4GKGA

Crystal structure of the s-helix linker
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
52
structure length
52
Chain Sequence
PRGSHMEERLARNALEASVEERTRDLRMARDRLETEIADHRQTTEKLQAVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the S-Helix Linker
rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
molecule keywords C4-dicarboxylate transport sensor protein dctB
total genus 22
structure length 52
sequence length 52
chains with identical sequence F
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4gkgA00
3HE5B 4RESB 5APXA 5AW8B 1A02J 3HE5A 1JNMA 4LC1A 4GT1A 2WT7B 1FOSF 3TNUA 2YNYA 4C7NB 3KDPB 5AW4B 3IR9A 2C9NY 1MUUA 3M0AA 3NXSA 1GU5A 1GD2E 3LIDA 2W6AA 4JYBA 1H88A 3NMDA 3P7KA 2QM8A 3A5TA 1HBWA 2P67A 2P2UA 3MGNA 4I2LC 5APYA 4I6MC 1HUCA 3V5BA 2WPSA 1FAVA 1H89A 5AW3B 1T2KC 2VRSA 2WTYA 3B8EB 3M9BA 5APWA 1MFZA 2N9BA 5AW9B 4AUWA 5CMZA 5AVRB 5AVTB 2YO3A 3VMYA 1X8YA 1OXZA 3L35A 1CI6A 4XE5B 3LIEA 3TNUB 1HJBA 4GKGA 3VMXA 1FOSE 5APVA 3A2AA 1H8AA 3TYYA 5AVXB 1CZQA 2P7JA 3MD0A 2KP8A 5AW6B 2YO2A 2JJLA 3L36A 5AVWB 3M06A 2XZRA 1DH3A 3A3YB 2WPQA 3TK1A 2IPPA 3VTPC 1KQLA 1G2CB 1S9KD 5APTA 1GU4A 5AW2B 5AVVB 2H7HA 2Z5HA 5AVYB 3L37A 3NFQA 2R5BA 1NWQA 1IO4A 2XV5A 3M0DA 4KHXA 5APSA 3V4QA 2E42A 3UIAA 5APQA 2QM7A 1CI6B 5APUA 4DZOA 2E43A 2C9LY 1MV8A 3VN0A 3O8ZA 3SWFA 1CSBA 1GK4A 2R32A 5AW5B 1HWTC 3HE4B 4JYCA 3T97A 3M9HA 5AW1B 3VMZA 1GZLA 4M3LA 1SP4A 2ZFCA 5AVZB 1J2JB 2Q7CA 1T2KD 4C7NA 2Q3IA 2WPRA 3P32A 3NTNA 2WWWA 5AW7B 2Z5IA 1OWAA 4AQRD 3KQGA 4HYTB 1NAFA 2XU6A 2BASA 5AVQB 1YYCA 2WT7A 3OAKA 4B86A 2Q5UA 3A7OA 4AYCA 3HE4A 2R3CA 1GK6A 4C46A 5AW0B 5AVUB 5AVSB 1JUNA 1A02F 2R5DA 3M91A 3HTKA 3V4WA 2W27A 3P8MC 1S9KE 3VYIA 1GTWA 2ZXEB 1SLQA 4EOTA 3I5CA
chains in the Genus database with same CATH superfamily
2FY8A 1T8ZA 2FXPA 1P84D 3SFDC 3E1RA 1NTZK 1VQPP 1RH5B 1L0NE 1LT9C 1NHLA 3HE5A 3AEFC 5AW8B 5KLVJ 4PD4H 1RF1C 2FYNB 2ZVNB 2KZJA 2ZYAA 1LTGC 4N6JA 4OVNF 1PPJG 1VL2A 2WT7B 1S3JA 2HPCB 1VQ4P 2I1KA 2WSCH 2D2CB 1YJWP 1KQFB 3A0HH 2V4HA 3C1LA 1LNQA 5AW5B 1PFIA 2E76B 2Y0EA 4EDFA 1SQBE 1PV3A 1PIXA 1BE3D 2W8ZA 4JYBA 1NTME 2M3EA 4IL6E 4L74A 1DD4A 3HUSA 3AE5C 1RF0C 3L74E 2H43A 3NMDA 1NTZD 3P7KA 3A5TA 1EDIA 2FYZA 2KNCB 2P67A 3BRTB 3MGNA 3SFEC 4CPGA 2KS1B 4U3FE 1KQSO 1J1EC 1HGZA 3HUSB 4OGQD 2YIUB 3V5BA 5CHXA 5AW3B 2KK7A 2VRSA 1JTHA 3L70G 4H44B 1FZFA 4AUWA 3JCUE 2N9BA 5AW9B 5KLVD 1NTZE 2KSEA 4WB4A 1GL2A 3HD7B 1QLED 1BGYD 1X8YA 3MUDA 4XA4A 1H0TA 4XE5B 1NTZJ 1KFNA 1X79B 5APVA 5CCHD 3Q5SA 3L70D 2BEQD 3GW6A 2N1TD 1CZQA 2P7JA 2E75D 2KP8A 2LXBA 1KD1Q 2IFNA 3H32B 1EXJA 3MHVA 3BATA 3L36A 1JY2P 2PGDA 3L71E 1N7SB 3GLMA 2WPQA 2KSJA 1LTTC 2YXQB 3H1IJ 3QWOC 2RMZA 4ASWA 3TK1A 3CMEP 2JKVA 1MZ9A 3L70E 1SQBG 3FXEA 2W6BA 3CX5E 2KIKA 1KQLA 2IBZE 2OYOA 3CCUP 3CC2P 3CI9A 1JY2O 1S4XA 3AEDC 2FXOA 3H1JE 4Y99B 1L0LE 2V7QJ 2Z5HA 3L71D 1IFJA 4DCKA 1NU1G 3NFQA 1WRGA 1SFCC 2GA1A 4PD4I 2BCCE 1LTJA 3M0DA 2ZJSE 5DJUB 2HFED 3SWYA 1CI6B 4GOFA 4JBZA 4H44D 2L91A 5BU8B 2FYUE 3EFGA 1SQQE 4RO0A 2AEMA 3GMAA 1PGQA 5M1BA 2M0BA 1HJ0A 1GK4A 2I1JA 2JP3A 2R32A 4WVZA 2NPSC 1RE3A 4OGQC 3AE6C 1SQQJ 4JYCA 3A0BE 3AE4C 4NPFX 3RL0D 1BCCJ 1WMKA 2AXTE 2XNXA 1GZLA 2E5YA 3M9HA 3RK3C 3TDKA 3FXDA 3M9QA 1KILE 2Q7CA 4ZKUA 4NPEA 2E75B 5KJ7C 1Q86Q 2Q3IA 3L75J 1YTZT 3U1AA 3P32A 3CCRP 1SQPE 3CCSP 1FZCA 3PJSK 2YKPA 1URQB 3NTNA 2M5AA 3EFFK 2QJPB 2NRGA 1JCDA 1FJPA 2WVRA 4AQRD 2A06G 4EIJA 2KZIA 1FZBA 1GMJA 1IFIA 1L0LK 1M1JC 1G1JA 2KOGA 3IFMA 1LWUA 4H0LB 4UB8E 1LT9A 1RF1B 1BSNA 1L0LG 1Y47A 2XU6A 1BE3E 4WWIA 3WUTA 1OVUA 1M1JB 3L75G 3GF3A 2FYUD 1IFMA 3CLQA 3RL0C 1LTJB 1HH0A 1EZVD 2JWAA 2QJPC 4AYCA 2BCCJ 2WSCJ 2KUBA 4IOIH 1FZAA 1HGVA 1VPCA 2QJYB 1NJIQ 3MTUE 1UIIA 1KORA 3HTKA 3M91A 4TLFA 3V4WA 1DH3A 3RK2D 1VF5C 3WUUA 4IFMA 1N73C 2K9JB 3P8MC 1BDDA 2KNCA 1NTZG 1Z56A 5KTBA 4EOTA 1HTLC 3I5CA 1NH4A 2DW3A 2YKQA 3H32A 2M3BA 5GTIH 1Q7YQ 2QA4P 2O01H 2KLUA 5CCGA 1E5WA 4LC1A 3VP9A 5B66H 3TGUG 1VQ6P 3ABVC 4GT1A 1SQBK 3H1ID 5EFWB 2H8PD 2J58A 3H1HJ 3II6A 4D6TE 1JM0A 3D70A 1EDLA 1Q82Q 2E76C 1FDOA 1L2PA 2R3SA 2YNYA 2QJYC 4TT3H 1GL2B 1M8OB 1SVFA 2ZYGA 2ITAA 1BSHA 3P8CE 3H1HE 3CWBE 4D6TJ 1YI2P 1FE6A 5AW4B 3RK3E 1N73A 2A45I 3IR9A 3BCCJ 1MUUA 1GW4A 3BCCD 3ITKA 1KILC 1KYOI 1GU5A 4JPZB 2B87A 2RN0A 1K8AQ 4KJMA 3S9OA 2J59M 4JF7A 1H88A 3BCCE 1NTKJ 1KB9I 3KHUA 3H1HD 4H0LC 1P84I 1UIXA 1XTCC 3H1LD 3TGUE 4I6MC 1HUCA 3CX5I 2WPSA 1PP9D 3CCLP 3CL3D 2FYUK 3MIWA 1JY3O 1OW7A 3RK2B 2FFDC 5KKZC 3M9BA 2I8DA 1MFZA 1SQQG 5APWA 1JMMA 3U1CA 1OZHA 1KB9H 4GDOA 1X22A 1ZMEC 1BGYJ 3VMYA 3BRVB 2C0XA 2RKLA 1OXZA 1PGJA 1VQKP 1Q2NA 4GKGA 4N78D 3VMXA 1OVVA 5CCGC 3V2RA 3H1LJ 4EI2A 2QRXA 3RGUA 4ZKPA 5AVWB 3VOPA 1NU1J 1J1EB 3HUSC 1NTMJ 3CWBG 1KFMA 1GW3A 4HH2A 3L74J 1AFOA 3O6QB 1S5LX 3D6YA 3S1KA 1NTMK 2K9JA 2Q3EA 2A06E 1NU1K 1S1CX 3U59A 2OYHB 1FDMA 1OIPA 3O6QA 2WSEH 1M57D 1P84E 1PP9J 3IAOA 3G3ZA 2PFXA 2SPZA 4DOJA 5KAIE 1S9KD 5AVVB 1GU4A 1JO5A 4GODA 1T6AA 1BCCE 2QIWA 2N1TC 4I7ZB 1IO4A 5B5EH 2FYUG 1FS0E 2W6JH 2XV5A 3L73J 3OJAB 3V4QA 3GHGA 1R5SA 3S4RA 1JY2N 2CPSA 2QM7A 3UIAA 2E42A 2IDBA 3CC4P 1AVYA 1SQVD 2FYNC 3I56P 2WITA 2A45G 3CCQP 1MV8A 3SWFA 2HODB 3CXHE 1S5LH 1DEBA 1IJDB 1KYOH 2KYVA 2WSEJ 3BASA 1FC2C 4PV1D 3V6IA 1NU1D 3VMAA 1LTIC 3L72D 4EYYQ 2NZ2A 4RJTA 2Q6QA 5AW1B 3V2QA 1KMIZ 4Y28J 4M3LA 4BWNA 2Y9ZA 1AVOA 1IZNB 1PGPA 4I1LA 4H13C 4PJ0E 5AVZB 1J2JB 1JY3N 3HD7C 4HB1A 3RK3D 3USSA 2OYIC 4GIFA 1FZGA 1KYOD 1AA0A 4ZNCA 1L4AB 1ZRTE 3H1KG 2P10A 3MP7B 3AEBC 4H44C 2E74D 1LJ2A 3L72G 3RL0g 2IYPA 2C0WA 3L71J 4A7PA 2LXCB 1ZRTD 3H1IE 3D6ZA 3GG2A 2KXPB 1YTZI 5H2FH 2MKVA 4HYTB 3CCMP 3L74D 1G1IA 1RY3A 1NTKD 1N7LA 5CJ0A 3CD6P 4OGQB 3C9IA 1FU1A 4BRYB 2POHA 3T97A 2UWJE 2ZXXA 3CCJP 2WPVB 2ZVOB 3GHGC 1L0NG 2KLVA 2Q5UA 3B5NC 1N2DC 3A7OA 3HE4A 3L73E 5KLVG 2HYNA 5TISE 1D7MA 4IFFA 1L4AC 1JUNA 1QX8A 4UB6E 4WY4C 1X0TA 2OTJP 2FFDA 3Q5PA 2W90A 3WU2H 1P84H 5CCHA 3KZIH 4HKZH 3RK2C 3CWBJ 2ZXEB 1GTWA 3C8VA 2IYOA 5C39A 3H1JD 1Y9BA 1ZP0C 1LP1B 3HE5B 1AJYA 4RESB 1QVFO 3OW2O 1RHZB 1IFPA 3CMAP 1SQXK 2QG4A 3TSIA 5APXA 2KI7B 3CPWO 1JNMA 1RQUA 4K35A 2JDIH 1U7MA 1KQGB 4U3FG 1Q90D 1SQPG 5KKZB 1VQOP 2QSIA 2ZYDA 1FZEA 4L75A 4PD4E 2OYHA 1M1JA 3TNUA 1VQLP 1OW8A 1S5LE 4C7NB 3JSVC 2Y0DA 1PGOA 2JR8A 2WSFH 3H6PA 4IL6X 1GL2C 3M0AA 3KPEA 3NXSA 5CCHC 2C9NY 1GD2E 2Q1KA 1BE3J 3FWLA 4N3YB 2E75C 2IZ1A 1OMIA 1QVGO 1KILB 2J5UA 1U7JA 2W6AA 2XDJA 4KT0J 2MJZA 1VDFA 2KS1A 4PV1C 2D2CD 1OVRA 4XFJA 1ZOYC 1JMBA 4YTPC 1SQXD 1OX3A 1J1DB 2QM8A 5CCGD 5CJ4A 2P2UA 1DIPA 1HBWA 2IBZI 5APYA 3H1LE 2K37A 2GM4A 2E76D 2E5TA 2N1TA 3I55P 3JCUH 3BCCG 2M5AB 2WTYA 5H2FE 1NTMD 3B8EB 4W80A 1DX7A 3Q5RA 1EZVG 2WQYC 5AVRB 1AQTA 5AVTB 1SQXE 1LP1A 2E74C 2XNDH 2ZT9B 3L72E 5KLIB 3FGAD 3N4XA 1K9MQ 1SFCB 3PRJA 1VQ7P 3BVHA 3L35A 3CXHD 2K88A 1FOSE 4W7YA 1SQXJ 5KJ7D 1KC8Q 1NU1E 1NTMG 3A2AA 1H8AA 5TISH 1Q81Q 1PPJE 1DD3A 3LW5J 2QJKC 5BU5A 5AW6B 1YBKA 4UB6H 1T3JA 4H13B 3H1LG 2YO2A 1LTSC 2JJLA 2NPSD 2P58A 2OYIA 3QH9A 1ZW0A 3WU2E 3KZIE 3SSUA 2HR3A 2IFMA 3L73G 1S72P 3RL0B 4I7ZC 4NPDA 3AE2C 4L76A 3CX5H 3MUDC 1VQNP 5AW2B 2H88C 2B89A 1EDJA 1YJNP 4WBAA 1NTKE 5AVYB 2OTKE 2WZ7A 1S2EA 3L37A 4N78E 4YXDC 2R5BA 3R2PA 1NWQA 1G2CA 4GOEA 1BGYE 1EQ7A 2GUSA 2N1TB 5APSA 1KN7A 2E43A 2LR2A 5APUA 4DZOA 1WT6A 3LW5H 4BXLA 2C9LY 3B5NB 4O9BA 3VN0A 1KZUB 3O8ZA 3G6EP 3AE7C 3GHGB 2ZT9D 2YIUC 3PH0A 3L71G 3V2PA 3A0BH 1IC2A 3L72J 2PP6A 2RH0A 1SQPD 2AXTH 3HE4B 1USEA 2A45H 2PRRA 3AE3C 5TJHA 3E7KA 1KB9D 2HODA 1SP4A 2QEXP 1GL2D 2IBZG 1FDIA 2O3JA 3AEEC 2O01J 1T2KD 4C7NA 2CPBA 4Z1MH 4H13D 4OH8B 3JC22 3HD7D 2WPRA 4Y99C 4U7JA 2KB7P 1VF5B 1SQVE 3H1JJ 1IK9A 3HRNA 1EZVI 1ZXGA 2WWWA 1JTHB 1KILD 1PL5A 1L0NK 2AEJA 4R4LA 2JEEA 5AW7B 4ZMDA 1NKNA 1OWAA 3CCEP 1ZR4A 1DEEG 2BEZF 1T3UA 5KAFE 1NTKK 3AE8C 1VQMP 1N8RQ 1NAFA 1NTKG 5KLVK 4UB8H 2FYUJ 2WT7A 2HPCA 1JY3P 1L0ND 2WMMA 2QE7H 3OAKA 3RBXA 4YPCA 3CX5D 4B86A 1W2BO 2FXMA 2QVAA 3IF4A 2H89C 4QMAA 1GK6A 4U3FJ 2B88A 3CXHI 3WMM0 5AVUB 1SFCD 1MKMA 3E1IA 3IN6A 2G8YA 1SQBJ 4PD4D 5KLIC 3H1HG 2OQQA 2JWDA 2FFDB 3N7NA 1EZVE 1IFNA 3H1KD 5DJTB 1S9KE 1SQXG 1PZQA 1LWUC 2AEFA 2M8RA 2WSFJ 2HLOA 5GTIE 3G71P 2HG5D 2NPSB 3B4SA 3FWNA 2CK3H 2IBZD 1NYHA 3GF7A 3Q3DA 1YITP 5B66E 1A02J 3H25A 3W67A 1JOCA 3FX0A 1OW6A 4BRYA 1JB0J 2OARA 1AV1A 1PPJD 1LTAC 4WY4D 3V2NA 1FOSF 2YKOA 2O01N 1VQ5P 3L75D 1LWUB 2Q9IA 3KDPB 4YXWH 3AE1C 3L70J 5GTHH 4C7RA 1IFDA 3LIDA 1R5LA 1SQBD 1URQD 1ZLLA 1GDTA 5L8RJ 2YMKA 2GUVA 3H1JG 1SS1A 1L0LJ 3B5NA 5E79E 3L4FA 3CWBD 4DT0A 1CW5A 2D2CC 4I2LC 2L5GB 1VQ8P 1LTJC 3M0DC 1RF1A 1ZR2A 1NKZB 1FAVA 3HTKB 1N7SD 1YQ3C 2AXCA 4WY4A 1T2KC 1H89A 1JEKA 1M7LA 3EWKA 3T97B 4D6TG 5KAFH 2K9YA 1LTBC 3PLNA 5CMZA 4OWFA 3G4SP 2YO3A 1RQVA 2NPSA 1AQ5A 2QJKB 3CCVP 1EC5A 1KB9E 3TNUB 1CI6A 1HJBA 3LIEA 1N86A 2E74B 3K5BA 3P8CD 3VP8A 1VQ9P 1KV4A 5CBOA 2A06D 3HD7A 5AVXB 3TYYA 1N7SA 3MD0A 5BVZA 1QEXA 3PP5A 1QL2A 4WY4B 2O1KA 3M06A 3KYQA 3ZDMA 2XZRA 1BCCD 2B9BA 3A3YB 4W7ZA 2W83C 3B71A 2Z4EA 1PP9G 2JO1A 1SQPK 1RE3C 1USDA 1U57A 2IPPA 3VTPC 3W68A 2Y0CA 2Y9YA 1G2CB 3Q1MA 2WSSH 3KQGA 1SQPJ 3PTZA 2BCCG 5APTA 3B5ND 1LGHB 2H7HA 1YIJP 1HVVA 1FZCC 4LGDE 5B5EE 3AECC 1NOHA 5KAIH 3H1KE 3KXDA 2K3RA 1URQA 1L4AD 2FBWC 1QGKB 4IFDK 2OTLP 1M1KQ 4KHXA 2YMYA 3H1IG 3AEGC 4R4MA 1IK7A 2FKWB 3AEAC 5APQA 3H1KJ 1H0TB 1NAYA 1RE4C 1M90Q 1SQVJ 1LT9B 1TU3F 2LKMA 4H0LD 5GTHE 1K73Q 4L73A 1R8EA 1CSBA 4K3AA 1BGYG 1ZN5A 1PP9E 2G3AA 3D71A 1SQVK 2O1JA 2OYIB 3R4YA 1HWTC 3CXHH 2B87B 2IX7C 2K1AA 1KYOE 3A0HE 1N7SC 4U3FD 3AE9C 3CC7P 1EDKA 4PJ0H 3VMZA 1XTGB 5E79H 3MZWB 2ZFCA 3PHLA 3G9RA 2YXRB 4DJGA 1L4AA 3TF5A 4HJGH 1L0NJ 4IL6H 1K04A 1SQQK 1URQC 1SFCA 2IZ0A 5KLVE 1BCCG 1YHQP 4RKUJ 1FJKA 4ASVA 1FBMA 3WUVA 3L75E 3RBZA 1EXIA 2Z5IA 1BE3G 1NGMB 2ZT9C 3RK3B 1SQVG 1FZCB 3TGUD 2P1JA 3OA7A 1L0LD 1RE4A 1QL1A 3EQ2A 4PV1B 2BASA 2V7QH 1YYCA 4MN4C 5AVQB 2N9YB 3F5HA 1NO4A 5K5GB 1BDCA 2OGUA 1YQ4C 2OYHC 2ZAEB 5CBNA 1KILA 1X9VA 2PAJA 1KTMA 1W2EA 1NVOA 4LLHA 1J1DC 4D6TD 1YJ9P 2R3CA 2XKMA 1SQQD 3L74G 2BCCD 3TGUJ 5AW0B 1ZV8A 4JQ0D 1Y8AA 1RF0A 1E79H 1LT1A 5AVSB 1N73B 1VF5D 1A02F 2R5DA 3Q2YA 3L73D 1M56D 2R44A 2W27A 1W5CE 1MFTA 1HF9A 3SWKA 3VYIA 1K05A 4C46A 1SLQA 1OFCX 5KJ7A 3F89A 1JCCA
chains in the Genus database with same CATH topology
1T8ZA 1NTZK 5AW8B 1LT9C 1NHLA 3HE5A 1RF1C 1LTGC 4N6JA 2WT7B 2HPCB 2I1KA 2WSCH 1PFIA 4JYBA 2H43A 3HUSA 1RF0C 3NMDA 3P7KA 3A5TA 2FYZA 2P67A 3BRTB 3MGNA 1RF1A 1J1EC 1HGZA 3HUSB 3V5BA 5CHXA 5AW3B 2VRSA 1JTHA 1FZFA 4AUWA 2N9BA 5AW9B 4WB4A 1GL2A 3HD7B 1X8YA 4XA4A 3MUDA 4XE5B 1KFNA 1X79B 5APVA 5CCHD 2N1TD 1CZQA 2P7JA 2KP8A 2IFNA 3H32B 3BATA 3L36A 1JY2P 3M06A 5AVWB 1N7SB 1DH3A 2WPQA 2KSJA 1LTTC 3TK1A 1MZ9A 2W6BA 1KQLA 3CI9A 1JY2O 4Y99B 2Z5HA 1IFJA 3NFQA 1WRGA 1SFCC 3M0DA 1LTJA 2HFED 3SWYA 1CI6B 3EFGA 2I1JA 1GK4A 2R32A 2NPSC 1RE3A 3RL0D 4JYCA 3T97A 3M9HA 2XNXA 1GZLA 3RK3C 3M9QA 4ZKUA 2Q7CA 5KJ7C 2Q3IA 1YTZT 3U1AA 3P32A 1FZCA 3NTNA 2YKPA 1URQB 1JCDA 1FJPA 4AQRD 4EIJA 3KQGA 1FZBA 2KOGA 1IFIA 1L0LK 1M1JC 3IFMA 1G1JA 1LWUA 1LT9A 1RF1B 2XU6A 1M1JB 3RL0C 3CLQA 1IFMA 1LTJB 1HH0A 4AYCA 1FZAA 1HGVA 1VPCA 3MTUE 3M91A 3HTKA 3V4WA 3RK2D 1N73C 4IFMA 3P8MC 1Z56A 5KTBA 4EOTA 1HTLC 3I5CA 1NH4A 2YKQA 3H32A 2M3BA 2O01H 5CCGA 1E5WA 4LC1A 3VP9A 4GT1A 1SQBK 2H8PD 2J58A 3II6A 2YNYA 1GL2B 1SVFA 3P8CE 1N73A 5AW4B 2A45I 3IR9A 1MUUA 1GW4A 1KILC 1GU5A 2J59M 4JF7A 1H88A 1XTCC 4I6MC 1HUCA 2WPSA 3CL3D 2FYUK 3MIWA 1JY3O 3RK2B 2FFDC 3M9BA 5APWA 1MFZA 1JMMA 3U1CA 3VMYA 3BRVB 2C0XA 1OXZA 4GKGA 4N78D 3VMXA 4ZKPA 3VOPA 1J1EB 3HUSC 1AFOA 1KFMA 1GW3A 4HH2A 1NTMK 1NU1K 3U59A 2OYHB 1FDMA 2WSEH 1S9KD 4DOJA 3G3ZA 1JO5A 1GU4A 5AVVB 2N1TC 1IO4A 3OJAB 2XV5A 3V4QA 3GHGA 2E42A 1JY2N 2CPSA 2QM7A 3UIAA 2WITA 2A45G 1MV8A 3SWFA 2HODB 1DEBA 1IJDB 2KYVA 3BASA 5BU8B 1HWTC 1LTIC 3V2QA 5AW1B 4M3LA 4I1LA 5AVZB 2OYIC 1J2JB 1JY3N 3HD7C 3RK3D 4GIFA 1FZGA 1L4AB 2C0WA 1YTZI 4HYTB 1G1IA 1RY3A 5CJ0A 1N7LA 3C9IA 1FU1A 2POHA 3GHGC 2KLVA 2Q5UA 3B5NC 1N2DC 3A7OA 3HE4A 2HYNA 4IFFA 1L4AC 1JUNA 4WY4C 2FFDA 5CCHA 3RK2C 2FFDB 1GTWA 2ZXEB 3HE5B 4RESB 1SQXK 3TSIA 5APXA 1JNMA 2OYHA 1FZEA 1M1JA 3TNUA 4C7NB 2WSFH 3H6PA 5CCHC 1GL2C 3M0AA 3KPEA 3NXSA 2C9NY 1GD2E 4N3YB 1KILB 2W6AA 2XDJA 2MJZA 1VDFA 5CCGD 2QM8A 1J1DB 5CJ4A 1HBWA 2P2UA 5APYA 2GM4A 2N1TA 2WTYA 3B8EB 4W80A 1DX7A 5AVRB 5AVTB 3N4XA 1SFCB 3BVHA 3L35A 1FOSE 4W7YA 5KJ7D 3A2AA 1H8AA 5BU5A 5AW6B 1T3JA 2YO2A 1LTSC 2JJLA 2NPSD 2OYIA 2IFMA 3RL0B 5AW2B 4WBAA 5AVYB 2WZ7A 3L37A 4N78E 2R5BA 3R2PA 1NWQA 1G2CA 1EQ7A 2GUSA 2N1TB 5APSA 2E43A 5APUA 4DZOA 1WT6A 3LW5H 2C9LY 3B5NB 4O9BA 3VN0A 1KZUB 3O8ZA 3GHGB 3V2PA 1IC2A 5AW5B 2PP6A 3HE4B 2A45H 2HODA 1SP4A 1GL2D 1T2KD 4C7NA 2CPBA 4OH8B 3HD7D 2WPRA 4Y99C 2KB7P 3HRNA 1IK9A 5CCGC 2WWWA 5AW7B 1JTHB 1KILD 3V2RA 1L0NK 2JEEA 1NKNA 1OWAA 1ZR4A 1T3UA 1NTKK 1NAFA 5KLVK 2WT7A 2HPCA 1JY3P 3OAKA 4B86A 2FXMA 1GK6A 3WMM0 5AVUB 1SFCD 3E1IA 3N7NA 1IFNA 1S9KE 2M8RA 1LWUC 2HLOA 2HG5D 2NPSB 1A02J 1JOCA 2OARA 4WY4D 1FOSF 1LTAC 3V2NA 2YKOA 2Q9IA 1LWUB 3KDPB 4C7RA 1IFDA 3LIDA 1URQD 1ZLLA 1GDTA 2GUVA 3B5NA 3L4FA 1CW5A 4I2LC 2L5GB 1LTJC 3M0DC 1ZR2A 1NKZB 1FAVA 3HTKB 1N7SD 4WY4A 1T2KC 1H89A 1M7LA 1LTBC 5CMZA 2YO3A 2NPSA 1AQ5A 3TNUB 1CI6A 1HJBA 3LIEA 1N86A 3P8CD 3VP8A 3HD7A 3TYYA 5AVXB 5BVZA 1N7SA 3MD0A 3PP5A 1QL2A 4WY4B 2O1KA 3KYQA 2XZRA 3A3YB 4W7ZA 2Z4EA 1SQPK 1RE3C 2IPPA 3VTPC 1G2CB 5APTA 3B5ND 1LGHB 2H7HA 1HVVA 1FZCC 4LGDE 1NOHA 1URQA 1L4AD 4IFDK 4KHXA 2YMYA 5APQA 2FKWB 1RE4C 1LT9B 2LKMA 1CSBA 2OYIB 1ZN5A 1SQVK 2O1JA 2IX7C 1N7SC 3VMZA 1XTGB 2ZFCA 1L4AA 1SQQK 1URQC 1SFCA 1FJKA 1FBMA 2Z5IA 3RK3B 1FZCB 3OA7A 2P1JA 1RE4A 1QL1A 3EQ2A 2BASA 5AVQB 1YYCA 1NO4A 2OYHC 1KILA 1X9VA 2PAJA 1W2EA 4LLHA 1J1DC 2R3CA 2XKMA 4C46A 5AW0B 1ZV8A 1RF0A 1N73B 5AVSB 1A02F 2R5DA 2W27A 3VYIA 1SLQA 5KJ7A 1JCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE5 B;  4RES B;  5APX A;  5AW8 B;  1A02 J;  3HE5 A;  1JNM A;  4LC1 A;  4GT1 A;  2WT7 B;  1FOS F;  3TNU A;  2YNY A;  4C7N B;  3KDP B;  5AW4 B;  3IR9 A;  2C9N Y;  1MUU A;  3M0A A;  3NXS A;  1GU5 A;  1GD2 E;  3LID A;  2W6A A;  4JYB A;  1H88 A;  3NMD A;  3P7K A;  2QM8 A;  3A5T A;  1HBW A;  2P67 A;  2P2U A;  3MGN A;  4I2L C;  5APY A;  4I6M C;  1HUC A;  3V5B A;  2WPS A;  1FAV A;  1H89 A;  5AW3 B;  1T2K C;  2VRS A;  2WTY A;  3B8E B;  3M9B A;  5APW A;  1MFZ A;  2N9B A;  5AW9 B;  4AUW A;  5CMZ A;  5AVR B;  5AVT B;  2YO3 A;  3VMY A;  1X8Y A;  1OXZ A;  3L35 A;  1CI6 A;  4XE5 B;  3LIE A;  3TNU B;  1HJB A;  4GKG A;  3VMX A;  1FOS E;  5APV A;  3A2A A;  1H8A A;  3TYY A;  5AVX B;  1CZQ A;  2P7J A;  3MD0 A;  2KP8 A;  5AW6 B;  2YO2 A;  2JJL A;  3L36 A;  5AVW B;  3M06 A;  2XZR A;  1DH3 A;  3A3Y B;  2WPQ A;  3TK1 A;  2IPP A;  3VTP C;  1KQL A;  1G2C B;  1S9K D;  5APT A;  1GU4 A;  5AW2 B;  5AVV B;  2H7H A;  2Z5H A;  5AVY B;  3L37 A;  3NFQ A;  2R5B A;  1NWQ A;  1IO4 A;  2XV5 A;  3M0D A;  4KHX A;  5APS A;  3V4Q A;  2E42 A;  3UIA A;  5APQ A;  2QM7 A;  1CI6 B;  5APU A;  4DZO A;  2E43 A;  2C9L Y;  1MV8 A;  3VN0 A;  3O8Z A;  3SWF A;  1CSB A;  1GK4 A;  2R32 A;  5AW5 B;  1HWT C;  3HE4 B;  4JYC A;  3T97 A;  3M9H A;  5AW1 B;  3VMZ A;  1GZL A;  4M3L A;  1SP4 A;  2ZFC A;  5AVZ B;  1J2J B;  2Q7C A;  1T2K D;  4C7N A;  2Q3I A;  2WPR A;  3P32 A;  3NTN A;  2WWW A;  5AW7 B;  2Z5I A;  1OWA A;  4AQR D;  3KQG A;  4HYT B;  1NAF A;  2XU6 A;  2BAS A;  5AVQ B;  1YYC A;  2WT7 A;  3OAK A;  4B86 A;  2Q5U A;  3A7O A;  4AYC A;  3HE4 A;  2R3C A;  1GK6 A;  4C46 A;  5AW0 B;  5AVU B;  5AVS B;  1JUN A;  1A02 F;  2R5D A;  3M91 A;  3HTK A;  3V4W A;  2W27 A;  3P8M C;  1S9K E;  3VYI A;  1GTW A;  2ZXE B;  1SLQ A;  4EOT A;  3I5C A; 
#chains in the Genus database with same CATH topology
 2FY8 A;  1T8Z A;  2FXP A;  1P84 D;  3SFD C;  3E1R A;  1NTZ K;  1VQP P;  1RH5 B;  1L0N E;  1LT9 C;  1NHL A;  3HE5 A;  3AEF C;  5AW8 B;  5KLV J;  4PD4 H;  1RF1 C;  2FYN B;  2ZVN B;  2KZJ A;  2ZYA A;  1LTG C;  4N6J A;  4OVN F;  1PPJ G;  1VL2 A;  2WT7 B;  1S3J A;  2HPC B;  1VQ4 P;  2I1K A;  2WSC H;  2D2C B;  1YJW P;  1KQF B;  3A0H H;  2V4H A;  3C1L A;  1LNQ A;  5AW5 B;  1PFI A;  2E76 B;  2Y0E A;  4EDF A;  1SQB E;  1PV3 A;  1PIX A;  1BE3 D;  2W8Z A;  4JYB A;  1NTM E;  2M3E A;  4IL6 E;  4L74 A;  1DD4 A;  3HUS A;  3AE5 C;  1RF0 C;  3L74 E;  2H43 A;  3NMD A;  1NTZ D;  3P7K A;  3A5T A;  1EDI A;  2FYZ A;  2KNC B;  2P67 A;  3BRT B;  3MGN A;  3SFE C;  4CPG A;  2KS1 B;  4U3F E;  1KQS O;  1J1E C;  1HGZ A;  3HUS B;  4OGQ D;  2YIU B;  3V5B A;  5CHX A;  5AW3 B;  2KK7 A;  2VRS A;  1JTH A;  3L70 G;  4H44 B;  1FZF A;  4AUW A;  3JCU E;  2N9B A;  5AW9 B;  5KLV D;  1NTZ E;  2KSE A;  4WB4 A;  1GL2 A;  3HD7 B;  1QLE D;  1BGY D;  1X8Y A;  3MUD A;  4XA4 A;  1H0T A;  4XE5 B;  1NTZ J;  1KFN A;  1X79 B;  5APV A;  5CCH D;  3Q5S A;  3L70 D;  2BEQ D;  3GW6 A;  2N1T D;  1CZQ A;  2P7J A;  2E75 D;  2KP8 A;  2LXB A;  1KD1 Q;  2IFN A;  3H32 B;  1EXJ A;  3MHV A;  3BAT A;  3L36 A;  1JY2 P;  2PGD A;  3L71 E;  1N7S B;  3GLM A;  2WPQ A;  2KSJ A;  1LTT C;  2YXQ B;  3H1I J;  3QWO C;  2RMZ A;  4ASW A;  3TK1 A;  3CME P;  2JKV A;  1MZ9 A;  3L70 E;  1SQB G;  3FXE A;  2W6B A;  3CX5 E;  2KIK A;  1KQL A;  2IBZ E;  2OYO A;  3CCU P;  3CC2 P;  3CI9 A;  1JY2 O;  1S4X A;  3AED C;  2FXO A;  3H1J E;  4Y99 B;  1L0L E;  2V7Q J;  2Z5H A;  3L71 D;  1IFJ A;  4DCK A;  1NU1 G;  3NFQ A;  1WRG A;  1SFC C;  2GA1 A;  4PD4 I;  2BCC E;  1LTJ A;  3M0D A;  2ZJS E;  5DJU B;  2HFE D;  3SWY A;  1CI6 B;  4GOF A;  4JBZ A;  4H44 D;  2L91 A;  5BU8 B;  2FYU E;  3EFG A;  1SQQ E;  4RO0 A;  2AEM A;  3GMA A;  1PGQ A;  5M1B A;  2M0B A;  1HJ0 A;  1GK4 A;  2I1J A;  2JP3 A;  2R32 A;  4WVZ A;  2NPS C;  1RE3 A;  4OGQ C;  3AE6 C;  1SQQ J;  4JYC A;  3A0B E;  3AE4 C;  4NPF X;  3RL0 D;  1BCC J;  1WMK A;  2AXT E;  2XNX A;  1GZL A;  2E5Y A;  3M9H A;  3RK3 C;  3TDK A;  3FXD A;  3M9Q A;  1KIL E;  2Q7C A;  4ZKU A;  4NPE A;  2E75 B;  5KJ7 C;  1Q86 Q;  2Q3I A;  3L75 J;  1YTZ T;  3U1A A;  3P32 A;  3CCR P;  1SQP E;  3CCS P;  1FZC A;  3PJS K;  2YKP A;  1URQ B;  3NTN A;  2M5A A;  3EFF K;  2QJP B;  2NRG A;  1JCD A;  1FJP A;  2WVR A;  4AQR D;  2A06 G;  4EIJ A;  2KZI A;  1FZB A;  1GMJ A;  1IFI A;  1L0L K;  1M1J C;  1G1J A;  2KOG A;  3IFM A;  1LWU A;  4H0L B;  4UB8 E;  1LT9 A;  1RF1 B;  1BSN A;  1L0L G;  1Y47 A;  2XU6 A;  1BE3 E;  4WWI A;  3WUT A;  1OVU A;  1M1J B;  3L75 G;  3GF3 A;  2FYU D;  1IFM A;  3CLQ A;  3RL0 C;  1LTJ B;  1HH0 A;  1EZV D;  2JWA A;  2QJP C;  4AYC A;  2BCC J;  2WSC J;  2KUB A;  4IOI H;  1FZA A;  1HGV A;  1VPC A;  2QJY B;  1NJI Q;  3MTU E;  1UII A;  1KOR A;  3HTK A;  3M91 A;  4TLF A;  3V4W A;  1DH3 A;  3RK2 D;  1VF5 C;  3WUU A;  4IFM A;  1N73 C;  2K9J B;  3P8M C;  1BDD A;  2KNC A;  1NTZ G;  1Z56 A;  5KTB A;  4EOT A;  1HTL C;  3I5C A;  1NH4 A;  2DW3 A;  2YKQ A;  3H32 A;  2M3B A;  5GTI H;  1Q7Y Q;  2QA4 P;  2O01 H;  2KLU A;  5CCG A;  1E5W A;  4LC1 A;  3VP9 A;  5B66 H;  3TGU G;  1VQ6 P;  3ABV C;  4GT1 A;  1SQB K;  3H1I D;  5EFW B;  2H8P D;  2J58 A;  3H1H J;  3II6 A;  4D6T E;  1JM0 A;  3D70 A;  1EDL A;  1Q82 Q;  2E76 C;  1FDO A;  1L2P A;  2R3S A;  2YNY A;  2QJY C;  4TT3 H;  1GL2 B;  1M8O B;  1SVF A;  2ZYG A;  2ITA A;  1BSH A;  3P8C E;  3H1H E;  3CWB E;  4D6T J;  1YI2 P;  1FE6 A;  5AW4 B;  3RK3 E;  1N73 A;  2A45 I;  3IR9 A;  3BCC J;  1MUU A;  1GW4 A;  3BCC D;  3ITK A;  1KIL C;  1KYO I;  1GU5 A;  4JPZ B;  2B87 A;  2RN0 A;  1K8A Q;  4KJM A;  3S9O A;  2J59 M;  4JF7 A;  1H88 A;  3BCC E;  1NTK J;  1KB9 I;  3KHU A;  3H1H D;  4H0L C;  1P84 I;  1UIX A;  1XTC C;  3H1L D;  3TGU E;  4I6M C;  1HUC A;  3CX5 I;  2WPS A;  1PP9 D;  3CCL P;  3CL3 D;  2FYU K;  3MIW A;  1JY3 O;  1OW7 A;  3RK2 B;  2FFD C;  5KKZ C;  3M9B A;  2I8D A;  1MFZ A;  1SQQ G;  5APW A;  1JMM A;  3U1C A;  1OZH A;  1KB9 H;  4GDO A;  1X22 A;  1ZME C;  1BGY J;  3VMY A;  3BRV B;  2C0X A;  2RKL A;  1OXZ A;  1PGJ A;  1VQK P;  1Q2N A;  4GKG A;  4N78 D;  3VMX A;  1OVV A;  5CCG C;  3V2R A;  3H1L J;  4EI2 A;  2QRX A;  3RGU A;  4ZKP A;  5AVW B;  3VOP A;  1NU1 J;  1J1E B;  3HUS C;  1NTM J;  3CWB G;  1KFM A;  1GW3 A;  4HH2 A;  3L74 J;  1AFO A;  3O6Q B;  1S5L X;  3D6Y A;  3S1K A;  1NTM K;  2K9J A;  2Q3E A;  2A06 E;  1NU1 K;  1S1C X;  3U59 A;  2OYH B;  1FDM A;  1OIP A;  3O6Q A;  2WSE H;  1M57 D;  1P84 E;  1PP9 J;  3IAO A;  3G3Z A;  2PFX A;  2SPZ A;  4DOJ A;  5KAI E;  1S9K D;  5AVV B;  1GU4 A;  1JO5 A;  4GOD A;  1T6A A;  1BCC E;  2QIW A;  2N1T C;  4I7Z B;  1IO4 A;  5B5E H;  2FYU G;  1FS0 E;  2W6J H;  2XV5 A;  3L73 J;  3OJA B;  3V4Q A;  3GHG A;  1R5S A;  3S4R A;  1JY2 N;  2CPS A;  2QM7 A;  3UIA A;  2E42 A;  2IDB A;  3CC4 P;  1AVY A;  1SQV D;  2FYN C;  3I56 P;  2WIT A;  2A45 G;  3CCQ P;  1MV8 A;  3SWF A;  2HOD B;  3CXH E;  1S5L H;  1DEB A;  1IJD B;  1KYO H;  2KYV A;  2WSE J;  3BAS A;  1FC2 C;  4PV1 D;  3V6I A;  1NU1 D;  3VMA A;  1LTI C;  3L72 D;  4EYY Q;  2NZ2 A;  4RJT A;  2Q6Q A;  5AW1 B;  3V2Q A;  1KMI Z;  4Y28 J;  4M3L A;  4BWN A;  2Y9Z A;  1AVO A;  1IZN B;  1PGP A;  4I1L A;  4H13 C;  4PJ0 E;  5AVZ B;  1J2J B;  1JY3 N;  3HD7 C;  4HB1 A;  3RK3 D;  3USS A;  2OYI C;  4GIF A;  1FZG A;  1KYO D;  1AA0 A;  4ZNC A;  1L4A B;  1ZRT E;  3H1K G;  2P10 A;  3MP7 B;  3AEB C;  4H44 C;  2E74 D;  1LJ2 A;  3L72 G;  3RL0 g;  2IYP A;  2C0W A;  3L71 J;  4A7P A;  2LXC B;  1ZRT D;  3H1I E;  3D6Z A;  3GG2 A;  2KXP B;  1YTZ I;  5H2F H;  2MKV A;  4HYT B;  3CCM P;  3L74 D;  1G1I A;  1RY3 A;  1NTK D;  1N7L A;  5CJ0 A;  3CD6 P;  4OGQ B;  3C9I A;  1FU1 A;  4BRY B;  2POH A;  3T97 A;  2UWJ E;  2ZXX A;  3CCJ P;  2WPV B;  2ZVO B;  3GHG C;  1L0N G;  2KLV A;  2Q5U A;  3B5N C;  1N2D C;  3A7O A;  3HE4 A;  3L73 E;  5KLV G;  2HYN A;  5TIS E;  1D7M A;  4IFF A;  1L4A C;  1JUN A;  1QX8 A;  4UB6 E;  4WY4 C;  1X0T A;  2OTJ P;  2FFD A;  3Q5P A;  2W90 A;  3WU2 H;  1P84 H;  5CCH A;  3KZI H;  4HKZ H;  3RK2 C;  3CWB J;  2ZXE B;  1GTW A;  3C8V A;  2IYO A;  5C39 A;  3H1J D;  1Y9B A;  1ZP0 C;  1LP1 B;  3HE5 B;  1AJY A;  4RES B;  1QVF O;  3OW2 O;  1RHZ B;  1IFP A;  3CMA P;  1SQX K;  2QG4 A;  3TSI A;  5APX A;  2KI7 B;  3CPW O;  1JNM A;  1RQU A;  4K35 A;  2JDI H;  1U7M A;  1KQG B;  4U3F G;  1Q90 D;  1SQP G;  5KKZ B;  1VQO P;  2QSI A;  2ZYD A;  1FZE A;  4L75 A;  4PD4 E;  2OYH A;  1M1J A;  3TNU A;  1VQL P;  1OW8 A;  1S5L E;  4C7N B;  3JSV C;  2Y0D A;  1PGO A;  2JR8 A;  2WSF H;  3H6P A;  4IL6 X;  1GL2 C;  3M0A A;  3KPE A;  3NXS A;  5CCH C;  2C9N Y;  1GD2 E;  2Q1K A;  1BE3 J;  3FWL A;  4N3Y B;  2E75 C;  2IZ1 A;  1OMI A;  1QVG O;  1KIL B;  2J5U A;  1U7J A;  2W6A A;  2XDJ A;  4KT0 J;  2MJZ A;  1VDF A;  2KS1 A;  4PV1 C;  2D2C D;  1OVR A;  4XFJ A;  1ZOY C;  1JMB A;  4YTP C;  1SQX D;  1OX3 A;  1J1D B;  2QM8 A;  5CCG D;  5CJ4 A;  2P2U A;  1DIP A;  1HBW A;  2IBZ I;  5APY A;  3H1L E;  2K37 A;  2GM4 A;  2E76 D;  2E5T A;  2N1T A;  3I55 P;  3JCU H;  3BCC G;  2M5A B;  2WTY A;  5H2F E;  1NTM D;  3B8E B;  4W80 A;  1DX7 A;  3Q5R A;  1EZV G;  2WQY C;  5AVR B;  1AQT A;  5AVT B;  1SQX E;  1LP1 A;  2E74 C;  2XND H;  2ZT9 B;  3L72 E;  5KLI B;  3FGA D;  3N4X A;  1K9M Q;  1SFC B;  3PRJ A;  1VQ7 P;  3BVH A;  3L35 A;  3CXH D;  2K88 A;  1FOS E;  4W7Y A;  1SQX J;  5KJ7 D;  1KC8 Q;  1NU1 E;  1NTM G;  3A2A A;  1H8A A;  5TIS H;  1Q81 Q;  1PPJ E;  1DD3 A;  3LW5 J;  2QJK C;  5BU5 A;  5AW6 B;  1YBK A;  4UB6 H;  1T3J A;  4H13 B;  3H1L G;  2YO2 A;  1LTS C;  2JJL A;  2NPS D;  2P58 A;  2OYI A;  3QH9 A;  1ZW0 A;  3WU2 E;  3KZI E;  3SSU A;  2HR3 A;  2IFM A;  3L73 G;  1S72 P;  3RL0 B;  4I7Z C;  4NPD A;  3AE2 C;  4L76 A;  3CX5 H;  3MUD C;  1VQN P;  5AW2 B;  2H88 C;  2B89 A;  1EDJ A;  1YJN P;  4WBA A;  1NTK E;  5AVY B;  2OTK E;  2WZ7 A;  1S2E A;  3L37 A;  4N78 E;  4YXD C;  2R5B A;  3R2P A;  1NWQ A;  1G2C A;  4GOE A;  1BGY E;  1EQ7 A;  2GUS A;  2N1T B;  5APS A;  1KN7 A;  2E43 A;  2LR2 A;  5APU A;  4DZO A;  1WT6 A;  3LW5 H;  4BXL A;  2C9L Y;  3B5N B;  4O9B A;  3VN0 A;  1KZU B;  3O8Z A;  3G6E P;  3AE7 C;  3GHG B;  2ZT9 D;  2YIU C;  3PH0 A;  3L71 G;  3V2P A;  3A0B H;  1IC2 A;  3L72 J;  2PP6 A;  2RH0 A;  1SQP D;  2AXT H;  3HE4 B;  1USE A;  2A45 H;  2PRR A;  3AE3 C;  5TJH A;  3E7K A;  1KB9 D;  2HOD A;  1SP4 A;  2QEX P;  1GL2 D;  2IBZ G;  1FDI A;  2O3J A;  3AEE C;  2O01 J;  1T2K D;  4C7N A;  2CPB A;  4Z1M H;  4H13 D;  4OH8 B;  3JC2 2;  3HD7 D;  2WPR A;  4Y99 C;  4U7J A;  2KB7 P;  1VF5 B;  1SQV E;  3H1J J;  1IK9 A;  3HRN A;  1EZV I;  1ZXG A;  2WWW A;  1JTH B;  1KIL D;  1PL5 A;  1L0N K;  2AEJ A;  4R4L A;  2JEE A;  5AW7 B;  4ZMD A;  1NKN A;  1OWA A;  3CCE P;  1ZR4 A;  1DEE G;  2BEZ F;  1T3U A;  5KAF E;  1NTK K;  3AE8 C;  1VQM P;  1N8R Q;  1NAF A;  1NTK G;  5KLV K;  4UB8 H;  2FYU J;  2WT7 A;  2HPC A;  1JY3 P;  1L0N D;  2WMM A;  2QE7 H;  3OAK A;  3RBX A;  4YPC A;  3CX5 D;  4B86 A;  1W2B O;  2FXM A;  2QVA A;  3IF4 A;  2H89 C;  4QMA A;  1GK6 A;  4U3F J;  2B88 A;  3CXH I;  3WMM 0;  5AVU B;  1SFC D;  1MKM A;  3E1I A;  3IN6 A;  2G8Y A;  1SQB J;  4PD4 D;  5KLI C;  3H1H G;  2OQQ A;  2JWD A;  2FFD B;  3N7N A;  1EZV E;  1IFN A;  3H1K D;  5DJT B;  1S9K E;  1SQX G;  1PZQ A;  1LWU C;  2AEF A;  2M8R A;  2WSF J;  2HLO A;  5GTI E;  3G71 P;  2HG5 D;  2NPS B;  3B4S A;  3FWN A;  2CK3 H;  2IBZ D;  1NYH A;  3GF7 A;  3Q3D A;  1YIT P;  5B66 E;  1A02 J;  3H25 A;  3W67 A;  1JOC A;  3FX0 A;  1OW6 A;  4BRY A;  1JB0 J;  2OAR A;  1AV1 A;  1PPJ D;  1LTA C;  4WY4 D;  3V2N A;  1FOS F;  2YKO A;  2O01 N;  1VQ5 P;  3L75 D;  1LWU B;  2Q9I A;  3KDP B;  4YXW H;  3AE1 C;  3L70 J;  5GTH H;  4C7R A;  1IFD A;  3LID A;  1R5L A;  1SQB D;  1URQ D;  1ZLL A;  1GDT A;  5L8R J;  2YMK A;  2GUV A;  3H1J G;  1SS1 A;  1L0L J;  3B5N A;  5E79 E;  3L4F A;  3CWB D;  4DT0 A;  1CW5 A;  2D2C C;  4I2L C;  2L5G B;  1VQ8 P;  1LTJ C;  3M0D C;  1RF1 A;  1ZR2 A;  1NKZ B;  1FAV A;  3HTK B;  1N7S D;  1YQ3 C;  2AXC A;  4WY4 A;  1T2K C;  1H89 A;  1JEK A;  1M7L A;  3EWK A;  3T97 B;  4D6T G;  5KAF H;  2K9Y A;  1LTB C;  3PLN A;  5CMZ A;  4OWF A;  3G4S P;  2YO3 A;  1RQV A;  2NPS A;  1AQ5 A;  2QJK B;  3CCV P;  1EC5 A;  1KB9 E;  3TNU B;  1CI6 A;  1HJB A;  3LIE A;  1N86 A;  2E74 B;  3K5B A;  3P8C D;  3VP8 A;  1VQ9 P;  1KV4 A;  5CBO A;  2A06 D;  3HD7 A;  5AVX B;  3TYY A;  1N7S A;  3MD0 A;  5BVZ A;  1QEX A;  3PP5 A;  1QL2 A;  4WY4 B;  2O1K A;  3M06 A;  3KYQ A;  3ZDM A;  2XZR A;  1BCC D;  2B9B A;  3A3Y B;  4W7Z A;  2W83 C;  3B71 A;  2Z4E A;  1PP9 G;  2JO1 A;  1SQP K;  1RE3 C;  1USD A;  1U57 A;  2IPP A;  3VTP C;  3W68 A;  2Y0C A;  2Y9Y A;  1G2C B;  3Q1M A;  2WSS H;  3KQG A;  1SQP J;  3PTZ A;  2BCC G;  5APT A;  3B5N D;  1LGH B;  2H7H A;  1YIJ P;  1HVV A;  1FZC C;  4LGD E;  5B5E E;  3AEC C;  1NOH A;  5KAI H;  3H1K E;  3KXD A;  2K3R A;  1URQ A;  1L4A D;  2FBW C;  1QGK B;  4IFD K;  2OTL P;  1M1K Q;  4KHX A;  2YMY A;  3H1I G;  3AEG C;  4R4M A;  1IK7 A;  2FKW B;  3AEA C;  5APQ A;  3H1K J;  1H0T B;  1NAY A;  1RE4 C;  1M90 Q;  1SQV J;  1LT9 B;  1TU3 F;  2LKM A;  4H0L D;  5GTH E;  1K73 Q;  4L73 A;  1R8E A;  1CSB A;  4K3A A;  1BGY G;  1ZN5 A;  1PP9 E;  2G3A A;  3D71 A;  1SQV K;  2O1J A;  2OYI B;  3R4Y A;  1HWT C;  3CXH H;  2B87 B;  2IX7 C;  2K1A A;  1KYO E;  3A0H E;  1N7S C;  4U3F D;  3AE9 C;  3CC7 P;  1EDK A;  4PJ0 H;  3VMZ A;  1XTG B;  5E79 H;  3MZW B;  2ZFC A;  3PHL A;  3G9R A;  2YXR B;  4DJG A;  1L4A A;  3TF5 A;  4HJG H;  1L0N J;  4IL6 H;  1K04 A;  1SQQ K;  1URQ C;  1SFC A;  2IZ0 A;  5KLV E;  1BCC G;  1YHQ P;  4RKU J;  1FJK A;  4ASV A;  1FBM A;  3WUV A;  3L75 E;  3RBZ A;  1EXI A;  2Z5I A;  1BE3 G;  1NGM B;  2ZT9 C;  3RK3 B;  1SQV G;  1FZC B;  3TGU D;  2P1J A;  3OA7 A;  1L0L D;  1RE4 A;  1QL1 A;  3EQ2 A;  4PV1 B;  2BAS A;  2V7Q H;  1YYC A;  4MN4 C;  5AVQ B;  2N9Y B;  3F5H A;  1NO4 A;  5K5G B;  1BDC A;  2OGU A;  1YQ4 C;  2OYH C;  2ZAE B;  5CBN A;  1KIL A;  1X9V A;  2PAJ A;  1KTM A;  1W2E A;  1NVO A;  4LLH A;  1J1D C;  4D6T D;  1YJ9 P;  2R3C A;  2XKM A;  1SQQ D;  3L74 G;  2BCC D;  3TGU J;  5AW0 B;  1ZV8 A;  4JQ0 D;  1Y8A A;  1RF0 A;  1E79 H;  1LT1 A;  5AVS B;  1N73 B;  1VF5 D;  1A02 F;  2R5D A;  3Q2Y A;  3L73 D;  1M56 D;  2R44 A;  2W27 A;  1W5C E;  1MFT A;  1HF9 A;  3SWK A;  3VYI A;  1K05 A;  4C46 A;  1SLQ A;  1OFC X;  5KJ7 A;  3F89 A;  1JCC A; 
#chains in the Genus database with same CATH homology
 1T8Z A;  1NTZ K;  5AW8 B;  1LT9 C;  1NHL A;  3HE5 A;  1RF1 C;  1LTG C;  4N6J A;  2WT7 B;  2HPC B;  2I1K A;  2WSC H;  1PFI A;  4JYB A;  2H43 A;  3HUS A;  1RF0 C;  3NMD A;  3P7K A;  3A5T A;  2FYZ A;  2P67 A;  3BRT B;  3MGN A;  1RF1 A;  1J1E C;  1HGZ A;  3HUS B;  3V5B A;  5CHX A;  5AW3 B;  2VRS A;  1JTH A;  1FZF A;  4AUW A;  2N9B A;  5AW9 B;  4WB4 A;  1GL2 A;  3HD7 B;  1X8Y A;  4XA4 A;  3MUD A;  4XE5 B;  1KFN A;  1X79 B;  5APV A;  5CCH D;  2N1T D;  1CZQ A;  2P7J A;  2KP8 A;  2IFN A;  3H32 B;  3BAT A;  3L36 A;  1JY2 P;  3M06 A;  5AVW B;  1N7S B;  1DH3 A;  2WPQ A;  2KSJ A;  1LTT C;  3TK1 A;  1MZ9 A;  2W6B A;  1KQL A;  3CI9 A;  1JY2 O;  4Y99 B;  2Z5H A;  1IFJ A;  3NFQ A;  1WRG A;  1SFC C;  3M0D A;  1LTJ A;  2HFE D;  3SWY A;  1CI6 B;  3EFG A;  2I1J A;  1GK4 A;  2R32 A;  2NPS C;  1RE3 A;  3RL0 D;  4JYC A;  3T97 A;  3M9H A;  2XNX A;  1GZL A;  3RK3 C;  3M9Q A;  4ZKU A;  2Q7C A;  5KJ7 C;  2Q3I A;  1YTZ T;  3U1A A;  3P32 A;  1FZC A;  3NTN A;  2YKP A;  1URQ B;  1JCD A;  1FJP A;  4AQR D;  4EIJ A;  3KQG A;  1FZB A;  2KOG A;  1IFI A;  1L0L K;  1M1J C;  3IFM A;  1G1J A;  1LWU A;  1LT9 A;  1RF1 B;  2XU6 A;  1M1J B;  3RL0 C;  3CLQ A;  1IFM A;  1LTJ B;  1HH0 A;  4AYC A;  1FZA A;  1HGV A;  1VPC A;  3MTU E;  3M91 A;  3HTK A;  3V4W A;  3RK2 D;  1N73 C;  4IFM A;  3P8M C;  1Z56 A;  5KTB A;  4EOT A;  1HTL C;  3I5C A;  1NH4 A;  2YKQ A;  3H32 A;  2M3B A;  2O01 H;  5CCG A;  1E5W A;  4LC1 A;  3VP9 A;  4GT1 A;  1SQB K;  2H8P D;  2J58 A;  3II6 A;  2YNY A;  1GL2 B;  1SVF A;  3P8C E;  1N73 A;  5AW4 B;  2A45 I;  3IR9 A;  1MUU A;  1GW4 A;  1KIL C;  1GU5 A;  2J59 M;  4JF7 A;  1H88 A;  1XTC C;  4I6M C;  1HUC A;  2WPS A;  3CL3 D;  2FYU K;  3MIW A;  1JY3 O;  3RK2 B;  2FFD C;  3M9B A;  5APW A;  1MFZ A;  1JMM A;  3U1C A;  3VMY A;  3BRV B;  2C0X A;  1OXZ A;  4GKG A;  4N78 D;  3VMX A;  4ZKP A;  3VOP A;  1J1E B;  3HUS C;  1AFO A;  1KFM A;  1GW3 A;  4HH2 A;  1NTM K;  1NU1 K;  3U59 A;  2OYH B;  1FDM A;  2WSE H;  1S9K D;  4DOJ A;  3G3Z A;  1JO5 A;  1GU4 A;  5AVV B;  2N1T C;  1IO4 A;  3OJA B;  2XV5 A;  3V4Q A;  3GHG A;  2E42 A;  1JY2 N;  2CPS A;  2QM7 A;  3UIA A;  2WIT A;  2A45 G;  1MV8 A;  3SWF A;  2HOD B;  1DEB A;  1IJD B;  2KYV A;  3BAS A;  5BU8 B;  1HWT C;  1LTI C;  3V2Q A;  5AW1 B;  4M3L A;  4I1L A;  5AVZ B;  2OYI C;  1J2J B;  1JY3 N;  3HD7 C;  3RK3 D;  4GIF A;  1FZG A;  1L4A B;  2C0W A;  1YTZ I;  4HYT B;  1G1I A;  1RY3 A;  5CJ0 A;  1N7L A;  3C9I A;  1FU1 A;  2POH A;  3GHG C;  2KLV A;  2Q5U A;  3B5N C;  1N2D C;  3A7O A;  3HE4 A;  2HYN A;  4IFF A;  1L4A C;  1JUN A;  4WY4 C;  2FFD A;  5CCH A;  3RK2 C;  2FFD B;  1GTW A;  2ZXE B;  3HE5 B;  4RES B;  1SQX K;  3TSI A;  5APX A;  1JNM A;  2OYH A;  1FZE A;  1M1J A;  3TNU A;  4C7N B;  2WSF H;  3H6P A;  5CCH C;  1GL2 C;  3M0A A;  3KPE A;  3NXS A;  2C9N Y;  1GD2 E;  4N3Y B;  1KIL B;  2W6A A;  2XDJ A;  2MJZ A;  1VDF A;  5CCG D;  2QM8 A;  1J1D B;  5CJ4 A;  1HBW A;  2P2U A;  5APY A;  2GM4 A;  2N1T A;  2WTY A;  3B8E B;  4W80 A;  1DX7 A;  5AVR B;  5AVT B;  3N4X A;  1SFC B;  3BVH A;  3L35 A;  1FOS E;  4W7Y A;  5KJ7 D;  3A2A A;  1H8A A;  5BU5 A;  5AW6 B;  1T3J A;  2YO2 A;  1LTS C;  2JJL A;  2NPS D;  2OYI A;  2IFM A;  3RL0 B;  5AW2 B;  4WBA A;  5AVY B;  2WZ7 A;  3L37 A;  4N78 E;  2R5B A;  3R2P A;  1NWQ A;  1G2C A;  1EQ7 A;  2GUS A;  2N1T B;  5APS A;  2E43 A;  5APU A;  4DZO A;  1WT6 A;  3LW5 H;  2C9L Y;  3B5N B;  4O9B A;  3VN0 A;  1KZU B;  3O8Z A;  3GHG B;  3V2P A;  1IC2 A;  5AW5 B;  2PP6 A;  3HE4 B;  2A45 H;  2HOD A;  1SP4 A;  1GL2 D;  1T2K D;  4C7N A;  2CPB A;  4OH8 B;  3HD7 D;  2WPR A;  4Y99 C;  2KB7 P;  3HRN A;  1IK9 A;  5CCG C;  2WWW A;  5AW7 B;  1JTH B;  1KIL D;  3V2R A;  1L0N K;  2JEE A;  1NKN A;  1OWA A;  1ZR4 A;  1T3U A;  1NTK K;  1NAF A;  5KLV K;  2WT7 A;  2HPC A;  1JY3 P;  3OAK A;  4B86 A;  2FXM A;  1GK6 A;  3WMM 0;  5AVU B;  1SFC D;  3E1I A;  3N7N A;  1IFN A;  1S9K E;  2M8R A;  1LWU C;  2HLO A;  2HG5 D;  2NPS B;  1A02 J;  1JOC A;  2OAR A;  4WY4 D;  1FOS F;  1LTA C;  3V2N A;  2YKO A;  2Q9I A;  1LWU B;  3KDP B;  4C7R A;  1IFD A;  3LID A;  1URQ D;  1ZLL A;  1GDT A;  2GUV A;  3B5N A;  3L4F A;  1CW5 A;  4I2L C;  2L5G B;  1LTJ C;  3M0D C;  1ZR2 A;  1NKZ B;  1FAV A;  3HTK B;  1N7S D;  4WY4 A;  1T2K C;  1H89 A;  1M7L A;  1LTB C;  5CMZ A;  2YO3 A;  2NPS A;  1AQ5 A;  3TNU B;  1CI6 A;  1HJB A;  3LIE A;  1N86 A;  3P8C D;  3VP8 A;  3HD7 A;  3TYY A;  5AVX B;  5BVZ A;  1N7S A;  3MD0 A;  3PP5 A;  1QL2 A;  4WY4 B;  2O1K A;  3KYQ A;  2XZR A;  3A3Y B;  4W7Z A;  2Z4E A;  1SQP K;  1RE3 C;  2IPP A;  3VTP C;  1G2C B;  5APT A;  3B5N D;  1LGH B;  2H7H A;  1HVV A;  1FZC C;  4LGD E;  1NOH A;  1URQ A;  1L4A D;  4IFD K;  4KHX A;  2YMY A;  5APQ A;  2FKW B;  1RE4 C;  1LT9 B;  2LKM A;  1CSB A;  2OYI B;  1ZN5 A;  1SQV K;  2O1J A;  2IX7 C;  1N7S C;  3VMZ A;  1XTG B;  2ZFC A;  1L4A A;  1SQQ K;  1URQ C;  1SFC A;  1FJK A;  1FBM A;  2Z5I A;  3RK3 B;  1FZC B;  3OA7 A;  2P1J A;  1RE4 A;  1QL1 A;  3EQ2 A;  2BAS A;  5AVQ B;  1YYC A;  1NO4 A;  2OYH C;  1KIL A;  1X9V A;  2PAJ A;  1W2E A;  4LLH A;  1J1D C;  2R3C A;  2XKM A;  4C46 A;  5AW0 B;  1ZV8 A;  1RF0 A;  1N73 B;  5AVS B;  1A02 F;  2R5D A;  2W27 A;  3VYI A;  1SLQ A;  5KJ7 A;  1JCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...