BVZ A;  5AVZ B;  1OWA A;  1JY2 O;  1J1D B;  2CPB A;  2OQQ A;  4N3Y B;  1YTZ I;  5TIS E;  1EZV E;  3L73 G;  3H1H G;  3VOP A;  2IYP A;  1RQU A;  1M57 D;  5APS A;  3CC2 P;  1LT9 B;  2QJY B;  3GLM A;  1CSB A;  2RKL A;  2IBZ D;  4OWF A;  1UII A;  1OMI A;  1YHQ P;  4IOI H;  2D2C B;  1PIX A;  1LTS C;  1NU1 D;  1VPC A;  3H1J G;  2K88 A;  1HUC A;  1NHL A;  4GT1 A;  2M5A A;  2YIU C;  3TF5 A;  1FZA A;  3HE4 B;  1LTB C;  1NTZ G;  1NTK E;  3CC4 P;  2YO3 A;  3PJS K;  1T2K C;  2WIT A;  3KYQ A;  3L72 J;  1P84 I;  1YQ3 C;  1FOS F;  1JTH B;  2UWJ E;  1VF5 D;  1FJK A;  1A02 F;  5KJ7 C;  1SQB G;  5GTI E;  1L0L K;  1ZOY C;  4ASW A;  1FBM A;  1JMM A;  4N78 D;  1EXJ A;  3AE4 C;  2KNC A;  1X79 B;  1RE3 A;  3LIE A;  1USE A;  4WWI A;  2IFN A;  3H32 A;  1IK9 A;  4DJG A;  2PAJ A;  1EZV G;  1HGZ A;  1PGP A;  2P7J A;  1OZH A;  3HD7 A;  2QJP B;  3RK3 E;  1SQQ K;  4ZKP A;  1KFN A;  1HJ0 A;  1IO4 A;  1WRG A;  1QVF O;  1KB9 E;  1BCC E;  1L0L D;  1BE3 J;  1BGY E;  2JP3 A;  5APV A;  1EC5 A;  1QL1 A;  1VQ6 P;  2XU6 A;  2OYH B;  1USD A;  2C0X A;  3RBZ A;  2KLV A;  3TSI A;  1NAF A;  3FXE A;  2E74 D;  3CCE P;  1SQQ D;  1S2E A;  2R5D A;  2NPS C;  1LTA C;  1DH3 A;  1NWQ A;  1LWU A;  1N7S C;  2N1T B;  2WSC H;  2P10 A;  2ZT9 B;  3BCC J;  1CZQ A;  3KZI H;  2WT7 B;  2E76 B;  2GA1 A;  1FDI A;  3HUS B;  1KB9 I;  4OGQ B;  1LJ2 A;  1M1J A;  2Z4E A;  1MZ9 A;  2POH A;  1G1I A;  4ZKU A;  1P84 D;  1Y8A A;  1OVU A;  1L0N E;  2A45 G;  3MD0 A;  5CJ4 A;  1PP9 E;  2GM4 A;  1W2E A;  1MUU A;  2QJK C;  5AW9 B;  1HJB A;  1BCC G;  1JCC A;  3SSU A;  2KZI A;  5APQ A;  2FBW C;  1VQ9 P;  1BGY G;  1NTK J;  1YQ4 C;  5AW3 B;  5CCG C;  2KZJ A;  3V4Q A;  2A06 E;  4C7R A;  1OIP A;  1QEX A;  3BCC D;  4EDF A;  1KQS O;  1SQX J;  3A0H H;  3H1K G;  3HRN A;  2L5G B;  1URQ A;  2KS1 A;  1D7M A;  4OVN F;  2HOD A;  1KIL B;  3RL0 D;  2QE7 H;  1SQV G;  4K35 A;  4D6T J;  1TU3 F;  4GOE A;  1JUN A;  2K9J B;  2IYO A;  2V7Q J;  5M1B A;  5CCG A;  2ZYA A;  3CCL P;  1S5L X;  2JKV A;  2BCC D;  3C8V A;  1H0T B;  1N73 C;  4JYB A;  2QA4 P;  2RN0 A;  2FYU G;  2YO2 A;  4H13 B;  4U3F E;  2FYN B;  1RHZ B;  1GL2 B;  3H1I E;  3HD7 D;  5CBO A;  1SQX D;  2Q3E A;  2QSI A;  3Q5S A;  3NMD A;  1YJ9 P;  5AVT B;  3L75 D;  3AE6 C;  3Q3D A;  1LGH B;  3T97 A;  3L36 A;  1IK7 A;  2RMZ A;  2W83 C;  4H0L D;  4D6T D;  4YXD C;  3HTK A;  4H44 B;  1E5W A;  4I7Z B;  1VQN P;  4PJ0 H;  3IF4 A;  5B5E H;  1BDD A;  5AW5 B;  1HWT C;  4M3L A;  3KZI E;  4N6J A;  3H1L E;  1Q81 Q;  1NH4 A;  1KC8 Q;  1NTM E;  1IFD A;  1GMJ A;  4DOJ A;  2YXR B;  1ZXG A;  2YNY A;  2W6J H;  3KHU A;  2M5A B;  5KLV E;  1JMB A;  1KYO H;  1HBW A;  3L70 D;  3PH0 A;  1BDC A;  3G3Z A;  2QIW A;  2LKM A;  2ZXX A;  4EIJ A;  3U1C A;  1GK4 A;  2HLO A;  2O01 N;  4GKG A;  1S9K E;  4BRY A;  2Z5I A;  3CXH H;  2JWA A;  1L0N J;  4HKZ H;  1VF5 C;  1PP9 J;  2YIU B;  1U7M A;  3KXD A;  1VQK P;  4LC1 A;  3H32 B;  3AEF C;  1HVV A;  3II6 A;  1GK6 A;  4O9B A;  3W68 A;  2QEX P;  1OW6 A;  2WVR A;  1L4A D;  3AE9 C;  4EI2 A;  4HYT B;  3CCJ P;  4LGD E;  3ABV C;  2BEQ D;  3W67 A;  3TGU D;  1URQ D;  3L74 J;  2WZ7 A;  2B9B A;  3PLN A;  1U7J A;  2G8Y A;  3WU2 E;  4WVZ A;  1H8A A;  2Q9I A;  3M0D C;  1N7L A;  4RJT A;  1WT6 A;  2W27 A;  1SQP K;  1VQ8 P;  3CX5 H;  2P67 A;  2LXC B;  4U3F J;  1EDL A;  2M3E A;  3H1H E;  3VMX A;  3O6Q B;  1FC2 C;  2YMY A;  3H1I J;  2XND H;  3AEC C;  2E74 C;  1XTG B;  1NU1 G;  4HB1 A;  1CI6 A;  1KIL E;  1YJW P;  3D6Z A;  3RK2 C;  1KV4 A;  3G71 P;  3TNU A;  4PJ0 E;  3F5H A;  3H1J E;  3H6P A;  3B5N A;  5B5E E;  2H43 A;  3L74 D;  4Z1M H;  5APT A;  2IFM A;  2NPS B;  2WSC J;  3UIA A;  1X8Y A;  2A45 H;  2P1J A;  3D71 A;  1N7S B;  2BAS A;  4HH2 A;  2E75 D;  1KFM A;  3H1L J;  1NTM J;  1KYO E;  1VL2 A;  1Q86 Q;  4TLF A;  1GTW A;  2E42 A;  4C46 A;  1SQB E;  4JF7 A;  3P8C E;  1NJI Q;  2Q1K A;  3JCU H;  5KLV J;  2Y0C A;  3A7O A;  4PD4 I;  3EQ2 A;  2IPP A;  2WTY A;  2WSF H;  1R5L A;  3CXH E;  4UB8 H;  3IR9 A;  1QVG O;  4EYY Q;  1GU4 A;  2E5Y A;  3WUV A;  1Z56 A;  3SFD C;  3MIW A;  1K05 A;  4C7N A;  2KS1 B;  1LTG C;  3C9I A;  1K8A Q;  4ZMD A;  1DX7 A;  2QJK B;  2I8D A;  3TYY A;  3L4F A;  1ZRT E;  4IL6 H;  3H25 A;  1YBK A;  4I2L C;  3RL0 C;  4Y99 C;  5AW1 B;  3FX0 A;  5KKZ C;  3G4S P;  3VTP C;  1YJN P;  1G2C B;  5AW2 B;  2VRS A;  1KQL A;  1KYO I;  5E79 H;  1PPJ D;  1RE3 C;  1ZN5 A;  5KAI H;  2JDI H;  3CX5 E;  1QGK B;  3HD7 C;  3T97 B;  1FJP A;  3U59 A;  1N73 B;  2Z5H A;  3AED C;  1RF1 C;  1GZL A;  2N1T D;  2ZVN B;  2H7H A;  4PV1 D;  3L73 J;  1EZV I;  3H1H J;  4H0L C;  3HE5 A;  2CK3 H;  2KP8 A;  1DEE G;  5CCH D;  4L76 A;  2B87 A;  4GOD A;  1ZME C;  2OYO A;  2OGU A;  2ZYD A;  2HR3 A;  1RF1 A;  1SFC D;  2AEF A;  1QLE D;  1AA0 A;  3H1J J;  3L72 D;  1HGV A;  2JWD A;  2HFE D;  1AVY A;  1NTZ J;  1LP1 B;  2K37 A;  1XTC C;  3N7N A;  1LWU C;  1S72 P;  1NTZ K;  1LTI C;  3B5N D;  3L73 D;  4PD4 D;  2MJZ A;  5AVV B;  1EQ7 A;  3JCU E;  1NO4 A;  2JO1 A;  2Q3I A;  1OVV A;  3GHG A;  3H1K E;  1SQB J;  3A3Y B;  4UB8 E;  1EDK A;  1KN7 A;  3Q1M A;  1JO5 A;  5B66 H;  4IFD K;  1SQV E;  2OYI A;  3V2Q A;  1FZG A;  2HPC A;  1IFJ A;  1KD1 Q;  1ZV8 A;  3CCV P;  2BCC G;  3V4W A;  1JB0 J;  1M1J C;  2WPS A;  2E5T A;  2PFX A;  3USS A;  2R3S A;  4Y28 J;  4IL6 E;  3AE3 C;  5DJU B;  1VF5 B;  3E1I A;  3V2P A;  1NTZ D;  1Q7Y Q;  2FYU E;  1BE3 D;  1L4A C;  3B71 A;  3EFG A;  2BEZ F;  1AJY A;  2FFD C;  1YTZ T;  3CL3 D;  2A45 I;  3L75 G;  3P8M C;  1M1K Q;  1SP4 A;  1KMI Z;  3GMA A;  5E79 E;  1OW7 A;  2J58 A;  1URQ C;  1LTT C;  2IZ0 A;  2WQY C;  4RKU J;  3V6I A;  5KAI E;  3VP8 A;  1EDI A;  1BSH A;  1L4A A;  1L2P A;  1PV3 A;  2JR8 A;  2FFD A;  3KPE A;  4H44 D;  1EZV D;  1NTK K;  1CI6 B;  1OFC X;  1JY3 N;  2WPR A;  2FKW B;  2XNX A;  1SQX K;  1HH0 A;  1MFT A;  2Q6Q A;  3L70 G;  4YTP C;  5CJ0 A;  2H88 C;  3JC2 2;  1LNQ A;  1FZB A;  3GF3 A;  1R5S A;  3L35 A;  5AVR B;  4WY4 D;  5AVU B;  2O01 J;  3RK2 B;  1JCD A;  5CHX A;  4RO0 A;  2KSE A;  1LT9 A;  1NTK D;  1AQ5 A;  2E75 C;  2NRG A;  4WBA A;  3CPW O;  3MZW B;  4KT0 J;  1SQP E;  3CWB E;  1BCC J;  1RY3 A;  4GOF A;  3QWO C;  4TT3 H;  3L71 E;  1BGY J;  4XA4 A;  5GTH H;  4AQR D;  3HE4 A;  5B66 E;  3BRV B;  1OX3 A;  1IC2 A;  2WSE H;  4UB6 H;  3RL0 g;  3V5B A;  1RQV A;  3H1K J;  3TGU G;  1JTH A;  2N9B A;  1SQV J;  3MUD A;  3RK3 D;  1JY3 O;  1OW8 A;  4IFM A;  2P2U A;  1T3U A;  3PTZ A;  4R4L A;  2ZYG A;  4NPF X;  2YKP A;  1KB9 D;  2B89 A;  1S1C X;  2DW3 A;  1ZR4 A;  1VQL P;  3SWK A;  2FYU J;  3E1R A;  1BGY D;  2FXM A;  4R4M A;  1RF0 C;  2KUB A;  5DJT B;  3LID A;  1RE4 A;  2IBZ E;  3RL0 B;  3KDP B;  1DIP A;  4Y99 B;  5K5G B;  5KKZ B;  2JJL A;  1FDM A;  1NU1 E;  2B88 A;  1YI2 P;  3FXD A;  2KSJ A;  5C39 A;  2KXP B;  5APX A;  1LTJ C;  3CI9 A;  1K73 Q;  1L0N K;  2KNC B;  1SQP G;  3CWB G;  1IFN A;  1P84 H;  3AE8 C;  4PV1 C;  1RF0 A;  3A0H E;  3L71 G;  3A5T A;  2OYH A;  1Y9B A;  3HD7 B;  3B4S A;  1PL5 A;  4DT0 A;  4GIF A;  5TIS H;  1RF1 B;  5H2F H;  4LLH A;  5CCH C;  3FWL A;  2YKQ A;  2L91 A;  1LTJ A;  3VN0 A;  2QG4 A;  4N78 E;  1MFZ A;  4W7Z A;  4H0L B;  4AYC A;  3WUT A;  2N1T A;  1SFC C;  1AFO A;  3MP7 B;  2OAR A;  2C9N Y;  3VP9 A;  2XV5 A;  3BAT A;  3D70 A;  1L0N D;  1PP9 D;  3CLQ A;  3EFF K;  1VDF A;  2FYZ A;  2WT7 A;  1AVO A;  1NVO A;  3WMM 0;  1IFM A;  1N86 A;  3OJA B;  3V2R A;  5CCH A;  3D6Y A;  3B5N C;  3L72 E;  2J5U A;  3HUS A;  1PGO A;  1YYC A;  5GTH E;  2IBZ G;  2A06 D;  1E79 H;  1JEK A;  2HPC B;  3TDK A;  1SFC A;  1L0L E;  1J1E C;  1LWU B;  3M91 A;  4UB6 E;  3CMA P;  3Q5R A;  1DD3 A;  1X9V A;  2D2C D;  5GTI H;  4GDO A;  3CD6 P;  1PPJ G;  2GUS A;  1SQQ E;  3PRJ A;  3SWY A;  1NKN A;  3N4X A;  1FU1 A;  3A2A A;  3AE7 C;  1W2B O;  3NXS A;  2J59 M;  2V7Q H;  1M1J B;  4A7P A;  2H8P D;  4U3F D;  1KIL A;  2PGD A;  2R5B A;  4BWN A;  3H1I D;  1NTM K;  2WMM A;  5KLI C;  2C9L Y;  3AEA C;  1FE6 A;  1WMK A;  2K9J A;  4JYC A;  2KLU A;  1L4A B;  1JM0 A;  1KB9 H;  1M8O B;  2WWW A;  2FFD B;  5KLV K;  1H88 A;  4K3A A;  1JNM A;  5AVQ B;  4KHX A;  3L37 A;  3RGU A;  3EWK A;  1VQ4 P;  1NU1 J;  4H44 C;  1P84 E;  1URQ B;  4IFF A;  3L72 G;  3CCM P;  2HOD B;  1KTM A;  1Q90 D;  3C1L A;  2Y9Z A;  1L0L G;  1QX8 A;  5TJH A;  1LT1 A;  1IZN B;  2YXQ B;  3VMA A;  3H1L D;  1JOC A;  5H2F E;  1NTM D;  4B86 A;  3A0B H;  3BCC E;  1KZU B;  1PGJ A;  1ZW0 A;  1Q2N A;  1KQG B;  3P32 A;  5KLV D;  2LXB A;  1YIT P;  1FOS E;  1G1J A;  2GUV A;  4WY4 C;  1SQQ G;  1S4X A;  4XE5 B;  3GW6 A;  4RES B;  1OXZ A;  4ASV A;  1IJD B;  4YXW H;  2R44 A;  3FGA D;  2WPV B;  1S9K D;  2HG5 D;  1CW5 A;  5AVX B;  2BCC E;  2KB7 P;  4JBZ A;  1JY2 P;  3CXH I;  2I1K A;  1HTL C;  2ITA A;  4L73 A;  1BE3 G;  2LR2 A;  4WY4 A;  3HTK B;  3S4R A;  2E75 B;  2ZT9 D;  1SQX E;  4WB4 A;  1FZC C;  3Q2Y A;  2E76 D;  1L0L J;  5BU8 B;  1SLQ A;  2WSE J;  3L75 E;  3OW2 O;  3M0A A;  3WUU A;  3CC7 P;  1N8R Q;  3CCS P;  4KJM A;  4D6T E;  4OGQ D;  3RK3 C;  4CPG A;  3VMY A;  1VQ5 P;  2ZXE B;  3GHG C;  4IL6 X;  2XKM A;  2RH0 A;  1Y47 A;  2FXP A;  3PP5 A;  1SQQ J;  2QVA A;  2OYI C;  5AW8 B;  3BCC G;  1FZC A;  3MTU E;  2FXO A;  5KJ7 A;  2M8R A;  1IFP A;  2W8Z A;  2I1J A;  1S3J A;  4BRY B;  3H1H D;  3BRT B;  3CX5 I;  3MGN A;  4JQ0 D;  1VQM P;  1GD2 E;  1VQP P;  1SQB K;  3L70 E;  1KIL D;  4W7Y A;  3LW5 H;  2AEJ A;  5L8R J;  3GF7 A;  1MV8 A;  3I56 P;  1X0T A;  3H1J D;  3CCR P;  1NTK G;  3I55 P;  2H89 C;  2KI7 B;  3O6Q A;  3K5B A;  3RK2 D;  1LTJ B;  3IFM A;  2ZVO B;  1NAY A;  5KAF H;  3A0B E;  2V4H A;  3AE2 C;  1SQX G;  2QM7 A;  4XFJ A;  1T6A A;  4H13 D;  2JEE A;  4PV1 B;  2E43 A;  1VQO P;  3MHV A;  1BSN A;  1FDO A;  1GL2 D;  1S5L H;  1H89 A;  1KYO D;  4I6M C;  5AVW B;  1AQT A;  4W80 A;  4D6T G;  1R8E A;  3NFQ A;  3AE5 C;  1U57 A;  1SQB D;  3B8E B;  3SFE C;  4NPD A;  2Y0E A;  1NGM B;  3P8C D;  2Q7C A;  2AXT H;  4DZO A;  4HJG H;  1GU5 A;  1VQ7 P;  2OTK E;  2NPS A;  5AW0 B;  5APW A;  2M3B A;  1A02 J;  1J1D C;  3CXH D;  2O1J A;  1K9M Q;  1N7S A;  1SFC B;  4U7J A;  3TGU E;  1ZP0 C;  3GG2 A;  2WPQ A;  4BXL A;  1GW4 A;  1ZLL A;  5AW6 B;  2BCC J;  3V2N A;  3TNU B;  1ZRT D;  4NPE A;  1LT9 C;  2QJY C;  1NOH A;  3S9O A;  3B5N B;  3IAO A;  3E7K A;  2D2C C;  1J1E B;  2WSS H;  2AXC A;  2ZAE B;  2E74 B;  2YMK A;  3O8Z A;  3L75 J; 
#chains in the Genus database with same CATH homology
 2A06 G;  3CXH H;  1BGY G;  3L70 G;  1NTK G;  1SQV G;  1SQQ G;  1L0L G;  1EZV G;  1SQB G;  3H1L G;  3L74 G;  1PPJ G;  2FYU G;  1L0N G;  4D6T G;  2IBZ G;  1KYO H;  1NTM G;  1PP9 G;  3H1I G;  1NTZ G;  3BCC G;  1BE3 G;  3L73 G;  1SQP G;  3CWB G;  1NU1 G;  1P84 H;  1SQX G;  3H1H G;  2BCC G;  3L72 G;  3H1K G;  4PD4 H;  3L71 G;  5KLV G;  3CX5 H;  1KB9 H;  1BCC G;  3H1J G;  3TGU G;  3L75 G;  4U3F G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...