4GKGA

Crystal structure of the s-helix linker
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
52
structure length
52
Chain Sequence
PRGSHMEERLARNALEASVEERTRDLRMARDRLETEIADHRQTTEKLQAVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C4-dicarboxylate transport sensor protein dctB
publication title Crystal structure of the S-Helix Linker
rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
total genus 22
structure length 52
sequence length 52
chains with identical sequence F
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4gkgA00
5AVUB 2XU6A 2R5DA 1SP4A 2P67A 2W27A 4JYCA 1CI6A 4C46A 2ZFCA 2Q7CA 5AVRB 1NWQA 3A7OA 3T97A 2WPRA 5APVA 3UIAA 2JJLA 5APXA 1OWAA 2ZXEB 3HE5A 3L35A 3LIDA 4GT1A 1GTWA 1GU4A 5APQA 4GKGA 1MUUA 3A3YB 2Q5UA 1JUNA 3TYYA 3HE5B 1HUCA 5APSA 5APTA 2YNYA 2XZRA 2WWWA 2P7JA 1IO4A 3NXSA 1KQLA 3MGNA 5AVXB 5AW2B 5AVYB 3VTPC 1A02J 2QM8A 2Q3IA 3I5CA 1T2KD 2WPSA 3NTNA 3TNUA 1GK6A 3V4WA 3M9HA 4AYCA 1MV8A 1T2KC 3L36A 3V4QA 1NAFA 1FOSE 2C9LY 3KDPB 1H88A 4EOTA 3TNUB 5AW6B 3M0DA 2BASA 2E43A 3M06A 5AVQB 2R5BA 3VMYA 1CZQA 2VRSA 4KHXA 2WPQA 4AQRD 2YO3A 2R32A 5AVWB 3NFQA 5AVZB 5AW0B 1S9KE 5AVVB 2N9BA 3A5TA 2R3CA 5APYA 2W6AA 3P7KA 3TK1A 1FAVA 5AW9B 5CMZA 1FOSF 3VN0A 1G2CB 1J2JB 3SWFA 3LIEA 3MD0A 1HWTC 2WT7A 4M3LA 3NMDA 4JYBA 1X8YA 5AVSB 3HTKA 2WT7B 4HYTB 3OAKA 4AUWA 1GZLA 3VMXA 5AW3B 5AW7B 1JNMA 3VYIA 4C7NA 2E42A 2XV5A 3M91A 1CSBA 3P32A 3B8EB 3HE4A 2KP8A 2WTYA 1GU5A 4C7NB 1SLQA 1OXZA 5AW1B 3O8ZA 3M0AA 2C9NY 1CI6B 2IPPA 3HE4B 4RESB 2QM7A 1MFZA 1H8AA 1H89A 3M9BA 1HJBA 2YO2A 3P8MC 4I2LC 5AW5B 5AW4B 2H7HA 3L37A 5AVTB 1HBWA 5APUA 1GD2E 4LC1A 2P2UA 3VMZA 1A02F 2Z5HA 4DZOA 1YYCA 5APWA 3A2AA 1S9KD 4B86A 2Z5IA 3IR9A 5AW8B 4XE5B 4I6MC 1GK4A 3KQGA 3V5BA 1DH3A
chains in the Genus database with same CATH superfamily
3HUSC 5M1BA 2V7QJ 1YJNP 1JO5A 3ZDMA 2N1TB 1RF1B 1SQQG 2HR3A 1T3JA 3BCCJ 3CI9A 1L0NJ 5GTHH 2AEJA 3A3YB 1VQ6P 1X22A 3VOPA 2E74B 2HODA 3IFMA 1R8EA 4AYCA 1J1DB 3II6A 3M9HA 2KLVA 5L8RJ 2IYOA 4I7ZC 3L72E 2BASA 1SS1A 2A06E 3HUSB 3D70A 4UB8E 2IFMA 1IK7A 1YQ4C 2HPCB 2JEEA 3MZWB 4IOIH 4TLFA 5BVZA 4A7PA 1Q86Q 2ZT9B 1GMJA 2OYIB 1G2CB 1JTHB 1X8YA 1NTKJ 2FYNC 5EFWB 2JWDA 1KILA 1GW4A 1JY2O 2BCCJ 2HFED 1UIIA 1VF5D 1NOHA 1QVGO 1USEA 3H1LD 2G8YA 3PLNA 2ZVNB 1EC5A 1R5LA 3G9RA 4ZMDA 3CWBD 3GG2A 1KB9H 2FYUD 3S1KA 3RBXA 4JYCA 3H1LG 1VQ7P 3H32B 1J1EC 1AVYA 1LTGC 2QIWA 3H1KD 3CC2P 1Q90D 2FYUG 3TGUE 5APTA 3V2NA 1EDLA 5CHXA 3AEBC 1KQLA 1AVOA 1KYOD 3H1KG 3Q5RA 1Y8AA 2HODB 3L36A 3CCSP 3CX5I 1L2PA 2VRSA 1HH0A 4PJ0E 3L73J 2Y0CA 4N6JA 1KB9I 2WMMA 2OGUA 2WSFJ 5KLVD 1LTJC 2ITAA 2E5TA 3L71D 4HKZH 3H1JG 3HTKA 4WVZA 4GDOA 3RL0g 1N8RQ 4HYTB 4AUWA 1M56D 2Y0EA 1PP9D 1S1CX 3BATA 2QJYC 3L71G 4R4MA 1KILB 2B88A 2QG4A 1CI6B 2WQYC 3H1IJ 4WBAA 4XFJA 1PP9G 1U57A 2Z5HA 3U1AA 3A2AA 2WVRA 4B86A 4R4LA 1SQXE 1LT1A 2IZ0A 2I1KA 1K9MQ 2UWJE 1FZGA 3AEGC 3UIAA 2O1KA 1VQKP 5CCGD 2JKVA 2IBZE 2QJKC 2IDBA 1HUCA 1VQLP 5APSA 1H0TA 1M1JC 1PGJA 1NTME 3P8CD 3MGNA 1IJDB 5AVYB 2Q3IA 2YKQA 3H1HE 4JQ0D 3TNUA 2AEFA 2D2CD 2KXPB 3V4QA 1BGYD 1NTZK 2KK7A 3CMEP 5KLIB 3VMYA 1MFTA 4UB8H 3RK3D 4PV1D 2OYHA 1L0LE 2JP3A 3RL0B 1MKMA 1BGYG 4YXDC 4H44D 1LP1B 2QJKB 1BE3J 2N9YB 3VN0A 3KXDA 4M3LA 2O3JA 1K04A 3AE1C 1NU1K 3IF4A 3AEFC 3HTKB 3N7NA 1JOCA 4W7ZA 3CCJP 4L75A 2KB7P 1URQD 4ASVA 4IL6E 4QMAA 3Q2YA 3VMZA 2RH0A 3BCCD 1L0ND 5B66E 2R3SA 3B4SA 2YIUB 2OTLP 2K37A 2P67A 5CBOA 2K9YA 3BCCG 2E75C 2CK3H 2GM4A 4L76A 2LXCB 5APQA 3GHGA 3TYYA 1BDCA 1BCCJ 3SWKA 1PV3A 1NTZJ 3WUTA 5E79E 1H0TB 3B5ND 1A02J 3NTNA 2NZ2A 4WY4D 3AE4C 2KUBA 3E1RA 3KDPB 3TNUB 1NJIQ 3MTUE 3OA7A 1FC2C 4Y99C 3AEAC 2WPQA 1W2EA 2PFXA 4PJ0H 3L74J 4U3FE 2OYHB 1NU1J 2O1JA 2E76D 1SFCA 1NTKD 1OVRA 2CPBA 2BCCD 2PRRA 2OARA 2NPSA 1PPJD 1NTKG 3GW6A 4PD4D 4OGQC 1S3JA 3V2PA 1PPJG 3W67A 2OYOA 4Y99B 1HJBA 2BEZF 2W90A 2ZT9D 4H13B 3L37A 1FDIA 2KIKA 2P2UA 4DZOA 3R2PA 5AW8B 1GK4A 3L72J 3D6ZA 1VQOP 3V5BA 1KFMA 1DEEG 1OZHA 1VPCA 2OTJP 1OW6A 1NWQA 4N78E 2D2CC 1QX8A 4H0LD 4OGQB 1WT6A 5KJ7D 4TT3H 1JMMA 4PV1C 1SFCC 3GHGB 3Q5SA 1SVFA 3O6QA 3C8VA 4BWNA 1T2KD 2NPSC 4YPCA 2QJPC 5KAIE 5TISE 3L73D 3A0HE 1EXIA 4Z1MH 5AVQB 1YHQP 3L75G 3PTZA 1HVVA 5CJ0A 1SQPE 2ZVOB 3FXEA 3BASA 3L73G 4U7JA 2Y9YA 2DW3A 5KTBA 3QH9A 3IN6A 1SFCB 1RQVA 3MD0A 2QVAA 1OFCX 2KI7B 3C9IA 3CCMP 1SQBE 1DD3A 1X79B 3H1ID 3CC7P 2NPSB 2QJPB 3VP9A 4RJTA 4IL6H 2P1JA 3TGUJ 3E1IA 1YITP 1NGMB 3EQ2A 2M3BA 4RO0A 3L70E 2BEQD 5AVTB 1LTSC 1N7SA 1S9KD 5B66H 4GOFA 2Q1KA 1NTMK 1YTZT 1SP4A 1L4AD 1LT9C 2K88A 1YTZI 3A7OA 3CL3D 3A0BE 1KILD 1HGVA 2PP6A 5CJ4A 2FXPA 2WSSH 2QSIA 1Z56A 2Q5UA 1PIXA 3HD7D 1L0LK 5E79H 3O6QB 1VQ8P 5DJUB 2E76C 3GF7A 3PP5A 2FYUE 5CCHC 1YI2P 1T6AA 4HJGH 2QE7H 1ZR4A 3V2RA 4UB6E 1BE3D 3H1KE 4KHXA 1KMIZ 1EDIA 2B87A 1KB9D 2PAJA 3NFQA 4D6TE 2WSCH 3GMAA 1SQVE 1M1KQ 1BE3G 5CMZA 1FOSF 1N7SC 1EZVI 1JB0J 2L5GB 3NMDA 1JY3N 1JMBA 4W7YA 4IFDK 1JM0A 5KAFE 1KQFB 2XV5A 3H1JE 3RL0D 3VP8A 3AE8C 1ZR2A 1MFZA 1NTMJ 3V2QA 3L71E 2QEXP 1AJYA 1RH5B 1N7SB 3GF3A 2XU6A 1YBKA 1U7MA 2RN0A 1CI6A 4I7ZB 1S2EA 1JEKA 1BCCD 2Q7CA 1L0LJ 1NTZD 3CX5H 1NKZB 1N7LA 2ZXEB 5H2FE 1N73C 2K3RA 2W6JH 1WMKA 1LTJA 3MUDC 5AW2B 2HYNA 3FX0A 4WB4A 2WPSA 5KAIH 3V4WA 5TISH 3CCEP 1Y47A 1P84E 3L74D 3A0HH 3I55P 4EYYQ 1HF9A 1NU1D 1FDOA 2FYNB 4DCKA 3CWBG 3M06A 5K5GB 3CCUP 3I56P 1CZQA 4IL6X 4AQRD 3K5BA 4L74A 4LLHA 3L74G 2B87B 1FZBA 1NU1G 3RK2C 1IFPA 2W83C 1RQUA 3R4YA 5AVSB 4EDFA 3WUUA 4MN4C 4EI2A 2YMYA 3BVHA 1J1EB 3M0DC 1LP1A 2Y0DA 5AW1B 4K3AA 3L72D 1MZ9A 1M1JA 1M8OB 2A06D 2J5UA 2AEMA 4I2LC 2CPSA 5AW5B 1FZCA 2SPZA 2H89C 1KFNA 1GL2C 4RKUJ 1XTGB 4I6MC 4L73A 3L72G 2A06G 1NKNA 5KLVG 1M57D 4DT0A 1PGPA 3A0BH 4JF7A 2M3EA 4U3FJ 2WSCJ 4KT0J 2A45G 2H88C 1SQPK 3TF5A 2GUVA 3PJSK 3ITKA 1LTJB 1USDA 3VTPC 2FKWB 4I1LA 3JC22 1KV4A 4UB6H 1SQBK 2QJYB 1G1JA 1QEXA 4EIJA 2GUSA 5AVVB 3CLQA 2R3CA 1Q2NA 3GLMA 1FZCC 4CPGA 2LR2A 2NRGA 5KKZC 4ZKUA 1ZOYC 3G6EP 2P58A 1NAYA 1OW8A 1VQNP 5KAFH 4GODA 2QA4P 1OMIA 2H43A 2FXMA 2HG5D 2KS1A 3HE4A 1LNQA 4LGDE 3CCVP 2I8DA 1AQTA 1VF5C 1FU1A 2H8PD 2YO2A 2IZ1A 1LJ2A 1M1JB 1R5SA 2J58A 1ZRTE 2G3AA 3U1CA 5APWA 1FZCB 1X0TA 2Z5IA 4XE5B 1FZAA 5KKZB 4ZNCA 4PD4E 1KTMA 2W27A 1SQPJ 2FYUK 1S5LX 5AVRB 3WUVA 5APVA 3SWYA 1KYOI 5DJTB 3AE6C 5H2FH 2B9BA 3HE5A 3AECC 4GT1A 1JY3O 1FZFA 1K8AQ 4NPFX 1U7JA 1RE4C 1SQBJ 2PGDA 1AQ5A 1SQVK 3I5CA 1QGKB 1P84H 3EFFK 1NAFA 1EZVE 2C9LY 2K9JA 2M0BA 1ZV8A 1L0NG 3D71A 3HRNA 2WZ7A 1LWUC 1RY3A 3D6YA 4ASWA 3L70J 1KN7A 1AA0A 1K73Q 3RGUA 5CCGA 2FFDC 2C0XA 2A45I 2W6AA 3L75E 2IBZD 2N1TD 1Q82Q 2GA1A 3H25A 3OAKA 1D7MA 1NTMD 3PH0A 5AW3B 1TU3F 5B5EE 2IBZG 2E75B 3B8EB 3B71A 2WTYA 2E74D 2KS1B 3HE4B 1NTMG 1P84I 1CW5A 3CCRP 2FYUJ 1L0LD 2C0WA 1RF0C 2OTKE 1M7LA 2BCCG 1E5WA 1QLED 1VL2A 1L0LG 4D6TJ 1PZQA 1URQA 3CXHD 3M9QA 1SQVJ 5CCGC 3FGAD 3HE5B 2AXTE 2YNYA 2P7JA 2M5AA 1BSNA 1FDMA 1FOSE 2IFNA 1JCDA 3H1JJ 2K9JB 1PGQA 3RK3C 2R44A 1SQQE 5AVWB 2FY8A 1KZUB 1VQ9P 2N9BA 5APYA 1VQPP 1HJ0A 4H44C 3SWFA 2MKVA 1LTBC 1N2DC 1LT9A 1S5LE 4WY4A 4IFFA 3VMAA 2ZYAA 2XNXA 4C7NA 1ZLLA 2D2CB 4Y28J 1URQC 1DX7A 3JCUE 1IFNA 2IPPA 3CMAP 2MJZA 1S4XA 2O01N 3RK3B 4PV1B 1T3UA 1UIXA 5AW4B 2J59M 1HBWA 5GTIE 5CCHA 2E5YA 4PD4H 1SQXK 2XDJA 1N86A 4IFMA 1PGOA 1AFOA 4WWIA 4C7RA 4NPEA 4OH8B 3TDKA 3H1IG 1HGZA 1KORA 3L35A 3LIDA 3IAOA 2FYZA 1URQB 3QWOC 4HH2A 1RE3C 1VQMP 3KYQA 1FBMA 4O9BA 4KJMA 2M5AB 3B5NC 3C1LA 1FZEA 4WY4C 5AW6B 3H1LE 4JBZA 5KJ7A 4PD4I 3CWBE 4N78D 1GDTA 5BU5A 2E74C 1JY3P 3CX5D 3FWLA 1J2JB 2ZJSE 3KPEA 3LIEA 2WT7A 1E79H 4JYBA 1X9VA 1LT9B 1OX3A 5B5EH 1VQ4P 1ZW0A 2YKPA 4WY4B 1CSBA 1N73A 4C7NB 3O8ZA 3EWKA 1SQXJ 1KYOE 3M9BA 1G1IA 3MUDA 2H7HA 1SQPD 2ZT9C 1GD2E 2OYIC 3H6PA 1ZP0C 3IR9A 2E76B 4W80A 3AE7C 3KZIE 2ZFCA 1IFIA 1SQPG 2B89A 3RBZA 1SQBD 4GIFA 4H0LC 1GTWA 5KLVE 1EDJA 3H1HJ 5KJ7C 2AXTH 1NVOA 4DOJA 1OIPA 1AV1A 2Q3EA 2WWWA 1SQBG 1PP9E 3V6IA 3L70D 3WU2E 1T2KC 3F5HA 3M0DA 2YMKA 1L4AA 1Y9BA 2M8RA 1KC8Q 3L4FA 2QRXA 1BCCG 3L70G 1NTZG 1JCCA 1GL2A 1YIJP 4H0LB 5AW9B 1QL1A 3HD7A 2Y9ZA 1EQ7A 1HWTC 1S5LH 1ZN5A 3SFEC 2WT7B 2KNCA 1GZLA 5AW7B 3VYIA 1BSHA 1FJKA 3JCUH 1OXZA 1N73B 1OVVA 3M0AA 3P8CE 2KSJA 3MHVA 4RESB 1KQGB 1LTTC 5GTIH 1BGYE 2K1AA 1A02F 1KQSO 3CCLP 2JDIH 4D6TD 3G71P 2POHA 3RK3E 3FXDA 1SQVD 4OWFA 4BRYA 2E75D 1L4AC 1NHLA 4D6TG 5APXA 1OWAA 1KILC 1SQVG 1MUUA 1IFDA 3L75J 4GOEA 4XA4A 3MP7B 1SQQK 3RK2B 3H1JD 1IK9A 3HD7C 3WMM0 3NXSA 5AVXB 4BXLA 1DEBA 2RMZA 2W6BA 1M90Q 1LTIC 3TSIA 2WSEH 1IZNB 4H13D 1L4AB 3BRTB 3BCCE 1L0NE 3AE9C 1KD1Q 3Q1MA 3SFDC 3TK1A 1GL2B 1PL5A 3HD7B 3FWNA 1EXJA 3G4SP 4OGQD 5CBNA 3VMXA 2KLUA 4DJGA 5KLIC 3LW5H 2KNCB 2IYPA 2WITA 2KZIA 4NPDA 3S4RA 1T8ZA 1P84D 3RL0C 5BU8B 1FE6A 1KYOH 2QM7A 3MIWA 1RE4A 2ZXXA 4ZKPA 2O01H 3P8MC 1DIPA 3SSUA 3TGUD 3Q5PA 4HB1A 3W68A 2KOGA 1YQ3C 1QVFO 1VDFA 1PFIA 3KZIH 2I1JA 5AVUB 1Q7YQ 2R5DA 1LWUA 3TGUG 1SQQJ 2WPRA 4BRYB 1NTKE 2FFDA 3CC4P 3AE2C 3F89A 4GKGA 3ABVC 1SFCD 2BCCE 1NH4A 1PPJE 3U59A 3N4XA 1GW3A 2A45H 2NPSD 2QM8A 3WU2H 2FBWC 2JO1A 4N3YB 1Q81Q 4YTPC 2YIUC 3CXHE 1XTCC 1IFJA 1VF5B 1FAVA 1W5CE 1RF0A 2V4HA 3AE3C 3EFGA 1FJPA 1SQXD 1JNMA 1WRGA 1VQ5P 2E42A 2LKMA 3BRVB 2ZYGA 1GU5A 2W8ZA 2C9NY 1H8AA 1SQXG 1K05A 2YKOA 2OYHC 5TJHA 5KLVK 5APUA 1JY2P 3L73E 4JPZB 1YYCA 2KSEA 1S72P 2P10A 3CPWO 3H1HD 3H1LJ 4C46A 3E7KA 1OVUA 2WSEJ 1LWUB 1IFMA 3T97A 2JJLA 2YXQB 3CWBJ 2XNDH 1GU4A 5GTHE 1YJWP 3H1HG 1JUNA 2FFDB 4H13C 2XZRA 3H1IE 1LTAC 1JY2N 1IO4A 3AEDC 5CCHD 3H1KJ 2FXOA 1ZMEC 2Q6QA 3OW2O 3LW5J 1ZRTD 3JSVC 2V7QH 4K35A 3AE5C 4OVNF 1QL2A 2R32A 2JWAA 2O01J 5AVZB 1S9KE 3A5TA 2OQQA 3AEEC 3PHLA 3GHGC 3P7KA 1N7SD 1DD4A 3USSA 1NYHA 2WPVB 1KILE 3KHUA 1RHZB 2L91A 2Z4EA 5KLVJ 3P32A 3Q3DA 3S9OA 1HTLC 1OW7A 3L71J 2RKLA 1EZVD 2HLOA 1RE3A 1BDDA 1EDKA 3CX5E 1PP9J 3B5NA 1EZVG 1BE3E 2N1TA 1RF1A 3L75D 1KB9E 2LXBA 1IC2A 1W2BO 2ZAEB 1YJ9P 3T97B 3CCQP 3OJAB 4U3FD 1L0NK 4H44B 5C39A 1GK6A 1MV8A 3HUSA 1H88A 4EOTA 1ZXGA 4U3FG 2XKMA 2E43A 2IBZI 3CXHH 2R5BA 2HPCA 2AXCA 2YO3A 5AW0B 1NO4A 1BGYJ 2OYIA 3RK2D 1G2CA 1JTHA 1BCCE 2KYVA 1NTZE 2N1TC 1LGHB 1RF1C 2YXRB 1FS0E 2JR8A 3CD6P 3M91A 2KP8A 3PRJA 1SLQA 1NTKK 1H89A 2ZYDA 1GL2D 4LC1A 3L74E 1SQQD 1J1DC 2IX7C 1NU1E 2KZJA 3G3ZA 3CXHI 2Q9IA 2WSFH 3B5NB 4YXWH 3KQGA 3H32A 1DH3A
chains in the Genus database with same CATH topology
3HUSC 2W27A 1JO5A 2FYUK 2N1TB 1RF1B 1VPCA 1L4AC 1NHLA 1T3JA 5AVRB 1NWQA 4N78E 3CI9A 5APVA 3SWYA 5APXA 1WT6A 1OWAA 1KILC 3HE5A 5KJ7D 4GT1A 1JY3O 1MUUA 1IFDA 3A3YB 1FZFA 1JMMA 4XA4A 1SFCC 1SQQK 3GHGB 3VOPA 3RK2B 1SVFA 1IK9A 1RE4C 3HD7C 3WMM0 2HODA 3IFMA 3NXSA 5AVXB 1AQ5A 1SQVK 3I5CA 2NPSC 1T2KD 1DEBA 1J1DB 3II6A 3M9HA 4AYCA 2KLVA 1NAFA 2C9LY 2W6BA 1ZV8A 2BASA 1LTIC 3HRNA 3HUSB 3TSIA 5AVQB 2WZ7A 1LWUC 1HVVA 1RY3A 2IFMA 5CJ0A 2WSEH 1L4AB 3BRTB 2HPCB 2JEEA 3BASA 5CCGA 2FFDC 2C0XA 2A45I 5KTBA 2W6AA 5BVZA 3TK1A 1GL2B 2OYIB 1G2CB 1SFCB 3MD0A 1JTHB 2N1TD 3HD7B 1X8YA 3C9IA 1X79B 3OAKA 3VMXA 2NPSB 5AW3B 3LW5H 3VP9A 1KILA 2WITA 1GW4A 1JY2O 2P1JA 3B8EB 2WTYA 2HFED 3E1IA 1T8ZA 3EQ2A 3RL0C 3HE4B 2M3BA 5BU8B 1NOHA 2QM7A 3MIWA 1RE4A 4ZKPA 2O01H 3P8MC 1CW5A 5AVTB 2KOGA 1LTSC 1N7SA 2C0WA 1S9KD 1VDFA 1PFIA 1RF0C 1NTMK 2I1JA 1YTZT 5AVUB 2R5DA 1SP4A 1M7LA 4JYCA 1LWUA 1L4AD 1LT9C 1E5WA 3H32B 1YTZI 3A7OA 1J1EC 3CL3D 2WPRA 1LTGC 1KILD 1HGVA 2FFDA 1URQA 2PP6A 3M9QA 5CJ4A 4GKGA 1Z56A 5CCGC 1SFCD 2Q5UA 3HE5B 1NH4A 5APTA 3V2NA 2YNYA 3HD7D 1L0LK 3U59A 5CHXA 2P7JA 3N4XA 1GW3A 2A45H 1KQLA 2NPSD 2QM8A 3PP5A 4N3YB 1FDMA 2HODB 5CCHC 3L36A 1FOSE 2IFNA 1JCDA 1ZR4A 3V2RA 2VRSA 1XTCC 4KHXA 3RK3C 1HH0A 5AVWB 2PAJA 3NFQA 1KZUB 2WSCH 2N9BA 1IFJA 4N6JA 5APYA 1FAVA 5CMZA 1FOSF 1N7SC 3SWFA 1RF0A 1LTJC 1LTBC 2L5GB 3NMDA 1N2DC 1JY3N 1LT9A 3HTKA 3EFGA 4HYTB 1FJPA 4WY4A 4AUWA 4W7YA 4IFFA 1JNMA 4IFDK 1WRGA 2XNXA 4C7NA 2LKMA 2E42A 1ZLLA 2XV5A 3BRVB 3BATA 1GU5A 3RL0D 1URQC 1DX7A 1KILB 1IFNA 3VP8A 2C9NY 1CI6B 2IPPA 1ZR2A 2MJZA 1MFZA 1H8AA 3RK3B 2OYHC 2YKOA 1T3UA 4WBAA 5AW4B 2J59M 3V2QA 1HBWA 5KLVK 5APUA 1JY2P 2Z5HA 1YYCA 3U1AA 3A2AA 5CCHA 4B86A 1N7SB 1SQXK 2I1KA 2XU6A 2XDJA 1N86A 1CI6A 4C46A 4IFMA 1AFOA 1FZGA 4C7RA 2Q7CA 4OH8B 1LWUB 1IFMA 3T97A 3UIAA 1HGZA 2JJLA 1NKZB 2O1KA 1N7LA 2ZXEB 5CCGD 3L35A 3LIDA 1GU4A 1N73C 1JUNA 2FFDB 2FYZA 1HUCA 1URQB 5APSA 2XZRA 1LTJA 1M1JC 4HH2A 1RE3C 1LTAC 1JY2N 1IO4A 3P8CD 3KYQA 1FBMA 2HYNA 3MGNA 1IJDB 4WB4A 4O9BA 5AVYB 5AW2B 2Q3IA 2YKQA 5CCHD 2WPSA 3B5NC 3TNUA 3V4WA 1FZEA 3V4QA 4WY4C 1NTZK 5AW6B 3M06A 3VMYA 3RK3D 1CZQA 1QL2A 4AQRD 2OYHA 2R32A 3RL0B 5AVZB 1S9KE 3A5TA 4LLHA 5KJ7A 1FZBA 4N78D 1GDTA 3GHGC 3P7KA 5BU5A 1N7SD 3RK2C 1JY3P 3VN0A 1J2JB 1KFMA 3KPEA 3LIEA 2WT7A 4M3LA 4JYBA 5AVSB 1NU1K 1X9VA 1LT9B 3HTKB 3N7NA 2YMYA 1JOCA 4W7ZA 2YKPA 2Z4EA 4WY4B 1CSBA 1J1EB 3P32A 1N73A 2KB7P 1URQD 3BVHA 3M0DC 1HTLC 4C7NB 2HLOA 5AW1B 3O8ZA 1MZ9A 1M1JA 1RE3A 3M9BA 1G1IA 3MUDA 4I2LC 2CPSA 5AW5B 1FZCA 2H7HA 1KFNA 1GL2C 1GD2E 2OYIC 3B5NA 3H6PA 3VMZA 1XTGB 3IR9A 4I6MC 4W80A 2N1TA 1NKNA 1RF1A 2P67A 2ZFCA 1IFIA 4JF7A 1IC2A 3V5BA 2GM4A 4GIFA 2A45G 1GTWA 5APQA 3GHGA 5KJ7C 3TYYA 1SQPK 3OJAB 4DOJA 2GUVA 2WWWA 1L0NK 1LTJB 3B5ND 3VTPC 1A02J 2FKWB 3NTNA 1GK6A 4WY4D 1MV8A 1T2KC 3HUSA 3KDPB 1H88A 4EOTA 4I1LA 3TNUB 3M0DA 2XKMA 3MTUE 2E43A 3OA7A 1L4AA 1SQBK 2R5BA 2M8RA 2HPCA 4Y99C 3L4FA 2WPQA 1G1JA 2YO3A 1W2EA 4EIJA 5AW0B 2GUSA 1NO4A 5AVVB 1JCCA 3CLQA 1GL2A 2R3CA 2OYHB 2O1JA 3RK2D 2OYIA 1G2CA 1FZCC 1SFCA 1JTHA 5AW9B 2CPBA 1QL1A 4ZKUA 3HD7A 1EQ7A 1HWTC 2KYVA 1ZN5A 2OARA 2N1TC 1LGHB 2NPSA 1RF1C 2WT7B 1GZLA 5AW7B 3VYIA 1FJKA 2H43A 2FXMA 3M91A 3V2PA 2HG5D 3HE4A 2KP8A 1OXZA 1SLQA 4LGDE 1N73B 3M0AA 3P8CE 2KSJA 4RESB 4Y99B 1NTKK 1H89A 1HJBA 1LTTC 2YO2A 1FU1A 2H8PD 1GL2D 3L37A 1M1JB 2J58A 4LC1A 2P2UA 1J1DC 2IX7C 1A02F 4DZOA 3G3ZA 5APWA 3U1CA 1FZCB 3R2PA 2Z5IA 5AW8B 2POHA 4XE5B 1FZAA 1GK4A 2Q9IA 2WSFH 3B5NB 3KQGA 3H32A 1DH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVU B;  2XU6 A;  2R5D A;  1SP4 A;  2P67 A;  2W27 A;  4JYC A;  1CI6 A;  4C46 A;  2ZFC A;  2Q7C A;  5AVR B;  1NWQ A;  3A7O A;  3T97 A;  2WPR A;  5APV A;  3UIA A;  2JJL A;  5APX A;  1OWA A;  2ZXE B;  3HE5 A;  3L35 A;  3LID A;  4GT1 A;  1GTW A;  1GU4 A;  5APQ A;  4GKG A;  1MUU A;  3A3Y B;  2Q5U A;  1JUN A;  3TYY A;  3HE5 B;  1HUC A;  5APS A;  5APT A;  2YNY A;  2XZR A;  2WWW A;  2P7J A;  1IO4 A;  3NXS A;  1KQL A;  3MGN A;  5AVX B;  5AW2 B;  5AVY B;  3VTP C;  1A02 J;  2QM8 A;  2Q3I A;  3I5C A;  1T2K D;  2WPS A;  3NTN A;  3TNU A;  1GK6 A;  3V4W A;  3M9H A;  4AYC A;  1MV8 A;  1T2K C;  3L36 A;  3V4Q A;  1NAF A;  1FOS E;  2C9L Y;  3KDP B;  1H88 A;  4EOT A;  3TNU B;  5AW6 B;  3M0D A;  2BAS A;  2E43 A;  3M06 A;  5AVQ B;  2R5B A;  3VMY A;  1CZQ A;  2VRS A;  4KHX A;  2WPQ A;  4AQR D;  2YO3 A;  2R32 A;  5AVW B;  3NFQ A;  5AVZ B;  5AW0 B;  1S9K E;  5AVV B;  2N9B A;  3A5T A;  2R3C A;  5APY A;  2W6A A;  3P7K A;  3TK1 A;  1FAV A;  5AW9 B;  5CMZ A;  1FOS F;  3VN0 A;  1G2C B;  1J2J B;  3SWF A;  3LIE A;  3MD0 A;  1HWT C;  2WT7 A;  4M3L A;  3NMD A;  4JYB A;  1X8Y A;  5AVS B;  3HTK A;  2WT7 B;  4HYT B;  3OAK A;  4AUW A;  1GZL A;  3VMX A;  5AW3 B;  5AW7 B;  1JNM A;  3VYI A;  4C7N A;  2E42 A;  2XV5 A;  3M91 A;  1CSB A;  3P32 A;  3B8E B;  3HE4 A;  2KP8 A;  2WTY A;  1GU5 A;  4C7N B;  1SLQ A;  1OXZ A;  5AW1 B;  3O8Z A;  3M0A A;  2C9N Y;  1CI6 B;  2IPP A;  3HE4 B;  4RES B;  2QM7 A;  1MFZ A;  1H8A A;  1H89 A;  3M9B A;  1HJB A;  2YO2 A;  3P8M C;  4I2L C;  5AW5 B;  5AW4 B;  2H7H A;  3L37 A;  5AVT B;  1HBW A;  5APU A;  1GD2 E;  4LC1 A;  2P2U A;  3VMZ A;  1A02 F;  2Z5H A;  4DZO A;  1YYC A;  5APW A;  3A2A A;  1S9K D;  4B86 A;  2Z5I A;  3IR9 A;  5AW8 B;  4XE5 B;  4I6M C;  1GK4 A;  3KQG A;  3V5B A;  1DH3 A; 
#chains in the Genus database with same CATH topology
 3HUS C;  5M1B A;  2V7Q J;  1YJN P;  1JO5 A;  3ZDM A;  2N1T B;  1RF1 B;  1SQQ G;  2HR3 A;  1T3J A;  3BCC J;  3CI9 A;  1L0N J;  5GTH H;  2AEJ A;  3A3Y B;  1VQ6 P;  1X22 A;  3VOP A;  2E74 B;  2HOD A;  3IFM A;  1R8E A;  4AYC A;  1J1D B;  3II6 A;  3M9H A;  2KLV A;  5L8R J;  2IYO A;  4I7Z C;  3L72 E;  2BAS A;  1SS1 A;  2A06 E;  3HUS B;  3D70 A;  4UB8 E;  2IFM A;  1IK7 A;  1YQ4 C;  2HPC B;  2JEE A;  3MZW B;  4IOI H;  4TLF A;  5BVZ A;  4A7P A;  1Q86 Q;  2ZT9 B;  1GMJ A;  2OYI B;  1G2C B;  1JTH B;  1X8Y A;  1NTK J;  2FYN C;  5EFW B;  2JWD A;  1KIL A;  1GW4 A;  1JY2 O;  2BCC J;  2HFE D;  1UII A;  1VF5 D;  1NOH A;  1QVG O;  1USE A;  3H1L D;  2G8Y A;  3PLN A;  2ZVN B;  1EC5 A;  1R5L A;  3G9R A;  4ZMD A;  3CWB D;  3GG2 A;  1KB9 H;  2FYU D;  3S1K A;  3RBX A;  4JYC A;  3H1L G;  1VQ7 P;  3H32 B;  1J1E C;  1AVY A;  1LTG C;  2QIW A;  3H1K D;  3CC2 P;  1Q90 D;  2FYU G;  3TGU E;  5APT A;  3V2N A;  1EDL A;  5CHX A;  3AEB C;  1KQL A;  1AVO A;  1KYO D;  3H1K G;  3Q5R A;  1Y8A A;  2HOD B;  3L36 A;  3CCS P;  3CX5 I;  1L2P A;  2VRS A;  1HH0 A;  4PJ0 E;  3L73 J;  2Y0C A;  4N6J A;  1KB9 I;  2WMM A;  2OGU A;  2WSF J;  5KLV D;  1LTJ C;  2ITA A;  2E5T A;  3L71 D;  4HKZ H;  3H1J G;  3HTK A;  4WVZ A;  4GDO A;  3RL0 g;  1N8R Q;  4HYT B;  4AUW A;  1M56 D;  2Y0E A;  1PP9 D;  1S1C X;  3BAT A;  2QJY C;  3L71 G;  4R4M A;  1KIL B;  2B88 A;  2QG4 A;  1CI6 B;  2WQY C;  3H1I J;  4WBA A;  4XFJ A;  1PP9 G;  1U57 A;  2Z5H A;  3U1A A;  3A2A A;  2WVR A;  4B86 A;  4R4L A;  1SQX E;  1LT1 A;  2IZ0 A;  2I1K A;  1K9M Q;  2UWJ E;  1FZG A;  3AEG C;  3UIA A;  2O1K A;  1VQK P;  5CCG D;  2JKV A;  2IBZ E;  2QJK C;  2IDB A;  1HUC A;  1VQL P;  5APS A;  1H0T A;  1M1J C;  1PGJ A;  1NTM E;  3P8C D;  3MGN A;  1IJD B;  5AVY B;  2Q3I A;  2YKQ A;  3H1H E;  4JQ0 D;  3TNU A;  2AEF A;  2D2C D;  2KXP B;  3V4Q A;  1BGY D;  1NTZ K;  2KK7 A;  3CME P;  5KLI B;  3VMY A;  1MFT A;  4UB8 H;  3RK3 D;  4PV1 D;  2OYH A;  1L0L E;  2JP3 A;  3RL0 B;  1MKM A;  1BGY G;  4YXD C;  4H44 D;  1LP1 B;  2QJK B;  1BE3 J;  2N9Y B;  3VN0 A;  3KXD A;  4M3L A;  2O3J A;  1K04 A;  3AE1 C;  1NU1 K;  3IF4 A;  3AEF C;  3HTK B;  3N7N A;  1JOC A;  4W7Z A;  3CCJ P;  4L75 A;  2KB7 P;  1URQ D;  4ASV A;  4IL6 E;  4QMA A;  3Q2Y A;  3VMZ A;  2RH0 A;  3BCC D;  1L0N D;  5B66 E;  2R3S A;  3B4S A;  2YIU B;  2OTL P;  2K37 A;  2P67 A;  5CBO A;  2K9Y A;  3BCC G;  2E75 C;  2CK3 H;  2GM4 A;  4L76 A;  2LXC B;  5APQ A;  3GHG A;  3TYY A;  1BDC A;  1BCC J;  3SWK A;  1PV3 A;  1NTZ J;  3WUT A;  5E79 E;  1H0T B;  3B5N D;  1A02 J;  3NTN A;  2NZ2 A;  4WY4 D;  3AE4 C;  2KUB A;  3E1R A;  3KDP B;  3TNU B;  1NJI Q;  3MTU E;  3OA7 A;  1FC2 C;  4Y99 C;  3AEA C;  2WPQ A;  1W2E A;  2PFX A;  4PJ0 H;  3L74 J;  4U3F E;  2OYH B;  1NU1 J;  2O1J A;  2E76 D;  1SFC A;  1NTK D;  1OVR A;  2CPB A;  2BCC D;  2PRR A;  2OAR A;  2NPS A;  1PPJ D;  1NTK G;  3GW6 A;  4PD4 D;  4OGQ C;  1S3J A;  3V2P A;  1PPJ G;  3W67 A;  2OYO A;  4Y99 B;  1HJB A;  2BEZ F;  2W90 A;  2ZT9 D;  4H13 B;  3L37 A;  1FDI A;  2KIK A;  2P2U A;  4DZO A;  3R2P A;  5AW8 B;  1GK4 A;  3L72 J;  3D6Z A;  1VQO P;  3V5B A;  1KFM A;  1DEE G;  1OZH A;  1VPC A;  2OTJ P;  1OW6 A;  1NWQ A;  4N78 E;  2D2C C;  1QX8 A;  4H0L D;  4OGQ B;  1WT6 A;  5KJ7 D;  4TT3 H;  1JMM A;  4PV1 C;  1SFC C;  3GHG B;  3Q5S A;  1SVF A;  3O6Q A;  3C8V A;  4BWN A;  1T2K D;  2NPS C;  4YPC A;  2QJP C;  5KAI E;  5TIS E;  3L73 D;  3A0H E;  1EXI A;  4Z1M H;  5AVQ B;  1YHQ P;  3L75 G;  3PTZ A;  1HVV A;  5CJ0 A;  1SQP E;  2ZVO B;  3FXE A;  3BAS A;  3L73 G;  4U7J A;  2Y9Y A;  2DW3 A;  5KTB A;  3QH9 A;  3IN6 A;  1SFC B;  1RQV A;  3MD0 A;  2QVA A;  1OFC X;  2KI7 B;  3C9I A;  3CCM P;  1SQB E;  1DD3 A;  1X79 B;  3H1I D;  3CC7 P;  2NPS B;  2QJP B;  3VP9 A;  4RJT A;  4IL6 H;  2P1J A;  3TGU J;  3E1I A;  1YIT P;  1NGM B;  3EQ2 A;  2M3B A;  4RO0 A;  3L70 E;  2BEQ D;  5AVT B;  1LTS C;  1N7S A;  1S9K D;  5B66 H;  4GOF A;  2Q1K A;  1NTM K;  1YTZ T;  1SP4 A;  1L4A D;  1LT9 C;  2K88 A;  1YTZ I;  3A7O A;  3CL3 D;  3A0B E;  1KIL D;  1HGV A;  2PP6 A;  5CJ4 A;  2FXP A;  2WSS H;  2QSI A;  1Z56 A;  2Q5U A;  1PIX A;  3HD7 D;  1L0L K;  5E79 H;  3O6Q B;  1VQ8 P;  5DJU B;  2E76 C;  3GF7 A;  3PP5 A;  2FYU E;  5CCH C;  1YI2 P;  1T6A A;  4HJG H;  2QE7 H;  1ZR4 A;  3V2R A;  4UB6 E;  1BE3 D;  3H1K E;  4KHX A;  1KMI Z;  1EDI A;  2B87 A;  1KB9 D;  2PAJ A;  3NFQ A;  4D6T E;  2WSC H;  3GMA A;  1SQV E;  1M1K Q;  1BE3 G;  5CMZ A;  1FOS F;  1N7S C;  1EZV I;  1JB0 J;  2L5G B;  3NMD A;  1JY3 N;  1JMB A;  4W7Y A;  4IFD K;  1JM0 A;  5KAF E;  1KQF B;  2XV5 A;  3H1J E;  3RL0 D;  3VP8 A;  3AE8 C;  1ZR2 A;  1MFZ A;  1NTM J;  3V2Q A;  3L71 E;  2QEX P;  1AJY A;  1RH5 B;  1N7S B;  3GF3 A;  2XU6 A;  1YBK A;  1U7M A;  2RN0 A;  1CI6 A;  4I7Z B;  1S2E A;  1JEK A;  1BCC D;  2Q7C A;  1L0L J;  1NTZ D;  3CX5 H;  1NKZ B;  1N7L A;  2ZXE B;  5H2F E;  1N73 C;  2K3R A;  2W6J H;  1WMK A;  1LTJ A;  3MUD C;  5AW2 B;  2HYN A;  3FX0 A;  4WB4 A;  2WPS A;  5KAI H;  3V4W A;  5TIS H;  3CCE P;  1Y47 A;  1P84 E;  3L74 D;  3A0H H;  3I55 P;  4EYY Q;  1HF9 A;  1NU1 D;  1FDO A;  2FYN B;  4DCK A;  3CWB G;  3M06 A;  5K5G B;  3CCU P;  3I56 P;  1CZQ A;  4IL6 X;  4AQR D;  3K5B A;  4L74 A;  4LLH A;  3L74 G;  2B87 B;  1FZB A;  1NU1 G;  3RK2 C;  1IFP A;  2W83 C;  1RQU A;  3R4Y A;  5AVS B;  4EDF A;  3WUU A;  4MN4 C;  4EI2 A;  2YMY A;  3BVH A;  1J1E B;  3M0D C;  1LP1 A;  2Y0D A;  5AW1 B;  4K3A A;  3L72 D;  1MZ9 A;  1M1J A;  1M8O B;  2A06 D;  2J5U A;  2AEM A;  4I2L C;  2CPS A;  5AW5 B;  1FZC A;  2SPZ A;  2H89 C;  1KFN A;  1GL2 C;  4RKU J;  1XTG B;  4I6M C;  4L73 A;  3L72 G;  2A06 G;  1NKN A;  5KLV G;  1M57 D;  4DT0 A;  1PGP A;  3A0B H;  4JF7 A;  2M3E A;  4U3F J;  2WSC J;  4KT0 J;  2A45 G;  2H88 C;  1SQP K;  3TF5 A;  2GUV A;  3PJS K;  3ITK A;  1LTJ B;  1USD A;  3VTP C;  2FKW B;  4I1L A;  3JC2 2;  1KV4 A;  4UB6 H;  1SQB K;  2QJY B;  1G1J A;  1QEX A;  4EIJ A;  2GUS A;  5AVV B;  3CLQ A;  2R3C A;  1Q2N A;  3GLM A;  1FZC C;  4CPG A;  2LR2 A;  2NRG A;  5KKZ C;  4ZKU A;  1ZOY C;  3G6E P;  2P58 A;  1NAY A;  1OW8 A;  1VQN P;  5KAF H;  4GOD A;  2QA4 P;  1OMI A;  2H43 A;  2FXM A;  2HG5 D;  2KS1 A;  3HE4 A;  1LNQ A;  4LGD E;  3CCV P;  2I8D A;  1AQT A;  1VF5 C;  1FU1 A;  2H8P D;  2YO2 A;  2IZ1 A;  1LJ2 A;  1M1J B;  1R5S A;  2J58 A;  1ZRT E;  2G3A A;  3U1C A;  5APW A;  1FZC B;  1X0T A;  2Z5I A;  4XE5 B;  1FZA A;  5KKZ B;  4ZNC A;  4PD4 E;  1KTM A;  2W27 A;  1SQP J;  2FYU K;  1S5L X;  5AVR B;  3WUV A;  5APV A;  3SWY A;  1KYO I;  5DJT B;  3AE6 C;  5H2F H;  2B9B A;  3HE5 A;  3AEC C;  4GT1 A;  1JY3 O;  1FZF A;  1K8A Q;  4NPF X;  1U7J A;  1RE4 C;  1SQB J;  2PGD A;  1AQ5 A;  1SQV K;  3I5C A;  1QGK B;  1P84 H;  3EFF K;  1NAF A;  1EZV E;  2C9L Y;  2K9J A;  2M0B A;  1ZV8 A;  1L0N G;  3D71 A;  3HRN A;  2WZ7 A;  1LWU C;  1RY3 A;  3D6Y A;  4ASW A;  3L70 J;  1KN7 A;  1AA0 A;  1K73 Q;  3RGU A;  5CCG A;  2FFD C;  2C0X A;  2A45 I;  2W6A A;  3L75 E;  2IBZ D;  2N1T D;  1Q82 Q;  2GA1 A;  3H25 A;  3OAK A;  1D7M A;  1NTM D;  3PH0 A;  5AW3 B;  1TU3 F;  5B5E E;  2IBZ G;  2E75 B;  3B8E B;  3B71 A;  2WTY A;  2E74 D;  2KS1 B;  3HE4 B;  1NTM G;  1P84 I;  1CW5 A;  3CCR P;  2FYU J;  1L0L D;  2C0W A;  1RF0 C;  2OTK E;  1M7L A;  2BCC G;  1E5W A;  1QLE D;  1VL2 A;  1L0L G;  4D6T J;  1PZQ A;  1URQ A;  3CXH D;  3M9Q A;  1SQV J;  5CCG C;  3FGA D;  3HE5 B;  2AXT E;  2YNY A;  2P7J A;  2M5A A;  1BSN A;  1FDM A;  1FOS E;  2IFN A;  1JCD A;  3H1J J;  2K9J B;  1PGQ A;  3RK3 C;  2R44 A;  1SQQ E;  5AVW B;  2FY8 A;  1KZU B;  1VQ9 P;  2N9B A;  5APY A;  1VQP P;  1HJ0 A;  4H44 C;  3SWF A;  2MKV A;  1LTB C;  1N2D C;  1LT9 A;  1S5L E;  4WY4 A;  4IFF A;  3VMA A;  2ZYA A;  2XNX A;  4C7N A;  1ZLL A;  2D2C B;  4Y28 J;  1URQ C;  1DX7 A;  3JCU E;  1IFN A;  2IPP A;  3CMA P;  2MJZ A;  1S4X A;  2O01 N;  3RK3 B;  4PV1 B;  1T3U A;  1UIX A;  5AW4 B;  2J59 M;  1HBW A;  5GTI E;  5CCH A;  2E5Y A;  4PD4 H;  1SQX K;  2XDJ A;  1N86 A;  4IFM A;  1PGO A;  1AFO A;  4WWI A;  4C7R A;  4NPE A;  4OH8 B;  3TDK A;  3H1I G;  1HGZ A;  1KOR A;  3L35 A;  3LID A;  3IAO A;  2FYZ A;  1URQ B;  3QWO C;  4HH2 A;  1RE3 C;  1VQM P;  3KYQ A;  1FBM A;  4O9B A;  4KJM A;  2M5A B;  3B5N C;  3C1L A;  1FZE A;  4WY4 C;  5AW6 B;  3H1L E;  4JBZ A;  5KJ7 A;  4PD4 I;  3CWB E;  4N78 D;  1GDT A;  5BU5 A;  2E74 C;  1JY3 P;  3CX5 D;  3FWL A;  1J2J B;  2ZJS E;  3KPE A;  3LIE A;  2WT7 A;  1E79 H;  4JYB A;  1X9V A;  1LT9 B;  1OX3 A;  5B5E H;  1VQ4 P;  1ZW0 A;  2YKP A;  4WY4 B;  1CSB A;  1N73 A;  4C7N B;  3O8Z A;  3EWK A;  1SQX J;  1KYO E;  3M9B A;  1G1I A;  3MUD A;  2H7H A;  1SQP D;  2ZT9 C;  1GD2 E;  2OYI C;  3H6P A;  1ZP0 C;  3IR9 A;  2E76 B;  4W80 A;  3AE7 C;  3KZI E;  2ZFC A;  1IFI A;  1SQP G;  2B89 A;  3RBZ A;  1SQB D;  4GIF A;  4H0L C;  1GTW A;  5KLV E;  1EDJ A;  3H1H J;  5KJ7 C;  2AXT H;  1NVO A;  4DOJ A;  1OIP A;  1AV1 A;  2Q3E A;  2WWW A;  1SQB G;  1PP9 E;  3V6I A;  3L70 D;  3WU2 E;  1T2K C;  3F5H A;  3M0D A;  2YMK A;  1L4A A;  1Y9B A;  2M8R A;  1KC8 Q;  3L4F A;  2QRX A;  1BCC G;  3L70 G;  1NTZ G;  1JCC A;  1GL2 A;  1YIJ P;  4H0L B;  5AW9 B;  1QL1 A;  3HD7 A;  2Y9Z A;  1EQ7 A;  1HWT C;  1S5L H;  1ZN5 A;  3SFE C;  2WT7 B;  2KNC A;  1GZL A;  5AW7 B;  3VYI A;  1BSH A;  1FJK A;  3JCU H;  1OXZ A;  1N73 B;  1OVV A;  3M0A A;  3P8C E;  2KSJ A;  3MHV A;  4RES B;  1KQG B;  1LTT C;  5GTI H;  1BGY E;  2K1A A;  1A02 F;  1KQS O;  3CCL P;  2JDI H;  4D6T D;  3G71 P;  2POH A;  3RK3 E;  3FXD A;  1SQV D;  4OWF A;  4BRY A;  2E75 D;  1L4A C;  1NHL A;  4D6T G;  5APX A;  1OWA A;  1KIL C;  1SQV G;  1MUU A;  1IFD A;  3L75 J;  4GOE A;  4XA4 A;  3MP7 B;  1SQQ K;  3RK2 B;  3H1J D;  1IK9 A;  3HD7 C;  3WMM 0;  3NXS A;  5AVX B;  4BXL A;  1DEB A;  2RMZ A;  2W6B A;  1M90 Q;  1LTI C;  3TSI A;  2WSE H;  1IZN B;  4H13 D;  1L4A B;  3BRT B;  3BCC E;  1L0N E;  3AE9 C;  1KD1 Q;  3Q1M A;  3SFD C;  3TK1 A;  1GL2 B;  1PL5 A;  3HD7 B;  3FWN A;  1EXJ A;  3G4S P;  4OGQ D;  5CBN A;  3VMX A;  2KLU A;  4DJG A;  5KLI C;  3LW5 H;  2KNC B;  2IYP A;  2WIT A;  2KZI A;  4NPD A;  3S4R A;  1T8Z A;  1P84 D;  3RL0 C;  5BU8 B;  1FE6 A;  1KYO H;  2QM7 A;  3MIW A;  1RE4 A;  2ZXX A;  4ZKP A;  2O01 H;  3P8M C;  1DIP A;  3SSU A;  3TGU D;  3Q5P A;  4HB1 A;  3W68 A;  2KOG A;  1YQ3 C;  1QVF O;  1VDF A;  1PFI A;  3KZI H;  2I1J A;  5AVU B;  1Q7Y Q;  2R5D A;  1LWU A;  3TGU G;  1SQQ J;  2WPR A;  4BRY B;  1NTK E;  2FFD A;  3CC4 P;  3AE2 C;  3F89 A;  4GKG A;  3ABV C;  1SFC D;  2BCC E;  1NH4 A;  1PPJ E;  3U59 A;  3N4X A;  1GW3 A;  2A45 H;  2NPS D;  2QM8 A;  3WU2 H;  2FBW C;  2JO1 A;  4N3Y B;  1Q81 Q;  4YTP C;  2YIU C;  3CXH E;  1XTC C;  1IFJ A;  1VF5 B;  1FAV A;  1W5C E;  1RF0 A;  2V4H A;  3AE3 C;  3EFG A;  1FJP A;  1SQX D;  1JNM A;  1WRG A;  1VQ5 P;  2E42 A;  2LKM A;  3BRV B;  2ZYG A;  1GU5 A;  2W8Z A;  2C9N Y;  1H8A A;  1SQX G;  1K05 A;  2YKO A;  2OYH C;  5TJH A;  5KLV K;  5APU A;  1JY2 P;  3L73 E;  4JPZ B;  1YYC A;  2KSE A;  1S72 P;  2P10 A;  3CPW O;  3H1H D;  3H1L J;  4C46 A;  3E7K A;  1OVU A;  2WSE J;  1LWU B;  1IFM A;  3T97 A;  2JJL A;  2YXQ B;  3CWB J;  2XND H;  1GU4 A;  5GTH E;  1YJW P;  3H1H G;  1JUN A;  2FFD B;  4H13 C;  2XZR A;  3H1I E;  1LTA C;  1JY2 N;  1IO4 A;  3AED C;  5CCH D;  3H1K J;  2FXO A;  1ZME C;  2Q6Q A;  3OW2 O;  3LW5 J;  1ZRT D;  3JSV C;  2V7Q H;  4K35 A;  3AE5 C;  4OVN F;  1QL2 A;  2R32 A;  2JWA A;  2O01 J;  5AVZ B;  1S9K E;  3A5T A;  2OQQ A;  3AEE C;  3PHL A;  3GHG C;  3P7K A;  1N7S D;  1DD4 A;  3USS A;  1NYH A;  2WPV B;  1KIL E;  3KHU A;  1RHZ B;  2L91 A;  2Z4E A;  5KLV J;  3P32 A;  3Q3D A;  3S9O A;  1HTL C;  1OW7 A;  3L71 J;  2RKL A;  1EZV D;  2HLO A;  1RE3 A;  1BDD A;  1EDK A;  3CX5 E;  1PP9 J;  3B5N A;  1EZV G;  1BE3 E;  2N1T A;  1RF1 A;  3L75 D;  1KB9 E;  2LXB A;  1IC2 A;  1W2B O;  2ZAE B;  1YJ9 P;  3T97 B;  3CCQ P;  3OJA B;  4U3F D;  1L0N K;  4H44 B;  5C39 A;  1GK6 A;  1MV8 A;  3HUS A;  1H88 A;  4EOT A;  1ZXG A;  4U3F G;  2XKM A;  2E43 A;  2IBZ I;  3CXH H;  2R5B A;  2HPC A;  2AXC A;  2YO3 A;  5AW0 B;  1NO4 A;  1BGY J;  2OYI A;  3RK2 D;  1G2C A;  1JTH A;  1BCC E;  2KYV A;  1NTZ E;  2N1T C;  1LGH B;  1RF1 C;  2YXR B;  1FS0 E;  2JR8 A;  3CD6 P;  3M91 A;  2KP8 A;  3PRJ A;  1SLQ A;  1NTK K;  1H89 A;  2ZYD A;  1GL2 D;  4LC1 A;  3L74 E;  1SQQ D;  1J1D C;  2IX7 C;  1NU1 E;  2KZJ A;  3G3Z A;  3CXH I;  2Q9I A;  2WSF H;  3B5N B;  4YXW H;  3KQG A;  3H32 A;  1DH3 A; 
#chains in the Genus database with same CATH homology
 3HUS C;  2W27 A;  1JO5 A;  2FYU K;  2N1T B;  1RF1 B;  1VPC A;  1L4A C;  1NHL A;  1T3J A;  5AVR B;  1NWQ A;  4N78 E;  3CI9 A;  5APV A;  3SWY A;  5APX A;  1WT6 A;  1OWA A;  1KIL C;  3HE5 A;  5KJ7 D;  4GT1 A;  1JY3 O;  1MUU A;  1IFD A;  3A3Y B;  1FZF A;  1JMM A;  4XA4 A;  1SFC C;  1SQQ K;  3GHG B;  3VOP A;  3RK2 B;  1SVF A;  1IK9 A;  1RE4 C;  3HD7 C;  3WMM 0;  2HOD A;  3IFM A;  3NXS A;  5AVX B;  1AQ5 A;  1SQV K;  3I5C A;  2NPS C;  1T2K D;  1DEB A;  1J1D B;  3II6 A;  3M9H A;  4AYC A;  2KLV A;  1NAF A;  2C9L Y;  2W6B A;  1ZV8 A;  2BAS A;  1LTI C;  3HRN A;  3HUS B;  3TSI A;  5AVQ B;  2WZ7 A;  1LWU C;  1HVV A;  1RY3 A;  2IFM A;  5CJ0 A;  2WSE H;  1L4A B;  3BRT B;  2HPC B;  2JEE A;  3BAS A;  5CCG A;  2FFD C;  2C0X A;  2A45 I;  5KTB A;  2W6A A;  5BVZ A;  3TK1 A;  1GL2 B;  2OYI B;  1G2C B;  1SFC B;  3MD0 A;  1JTH B;  2N1T D;  3HD7 B;  1X8Y A;  3C9I A;  1X79 B;  3OAK A;  3VMX A;  2NPS B;  5AW3 B;  3LW5 H;  3VP9 A;  1KIL A;  2WIT A;  1GW4 A;  1JY2 O;  2P1J A;  3B8E B;  2WTY A;  2HFE D;  3E1I A;  1T8Z A;  3EQ2 A;  3RL0 C;  3HE4 B;  2M3B A;  5BU8 B;  1NOH A;  2QM7 A;  3MIW A;  1RE4 A;  4ZKP A;  2O01 H;  3P8M C;  1CW5 A;  5AVT B;  2KOG A;  1LTS C;  1N7S A;  2C0W A;  1S9K D;  1VDF A;  1PFI A;  1RF0 C;  1NTM K;  2I1J A;  1YTZ T;  5AVU B;  2R5D A;  1SP4 A;  1M7L A;  4JYC A;  1LWU A;  1L4A D;  1LT9 C;  1E5W A;  3H32 B;  1YTZ I;  3A7O A;  1J1E C;  3CL3 D;  2WPR A;  1LTG C;  1KIL D;  1HGV A;  2FFD A;  1URQ A;  2PP6 A;  3M9Q A;  5CJ4 A;  4GKG A;  1Z56 A;  5CCG C;  1SFC D;  2Q5U A;  3HE5 B;  1NH4 A;  5APT A;  3V2N A;  2YNY A;  3HD7 D;  1L0L K;  3U59 A;  5CHX A;  2P7J A;  3N4X A;  1GW3 A;  2A45 H;  1KQL A;  2NPS D;  2QM8 A;  3PP5 A;  4N3Y B;  1FDM A;  2HOD B;  5CCH C;  3L36 A;  1FOS E;  2IFN A;  1JCD A;  1ZR4 A;  3V2R A;  2VRS A;  1XTC C;  4KHX A;  3RK3 C;  1HH0 A;  5AVW B;  2PAJ A;  3NFQ A;  1KZU B;  2WSC H;  2N9B A;  1IFJ A;  4N6J A;  5APY A;  1FAV A;  5CMZ A;  1FOS F;  1N7S C;  3SWF A;  1RF0 A;  1LTJ C;  1LTB C;  2L5G B;  3NMD A;  1N2D C;  1JY3 N;  1LT9 A;  3HTK A;  3EFG A;  4HYT B;  1FJP A;  4WY4 A;  4AUW A;  4W7Y A;  4IFF A;  1JNM A;  4IFD K;  1WRG A;  2XNX A;  4C7N A;  2LKM A;  2E42 A;  1ZLL A;  2XV5 A;  3BRV B;  3BAT A;  1GU5 A;  3RL0 D;  1URQ C;  1DX7 A;  1KIL B;  1IFN A;  3VP8 A;  2C9N Y;  1CI6 B;  2IPP A;  1ZR2 A;  2MJZ A;  1MFZ A;  1H8A A;  3RK3 B;  2OYH C;  2YKO A;  1T3U A;  4WBA A;  5AW4 B;  2J59 M;  3V2Q A;  1HBW A;  5KLV K;  5APU A;  1JY2 P;  2Z5H A;  1YYC A;  3U1A A;  3A2A A;  5CCH A;  4B86 A;  1N7S B;  1SQX K;  2I1K A;  2XU6 A;  2XDJ A;  1N86 A;  1CI6 A;  4C46 A;  4IFM A;  1AFO A;  1FZG A;  4C7R A;  2Q7C A;  4OH8 B;  1LWU B;  1IFM A;  3T97 A;  3UIA A;  1HGZ A;  2JJL A;  1NKZ B;  2O1K A;  1N7L A;  2ZXE B;  5CCG D;  3L35 A;  3LID A;  1GU4 A;  1N73 C;  1JUN A;  2FFD B;  2FYZ A;  1HUC A;  1URQ B;  5APS A;  2XZR A;  1LTJ A;  1M1J C;  4HH2 A;  1RE3 C;  1LTA C;  1JY2 N;  1IO4 A;  3P8C D;  3KYQ A;  1FBM A;  2HYN A;  3MGN A;  1IJD B;  4WB4 A;  4O9B A;  5AVY B;  5AW2 B;  2Q3I A;  2YKQ A;  5CCH D;  2WPS A;  3B5N C;  3TNU A;  3V4W A;  1FZE A;  3V4Q A;  4WY4 C;  1NTZ K;  5AW6 B;  3M06 A;  3VMY A;  3RK3 D;  1CZQ A;  1QL2 A;  4AQR D;  2OYH A;  2R32 A;  3RL0 B;  5AVZ B;  1S9K E;  3A5T A;  4LLH A;  5KJ7 A;  1FZB A;  4N78 D;  1GDT A;  3GHG C;  3P7K A;  5BU5 A;  1N7S D;  3RK2 C;  1JY3 P;  3VN0 A;  1J2J B;  1KFM A;  3KPE A;  3LIE A;  2WT7 A;  4M3L A;  4JYB A;  5AVS B;  1NU1 K;  1X9V A;  1LT9 B;  3HTK B;  3N7N A;  2YMY A;  1JOC A;  4W7Z A;  2YKP A;  2Z4E A;  4WY4 B;  1CSB A;  1J1E B;  3P32 A;  1N73 A;  2KB7 P;  1URQ D;  3BVH A;  3M0D C;  1HTL C;  4C7N B;  2HLO A;  5AW1 B;  3O8Z A;  1MZ9 A;  1M1J A;  1RE3 A;  3M9B A;  1G1I A;  3MUD A;  4I2L C;  2CPS A;  5AW5 B;  1FZC A;  2H7H A;  1KFN A;  1GL2 C;  1GD2 E;  2OYI C;  3B5N A;  3H6P A;  3VMZ A;  1XTG B;  3IR9 A;  4I6M C;  4W80 A;  2N1T A;  1NKN A;  1RF1 A;  2P67 A;  2ZFC A;  1IFI A;  4JF7 A;  1IC2 A;  3V5B A;  2GM4 A;  4GIF A;  2A45 G;  1GTW A;  5APQ A;  3GHG A;  5KJ7 C;  3TYY A;  1SQP K;  3OJA B;  4DOJ A;  2GUV A;  2WWW A;  1L0N K;  1LTJ B;  3B5N D;  3VTP C;  1A02 J;  2FKW B;  3NTN A;  1GK6 A;  4WY4 D;  1MV8 A;  1T2K C;  3HUS A;  3KDP B;  1H88 A;  4EOT A;  4I1L A;  3TNU B;  3M0D A;  2XKM A;  3MTU E;  2E43 A;  3OA7 A;  1L4A A;  1SQB K;  2R5B A;  2M8R A;  2HPC A;  4Y99 C;  3L4F A;  2WPQ A;  1G1J A;  2YO3 A;  1W2E A;  4EIJ A;  5AW0 B;  2GUS A;  1NO4 A;  5AVV B;  1JCC A;  3CLQ A;  1GL2 A;  2R3C A;  2OYH B;  2O1J A;  3RK2 D;  2OYI A;  1G2C A;  1FZC C;  1SFC A;  1JTH A;  5AW9 B;  2CPB A;  1QL1 A;  4ZKU A;  3HD7 A;  1EQ7 A;  1HWT C;  2KYV A;  1ZN5 A;  2OAR A;  2N1T C;  1LGH B;  2NPS A;  1RF1 C;  2WT7 B;  1GZL A;  5AW7 B;  3VYI A;  1FJK A;  2H43 A;  2FXM A;  3M91 A;  3V2P A;  2HG5 D;  3HE4 A;  2KP8 A;  1OXZ A;  1SLQ A;  4LGD E;  1N73 B;  3M0A A;  3P8C E;  2KSJ A;  4RES B;  4Y99 B;  1NTK K;  1H89 A;  1HJB A;  1LTT C;  2YO2 A;  1FU1 A;  2H8P D;  1GL2 D;  3L37 A;  1M1J B;  2J58 A;  4LC1 A;  2P2U A;  1J1D C;  2IX7 C;  1A02 F;  4DZO A;  3G3Z A;  5APW A;  3U1C A;  1FZC B;  3R2P A;  2Z5I A;  5AW8 B;  2POH A;  4XE5 B;  1FZA A;  1GK4 A;  2Q9I A;  2WSF H;  3B5N B;  3KQG A;  3H32 A;  1DH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...