3RL0g

Truncated snare complex with complexin (p1)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
47
structure length
47
Chain Sequence
GSKLPDAAKKMEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/exocytosis
molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 47
sequence length 47
chains with identical sequence h, i, j, k, l, m, n
ec nomenclature
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3rl0g00
3RK3E 4GDOA 1KILE 3RL0g
chains in the Genus database with same CATH superfamily
2WSSH 1KYOI 3KXDA 1N73A 1P84H 1JB0J 2E75D 3WUUA 1VF5B 3H1LD 5KAIH 3FWNA 4D6TG 3AE6C 3ZDMA 4R4MA 2WT7B 3BASA 3U1CA 1EDKA 1SP4A 4UB8H 3PJSK 3H1KE 3V4QA 2A06E 1MKMA 2PGDA 1KC8Q 1RF1B 3D71A 2PP6A 2O01H 4PJ0E 1BSNA 1DEBA 1YBKA 1SQBG 1UIXA 2WPSA 4KJMA 2KUBA 1IFMA 1ZLLA 3G6EP 1CW5A 2Y9ZA 1M1JC 4YPCA 3L74J 1U57A 3CPWO 1H89A 1SQPG 2Z5IA 5KAFH 1VF5D 4AUWA 3TGUE 4L75A 3BCCJ 1VQMP 2Q3IA 2KK7A 1N7SB 2P2UA 2JWDA 3H1JG 1N73C 3H1LE 1NYHA 5AW5B 1X0TA 1NTZD 1EDIA 3L70J 4B86A 1JMMA 1PZQA 2AEJA 1P84I 2VRSA 1IZNB 5AW1B 1Q90D 3FXDA 3BRTB 3HE5B 4IL6H 3TNUA 2N1TB 4K3AA 1K04A 3CC7P 5GTIE 2PAJA 5AW0B 3WMM0 1LGHB 4EYYQ 1PV3A 1KILB 5KLVD 4XFJA 3E1RA 1KORA 1MUUA 2ZAEB 1N7SD 2J59M 3NTNA 3M9BA 3Q3DA 3H1HD 3TK1A 5KLVK 3G71P 1GU4A 2Y9YA 4GODA 3RK3E 1OVUA 4PJ0H 3V6IA 1NTKG 1NO4A 1DEEG 1OVVA 1DD4A 4AQRD 4N78E 4N3YB 1QLED 2O3JA 5CHXA 3WUVA 1SQQK 1PP9G 3OJAB 1KFNA 1NTZE 2N1TD 5AVZB 2FKWB 2QA4P 2FYUG 3B71A 1FS0E 5APTA 4DJGA 4K35A 3S4RA 5KKZB 1J1EC 1KILD 2XZRA 4IFMA 3NXSA 3HE4A 2RN0A 3HUSB 3WU2E 1ZR2A 1SQXD 1L0LG 1FZAA 1L4AC 1M56D 3RL0D 3CCUP 1H88A 3HD7A 3VTPC 5CCHD 3KQGA 1SFCB 1ZW0A 3AE5C 1FAVA 2IYOA 2W83C 5CJ0A 3H1KJ 1SQVG 3B4SA 1IFDA 5APUA 1T6AA 1QX8A 4H0LC 3SWFA 3H1HE 3CCVP 1PGQA 2ZVNB 4TLFA 5B66E 5GTIH 1YITP 1M1JB 3L35A 2Y0CA 2XU6A 1T2KC 3PP5A 4C7NB 1VQ4P 4HJGH 3FXEA 2QJYB 2RKLA 1SQBK 4ASVA 4U3FD 3AE1C 2KNCB 1SFCD 3AE9C 1KILE 3VP8A 5B5EE 2KIKA 3L37A 5CCGD 2E43A 2DW3A 1QL2A 1QVGO 3M0DA 1SQXE 1N73B 1ZR4A 3H1LJ 1NAFA 3P8MC 2I8DA 5AW7B 3IR9A 1ZRTD 1BSHA 3D6ZA 3GHGA 3HD7C 5KLIB 2ZVOB 3IFMA 1NH4A 4WY4C 3V2PA 2AXTE 2KLUA 1BGYD 3L71D 1JCCA 3H1ID 1RE4C 3L4FA 5TJHA 2FYZA 1XTGB 1VPCA 3O8ZA 3VMXA 2XDJA 1QL1A 4HKZH 2K9JA 1RF0A 1KB9H 1J1DC 2A06G 3Q5RA 2W27A 5CBOA 1ZXGA 1L0ND 2LXBA 3A2AA 3D70A 1NTMD 4R4LA 2RH0A 2P67A 1YYCA 2XNXA 5B66H 1E79H 1YQ4C 5AW3B 2XNDH 1URQA 4Y99C 1NTZJ 3JCUH 1NTMK 3TGUG 1ZRTE 1LT9A 1J1EB 1KTMA 1EXJA 2N9YB 5TISE 1GD2E 2HR3A 2M3BA 1E5WA 2IX7C 3CWBG 5B5EH 2LKMA 4ZKPA 1IK7A 1AV1A 1SLQA 3PTZA 1BGYE 3VP9A 3TNUB 3Q5PA 2FYUK 1LTJA 3L71E 2ZJSE 3H1IE 2P10A 3GLMA 2QRXA 3H1HJ 5AW9B 3L75D 3OA7A 2IZ1A 3L74E 1L0NE 1LTTC 5AVQB 1HJ0A 3Q5SA 1PGJA 2QE7H 2H8PD 1NTME 1SQVK 3MIWA 1JY3P 4GOEA 2V7QJ 4H44B 2GUVA 2K88A 2H7HA 2AEFA 3EFFK 1LTAC 3TF5A 3GF7A 3U59A 1URQC 2YKPA 1KYOH 4W80A 2ITAA 4OH8B 1CI6B 1VL2A 1JY2O 1LT9C 2JKVA 2CK3H 1SQXJ 5AVYB 1GDTA 3TYYA 3UIAA 1NTZG 1OFCX 3HD7B 1DD3A 4JF7A 3G3ZA 1LP1A 4OGQC 1HUCA 1RH5B 5L8RJ 3W67A 4H44D 5APXA 2YKQA 4JYCA 1T2KD 5TISH 1OWAA 1HVVA 4WY4B 2WPQA 2R3CA 3A7OA 2FXOA 3L75E 2YO2A 2O1JA 1USDA 3H25A 2HYNA 1YI2P 2IBZD 3A0HE 1J1DB 1DH3A 1FZGA 1Z56A 2QJKC 5APSA 3AE7C 4WB4A 4U3FJ 3CX5D 3HD7D 4NPEA 1BCCG 3B8EB 1HWTC 1N7LA 2WPVB 3SFDC 1S4XA 4Y99B 4NPDA 1VQ8P 4WY4D 1EZVD 3AECC 2B9BA 3P7KA 3GHGB 2H88C 5KJ7A 3R2PA 1GU5A 1LT1A 2OTKE 4JPZB 4QMAA 3KHUA 1IFPA 1UIIA 1BGYJ 3GMAA 1ZV8A 1ZOYC 3L71J 1XTCC 3H1IJ 1OW8A 1KV4A 3USSA 1FU1A 2MJZA 2W8ZA 1LWUC 2K9JB 2AEMA 1HJBA 2QSIA 3EFGA 1U7MA 3CCSP 1VQ6P 1L0NJ 2BEQD 1N8RQ 2FYNB 1PGOA 3F5HA 3CX5E 2H43A 1S9KE 1NTMJ 1GK6A 1TU3F 1X22A 1NJIQ 1S72P 1FE6A 2FXPA 3A0HH 1URQB 2K9YA 3V2QA 3R4YA 1Q82Q 1A02J 1NU1G 2YMYA 2NPSC 1LT9B 4I7ZC 3SWKA 5KJ7C 1S3JA 1VQLP 3W68A 3VMYA 2A45H 4GT1A 1PPJD 2KZIA 1W2BO 1PGPA 2Q5UA 3Q2YA 1VQ7P 4I2LC 5AVRB 1L4AA 1LTJB 3CCLP 3RK2C 1YJNP 3BVHA 3AEAC 2SPZA 4GDOA 3KPEA 2D2CC 3BATA 4GKGA 3L75J 4XA4A 2CPSA 4LGDE 4L76A 1URQD 2Q9IA 2WITA 5CJ4A 3CC2P 2H89C 1T3UA 1DX7A 1SQQD 2BCCD 3GW6A 4OVNF 1X9VA 4NPFX 1MZ9A 3K5BA 2YXQB 3GG2A 3L74G 1Q86Q 2OYIC 3G9RA 1OX3A 4GOFA 4Y28J 3ITKA 1S5LE 5AW6B 1CI6A 1BE3D 3BCCG 3MGNA 4LLHA 3MP7B 2B87A 3M9QA 1HGZA 5H2FE 1G1JA 5AW8B 1H0TA 2A45I 1SS1A 3L70G 4D6TD 1LP1B 3V4WA 1YIJP 1JNMA 3N4XA 3P8CD 5KLVE 1HH0A 3L36A 1KMIZ 3AE4C 3A0BE 3V2NA 1GL2C 4WY4A 3VYIA 2KB7P 1EQ7A 2XV5A 1CZQA 2KOGA 1RE4A 1X79B 1SQQE 3KZIE 1LNQA 1SQBD 3L75G 5GTHE 5BU5A 2YXRB 4JQ0D 1SQPD 3D6YA 1N86A 2E74C 1FOSF 1BE3E 3CL3D 4H13C 2QJPC 2QM8A 2ZXEB 1SQPK 4Z1MH 4RKUJ 3H1JD 2NPSB 2A45G 2IDBA 1WT6A 3CX5I 4I7ZB 2N9BA 2GM4A 4ZMDA 2POHA 1VQKP 3NFQA 1JY3N 1HGVA 3E7KA 1Y9BA 3SSUA 1S5LH 3B5NC 1G2CA 3IF4A 4HB1A 2JJLA 2IFMA 1R5LA 4L73A 1NU1K 3RK2B 3WU2H 1MV8A 4KHXA 2Z5HA 3H32B 3II6A 4TT3H 5DJUB 2HFED 4UB6E 3JC22 2CPBA 2QEXP 4MN4C 2D2CB 2V4HA 4DCKA 1SQBE 2GA1A 2ZYAA 3H1KG 3AE8C 4KT0J 3JSVC 2WWWA 1JCDA 4M3LA 4BWNA 1OXZA 4WBAA 5E79E 5CBNA 2E5TA 2GUSA 2LXCB 5KJ7D 4U3FE 1KD1Q 2ZFCA 1KQFB 2OGUA 3KZIH 1MFTA 3CXHD 3SFEC 3CMEP 2FXMA 1NTKD 2NRGA 2KSJA 2M3EA 3H1JE 3AEGC 2V7QH 3RK2D 4PD4D 1PP9D 1EC5A 3RBZA 1K05A 3S1KA 1FZCA 1K73Q 5BU8B 4JBZA 1NTKK 2FYUD 4GIFA 2ZT9C 1P84D 2IZ0A 2JO1A 3L72D 3CCQP 2C9LY 1M90Q 2KSEA 4BRYB 3O6QA 1L4AB 1L0LD 3H1LG 4U7JA 3MZWB 1Q81Q 1KQLA 1VF5C 5KLVJ 2J5UA 3RK3C 1NKZB 1L0LK 5BVZA 4YXWH 3FX0A 3M91A 1AVYA 2E76C 1SQVD 4YXDC 2KLVA 4H0LB 1RQVA 3P32A 3C8VA 2WZ7A 3A3YB 4AYCA 1SQQJ 2BCCJ 2AXTH 4C46A 2L5GB 1RE3C 1QEXA 5EFWB 4UB6H 3CXHE 1JMBA 1VQ5P 2NZ2A 1IFJA 3QH9A 1L4AD 1JY2P 1Q2NA 4PD4E 1PP9E 2C0WA 2YMKA 1IFIA 1VQOP 1BE3J 4HYTB 4EI2A 4H13B 3RBXA 2FYUE 1FZCC 3S9OA 2QJPB 1R5SA 3AEDC 4DZOA 2QIWA 2Q6QA 3L72E 2B87B 1R8EA 2Q1KA 5KAIE 1L0LE 4H0LD 2RMZA 2WSFJ 3LIDA 2XKMA 4D6TJ 1H0TB 1OVRA 1PIXA 2M5AB 4ZKUA 1WMKA 2PFXA 3N7NA 1SQVE 2JWAA 1NGMB 1N2DC 1DIPA 2I1JA 2O01N 3OAKA 3H6PA 1SQBJ 5KLVG 4H13D 2K1AA 1LWUA 1KILC 1OW6A 1Y47A 1JTHA 3C1LA 2A06D 3H1HG 1QGKB 1VQ9P 4EOTA 4PV1C 3RL0C 1GW4A 1RQUA 3BRVB 1K8AQ 2Q7CA 2W6AA 2JDIH 1SVFA 2W6BA 5AW4B 3VMZA 1VQPP 3H1JJ 3LW5J 1J2JB 1FDMA 3HTKA 2PRRA 2NPSA 3TGUD 1BE3G 1PL5A 2ZT9B 2YNYA 1GZLA 1KQGB 2OQQA 4IL6E 1G2CB 2WMMA 1SQXG 3CWBD 2BASA 3HUSC 5M1BA 3VN0A 1YQ3C 3GF3A 1S5LX 3RK3B 3H32A 1EXIA 4DT0A 1SFCC 2IBZE 2KXPB 2E76B 5CCGC 2QVAA 3E1IA 3L73D 1JO5A 4HH2A 3AE3C 3I55P 1M8OB 4ZNCA 2W6JH 5K5GB 1AQ5A 2OTJP 2HPCB 2B88A 1ZN5A 3PH0A 2AXCA 4DOJA 2ZT9D 1NTKJ 4JYBA 1GK4A 2WSCH 2E42A 1EZVE 1PP9J 3CLQA 2OYIA 4U3FG 1GMJA 2WSEJ 2FYUJ 1EDJA 2B89A 2QJYC 3MUDC 1FZCB 3RK3D 3L72J 5APVA 3CXHI 1S2EA 2Q3EA 2E76D 2BEZF 1FBMA 1L0LJ 3CWBE 1ZP0C 4N78D 4W7ZA 3O6QB 3PLNA 2G8YA 2K37A 3M9HA 4BRYA 4PD4I 3I56P 2R5DA 1GTWA 3CCEP 1VDFA 4OGQB 4BXLA 5KLIC 2WPRA 1SQVJ 2YO3A 2C9NY 1U7JA 3L73E 1NTZK 2O01J 1GL2A 2WVRA 2G3AA 2FBWC 1BGYG 2YIUC 3L71G 1AA0A 3CI9A 1IFNA 1LTGC 3H1IG 3A5TA 2WSCJ 2Z4EA 5AVWB 2KI7B 3M06A 1KB9D 3TSIA 2QJKB 4IFFA 3T97A 4PV1B 3RL0B 2L91A 2M0BA 3V2RA 1IC2A 1L0NG 2YKOA 4RO0A 2J58A 1NTMG 1FZBA 1M57D 1BCCD 4OGQD 3CX5H 1USEA 1T3JA 1FZFA 1PPJE 1H8AA 3V5BA 2KS1A 1LTSC 3NMDA 2R32A 5APWA 1AFOA 2WQYC 4EIJA 1NWQA 4OWFA 3RGUA 2JEEA 2M5AA 1OW7A 5AVSB 3VOPA 3L72G 4IFDK 1HF9A 3B5NA 3M0AA 3SWYA 1L2PA 4I1LA 1BDDA 2FFDA 5AW2B 1FC2C 1Y8AA 1QVFO 4WVZA 4PV1D 1BDCA 2HODA 3CMAP 2P58A 3FWLA 1LWUB 1SQXK 1KB9E 1AJYA 2ZYGA 2BCCE 2WTYA 1JTHB 1NAYA 1VQNP 2R44A 4O9BA 1JEKA 3CC4P 1YTZI 1HBWA 1T8ZA 1BCCE 2IBZI 2OYHA 4H44C 3JCUE 1KYOD 1JUNA 3HTKB 3TGUJ 4RESB 1CSBA 1FDOA 3I5CA 2Y0DA 1Q7YQ 1FDIA 4EDFA 1MFZA 1NU1D 4D6TE 3CWBJ 3P8CE 3QWOC 1NVOA 3F89A 3AEEC 2QM7A 1EZVI 4C7RA 2FFDC 1KN7A 2HG5D 2KP8A 1LTBC 1FOSE 1NOHA 1JY2N 1GW3A 3G4SP 2FY8A 5H2FH 2M8RA 2WT7A 3L73J 5APQA 3IAOA 2YIUB 1KZUB 2JR8A 3A0BH 5APYA 1AVOA 2E75C 1SQPE 1NHLA 2NPSD 1G1IA 1RF1A 3U1AA 1RE3A 2E5YA 5C39A 4L74A 2IBZG 2HPCA 4CPGA 3AEBC 1FJPA 2OYHC 1KYOE 1YJWP 2KYVA 2ZYDA 2OYIB 3MHVA 3WUTA 3L74D 5GTHH 5AVVB 2HLOA 5DJTB 1NU1E 1D7MA 2P7JA 3BCCD 1EDLA 2D2CD 1EZVG 1L0NK 1RHZB 4A7PA 1N7SA 3M0DC 5AVTB 3VMAA 4I6MC 5AVUB 2IYPA 4W7YA 3GHGC 4XE5B 5AVXB 3L70D 2WSFH 1IO4A 1GL2B 1M1KQ 3KDPB 1HTLC 2JP3A 1NKNA 1OMIA 3CCMP 3HE5A 4WWIA 2IFNA 5CMZA 2N1TA 1JM0A 2I1KA 1KFMA 3RL0g 1RF1C 1S1CX 1KILA 3L73G 4IL6X 3EWKA 1YTZT 3CCRP 3T97B 1RF0C 2MKVA 1NTKE 1A02F 3LIEA 3PRJA 1LJ2A 1OIPA 3FGAD 2FYNC 1BCCJ 4N6JA 1X8YA 5CCHA 2E74B 3Q1MA 4ASWA 4IOIH 1M7LA 1KB9I 5E79H 3BCCE 3MD0A 1P84E 2R3SA 2KS1B 3PHLA 2R5BA 1GL2D 1PFIA 1JY3O 4RJTA 1N7SC 1ZMEC 3C9IA 2OTLP 2Y0EA 1OZHA 1FJKA 1LTIC 2LR2A 3LW5H 1PPJG 3L70E 3HE4B 3B5NB 4UB8E 2FFDB 3HUSA 3ABVC 2HODB 1RY3A 1K9MQ 3CD6P 1LTJC 3OW2O 1IK9A 1W2EA 2N1TC 2UWJE 2E74D 1SFCA 2P1JA 1AQTA 4LC1A 5CCGA 1W5CE 5KAFE 3H1KD 1SQPJ 2E75B 3HRNA 3CCJP 5KTBA 1SQQG 1WRGA 3AE2C 1YHQP 4YTPC 5CCHC 2BCCG 3TDKA 2C0XA 1KQSO 1YJ9P 1FZEA 2OYHB 3MTUE 3B5ND 1M1JA 3AEFC 2QG4A 2OARA 2W90A 3CXHH 2IPPA 4C7NA 3IN6A 2O1KA 3KYQA 1NU1J 1S9KD 3MUDA 2KZJA 2K3RA 2KNCA 4PD4H 2ZXXA 1IJDB 2OYOA 1JOCA 5KKZC 3EQ2A 2WSEH
chains in the Genus database with same CATH topology
3AE5C 1NGMB 1ZMEC 4U7JA 3AE7C 1VF5C 2FXPA 1Q90D 1HJ0A 3Q5SA 3AE3C 1JB0J 1Y9BA 4H44C 2E75D 1VF5B 2J5UA 2K9YA 1DIPA 3R4YA 4PV1B 2V7QJ 4H44B 2D2CD 3AE6C 4H13D 1K04A 4H0LC 2WPVB 4I7ZB 4R4MA 3SFDC 3Q5RA 1OW6A 2E76C 1FDOA 4I7ZC 4YXDC 2ZT9D 1FDIA 4H0LB 1PV3A 1RQVA 3ABVC 3GF7A 4OGQD 4XFJA 3C8VA 4TT3H 1KORA 3AECC 3D70A 1KMIZ 4PV1C 1MKMA 2D2CB 3AE4C 3Q2YA 4R4LA 1RQUA 1VL2A 2E74D 3Q3DA 2H88C 3AEEC 2WQYC 1YQ4C 1GMJA 2WSEJ 3D71A 2QJYC 3AE8C 4KT0J 3AEAC 1UIXA 2NZ2A 2JP3A 1OMIA 3RK3E 1ZRTE 3LW5J 1OW7A 2E76D 3AE1C 2BEZF 3GMAA 3AE9C 2D2CC 2E75B 4GDOA 1ZP0C 1HF9A 1KILE 1ZOYC 2YMKA 1KQFB 1KTMA 3RL0g 1U57A 1DD3A 1EXJA 1DD4A 2G8YA 1S1CX 4H13B 3AE2C 4YTPC 1OW8A 3SFEC 1VF5D 4IL6X 3EWKA 4OGQC 3S9OA 1PL5A 3AEDC 3IAOA 4PV1D 2ZT9B 5L8RJ 2H89C 4H44D 3T97B 2QIWA 1IK7A 4OGQB 2MKVA 1KQGB 3AEGC 5KLIC 2OQQA 3AEFC 1R8EA 3FGAD 3B71A 3D6YA 3Q5PA 2E75C 3D6ZA 4H0LD 2E74C 1K05A 2WSFJ 2FYNC 2QSIA 1AJYA 5M1BA 3IN6A 2O01J 4H13C 2E74B 3AEBC 2P10A 2BEQD 3Q1MA 1PIXA 2G3AA 2FBWC 2QJPC 2YIUC 2ZT9C 1YQ3C 3GLMA 1NYHA 3GF3A 1S5LX 1TU3F 3H25A 4Z1MH 4RKUJ 2JO1A 1EXIA 3G9RA 1WMKA 2WSCJ 2IDBA 4Y28J 3O6QA 5KKZC 2E76B 2QJKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK3 E;  4GDO A;  1KIL E;  3RL0 g; 
#chains in the Genus database with same CATH topology
 2WSS H;  1KYO I;  3KXD A;  1N73 A;  1P84 H;  1JB0 J;  2E75 D;  3WUU A;  1VF5 B;  3H1L D;  5KAI H;  3FWN A;  4D6T G;  3AE6 C;  3ZDM A;  4R4M A;  2WT7 B;  3BAS A;  3U1C A;  1EDK A;  1SP4 A;  4UB8 H;  3PJS K;  3H1K E;  3V4Q A;  2A06 E;  1MKM A;  2PGD A;  1KC8 Q;  1RF1 B;  3D71 A;  2PP6 A;  2O01 H;  4PJ0 E;  1BSN A;  1DEB A;  1YBK A;  1SQB G;  1UIX A;  2WPS A;  4KJM A;  2KUB A;  1IFM A;  1ZLL A;  3G6E P;  1CW5 A;  2Y9Z A;  1M1J C;  4YPC A;  3L74 J;  1U57 A;  3CPW O;  1H89 A;  1SQP G;  2Z5I A;  5KAF H;  1VF5 D;  4AUW A;  3TGU E;  4L75 A;  3BCC J;  1VQM P;  2Q3I A;  2KK7 A;  1N7S B;  2P2U A;  2JWD A;  3H1J G;  1N73 C;  3H1L E;  1NYH A;  5AW5 B;  1X0T A;  1NTZ D;  1EDI A;  3L70 J;  4B86 A;  1JMM A;  1PZQ A;  2AEJ A;  1P84 I;  2VRS A;  1IZN B;  5AW1 B;  1Q90 D;  3FXD A;  3BRT B;  3HE5 B;  4IL6 H;  3TNU A;  2N1T B;  4K3A A;  1K04 A;  3CC7 P;  5GTI E;  2PAJ A;  5AW0 B;  3WMM 0;  1LGH B;  4EYY Q;  1PV3 A;  1KIL B;  5KLV D;  4XFJ A;  3E1R A;  1KOR A;  1MUU A;  2ZAE B;  1N7S D;  2J59 M;  3NTN A;  3M9B A;  3Q3D A;  3H1H D;  3TK1 A;  5KLV K;  3G71 P;  1GU4 A;  2Y9Y A;  4GOD A;  3RK3 E;  1OVU A;  4PJ0 H;  3V6I A;  1NTK G;  1NO4 A;  1DEE G;  1OVV A;  1DD4 A;  4AQR D;  4N78 E;  4N3Y B;  1QLE D;  2O3J A;  5CHX A;  3WUV A;  1SQQ K;  1PP9 G;  3OJA B;  1KFN A;  1NTZ E;  2N1T D;  5AVZ B;  2FKW B;  2QA4 P;  2FYU G;  3B71 A;  1FS0 E;  5APT A;  4DJG A;  4K35 A;  3S4R A;  5KKZ B;  1J1E C;  1KIL D;  2XZR A;  4IFM A;  3NXS A;  3HE4 A;  2RN0 A;  3HUS B;  3WU2 E;  1ZR2 A;  1SQX D;  1L0L G;  1FZA A;  1L4A C;  1M56 D;  3RL0 D;  3CCU P;  1H88 A;  3HD7 A;  3VTP C;  5CCH D;  3KQG A;  1SFC B;  1ZW0 A;  3AE5 C;  1FAV A;  2IYO A;  2W83 C;  5CJ0 A;  3H1K J;  1SQV G;  3B4S A;  1IFD A;  5APU A;  1T6A A;  1QX8 A;  4H0L C;  3SWF A;  3H1H E;  3CCV P;  1PGQ A;  2ZVN B;  4TLF A;  5B66 E;  5GTI H;  1YIT P;  1M1J B;  3L35 A;  2Y0C A;  2XU6 A;  1T2K C;  3PP5 A;  4C7N B;  1VQ4 P;  4HJG H;  3FXE A;  2QJY B;  2RKL A;  1SQB K;  4ASV A;  4U3F D;  3AE1 C;  2KNC B;  1SFC D;  3AE9 C;  1KIL E;  3VP8 A;  5B5E E;  2KIK A;  3L37 A;  5CCG D;  2E43 A;  2DW3 A;  1QL2 A;  1QVG O;  3M0D A;  1SQX E;  1N73 B;  1ZR4 A;  3H1L J;  1NAF A;  3P8M C;  2I8D A;  5AW7 B;  3IR9 A;  1ZRT D;  1BSH A;  3D6Z A;  3GHG A;  3HD7 C;  5KLI B;  2ZVO B;  3IFM A;  1NH4 A;  4WY4 C;  3V2P A;  2AXT E;  2KLU A;  1BGY D;  3L71 D;  1JCC A;  3H1I D;  1RE4 C;  3L4F A;  5TJH A;  2FYZ A;  1XTG B;  1VPC A;  3O8Z A;  3VMX A;  2XDJ A;  1QL1 A;  4HKZ H;  2K9J A;  1RF0 A;  1KB9 H;  1J1D C;  2A06 G;  3Q5R A;  2W27 A;  5CBO A;  1ZXG A;  1L0N D;  2LXB A;  3A2A A;  3D70 A;  1NTM D;  4R4L A;  2RH0 A;  2P67 A;  1YYC A;  2XNX A;  5B66 H;  1E79 H;  1YQ4 C;  5AW3 B;  2XND H;  1URQ A;  4Y99 C;  1NTZ J;  3JCU H;  1NTM K;  3TGU G;  1ZRT E;  1LT9 A;  1J1E B;  1KTM A;  1EXJ A;  2N9Y B;  5TIS E;  1GD2 E;  2HR3 A;  2M3B A;  1E5W A;  2IX7 C;  3CWB G;  5B5E H;  2LKM A;  4ZKP A;  1IK7 A;  1AV1 A;  1SLQ A;  3PTZ A;  1BGY E;  3VP9 A;  3TNU B;  3Q5P A;  2FYU K;  1LTJ A;  3L71 E;  2ZJS E;  3H1I E;  2P10 A;  3GLM A;  2QRX A;  3H1H J;  5AW9 B;  3L75 D;  3OA7 A;  2IZ1 A;  3L74 E;  1L0N E;  1LTT C;  5AVQ B;  1HJ0 A;  3Q5S A;  1PGJ A;  2QE7 H;  2H8P D;  1NTM E;  1SQV K;  3MIW A;  1JY3 P;  4GOE A;  2V7Q J;  4H44 B;  2GUV A;  2K88 A;  2H7H A;  2AEF A;  3EFF K;  1LTA C;  3TF5 A;  3GF7 A;  3U59 A;  1URQ C;  2YKP A;  1KYO H;  4W80 A;  2ITA A;  4OH8 B;  1CI6 B;  1VL2 A;  1JY2 O;  1LT9 C;  2JKV A;  2CK3 H;  1SQX J;  5AVY B;  1GDT A;  3TYY A;  3UIA A;  1NTZ G;  1OFC X;  3HD7 B;  1DD3 A;  4JF7 A;  3G3Z A;  1LP1 A;  4OGQ C;  1HUC A;  1RH5 B;  5L8R J;  3W67 A;  4H44 D;  5APX A;  2YKQ A;  4JYC A;  1T2K D;  5TIS H;  1OWA A;  1HVV A;  4WY4 B;  2WPQ A;  2R3C A;  3A7O A;  2FXO A;  3L75 E;  2YO2 A;  2O1J A;  1USD A;  3H25 A;  2HYN A;  1YI2 P;  2IBZ D;  3A0H E;  1J1D B;  1DH3 A;  1FZG A;  1Z56 A;  2QJK C;  5APS A;  3AE7 C;  4WB4 A;  4U3F J;  3CX5 D;  3HD7 D;  4NPE A;  1BCC G;  3B8E B;  1HWT C;  1N7L A;  2WPV B;  3SFD C;  1S4X A;  4Y99 B;  4NPD A;  1VQ8 P;  4WY4 D;  1EZV D;  3AEC C;  2B9B A;  3P7K A;  3GHG B;  2H88 C;  5KJ7 A;  3R2P A;  1GU5 A;  1LT1 A;  2OTK E;  4JPZ B;  4QMA A;  3KHU A;  1IFP A;  1UII A;  1BGY J;  3GMA A;  1ZV8 A;  1ZOY C;  3L71 J;  1XTC C;  3H1I J;  1OW8 A;  1KV4 A;  3USS A;  1FU1 A;  2MJZ A;  2W8Z A;  1LWU C;  2K9J B;  2AEM A;  1HJB A;  2QSI A;  3EFG A;  1U7M A;  3CCS P;  1VQ6 P;  1L0N J;  2BEQ D;  1N8R Q;  2FYN B;  1PGO A;  3F5H A;  3CX5 E;  2H43 A;  1S9K E;  1NTM J;  1GK6 A;  1TU3 F;  1X22 A;  1NJI Q;  1S72 P;  1FE6 A;  2FXP A;  3A0H H;  1URQ B;  2K9Y A;  3V2Q A;  3R4Y A;  1Q82 Q;  1A02 J;  1NU1 G;  2YMY A;  2NPS C;  1LT9 B;  4I7Z C;  3SWK A;  5KJ7 C;  1S3J A;  1VQL P;  3W68 A;  3VMY A;  2A45 H;  4GT1 A;  1PPJ D;  2KZI A;  1W2B O;  1PGP A;  2Q5U A;  3Q2Y A;  1VQ7 P;  4I2L C;  5AVR B;  1L4A A;  1LTJ B;  3CCL P;  3RK2 C;  1YJN P;  3BVH A;  3AEA C;  2SPZ A;  4GDO A;  3KPE A;  2D2C C;  3BAT A;  4GKG A;  3L75 J;  4XA4 A;  2CPS A;  4LGD E;  4L76 A;  1URQ D;  2Q9I A;  2WIT A;  5CJ4 A;  3CC2 P;  2H89 C;  1T3U A;  1DX7 A;  1SQQ D;  2BCC D;  3GW6 A;  4OVN F;  1X9V A;  4NPF X;  1MZ9 A;  3K5B A;  2YXQ B;  3GG2 A;  3L74 G;  1Q86 Q;  2OYI C;  3G9R A;  1OX3 A;  4GOF A;  4Y28 J;  3ITK A;  1S5L E;  5AW6 B;  1CI6 A;  1BE3 D;  3BCC G;  3MGN A;  4LLH A;  3MP7 B;  2B87 A;  3M9Q A;  1HGZ A;  5H2F E;  1G1J A;  5AW8 B;  1H0T A;  2A45 I;  1SS1 A;  3L70 G;  4D6T D;  1LP1 B;  3V4W A;  1YIJ P;  1JNM A;  3N4X A;  3P8C D;  5KLV E;  1HH0 A;  3L36 A;  1KMI Z;  3AE4 C;  3A0B E;  3V2N A;  1GL2 C;  4WY4 A;  3VYI A;  2KB7 P;  1EQ7 A;  2XV5 A;  1CZQ A;  2KOG A;  1RE4 A;  1X79 B;  1SQQ E;  3KZI E;  1LNQ A;  1SQB D;  3L75 G;  5GTH E;  5BU5 A;  2YXR B;  4JQ0 D;  1SQP D;  3D6Y A;  1N86 A;  2E74 C;  1FOS F;  1BE3 E;  3CL3 D;  4H13 C;  2QJP C;  2QM8 A;  2ZXE B;  1SQP K;  4Z1M H;  4RKU J;  3H1J D;  2NPS B;  2A45 G;  2IDB A;  1WT6 A;  3CX5 I;  4I7Z B;  2N9B A;  2GM4 A;  4ZMD A;  2POH A;  1VQK P;  3NFQ A;  1JY3 N;  1HGV A;  3E7K A;  1Y9B A;  3SSU A;  1S5L H;  3B5N C;  1G2C A;  3IF4 A;  4HB1 A;  2JJL A;  2IFM A;  1R5L A;  4L73 A;  1NU1 K;  3RK2 B;  3WU2 H;  1MV8 A;  4KHX A;  2Z5H A;  3H32 B;  3II6 A;  4TT3 H;  5DJU B;  2HFE D;  4UB6 E;  3JC2 2;  2CPB A;  2QEX P;  4MN4 C;  2D2C B;  2V4H A;  4DCK A;  1SQB E;  2GA1 A;  2ZYA A;  3H1K G;  3AE8 C;  4KT0 J;  3JSV C;  2WWW A;  1JCD A;  4M3L A;  4BWN A;  1OXZ A;  4WBA A;  5E79 E;  5CBN A;  2E5T A;  2GUS A;  2LXC B;  5KJ7 D;  4U3F E;  1KD1 Q;  2ZFC A;  1KQF B;  2OGU A;  3KZI H;  1MFT A;  3CXH D;  3SFE C;  3CME P;  2FXM A;  1NTK D;  2NRG A;  2KSJ A;  2M3E A;  3H1J E;  3AEG C;  2V7Q H;  3RK2 D;  4PD4 D;  1PP9 D;  1EC5 A;  3RBZ A;  1K05 A;  3S1K A;  1FZC A;  1K73 Q;  5BU8 B;  4JBZ A;  1NTK K;  2FYU D;  4GIF A;  2ZT9 C;  1P84 D;  2IZ0 A;  2JO1 A;  3L72 D;  3CCQ P;  2C9L Y;  1M90 Q;  2KSE A;  4BRY B;  3O6Q A;  1L4A B;  1L0L D;  3H1L G;  4U7J A;  3MZW B;  1Q81 Q;  1KQL A;  1VF5 C;  5KLV J;  2J5U A;  3RK3 C;  1NKZ B;  1L0L K;  5BVZ A;  4YXW H;  3FX0 A;  3M91 A;  1AVY A;  2E76 C;  1SQV D;  4YXD C;  2KLV A;  4H0L B;  1RQV A;  3P32 A;  3C8V A;  2WZ7 A;  3A3Y B;  4AYC A;  1SQQ J;  2BCC J;  2AXT H;  4C46 A;  2L5G B;  1RE3 C;  1QEX A;  5EFW B;  4UB6 H;  3CXH E;  1JMB A;  1VQ5 P;  2NZ2 A;  1IFJ A;  3QH9 A;  1L4A D;  1JY2 P;  1Q2N A;  4PD4 E;  1PP9 E;  2C0W A;  2YMK A;  1IFI A;  1VQO P;  1BE3 J;  4HYT B;  4EI2 A;  4H13 B;  3RBX A;  2FYU E;  1FZC C;  3S9O A;  2QJP B;  1R5S A;  3AED C;  4DZO A;  2QIW A;  2Q6Q A;  3L72 E;  2B87 B;  1R8E A;  2Q1K A;  5KAI E;  1L0L E;  4H0L D;  2RMZ A;  2WSF J;  3LID A;  2XKM A;  4D6T J;  1H0T B;  1OVR A;  1PIX A;  2M5A B;  4ZKU A;  1WMK A;  2PFX A;  3N7N A;  1SQV E;  2JWA A;  1NGM B;  1N2D C;  1DIP A;  2I1J A;  2O01 N;  3OAK A;  3H6P A;  1SQB J;  5KLV G;  4H13 D;  2K1A A;  1LWU A;  1KIL C;  1OW6 A;  1Y47 A;  1JTH A;  3C1L A;  2A06 D;  3H1H G;  1QGK B;  1VQ9 P;  4EOT A;  4PV1 C;  3RL0 C;  1GW4 A;  1RQU A;  3BRV B;  1K8A Q;  2Q7C A;  2W6A A;  2JDI H;  1SVF A;  2W6B A;  5AW4 B;  3VMZ A;  1VQP P;  3H1J J;  3LW5 J;  1J2J B;  1FDM A;  3HTK A;  2PRR A;  2NPS A;  3TGU D;  1BE3 G;  1PL5 A;  2ZT9 B;  2YNY A;  1GZL A;  1KQG B;  2OQQ A;  4IL6 E;  1G2C B;  2WMM A;  1SQX G;  3CWB D;  2BAS A;  3HUS C;  5M1B A;  3VN0 A;  1YQ3 C;  3GF3 A;  1S5L X;  3RK3 B;  3H32 A;  1EXI A;  4DT0 A;  1SFC C;  2IBZ E;  2KXP B;  2E76 B;  5CCG C;  2QVA A;  3E1I A;  3L73 D;  1JO5 A;  4HH2 A;  3AE3 C;  3I55 P;  1M8O B;  4ZNC A;  2W6J H;  5K5G B;  1AQ5 A;  2OTJ P;  2HPC B;  2B88 A;  1ZN5 A;  3PH0 A;  2AXC A;  4DOJ A;  2ZT9 D;  1NTK J;  4JYB A;  1GK4 A;  2WSC H;  2E42 A;  1EZV E;  1PP9 J;  3CLQ A;  2OYI A;  4U3F G;  1GMJ A;  2WSE J;  2FYU J;  1EDJ A;  2B89 A;  2QJY C;  3MUD C;  1FZC B;  3RK3 D;  3L72 J;  5APV A;  3CXH I;  1S2E A;  2Q3E A;  2E76 D;  2BEZ F;  1FBM A;  1L0L J;  3CWB E;  1ZP0 C;  4N78 D;  4W7Z A;  3O6Q B;  3PLN A;  2G8Y A;  2K37 A;  3M9H A;  4BRY A;  4PD4 I;  3I56 P;  2R5D A;  1GTW A;  3CCE P;  1VDF A;  4OGQ B;  4BXL A;  5KLI C;  2WPR A;  1SQV J;  2YO3 A;  2C9N Y;  1U7J A;  3L73 E;  1NTZ K;  2O01 J;  1GL2 A;  2WVR A;  2G3A A;  2FBW C;  1BGY G;  2YIU C;  3L71 G;  1AA0 A;  3CI9 A;  1IFN A;  1LTG C;  3H1I G;  3A5T A;  2WSC J;  2Z4E A;  5AVW B;  2KI7 B;  3M06 A;  1KB9 D;  3TSI A;  2QJK B;  4IFF A;  3T97 A;  4PV1 B;  3RL0 B;  2L91 A;  2M0B A;  3V2R A;  1IC2 A;  1L0N G;  2YKO A;  4RO0 A;  2J58 A;  1NTM G;  1FZB A;  1M57 D;  1BCC D;  4OGQ D;  3CX5 H;  1USE A;  1T3J A;  1FZF A;  1PPJ E;  1H8A A;  3V5B A;  2KS1 A;  1LTS C;  3NMD A;  2R32 A;  5APW A;  1AFO A;  2WQY C;  4EIJ A;  1NWQ A;  4OWF A;  3RGU A;  2JEE A;  2M5A A;  1OW7 A;  5AVS B;  3VOP A;  3L72 G;  4IFD K;  1HF9 A;  3B5N A;  3M0A A;  3SWY A;  1L2P A;  4I1L A;  1BDD A;  2FFD A;  5AW2 B;  1FC2 C;  1Y8A A;  1QVF O;  4WVZ A;  4PV1 D;  1BDC A;  2HOD A;  3CMA P;  2P58 A;  3FWL A;  1LWU B;  1SQX K;  1KB9 E;  1AJY A;  2ZYG A;  2BCC E;  2WTY A;  1JTH B;  1NAY A;  1VQN P;  2R44 A;  4O9B A;  1JEK A;  3CC4 P;  1YTZ I;  1HBW A;  1T8Z A;  1BCC E;  2IBZ I;  2OYH A;  4H44 C;  3JCU E;  1KYO D;  1JUN A;  3HTK B;  3TGU J;  4RES B;  1CSB A;  1FDO A;  3I5C A;  2Y0D A;  1Q7Y Q;  1FDI A;  4EDF A;  1MFZ A;  1NU1 D;  4D6T E;  3CWB J;  3P8C E;  3QWO C;  1NVO A;  3F89 A;  3AEE C;  2QM7 A;  1EZV I;  4C7R A;  2FFD C;  1KN7 A;  2HG5 D;  2KP8 A;  1LTB C;  1FOS E;  1NOH A;  1JY2 N;  1GW3 A;  3G4S P;  2FY8 A;  5H2F H;  2M8R A;  2WT7 A;  3L73 J;  5APQ A;  3IAO A;  2YIU B;  1KZU B;  2JR8 A;  3A0B H;  5APY A;  1AVO A;  2E75 C;  1SQP E;  1NHL A;  2NPS D;  1G1I A;  1RF1 A;  3U1A A;  1RE3 A;  2E5Y A;  5C39 A;  4L74 A;  2IBZ G;  2HPC A;  4CPG A;  3AEB C;  1FJP A;  2OYH C;  1KYO E;  1YJW P;  2KYV A;  2ZYD A;  2OYI B;  3MHV A;  3WUT A;  3L74 D;  5GTH H;  5AVV B;  2HLO A;  5DJT B;  1NU1 E;  1D7M A;  2P7J A;  3BCC D;  1EDL A;  2D2C D;  1EZV G;  1L0N K;  1RHZ B;  4A7P A;  1N7S A;  3M0D C;  5AVT B;  3VMA A;  4I6M C;  5AVU B;  2IYP A;  4W7Y A;  3GHG C;  4XE5 B;  5AVX B;  3L70 D;  2WSF H;  1IO4 A;  1GL2 B;  1M1K Q;  3KDP B;  1HTL C;  2JP3 A;  1NKN A;  1OMI A;  3CCM P;  3HE5 A;  4WWI A;  2IFN A;  5CMZ A;  2N1T A;  1JM0 A;  2I1K A;  1KFM A;  3RL0 g;  1RF1 C;  1S1C X;  1KIL A;  3L73 G;  4IL6 X;  3EWK A;  1YTZ T;  3CCR P;  3T97 B;  1RF0 C;  2MKV A;  1NTK E;  1A02 F;  3LIE A;  3PRJ A;  1LJ2 A;  1OIP A;  3FGA D;  2FYN C;  1BCC J;  4N6J A;  1X8Y A;  5CCH A;  2E74 B;  3Q1M A;  4ASW A;  4IOI H;  1M7L A;  1KB9 I;  5E79 H;  3BCC E;  3MD0 A;  1P84 E;  2R3S A;  2KS1 B;  3PHL A;  2R5B A;  1GL2 D;  1PFI A;  1JY3 O;  4RJT A;  1N7S C;  1ZME C;  3C9I A;  2OTL P;  2Y0E A;  1OZH A;  1FJK A;  1LTI C;  2LR2 A;  3LW5 H;  1PPJ G;  3L70 E;  3HE4 B;  3B5N B;  4UB8 E;  2FFD B;  3HUS A;  3ABV C;  2HOD B;  1RY3 A;  1K9M Q;  3CD6 P;  1LTJ C;  3OW2 O;  1IK9 A;  1W2E A;  2N1T C;  2UWJ E;  2E74 D;  1SFC A;  2P1J A;  1AQT A;  4LC1 A;  5CCG A;  1W5C E;  5KAF E;  3H1K D;  1SQP J;  2E75 B;  3HRN A;  3CCJ P;  5KTB A;  1SQQ G;  1WRG A;  3AE2 C;  1YHQ P;  4YTP C;  5CCH C;  2BCC G;  3TDK A;  2C0X A;  1KQS O;  1YJ9 P;  1FZE A;  2OYH B;  3MTU E;  3B5N D;  1M1J A;  3AEF C;  2QG4 A;  2OAR A;  2W90 A;  3CXH H;  2IPP A;  4C7N A;  3IN6 A;  2O1K A;  3KYQ A;  1NU1 J;  1S9K D;  3MUD A;  2KZJ A;  2K3R A;  2KNC A;  4PD4 H;  2ZXX A;  1IJD B;  2OYO A;  1JOC A;  5KKZ C;  3EQ2 A;  2WSE H; 
#chains in the Genus database with same CATH homology
 3AE5 C;  1NGM B;  1ZME C;  4U7J A;  3AE7 C;  1VF5 C;  2FXP A;  1Q90 D;  1HJ0 A;  3Q5S A;  3AE3 C;  1JB0 J;  1Y9B A;  4H44 C;  2E75 D;  1VF5 B;  2J5U A;  2K9Y A;  1DIP A;  3R4Y A;  4PV1 B;  2V7Q J;  4H44 B;  2D2C D;  3AE6 C;  4H13 D;  1K04 A;  4H0L C;  2WPV B;  4I7Z B;  4R4M A;  3SFD C;  3Q5R A;  1OW6 A;  2E76 C;  1FDO A;  4I7Z C;  4YXD C;  2ZT9 D;  1FDI A;  4H0L B;  1PV3 A;  1RQV A;  3ABV C;  3GF7 A;  4OGQ D;  4XFJ A;  3C8V A;  4TT3 H;  1KOR A;  3AEC C;  3D70 A;  1KMI Z;  4PV1 C;  1MKM A;  2D2C B;  3AE4 C;  3Q2Y A;  4R4L A;  1RQU A;  1VL2 A;  2E74 D;  3Q3D A;  2H88 C;  3AEE C;  2WQY C;  1YQ4 C;  1GMJ A;  2WSE J;  3D71 A;  2QJY C;  3AE8 C;  4KT0 J;  3AEA C;  1UIX A;  2NZ2 A;  2JP3 A;  1OMI A;  3RK3 E;  1ZRT E;  3LW5 J;  1OW7 A;  2E76 D;  3AE1 C;  2BEZ F;  3GMA A;  3AE9 C;  2D2C C;  2E75 B;  4GDO A;  1ZP0 C;  1HF9 A;  1KIL E;  1ZOY C;  2YMK A;  1KQF B;  1KTM A;  3RL0 g;  1U57 A;  1DD3 A;  1EXJ A;  1DD4 A;  2G8Y A;  1S1C X;  4H13 B;  3AE2 C;  4YTP C;  1OW8 A;  3SFE C;  1VF5 D;  4IL6 X;  3EWK A;  4OGQ C;  3S9O A;  1PL5 A;  3AED C;  3IAO A;  4PV1 D;  2ZT9 B;  5L8R J;  2H89 C;  4H44 D;  3T97 B;  2QIW A;  1IK7 A;  4OGQ B;  2MKV A;  1KQG B;  3AEG C;  5KLI C;  2OQQ A;  3AEF C;  1R8E A;  3FGA D;  3B71 A;  3D6Y A;  3Q5P A;  2E75 C;  3D6Z A;  4H0L D;  2E74 C;  1K05 A;  2WSF J;  2FYN C;  2QSI A;  1AJY A;  5M1B A;  3IN6 A;  2O01 J;  4H13 C;  2E74 B;  3AEB C;  2P10 A;  2BEQ D;  3Q1M A;  1PIX A;  2G3A A;  2FBW C;  2QJP C;  2YIU C;  2ZT9 C;  1YQ3 C;  3GLM A;  1NYH A;  3GF3 A;  1S5L X;  1TU3 F;  3H25 A;  4Z1M H;  4RKU J;  2JO1 A;  1EXI A;  3G9R A;  1WMK A;  2WSC J;  2IDB A;  4Y28 J;  3O6Q A;  5KKZ C;  2E76 B;  2QJK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...