1SQBG

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqbG00
1L0LG 3H1KG 3CWBG 5KLVG 3TGUG 1KB9H 1NTMG 1NTKG 4U3FG 1NU1G 3H1IG 3L73G 1SQXG 3H1LG 1SQBG 1SQQG 3BCCG 1P84H 1BCCG 3CXHH 1BGYG 1SQPG 3L70G 1PPJG 1EZVG 4PD4H 1PP9G 4D6TG 2IBZG 1NTZG 2BCCG 2A06G 3H1HG 3L74G 2FYUG 1KYOH 3L75G 1L0NG 3L72G 3L71G 1SQVG 3CX5H 3H1JG 1BE3G
chains in the Genus database with same CATH superfamily
5APTA 3H25A 2KI7B 2BCCJ 3H1JD 2QE7H 3L71J 2IYPA 5E79H 2P10A 3H1JE 3KXDA 1PP9G 2G8YA 1SQPD 5KLIC 3TNUB 1LWUA 3CXHI 3A0HH 1YHQP 2B87A 2AEJA 4D6TJ 2QIWA 1SQPE 3ZDMA 1QGKB 1IFIA 1IO4A 4IL6E 5AVUB 3ITKA 5C39A 1SQQK 4OWFA 1SQXJ 1IK9A 2W6AA 4GODA 2QVAA 1OIPA 1VQ6P 2FYUK 3M0DA 1LTSC 1FZCC 3AE6C 1T6AA 1GD2E 3VP9A 1M8OB 3Q5PA 1SQBD 2YKQA 2IDBA 1LTBC 2WMMA 3B5NC 5CCHA 4CPGA 2QA4P 3VTPC 1SQBE 3NFQA 1AVYA 1TU3F 1H89A 5KJ7A 1NGMB 3CD6P 1NTKK 3G3ZA 1J2JB 3GF3A 3HRNA 2M3BA 5B66E 2XDJA 1BGYD 1GU5A 3CPWO 1N7SA 1AV1A 3L75D 3GHGC 1KFNA 4H0LC 2PP6A 1BGYE 1PP9J 2D2CC 3AEFC 4RKUJ 1EQ7A 1OW7A 4DCKA 3L75E 2V7QJ 5KLVJ 2UWJE 1KORA 2QG4A 3CCUP 1GL2C 2WPVB 1IFNA 1KB9D 3P7KA 2YKOA 3LW5H 2IFNA 3CCVP 1SFCC 1FZGA 1KB9E 3CCLP 4L73A 1JY2O 1FAVA 4C7NB 1L0LG 4Z1MH 2YMYA 1IFMA 1ZRTD 4HB1A 2Y0DA 1AVOA 4LGDE 1RE3A 1S5LH 1ZRTE 2E76D 1UIIA 3H6PA 5KKZC 4NPEA 1URQC 3L71D 5CMZA 3L70J 1G1JA 3TGUG 1DEEG 3WMM0 1LT9A 3SSUA 3L71E 4KJMA 2KK7A 2E76B 3L74G 5B5EE 4EOTA 3MIWA 1L0NK 3PHLA 3AEAC 3CX5D 1E5WA 5CCGC 1KC8Q 1HBWA 2E74C 1NU1G 4O9BA 2Z4EA 1LJ2A 1JY2P 3CX5E 4WY4C 2WPRA 1CW5A 2OQQA 3CI9A 2KZIA 1M90Q 2FYNC 3K5BA 3KDPB 5AW1B 3EFFK 2WPQA 4N6JA 3CWBG 1VQOP 5AW8B 3M9HA 4N78D 2XU6A 3BATA 3D6YA 1L0LJ 2MJZA 3BCCG 5KAIH 3MGNA 4N78E 3II6A 2CK3H 4JF7A 3O6QB 1SQVG 1HF9A 3M06A 2YKPA 2V7QH 2FKWB 3H1ID 2IFMA 1M1JA 2R3CA 3TGUJ 2WSFH 3A2AA 3FX0A 2AXTH 3H1IE 2AEFA 2QJKB 3TF5A 5APYA 3L74J 2Y9YA 1S3JA 3UIAA 5TJHA 2P2UA 3B8EB 5APSA 1KMIZ 1BDDA 1HGVA 2W6JH 2FFDB 1NU1J 1BDCA 4JBZA 4PD4H 3L73J 3PP5A 3H1LJ 1RF1B 4BXLA 1LT9B 1GZLA 3H1JG 1J1DB 2KS1B 4OH8B 3L72D 1K05A 3CX5I 3MHVA 1BSHA 1ZW0A 1FZCA 2C0XA 2POHA 3HD7D 3L72E 1Q81Q 3M9QA 2KNCA 4H44C 3I55P 1SQPG 3B5NA 1E79H 2NRGA 3JCUH 3VMYA 1EZVD 1S5LX 2A45I 1KN7A 1GK6A 4LC1A 1SQVJ 2J59M 4L74A 1EZVE 1BE3J 2HODB 2HPCA 2W83C 4UB8E 1LTAC 1OVRA 3MUDC 3HD7B 2E5YA 2WITA 1Q7YQ 2QM7A 2WSSH 4GT1A 2JWAA 1JMMA 4Y99C 3GHGA 1NWQA 4XA4A 1DIPA 3AE4C 1SQBG 1OW8A 1SQXK 4C7RA 1LP1A 5CJ0A 2GUVA 3BVHA 1VQ4P 2N1TC 3N7NA 1QVGO 3H1HD 2PGDA 1GL2A 3MP7B 4PJ0H 1PGPA 4HJGH 3H1HE 3SWYA 3M0AA 2E75C 4XE5B 2W90A 1SFCA 2WPSA 2WT7A 5BU8B 3L75G 5AVYB 3R2PA 1G2CB 3HUSB 3AE3C 3RK3D 1JY3O 2CPSA 1PFIA 1OVUA 1WMKA 3C1LA 4B86A 1W5CE 2R3SA 4ASVA 3RK3E 2OTLP 2R44A 4EIJA 2OYIB 2Q3EA 1AQTA 1URQA 2FY8A 1HVVA 1L4AC 2FYUD 1EZVI 3S9OA 1S1CX 5KLVK 3RK3B 2KB7P 2FYUE 2ZJSE 3O8ZA 3T97A 1P84I 3H32A 4QMAA 1A02J 1RF0C 1EXIA 5CCGA 2OYHB 4TLFA 1NTKD 2G3AA 3L73D 3BRVB 4WY4A 4WBAA 4DJGA 1BCCD 3L4FA 3C9IA 1JY3P 1NTKE 3L73E 1PL5A 2QJYB 5BU5A 3VOPA 4IFFA 3HE4A 1BCCE 2ZT9D 4OVNF 4L76A 3P8MC 3H1KJ 4ZNCA 1H0TA 1CZQA 3OW2O 3KZIE 2Y9ZA 3RL0g 4W7YA 3RK2C 4I7ZC 2B88A 3V6IA 5TISE 2ZT9B 1VQ8P 3A0BH 2OYOA 2L91A 3EWKA 2A45G 3GF7A 2MKVA 1FE6A 2IBZD 1Y47A 1NAYA 2WVRA 1NTMG 1JCCA 3G6EP 1K73Q 2IBZE 5GTHH 3W68A 3V5BA 4HKZH 1ZR2A 3A3YB 2W8ZA 4IL6H 4GOFA 1UIXA 2B9BA 1GW3A 1JTHB 1W2EA 1Z56A 1FS0E 4IFDK 3HTKB 3OA7A 2K9YA 1M56D 4R4MA 1NTZD 2H7HA 5E79E 1L0ND 4NPDA 1SS1A 3OJAB 1NTZE 3A0HE 1FJPA 1L0NE 2M5AA 3Q3DA 3MUDA 4ASWA 3JSVC 1XTCC 1MZ9A 2DW3A 2AEMA 1S9KD 1L2PA 2LKMA 2Y0EA 3TYYA 1YTZI 1T8ZA 1EXJA 1HTLC 4U3FD 5AVQB 2PAJA 1S9KE 1LTJC 3AE7C 2WSCH 2C9LY 1NTMJ 1KQGB 1EZVG 1DD3A 2N1TA 4U3FE 2Y0CA 2R5DA 2ZVOB 2Q7CA 1K9MQ 1KILC 1R8EA 3S1KA 5CBNA 1X22A 3CCQP 5AVRB 5APVA 1NJIQ 1Q2NA 1JCDA 3RL0D 1J1EB 2WSFJ 2YXQB 2RMZA 5APQA 1H88A 1LWUB 2KUBA 1IFJA 3NXSA 3V2PA 4LLHA 2B87B 4KT0J 2NPSC 1L4AA 4NPFX 5H2FH 3RL0B 5APWA 1T2KC 2ZXXA 1FZAA 5CCHD 1IFDA 1DH3A 1S4XA 1PPJG 5KJ7D 3E1IA 3NTNA 2E43A 2OARA 2BCCD 2AXCA 2A06D 3SWKA 1N7LA 1RF0A 2XV5A 2LR2A 3OAKA 1AA0A 4PV1C 2QSIA 3SFEC 1Y9BA 2BCCE 1N7SD 2Q5UA 4W80A 2A06E 2YNYA 3CCJP 1SQQG 2N9YB 2I8DA 1H8AA 3VYIA 5AVWB 1YJ9P 2FYUG 1KYOH 1NTZK 4D6TD 3AEDC 3N4XA 1S5LE 5AW7B 3MTUE 4D6TE 3GMAA 4UB6H 4BRYA 1N8RQ 1SQXD 1N7SB 3NMDA 1KQSO 2SPZA 3AE1C 4W7ZA 1RHZB 2K9JA 1N73A 4OGQD 1SQXE 2GUSA 1K8AQ 5AVXB 1NTKG 4IOIH 3AECC 1MUUA 1KB9I 1BCCG 1JO5A 3E1RA 1NKZB 3USSA 4M3LA 1NYHA 5AVSB 3V2QA 4TT3H 4OGQB 3LIEA 4GDOA 1QL1A 1LGHB 2ZXEB 3CMAP 3CCSP 3V2NA 2YXRB 1FDOA 1SQQJ 1PP9D 3WU2H 1MFZA 5KAIE 4H13D 1VQNP 1OMIA 2JO1A 5KLVD 3AE8C 3QWOC 1PP9E 2KLVA 2L5GB 4JQ0D 1OZHA 5KLVE 2K3RA 2RH0A 1DX7A 2ITAA 2FXMA 2AXTE 4AQRD 4H13B 2K1AA 1FZEA 4JYCA 4XFJA 1USDA 3CWBJ 3LIDA 5APUA 2YIUB 1GTWA 1LWUC 4PD4D 3BCCJ 5DJTB 5M1BA 4PD4E 1AFOA 1LTJA 1P84H 3E7KA 3L35A 2N9BA 3L36A 3L70D 1JM0A 2LXBA 1L0NG 3F89A 2YMKA 4WWIA 1KILA 3L70E 3CC4P 1GMJA 3JCUE 5KTBA 5KAFH 3VMZA 1M57D 2LXCB 2JR8A 2YO3A 2XKMA 1QLED 1CI6A 3G4SP 1M1JB 2E76C 1HJBA 1Q82Q 1KD1Q 2Q1KA 1DD4A 5KLIB 3H1JJ 1BGYG 2O01N 1X8YA 1WT6A 2NPSA 2KSEA 5GTIH 1MKMA 3AE2C 1SQPJ 1KV4A 3VMXA 3M91A 1L0LD 3AEBC 1ZOYC 2ZYDA 1LTIC 3B5ND 1FC2C 5CHXA 1JEKA 2HR3A 2K88A 1L0LE 2NZ2A 4PJ0E 1FZCB 4PD4I 3VP8A 3B4SA 2KNCB 2HLOA 3TGUD 2FXOA 4OGQC 2YO2A 1IFPA 1FOSE 1YQ3C 3B5NB 1PGQA 3CXHH 2RN0A 2M0BA 4H0LD 1QX8A 2D2CD 2KP8A 3TGUE 3CCEP 1SQBJ 2H88C 2Q3IA 1JY2N 3L74D 1VQMP 2XNXA 1NOHA 3TNUA 2VRSA 2HPCB 2IZ1A 3KHUA 2P1JA 2QJKC 1VF5D 1VL2A 3GW6A 1NU1D 3L74E 1KQLA 1RE3C 5AW6B 3H1LD 1GL2D 1VQ5P 3GHGB 4H0LB 1FJKA 1NU1E 3L71G 2D2CB 1OVVA 3RBZA 2FFDC 1BGYJ 3H1LE 2WSCJ 1SFCD 1LP1B 1RF1C 1U7MA 1LT9C 3L75J 1J1DC 1QL2A 1VF5B 1U57A 4H13C 1GL2B 2C9NY 4IFMA 3AE9C 2P58A 1SQVD 3P8CD 1BE3D 1LTGC 1PGJA 3C8VA 1SQXG 1SFCB 2WT7B 1ZXGA 2O01J 1URQD 1SQVE 1LTTC 3CL3D 4YPCA 3P8CE 1BE3E 1GU4A 3WUVA 2JDIH 4JPZB 1FOSF 2CPBA 3HD7C 2WQYC 4YTPC 5AW4B 1JNMA 1NHLA 5KKZB 3L37A 1URQB 5CCGD 2E74D 1KFMA 3V4QA 4WY4D 1L0LK 1JB0J 3A0BE 3H1IG 2M8RA 1ZR4A 3T97B 1YQ4C 1M1JC 1X0TA 1K04A 5AVVB 4R4LA 3H32B 2IYOA 2J5UA 4I2LC 2OTKE 4DOJA 2E74B 3PRJA 5GTHE 4HYTB 1MV8A 5KLVG 4RO0A 4WY4B 3CC7P 4GKGA 2XNDH 1OXZA 5AVZB 3HUSC 4C7NA 2WZ7A 2FYNB 1HH0A 1WRGA 3HE4B 3D71A 3L72G 2JJLA 3I5CA 5K5GB 2HYNA 1Q90D 2OYIC 1OWAA 4N3YB 5B66H 2HG5D 1H0TB 4U7JA 1NU1K 3TSIA 1ZN5A 4ZMDA 3AEGC 5CBOA 3RK3C 2FXPA 3BASA 3RBXA 3TK1A 1LNQA 1QEXA 5APXA 1BSNA 1NVOA 1VQLP 2IBZI 2H43A 1HJ0A 2C0WA 3MZWB 3RGUA 3PJSK 1VQKP 1OFCX 3L70G 3CCMP 2PRRA 3H1IJ 1YYCA 1CSBA 2OYHC 2WSEH 1DEBA 1SQVK 4H44D 1QVFO 2O01H 1KQFB 1KB9H 3WUUA 3H1KD 2O1JA 2J58A 3A7OA 2QJYC 1XTGB 1NH4A 2E42A 3H1KE 2Z5IA 3GLMA 1VF5C 3H1HG 4AYCA 1LT1A 3FWLA 2JKVA 3O6QA 4H44B 1T3UA 1S2EA 3L72J 1AJYA 3CMEP 3Q5SA 1D7MA 2QJPB 1NAFA 3M9BA 3FXDA 2ZT9C 3JC22 1VQ9P 2R5BA 1N86A 1GK4A 2M5AB 1JY3N 1YITP 2N1TD 5B5EH 2ZFCA 1MFTA 4IL6X 1N2DC 1PV3A 2IZ0A 5H2FE 1A02F 1SQPK 4Y99B 4EYYQ 3G9RA 3Q5RA 2ZAEB 3CX5H 2FFDA 2O3JA 2E75D 1KTMA 5L8RJ 3IR9A 1RF1A 1FBMA 2KS1A 3P32A 4HH2A 1PZQA 2IPPA 2OTJP 3PTZA 2N1TB 2BEZF 3G71P 5DJUB 3AEEC 1M1KQ 3PH0A 2A45H 1KYOD 3IFMA 2KSJA 2E75B 2V4HA 3H1HJ 1ZMEC 3IN6A 3L73G 3H1LG 1KYOE 1SQBK 1L4AD 1RY3A 3KPEA 1NKNA 1USEA 3ABVC 1RQUA 2RKLA 3BRTB 1YBKA 2P67A 2HODA 2I1KA 4I1LA 2WWWA 3HD7A 1Q86Q 5AW0B 3A5TA 4UB6E 2W27A 1RQVA 5AW3B 1NTMD 4EDFA 3U1CA 2O1KA 3QH9A 1OW6A 1RE4C 1L4AB 5AW2B 1NTME 4GOEA 1YJNP 1U7JA 1BE3G 2W6BA 2KZJA 1EDLA 1VQ7P 2B89A 2P7JA 2FYUJ 1W2BO 2KIKA 1JMBA 1GDTA 1ZLLA 1JOCA 2IBZG 1YTZT 4Y28J 2QEXP 4WVZA 1G2CA 3HUSA 4C46A 1G1IA 1J1EC 3RK2D 3IAOA 1FZFA 1GW4A 1VPCA 3WU2E 3SWFA 2QRXA 1NTKJ 2E5TA 1PGOA 3W67A 2JP3A 5AW9B 4RESB 4WB4A 1BCCJ 2FBWC 1X79B 4UB8H 2OYIA 3TDKA 2H8PD 3GG2A 2ZYAA 4BRYB 1EC5A 1KYOI 2ZVNB 1KZUB 4I6MC 3FXEA 3B71A 2GA1A 3RL0C 2K9JB 1N73B 1YIJP 3RK2B 3V2RA 4I7ZB 1NTZG 2HFED 4A7PA 3IF4A 2QJPC 2IX7C 1YI2P 3M0DC 3Q2YA 3FWNA 2I1JA 1JUNA 1YJWP 2KXPB 2PFXA 2GM4A 2OYHA 1P84D 4GIFA 5AW5B 5CCHC 1S72P 1SLQA 2KYVA 1RH5B 2XZRA 1P84E 3HE5A 1ZP0C 3CLQA 4U3FG 5KJ7C 3I56P 2BASA 5BVZA 4AUWA 1FZBA 1FU1A 1T3JA 1SVFA 1R5SA 4JYBA 1EDJA 3CCRP 1N7SC 3SFDC 4YXWH 1VQPP 2Q6QA 5KAFE 1NTMK 5EFWB 1SP4A 2R32A 3VN0A 5AVTB 1PPJD 3R4YA 1HWTC 2OGUA 3KQGA 2M3EA 3H1KG 1ZV8A 2H89C 1NTZJ 2QM8A 1PPJE 1L0NJ 5GTIE 3U1AA 4EI2A 1EDKA 1SQQD 4ZKUA 1KILD 2KLUA 3U59A 2Q9IA 3V4WA 1SQQE 1LTJB 1KILE 1R5LA 2WTYA 4L75A 4RJTA 1EDIA 1FDIA 2ZYGA 4ZKPA 1IZNB 1VDFA 1JTHA 1OX3A 1FDMA 3Q1MA 4YXDC 4U3FJ 2BEQD 3CXHD 4MN4C 2BCCG 1IJDB 2A06G 3D6ZA 1KILB 3HTKA 3WUTA 3CC2P 3KZIH 3CXHE 1IC2A 3KYQA 3CWBD 2NPSD 4K3AA 1Y8AA 3EFGA 1CI6B 3BCCD 3CWBE 1T2KD 4D6TG 3HE5B 3MD0A 2JWDA 3VMAA 5TISH 1HUCA 2YIUC 1X9VA 4KHXA 3BCCE 2WSEJ 2K37A 3FGAD 1PIXA 3F5HA 4BWNA 2NPSB 4K35A 1HGZA 1RE4A 1N73C 4PV1D 3S4RA 1AQ5A 5CJ4A 3AE5C 1NO4A 3D70A 2Z5HA 1M7LA 2KOGA 2FYZA 3EQ2A 1IK7A 4DZOA 3LW5J 2JEEA 3PLNA 4PV1B 4DT0A
chains in the Genus database with same CATH topology
1L0LG 3H1KG 3CWBG 5KLVG 3TGUG 1KB9H 1NTMG 1NTKG 4U3FG 1NU1G 3H1IG 3L73G 1SQXG 3H1LG 1SQBG 1SQQG 3BCCG 1P84H 1BCCG 3CXHH 1BGYG 1SQPG 3L70G 1PPJG 1EZVG 4PD4H 1PP9G 4D6TG 2IBZG 1NTZG 2BCCG 2A06G 3H1HG 3L74G 2FYUG 1KYOH 3L75G 1L0NG 3L72G 3L71G 1SQVG 3CX5H 3H1JG 1BE3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L G;  3H1K G;  3CWB G;  5KLV G;  3TGU G;  1KB9 H;  1NTM G;  1NTK G;  4U3F G;  1NU1 G;  3H1I G;  3L73 G;  1SQX G;  3H1L G;  1SQB G;  1SQQ G;  3BCC G;  1P84 H;  1BCC G;  3CXH H;  1BGY G;  1SQP G;  3L70 G;  1PPJ G;  1EZV G;  4PD4 H;  1PP9 G;  4D6T G;  2IBZ G;  1NTZ G;  2BCC G;  2A06 G;  3H1H G;  3L74 G;  2FYU G;  1KYO H;  3L75 G;  1L0N G;  3L72 G;  3L71 G;  1SQV G;  3CX5 H;  3H1J G;  1BE3 G; 
#chains in the Genus database with same CATH topology
 5APT A;  3H25 A;  2KI7 B;  2BCC J;  3H1J D;  2QE7 H;  3L71 J;  2IYP A;  5E79 H;  2P10 A;  3H1J E;  3KXD A;  1PP9 G;  2G8Y A;  1SQP D;  5KLI C;  3TNU B;  1LWU A;  3CXH I;  3A0H H;  1YHQ P;  2B87 A;  2AEJ A;  4D6T J;  2QIW A;  1SQP E;  3ZDM A;  1QGK B;  1IFI A;  1IO4 A;  4IL6 E;  5AVU B;  3ITK A;  5C39 A;  1SQQ K;  4OWF A;  1SQX J;  1IK9 A;  2W6A A;  4GOD A;  2QVA A;  1OIP A;  1VQ6 P;  2FYU K;  3M0D A;  1LTS C;  1FZC C;  3AE6 C;  1T6A A;  1GD2 E;  3VP9 A;  1M8O B;  3Q5P A;  1SQB D;  2YKQ A;  2IDB A;  1LTB C;  2WMM A;  3B5N C;  5CCH A;  4CPG A;  2QA4 P;  3VTP C;  1SQB E;  3NFQ A;  1AVY A;  1TU3 F;  1H89 A;  5KJ7 A;  1NGM B;  3CD6 P;  1NTK K;  3G3Z A;  1J2J B;  3GF3 A;  3HRN A;  2M3B A;  5B66 E;  2XDJ A;  1BGY D;  1GU5 A;  3CPW O;  1N7S A;  1AV1 A;  3L75 D;  3GHG C;  1KFN A;  4H0L C;  2PP6 A;  1BGY E;  1PP9 J;  2D2C C;  3AEF C;  4RKU J;  1EQ7 A;  1OW7 A;  4DCK A;  3L75 E;  2V7Q J;  5KLV J;  2UWJ E;  1KOR A;  2QG4 A;  3CCU P;  1GL2 C;  2WPV B;  1IFN A;  1KB9 D;  3P7K A;  2YKO A;  3LW5 H;  2IFN A;  3CCV P;  1SFC C;  1FZG A;  1KB9 E;  3CCL P;  4L73 A;  1JY2 O;  1FAV A;  4C7N B;  1L0L G;  4Z1M H;  2YMY A;  1IFM A;  1ZRT D;  4HB1 A;  2Y0D A;  1AVO A;  4LGD E;  1RE3 A;  1S5L H;  1ZRT E;  2E76 D;  1UII A;  3H6P A;  5KKZ C;  4NPE A;  1URQ C;  3L71 D;  5CMZ A;  3L70 J;  1G1J A;  3TGU G;  1DEE G;  3WMM 0;  1LT9 A;  3SSU A;  3L71 E;  4KJM A;  2KK7 A;  2E76 B;  3L74 G;  5B5E E;  4EOT A;  3MIW A;  1L0N K;  3PHL A;  3AEA C;  3CX5 D;  1E5W A;  5CCG C;  1KC8 Q;  1HBW A;  2E74 C;  1NU1 G;  4O9B A;  2Z4E A;  1LJ2 A;  1JY2 P;  3CX5 E;  4WY4 C;  2WPR A;  1CW5 A;  2OQQ A;  3CI9 A;  2KZI A;  1M90 Q;  2FYN C;  3K5B A;  3KDP B;  5AW1 B;  3EFF K;  2WPQ A;  4N6J A;  3CWB G;  1VQO P;  5AW8 B;  3M9H A;  4N78 D;  2XU6 A;  3BAT A;  3D6Y A;  1L0L J;  2MJZ A;  3BCC G;  5KAI H;  3MGN A;  4N78 E;  3II6 A;  2CK3 H;  4JF7 A;  3O6Q B;  1SQV G;  1HF9 A;  3M06 A;  2YKP A;  2V7Q H;  2FKW B;  3H1I D;  2IFM A;  1M1J A;  2R3C A;  3TGU J;  2WSF H;  3A2A A;  3FX0 A;  2AXT H;  3H1I E;  2AEF A;  2QJK B;  3TF5 A;  5APY A;  3L74 J;  2Y9Y A;  1S3J A;  3UIA A;  5TJH A;  2P2U A;  3B8E B;  5APS A;  1KMI Z;  1BDD A;  1HGV A;  2W6J H;  2FFD B;  1NU1 J;  1BDC A;  4JBZ A;  4PD4 H;  3L73 J;  3PP5 A;  3H1L J;  1RF1 B;  4BXL A;  1LT9 B;  1GZL A;  3H1J G;  1J1D B;  2KS1 B;  4OH8 B;  3L72 D;  1K05 A;  3CX5 I;  3MHV A;  1BSH A;  1ZW0 A;  1FZC A;  2C0X A;  2POH A;  3HD7 D;  3L72 E;  1Q81 Q;  3M9Q A;  2KNC A;  4H44 C;  3I55 P;  1SQP G;  3B5N A;  1E79 H;  2NRG A;  3JCU H;  3VMY A;  1EZV D;  1S5L X;  2A45 I;  1KN7 A;  1GK6 A;  4LC1 A;  1SQV J;  2J59 M;  4L74 A;  1EZV E;  1BE3 J;  2HOD B;  2HPC A;  2W83 C;  4UB8 E;  1LTA C;  1OVR A;  3MUD C;  3HD7 B;  2E5Y A;  2WIT A;  1Q7Y Q;  2QM7 A;  2WSS H;  4GT1 A;  2JWA A;  1JMM A;  4Y99 C;  3GHG A;  1NWQ A;  4XA4 A;  1DIP A;  3AE4 C;  1SQB G;  1OW8 A;  1SQX K;  4C7R A;  1LP1 A;  5CJ0 A;  2GUV A;  3BVH A;  1VQ4 P;  2N1T C;  3N7N A;  1QVG O;  3H1H D;  2PGD A;  1GL2 A;  3MP7 B;  4PJ0 H;  1PGP A;  4HJG H;  3H1H E;  3SWY A;  3M0A A;  2E75 C;  4XE5 B;  2W90 A;  1SFC A;  2WPS A;  2WT7 A;  5BU8 B;  3L75 G;  5AVY B;  3R2P A;  1G2C B;  3HUS B;  3AE3 C;  3RK3 D;  1JY3 O;  2CPS A;  1PFI A;  1OVU A;  1WMK A;  3C1L A;  4B86 A;  1W5C E;  2R3S A;  4ASV A;  3RK3 E;  2OTL P;  2R44 A;  4EIJ A;  2OYI B;  2Q3E A;  1AQT A;  1URQ A;  2FY8 A;  1HVV A;  1L4A C;  2FYU D;  1EZV I;  3S9O A;  1S1C X;  5KLV K;  3RK3 B;  2KB7 P;  2FYU E;  2ZJS E;  3O8Z A;  3T97 A;  1P84 I;  3H32 A;  4QMA A;  1A02 J;  1RF0 C;  1EXI A;  5CCG A;  2OYH B;  4TLF A;  1NTK D;  2G3A A;  3L73 D;  3BRV B;  4WY4 A;  4WBA A;  4DJG A;  1BCC D;  3L4F A;  3C9I A;  1JY3 P;  1NTK E;  3L73 E;  1PL5 A;  2QJY B;  5BU5 A;  3VOP A;  4IFF A;  3HE4 A;  1BCC E;  2ZT9 D;  4OVN F;  4L76 A;  3P8M C;  3H1K J;  4ZNC A;  1H0T A;  1CZQ A;  3OW2 O;  3KZI E;  2Y9Z A;  3RL0 g;  4W7Y A;  3RK2 C;  4I7Z C;  2B88 A;  3V6I A;  5TIS E;  2ZT9 B;  1VQ8 P;  3A0B H;  2OYO A;  2L91 A;  3EWK A;  2A45 G;  3GF7 A;  2MKV A;  1FE6 A;  2IBZ D;  1Y47 A;  1NAY A;  2WVR A;  1NTM G;  1JCC A;  3G6E P;  1K73 Q;  2IBZ E;  5GTH H;  3W68 A;  3V5B A;  4HKZ H;  1ZR2 A;  3A3Y B;  2W8Z A;  4IL6 H;  4GOF A;  1UIX A;  2B9B A;  1GW3 A;  1JTH B;  1W2E A;  1Z56 A;  1FS0 E;  4IFD K;  3HTK B;  3OA7 A;  2K9Y A;  1M56 D;  4R4M A;  1NTZ D;  2H7H A;  5E79 E;  1L0N D;  4NPD A;  1SS1 A;  3OJA B;  1NTZ E;  3A0H E;  1FJP A;  1L0N E;  2M5A A;  3Q3D A;  3MUD A;  4ASW A;  3JSV C;  1XTC C;  1MZ9 A;  2DW3 A;  2AEM A;  1S9K D;  1L2P A;  2LKM A;  2Y0E A;  3TYY A;  1YTZ I;  1T8Z A;  1EXJ A;  1HTL C;  4U3F D;  5AVQ B;  2PAJ A;  1S9K E;  1LTJ C;  3AE7 C;  2WSC H;  2C9L Y;  1NTM J;  1KQG B;  1EZV G;  1DD3 A;  2N1T A;  4U3F E;  2Y0C A;  2R5D A;  2ZVO B;  2Q7C A;  1K9M Q;  1KIL C;  1R8E A;  3S1K A;  5CBN A;  1X22 A;  3CCQ P;  5AVR B;  5APV A;  1NJI Q;  1Q2N A;  1JCD A;  3RL0 D;  1J1E B;  2WSF J;  2YXQ B;  2RMZ A;  5APQ A;  1H88 A;  1LWU B;  2KUB A;  1IFJ A;  3NXS A;  3V2P A;  4LLH A;  2B87 B;  4KT0 J;  2NPS C;  1L4A A;  4NPF X;  5H2F H;  3RL0 B;  5APW A;  1T2K C;  2ZXX A;  1FZA A;  5CCH D;  1IFD A;  1DH3 A;  1S4X A;  1PPJ G;  5KJ7 D;  3E1I A;  3NTN A;  2E43 A;  2OAR A;  2BCC D;  2AXC A;  2A06 D;  3SWK A;  1N7L A;  1RF0 A;  2XV5 A;  2LR2 A;  3OAK A;  1AA0 A;  4PV1 C;  2QSI A;  3SFE C;  1Y9B A;  2BCC E;  1N7S D;  2Q5U A;  4W80 A;  2A06 E;  2YNY A;  3CCJ P;  1SQQ G;  2N9Y B;  2I8D A;  1H8A A;  3VYI A;  5AVW B;  1YJ9 P;  2FYU G;  1KYO H;  1NTZ K;  4D6T D;  3AED C;  3N4X A;  1S5L E;  5AW7 B;  3MTU E;  4D6T E;  3GMA A;  4UB6 H;  4BRY A;  1N8R Q;  1SQX D;  1N7S B;  3NMD A;  1KQS O;  2SPZ A;  3AE1 C;  4W7Z A;  1RHZ B;  2K9J A;  1N73 A;  4OGQ D;  1SQX E;  2GUS A;  1K8A Q;  5AVX B;  1NTK G;  4IOI H;  3AEC C;  1MUU A;  1KB9 I;  1BCC G;  1JO5 A;  3E1R A;  1NKZ B;  3USS A;  4M3L A;  1NYH A;  5AVS B;  3V2Q A;  4TT3 H;  4OGQ B;  3LIE A;  4GDO A;  1QL1 A;  1LGH B;  2ZXE B;  3CMA P;  3CCS P;  3V2N A;  2YXR B;  1FDO A;  1SQQ J;  1PP9 D;  3WU2 H;  1MFZ A;  5KAI E;  4H13 D;  1VQN P;  1OMI A;  2JO1 A;  5KLV D;  3AE8 C;  3QWO C;  1PP9 E;  2KLV A;  2L5G B;  4JQ0 D;  1OZH A;  5KLV E;  2K3R A;  2RH0 A;  1DX7 A;  2ITA A;  2FXM A;  2AXT E;  4AQR D;  4H13 B;  2K1A A;  1FZE A;  4JYC A;  4XFJ A;  1USD A;  3CWB J;  3LID A;  5APU A;  2YIU B;  1GTW A;  1LWU C;  4PD4 D;  3BCC J;  5DJT B;  5M1B A;  4PD4 E;  1AFO A;  1LTJ A;  1P84 H;  3E7K A;  3L35 A;  2N9B A;  3L36 A;  3L70 D;  1JM0 A;  2LXB A;  1L0N G;  3F89 A;  2YMK A;  4WWI A;  1KIL A;  3L70 E;  3CC4 P;  1GMJ A;  3JCU E;  5KTB A;  5KAF H;  3VMZ A;  1M57 D;  2LXC B;  2JR8 A;  2YO3 A;  2XKM A;  1QLE D;  1CI6 A;  3G4S P;  1M1J B;  2E76 C;  1HJB A;  1Q82 Q;  1KD1 Q;  2Q1K A;  1DD4 A;  5KLI B;  3H1J J;  1BGY G;  2O01 N;  1X8Y A;  1WT6 A;  2NPS A;  2KSE A;  5GTI H;  1MKM A;  3AE2 C;  1SQP J;  1KV4 A;  3VMX A;  3M91 A;  1L0L D;  3AEB C;  1ZOY C;  2ZYD A;  1LTI C;  3B5N D;  1FC2 C;  5CHX A;  1JEK A;  2HR3 A;  2K88 A;  1L0L E;  2NZ2 A;  4PJ0 E;  1FZC B;  4PD4 I;  3VP8 A;  3B4S A;  2KNC B;  2HLO A;  3TGU D;  2FXO A;  4OGQ C;  2YO2 A;  1IFP A;  1FOS E;  1YQ3 C;  3B5N B;  1PGQ A;  3CXH H;  2RN0 A;  2M0B A;  4H0L D;  1QX8 A;  2D2C D;  2KP8 A;  3TGU E;  3CCE P;  1SQB J;  2H88 C;  2Q3I A;  1JY2 N;  3L74 D;  1VQM P;  2XNX A;  1NOH A;  3TNU A;  2VRS A;  2HPC B;  2IZ1 A;  3KHU A;  2P1J A;  2QJK C;  1VF5 D;  1VL2 A;  3GW6 A;  1NU1 D;  3L74 E;  1KQL A;  1RE3 C;  5AW6 B;  3H1L D;  1GL2 D;  1VQ5 P;  3GHG B;  4H0L B;  1FJK A;  1NU1 E;  3L71 G;  2D2C B;  1OVV A;  3RBZ A;  2FFD C;  1BGY J;  3H1L E;  2WSC J;  1SFC D;  1LP1 B;  1RF1 C;  1U7M A;  1LT9 C;  3L75 J;  1J1D C;  1QL2 A;  1VF5 B;  1U57 A;  4H13 C;  1GL2 B;  2C9N Y;  4IFM A;  3AE9 C;  2P58 A;  1SQV D;  3P8C D;  1BE3 D;  1LTG C;  1PGJ A;  3C8V A;  1SQX G;  1SFC B;  2WT7 B;  1ZXG A;  2O01 J;  1URQ D;  1SQV E;  1LTT C;  3CL3 D;  4YPC A;  3P8C E;  1BE3 E;  1GU4 A;  3WUV A;  2JDI H;  4JPZ B;  1FOS F;  2CPB A;  3HD7 C;  2WQY C;  4YTP C;  5AW4 B;  1JNM A;  1NHL A;  5KKZ B;  3L37 A;  1URQ B;  5CCG D;  2E74 D;  1KFM A;  3V4Q A;  4WY4 D;  1L0L K;  1JB0 J;  3A0B E;  3H1I G;  2M8R A;  1ZR4 A;  3T97 B;  1YQ4 C;  1M1J C;  1X0T A;  1K04 A;  5AVV B;  4R4L A;  3H32 B;  2IYO A;  2J5U A;  4I2L C;  2OTK E;  4DOJ A;  2E74 B;  3PRJ A;  5GTH E;  4HYT B;  1MV8 A;  5KLV G;  4RO0 A;  4WY4 B;  3CC7 P;  4GKG A;  2XND H;  1OXZ A;  5AVZ B;  3HUS C;  4C7N A;  2WZ7 A;  2FYN B;  1HH0 A;  1WRG A;  3HE4 B;  3D71 A;  3L72 G;  2JJL A;  3I5C A;  5K5G B;  2HYN A;  1Q90 D;  2OYI C;  1OWA A;  4N3Y B;  5B66 H;  2HG5 D;  1H0T B;  4U7J A;  1NU1 K;  3TSI A;  1ZN5 A;  4ZMD A;  3AEG C;  5CBO A;  3RK3 C;  2FXP A;  3BAS A;  3RBX A;  3TK1 A;  1LNQ A;  1QEX A;  5APX A;  1BSN A;  1NVO A;  1VQL P;  2IBZ I;  2H43 A;  1HJ0 A;  2C0W A;  3MZW B;  3RGU A;  3PJS K;  1VQK P;  1OFC X;  3L70 G;  3CCM P;  2PRR A;  3H1I J;  1YYC A;  1CSB A;  2OYH C;  2WSE H;  1DEB A;  1SQV K;  4H44 D;  1QVF O;  2O01 H;  1KQF B;  1KB9 H;  3WUU A;  3H1K D;  2O1J A;  2J58 A;  3A7O A;  2QJY C;  1XTG B;  1NH4 A;  2E42 A;  3H1K E;  2Z5I A;  3GLM A;  1VF5 C;  3H1H G;  4AYC A;  1LT1 A;  3FWL A;  2JKV A;  3O6Q A;  4H44 B;  1T3U A;  1S2E A;  3L72 J;  1AJY A;  3CME P;  3Q5S A;  1D7M A;  2QJP B;  1NAF A;  3M9B A;  3FXD A;  2ZT9 C;  3JC2 2;  1VQ9 P;  2R5B A;  1N86 A;  1GK4 A;  2M5A B;  1JY3 N;  1YIT P;  2N1T D;  5B5E H;  2ZFC A;  1MFT A;  4IL6 X;  1N2D C;  1PV3 A;  2IZ0 A;  5H2F E;  1A02 F;  1SQP K;  4Y99 B;  4EYY Q;  3G9R A;  3Q5R A;  2ZAE B;  3CX5 H;  2FFD A;  2O3J A;  2E75 D;  1KTM A;  5L8R J;  3IR9 A;  1RF1 A;  1FBM A;  2KS1 A;  3P32 A;  4HH2 A;  1PZQ A;  2IPP A;  2OTJ P;  3PTZ A;  2N1T B;  2BEZ F;  3G71 P;  5DJU B;  3AEE C;  1M1K Q;  3PH0 A;  2A45 H;  1KYO D;  3IFM A;  2KSJ A;  2E75 B;  2V4H A;  3H1H J;  1ZME C;  3IN6 A;  3L73 G;  3H1L G;  1KYO E;  1SQB K;  1L4A D;  1RY3 A;  3KPE A;  1NKN A;  1USE A;  3ABV C;  1RQU A;  2RKL A;  3BRT B;  1YBK A;  2P67 A;  2HOD A;  2I1K A;  4I1L A;  2WWW A;  3HD7 A;  1Q86 Q;  5AW0 B;  3A5T A;  4UB6 E;  2W27 A;  1RQV A;  5AW3 B;  1NTM D;  4EDF A;  3U1C A;  2O1K A;  3QH9 A;  1OW6 A;  1RE4 C;  1L4A B;  5AW2 B;  1NTM E;  4GOE A;  1YJN P;  1U7J A;  1BE3 G;  2W6B A;  2KZJ A;  1EDL A;  1VQ7 P;  2B89 A;  2P7J A;  2FYU J;  1W2B O;  2KIK A;  1JMB A;  1GDT A;  1ZLL A;  1JOC A;  2IBZ G;  1YTZ T;  4Y28 J;  2QEX P;  4WVZ A;  1G2C A;  3HUS A;  4C46 A;  1G1I A;  1J1E C;  3RK2 D;  3IAO A;  1FZF A;  1GW4 A;  1VPC A;  3WU2 E;  3SWF A;  2QRX A;  1NTK J;  2E5T A;  1PGO A;  3W67 A;  2JP3 A;  5AW9 B;  4RES B;  4WB4 A;  1BCC J;  2FBW C;  1X79 B;  4UB8 H;  2OYI A;  3TDK A;  2H8P D;  3GG2 A;  2ZYA A;  4BRY B;  1EC5 A;  1KYO I;  2ZVN B;  1KZU B;  4I6M C;  3FXE A;  3B71 A;  2GA1 A;  3RL0 C;  2K9J B;  1N73 B;  1YIJ P;  3RK2 B;  3V2R A;  4I7Z B;  1NTZ G;  2HFE D;  4A7P A;  3IF4 A;  2QJP C;  2IX7 C;  1YI2 P;  3M0D C;  3Q2Y A;  3FWN A;  2I1J A;  1JUN A;  1YJW P;  2KXP B;  2PFX A;  2GM4 A;  2OYH A;  1P84 D;  4GIF A;  5AW5 B;  5CCH C;  1S72 P;  1SLQ A;  2KYV A;  1RH5 B;  2XZR A;  1P84 E;  3HE5 A;  1ZP0 C;  3CLQ A;  4U3F G;  5KJ7 C;  3I56 P;  2BAS A;  5BVZ A;  4AUW A;  1FZB A;  1FU1 A;  1T3J A;  1SVF A;  1R5S A;  4JYB A;  1EDJ A;  3CCR P;  1N7S C;  3SFD C;  4YXW H;  1VQP P;  2Q6Q A;  5KAF E;  1NTM K;  5EFW B;  1SP4 A;  2R32 A;  3VN0 A;  5AVT B;  1PPJ D;  3R4Y A;  1HWT C;  2OGU A;  3KQG A;  2M3E A;  3H1K G;  1ZV8 A;  2H89 C;  1NTZ J;  2QM8 A;  1PPJ E;  1L0N J;  5GTI E;  3U1A A;  4EI2 A;  1EDK A;  1SQQ D;  4ZKU A;  1KIL D;  2KLU A;  3U59 A;  2Q9I A;  3V4W A;  1SQQ E;  1LTJ B;  1KIL E;  1R5L A;  2WTY A;  4L75 A;  4RJT A;  1EDI A;  1FDI A;  2ZYG A;  4ZKP A;  1IZN B;  1VDF A;  1JTH A;  1OX3 A;  1FDM A;  3Q1M A;  4YXD C;  4U3F J;  2BEQ D;  3CXH D;  4MN4 C;  2BCC G;  1IJD B;  2A06 G;  3D6Z A;  1KIL B;  3HTK A;  3WUT A;  3CC2 P;  3KZI H;  3CXH E;  1IC2 A;  3KYQ A;  3CWB D;  2NPS D;  4K3A A;  1Y8A A;  3EFG A;  1CI6 B;  3BCC D;  3CWB E;  1T2K D;  4D6T G;  3HE5 B;  3MD0 A;  2JWD A;  3VMA A;  5TIS H;  1HUC A;  2YIU C;  1X9V A;  4KHX A;  3BCC E;  2WSE J;  2K37 A;  3FGA D;  1PIX A;  3F5H A;  4BWN A;  2NPS B;  4K35 A;  1HGZ A;  1RE4 A;  1N73 C;  4PV1 D;  3S4R A;  1AQ5 A;  5CJ4 A;  3AE5 C;  1NO4 A;  3D70 A;  2Z5H A;  1M7L A;  2KOG A;  2FYZ A;  3EQ2 A;  1IK7 A;  4DZO A;  3LW5 J;  2JEE A;  3PLN A;  4PV1 B;  4DT0 A; 
#chains in the Genus database with same CATH homology
 1L0L G;  3H1K G;  3CWB G;  5KLV G;  3TGU G;  1KB9 H;  1NTM G;  1NTK G;  4U3F G;  1NU1 G;  3H1I G;  3L73 G;  1SQX G;  3H1L G;  1SQB G;  1SQQ G;  3BCC G;  1P84 H;  1BCC G;  3CXH H;  1BGY G;  1SQP G;  3L70 G;  1PPJ G;  1EZV G;  4PD4 H;  1PP9 G;  4D6T G;  2IBZ G;  1NTZ G;  2BCC G;  2A06 G;  3H1H G;  3L74 G;  2FYU G;  1KYO H;  3L75 G;  1L0N G;  3L72 G;  3L71 G;  1SQV G;  3CX5 H;  3H1J G;  1BE3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...