1QGKB

Structure of importin beta bound to the ibb domain of importin alpha
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
44
structure length
44
Chain Sequence
AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IMPORTIN BETA SUBUNIT)
publication title Structure of importin-beta bound to the IBB domain of importin-alpha.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport receptor
total genus 14
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 1999-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.690 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Importin-alpha, importin-beta-binding domain 1qgkB00
1QGKB
chains in the Genus database with same CATH superfamily
1PZQA 2XNXA 1NTMG 3GG2A 3QWOC 1YTZI 1PL5A 3H1HD 1P84E 3HRNA 3U59A 1SQPJ 3EFGA 2FYZA 2A06G 3FXDA 1GU5A 2E74B 3HTKA 4KT0J 1SQQG 1BE3G 4OH8B 1MZ9A 3AE1C 2H88C 5L8RJ 3R4YA 1LTBC 1KB9I 2AEMA 2Q3EA 2NRGA 3MUDA 1IC2A 2WPSA 1T2KC 3F89A 1VPCA 4N3YB 4HKZH 4TLFA 3BCCD 2FXPA 1LJ2A 2B88A 1GL2C 4OWFA 2W27A 1JM0A 2KS1B 1LTJC 1SQBG 3NTNA 2C0WA 4EIJA 1L0NJ 2E75D 1SQQE 2JWDA 3AE3C 3MHVA 2YMKA 3CWBG 3V4QA 5B5EH 2Q1KA 3AEDC 1OX3A 3AEAC 3HD7A 5TISH 1RH5B 3P8CD 1WRGA 2V7QH 4H13B 5AVTB 4D6TG 5EFWB 5AVUB 3L73D 2KP8A 1SQBE 1H88A 1Y9BA 2SPZA 1SQXJ 5TJHA 1MFTA 1BSNA 2ZXXA 3D6ZA 3C9IA 4WY4D 1KQLA 1OVUA 3E1RA 1EZVG 3A2AA 2IX7C 1NGMB 3O6QA 1KYOE 2POHA 1PPJE 4LC1A 4D6TE 4ASWA 4MN4C 5AW5B 5B66E 1AVOA 2KSJA 1Q81Q 2PRRA 3I5CA 3U1AA 3G3ZA 1NTKJ 3AECC 2YNYA 2N9BA 1L4AA 2O01J 2W8ZA 3H1HJ 1BCCE 2FYUK 5DJUB 4U3FG 3CCEP 2OTLP 5KJ7A 1EZVE 3GHGC 1RF0A 2QVAA 2R5DA 1LP1A 1J1EC 2C0XA 2NPSA 1FDOA 5GTIE 4JF7A 4ZMDA 2NZ2A 5BU5A 1DIPA 1P84I 5KLVG 1GDTA 5GTHH 2JWAA 1PP9D 2IPPA 1KB9D 2KB7P 3BCCJ 1VF5C 1N73C 1JY3N 3H1LD 2FFDC 4UB8E 3Q2YA 2K1AA 1LTTC 4U3FE 3CMAP 1N7SB 2ZVNB 2O1KA 3RL0D 1MKMA 2ZJSE 3FWLA 4GKGA 2IFMA 2K9JB 1NYHA 2GUSA 4OVNF 3PLNA 2JKVA 2FYUG 1LTIC 2WPRA 5KLVE 4NPDA 2N9YB 1SFCD 2K9YA 1VQ7P 1OW6A 3PH0A 1YQ3C 4EOTA 2QIWA 4DOJA 1BGYG 3A3YB 4ZNCA 3KZIE 1FOSE 5E79E 4DZOA 2WSEJ 2WT7A 2O01H 5CHXA 2P67A 5KKZC 2Z5IA 5APQA 2BCCD 1SQVK 3AEBC 5CCHC 1NWQA 2FYUE 1XTCC 1NOHA 1M57D 1JTHB 3AE5C 1MUUA 4H0LC 1U7MA 2OGUA 1IFDA 1BGYE 1Y47A 3TYYA 1YYCA 3L75J 3L70G 4AQRD 2A45H 4W80A 1GL2B 3PP5A 1LT1A 1FZFA 4DJGA 2KK7A 1LTJB 2YXQB 1KYOI 3CXHE 4H44B 3II6A 2IBZG 5AVQB 3RBZA 1KQGB 1NTZG 3RL0g 3PJSK 1SQVG 3L70E 1GK6A 2OYOA 3OJAB 1EZVI 1PP9J 2MJZA 2KNCB 1LTAC 1P84D 2G8YA 2KNCA 3H1LJ 2QE7H 4C7NB 1OVRA 2KI7B 2IBZE 1YIJP 2OTKE 3TNUA 3HD7D 1OZHA 2QA4P 3BRVB 3EQ2A 1AV1A 1DD4A 1W2EA 1NH4A 1OVVA 3PTZA 2RH0A 1SQVE 1M1JA 4I7ZC 1GZLA 3HE5B 1GMJA 5APUA 3L72E 1X0TA 2KOGA 1AA0A 5C39A 3Q3DA 1Q90D 2B87B 3L71J 5CBNA 1SQQD 1BE3D 5CCGA 1VQ8P 2B87A 1RE4C 4IFDK 2LKMA 3B5ND 4RO0A 2BCCJ 1PIXA 4GOEA 3V5BA 2Y0CA 2WSCJ 2FKWB 3GHGB 1J1EB 3CX5I 5H2FH 1ZV8A 1PGOA 3OA7A 4IOIH 3V2NA 3ABVC 3H1IG 1AJYA 3B5NC 1S2EA 3G6EP 1L4AD 2D2CB 1RQVA 1SQBD 3RK3E 3V6IA 4HH2A 1IZNB 3E1IA 1KB9H 5AVRB 1DX7A 1IFIA 5KJ7D 1VF5B 1N73B 1LWUA 1RF1A 3W67A 3H1JG 2NPSD 5CJ4A 2OYIA 1KQFB 1PGJA 2R5BA 1QL2A 1NTMK 3H1KG 1KYOD 1EXJA 1PPJD 1ZLLA 3H1IE 3RK2C 4D6TD 1J1DC 1M1KQ 1DD3A 1K8AQ 2WZ7A 1N8RQ 3CXHI 1GW4A 4I1LA 1Z56A 2YO3A 2ZT9D 2E43A 3H1JE 5CJ0A 1YJNP 1NU1K 1YJ9P 5KAIH 2ZYAA 1BDCA 1EDIA 1AQTA 5KKZB 2Y9YA 1EZVD 4AUWA 1FU1A 1JCDA 1KILC 3H1KE 1QVFO 4B86A 2ZT9C 1E5WA 2WSCH 4RESB 4H0LB 4IL6H 1PGQA 3P32A 3K5BA 4LGDE 1VQPP 2JDIH 2YO2A 1JCCA 1FZCC 1JEKA 3CLQA 2IBZI 2AXTE 3AE6C 4W7YA 2E5YA 4IFMA 3P8MC 2DW3A 3AE4C 4U3FD 2P7JA 1M56D 3CCJP 3HE4B 1QL1A 1JY2O 3WU2E 3H32B 1SQQJ 1USEA 3D6YA 1JUNA 1G1JA 1K73Q 1ZXGA 3AE7C 2P2UA 1RE3C 4Y99C 1SQPG 1LGHB 1NU1G 5KLVD 3A0BH 2GM4A 3WUTA 1L2PA 3ITKA 1NTME 2I8DA 5TISE 3L74G 4PV1D 1K04A 5APTA 1G1IA 3R2PA 3JCUH 1SQBJ 2A06E 4HB1A 4NPFX 1URQD 2KS1A 1BE3E 1P84H 2Q5UA 1PV3A 2WQYC 1GU4A 2JEEA 3SFEC 1N2DC 1JY2P 5KTBA 2FYUD 3L36A 3CPWO 1NU1E 2J58A 5AW1B 1URQC 3N4XA 4UB6E 1L0NG 2E75C 2ZYGA 1K9MQ 1LT9C 4Z1MH 3L74E 4I7ZB 1BGYD 2I1JA 4WB4A 1FOSF 3QH9A 1IFMA 1NHLA 5KAFE 1KFMA 1NTKK 2QSIA 1S4XA 3M0DC 4OGQD 2RN0A 3CWBE 1CZQA 1FS0E 3CXHD 1BCCJ 5KLVK 3Q5RA 2OYHC 4KJMA 3SWFA 1QVGO 1S3JA 1Q7YQ 4PJ0E 1EXIA 1G2CB 2K3RA 4JQ0D 2WTYA 4EI2A 2Q9IA 3UIAA 3L70D 2YMYA 1IFNA 4N78E 4WY4C 1OMIA 1IFPA 5KLIB 5CCGD 2QJKC 1GD2E 3MP7B 1JOCA 3CMEP 2ZVOB 2B9BA 1AVYA 3KPEA 3CCQP 4YPCA 4AYCA 1DH3A 1LNQA 2KUBA 2XNDH 4U3FJ 2W6JH 1KORA 1X79B 1LTGC 3EWKA 2IBZD 2H89C 3VMXA 4NPEA 3O8ZA 1FAVA 1KMIZ 1FJPA 1NTKG 2QJYB 1U57A 1NAYA 1SQVD 2IZ0A 3HUSC 1KZUB 3TDKA 3LIEA 1VQ9P 1KYOH 4L73A 3KDPB 3L72D 3RK2B 3Q5PA 4KHXA 3M06A 1J1DB 5B66H 2M3EA 3IR9A 5AW8B 3Q1MA 3GLMA 3H25A 1S5LE 4O9BA 4GODA 1N7SA 1T8ZA 3WMM0 1NTKE 1JNMA 4WBAA 2A45G 3BCCG 3N7NA 3U1CA 4GOFA 2K9JA 1KILB 2FYUJ 2FYNC 3RL0C 1T3UA 3TGUG 5GTIH 3AE8C 4K35A 2N1TB 1HJ0A 5CMZA 4JYCA 1BGYJ 3G4SP 2N1TA 3RK3D 3CX5E 3CCRP 3L73J 1Q82Q 1FZCB 5AW2B 4XFJA 5AVWB 1SFCC 2LXBA 3OW2O 2YIUC 1SLQA 1GTWA 1NTZK 4C46A 4UB8H 2BASA 3GMAA 5AW3B 3T97B 1ZN5A 1S5LX 3BVHA 2HPCB 1OW7A 2XDJA 1HUCA 3T97A 3TGUE 2HPCA 1VQ4P 3A0HE 2O1JA 1JTHA 2QG4A 1NO4A 2VRSA 3FGAD 3H1ID 4Y99B 3G9RA 3NFQA 1IFJA 1HWTC 3KQGA 2M5AB 3L35A 2ITAA 1VL2A 1FJKA 3JC22 4PD4E 2E74D 1GL2A 3H1JD 3KZIH 1EQ7A 1W2BO 1LTJA 5E79H 3CCMP 2Q6QA 3L75G 1HGVA 2OTJP 4R4LA 3M0AA 3CCLP 3H1KD 3S1KA 1T6AA 1H8AA 1ZR2A 2E75B 3NXSA 3V4WA 1LT9B 2PAJA 2AEJA 3W68A 4EDFA 3MUDC 4YXWH 3L72J 4U7JA 2K88A 1JY3O 3ZDMA 1XTGB 3SFDC 2FXMA 3IF4A 1IK9A 2Q7CA 4C7NA 1ZMEC 3CXHH 1NTZE 2OYHB 2M3BA 1HVVA 4DCKA 3D70A 2ZAEB 2M8RA 3H1LG 1L0LK 4H13D 1AQ5A 2O01N 3HD7C 3HE5A 1NTMD 4BWNA 1RQUA 3I56P 3CL3D 4WY4B 2A06D 3VOPA 3VP9A 2QJKB 2L5GB 1UIIA 4I2LC 1TU3F 1SQPD 3FX0A 1NU1D 3RBXA 1ZRTE 2G3AA 4IFFA 1FC2C 3L71G 3VN0A 5CBOA 1JY2N 3GHGA 4GT1A 3L74D 3TSIA 3H1IJ 4RKUJ 3M9HA 3M9QA 4BRYB 2LXCB 4YXDC 1N7LA 2E76D 3GF7A 2QJPC 1L0LG 3IN6A 2JP3A 2FFDB 2HR3A 1N73A 3CWBD 2FFDA 3H1JJ 1KN7A 1K05A 1L4AC 1FZBA 1WMKA 2H7HA 2E76C 3L71E 5KJ7C 2P1JA 1ZW0A 1QEXA 5AW7B 1RF0C 2WPVB 1Y8AA 4PD4I 2FYNB 2NPSC 3RL0B 1KV4A 1KTMA 3D71A 1VQMP 2CPSA 4N78D 1L0LE 1U7JA 2KZIA 1H0TB 1N7SD 1QLED 1MFZA 1SQPK 1R5SA 2Y9ZA 1SFCB 3V2PA 2BEQD 2PP6A 1R8EA 2YIUB 3OAKA 2YXRB 1AFOA 1EDKA 2Z4EA 2HG5D 1S9KE 2XV5A 5CCHA 1YHQP 1NKNA 1M8OB 1N86A 1OW8A 5AVXB 2KLUA 3KHUA 4EYYQ 2YKOA 4ASVA 4M3LA 5AVZB 4QMAA 1NTMJ 1SVFA 2HODB 1VDFA 1L0NK 4LLHA 2JO1A 3HE4A 2IYOA 2OQQA 1BE3J 1NTKD 1HGZA 5AVVB 1EC5A 2H43A 3H32A 4L75A 1JB0J 1HBWA 1QGKB 2WSFJ 3HTKB 1NU1J 2LR2A 2KSEA 5AW4B 5B5EE 1T2KD 1E79H 1VQNP 3MTUE 3G71P 3L74J 2RKLA 1KD1Q 1HJBA 1GL2D 3CX5D 5AVYB 2Y0DA 1SQXK 1OIPA 2AXTH 2AXCA 4H44D 1ZR4A 4PV1C 1EDLA 3VMAA 3LW5J 3CWBJ 1SQPE 3WU2H 1FDMA 3TGUD 2W6BA 2L91A 3S9OA 1ZP0C 1QX8A 4H44C 1JO5A 4D6TJ 4GIFA 2MKVA 2ZXEB 3HD7B 2KZJA 2CPBA 1KC8Q 4PD4D 2J59M 1PPJG 1IK7A 2WSSH 1UIXA 4A7PA 2GUVA 5APWA 2PFXA 1CW5A 1L0NE 2IFNA 1SQXG 3MD0A 2UWJE 1RE4A 3VMYA 2WSFH 4OGQC 1FBMA 3BRTB 1G2CA 2E42A 3JSVC 2W6AA 4UB6H 5M1BA 1T3JA 1BCCG 2WMMA 4R4MA 4JYBA 1M1JC 4C7RA 3O6QB 3B5NB 2R3SA 3FWNA 3F5HA 1X8YA 5GTHE 3S4RA 2PGDA 1NVOA 3B5NA 1DEEG 2W90A 3PHLA 3SWKA 2JJLA 2QJPB 5KAFH 3CCUP 3L75D 3V2RA 4Y28J 1SQXE 1YJWP 3LW5H 3B8EB 1KILE 5CCGC 1L4AB 1R5LA 4HJGH 1NTZD 2E76B 4JBZA 3KYQA 3H1HG 3SSUA 4PJ0H 2P10A 2D2CD 5KLVJ 1LP1B 2Q3IA 2NPSB 5AW0B 3AE9C 3MZWB 1VF5D 4YTPC 3AEGC 3CD6P 2WITA 2D2CC 2XZRA 3VMZA 3VTPC 1LWUC 2KIKA 2W83C 4I6MC 1RF1C 2QM7A 1OXZA 3H1HE 3MGNA 1ZRTD 3LIDA 3VYIA 2OYIC 2C9NY 1KILA 2ZT9B 3NMDA 2H8PD 3TGUJ 3L4FA 3M9BA 2XKMA 1FZAA 2KLVA 2QEXP 4W7ZA 1YBKA 1RY3A 3V2QA 3AEEC 3VP8A 1FZCA 2FBWC 1HH0A 2HLOA 3CC2P 1YTZT 1IJDB 1RHZB 3BCCE 1S5LH 2Y0EA 1JMBA 2B89A 1NJIQ 5CCHD 3RK3C 3L73G 2WT7B 1A02F 3L71D 3PRJA 1J2JB 4H0LD 1HF9A 2WWWA 1RE3A 1IO4A 1M7LA 4WVZA 1GW3A 3CCVP 3L70J 1L0LD 1VQ6P 2R3CA 2M5AA 3WUUA 2KXPB 3P8CE 3CC7P 2QRXA 3CX5H 1LTSC 5APVA 5DJTB 3L73E 4ZKUA 3USSA 3CCSP 2V4HA 4PV1B 1JMMA 1S1CX 2K37A 1S9KD 2YKPA 2HFED 1GK4A 2E74C 1FZGA 5APXA 1NTZJ 1M90Q 2AEFA 1BSHA 1URQB 3A0HH 1SQVJ 1URQA 2I1KA 2ZFCA 1S72P 2C9LY 1LT9A 1YITP 1OFCX 1VQOP 3GW6A 1NKZB 2E5TA 3L75E 2R44A 2QM8A 4GDOA 4PD4H 3L72G 5AVSB 3M0DA 1KFNA 3RGUA 1PP9G 1USDA 5AW9B 2WPQA 2WSEH 2OYHA 3WUVA 1HTLC 2IDBA 3TNUB 4OGQB 5BU8B 3AE2C 1A02J 5H2FE 4XE5B 1DEBA 1M1JB 1W5CE 1ZOYC 2WVRA 2Z5HA 3BASA 4WY4A 4H13C 3GF3A 4HYTB 2RMZA 2J5UA 1EDJA 1JY3P 3BATA 1PP9E 3IAOA 1KB9E 4ZKPA 3EFFK 1X22A 3H1LE 2CK3H 1VQKP 4JPZB 1CSBA 1OWAA 3Q5SA 1FDIA 4RJTA 2YKQA 1WT6A 3HUSB 1SS1A 1SP4A 2OARA 3HUSA 2A45I 2BCCG 5APSA 1FE6A 4BRYA 3H6PA 2BEZF 1L0LJ 3KXDA 3MIWA 1PGPA 5KLIC 4L74A 3L37A 3IFMA 3TK1A 3SWYA 1L0ND 1MV8A 3FXEA 4WWIA 4XA4A 1Q86Q 3P7KA 1LWUB 5KAIE 1RF1B 3H1KJ 3A5TA 2KYVA 3RK2D 2XU6A 2OYIB 2BCCE 2FXOA 1BDDA 3CC4P 1CI6B 2QJYC 3M91A 1Q2NA 5BVZA 1D7MA 2P58A 1CI6A 4TT3H 2ZYDA 3I55P 4DT0A 4IL6E 2FY8A 1VQ5P 2M0BA 1H0TA 1NAFA 5K5GB 4L76A 1YQ4C 1SFCA 2IYPA 1SQXD 1SQQK 3AEFC 3E7KA 1KILD 1N7SC 3RK3B 4BXLA 1H89A 2GA1A 1BCCD 2JR8A 3B71A 3C8VA 4K3AA 2N1TD 2HYNA 5AW6B 2R32A 3B4SA 1PFIA 3CI9A 3C1LA 1VQLP 3A0BE 3A7OA 1FZEA 5APYA 1YI2P 2O3JA 1X9VA 1SQBK 2HODA 2N1TC 2IZ1A 3TF5A 2V7QJ 4CPGA 1KQSO 4IL6X 4N6JA 3JCUE
chains in the Genus database with same CATH topology
1QGKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGK B; 
#chains in the Genus database with same CATH topology
 1PZQ A;  2XNX A;  1NTM G;  3GG2 A;  3QWO C;  1YTZ I;  1PL5 A;  3H1H D;  1P84 E;  3HRN A;  3U59 A;  1SQP J;  3EFG A;  2FYZ A;  2A06 G;  3FXD A;  1GU5 A;  2E74 B;  3HTK A;  4KT0 J;  1SQQ G;  1BE3 G;  4OH8 B;  1MZ9 A;  3AE1 C;  2H88 C;  5L8R J;  3R4Y A;  1LTB C;  1KB9 I;  2AEM A;  2Q3E A;  2NRG A;  3MUD A;  1IC2 A;  2WPS A;  1T2K C;  3F89 A;  1VPC A;  4N3Y B;  4HKZ H;  4TLF A;  3BCC D;  2FXP A;  1LJ2 A;  2B88 A;  1GL2 C;  4OWF A;  2W27 A;  1JM0 A;  2KS1 B;  1LTJ C;  1SQB G;  3NTN A;  2C0W A;  4EIJ A;  1L0N J;  2E75 D;  1SQQ E;  2JWD A;  3AE3 C;  3MHV A;  2YMK A;  3CWB G;  3V4Q A;  5B5E H;  2Q1K A;  3AED C;  1OX3 A;  3AEA C;  3HD7 A;  5TIS H;  1RH5 B;  3P8C D;  1WRG A;  2V7Q H;  4H13 B;  5AVT B;  4D6T G;  5EFW B;  5AVU B;  3L73 D;  2KP8 A;  1SQB E;  1H88 A;  1Y9B A;  2SPZ A;  1SQX J;  5TJH A;  1MFT A;  1BSN A;  2ZXX A;  3D6Z A;  3C9I A;  4WY4 D;  1KQL A;  1OVU A;  3E1R A;  1EZV G;  3A2A A;  2IX7 C;  1NGM B;  3O6Q A;  1KYO E;  2POH A;  1PPJ E;  4LC1 A;  4D6T E;  4ASW A;  4MN4 C;  5AW5 B;  5B66 E;  1AVO A;  2KSJ A;  1Q81 Q;  2PRR A;  3I5C A;  3U1A A;  3G3Z A;  1NTK J;  3AEC C;  2YNY A;  2N9B A;  1L4A A;  2O01 J;  2W8Z A;  3H1H J;  1BCC E;  2FYU K;  5DJU B;  4U3F G;  3CCE P;  2OTL P;  5KJ7 A;  1EZV E;  3GHG C;  1RF0 A;  2QVA A;  2R5D A;  1LP1 A;  1J1E C;  2C0X A;  2NPS A;  1FDO A;  5GTI E;  4JF7 A;  4ZMD A;  2NZ2 A;  5BU5 A;  1DIP A;  1P84 I;  5KLV G;  1GDT A;  5GTH H;  2JWA A;  1PP9 D;  2IPP A;  1KB9 D;  2KB7 P;  3BCC J;  1VF5 C;  1N73 C;  1JY3 N;  3H1L D;  2FFD C;  4UB8 E;  3Q2Y A;  2K1A A;  1LTT C;  4U3F E;  3CMA P;  1N7S B;  2ZVN B;  2O1K A;  3RL0 D;  1MKM A;  2ZJS E;  3FWL A;  4GKG A;  2IFM A;  2K9J B;  1NYH A;  2GUS A;  4OVN F;  3PLN A;  2JKV A;  2FYU G;  1LTI C;  2WPR A;  5KLV E;  4NPD A;  2N9Y B;  1SFC D;  2K9Y A;  1VQ7 P;  1OW6 A;  3PH0 A;  1YQ3 C;  4EOT A;  2QIW A;  4DOJ A;  1BGY G;  3A3Y B;  4ZNC A;  3KZI E;  1FOS E;  5E79 E;  4DZO A;  2WSE J;  2WT7 A;  2O01 H;  5CHX A;  2P67 A;  5KKZ C;  2Z5I A;  5APQ A;  2BCC D;  1SQV K;  3AEB C;  5CCH C;  1NWQ A;  2FYU E;  1XTC C;  1NOH A;  1M57 D;  1JTH B;  3AE5 C;  1MUU A;  4H0L C;  1U7M A;  2OGU A;  1IFD A;  1BGY E;  1Y47 A;  3TYY A;  1YYC A;  3L75 J;  3L70 G;  4AQR D;  2A45 H;  4W80 A;  1GL2 B;  3PP5 A;  1LT1 A;  1FZF A;  4DJG A;  2KK7 A;  1LTJ B;  2YXQ B;  1KYO I;  3CXH E;  4H44 B;  3II6 A;  2IBZ G;  5AVQ B;  3RBZ A;  1KQG B;  1NTZ G;  3RL0 g;  3PJS K;  1SQV G;  3L70 E;  1GK6 A;  2OYO A;  3OJA B;  1EZV I;  1PP9 J;  2MJZ A;  2KNC B;  1LTA C;  1P84 D;  2G8Y A;  2KNC A;  3H1L J;  2QE7 H;  4C7N B;  1OVR A;  2KI7 B;  2IBZ E;  1YIJ P;  2OTK E;  3TNU A;  3HD7 D;  1OZH A;  2QA4 P;  3BRV B;  3EQ2 A;  1AV1 A;  1DD4 A;  1W2E A;  1NH4 A;  1OVV A;  3PTZ A;  2RH0 A;  1SQV E;  1M1J A;  4I7Z C;  1GZL A;  3HE5 B;  1GMJ A;  5APU A;  3L72 E;  1X0T A;  2KOG A;  1AA0 A;  5C39 A;  3Q3D A;  1Q90 D;  2B87 B;  3L71 J;  5CBN A;  1SQQ D;  1BE3 D;  5CCG A;  1VQ8 P;  2B87 A;  1RE4 C;  4IFD K;  2LKM A;  3B5N D;  4RO0 A;  2BCC J;  1PIX A;  4GOE A;  3V5B A;  2Y0C A;  2WSC J;  2FKW B;  3GHG B;  1J1E B;  3CX5 I;  5H2F H;  1ZV8 A;  1PGO A;  3OA7 A;  4IOI H;  3V2N A;  3ABV C;  3H1I G;  1AJY A;  3B5N C;  1S2E A;  3G6E P;  1L4A D;  2D2C B;  1RQV A;  1SQB D;  3RK3 E;  3V6I A;  4HH2 A;  1IZN B;  3E1I A;  1KB9 H;  5AVR B;  1DX7 A;  1IFI A;  5KJ7 D;  1VF5 B;  1N73 B;  1LWU A;  1RF1 A;  3W67 A;  3H1J G;  2NPS D;  5CJ4 A;  2OYI A;  1KQF B;  1PGJ A;  2R5B A;  1QL2 A;  1NTM K;  3H1K G;  1KYO D;  1EXJ A;  1PPJ D;  1ZLL A;  3H1I E;  3RK2 C;  4D6T D;  1J1D C;  1M1K Q;  1DD3 A;  1K8A Q;  2WZ7 A;  1N8R Q;  3CXH I;  1GW4 A;  4I1L A;  1Z56 A;  2YO3 A;  2ZT9 D;  2E43 A;  3H1J E;  5CJ0 A;  1YJN P;  1NU1 K;  1YJ9 P;  5KAI H;  2ZYA A;  1BDC A;  1EDI A;  1AQT A;  5KKZ B;  2Y9Y A;  1EZV D;  4AUW A;  1FU1 A;  1JCD A;  1KIL C;  3H1K E;  1QVF O;  4B86 A;  2ZT9 C;  1E5W A;  2WSC H;  4RES B;  4H0L B;  4IL6 H;  1PGQ A;  3P32 A;  3K5B A;  4LGD E;  1VQP P;  2JDI H;  2YO2 A;  1JCC A;  1FZC C;  1JEK A;  3CLQ A;  2IBZ I;  2AXT E;  3AE6 C;  4W7Y A;  2E5Y A;  4IFM A;  3P8M C;  2DW3 A;  3AE4 C;  4U3F D;  2P7J A;  1M56 D;  3CCJ P;  3HE4 B;  1QL1 A;  1JY2 O;  3WU2 E;  3H32 B;  1SQQ J;  1USE A;  3D6Y A;  1JUN A;  1G1J A;  1K73 Q;  1ZXG A;  3AE7 C;  2P2U A;  1RE3 C;  4Y99 C;  1SQP G;  1LGH B;  1NU1 G;  5KLV D;  3A0B H;  2GM4 A;  3WUT A;  1L2P A;  3ITK A;  1NTM E;  2I8D A;  5TIS E;  3L74 G;  4PV1 D;  1K04 A;  5APT A;  1G1I A;  3R2P A;  3JCU H;  1SQB J;  2A06 E;  4HB1 A;  4NPF X;  1URQ D;  2KS1 A;  1BE3 E;  1P84 H;  2Q5U A;  1PV3 A;  2WQY C;  1GU4 A;  2JEE A;  3SFE C;  1N2D C;  1JY2 P;  5KTB A;  2FYU D;  3L36 A;  3CPW O;  1NU1 E;  2J58 A;  5AW1 B;  1URQ C;  3N4X A;  4UB6 E;  1L0N G;  2E75 C;  2ZYG A;  1K9M Q;  1LT9 C;  4Z1M H;  3L74 E;  4I7Z B;  1BGY D;  2I1J A;  4WB4 A;  1FOS F;  3QH9 A;  1IFM A;  1NHL A;  5KAF E;  1KFM A;  1NTK K;  2QSI A;  1S4X A;  3M0D C;  4OGQ D;  2RN0 A;  3CWB E;  1CZQ A;  1FS0 E;  3CXH D;  1BCC J;  5KLV K;  3Q5R A;  2OYH C;  4KJM A;  3SWF A;  1QVG O;  1S3J A;  1Q7Y Q;  4PJ0 E;  1EXI A;  1G2C B;  2K3R A;  4JQ0 D;  2WTY A;  4EI2 A;  2Q9I A;  3UIA A;  3L70 D;  2YMY A;  1IFN A;  4N78 E;  4WY4 C;  1OMI A;  1IFP A;  5KLI B;  5CCG D;  2QJK C;  1GD2 E;  3MP7 B;  1JOC A;  3CME P;  2ZVO B;  2B9B A;  1AVY A;  3KPE A;  3CCQ P;  4YPC A;  4AYC A;  1DH3 A;  1LNQ A;  2KUB A;  2XND H;  4U3F J;  2W6J H;  1KOR A;  1X79 B;  1LTG C;  3EWK A;  2IBZ D;  2H89 C;  3VMX A;  4NPE A;  3O8Z A;  1FAV A;  1KMI Z;  1FJP A;  1NTK G;  2QJY B;  1U57 A;  1NAY A;  1SQV D;  2IZ0 A;  3HUS C;  1KZU B;  3TDK A;  3LIE A;  1VQ9 P;  1KYO H;  4L73 A;  3KDP B;  3L72 D;  3RK2 B;  3Q5P A;  4KHX A;  3M06 A;  1J1D B;  5B66 H;  2M3E A;  3IR9 A;  5AW8 B;  3Q1M A;  3GLM A;  3H25 A;  1S5L E;  4O9B A;  4GOD A;  1N7S A;  1T8Z A;  3WMM 0;  1NTK E;  1JNM A;  4WBA A;  2A45 G;  3BCC G;  3N7N A;  3U1C A;  4GOF A;  2K9J A;  1KIL B;  2FYU J;  2FYN C;  3RL0 C;  1T3U A;  3TGU G;  5GTI H;  3AE8 C;  4K35 A;  2N1T B;  1HJ0 A;  5CMZ A;  4JYC A;  1BGY J;  3G4S P;  2N1T A;  3RK3 D;  3CX5 E;  3CCR P;  3L73 J;  1Q82 Q;  1FZC B;  5AW2 B;  4XFJ A;  5AVW B;  1SFC C;  2LXB A;  3OW2 O;  2YIU C;  1SLQ A;  1GTW A;  1NTZ K;  4C46 A;  4UB8 H;  2BAS A;  3GMA A;  5AW3 B;  3T97 B;  1ZN5 A;  1S5L X;  3BVH A;  2HPC B;  1OW7 A;  2XDJ A;  1HUC A;  3T97 A;  3TGU E;  2HPC A;  1VQ4 P;  3A0H E;  2O1J A;  1JTH A;  2QG4 A;  1NO4 A;  2VRS A;  3FGA D;  3H1I D;  4Y99 B;  3G9R A;  3NFQ A;  1IFJ A;  1HWT C;  3KQG A;  2M5A B;  3L35 A;  2ITA A;  1VL2 A;  1FJK A;  3JC2 2;  4PD4 E;  2E74 D;  1GL2 A;  3H1J D;  3KZI H;  1EQ7 A;  1W2B O;  1LTJ A;  5E79 H;  3CCM P;  2Q6Q A;  3L75 G;  1HGV A;  2OTJ P;  4R4L A;  3M0A A;  3CCL P;  3H1K D;  3S1K A;  1T6A A;  1H8A A;  1ZR2 A;  2E75 B;  3NXS A;  3V4W A;  1LT9 B;  2PAJ A;  2AEJ A;  3W68 A;  4EDF A;  3MUD C;  4YXW H;  3L72 J;  4U7J A;  2K88 A;  1JY3 O;  3ZDM A;  1XTG B;  3SFD C;  2FXM A;  3IF4 A;  1IK9 A;  2Q7C A;  4C7N A;  1ZME C;  3CXH H;  1NTZ E;  2OYH B;  2M3B A;  1HVV A;  4DCK A;  3D70 A;  2ZAE B;  2M8R A;  3H1L G;  1L0L K;  4H13 D;  1AQ5 A;  2O01 N;  3HD7 C;  3HE5 A;  1NTM D;  4BWN A;  1RQU A;  3I56 P;  3CL3 D;  4WY4 B;  2A06 D;  3VOP A;  3VP9 A;  2QJK B;  2L5G B;  1UII A;  4I2L C;  1TU3 F;  1SQP D;  3FX0 A;  1NU1 D;  3RBX A;  1ZRT E;  2G3A A;  4IFF A;  1FC2 C;  3L71 G;  3VN0 A;  5CBO A;  1JY2 N;  3GHG A;  4GT1 A;  3L74 D;  3TSI A;  3H1I J;  4RKU J;  3M9H A;  3M9Q A;  4BRY B;  2LXC B;  4YXD C;  1N7L A;  2E76 D;  3GF7 A;  2QJP C;  1L0L G;  3IN6 A;  2JP3 A;  2FFD B;  2HR3 A;  1N73 A;  3CWB D;  2FFD A;  3H1J J;  1KN7 A;  1K05 A;  1L4A C;  1FZB A;  1WMK A;  2H7H A;  2E76 C;  3L71 E;  5KJ7 C;  2P1J A;  1ZW0 A;  1QEX A;  5AW7 B;  1RF0 C;  2WPV B;  1Y8A A;  4PD4 I;  2FYN B;  2NPS C;  3RL0 B;  1KV4 A;  1KTM A;  3D71 A;  1VQM P;  2CPS A;  4N78 D;  1L0L E;  1U7J A;  2KZI A;  1H0T B;  1N7S D;  1QLE D;  1MFZ A;  1SQP K;  1R5S A;  2Y9Z A;  1SFC B;  3V2P A;  2BEQ D;  2PP6 A;  1R8E A;  2YIU B;  3OAK A;  2YXR B;  1AFO A;  1EDK A;  2Z4E A;  2HG5 D;  1S9K E;  2XV5 A;  5CCH A;  1YHQ P;  1NKN A;  1M8O B;  1N86 A;  1OW8 A;  5AVX B;  2KLU A;  3KHU A;  4EYY Q;  2YKO A;  4ASV A;  4M3L A;  5AVZ B;  4QMA A;  1NTM J;  1SVF A;  2HOD B;  1VDF A;  1L0N K;  4LLH A;  2JO1 A;  3HE4 A;  2IYO A;  2OQQ A;  1BE3 J;  1NTK D;  1HGZ A;  5AVV B;  1EC5 A;  2H43 A;  3H32 A;  4L75 A;  1JB0 J;  1HBW A;  1QGK B;  2WSF J;  3HTK B;  1NU1 J;  2LR2 A;  2KSE A;  5AW4 B;  5B5E E;  1T2K D;  1E79 H;  1VQN P;  3MTU E;  3G71 P;  3L74 J;  2RKL A;  1KD1 Q;  1HJB A;  1GL2 D;  3CX5 D;  5AVY B;  2Y0D A;  1SQX K;  1OIP A;  2AXT H;  2AXC A;  4H44 D;  1ZR4 A;  4PV1 C;  1EDL A;  3VMA A;  3LW5 J;  3CWB J;  1SQP E;  3WU2 H;  1FDM A;  3TGU D;  2W6B A;  2L91 A;  3S9O A;  1ZP0 C;  1QX8 A;  4H44 C;  1JO5 A;  4D6T J;  4GIF A;  2MKV A;  2ZXE B;  3HD7 B;  2KZJ A;  2CPB A;  1KC8 Q;  4PD4 D;  2J59 M;  1PPJ G;  1IK7 A;  2WSS H;  1UIX A;  4A7P A;  2GUV A;  5APW A;  2PFX A;  1CW5 A;  1L0N E;  2IFN A;  1SQX G;  3MD0 A;  2UWJ E;  1RE4 A;  3VMY A;  2WSF H;  4OGQ C;  1FBM A;  3BRT B;  1G2C A;  2E42 A;  3JSV C;  2W6A A;  4UB6 H;  5M1B A;  1T3J A;  1BCC G;  2WMM A;  4R4M A;  4JYB A;  1M1J C;  4C7R A;  3O6Q B;  3B5N B;  2R3S A;  3FWN A;  3F5H A;  1X8Y A;  5GTH E;  3S4R A;  2PGD A;  1NVO A;  3B5N A;  1DEE G;  2W90 A;  3PHL A;  3SWK A;  2JJL A;  2QJP B;  5KAF H;  3CCU P;  3L75 D;  3V2R A;  4Y28 J;  1SQX E;  1YJW P;  3LW5 H;  3B8E B;  1KIL E;  5CCG C;  1L4A B;  1R5L A;  4HJG H;  1NTZ D;  2E76 B;  4JBZ A;  3KYQ A;  3H1H G;  3SSU A;  4PJ0 H;  2P10 A;  2D2C D;  5KLV J;  1LP1 B;  2Q3I A;  2NPS B;  5AW0 B;  3AE9 C;  3MZW B;  1VF5 D;  4YTP C;  3AEG C;  3CD6 P;  2WIT A;  2D2C C;  2XZR A;  3VMZ A;  3VTP C;  1LWU C;  2KIK A;  2W83 C;  4I6M C;  1RF1 C;  2QM7 A;  1OXZ A;  3H1H E;  3MGN A;  1ZRT D;  3LID A;  3VYI A;  2OYI C;  2C9N Y;  1KIL A;  2ZT9 B;  3NMD A;  2H8P D;  3TGU J;  3L4F A;  3M9B A;  2XKM A;  1FZA A;  2KLV A;  2QEX P;  4W7Z A;  1YBK A;  1RY3 A;  3V2Q A;  3AEE C;  3VP8 A;  1FZC A;  2FBW C;  1HH0 A;  2HLO A;  3CC2 P;  1YTZ T;  1IJD B;  1RHZ B;  3BCC E;  1S5L H;  2Y0E A;  1JMB A;  2B89 A;  1NJI Q;  5CCH D;  3RK3 C;  3L73 G;  2WT7 B;  1A02 F;  3L71 D;  3PRJ A;  1J2J B;  4H0L D;  1HF9 A;  2WWW A;  1RE3 A;  1IO4 A;  1M7L A;  4WVZ A;  1GW3 A;  3CCV P;  3L70 J;  1L0L D;  1VQ6 P;  2R3C A;  2M5A A;  3WUU A;  2KXP B;  3P8C E;  3CC7 P;  2QRX A;  3CX5 H;  1LTS C;  5APV A;  5DJT B;  3L73 E;  4ZKU A;  3USS A;  3CCS P;  2V4H A;  4PV1 B;  1JMM A;  1S1C X;  2K37 A;  1S9K D;  2YKP A;  2HFE D;  1GK4 A;  2E74 C;  1FZG A;  5APX A;  1NTZ J;  1M90 Q;  2AEF A;  1BSH A;  1URQ B;  3A0H H;  1SQV J;  1URQ A;  2I1K A;  2ZFC A;  1S72 P;  2C9L Y;  1LT9 A;  1YIT P;  1OFC X;  1VQO P;  3GW6 A;  1NKZ B;  2E5T A;  3L75 E;  2R44 A;  2QM8 A;  4GDO A;  4PD4 H;  3L72 G;  5AVS B;  3M0D A;  1KFN A;  3RGU A;  1PP9 G;  1USD A;  5AW9 B;  2WPQ A;  2WSE H;  2OYH A;  3WUV A;  1HTL C;  2IDB A;  3TNU B;  4OGQ B;  5BU8 B;  3AE2 C;  1A02 J;  5H2F E;  4XE5 B;  1DEB A;  1M1J B;  1W5C E;  1ZOY C;  2WVR A;  2Z5H A;  3BAS A;  4WY4 A;  4H13 C;  3GF3 A;  4HYT B;  2RMZ A;  2J5U A;  1EDJ A;  1JY3 P;  3BAT A;  1PP9 E;  3IAO A;  1KB9 E;  4ZKP A;  3EFF K;  1X22 A;  3H1L E;  2CK3 H;  1VQK P;  4JPZ B;  1CSB A;  1OWA A;  3Q5S A;  1FDI A;  4RJT A;  2YKQ A;  1WT6 A;  3HUS B;  1SS1 A;  1SP4 A;  2OAR A;  3HUS A;  2A45 I;  2BCC G;  5APS A;  1FE6 A;  4BRY A;  3H6P A;  2BEZ F;  1L0L J;  3KXD A;  3MIW A;  1PGP A;  5KLI C;  4L74 A;  3L37 A;  3IFM A;  3TK1 A;  3SWY A;  1L0N D;  1MV8 A;  3FXE A;  4WWI A;  4XA4 A;  1Q86 Q;  3P7K A;  1LWU B;  5KAI E;  1RF1 B;  3H1K J;  3A5T A;  2KYV A;  3RK2 D;  2XU6 A;  2OYI B;  2BCC E;  2FXO A;  1BDD A;  3CC4 P;  1CI6 B;  2QJY C;  3M91 A;  1Q2N A;  5BVZ A;  1D7M A;  2P58 A;  1CI6 A;  4TT3 H;  2ZYD A;  3I55 P;  4DT0 A;  4IL6 E;  2FY8 A;  1VQ5 P;  2M0B A;  1H0T A;  1NAF A;  5K5G B;  4L76 A;  1YQ4 C;  1SFC A;  2IYP A;  1SQX D;  1SQQ K;  3AEF C;  3E7K A;  1KIL D;  1N7S C;  3RK3 B;  4BXL A;  1H89 A;  2GA1 A;  1BCC D;  2JR8 A;  3B71 A;  3C8V A;  4K3A A;  2N1T D;  2HYN A;  5AW6 B;  2R32 A;  3B4S A;  1PFI A;  3CI9 A;  3C1L A;  1VQL P;  3A0B E;  3A7O A;  1FZE A;  5APY A;  1YI2 P;  2O3J A;  1X9V A;  1SQB K;  2HOD A;  2N1T C;  2IZ1 A;  3TF5 A;  2V7Q J;  4CPG A;  1KQS O;  4IL6 X;  4N6J A;  3JCU E; 
#chains in the Genus database with same CATH homology
 1QGK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...