1QGKB

Structure of importin beta bound to the ibb domain of importin alpha
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
44
structure length
44
Chain Sequence
AARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport receptor
molecule keywords PROTEIN (IMPORTIN BETA SUBUNIT)
publication title Structure of importin-beta bound to the IBB domain of importin-alpha.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 1999-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.690 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Importin-alpha, importin-beta-binding domain 1qgkB00
1QGKB
chains in the Genus database with same CATH superfamily
2Q9IA 1FDOA 2IBZE 5CCHC 2UWJE 2C9NY 5KLVG 5KLIB 1S2EA 3D6ZA 2Y9YA 2H8PD 3MD0A 1VQ4P 1G1IA 2Q1KA 3H32B 3KZIH 5KJ7A 1H0TB 2WTYA 4KJMA 2W6BA 1T2KC 2AXCA 1GU4A 4UB8E 3HE4A 3USSA 3PTZA 2JWDA 4H13C 1VQ7P 3L73G 4Z1MH 3BVHA 3H1LG 3TGUJ 4DOJA 3B5ND 3S4RA 2FYNC 5AW8B 3MTUE 4U3FE 5TISE 1LTGC 1U57A 1YIJP 2YIUC 1SQPE 2WSSH 3M9BA 1LWUB 2JJLA 3WMM0 1NU1K 2JR8A 2HPCA 1QX8A 4WB4A 1EDJA 1Y9BA 3P7KA 1SQVD 1RF0C 4BRYA 3B5NB 2A45H 3Q5RA 2K9JA 1Q90D 1CSBA 4YPCA 2JEEA 1FJPA 1ZW0A 2OGUA 3KPEA 2B89A 3V2PA 3CXHE 4NPFX 4JQ0D 1AVOA 2L91A 3GHGA 1MUUA 3L74J 4U7JA 5AW2B 3VMZA 3W68A 3TGUE 1X0TA 5AVRB 1JEKA 1YJNP 3CMAP 1SQQD 3VMYA 3PH0A 3RBXA 1PPJE 2HFED 3II6A 3VMAA 5AW7B 3BCCJ 4HH2A 4EOTA 1SQVK 3CX5I 3BRTB 2E5TA 1KTMA 2QG4A 2W8ZA 5CCGD 5KAFH 3LW5H 4WVZA 3NXSA 5E79H 1BGYD 2M3EA 1DEEG 3NTNA 1OX3A 3PJSK 4NPDA 4RESB 1KZUB 4W7YA 2YXRB 3VTPC 1VF5C 2N1TB 2ZT9D 2ZYGA 2A06G 1W5CE 2O01N 4XFJA 1N7SD 4YTPC 2PRRA 1YTZI 1BE3J 1LTJC 3H1HJ 1KMIZ 4L75A 1YJWP 2P67A 5APWA 5K5GB 1SQQK 1VQ6P 1Q86Q 1QVGO 4LC1A 1NU1G 1PP9D 1FZCA 1BSHA 3L74E 3UIAA 1YBKA 1IFNA 2QJYC 3KHUA 1JNMA 1FJKA 2IYPA 1PGJA 3CCRP 1S72P 3CLQA 2OYHC 2YNYA 1S4XA 3CWBE 1CW5A 4HJGH 3BCCE 2IZ0A 2Q3EA 3H1IE 1GD2E 4ASVA 2BCCD 3L4FA 2J58A 3I55P 4GODA 5AVTB 2C9LY 1N7SA 1ZRTD 3FWLA 1N86A 5CJ4A 5B66H 1J2JB 1J1EC 5GTIH 2QRXA 2IYOA 4GIFA 1DX7A 2ZYAA 1BE3E 3CCJP 3H1HE 1SQVG 3C1LA 2NPSD 2W83C 2ZXXA 1N73C 3AE3C 2KK7A 1NTZE 3FXDA 1ZV8A 5CCHD 2MKVA 4D6TD 3TK1A 2FYUJ 1Q82Q 1EDLA 1AQ5A 1L0ND 3L75D 3O8ZA 1M90Q 4I2LC 1SQQG 1LT1A 1X8YA 3HE5B 1KORA 4RO0A 1JY2P 3GMAA 1K05A 1P84I 1KV4A 2P7JA 4XE5B 1BGYG 2HODB 3OW2O 5KLIC 1IK9A 1S5LE 1VQ8P 3T97A 1G2CA 2KS1A 2W90A 2J59M 3AE5C 2NPSA 2PGDA 4B86A 4C7NA 1Z56A 1KILA 5KAIE 4PV1D 2AEFA 5CCHA 1EDKA 3MUDA 3PHLA 4OGQD 3KYQA 1OW7A 3G71P 1EXJA 2HR3A 2FXMA 2O01H 1S3JA 1YYCA 4PJ0E 2V4HA 3CCSP 4PD4E 1M7LA 4BXLA 3D70A 2CPSA 5AVUB 1VQKP 1LTAC 3QWOC 1GK4A 1QGKB 2FXPA 3IAOA 1LWUC 1PGQA 2WPVB 1NTMD 4OGQB 1VQ5P 3TNUA 2BCCG 2M8RA 3RK2D 2OTLP 2WSEJ 2YKQA 1EZVE 1QEXA 3B5NC 1JY3N 4ZNCA 3IFMA 2LXCB 2E76D 2A45G 3G3ZA 3BRVB 1M1JB 2KXPB 3CC7P 1RF0A 5GTHE 1FDMA 1LNQA 1FZGA 2Q3IA 2BEQD 1EQ7A 2RKLA 1NTMK 2G3AA 4D6TG 4R4LA 3P8CE 4XA4A 1AJYA 2E76B 2QVAA 1QVFO 3I56P 4R4MA 2K37A 1N7LA 4YXDC 2N1TC 2R5BA 5CBOA 3G9RA 1SS1A 1FZCC 2WZ7A 5B5EE 3GG2A 3MZWB 1KD1Q 3Q5PA 3IN6A 5CBNA 1SQBK 3HUSB 1KYOE 3V2NA 1USEA 1LTIC 3W67A 5CCGC 1BCCE 1JY3P 2QE7H 2WMMA 2IBZI 3KXDA 3RK3D 5L8RJ 3SWYA 3L72E 2ZT9C 2RN0A 3FXEA 4WWIA 4HYTB 2P2UA 1LTJA 1L0LJ 1N7SC 4YXWH 1YITP 4AUWA 2Z4EA 3FX0A 3BCCD 3IR9A 3AE9C 3B8EB 2E75D 2YO3A 4ZKPA 1XTCC 2LR2A 3MP7B 2OYHA 5CHXA 3VP8A 1NTMG 2WITA 1UIIA 1J1DB 2E75B 3H1KJ 3A5TA 1M8OB 2R44A 3G4SP 3L70D 2M5AA 1NAYA 3V4WA 4K3AA 1JMMA 1L0LE 1KB9E 3MHVA 5GTHH 1JTHB 1P84H 2XU6A 1SQBG 1KILE 2KI7B 2FY8A 3TSIA 2Q7CA 1SQPJ 1Q81Q 2NPSC 2PAJA 1KFMA 4ZMDA 2XNXA 3R2PA 4OH8B 3AEEC 5APVA 3MUDC 2QM7A 3HTKB 1UIXA 3RBZA 1CI6A 2WSEH 4WBAA 3JCUE 2ZVOB 3A0BH 3TF5A 3H1KE 3E1RA 5BVZA 2JWAA 4RJTA 2AEMA 1GMJA 3C9IA 1JM0A 2R32A 1KQFB 3H32A 2KLVA 3Q3DA 1H0TA 3RL0D 1DEBA 2FYUD 1SLQA 2P10A 2J5UA 3CI9A 1ZOYC 1QL1A 4PV1C 3H1JJ 3TDKA 4OGQC 1YI2P 5C39A 1KQGB 4BRYB 3RL0B 5KLVJ 1X79B 1H8AA 1N2DC 1L4AB 1LWUA 2FYUK 1KC8Q 2OTJP 4W7ZA 2WSCJ 1M1JC 4GOEA 1GZLA 2N1TD 2D2CB 3ABVC 2RMZA 1JMBA 1QLED 3G6EP 2B88A 3L71D 3B5NA 4DT0A 1JUNA 1S9KE 3L70G 3RK2C 1GL2D 1P84D 2JO1A 3GF3A 1HGZA 3CWBJ 5APSA 3L73J 5APTA 2WPQA 3PLNA 2QJPC 3P8CD 3VP9A 4GT1A 1IO4A 2E76C 3H1IJ 2MJZA 1VQMP 2E43A 2BASA 2KSJA 1EC5A 1MZ9A 3H1JE 1RE3C 2E42A 2OYIB 3CCLP 2JKVA 4N78D 3F89A 1SQXE 1GL2B 1T3JA 3NMDA 1WRGA 1Q7YQ 5KLVE 5DJTB 3HUSC 5AW0B 2WVRA 1VQPP 3CC4P 2NZ2A 3U1AA 2FFDB 1L2PA 3K5BA 2N1TA 2P1JA 2IPPA 1NTZJ 4OWFA 1NTKJ 4UB8H 1RE4C 1FOSF 2OARA 1RQVA 5APYA 4TLFA 1VQ9P 3L73E 4H44D 3A0HE 4WY4D 3H1LE 4N6JA 2FYUG 3M0AA 1ZLLA 5CCGA 4UB6E 1PGPA 2GA1A 3V2RA 2AXTE 5TISH 1FE6A 1YQ4C 5AW3B 1RF1B 3RK3C 3O6QB 3B4SA 3PP5A 2XKMA 1U7MA 2KZJA 4H44B 4WY4B 1S1CX 2K9YA 2WWWA 2XV5A 1YHQP 2E75C 3E1IA 2XZRA 2GM4A 2H88C 3AEFC 1IFDA 3M0DC 1NTKE 2KNCB 1E5WA 3CXHH 1NU1J 2NRGA 1RH5B 1DIPA 3L71G 4H0LB 1L0LD 4LGDE 1ZXGA 2B9BA 4I7ZC 1BDCA 3CX5E 1U7JA 1FOSE 3E7KA 1URQD 4IOIH 2PP6A 1HUCA 2R3SA 2POHA 2IBZD 4Y99B 2WT7B 5AVXB 3D6YA 3P32A 2KOGA 2A06E 1LP1B 2YMKA 3HE5A 2Z5HA 1URQB 3AE6C 1OVUA 1L0NK 1SQVJ 1BDDA 1M56D 3EFFK 1PP9G 1D7MA 2KB7P 1NU1E 2RH0A 1SFCD 2M3BA 1NYHA 3L35A 4LLHA 3SWFA 4U3FD 3WUTA 3AE4C 1SQPD 2V7QJ 4M3LA 5AW6B 5H2FE 1ZR2A 1SQQJ 1HWTC 2FYNB 3MGNA 1NVOA 4DJGA 1LJ2A 4IL6E 3RL0C 1SFCB 1BGYJ 5AVZB 1L4AC 1IFIA 3TYYA 5M1BA 2HYNA 3SFDC 1SQVE 3VN0A 1HF9A 1BCCJ 3CXHD 2QM8A 3L72J 1VDFA 1G1JA 3TGUD 1R8EA 4KT0J 3Q5SA 2QJKB 1PPJD 1HH0A 1M1JA 1H89A 3HD7D 1AA0A 1L0LG 2FYZA 1L0NG 3L75G 1HBWA 5APXA 1SQQE 4DZOA 5KKZB 4EIJA 3RL0g 1GTWA 2OYIC 1KB9I 3WU2E 1DH3A 1GL2C 1PV3A 2BCCJ 2IBZG 1BGYE 1S5LH 2R5DA 1VF5B 3HD7B 3H25A 3RGUA 1NOHA 1T8ZA 1RE3A 4I1LA 5KAIH 3KZIE 1MFZA 1IFJA 3L74D 3V2QA 1ZP0C 5AW9B 3HUSA 3CWBD 4EDFA 3L73D 4PJ0H 1S5LX 3R4YA 2QA4P 3NFQA 4L73A 1VQNP 1KN7A 1KQSO 4PD4H 3H1ID 3JSVC 3GW6A 3U1CA 1RE4A 1K8AQ 3D71A 4D6TJ 5CMZA 1NAFA 1M57D 4U3FG 1FBMA 1A02F 2KSEA 1SQPG 3SSUA 1VQOP 2KYVA 1K04A 3LW5J 3M9QA 2BCCE 2CK3H 4H44C 4WY4C 1T3UA 1BE3D 2IZ1A 3H1HD 2B87B 5TJHA 1WT6A 1ZRTE 5APUA 2I8DA 1GDTA 2SPZA 3GF7A 1R5LA 4W80A 3FGAD 1OIPA 1NTZD 1NTKD 2E5YA 2GUSA 3S9OA 2HLOA 1HVVA 3A3YB 4EI2A 3CCMP 1N73B 1MKMA 1FS0E 1PIXA 3TGUG 1LT9B 3S1KA 2OQQA 4K35A 3Q1MA 3KDPB 3M0DA 3EWKA 4D6TE 3M9HA 1NO4A 1PPJG 1YJ9P 1M1KQ 3CXHI 2W6AA 1KFNA 1HJBA 2V7QH 2BEZF 1JTHA 2K1AA 4Y99C 3AEDC 5KAFE 5E79E 1NTZK 1EDIA 2W27A 2H7HA 2E74B 5B5EH 1NH4A 5APQA 1TU3F 4GKGA 3HE4B 1VL2A 1KYOH 1URQC 1R5SA 3I5CA 1Y8AA 3HTKA 2O1KA 1GW4A 2O1JA 1NU1D 2C0XA 3L74G 5AVYB 3IF4A 4PD4D 1L4AD 5AW5B 3PRJA 3CWBG 3EQ2A 1SQBJ 1GK6A 2FBWC 2D2CD 3BCCG 1FU1A 4I6MC 1GU5A 2HPCB 3H1IG 3GLMA 2M0BA 1SQXJ 2QSIA 2ZVNB 1EZVD 1SFCC 2Y0CA 2K9JB 2I1KA 1NTME 3WUUA 3VOPA 3CCUP 5B66E 3CCVP 3CD6P 5GTIE 1IFPA 2KUBA 1ZR4A 1BE3G 2Z5IA 3H1HG 3GHGB 4O9BA 4TT3H 3V6IA 2YKOA 1NTZG 3BATA 1IZNB 1NTKG 1BSNA 1L4AA 1LTSC 1T6AA 2I1JA 3H1LJ 2QJKC 1KB9H 4C7RA 5AVQB 2O01J 2KZIA 2K3RA 4EYYQ 1SQBE 1NGMB 3H6PA 2O3JA 1YQ3C 5KKZC 1VPCA 3A2AA 5AVWB 3M91A 3OAKA 3F5HA 2YKPA 3HD7C 3AE8C 1KYOD 3JCUH 1FZCB 2OYIA 1QL2A 1DD3A 1X22A 2ZXEB 1BCCD 2DW3A 1GL2A 3L72D 4L74A 1JCCA 1Y47A 3U59A 1FZAA 2OTKE 2FFDA 1ZN5A 1H88A 3RK3E 3L70J 3CPWO 1VQLP 2QEXP 1MFTA 4AQRD 2ZAEB 2ZT9B 1YTZT 3P8MC 1JY2O 1NHLA 2LKMA 4MN4C 1ZMEC 1JY2N 1OW6A 1N7SB 1OVRA 2XNDH 3LIEA 4H0LD 2YXQB 4PD4I 2WPSA 1EZVG 1K73Q 2ZFCA 1NWQA 1RF1A 1J1DC 3VYIA 3O6QA 1JB0J 2Y0DA 1E79H 3N4XA 4JYBA 3B71A 2PFXA 1DD4A 2N9BA 1LGHB 1EZVI 4WY4A 3AE1C 2P58A 4AYCA 1KB9D 2IDBA 1LT9C 1JO5A 1KILD 3L70E 3CMEP 1KQLA 2KNCA 1N8RQ 3KQGA 4CPGA 3T97B 5BU5A 1G2CB 1T2KD 2KS1B 3AEAC 2NPSB 5KJ7C 2E74C 5AVVB 4C7NB 1OWAA 4H13D 1KILB 3HRNA 1HTLC 3V4QA 2WSFJ 1L0LK 3JC22 2ITAA 3H1KD 2HODA 2WT7A 2WSCH 3EFGA 4GOFA 1OZHA 1FZBA 3C8VA 3AEBC 1BCCG 1LP1A 2WPRA 3L72G 3AE7C 2L5GB 1IC2A 4L76A 1KYOI 2Q5UA 1URQA 4H13B 3A0HH 3L71J 4JF7A 4KHXA 4GDOA 1W2EA 1NKZB 4UB6H 2FYUE 1LTTC 1WMKA 3LIDA 3TNUB 2AXTH 3BASA 2JP3A 4Y28J 2YIUB 1RY3A 3L36A 3OJAB 5AVSB 4PV1B 2H89C 5DJUB 1IK7A 1JY3O 3GHGC 2D2CC 4BWNA 1AV1A 1SQPK 1SFCA 3L37A 3CCQP 3A7OA 1S9KD 3AEGC 1FZFA 2OYOA 3M06A 1PP9J 2KIKA 1VF5D 3VMXA 3L71E 4HKZH 1JCDA 2CPBA 3CX5H 1OW8A 4DCKA 2R3CA 2A45I 1SQBD 1P84E 4C46A 3RK2B 2Y0EA 2FKWB 3H1JD 1HJ0A 1IFMA 1RQUA 4OVNF 2QJPB 1OVVA 1PFIA 1FC2C 1PGOA 2AEJA 1IJDB 1NJIQ 1NKNA 3ITKA 3QH9A 1SQXD 2W6JH 4NPEA 1OMIA 5KLVD 1HGVA 1FZEA 2FFDC 5EFWB 2JDIH 4JYCA 4A7PA 3AE2C 3SWKA 4N78E 5CJ0A 3H1KG 3A0BE 3CL3D 4QMAA 1LTJB 2H43A 2YMYA 3ZDMA 1AVYA 3Q2YA 3HD7A 2IX7C 2VRSA 2YO2A 1PP9E 2LXBA 2ZYDA 3H1LD 2IFMA 1XTGB 4HB1A 4JPZB 3SFEC 1AQTA 2QJYB 3MIWA 1SQXK 4ZKUA 1OXZA 5KLVK 2HG5D 1Q2NA 3OA7A 2KP8A 2OYHB 1RF1C 4IFMA 5H2FH 1L0NJ 3L75J 4RKUJ 3CCEP 1SP4A 1W2BO 1OFCX 2QIWA 4IL6H 4N3YB 1A02J 1PL5A 1SVFA 1JOCA 1PZQA 5AW4B 3RK3B 2GUVA 5BU8B 4IFFA 3AECC 5AW1B 2WSFH 2M5AB 1RHZB 1J1EB 3WUVA 2Y9ZA 5KJ7D 4H0LC 2E74D 3N7NA 2B87A 1GW3A 2K88A 5KTBA 3CX5D 4IL6X 2Q6QA 1X9VA 2KLUA 2ZJSE 2XDJA 1MV8A 4JBZA 1K9MQ 3FWNA 2G8YA 4I7ZB 1N73A 1L0NE 4ASWA 3L75E 1AFOA 1FDIA 1EXIA 1LT9A 1USDA 4IFDK 4U3FJ 3H1JG 1CI6B 2IFNA 1NTKK 2WQYC 3WU2H 1FAVA 3CC2P 1CZQA 2A06D 1KILC 1NTMJ 1SQXG 1LTBC 2N9YB 3V5BA 2C0WA 2FXOA
chains in the Genus database with same CATH topology
1QGKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGK B; 
#chains in the Genus database with same CATH topology
 2Q9I A;  1FDO A;  2IBZ E;  5CCH C;  2UWJ E;  2C9N Y;  5KLV G;  5KLI B;  1S2E A;  3D6Z A;  2Y9Y A;  2H8P D;  3MD0 A;  1VQ4 P;  1G1I A;  2Q1K A;  3H32 B;  3KZI H;  5KJ7 A;  1H0T B;  2WTY A;  4KJM A;  2W6B A;  1T2K C;  2AXC A;  1GU4 A;  4UB8 E;  3HE4 A;  3USS A;  3PTZ A;  2JWD A;  4H13 C;  1VQ7 P;  3L73 G;  4Z1M H;  3BVH A;  3H1L G;  3TGU J;  4DOJ A;  3B5N D;  3S4R A;  2FYN C;  5AW8 B;  3MTU E;  4U3F E;  5TIS E;  1LTG C;  1U57 A;  1YIJ P;  2YIU C;  1SQP E;  2WSS H;  3M9B A;  1LWU B;  2JJL A;  3WMM 0;  1NU1 K;  2JR8 A;  2HPC A;  1QX8 A;  4WB4 A;  1EDJ A;  1Y9B A;  3P7K A;  1SQV D;  1RF0 C;  4BRY A;  3B5N B;  2A45 H;  3Q5R A;  2K9J A;  1Q90 D;  1CSB A;  4YPC A;  2JEE A;  1FJP A;  1ZW0 A;  2OGU A;  3KPE A;  2B89 A;  3V2P A;  3CXH E;  4NPF X;  4JQ0 D;  1AVO A;  2L91 A;  3GHG A;  1MUU A;  3L74 J;  4U7J A;  5AW2 B;  3VMZ A;  3W68 A;  3TGU E;  1X0T A;  5AVR B;  1JEK A;  1YJN P;  3CMA P;  1SQQ D;  3VMY A;  3PH0 A;  3RBX A;  1PPJ E;  2HFE D;  3II6 A;  3VMA A;  5AW7 B;  3BCC J;  4HH2 A;  4EOT A;  1SQV K;  3CX5 I;  3BRT B;  2E5T A;  1KTM A;  2QG4 A;  2W8Z A;  5CCG D;  5KAF H;  3LW5 H;  4WVZ A;  3NXS A;  5E79 H;  1BGY D;  2M3E A;  1DEE G;  3NTN A;  1OX3 A;  3PJS K;  4NPD A;  4RES B;  1KZU B;  4W7Y A;  2YXR B;  3VTP C;  1VF5 C;  2N1T B;  2ZT9 D;  2ZYG A;  2A06 G;  1W5C E;  2O01 N;  4XFJ A;  1N7S D;  4YTP C;  2PRR A;  1YTZ I;  1BE3 J;  1LTJ C;  3H1H J;  1KMI Z;  4L75 A;  1YJW P;  2P67 A;  5APW A;  5K5G B;  1SQQ K;  1VQ6 P;  1Q86 Q;  1QVG O;  4LC1 A;  1NU1 G;  1PP9 D;  1FZC A;  1BSH A;  3L74 E;  3UIA A;  1YBK A;  1IFN A;  2QJY C;  3KHU A;  1JNM A;  1FJK A;  2IYP A;  1PGJ A;  3CCR P;  1S72 P;  3CLQ A;  2OYH C;  2YNY A;  1S4X A;  3CWB E;  1CW5 A;  4HJG H;  3BCC E;  2IZ0 A;  2Q3E A;  3H1I E;  1GD2 E;  4ASV A;  2BCC D;  3L4F A;  2J58 A;  3I55 P;  4GOD A;  5AVT B;  2C9L Y;  1N7S A;  1ZRT D;  3FWL A;  1N86 A;  5CJ4 A;  5B66 H;  1J2J B;  1J1E C;  5GTI H;  2QRX A;  2IYO A;  4GIF A;  1DX7 A;  2ZYA A;  1BE3 E;  3CCJ P;  3H1H E;  1SQV G;  3C1L A;  2NPS D;  2W83 C;  2ZXX A;  1N73 C;  3AE3 C;  2KK7 A;  1NTZ E;  3FXD A;  1ZV8 A;  5CCH D;  2MKV A;  4D6T D;  3TK1 A;  2FYU J;  1Q82 Q;  1EDL A;  1AQ5 A;  1L0N D;  3L75 D;  3O8Z A;  1M90 Q;  4I2L C;  1SQQ G;  1LT1 A;  1X8Y A;  3HE5 B;  1KOR A;  4RO0 A;  1JY2 P;  3GMA A;  1K05 A;  1P84 I;  1KV4 A;  2P7J A;  4XE5 B;  1BGY G;  2HOD B;  3OW2 O;  5KLI C;  1IK9 A;  1S5L E;  1VQ8 P;  3T97 A;  1G2C A;  2KS1 A;  2W90 A;  2J59 M;  3AE5 C;  2NPS A;  2PGD A;  4B86 A;  4C7N A;  1Z56 A;  1KIL A;  5KAI E;  4PV1 D;  2AEF A;  5CCH A;  1EDK A;  3MUD A;  3PHL A;  4OGQ D;  3KYQ A;  1OW7 A;  3G71 P;  1EXJ A;  2HR3 A;  2FXM A;  2O01 H;  1S3J A;  1YYC A;  4PJ0 E;  2V4H A;  3CCS P;  4PD4 E;  1M7L A;  4BXL A;  3D70 A;  2CPS A;  5AVU B;  1VQK P;  1LTA C;  3QWO C;  1GK4 A;  1QGK B;  2FXP A;  3IAO A;  1LWU C;  1PGQ A;  2WPV B;  1NTM D;  4OGQ B;  1VQ5 P;  3TNU A;  2BCC G;  2M8R A;  3RK2 D;  2OTL P;  2WSE J;  2YKQ A;  1EZV E;  1QEX A;  3B5N C;  1JY3 N;  4ZNC A;  3IFM A;  2LXC B;  2E76 D;  2A45 G;  3G3Z A;  3BRV B;  1M1J B;  2KXP B;  3CC7 P;  1RF0 A;  5GTH E;  1FDM A;  1LNQ A;  1FZG A;  2Q3I A;  2BEQ D;  1EQ7 A;  2RKL A;  1NTM K;  2G3A A;  4D6T G;  4R4L A;  3P8C E;  4XA4 A;  1AJY A;  2E76 B;  2QVA A;  1QVF O;  3I56 P;  4R4M A;  2K37 A;  1N7L A;  4YXD C;  2N1T C;  2R5B A;  5CBO A;  3G9R A;  1SS1 A;  1FZC C;  2WZ7 A;  5B5E E;  3GG2 A;  3MZW B;  1KD1 Q;  3Q5P A;  3IN6 A;  5CBN A;  1SQB K;  3HUS B;  1KYO E;  3V2N A;  1USE A;  1LTI C;  3W67 A;  5CCG C;  1BCC E;  1JY3 P;  2QE7 H;  2WMM A;  2IBZ I;  3KXD A;  3RK3 D;  5L8R J;  3SWY A;  3L72 E;  2ZT9 C;  2RN0 A;  3FXE A;  4WWI A;  4HYT B;  2P2U A;  1LTJ A;  1L0L J;  1N7S C;  4YXW H;  1YIT P;  4AUW A;  2Z4E A;  3FX0 A;  3BCC D;  3IR9 A;  3AE9 C;  3B8E B;  2E75 D;  2YO3 A;  4ZKP A;  1XTC C;  2LR2 A;  3MP7 B;  2OYH A;  5CHX A;  3VP8 A;  1NTM G;  2WIT A;  1UII A;  1J1D B;  2E75 B;  3H1K J;  3A5T A;  1M8O B;  2R44 A;  3G4S P;  3L70 D;  2M5A A;  1NAY A;  3V4W A;  4K3A A;  1JMM A;  1L0L E;  1KB9 E;  3MHV A;  5GTH H;  1JTH B;  1P84 H;  2XU6 A;  1SQB G;  1KIL E;  2KI7 B;  2FY8 A;  3TSI A;  2Q7C A;  1SQP J;  1Q81 Q;  2NPS C;  2PAJ A;  1KFM A;  4ZMD A;  2XNX A;  3R2P A;  4OH8 B;  3AEE C;  5APV A;  3MUD C;  2QM7 A;  3HTK B;  1UIX A;  3RBZ A;  1CI6 A;  2WSE H;  4WBA A;  3JCU E;  2ZVO B;  3A0B H;  3TF5 A;  3H1K E;  3E1R A;  5BVZ A;  2JWA A;  4RJT A;  2AEM A;  1GMJ A;  3C9I A;  1JM0 A;  2R32 A;  1KQF B;  3H32 A;  2KLV A;  3Q3D A;  1H0T A;  3RL0 D;  1DEB A;  2FYU D;  1SLQ A;  2P10 A;  2J5U A;  3CI9 A;  1ZOY C;  1QL1 A;  4PV1 C;  3H1J J;  3TDK A;  4OGQ C;  1YI2 P;  5C39 A;  1KQG B;  4BRY B;  3RL0 B;  5KLV J;  1X79 B;  1H8A A;  1N2D C;  1L4A B;  1LWU A;  2FYU K;  1KC8 Q;  2OTJ P;  4W7Z A;  2WSC J;  1M1J C;  4GOE A;  1GZL A;  2N1T D;  2D2C B;  3ABV C;  2RMZ A;  1JMB A;  1QLE D;  3G6E P;  2B88 A;  3L71 D;  3B5N A;  4DT0 A;  1JUN A;  1S9K E;  3L70 G;  3RK2 C;  1GL2 D;  1P84 D;  2JO1 A;  3GF3 A;  1HGZ A;  3CWB J;  5APS A;  3L73 J;  5APT A;  2WPQ A;  3PLN A;  2QJP C;  3P8C D;  3VP9 A;  4GT1 A;  1IO4 A;  2E76 C;  3H1I J;  2MJZ A;  1VQM P;  2E43 A;  2BAS A;  2KSJ A;  1EC5 A;  1MZ9 A;  3H1J E;  1RE3 C;  2E42 A;  2OYI B;  3CCL P;  2JKV A;  4N78 D;  3F89 A;  1SQX E;  1GL2 B;  1T3J A;  3NMD A;  1WRG A;  1Q7Y Q;  5KLV E;  5DJT B;  3HUS C;  5AW0 B;  2WVR A;  1VQP P;  3CC4 P;  2NZ2 A;  3U1A A;  2FFD B;  1L2P A;  3K5B A;  2N1T A;  2P1J A;  2IPP A;  1NTZ J;  4OWF A;  1NTK J;  4UB8 H;  1RE4 C;  1FOS F;  2OAR A;  1RQV A;  5APY A;  4TLF A;  1VQ9 P;  3L73 E;  4H44 D;  3A0H E;  4WY4 D;  3H1L E;  4N6J A;  2FYU G;  3M0A A;  1ZLL A;  5CCG A;  4UB6 E;  1PGP A;  2GA1 A;  3V2R A;  2AXT E;  5TIS H;  1FE6 A;  1YQ4 C;  5AW3 B;  1RF1 B;  3RK3 C;  3O6Q B;  3B4S A;  3PP5 A;  2XKM A;  1U7M A;  2KZJ A;  4H44 B;  4WY4 B;  1S1C X;  2K9Y A;  2WWW A;  2XV5 A;  1YHQ P;  2E75 C;  3E1I A;  2XZR A;  2GM4 A;  2H88 C;  3AEF C;  1IFD A;  3M0D C;  1NTK E;  2KNC B;  1E5W A;  3CXH H;  1NU1 J;  2NRG A;  1RH5 B;  1DIP A;  3L71 G;  4H0L B;  1L0L D;  4LGD E;  1ZXG A;  2B9B A;  4I7Z C;  1BDC A;  3CX5 E;  1U7J A;  1FOS E;  3E7K A;  1URQ D;  4IOI H;  2PP6 A;  1HUC A;  2R3S A;  2POH A;  2IBZ D;  4Y99 B;  2WT7 B;  5AVX B;  3D6Y A;  3P32 A;  2KOG A;  2A06 E;  1LP1 B;  2YMK A;  3HE5 A;  2Z5H A;  1URQ B;  3AE6 C;  1OVU A;  1L0N K;  1SQV J;  1BDD A;  1M56 D;  3EFF K;  1PP9 G;  1D7M A;  2KB7 P;  1NU1 E;  2RH0 A;  1SFC D;  2M3B A;  1NYH A;  3L35 A;  4LLH A;  3SWF A;  4U3F D;  3WUT A;  3AE4 C;  1SQP D;  2V7Q J;  4M3L A;  5AW6 B;  5H2F E;  1ZR2 A;  1SQQ J;  1HWT C;  2FYN B;  3MGN A;  1NVO A;  4DJG A;  1LJ2 A;  4IL6 E;  3RL0 C;  1SFC B;  1BGY J;  5AVZ B;  1L4A C;  1IFI A;  3TYY A;  5M1B A;  2HYN A;  3SFD C;  1SQV E;  3VN0 A;  1HF9 A;  1BCC J;  3CXH D;  2QM8 A;  3L72 J;  1VDF A;  1G1J A;  3TGU D;  1R8E A;  4KT0 J;  3Q5S A;  2QJK B;  1PPJ D;  1HH0 A;  1M1J A;  1H89 A;  3HD7 D;  1AA0 A;  1L0L G;  2FYZ A;  1L0N G;  3L75 G;  1HBW A;  5APX A;  1SQQ E;  4DZO A;  5KKZ B;  4EIJ A;  3RL0 g;  1GTW A;  2OYI C;  1KB9 I;  3WU2 E;  1DH3 A;  1GL2 C;  1PV3 A;  2BCC J;  2IBZ G;  1BGY E;  1S5L H;  2R5D A;  1VF5 B;  3HD7 B;  3H25 A;  3RGU A;  1NOH A;  1T8Z A;  1RE3 A;  4I1L A;  5KAI H;  3KZI E;  1MFZ A;  1IFJ A;  3L74 D;  3V2Q A;  1ZP0 C;  5AW9 B;  3HUS A;  3CWB D;  4EDF A;  3L73 D;  4PJ0 H;  1S5L X;  3R4Y A;  2QA4 P;  3NFQ A;  4L73 A;  1VQN P;  1KN7 A;  1KQS O;  4PD4 H;  3H1I D;  3JSV C;  3GW6 A;  3U1C A;  1RE4 A;  1K8A Q;  3D71 A;  4D6T J;  5CMZ A;  1NAF A;  1M57 D;  4U3F G;  1FBM A;  1A02 F;  2KSE A;  1SQP G;  3SSU A;  1VQO P;  2KYV A;  1K04 A;  3LW5 J;  3M9Q A;  2BCC E;  2CK3 H;  4H44 C;  4WY4 C;  1T3U A;  1BE3 D;  2IZ1 A;  3H1H D;  2B87 B;  5TJH A;  1WT6 A;  1ZRT E;  5APU A;  2I8D A;  1GDT A;  2SPZ A;  3GF7 A;  1R5L A;  4W80 A;  3FGA D;  1OIP A;  1NTZ D;  1NTK D;  2E5Y A;  2GUS A;  3S9O A;  2HLO A;  1HVV A;  3A3Y B;  4EI2 A;  3CCM P;  1N73 B;  1MKM A;  1FS0 E;  1PIX A;  3TGU G;  1LT9 B;  3S1K A;  2OQQ A;  4K35 A;  3Q1M A;  3KDP B;  3M0D A;  3EWK A;  4D6T E;  3M9H A;  1NO4 A;  1PPJ G;  1YJ9 P;  1M1K Q;  3CXH I;  2W6A A;  1KFN A;  1HJB A;  2V7Q H;  2BEZ F;  1JTH A;  2K1A A;  4Y99 C;  3AED C;  5KAF E;  5E79 E;  1NTZ K;  1EDI A;  2W27 A;  2H7H A;  2E74 B;  5B5E H;  1NH4 A;  5APQ A;  1TU3 F;  4GKG A;  3HE4 B;  1VL2 A;  1KYO H;  1URQ C;  1R5S A;  3I5C A;  1Y8A A;  3HTK A;  2O1K A;  1GW4 A;  2O1J A;  1NU1 D;  2C0X A;  3L74 G;  5AVY B;  3IF4 A;  4PD4 D;  1L4A D;  5AW5 B;  3PRJ A;  3CWB G;  3EQ2 A;  1SQB J;  1GK6 A;  2FBW C;  2D2C D;  3BCC G;  1FU1 A;  4I6M C;  1GU5 A;  2HPC B;  3H1I G;  3GLM A;  2M0B A;  1SQX J;  2QSI A;  2ZVN B;  1EZV D;  1SFC C;  2Y0C A;  2K9J B;  2I1K A;  1NTM E;  3WUU A;  3VOP A;  3CCU P;  5B66 E;  3CCV P;  3CD6 P;  5GTI E;  1IFP A;  2KUB A;  1ZR4 A;  1BE3 G;  2Z5I A;  3H1H G;  3GHG B;  4O9B A;  4TT3 H;  3V6I A;  2YKO A;  1NTZ G;  3BAT A;  1IZN B;  1NTK G;  1BSN A;  1L4A A;  1LTS C;  1T6A A;  2I1J A;  3H1L J;  2QJK C;  1KB9 H;  4C7R A;  5AVQ B;  2O01 J;  2KZI A;  2K3R A;  4EYY Q;  1SQB E;  1NGM B;  3H6P A;  2O3J A;  1YQ3 C;  5KKZ C;  1VPC A;  3A2A A;  5AVW B;  3M91 A;  3OAK A;  3F5H A;  2YKP A;  3HD7 C;  3AE8 C;  1KYO D;  3JCU H;  1FZC B;  2OYI A;  1QL2 A;  1DD3 A;  1X22 A;  2ZXE B;  1BCC D;  2DW3 A;  1GL2 A;  3L72 D;  4L74 A;  1JCC A;  1Y47 A;  3U59 A;  1FZA A;  2OTK E;  2FFD A;  1ZN5 A;  1H88 A;  3RK3 E;  3L70 J;  3CPW O;  1VQL P;  2QEX P;  1MFT A;  4AQR D;  2ZAE B;  2ZT9 B;  1YTZ T;  3P8M C;  1JY2 O;  1NHL A;  2LKM A;  4MN4 C;  1ZME C;  1JY2 N;  1OW6 A;  1N7S B;  1OVR A;  2XND H;  3LIE A;  4H0L D;  2YXQ B;  4PD4 I;  2WPS A;  1EZV G;  1K73 Q;  2ZFC A;  1NWQ A;  1RF1 A;  1J1D C;  3VYI A;  3O6Q A;  1JB0 J;  2Y0D A;  1E79 H;  3N4X A;  4JYB A;  3B71 A;  2PFX A;  1DD4 A;  2N9B A;  1LGH B;  1EZV I;  4WY4 A;  3AE1 C;  2P58 A;  4AYC A;  1KB9 D;  2IDB A;  1LT9 C;  1JO5 A;  1KIL D;  3L70 E;  3CME P;  1KQL A;  2KNC A;  1N8R Q;  3KQG A;  4CPG A;  3T97 B;  5BU5 A;  1G2C B;  1T2K D;  2KS1 B;  3AEA C;  2NPS B;  5KJ7 C;  2E74 C;  5AVV B;  4C7N B;  1OWA A;  4H13 D;  1KIL B;  3HRN A;  1HTL C;  3V4Q A;  2WSF J;  1L0L K;  3JC2 2;  2ITA A;  3H1K D;  2HOD A;  2WT7 A;  2WSC H;  3EFG A;  4GOF A;  1OZH A;  1FZB A;  3C8V A;  3AEB C;  1BCC G;  1LP1 A;  2WPR A;  3L72 G;  3AE7 C;  2L5G B;  1IC2 A;  4L76 A;  1KYO I;  2Q5U A;  1URQ A;  4H13 B;  3A0H H;  3L71 J;  4JF7 A;  4KHX A;  4GDO A;  1W2E A;  1NKZ B;  4UB6 H;  2FYU E;  1LTT C;  1WMK A;  3LID A;  3TNU B;  2AXT H;  3BAS A;  2JP3 A;  4Y28 J;  2YIU B;  1RY3 A;  3L36 A;  3OJA B;  5AVS B;  4PV1 B;  2H89 C;  5DJU B;  1IK7 A;  1JY3 O;  3GHG C;  2D2C C;  4BWN A;  1AV1 A;  1SQP K;  1SFC A;  3L37 A;  3CCQ P;  3A7O A;  1S9K D;  3AEG C;  1FZF A;  2OYO A;  3M06 A;  1PP9 J;  2KIK A;  1VF5 D;  3VMX A;  3L71 E;  4HKZ H;  1JCD A;  2CPB A;  3CX5 H;  1OW8 A;  4DCK A;  2R3C A;  2A45 I;  1SQB D;  1P84 E;  4C46 A;  3RK2 B;  2Y0E A;  2FKW B;  3H1J D;  1HJ0 A;  1IFM A;  1RQU A;  4OVN F;  2QJP B;  1OVV A;  1PFI A;  1FC2 C;  1PGO A;  2AEJ A;  1IJD B;  1NJI Q;  1NKN A;  3ITK A;  3QH9 A;  1SQX D;  2W6J H;  4NPE A;  1OMI A;  5KLV D;  1HGV A;  1FZE A;  2FFD C;  5EFW B;  2JDI H;  4JYC A;  4A7P A;  3AE2 C;  3SWK A;  4N78 E;  5CJ0 A;  3H1K G;  3A0B E;  3CL3 D;  4QMA A;  1LTJ B;  2H43 A;  2YMY A;  3ZDM A;  1AVY A;  3Q2Y A;  3HD7 A;  2IX7 C;  2VRS A;  2YO2 A;  1PP9 E;  2LXB A;  2ZYD A;  3H1L D;  2IFM A;  1XTG B;  4HB1 A;  4JPZ B;  3SFE C;  1AQT A;  2QJY B;  3MIW A;  1SQX K;  4ZKU A;  1OXZ A;  5KLV K;  2HG5 D;  1Q2N A;  3OA7 A;  2KP8 A;  2OYH B;  1RF1 C;  4IFM A;  5H2F H;  1L0N J;  3L75 J;  4RKU J;  3CCE P;  1SP4 A;  1W2B O;  1OFC X;  2QIW A;  4IL6 H;  4N3Y B;  1A02 J;  1PL5 A;  1SVF A;  1JOC A;  1PZQ A;  5AW4 B;  3RK3 B;  2GUV A;  5BU8 B;  4IFF A;  3AEC C;  5AW1 B;  2WSF H;  2M5A B;  1RHZ B;  1J1E B;  3WUV A;  2Y9Z A;  5KJ7 D;  4H0L C;  2E74 D;  3N7N A;  2B87 A;  1GW3 A;  2K88 A;  5KTB A;  3CX5 D;  4IL6 X;  2Q6Q A;  1X9V A;  2KLU A;  2ZJS E;  2XDJ A;  1MV8 A;  4JBZ A;  1K9M Q;  3FWN A;  2G8Y A;  4I7Z B;  1N73 A;  1L0N E;  4ASW A;  3L75 E;  1AFO A;  1FDI A;  1EXI A;  1LT9 A;  1USD A;  4IFD K;  4U3F J;  3H1J G;  1CI6 B;  2IFN A;  1NTK K;  2WQY C;  3WU2 H;  1FAV A;  3CC2 P;  1CZQ A;  2A06 D;  1KIL C;  1NTM J;  1SQX G;  1LTB C;  2N9Y B;  3V5B A;  2C0W A;  2FXO A; 
#chains in the Genus database with same CATH homology
 1QGK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...