1QGKB

Structure of importin beta bound to the ibb domain of importin alpha
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
44
structure length
44
Chain Sequence
b'AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IMPORTIN BETA SUBUNIT)
publication title Structure of importin-beta bound to the IBB domain of importin-alpha.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport receptor
total genus 14
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 1999-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.690 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Importin-alpha, importin-beta-binding domain 1qgkB00
1QGKB
chains in the Genus database with same CATH superfamily
1IC2A 3V2RA 1LTTC 1DH3A 1MV8A 1VQ7P 1KQLA 2KLVA 4JQ0D 1JO5A 1D7MA 1ZR4A 1L2PA 2KS1A 2N1TC 4JYBA 4LGDE 3VMZA 3CCVP 5AW9B 1URQD 1PPJE 1NTKE 2E76B 2O01J 2OQQA 2B88A 1YI2P 1T6AA 3AE1C 2KIKA 1KB9I 4H13D 3BCCJ 3CLQA 4XA4A 1HGVA 1WRGA 3RL0B 1ZW0A 4Y28J 3WUUA 1SQXJ 5APUA 4KHXA 2V4HA 2QJKC 1SFCC 2IFNA 2W8ZA 1FZGA 4I7ZB 1T2KD 3VYIA 2FYNB 1E79H 3Q5SA 1SQXD 1QLED 3MP7B 1NU1K 3VMXA 4A7PA 3SWFA 1OW8A 1P84H 3A5TA 3L74J 4BWNA 2AXTH 1YITP 2O1JA 4HJGH 2NPSA 2JEEA 1RQVA 1PFIA 4W7YA 1BSNA 2C0XA 1FU1A 2XNDH 2K1AA 2WT7A 3L74D 3G4SP 2E42A 5KJ7A 5B66E 2KI7B 1PP9G 2ZFCA 2ITAA 3B71A 1BGYE 4PJ0E 1SQQJ 4NPFX 3H32A 1YTZT 1EDLA 2YKPA 2Y0EA 3VMYA 4D6TJ 1G1IA 2BEQD 3I5CA 5AVZB 2R5BA 3A0BE 1H0TB 1JB0J 2XV5A 2K37A 1YJWP 4BRYA 3KZIE 1NTZK 5AW1B 5APSA 2QVAA 2HODA 2LXCB 4UB6H 1L0NJ 1SQVK 3GLMA 5CCHC 2FYNC 3SFDC 5GTHE 2QSIA 1LWUA 1NU1D 3L73E 1GW4A 2ZT9D 5APQA 1JMMA 1ZN5A 1KB9E 1KYOD 1OMIA 1YTZI 4C7NA 1L0ND 2PRRA 3TNUB 4B86A 1USDA 3RK2D 4QMAA 5APYA 1L0LJ 1JY3O 1VL2A 1RE4C 3H1LE 2N9YB 3HTKB 1U7JA 2JKVA 1Z56A 1SQPE 4DT0A 5KAIE 2GM4A 2E75C 2YMKA 3RBXA 2WMMA 2O1KA 1L0LD 3CWBJ 2OYIA 1FZBA 3V5BA 2Q1KA 3W67A 2OYHC 2POHA 3FX0A 1EQ7A 3HUSC 2Z5IA 1N8RQ 2Y9YA 4EIJA 3VMAA 1CW5A 3MUDA 3G71P 2YO3A 1EDIA 3RK3D 2K9YA 1SQVD 5AVTB 5E79H 1BE3J 2IYOA 4DJGA 1IFJA 2H89C 1EZVE 3CCLP 1Q86Q 2Z5HA 4N6JA 1OZHA 3GG2A 2BCCG 1BE3D 1IJDB 1KTMA 3EQ2A 4ZKPA 4EI2A 2ZVOB 2R3SA 1U7MA 2PFXA 1UIXA 1Q7YQ 4WY4D 5GTIH 1NTMJ 4IL6X 3L72J 4HKZH 3AEDC 3AEAC 4IL6E 2YMYA 3F5HA 2WITA 2KK7A 4PJ0H 3GW6A 3VN0A 2JWDA 3E1RA 2KB7P 3K5BA 3A0BH 3L75E 1FZAA 4PV1C 1ZP0C 2KYVA 3AE7C 2PP6A 3L70J 5KKZB 2IBZI 3TYYA 2OTJP 1AA0A 3RGUA 2BASA 3CCUP 2E5TA 1YJNP 4I1LA 5GTHH 1MFZA 3GHGA 3TK1A 1QL1A 1G2CA 2NZ2A 1KB9H 3FWNA 2NPSC 2A06E 1AVYA 1OXZA 5KTBA 5EFWB 1FDIA 2P67A 4UB8E 5KJ7C 1K04A 1S1CX 1NWQA 4BXLA 3H6PA 1NYHA 1FZCB 1PPJG 4DOJA 2QJYC 1PP9J 1IZNB 2D2CC 1NTKG 4OVNF 2QM7A 2W83C 1U57A 3MTUE 3MD0A 3T97B 1M1KQ 3V4QA 3PH0A 3B5NA 1N73B 1KILA 1PP9D 3H1HJ 3M0DA 1ZXGA 4WWIA 4EOTA 3P7KA 4DCKA 2N1TD 2M5AB 1FBMA 3BASA 2E5YA 1VPCA 3HD7B 5KKZC 4R4LA 2O3JA 3GF7A 1LWUC 3N7NA 4TT3H 4WB4A 2Q9IA 1J1DB 1X22A 2C9LY 1FZFA 2FFDA 1HBWA 1EC5A 1JM0A 2IZ1A 3CL3D 3BRVB 3D6YA 4GOEA 1M90Q 1ZRTD 3H25A 5CBNA 3JSVC 1DEEG 3I56P 1OFCX 3S1KA 3H1IE 1MUUA 1RF0A 2ZYGA 2FBWC 4JF7A 1MFTA 1SFCD 2WPSA 3M9BA 2OYIC 1BGYG 3CXHD 1NKZB 4L76A 3O6QB 3AE3C 1FZEA 3H1JJ 2AXTE 1W2EA 3FGAD 2JDIH 1S9KD 1LT9A 1IFNA 2M3BA 3D6ZA 3LIEA 3HE5B 3MUDC 2QEXP 2IFMA 1GK4A 2N9BA 1NKNA 2J58A 4HB1A 3S9OA 2SPZA 2WSSH 1SVFA 1RQUA 1N7SB 3AEBC 1VF5C 2E74C 2KZJA 4H44B 3L73G 2LKMA 5KLVJ 3F89A 1IFIA 1FOSF 1SQBE 3CCQP 3GMAA 1LTIC 2BCCD 5AVQB 1KFMA 5DJUB 1H0TA 1P84D 3FXEA 3USSA 1HJ0A 2P2UA 4UB6E 1HGZA 1E5WA 4PD4E 3H1LG 1USEA 5TISE 4UB8H 2J59M 1SQPG 3IN6A 3BATA 4Y99B 5CCHD 1VQ6P 2KSJA 1X0TA 4C46A 2HPCA 1GW3A 1XTGB 1KYOI 1NTKK 2IYPA 2WSFJ 2Q3EA 2A45I 4EDFA 3TNUA 1PGPA 1L4AB 4O9BA 2YIUC 1DD3A 3BCCE 1BCCJ 4WVZA 3HTKA 3OA7A 2FFDB 2E75D 1KORA 4H0LC 1EZVG 1SQXE 3B8EB 3R2PA 3SSUA 1PV3A 2HR3A 3GHGC 4AUWA 2P7JA 1BCCD 2Y0DA 4ASVA 1ZR2A 1GL2B 3VOPA 2R3CA 5E79E 3PTZA 1Y47A 1KN7A 2XDJA 3V2PA 3L74E 3IF4A 4XE5B 3EFFK 3B5NC 4RJTA 3HRNA 5KLIB 3P8CE 1NOHA 1KILC 5AVRB 4OGQB 1KV4A 1LT9B 1GZLA 1M1JB 1OVVA 1PPJD 3M0DC 1NTKD 3IR9A 2FYZA 1SQQE 2HFED 3V4WA 5GTIE 3V2QA 3L75G 2M8RA 1KMIZ 2Z4EA 4JBZA 4D6TE 5BU8B 1H89A 1YJ9P 2E76C 1URQB 1QL2A 2OTLP 3AECC 3S4RA 2KNCB 2KSEA 3AEFC 5B5EE 4N3YB 1RE3A 2JP3A 2A06G 3CCJP 3RL0C 1NAFA 1NU1J 2Y0CA 2QG4A 1RF0C 4PV1D 2BEZF 2HG5D 4ZNCA 1MKMA 4PD4H 4M3LA 3H1KJ 1YBKA 4I7ZC 5TISH 2QM8A 2YXQB 2HPCB 1NGMB 3LW5J 1LT9C 2QJPB 1GDTA 2FYUK 5CHXA 1S5LH 1SQPK 3H1KD 1RF1B 2YNYA 4LC1A 1Q82Q 2UWJE 2O01H 4GOFA 2ZXEB 2NPSD 5M1BA 3CWBE 3PP5A 1K8AQ 2FYUE 2XU6A 5KJ7D 3OJAB 2D2CD 3BRTB 1ZLLA 1KQFB 1FZCA 3L73J 1IFPA 3TGUE 2ZJSE 1NTZJ 3T97A 1BE3E 1SQVJ 2B87B 1N73A 1QX8A 4I2LC 2OGUA 5KAFH 3L73D 1VQKP 1HF9A 2J5UA 4N78E 1OW6A 1NTZD 1GTWA 1KB9D 1BSHA 3H1IG 1VQ4P 1JY3N 2M5AA 3M06A 3CC2P 3HD7A 3L71E 2PGDA 4CPGA 1K05A 2IX7C 2KOGA 1IK9A 1NTME 2WSEJ 1LTJB 3L72E 1LNQA 2L5GB 4OWFA 1HVVA 2ZT9B 4K3AA 2V7QJ 1JCDA 1GU4A 4L74A 3CD6P 1J1EB 2DW3A 3RK2B 2W6BA 2H43A 2H7HA 1HUCA 3CXHI 3L70E 2KLUA 4HYTB 1QVGO 2Q6QA 2FXPA 3A7OA 1LJ2A 3O6QA 1FOSE 1JUNA 1KYOH 1EZVD 5B5EH 2WVRA 2K9JB 2A45H 3NXSA 2Y9ZA 1SQBG 1BDCA 3HE5A 1NVOA 2GUSA 5AW8B 3TSIA 2C0WA 3RK3B 2JJLA 2R44A 2RH0A 4ASWA 1AV1A 1VF5D 1JY2O 2E74D 3WMM0 1FDOA 1N7SA 1JTHB 2H88C 1LGHB 2WSCJ 4RESB 1S3JA 2GUVA 5APWA 3V6IA 2O01N 3TF5A 1MZ9A 2B9BA 3VP8A 3H1HE 3SWKA 3AE8C 2CK3H 1OX3A 3BCCG 3BVHA 3Q3DA 3D70A 3CX5I 5APVA 3L75D 4WY4B 4XFJA 2XNXA 2XKMA 1SQXG 5K5GB 1JY2N 1RE3C 3VP9A 1X9VA 1RH5B 2KZIA 3RBZA 3RL0g 3D71A 2AEFA 1K9MQ 3NTNA 4EYYQ 3KQGA 1L4AA 1PL5A 3L74G 2A06D 2ZYAA 1Q81Q 3M91A 5AVYB 4H0LD 4KJMA 4RKUJ 1GMJA 1VQ8P 3EFGA 1A02J 3C8VA 2HLOA 3WU2E 1HWTC 1SQQG 5CMZA 5C39A 1GL2A 3H1JE 2IBZE 5AVXB 4D6TG 2K88A 4U3FE 1FZCC 3CI9A 2W6JH 5CCGA 4JPZB 1PGOA 3SWYA 3A2AA 3CCEP 3B5ND 5APTA 1N73C 1SLQA 1KILD 2QE7H 1TU3F 3TDKA 1L0NG 1VQMP 5AW2B 1M1JA 3QH9A 2K3RA 2YO2A 1M8OB 3FXDA 3WUVA 1X79B 4U7JA 1EDJA 5KLVE 3UIAA 3H1IJ 1EXJA 3GF3A 1T3JA 3CX5E 3HD7C 2IZ0A 2ZXXA 2OARA 3L36A 2N1TB 4LLHA 1SQBK 1J2JB 2E76D 2CPSA 1W5CE 1J1DC 3H1ID 2BCCJ 4GDOA 1URQA 4WBAA 1ZOYC 3WUTA 3KXDA 3AE4C 3C1LA 2KNCA 3MZWB 2R5DA 4I6MC 1OVUA 3CWBG 1AJYA 2Q3IA 4YPCA 1RHZB 4W80A 3RL0D 4L75A 3KHUA 1PIXA 2FYUG 4MN4C 4OH8B 1FJPA 1LP1B 1S5LX 1S5LE 3PJSK 1LTBC 3IAOA 1FE6A 2WPQA 2QJKB 1NJIQ 1SFCB 4GKGA 5AW7B 3AE9C 1BCCE 3TGUG 1T8ZA 1BE3G 3C9IA 1SS1A 2LXBA 4NPEA 3KDPB 1RF1A 5H2FE 1SQXK 1FJKA 5AVUB 2KP8A 2MKVA 5AW3B 3HE4B 4Z1MH 3QWOC 2ZAEB 1M7LA 4ZMDA 1SQBD 3E1IA 3CMEP 4GODA 1IFDA 3L71G 1N7SC 4H44C 1KC8Q 1XTCC 4PD4D 3CXHH 2L91A 2I1JA 1NTMG 1CZQA 3NMDA 5KAFE 1CI6B 3JCUE 3L72G 3P8MC 3AEGC 3A3YB 2B87A 3WU2H 3CCMP 2WQYC 2JR8A 1NTKJ 1A02F 4IOIH 1SQQK 4Y99C 1IK7A 3BCCD 1HJBA 3L70G 2P10A 2H8PD 3PRJA 1PZQA 1VQOP 1LTJA 2M3EA 1FAVA 5L8RJ 3CC7P 4GIFA 3ZDMA 1X8YA 2C9NY 3CCSP 1L4AC 2GA1A 2E43A 1G1JA 2KXPB 1L0NK 2YXRB 1Q90D 3ABVC 4AQRD 3CX5H 3SFEC 2FFDC 3N4XA 4NPDA 1NU1E 1IO4A 3OW2O 1YHQP 1KYOE 1L0NE 3CCRP 1S2EA 2E75B 3H1KE 1VQ5P 1PGJA 1R5SA 3G3ZA 1GK6A 1EXIA 2YKOA 3MIWA 3P8CD 1GL2C 1EZVI 1OW7A 1L0LK 2QA4P 4H13B 3JC22 2K9JA 3U1AA 1VDFA 2OYHB 1UIIA 3H1HG 4R4MA 5CCGC 4W7ZA 1HH0A 1OIPA 1JCCA 3HUSB 1SQQD 3M9QA 3L4FA 2B89A 1BGYJ 2WSFH 1QVFO 5AVSB 5KLIC 1L0LE 2QIWA 5AW4B 4D6TD 4OGQC 4C7RA 2PAJA 2NRGA 5APXA 1M1JC 1VQ9P 1DD4A 1BGYD 1JTHA 1W2BO 1FS0E 4IFDK 2HYNA 3M9HA 1YQ4C 4DZOA 1NTZE 2JWAA 5H2FH 1Y8AA 3RK3E 1SQVE 2QRXA 1NO4A 2KS1B 2ZYDA 4IFMA 3G9RA 5TJHA 1CSBA 5CJ4A 2AXCA 3Q2YA 2OYOA 1URQC 2W27A 4WY4A 3Q1MA 3PHLA 3P32A 1AQTA 3ITKA 2YKQA 2WWWA 1PGQA 3JCUH 2R32A 2IPPA 2ZVNB 1IFMA 2G3AA 4H13C 3H1LJ 1NTMK 3H1JG 2FYUJ 2IBZG 1GD2E 1SQPJ 3MGNA 3U1CA 4U3FG 1S72P 3B4SA 3CWBD 4PV1B 3AE2C 3H1LD 2Q5UA 1T3UA 2FYUD 2KUBA 1SQPD 3TGUJ 1T2KC 1GU5A 3AE6C 2QJPC 1RF1C 2WZ7A 3TGUD 1M56D 4RO0A 5KLVG 2I8DA 1FC2C 2NPSB 2LR2A 4GT1A 3O8ZA 4N78D 3L71J 2WT7B 1JNMA 1NH4A 3EWKA 5AW0B 1NHLA 2RN0A 3R4YA 2QJYB 1M57D 2D2CB 4L73A 3H32B 3U59A 4IFFA 1JY3P 1OWAA 3L71D 5B66H 1H8AA 1NAYA 1ZV8A 2FKWB 1FDMA 5AVVB 4AYCA 1JMBA 1NTMD 2VRSA 3LW5H 3L72D 2RKLA 1YYCA 1K73Q 3HD7D 4BRYB 1EDKA 1LTGC 2HODB 1VQLP 4YTPC 2N1TA 1RY3A 4YXDC 1PP9E 3KZIH 1LTJC 1LWUB 1BCCG 1S4XA 2P58A 2WPVB 3LIDA 1KQSO 4C7NB 2ZT9C 3L75J 2G8YA 1YQ3C 3L70D 1BDDA 2I1KA 5DJTB 1P84I 3PLNA 1QGKB 3NFQA 1J1EC 3RK2C 2CPBA 1LTAC 1KQGB 1KD1Q 2W90A 2AEMA 4TLFA 1LP1A 1KFNA 2OTKE 1R8EA 3V2NA 3G6EP 5AW5B 3A0HE 1SFCA 3MHVA 2OYIB 5KAIH 1ZRTE 1N2DC 5AW6B 1LTSC 1ZMEC 2W6AA 3CPWO 3CMAP 1SP4A 2FXMA 2WSEH 2WTYA 1R5LA 4YXWH 3HE4A 3CXHE 3RK3C 2V7QH 3H1HD 1N7SD 4H44D 3IFMA 1KILE 2AEJA 4PD4I 3OAKA 1N86A 1S9KE 3CC4P 1VF5B 2E74B 1CI6A 5CJ0A 4HH2A 1Q2NA 2FY8A 2Q7CA 2XZRA 1WT6A 1JEKA 1JY2P 1DX7A 4WY4C 3Q5RA 1KZUB 5KLVK 1NU1G 3II6A 3KYQA 5BVZA 1YIJP 1HTLC 3L35A 3E7KA 4ZKUA 2M0BA 3W68A 5CBOA 3M0AA 2A45G 3H1KG 1VQNP 5CCHA 4IL6H 1LT1A 1N7LA 1AQ5A 2BCCE 3FWLA 1P84E 1JOCA 2MJZA 1OVRA 2FXOA 1L4AD 2WPRA 2WSCH 4K35A 4U3FJ 2P1JA 1AFOA 2YIUB 1L0LG 3H1JD 3L37A 2IBZD 3AEEC 4U3FD 1RE4A 1H88A 2RMZA 4H0LB 1QEXA 4JYCA 3GHGB 1G2CB 1GL2D 1DIPA 1NTZG 2IDBA 1WMKA 1SQVG 3I55P 5CCGD 2OYHA 3KPEA 1Y9BA 3HUSA 5KLVD 4KT0J 3AE5C 1AVOA 3CX5D 4OGQD 1VQPP 1DEBA 2JO1A 5AVWB 3VTPC 3B5NB 3Q5PA 1SQBJ 1KILB 3A0HH 5BU5A
chains in the Genus database with same CATH topology
1QGKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGK B; 
#chains in the Genus database with same CATH topology
 1IC2 A;  3V2R A;  1LTT C;  1DH3 A;  1MV8 A;  1VQ7 P;  1KQL A;  2KLV A;  4JQ0 D;  1JO5 A;  1D7M A;  1ZR4 A;  1L2P A;  2KS1 A;  2N1T C;  4JYB A;  4LGD E;  3VMZ A;  3CCV P;  5AW9 B;  1URQ D;  1PPJ E;  1NTK E;  2E76 B;  2O01 J;  2OQQ A;  2B88 A;  1YI2 P;  1T6A A;  3AE1 C;  2KIK A;  1KB9 I;  4H13 D;  3BCC J;  3CLQ A;  4XA4 A;  1HGV A;  1WRG A;  3RL0 B;  1ZW0 A;  4Y28 J;  3WUU A;  1SQX J;  5APU A;  4KHX A;  2V4H A;  2QJK C;  1SFC C;  2IFN A;  2W8Z A;  1FZG A;  4I7Z B;  1T2K D;  3VYI A;  2FYN B;  1E79 H;  3Q5S A;  1SQX D;  1QLE D;  3MP7 B;  1NU1 K;  3VMX A;  4A7P A;  3SWF A;  1OW8 A;  1P84 H;  3A5T A;  3L74 J;  4BWN A;  2AXT H;  1YIT P;  2O1J A;  4HJG H;  2NPS A;  2JEE A;  1RQV A;  1PFI A;  4W7Y A;  1BSN A;  2C0X A;  1FU1 A;  2XND H;  2K1A A;  2WT7 A;  3L74 D;  3G4S P;  2E42 A;  5KJ7 A;  5B66 E;  2KI7 B;  1PP9 G;  2ZFC A;  2ITA A;  3B71 A;  1BGY E;  4PJ0 E;  1SQQ J;  4NPF X;  3H32 A;  1YTZ T;  1EDL A;  2YKP A;  2Y0E A;  3VMY A;  4D6T J;  1G1I A;  2BEQ D;  3I5C A;  5AVZ B;  2R5B A;  3A0B E;  1H0T B;  1JB0 J;  2XV5 A;  2K37 A;  1YJW P;  4BRY A;  3KZI E;  1NTZ K;  5AW1 B;  5APS A;  2QVA A;  2HOD A;  2LXC B;  4UB6 H;  1L0N J;  1SQV K;  3GLM A;  5CCH C;  2FYN C;  3SFD C;  5GTH E;  2QSI A;  1LWU A;  1NU1 D;  3L73 E;  1GW4 A;  2ZT9 D;  5APQ A;  1JMM A;  1ZN5 A;  1KB9 E;  1KYO D;  1OMI A;  1YTZ I;  4C7N A;  1L0N D;  2PRR A;  3TNU B;  4B86 A;  1USD A;  3RK2 D;  4QMA A;  5APY A;  1L0L J;  1JY3 O;  1VL2 A;  1RE4 C;  3H1L E;  2N9Y B;  3HTK B;  1U7J A;  2JKV A;  1Z56 A;  1SQP E;  4DT0 A;  5KAI E;  2GM4 A;  2E75 C;  2YMK A;  3RBX A;  2WMM A;  2O1K A;  1L0L D;  3CWB J;  2OYI A;  1FZB A;  3V5B A;  2Q1K A;  3W67 A;  2OYH C;  2POH A;  3FX0 A;  1EQ7 A;  3HUS C;  2Z5I A;  1N8R Q;  2Y9Y A;  4EIJ A;  3VMA A;  1CW5 A;  3MUD A;  3G71 P;  2YO3 A;  1EDI A;  3RK3 D;  2K9Y A;  1SQV D;  5AVT B;  5E79 H;  1BE3 J;  2IYO A;  4DJG A;  1IFJ A;  2H89 C;  1EZV E;  3CCL P;  1Q86 Q;  2Z5H A;  4N6J A;  1OZH A;  3GG2 A;  2BCC G;  1BE3 D;  1IJD B;  1KTM A;  3EQ2 A;  4ZKP A;  4EI2 A;  2ZVO B;  2R3S A;  1U7M A;  2PFX A;  1UIX A;  1Q7Y Q;  4WY4 D;  5GTI H;  1NTM J;  4IL6 X;  3L72 J;  4HKZ H;  3AED C;  3AEA C;  4IL6 E;  2YMY A;  3F5H A;  2WIT A;  2KK7 A;  4PJ0 H;  3GW6 A;  3VN0 A;  2JWD A;  3E1R A;  2KB7 P;  3K5B A;  3A0B H;  3L75 E;  1FZA A;  4PV1 C;  1ZP0 C;  2KYV A;  3AE7 C;  2PP6 A;  3L70 J;  5KKZ B;  2IBZ I;  3TYY A;  2OTJ P;  1AA0 A;  3RGU A;  2BAS A;  3CCU P;  2E5T A;  1YJN P;  4I1L A;  5GTH H;  1MFZ A;  3GHG A;  3TK1 A;  1QL1 A;  1G2C A;  2NZ2 A;  1KB9 H;  3FWN A;  2NPS C;  2A06 E;  1AVY A;  1OXZ A;  5KTB A;  5EFW B;  1FDI A;  2P67 A;  4UB8 E;  5KJ7 C;  1K04 A;  1S1C X;  1NWQ A;  4BXL A;  3H6P A;  1NYH A;  1FZC B;  1PPJ G;  4DOJ A;  2QJY C;  1PP9 J;  1IZN B;  2D2C C;  1NTK G;  4OVN F;  2QM7 A;  2W83 C;  1U57 A;  3MTU E;  3MD0 A;  3T97 B;  1M1K Q;  3V4Q A;  3PH0 A;  3B5N A;  1N73 B;  1KIL A;  1PP9 D;  3H1H J;  3M0D A;  1ZXG A;  4WWI A;  4EOT A;  3P7K A;  4DCK A;  2N1T D;  2M5A B;  1FBM A;  3BAS A;  2E5Y A;  1VPC A;  3HD7 B;  5KKZ C;  4R4L A;  2O3J A;  3GF7 A;  1LWU C;  3N7N A;  4TT3 H;  4WB4 A;  2Q9I A;  1J1D B;  1X22 A;  2C9L Y;  1FZF A;  2FFD A;  1HBW A;  1EC5 A;  1JM0 A;  2IZ1 A;  3CL3 D;  3BRV B;  3D6Y A;  4GOE A;  1M90 Q;  1ZRT D;  3H25 A;  5CBN A;  3JSV C;  1DEE G;  3I56 P;  1OFC X;  3S1K A;  3H1I E;  1MUU A;  1RF0 A;  2ZYG A;  2FBW C;  4JF7 A;  1MFT A;  1SFC D;  2WPS A;  3M9B A;  2OYI C;  1BGY G;  3CXH D;  1NKZ B;  4L76 A;  3O6Q B;  3AE3 C;  1FZE A;  3H1J J;  2AXT E;  1W2E A;  3FGA D;  2JDI H;  1S9K D;  1LT9 A;  1IFN A;  2M3B A;  3D6Z A;  3LIE A;  3HE5 B;  3MUD C;  2QEX P;  2IFM A;  1GK4 A;  2N9B A;  1NKN A;  2J58 A;  4HB1 A;  3S9O A;  2SPZ A;  2WSS H;  1SVF A;  1RQU A;  1N7S B;  3AEB C;  1VF5 C;  2E74 C;  2KZJ A;  4H44 B;  3L73 G;  2LKM A;  5KLV J;  3F89 A;  1IFI A;  1FOS F;  1SQB E;  3CCQ P;  3GMA A;  1LTI C;  2BCC D;  5AVQ B;  1KFM A;  5DJU B;  1H0T A;  1P84 D;  3FXE A;  3USS A;  1HJ0 A;  2P2U A;  4UB6 E;  1HGZ A;  1E5W A;  4PD4 E;  3H1L G;  1USE A;  5TIS E;  4UB8 H;  2J59 M;  1SQP G;  3IN6 A;  3BAT A;  4Y99 B;  5CCH D;  1VQ6 P;  2KSJ A;  1X0T A;  4C46 A;  2HPC A;  1GW3 A;  1XTG B;  1KYO I;  1NTK K;  2IYP A;  2WSF J;  2Q3E A;  2A45 I;  4EDF A;  3TNU A;  1PGP A;  1L4A B;  4O9B A;  2YIU C;  1DD3 A;  3BCC E;  1BCC J;  4WVZ A;  3HTK A;  3OA7 A;  2FFD B;  2E75 D;  1KOR A;  4H0L C;  1EZV G;  1SQX E;  3B8E B;  3R2P A;  3SSU A;  1PV3 A;  2HR3 A;  3GHG C;  4AUW A;  2P7J A;  1BCC D;  2Y0D A;  4ASV A;  1ZR2 A;  1GL2 B;  3VOP A;  2R3C A;  5E79 E;  3PTZ A;  1Y47 A;  1KN7 A;  2XDJ A;  3V2P A;  3L74 E;  3IF4 A;  4XE5 B;  3EFF K;  3B5N C;  4RJT A;  3HRN A;  5KLI B;  3P8C E;  1NOH A;  1KIL C;  5AVR B;  4OGQ B;  1KV4 A;  1LT9 B;  1GZL A;  1M1J B;  1OVV A;  1PPJ D;  3M0D C;  1NTK D;  3IR9 A;  2FYZ A;  1SQQ E;  2HFE D;  3V4W A;  5GTI E;  3V2Q A;  3L75 G;  2M8R A;  1KMI Z;  2Z4E A;  4JBZ A;  4D6T E;  5BU8 B;  1H89 A;  1YJ9 P;  2E76 C;  1URQ B;  1QL2 A;  2OTL P;  3AEC C;  3S4R A;  2KNC B;  2KSE A;  3AEF C;  5B5E E;  4N3Y B;  1RE3 A;  2JP3 A;  2A06 G;  3CCJ P;  3RL0 C;  1NAF A;  1NU1 J;  2Y0C A;  2QG4 A;  1RF0 C;  4PV1 D;  2BEZ F;  2HG5 D;  4ZNC A;  1MKM A;  4PD4 H;  4M3L A;  3H1K J;  1YBK A;  4I7Z C;  5TIS H;  2QM8 A;  2YXQ B;  2HPC B;  1NGM B;  3LW5 J;  1LT9 C;  2QJP B;  1GDT A;  2FYU K;  5CHX A;  1S5L H;  1SQP K;  3H1K D;  1RF1 B;  2YNY A;  4LC1 A;  1Q82 Q;  2UWJ E;  2O01 H;  4GOF A;  2ZXE B;  2NPS D;  5M1B A;  3CWB E;  3PP5 A;  1K8A Q;  2FYU E;  2XU6 A;  5KJ7 D;  3OJA B;  2D2C D;  3BRT B;  1ZLL A;  1KQF B;  1FZC A;  3L73 J;  1IFP A;  3TGU E;  2ZJS E;  1NTZ J;  3T97 A;  1BE3 E;  1SQV J;  2B87 B;  1N73 A;  1QX8 A;  4I2L C;  2OGU A;  5KAF H;  3L73 D;  1VQK P;  1HF9 A;  2J5U A;  4N78 E;  1OW6 A;  1NTZ D;  1GTW A;  1KB9 D;  1BSH A;  3H1I G;  1VQ4 P;  1JY3 N;  2M5A A;  3M06 A;  3CC2 P;  3HD7 A;  3L71 E;  2PGD A;  4CPG A;  1K05 A;  2IX7 C;  2KOG A;  1IK9 A;  1NTM E;  2WSE J;  1LTJ B;  3L72 E;  1LNQ A;  2L5G B;  4OWF A;  1HVV A;  2ZT9 B;  4K3A A;  2V7Q J;  1JCD A;  1GU4 A;  4L74 A;  3CD6 P;  1J1E B;  2DW3 A;  3RK2 B;  2W6B A;  2H43 A;  2H7H A;  1HUC A;  3CXH I;  3L70 E;  2KLU A;  4HYT B;  1QVG O;  2Q6Q A;  2FXP A;  3A7O A;  1LJ2 A;  3O6Q A;  1FOS E;  1JUN A;  1KYO H;  1EZV D;  5B5E H;  2WVR A;  2K9J B;  2A45 H;  3NXS A;  2Y9Z A;  1SQB G;  1BDC A;  3HE5 A;  1NVO A;  2GUS A;  5AW8 B;  3TSI A;  2C0W A;  3RK3 B;  2JJL A;  2R44 A;  2RH0 A;  4ASW A;  1AV1 A;  1VF5 D;  1JY2 O;  2E74 D;  3WMM 0;  1FDO A;  1N7S A;  1JTH B;  2H88 C;  1LGH B;  2WSC J;  4RES B;  1S3J A;  2GUV A;  5APW A;  3V6I A;  2O01 N;  3TF5 A;  1MZ9 A;  2B9B A;  3VP8 A;  3H1H E;  3SWK A;  3AE8 C;  2CK3 H;  1OX3 A;  3BCC G;  3BVH A;  3Q3D A;  3D70 A;  3CX5 I;  5APV A;  3L75 D;  4WY4 B;  4XFJ A;  2XNX A;  2XKM A;  1SQX G;  5K5G B;  1JY2 N;  1RE3 C;  3VP9 A;  1X9V A;  1RH5 B;  2KZI A;  3RBZ A;  3RL0 g;  3D71 A;  2AEF A;  1K9M Q;  3NTN A;  4EYY Q;  3KQG A;  1L4A A;  1PL5 A;  3L74 G;  2A06 D;  2ZYA A;  1Q81 Q;  3M91 A;  5AVY B;  4H0L D;  4KJM A;  4RKU J;  1GMJ A;  1VQ8 P;  3EFG A;  1A02 J;  3C8V A;  2HLO A;  3WU2 E;  1HWT C;  1SQQ G;  5CMZ A;  5C39 A;  1GL2 A;  3H1J E;  2IBZ E;  5AVX B;  4D6T G;  2K88 A;  4U3F E;  1FZC C;  3CI9 A;  2W6J H;  5CCG A;  4JPZ B;  1PGO A;  3SWY A;  3A2A A;  3CCE P;  3B5N D;  5APT A;  1N73 C;  1SLQ A;  1KIL D;  2QE7 H;  1TU3 F;  3TDK A;  1L0N G;  1VQM P;  5AW2 B;  1M1J A;  3QH9 A;  2K3R A;  2YO2 A;  1M8O B;  3FXD A;  3WUV A;  1X79 B;  4U7J A;  1EDJ A;  5KLV E;  3UIA A;  3H1I J;  1EXJ A;  3GF3 A;  1T3J A;  3CX5 E;  3HD7 C;  2IZ0 A;  2ZXX A;  2OAR A;  3L36 A;  2N1T B;  4LLH A;  1SQB K;  1J2J B;  2E76 D;  2CPS A;  1W5C E;  1J1D C;  3H1I D;  2BCC J;  4GDO A;  1URQ A;  4WBA A;  1ZOY C;  3WUT A;  3KXD A;  3AE4 C;  3C1L A;  2KNC A;  3MZW B;  2R5D A;  4I6M C;  1OVU A;  3CWB G;  1AJY A;  2Q3I A;  4YPC A;  1RHZ B;  4W80 A;  3RL0 D;  4L75 A;  3KHU A;  1PIX A;  2FYU G;  4MN4 C;  4OH8 B;  1FJP A;  1LP1 B;  1S5L X;  1S5L E;  3PJS K;  1LTB C;  3IAO A;  1FE6 A;  2WPQ A;  2QJK B;  1NJI Q;  1SFC B;  4GKG A;  5AW7 B;  3AE9 C;  1BCC E;  3TGU G;  1T8Z A;  1BE3 G;  3C9I A;  1SS1 A;  2LXB A;  4NPE A;  3KDP B;  1RF1 A;  5H2F E;  1SQX K;  1FJK A;  5AVU B;  2KP8 A;  2MKV A;  5AW3 B;  3HE4 B;  4Z1M H;  3QWO C;  2ZAE B;  1M7L A;  4ZMD A;  1SQB D;  3E1I A;  3CME P;  4GOD A;  1IFD A;  3L71 G;  1N7S C;  4H44 C;  1KC8 Q;  1XTC C;  4PD4 D;  3CXH H;  2L91 A;  2I1J A;  1NTM G;  1CZQ A;  3NMD A;  5KAF E;  1CI6 B;  3JCU E;  3L72 G;  3P8M C;  3AEG C;  3A3Y B;  2B87 A;  3WU2 H;  3CCM P;  2WQY C;  2JR8 A;  1NTK J;  1A02 F;  4IOI H;  1SQQ K;  4Y99 C;  1IK7 A;  3BCC D;  1HJB A;  3L70 G;  2P10 A;  2H8P D;  3PRJ A;  1PZQ A;  1VQO P;  1LTJ A;  2M3E A;  1FAV A;  5L8R J;  3CC7 P;  4GIF A;  3ZDM A;  1X8Y A;  2C9N Y;  3CCS P;  1L4A C;  2GA1 A;  2E43 A;  1G1J A;  2KXP B;  1L0N K;  2YXR B;  1Q90 D;  3ABV C;  4AQR D;  3CX5 H;  3SFE C;  2FFD C;  3N4X A;  4NPD A;  1NU1 E;  1IO4 A;  3OW2 O;  1YHQ P;  1KYO E;  1L0N E;  3CCR P;  1S2E A;  2E75 B;  3H1K E;  1VQ5 P;  1PGJ A;  1R5S A;  3G3Z A;  1GK6 A;  1EXI A;  2YKO A;  3MIW A;  3P8C D;  1GL2 C;  1EZV I;  1OW7 A;  1L0L K;  2QA4 P;  4H13 B;  3JC2 2;  2K9J A;  3U1A A;  1VDF A;  2OYH B;  1UII A;  3H1H G;  4R4M A;  5CCG C;  4W7Z A;  1HH0 A;  1OIP A;  1JCC A;  3HUS B;  1SQQ D;  3M9Q A;  3L4F A;  2B89 A;  1BGY J;  2WSF H;  1QVF O;  5AVS B;  5KLI C;  1L0L E;  2QIW A;  5AW4 B;  4D6T D;  4OGQ C;  4C7R A;  2PAJ A;  2NRG A;  5APX A;  1M1J C;  1VQ9 P;  1DD4 A;  1BGY D;  1JTH A;  1W2B O;  1FS0 E;  4IFD K;  2HYN A;  3M9H A;  1YQ4 C;  4DZO A;  1NTZ E;  2JWA A;  5H2F H;  1Y8A A;  3RK3 E;  1SQV E;  2QRX A;  1NO4 A;  2KS1 B;  2ZYD A;  4IFM A;  3G9R A;  5TJH A;  1CSB A;  5CJ4 A;  2AXC A;  3Q2Y A;  2OYO A;  1URQ C;  2W27 A;  4WY4 A;  3Q1M A;  3PHL A;  3P32 A;  1AQT A;  3ITK A;  2YKQ A;  2WWW A;  1PGQ A;  3JCU H;  2R32 A;  2IPP A;  2ZVN B;  1IFM A;  2G3A A;  4H13 C;  3H1L J;  1NTM K;  3H1J G;  2FYU J;  2IBZ G;  1GD2 E;  1SQP J;  3MGN A;  3U1C A;  4U3F G;  1S72 P;  3B4S A;  3CWB D;  4PV1 B;  3AE2 C;  3H1L D;  2Q5U A;  1T3U A;  2FYU D;  2KUB A;  1SQP D;  3TGU J;  1T2K C;  1GU5 A;  3AE6 C;  2QJP C;  1RF1 C;  2WZ7 A;  3TGU D;  1M56 D;  4RO0 A;  5KLV G;  2I8D A;  1FC2 C;  2NPS B;  2LR2 A;  4GT1 A;  3O8Z A;  4N78 D;  3L71 J;  2WT7 B;  1JNM A;  1NH4 A;  3EWK A;  5AW0 B;  1NHL A;  2RN0 A;  3R4Y A;  2QJY B;  1M57 D;  2D2C B;  4L73 A;  3H32 B;  3U59 A;  4IFF A;  1JY3 P;  1OWA A;  3L71 D;  5B66 H;  1H8A A;  1NAY A;  1ZV8 A;  2FKW B;  1FDM A;  5AVV B;  4AYC A;  1JMB A;  1NTM D;  2VRS A;  3LW5 H;  3L72 D;  2RKL A;  1YYC A;  1K73 Q;  3HD7 D;  4BRY B;  1EDK A;  1LTG C;  2HOD B;  1VQL P;  4YTP C;  2N1T A;  1RY3 A;  4YXD C;  1PP9 E;  3KZI H;  1LTJ C;  1LWU B;  1BCC G;  1S4X A;  2P58 A;  2WPV B;  3LID A;  1KQS O;  4C7N B;  2ZT9 C;  3L75 J;  2G8Y A;  1YQ3 C;  3L70 D;  1BDD A;  2I1K A;  5DJT B;  1P84 I;  3PLN A;  1QGK B;  3NFQ A;  1J1E C;  3RK2 C;  2CPB A;  1LTA C;  1KQG B;  1KD1 Q;  2W90 A;  2AEM A;  4TLF A;  1LP1 A;  1KFN A;  2OTK E;  1R8E A;  3V2N A;  3G6E P;  5AW5 B;  3A0H E;  1SFC A;  3MHV A;  2OYI B;  5KAI H;  1ZRT E;  1N2D C;  5AW6 B;  1LTS C;  1ZME C;  2W6A A;  3CPW O;  3CMA P;  1SP4 A;  2FXM A;  2WSE H;  2WTY A;  1R5L A;  4YXW H;  3HE4 A;  3CXH E;  3RK3 C;  2V7Q H;  3H1H D;  1N7S D;  4H44 D;  3IFM A;  1KIL E;  2AEJ A;  4PD4 I;  3OAK A;  1N86 A;  1S9K E;  3CC4 P;  1VF5 B;  2E74 B;  1CI6 A;  5CJ0 A;  4HH2 A;  1Q2N A;  2FY8 A;  2Q7C A;  2XZR A;  1WT6 A;  1JEK A;  1JY2 P;  1DX7 A;  4WY4 C;  3Q5R A;  1KZU B;  5KLV K;  1NU1 G;  3II6 A;  3KYQ A;  5BVZ A;  1YIJ P;  1HTL C;  3L35 A;  3E7K A;  4ZKU A;  2M0B A;  3W68 A;  5CBO A;  3M0A A;  2A45 G;  3H1K G;  1VQN P;  5CCH A;  4IL6 H;  1LT1 A;  1N7L A;  1AQ5 A;  2BCC E;  3FWL A;  1P84 E;  1JOC A;  2MJZ A;  1OVR A;  2FXO A;  1L4A D;  2WPR A;  2WSC H;  4K35 A;  4U3F J;  2P1J A;  1AFO A;  2YIU B;  1L0L G;  3H1J D;  3L37 A;  2IBZ D;  3AEE C;  4U3F D;  1RE4 A;  1H88 A;  2RMZ A;  4H0L B;  1QEX A;  4JYC A;  3GHG B;  1G2C B;  1GL2 D;  1DIP A;  1NTZ G;  2IDB A;  1WMK A;  1SQV G;  3I55 P;  5CCG D;  2OYH A;  3KPE A;  1Y9B A;  3HUS A;  5KLV D;  4KT0 J;  3AE5 C;  1AVO A;  3CX5 D;  4OGQ D;  1VQP P;  1DEB A;  2JO1 A;  5AVW B;  3VTP C;  3B5N B;  3Q5P A;  1SQB J;  1KIL B;  3A0H H;  5BU5 A; 
#chains in the Genus database with same CATH homology
 1QGK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...