3RL0g

Truncated snare complex with complexin (p1)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
47
structure length
47
Chain Sequence
GSKLPDAAKKMEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 16
structure length 47
sequence length 47
chains with identical sequence h, i, j, k, l, m, n
ec nomenclature
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3rl0g00
4GDOA 3RK3E 1KILE 3RL0g
chains in the Genus database with same CATH superfamily
2QJKC 1EDLA 1KN7A 1J1DB 1N7SC 4L75A 3OW2O 2IBZD 4PD4I 3RBXA 4HB1A 2FYNC 2J58A 2KYVA 4WBAA 1KFNA 3I5CA 2PFXA 1OXZA 1JCDA 1SQQD 1KC8Q 3AE7C 1L2PA 1DD4A 1J1EC 3JCUH 2I1KA 1E5WA 1T3UA 5AW2B 3P8CD 1LT9A 1VF5B 2Q7CA 1RF0C 3CWBG 2JR8A 1BGYD 3H1LE 3A5TA 3CCEP 5CCGD 3AE1C 5AVRB 3PP5A 2C0WA 3GF3A 1N7LA 4W80A 5AW0B 4KT0J 1NTMK 2W6AA 1S5LE 3BCCG 4ASWA 3U1AA 2KLUA 3RK3E 3M0DA 1OIPA 1EXJA 1D7MA 4WWIA 1LTTC 2AEMA 1NTKE 2YNYA 1GU4A 1T3JA 3S9OA 1NU1G 3KZIH 4R4LA 1LT9B 5AW7B 3W67A 1DIPA 4H44C 3E7KA 1DH3A 1NHLA 3H1KJ 3H1IG 1EQ7A 1KTMA 2M8RA 1XTGB 1CI6A 1JY2N 2I1JA 3CCVP 3NXSA 1KFMA 5CJ0A 3CCSP 1KB9D 2O01H 3CXHD 1QL1A 4K3AA 3JCUE 2Z4EA 3L71G 4A7PA 3G9RA 2P7JA 2WQYC 2WSCH 2D2CC 3H1HE 1NAYA 4C7NA 3M06A 3AEBC 3H1LJ 3C8VA 4EDFA 2A06E 3AEAC 1SVFA 1L0NG 4H13B 1CI6B 2QIWA 2QG4A 3C1LA 4IL6X 4RO0A 1L0NK 1HJBA 3E1IA 1UIXA 4WY4C 1LTJC 1SQBE 3M0AA 2NPSC 1QGKB 4KHXA 1KILC 5E79H 1LWUA 1NTKJ 3Q5PA 2RN0A 2XKMA 4WB4A 1KV4A 2KNCA 5CCHC 1DEEG 1AA0A 3CX5E 4C7NB 3H1KD 1T8ZA 3L74G 3T97A 5AW5B 1GMJA 4GODA 4L74A 3HE4A 3CMEP 3S1KA 4XFJA 1VQKP 2W6JH 2FFDC 1JY3P 1SQXG 1SQPG 2ZT9C 5KLIC 4JQ0D 1MV8A 1FZCC 3PH0A 5AVXB 4EIJA 5AVSB 3RL0B 1SQPK 4AYCA 1EDIA 5KKZB 5APWA 2QJYB 1Q7YQ 2V4HA 2KNCB 4OGQB 3H1LD 3VYIA 3V4QA 1K05A 3AECC 1ZN5A 3MIWA 2KK7A 1FAVA 3T97B 1RF1A 1OZHA 2YKPA 1AQ5A 3A7OA 1URQA 3H1HJ 1FDIA 3HE4B 5APVA 2J5UA 1GW4A 3CC2P 3L73G 5CCGA 4IFMA 4LGDE 1IFNA 3CLQA 1NTKD 1EDJA 1L0LE 1PIXA 1L4AA 2R3CA 1EDKA 2FBWC 3TGUG 1SQBJ 3BVHA 1N8RQ 2IX7C 3I56P 2HG5D 2Y0DA 1OX3A 5APYA 4RJTA 1RF1B 1RH5B 1GL2A 1URQB 2QJPB 5AW4B 5M1BA 4HKZH 5KAIH 3FGAD 1Y8AA 5BU8B 2YKOA 2YMYA 1VQOP 2OYHC 1K73Q 1L4AB 2B89A 1IJDB 3G4SP 1Q86Q 1ZOYC 1QLED 1PPJD 1VQMP 1IO4A 1HH0A 2IDBA 2JWDA 2O01J 3H1HD 4GOEA 2QE7H 4GDOA 3FXEA 1GL2B 2VRSA 3TSIA 3MTUE 2Z5IA 2A06D 2OYOA 4DZOA 1BSNA 1HGZA 2ZYAA 2Y0EA 5AVUB 1NOHA 3HRNA 1KMIZ 1SQBD 1LTBC 1M56D 1T2KD 1LTAC 1L0LJ 2ZYGA 2N1TD 3Q1MA 3CX5D 2FXPA 1X9VA 3NTNA 4DOJA 3D6YA 5KLVG 1N7SD 4ZKUA 1NTZG 3CCLP 3Q3DA 1PP9G 4B86A 2K9JA 5KLVK 4W7ZA 1BE3G 5CMZA 1VQPP 1RQVA 2FYUG 1CZQA 1R8EA 5APQA 5BVZA 2L5GB 2H88C 1G1IA 3RGUA 4GOFA 2M5AA 3H1JE 1YIJP 3UIAA 5AVTB 1JY3N 4LLHA 1VF5C 1KB9E 2E5YA 2NZ2A 1SQVG 1GZLA 2K9JB 5B66H 1M1JA 3OA7A 3CCQP 1SQVK 5DJUB 1CSBA 1GD2E 4DT0A 3O8ZA 5TISH 1L0LD 5K5GB 1AQTA 3PJSK 3Q2YA 2WT7A 2M5AB 1YYCA 2FKWB 2IBZG 2Z5HA 1NU1E 2JEEA 1P84I 1HJ0A 4H44D 2RKLA 2J59M 4LC1A 3P7KA 1FOSE 1LT9C 3ITKA 1OFCX 2H8PD 2ZAEB 1SQQG 3L70G 1FU1A 2G8YA 1OVUA 1M1JB 3H1IE 2FXMA 1SQQK 5AVQB 2W90A 2YIUB 1BGYG 3VMXA 1E79H 1ZV8A 3AEFC 2O01N 1IK7A 2OYIC 2UWJE 2WT7B 2ZVNB 3BRTB 1SLQA 4OWFA 3RK3B 2D2CD 2M3EA 3L71E 1JEKA 1RE4A 1S4XA 3H1JJ 2MJZA 4EI2A 2WSFH 2WPQA 3JSVC 3USSA 4HJGH 2ITAA 1BCCE 3CCMP 5AW9B 3MHVA 3Q5RA 3P8MC 2QRXA 3WUTA 2Y9YA 3U59A 4C46A 1S5LX 4OH8B 2LXBA 4WY4D 3EQ2A 2NPSD 4YTPC 5TISE 2YO3A 4H13C 1NTMG 1ZW0A 1S3JA 1ZRTE 4MN4C 4I7ZC 3R2PA 1RE3A 5CJ4A 1S1CX 5AW8B 5CCHD 1N73A 2NRGA 1VQ5P 1QX8A 1NU1J 2IBZI 1FE6A 3L74E 1IFPA 2IZ1A 3FWLA 1JCCA 3L37A 4BRYA 3HD7C 1YJ9P 2N1TA 2YXQB 1OVVA 1IFIA 1SQXE 3AE5C 3H1IJ 1USDA 2QM7A 1N7SA 2P10A 1WT6A 2GA1A 5AVWB 1A02F 3SSUA 3H1JD 4OVNF 3RL0C 3A0BH 2PRRA 1N73B 4IL6H 3AE6C 2XDJA 3LIEA 1KZUB 1U7JA 5KAFH 3CWBD 4JYCA 3II6A 2LXCB 4GT1A 1LWUC 1W5CE 3KQGA 4NPEA 3L71J 4NPFX 2P1JA 3RL0g 1BDCA 3SWKA 3BATA 1VQ9P 4BRYB 3TNUA 1PPJE 1ZXGA 2N1TB 5KJ7C 1VPCA 2QJKB 1BCCJ 3A3YB 4H0LD 2CK3H 3L73E 4R4MA 3H1KG 2XZRA 1VL2A 1N7SB 3CCJP 1VQ8P 1P84H 1OW7A 2RMZA 1LT1A 2FYNB 5APXA 3PHLA 4O9BA 1NU1D 3WUVA 2POHA 1MKMA 2E75C 1J1EB 1IFDA 1M7LA 4Y99C 1DX7A 1PL5A 4ZMDA 2A45G 1PGQA 3TNUB 2QM8A 3H1ID 2K9YA 3L74J 3KZIE 4KJMA 3GF7A 3H1LG 2R3SA 1URQC 1ZLLA 3L72G 1SQXJ 5CCGC 4PD4H 1ZR2A 3V4WA 1T6AA 1EXIA 3HTKA 1L4AC 2FYZA 3L71D 3A0BE 4IL6E 1HBWA 1JMBA 3L75G 5KAFE 2K37A 2QSIA 1VQ4P 4XE5B 3H25A 3N7NA 2WSEH 1EZVG 1KQLA 3W68A 1K04A 2WPRA 3IF4A 3CPWO 2I8DA 1NTKK 1BCCD 1KORA 2WSFJ 2CPBA 3D71A 4L76A 3EFFK 3D70A 4BXLA 1M8OB 2Q6QA 1GL2C 3GMAA 1H89A 3LW5H 1KYOI 3FX0A 3L73J 2BCCE 3FWNA 1MFZA 1ZRTD 4PV1C 4RKUJ 3HTKB 2B87B 2HODA 3RK2C 2JP3A 2IYPA 2E74C 4WVZA 4WY4A 2WTYA 3L4FA 2NPSA 2PGDA 3KYQA 3I55P 2W83C 2W8ZA 2BEQD 2FY8A 2OTJP 2ZJSE 2E42A 2WITA 2M0BA 3L74D 2W27A 1ZMEC 1Q90D 3K5BA 1NTZE 2SPZA 5CCHA 5TJHA 1PP9E 4Y28J 2D2CB 1IZNB 3VP9A 5E79E 1AV1A 3A0HH 2O1KA 3TDKA 3MP7B 1SQXD 1Z56A 2FYUE 2A45I 3VP8A 2DW3A 1FOSF 2XNXA 1LP1A 1WRGA 2FFDA 1M90Q 4PD4E 2A06G 1FZCA 2HODB 1N2DC 4WY4B 3CCRP 2NPSB 3B5NC 1PGOA 1DEBA 3H6PA 4Z1MH 2KXPB 3IFMA 3PTZA 4D6TE 2HLOA 1G2CA 2KOGA 1SQBK 2G3AA 1EZVI 1GK6A 3L73D 4AUWA 4W7YA 1LP1B 2FFDB 2PP6A 1CW5A 5KLIB 1FDOA 2IYOA 5AW1B 3TF5A 2WSCJ 5EFWB 1FZCB 3GHGA 1S2EA 1YHQP 2BCCJ 1G1JA 2B9BA 1DD3A 2W6BA 1SFCD 1NO4A 1KILE 3TK1A 2KP8A 1K9MQ 3L70E 2IPPA 3ZDMA 1G2CB 2E76D 3MUDC 3E1RA 1NTZJ 1OW8A 1PP9J 4U3FE 2YIUC 1AFOA 4DCKA 2FYUJ 3F5HA 5CHXA 1JUNA 2IFMA 3GHGB 4JPZB 2JO1A 4H0LB 1XTCC 1A02J 1NKNA 3H32B 1AJYA 5KAIE 3D6ZA 1J1DC 4N3YB 1JO5A 3RK3C 1L0LG 1LNQA 2WWWA 3FXDA 3IAOA 1L0LK 1VQ6P 1KYOH 1LJ2A 2WSEJ 3P32A 4ZKPA 2FXOA 4D6TJ 3CWBE 2WVRA 3GW6A 1NTME 1X22A 2BCCD 3CX5I 3G71P 2KI7B 4GIFA 1YBKA 1MFTA 3BRVB 2BEZF 3BCCE 1NYHA 3V6IA 1ZR4A 3WU2H 2AXCA 5B5EH 1RE4C 5KLVD 3HD7D 1OMIA 1NTZD 3EWKA 2A45H 4UB6H 1QVGO 1PP9D 5CBNA 3KPEA 2QA4P 3L70J 1H88A 3WUUA 1KQSO 3KXDA 1PV3A 2FYUD 3U1CA 3CC4P 5AVYB 1NH4A 5GTIH 1YQ4C 3BASA 1GDTA 2OARA 1TU3F 4PD4D 1LTIC 4U3FJ 1S5LH 2P67A 5BU5A 1RQUA 2KIKA 3RBZA 3VMAA 1FC2C 2C0XA 3G6EP 1N73C 3SWYA 5KJ7D 3M0DC 3AEGC 1AVYA 4D6TD 1VQLP 2N9BA 2R32A 1JB0J 1YJWP 2OQQA 2C9NY 1H0TA 5APTA 4TLFA 3CWBJ 3M91A 1SP4A 1W2BO 1HTLC 1S9KE 4HH2A 3KDPB 2E75D 1NTMJ 3L36A 5B66E 1IK9A 1X8YA 1GU5A 1L0NE 4EOTA 1IFJA 3WU2E 3HUSA 3ABVC 1KILD 2PAJA 3BCCJ 2ZVOB 2AEFA 2HPCA 5B5EE 3L70D 1FZFA 3H1JG 2KSEA 4UB6E 2OTKE 1URQD 5CBOA 4HYTB 1PGJA 1Y47A 1K8AQ 2AEJA 1SFCA 4I1LA 3L72E 4YPCA 2R5BA 4I2LC 4U3FD 3QH9A 1H0TB 5GTIE 1Q2NA 2P2UA 1L4AD 2WMMA 1JTHA 3OJAB 1HGVA 2ZT9D 3OAKA 3V2PA 2WPSA 2OYIA 1YTZI 2E43A 4YXWH 1NAFA 2O1JA 3L75E 5AW6B 1MZ9A 1SQPE 2M3BA 3HUSB 4CPGA 2HPCB 3CD6P 1EZVE 3VMZA 4UB8H 1GL2D 4ZNCA 1Q82Q 1M1KQ 3CX5H 1SFCB 1NU1K 5C39A 3SFDC 4IFDK 5KKZC 1RHZB 1GK4A 1FS0E 2QJYC 4PV1D 1YI2P 1NTMD 1VDFA 4OGQC 3VN0A 2E76B 2AXTH 1JTHB 1RF0A 3RK2D 2E74D 3AE9C 2V7QH 3GLMA 1LTGC 2OYIB 1VQNP 3HE5A 3BCCD 3WMM0 3CCUP 1LTSC 2H43A 1L0NJ 3B4SA 1USEA 3VOPA 1FZGA 2L91A 3R4YA 3TGUE 2HYNA 1QVFO 3M9HA 3F89A 1FZEA 2E5TA 1FJPA 3CL3D 2H89C 1S72P 1J2JB 3HD7A 2KZJA 1OW6A 1BCCG 3L72J 4N78E 2Q5UA 2WSSH 1KB9I 2P58A 3B5ND 3CXHI 1RF1C 3HE5B 1JY3O 1PZQA 2Q9IA 2QJPC 4I7ZB 4PJ0H 4DJGA 1NGMB 3L75J 1SQPJ 2YMKA 1N86A 4UB8E 4XA4A 1KYOD 1KQGB 4JYBA 2B87A 5L8RJ 1MUUA 2IZ0A 1JMMA 1PGPA 1NVOA 1IFMA 3HD7B 4ASVA 5KJ7A 1NTKG 1U57A 1FZAA 1IC2A 3GG2A 1ZP0C 2AXTE 1S9KD 3L35A 3N4XA 4H44B 3SWFA 3V2NA 1L0ND 3MGNA 1NKZB 1SQXK 3IN6A 3MZWB 4M3LA 1P84E 2JWAA 3VMYA 2MKVA 1LWUB 3AEDC 1OWAA 5AW3B 3O6QA 2JJLA 4JBZA 5AVZB 1LTJA 3M9QA 3L72D 2N9YB 1SS1A 1KILA 3TGUJ 4RESB 4U7JA 5KLVE 5GTHH 3V2QA 2KLVA 1PPJG 2HFED 5AVVB 1GTWA 3RK3D 1BE3E 2KB7P 3L75D 1SQPD 4IFFA 3GHGC 1HUCA 3H1HG 4PJ0E 4H0LC 1EZVD 5H2FH 2E75B 2Y0CA 3O6QB 1W2EA 1GW3A 2Q3EA 4QMAA 2K3RA 4Y99B 1LTJB 2JKVA 2OGUA 2BASA 3V2RA 1VF5D 1KILB 5KTBA 3KHUA 2JDIH 4N6JA 1YJNP 2XNDH 3CC7P 2XV5A 1SQBG 2B88A 1SQVE 2KUBA 2ZFCA 2GUSA 2HR3A 2YKQA 2V7QJ 1YITP 4JF7A 1FZBA 3A2AA 1Q81Q 1BSHA 3JC22 2ZT9B 1UIIA 2LKMA 1NWQA 2KS1A 2IBZE 3TGUD 1R5LA 3AE2C 3H32A 4TT3H 1KB9H 3CXHH 3TYYA 1FJKA 1SQQE 3Q5SA 4N78D 3QWOC 5GTHE 2R5DA 3AEEC 3P8CE 5KLVJ 2H7HA 3G3ZA 1JY2O 2Y9ZA 3A0HE 1BGYE 1WMKA 1FBMA 1M1JC 5APUA 4PV1B 3NFQA 5APSA 1LGHB 1BE3J 3RK2B 2BCCG 2E74B 2RH0A 2C9LY 2XU6A 5H2FE 4YXDC 2Q3IA 3MD0A 1PFIA 3B5NA 2KS1B 5DJTB 2YXRB 2OYHA 1JNMA 2OTLP 2YO2A 1OVRA 1QEXA 1VQ7P 3EFGA 3PLNA 1FDMA 1NJIQ 1NTZK 4GKGA 3NMDA 1JY2P 3AE3C 1SQVJ 4H13D 1EC5A 3LIDA 3V5BA 1QL2A 2K88A 1KD1Q 2FYUK 1P84D 3SFEC 3B5NB 3LW5J 2O3JA 2K1AA 2OYHB 3IR9A 3B71A 3M9BA 3CMAP 4NPDA 2Q1KA 3MUDA 3VTPC 3CXHE 4D6TG 2WZ7A 1SQQJ 4IOIH 1BE3D 1HWTC 2KZIA 2CPSA 1YTZT 3AE8C 4AQRD 4C7RA 1HF9A 1R5SA 1RY3A 1BGYJ 4L73A 3RL0D 1H8AA 2IFNA 1M57D 3AE4C 4K35A 3C9IA 3HUSC 2QVAA 1YQ3C 2KSJA 2QEXP 2R44A 4EYYQ 2ZXEB 1RE3C 4OGQD 1KQFB 2LR2A 3CI9A 2WPVB 1U7MA 2ZXXA 1JM0A 1X79B 1SFCC 2GM4A 4BWNA 3B8EB 2ZYDA 1BDDA 1SQVD 1HVVA 3S4RA 1X0TA 3PRJA 1AVOA 1Y9BA 1KYOE 2GUVA 2E76C 1T2KC 4U3FG 4I6MC 1JOCA 2N1TC 3H1KE
chains in the Genus database with same CATH topology
1ZMEC 2QJKC 1OMIA 1Q90D 3SFEC 1PL5A 3EWKA 3Q3DA 2ZT9B 3D6YA 2MKVA 3AEDC 1GMJA 2G8YA 4Y28J 2D2CB 3O6QA 2E76D 5M1BA 3R4YA 2K9YA 3LW5J 4XFJA 3GF7A 1KTMA 1OW8A 3FGAD 1RQVA 3B71A 2ZT9C 2FYNC 1PV3A 5KLIC 3AE5C 3AE2C 4TT3H 1YQ4C 3AEFC 2H89C 2P10A 1R8EA 1IK7A 2YIUC 4U7JA 1OW6A 1ZOYC 2H88C 1TU3F 3AE7C 1DD4A 3Q5SA 1EXIA 2ZT9D 3AEEC 2JO1A 2IDBA 4H0LB 3AE6C 2D2CD 1VF5B 1RQUA 3G9RA 2O01J 4OGQB 1WMKA 2WQYC 1AJYA 2QJPC 3D6ZA 4I7ZB 2D2CC 1K05A 4PV1B 2QSIA 3AECC 3AE8C 4H0LC 3H25A 1VF5C 3RL0g 3T97B 1NGMB 1HF9A 3AEBC 3AE1C 2E74B 4GDOA 2YMKA 1K04A 3AEGC 3GF3A 3C8VA 4Z1MH 2NZ2A 2E75B 3IAOA 3AE4C 3Q5RA 4YXDC 1FDIA 4KT0J 1KORA 3AEAC 2WSFJ 1YQ3C 3D71A 2G3AA 2J5UA 2WSEJ 3D70A 1KQGB 4H13B 5L8RJ 3RK3E 1JB0J 3GMAA 4H0LD 1S5LX 3SFDC 1EXJA 1VF5D 2QIWA 2OQQA 4R4MA 5KKZC 1VL2A 4OGQD 1KQFB 2QJYC 4IL6X 4YTPC 1U57A 2WPVB 4H13C 1UIXA 1OW7A 4PV1D 1PIXA 1KMIZ 3S9OA 3Q2YA 4OGQC 1FDOA 2E76B 1ZP0C 1ZRTE 2E74D 3AE9C 4I7ZC 2WSCJ 4PV1C 1S1CX 4RKUJ 3Q5PA 4R4LA 3GLMA 2FBWC 2E75D 4H44B 1Y9BA 1HJ0A 2JP3A 3AE3C 2E74C 4H44D 2BEZF 2E76C 1NYHA 3Q1MA 1MKMA 2E75C 1DD3A 4H13D 1DIPA 2V7QJ 2FXPA 2BEQD 4H44C 3IN6A 3ABVC 1KILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GDO A;  3RK3 E;  1KIL E;  3RL0 g; 
#chains in the Genus database with same CATH topology
 2QJK C;  1EDL A;  1KN7 A;  1J1D B;  1N7S C;  4L75 A;  3OW2 O;  2IBZ D;  4PD4 I;  3RBX A;  4HB1 A;  2FYN C;  2J58 A;  2KYV A;  4WBA A;  1KFN A;  3I5C A;  2PFX A;  1OXZ A;  1JCD A;  1SQQ D;  1KC8 Q;  3AE7 C;  1L2P A;  1DD4 A;  1J1E C;  3JCU H;  2I1K A;  1E5W A;  1T3U A;  5AW2 B;  3P8C D;  1LT9 A;  1VF5 B;  2Q7C A;  1RF0 C;  3CWB G;  2JR8 A;  1BGY D;  3H1L E;  3A5T A;  3CCE P;  5CCG D;  3AE1 C;  5AVR B;  3PP5 A;  2C0W A;  3GF3 A;  1N7L A;  4W80 A;  5AW0 B;  4KT0 J;  1NTM K;  2W6A A;  1S5L E;  3BCC G;  4ASW A;  3U1A A;  2KLU A;  3RK3 E;  3M0D A;  1OIP A;  1EXJ A;  1D7M A;  4WWI A;  1LTT C;  2AEM A;  1NTK E;  2YNY A;  1GU4 A;  1T3J A;  3S9O A;  1NU1 G;  3KZI H;  4R4L A;  1LT9 B;  5AW7 B;  3W67 A;  1DIP A;  4H44 C;  3E7K A;  1DH3 A;  1NHL A;  3H1K J;  3H1I G;  1EQ7 A;  1KTM A;  2M8R A;  1XTG B;  1CI6 A;  1JY2 N;  2I1J A;  3CCV P;  3NXS A;  1KFM A;  5CJ0 A;  3CCS P;  1KB9 D;  2O01 H;  3CXH D;  1QL1 A;  4K3A A;  3JCU E;  2Z4E A;  3L71 G;  4A7P A;  3G9R A;  2P7J A;  2WQY C;  2WSC H;  2D2C C;  3H1H E;  1NAY A;  4C7N A;  3M06 A;  3AEB C;  3H1L J;  3C8V A;  4EDF A;  2A06 E;  3AEA C;  1SVF A;  1L0N G;  4H13 B;  1CI6 B;  2QIW A;  2QG4 A;  3C1L A;  4IL6 X;  4RO0 A;  1L0N K;  1HJB A;  3E1I A;  1UIX A;  4WY4 C;  1LTJ C;  1SQB E;  3M0A A;  2NPS C;  1QGK B;  4KHX A;  1KIL C;  5E79 H;  1LWU A;  1NTK J;  3Q5P A;  2RN0 A;  2XKM A;  4WB4 A;  1KV4 A;  2KNC A;  5CCH C;  1DEE G;  1AA0 A;  3CX5 E;  4C7N B;  3H1K D;  1T8Z A;  3L74 G;  3T97 A;  5AW5 B;  1GMJ A;  4GOD A;  4L74 A;  3HE4 A;  3CME P;  3S1K A;  4XFJ A;  1VQK P;  2W6J H;  2FFD C;  1JY3 P;  1SQX G;  1SQP G;  2ZT9 C;  5KLI C;  4JQ0 D;  1MV8 A;  1FZC C;  3PH0 A;  5AVX B;  4EIJ A;  5AVS B;  3RL0 B;  1SQP K;  4AYC A;  1EDI A;  5KKZ B;  5APW A;  2QJY B;  1Q7Y Q;  2V4H A;  2KNC B;  4OGQ B;  3H1L D;  3VYI A;  3V4Q A;  1K05 A;  3AEC C;  1ZN5 A;  3MIW A;  2KK7 A;  1FAV A;  3T97 B;  1RF1 A;  1OZH A;  2YKP A;  1AQ5 A;  3A7O A;  1URQ A;  3H1H J;  1FDI A;  3HE4 B;  5APV A;  2J5U A;  1GW4 A;  3CC2 P;  3L73 G;  5CCG A;  4IFM A;  4LGD E;  1IFN A;  3CLQ A;  1NTK D;  1EDJ A;  1L0L E;  1PIX A;  1L4A A;  2R3C A;  1EDK A;  2FBW C;  3TGU G;  1SQB J;  3BVH A;  1N8R Q;  2IX7 C;  3I56 P;  2HG5 D;  2Y0D A;  1OX3 A;  5APY A;  4RJT A;  1RF1 B;  1RH5 B;  1GL2 A;  1URQ B;  2QJP B;  5AW4 B;  5M1B A;  4HKZ H;  5KAI H;  3FGA D;  1Y8A A;  5BU8 B;  2YKO A;  2YMY A;  1VQO P;  2OYH C;  1K73 Q;  1L4A B;  2B89 A;  1IJD B;  3G4S P;  1Q86 Q;  1ZOY C;  1QLE D;  1PPJ D;  1VQM P;  1IO4 A;  1HH0 A;  2IDB A;  2JWD A;  2O01 J;  3H1H D;  4GOE A;  2QE7 H;  4GDO A;  3FXE A;  1GL2 B;  2VRS A;  3TSI A;  3MTU E;  2Z5I A;  2A06 D;  2OYO A;  4DZO A;  1BSN A;  1HGZ A;  2ZYA A;  2Y0E A;  5AVU B;  1NOH A;  3HRN A;  1KMI Z;  1SQB D;  1LTB C;  1M56 D;  1T2K D;  1LTA C;  1L0L J;  2ZYG A;  2N1T D;  3Q1M A;  3CX5 D;  2FXP A;  1X9V A;  3NTN A;  4DOJ A;  3D6Y A;  5KLV G;  1N7S D;  4ZKU A;  1NTZ G;  3CCL P;  3Q3D A;  1PP9 G;  4B86 A;  2K9J A;  5KLV K;  4W7Z A;  1BE3 G;  5CMZ A;  1VQP P;  1RQV A;  2FYU G;  1CZQ A;  1R8E A;  5APQ A;  5BVZ A;  2L5G B;  2H88 C;  1G1I A;  3RGU A;  4GOF A;  2M5A A;  3H1J E;  1YIJ P;  3UIA A;  5AVT B;  1JY3 N;  4LLH A;  1VF5 C;  1KB9 E;  2E5Y A;  2NZ2 A;  1SQV G;  1GZL A;  2K9J B;  5B66 H;  1M1J A;  3OA7 A;  3CCQ P;  1SQV K;  5DJU B;  1CSB A;  1GD2 E;  4DT0 A;  3O8Z A;  5TIS H;  1L0L D;  5K5G B;  1AQT A;  3PJS K;  3Q2Y A;  2WT7 A;  2M5A B;  1YYC A;  2FKW B;  2IBZ G;  2Z5H A;  1NU1 E;  2JEE A;  1P84 I;  1HJ0 A;  4H44 D;  2RKL A;  2J59 M;  4LC1 A;  3P7K A;  1FOS E;  1LT9 C;  3ITK A;  1OFC X;  2H8P D;  2ZAE B;  1SQQ G;  3L70 G;  1FU1 A;  2G8Y A;  1OVU A;  1M1J B;  3H1I E;  2FXM A;  1SQQ K;  5AVQ B;  2W90 A;  2YIU B;  1BGY G;  3VMX A;  1E79 H;  1ZV8 A;  3AEF C;  2O01 N;  1IK7 A;  2OYI C;  2UWJ E;  2WT7 B;  2ZVN B;  3BRT B;  1SLQ A;  4OWF A;  3RK3 B;  2D2C D;  2M3E A;  3L71 E;  1JEK A;  1RE4 A;  1S4X A;  3H1J J;  2MJZ A;  4EI2 A;  2WSF H;  2WPQ A;  3JSV C;  3USS A;  4HJG H;  2ITA A;  1BCC E;  3CCM P;  5AW9 B;  3MHV A;  3Q5R A;  3P8M C;  2QRX A;  3WUT A;  2Y9Y A;  3U59 A;  4C46 A;  1S5L X;  4OH8 B;  2LXB A;  4WY4 D;  3EQ2 A;  2NPS D;  4YTP C;  5TIS E;  2YO3 A;  4H13 C;  1NTM G;  1ZW0 A;  1S3J A;  1ZRT E;  4MN4 C;  4I7Z C;  3R2P A;  1RE3 A;  5CJ4 A;  1S1C X;  5AW8 B;  5CCH D;  1N73 A;  2NRG A;  1VQ5 P;  1QX8 A;  1NU1 J;  2IBZ I;  1FE6 A;  3L74 E;  1IFP A;  2IZ1 A;  3FWL A;  1JCC A;  3L37 A;  4BRY A;  3HD7 C;  1YJ9 P;  2N1T A;  2YXQ B;  1OVV A;  1IFI A;  1SQX E;  3AE5 C;  3H1I J;  1USD A;  2QM7 A;  1N7S A;  2P10 A;  1WT6 A;  2GA1 A;  5AVW B;  1A02 F;  3SSU A;  3H1J D;  4OVN F;  3RL0 C;  3A0B H;  2PRR A;  1N73 B;  4IL6 H;  3AE6 C;  2XDJ A;  3LIE A;  1KZU B;  1U7J A;  5KAF H;  3CWB D;  4JYC A;  3II6 A;  2LXC B;  4GT1 A;  1LWU C;  1W5C E;  3KQG A;  4NPE A;  3L71 J;  4NPF X;  2P1J A;  3RL0 g;  1BDC A;  3SWK A;  3BAT A;  1VQ9 P;  4BRY B;  3TNU A;  1PPJ E;  1ZXG A;  2N1T B;  5KJ7 C;  1VPC A;  2QJK B;  1BCC J;  3A3Y B;  4H0L D;  2CK3 H;  3L73 E;  4R4M A;  3H1K G;  2XZR A;  1VL2 A;  1N7S B;  3CCJ P;  1VQ8 P;  1P84 H;  1OW7 A;  2RMZ A;  1LT1 A;  2FYN B;  5APX A;  3PHL A;  4O9B A;  1NU1 D;  3WUV A;  2POH A;  1MKM A;  2E75 C;  1J1E B;  1IFD A;  1M7L A;  4Y99 C;  1DX7 A;  1PL5 A;  4ZMD A;  2A45 G;  1PGQ A;  3TNU B;  2QM8 A;  3H1I D;  2K9Y A;  3L74 J;  3KZI E;  4KJM A;  3GF7 A;  3H1L G;  2R3S A;  1URQ C;  1ZLL A;  3L72 G;  1SQX J;  5CCG C;  4PD4 H;  1ZR2 A;  3V4W A;  1T6A A;  1EXI A;  3HTK A;  1L4A C;  2FYZ A;  3L71 D;  3A0B E;  4IL6 E;  1HBW A;  1JMB A;  3L75 G;  5KAF E;  2K37 A;  2QSI A;  1VQ4 P;  4XE5 B;  3H25 A;  3N7N A;  2WSE H;  1EZV G;  1KQL A;  3W68 A;  1K04 A;  2WPR A;  3IF4 A;  3CPW O;  2I8D A;  1NTK K;  1BCC D;  1KOR A;  2WSF J;  2CPB A;  3D71 A;  4L76 A;  3EFF K;  3D70 A;  4BXL A;  1M8O B;  2Q6Q A;  1GL2 C;  3GMA A;  1H89 A;  3LW5 H;  1KYO I;  3FX0 A;  3L73 J;  2BCC E;  3FWN A;  1MFZ A;  1ZRT D;  4PV1 C;  4RKU J;  3HTK B;  2B87 B;  2HOD A;  3RK2 C;  2JP3 A;  2IYP A;  2E74 C;  4WVZ A;  4WY4 A;  2WTY A;  3L4F A;  2NPS A;  2PGD A;  3KYQ A;  3I55 P;  2W83 C;  2W8Z A;  2BEQ D;  2FY8 A;  2OTJ P;  2ZJS E;  2E42 A;  2WIT A;  2M0B A;  3L74 D;  2W27 A;  1ZME C;  1Q90 D;  3K5B A;  1NTZ E;  2SPZ A;  5CCH A;  5TJH A;  1PP9 E;  4Y28 J;  2D2C B;  1IZN B;  3VP9 A;  5E79 E;  1AV1 A;  3A0H H;  2O1K A;  3TDK A;  3MP7 B;  1SQX D;  1Z56 A;  2FYU E;  2A45 I;  3VP8 A;  2DW3 A;  1FOS F;  2XNX A;  1LP1 A;  1WRG A;  2FFD A;  1M90 Q;  4PD4 E;  2A06 G;  1FZC A;  2HOD B;  1N2D C;  4WY4 B;  3CCR P;  2NPS B;  3B5N C;  1PGO A;  1DEB A;  3H6P A;  4Z1M H;  2KXP B;  3IFM A;  3PTZ A;  4D6T E;  2HLO A;  1G2C A;  2KOG A;  1SQB K;  2G3A A;  1EZV I;  1GK6 A;  3L73 D;  4AUW A;  4W7Y A;  1LP1 B;  2FFD B;  2PP6 A;  1CW5 A;  5KLI B;  1FDO A;  2IYO A;  5AW1 B;  3TF5 A;  2WSC J;  5EFW B;  1FZC B;  3GHG A;  1S2E A;  1YHQ P;  2BCC J;  1G1J A;  2B9B A;  1DD3 A;  2W6B A;  1SFC D;  1NO4 A;  1KIL E;  3TK1 A;  2KP8 A;  1K9M Q;  3L70 E;  2IPP A;  3ZDM A;  1G2C B;  2E76 D;  3MUD C;  3E1R A;  1NTZ J;  1OW8 A;  1PP9 J;  4U3F E;  2YIU C;  1AFO A;  4DCK A;  2FYU J;  3F5H A;  5CHX A;  1JUN A;  2IFM A;  3GHG B;  4JPZ B;  2JO1 A;  4H0L B;  1XTC C;  1A02 J;  1NKN A;  3H32 B;  1AJY A;  5KAI E;  3D6Z A;  1J1D C;  4N3Y B;  1JO5 A;  3RK3 C;  1L0L G;  1LNQ A;  2WWW A;  3FXD A;  3IAO A;  1L0L K;  1VQ6 P;  1KYO H;  1LJ2 A;  2WSE J;  3P32 A;  4ZKP A;  2FXO A;  4D6T J;  3CWB E;  2WVR A;  3GW6 A;  1NTM E;  1X22 A;  2BCC D;  3CX5 I;  3G71 P;  2KI7 B;  4GIF A;  1YBK A;  1MFT A;  3BRV B;  2BEZ F;  3BCC E;  1NYH A;  3V6I A;  1ZR4 A;  3WU2 H;  2AXC A;  5B5E H;  1RE4 C;  5KLV D;  3HD7 D;  1OMI A;  1NTZ D;  3EWK A;  2A45 H;  4UB6 H;  1QVG O;  1PP9 D;  5CBN A;  3KPE A;  2QA4 P;  3L70 J;  1H88 A;  3WUU A;  1KQS O;  3KXD A;  1PV3 A;  2FYU D;  3U1C A;  3CC4 P;  5AVY B;  1NH4 A;  5GTI H;  1YQ4 C;  3BAS A;  1GDT A;  2OAR A;  1TU3 F;  4PD4 D;  1LTI C;  4U3F J;  1S5L H;  2P67 A;  5BU5 A;  1RQU A;  2KIK A;  3RBZ A;  3VMA A;  1FC2 C;  2C0X A;  3G6E P;  1N73 C;  3SWY A;  5KJ7 D;  3M0D C;  3AEG C;  1AVY A;  4D6T D;  1VQL P;  2N9B A;  2R32 A;  1JB0 J;  1YJW P;  2OQQ A;  2C9N Y;  1H0T A;  5APT A;  4TLF A;  3CWB J;  3M91 A;  1SP4 A;  1W2B O;  1HTL C;  1S9K E;  4HH2 A;  3KDP B;  2E75 D;  1NTM J;  3L36 A;  5B66 E;  1IK9 A;  1X8Y A;  1GU5 A;  1L0N E;  4EOT A;  1IFJ A;  3WU2 E;  3HUS A;  3ABV C;  1KIL D;  2PAJ A;  3BCC J;  2ZVO B;  2AEF A;  2HPC A;  5B5E E;  3L70 D;  1FZF A;  3H1J G;  2KSE A;  4UB6 E;  2OTK E;  1URQ D;  5CBO A;  4HYT B;  1PGJ A;  1Y47 A;  1K8A Q;  2AEJ A;  1SFC A;  4I1L A;  3L72 E;  4YPC A;  2R5B A;  4I2L C;  4U3F D;  3QH9 A;  1H0T B;  5GTI E;  1Q2N A;  2P2U A;  1L4A D;  2WMM A;  1JTH A;  3OJA B;  1HGV A;  2ZT9 D;  3OAK A;  3V2P A;  2WPS A;  2OYI A;  1YTZ I;  2E43 A;  4YXW H;  1NAF A;  2O1J A;  3L75 E;  5AW6 B;  1MZ9 A;  1SQP E;  2M3B A;  3HUS B;  4CPG A;  2HPC B;  3CD6 P;  1EZV E;  3VMZ A;  4UB8 H;  1GL2 D;  4ZNC A;  1Q82 Q;  1M1K Q;  3CX5 H;  1SFC B;  1NU1 K;  5C39 A;  3SFD C;  4IFD K;  5KKZ C;  1RHZ B;  1GK4 A;  1FS0 E;  2QJY C;  4PV1 D;  1YI2 P;  1NTM D;  1VDF A;  4OGQ C;  3VN0 A;  2E76 B;  2AXT H;  1JTH B;  1RF0 A;  3RK2 D;  2E74 D;  3AE9 C;  2V7Q H;  3GLM A;  1LTG C;  2OYI B;  1VQN P;  3HE5 A;  3BCC D;  3WMM 0;  3CCU P;  1LTS C;  2H43 A;  1L0N J;  3B4S A;  1USE A;  3VOP A;  1FZG A;  2L91 A;  3R4Y A;  3TGU E;  2HYN A;  1QVF O;  3M9H A;  3F89 A;  1FZE A;  2E5T A;  1FJP A;  3CL3 D;  2H89 C;  1S72 P;  1J2J B;  3HD7 A;  2KZJ A;  1OW6 A;  1BCC G;  3L72 J;  4N78 E;  2Q5U A;  2WSS H;  1KB9 I;  2P58 A;  3B5N D;  3CXH I;  1RF1 C;  3HE5 B;  1JY3 O;  1PZQ A;  2Q9I A;  2QJP C;  4I7Z B;  4PJ0 H;  4DJG A;  1NGM B;  3L75 J;  1SQP J;  2YMK A;  1N86 A;  4UB8 E;  4XA4 A;  1KYO D;  1KQG B;  4JYB A;  2B87 A;  5L8R J;  1MUU A;  2IZ0 A;  1JMM A;  1PGP A;  1NVO A;  1IFM A;  3HD7 B;  4ASV A;  5KJ7 A;  1NTK G;  1U57 A;  1FZA A;  1IC2 A;  3GG2 A;  1ZP0 C;  2AXT E;  1S9K D;  3L35 A;  3N4X A;  4H44 B;  3SWF A;  3V2N A;  1L0N D;  3MGN A;  1NKZ B;  1SQX K;  3IN6 A;  3MZW B;  4M3L A;  1P84 E;  2JWA A;  3VMY A;  2MKV A;  1LWU B;  3AED C;  1OWA A;  5AW3 B;  3O6Q A;  2JJL A;  4JBZ A;  5AVZ B;  1LTJ A;  3M9Q A;  3L72 D;  2N9Y B;  1SS1 A;  1KIL A;  3TGU J;  4RES B;  4U7J A;  5KLV E;  5GTH H;  3V2Q A;  2KLV A;  1PPJ G;  2HFE D;  5AVV B;  1GTW A;  3RK3 D;  1BE3 E;  2KB7 P;  3L75 D;  1SQP D;  4IFF A;  3GHG C;  1HUC A;  3H1H G;  4PJ0 E;  4H0L C;  1EZV D;  5H2F H;  2E75 B;  2Y0C A;  3O6Q B;  1W2E A;  1GW3 A;  2Q3E A;  4QMA A;  2K3R A;  4Y99 B;  1LTJ B;  2JKV A;  2OGU A;  2BAS A;  3V2R A;  1VF5 D;  1KIL B;  5KTB A;  3KHU A;  2JDI H;  4N6J A;  1YJN P;  2XND H;  3CC7 P;  2XV5 A;  1SQB G;  2B88 A;  1SQV E;  2KUB A;  2ZFC A;  2GUS A;  2HR3 A;  2YKQ A;  2V7Q J;  1YIT P;  4JF7 A;  1FZB A;  3A2A A;  1Q81 Q;  1BSH A;  3JC2 2;  2ZT9 B;  1UII A;  2LKM A;  1NWQ A;  2KS1 A;  2IBZ E;  3TGU D;  1R5L A;  3AE2 C;  3H32 A;  4TT3 H;  1KB9 H;  3CXH H;  3TYY A;  1FJK A;  1SQQ E;  3Q5S A;  4N78 D;  3QWO C;  5GTH E;  2R5D A;  3AEE C;  3P8C E;  5KLV J;  2H7H A;  3G3Z A;  1JY2 O;  2Y9Z A;  3A0H E;  1BGY E;  1WMK A;  1FBM A;  1M1J C;  5APU A;  4PV1 B;  3NFQ A;  5APS A;  1LGH B;  1BE3 J;  3RK2 B;  2BCC G;  2E74 B;  2RH0 A;  2C9L Y;  2XU6 A;  5H2F E;  4YXD C;  2Q3I A;  3MD0 A;  1PFI A;  3B5N A;  2KS1 B;  5DJT B;  2YXR B;  2OYH A;  1JNM A;  2OTL P;  2YO2 A;  1OVR A;  1QEX A;  1VQ7 P;  3EFG A;  3PLN A;  1FDM A;  1NJI Q;  1NTZ K;  4GKG A;  3NMD A;  1JY2 P;  3AE3 C;  1SQV J;  4H13 D;  1EC5 A;  3LID A;  3V5B A;  1QL2 A;  2K88 A;  1KD1 Q;  2FYU K;  1P84 D;  3SFE C;  3B5N B;  3LW5 J;  2O3J A;  2K1A A;  2OYH B;  3IR9 A;  3B71 A;  3M9B A;  3CMA P;  4NPD A;  2Q1K A;  3MUD A;  3VTP C;  3CXH E;  4D6T G;  2WZ7 A;  1SQQ J;  4IOI H;  1BE3 D;  1HWT C;  2KZI A;  2CPS A;  1YTZ T;  3AE8 C;  4AQR D;  4C7R A;  1HF9 A;  1R5S A;  1RY3 A;  1BGY J;  4L73 A;  3RL0 D;  1H8A A;  2IFN A;  1M57 D;  3AE4 C;  4K35 A;  3C9I A;  3HUS C;  2QVA A;  1YQ3 C;  2KSJ A;  2QEX P;  2R44 A;  4EYY Q;  2ZXE B;  1RE3 C;  4OGQ D;  1KQF B;  2LR2 A;  3CI9 A;  2WPV B;  1U7M A;  2ZXX A;  1JM0 A;  1X79 B;  1SFC C;  2GM4 A;  4BWN A;  3B8E B;  2ZYD A;  1BDD A;  1SQV D;  1HVV A;  3S4R A;  1X0T A;  3PRJ A;  1AVO A;  1Y9B A;  1KYO E;  2GUV A;  2E76 C;  1T2K C;  4U3F G;  4I6M C;  1JOC A;  2N1T C;  3H1K E; 
#chains in the Genus database with same CATH homology
 1ZME C;  2QJK C;  1OMI A;  1Q90 D;  3SFE C;  1PL5 A;  3EWK A;  3Q3D A;  2ZT9 B;  3D6Y A;  2MKV A;  3AED C;  1GMJ A;  2G8Y A;  4Y28 J;  2D2C B;  3O6Q A;  2E76 D;  5M1B A;  3R4Y A;  2K9Y A;  3LW5 J;  4XFJ A;  3GF7 A;  1KTM A;  1OW8 A;  3FGA D;  1RQV A;  3B71 A;  2ZT9 C;  2FYN C;  1PV3 A;  5KLI C;  3AE5 C;  3AE2 C;  4TT3 H;  1YQ4 C;  3AEF C;  2H89 C;  2P10 A;  1R8E A;  1IK7 A;  2YIU C;  4U7J A;  1OW6 A;  1ZOY C;  2H88 C;  1TU3 F;  3AE7 C;  1DD4 A;  3Q5S A;  1EXI A;  2ZT9 D;  3AEE C;  2JO1 A;  2IDB A;  4H0L B;  3AE6 C;  2D2C D;  1VF5 B;  1RQU A;  3G9R A;  2O01 J;  4OGQ B;  1WMK A;  2WQY C;  1AJY A;  2QJP C;  3D6Z A;  4I7Z B;  2D2C C;  1K05 A;  4PV1 B;  2QSI A;  3AEC C;  3AE8 C;  4H0L C;  3H25 A;  1VF5 C;  3RL0 g;  3T97 B;  1NGM B;  1HF9 A;  3AEB C;  3AE1 C;  2E74 B;  4GDO A;  2YMK A;  1K04 A;  3AEG C;  3GF3 A;  3C8V A;  4Z1M H;  2NZ2 A;  2E75 B;  3IAO A;  3AE4 C;  3Q5R A;  4YXD C;  1FDI A;  4KT0 J;  1KOR A;  3AEA C;  2WSF J;  1YQ3 C;  3D71 A;  2G3A A;  2J5U A;  2WSE J;  3D70 A;  1KQG B;  4H13 B;  5L8R J;  3RK3 E;  1JB0 J;  3GMA A;  4H0L D;  1S5L X;  3SFD C;  1EXJ A;  1VF5 D;  2QIW A;  2OQQ A;  4R4M A;  5KKZ C;  1VL2 A;  4OGQ D;  1KQF B;  2QJY C;  4IL6 X;  4YTP C;  1U57 A;  2WPV B;  4H13 C;  1UIX A;  1OW7 A;  4PV1 D;  1PIX A;  1KMI Z;  3S9O A;  3Q2Y A;  4OGQ C;  1FDO A;  2E76 B;  1ZP0 C;  1ZRT E;  2E74 D;  3AE9 C;  4I7Z C;  2WSC J;  4PV1 C;  1S1C X;  4RKU J;  3Q5P A;  4R4L A;  3GLM A;  2FBW C;  2E75 D;  4H44 B;  1Y9B A;  1HJ0 A;  2JP3 A;  3AE3 C;  2E74 C;  4H44 D;  2BEZ F;  2E76 C;  1NYH A;  3Q1M A;  1MKM A;  2E75 C;  1DD3 A;  4H13 D;  1DIP A;  2V7Q J;  2FXP A;  2BEQ D;  4H44 C;  3IN6 A;  3ABV C;  1KIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...