4GKGA

Crystal structure of the s-helix linker
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
52
structure length
52
Chain Sequence
PRGSHMEERLARNALEASVEERTRDLRMARDRLETEIADHRQTTEKLQAVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C4-dicarboxylate transport sensor protein dctB
publication title Crystal structure of the S-Helix Linker
rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
total genus 22
structure length 52
sequence length 52
chains with identical sequence F
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4gkgA00
1GK6A 3KQGA 3M06A 1HUCA 3M0DA 3A5TA 1GU5A 1CI6A 2R3CA 1IO4A 2JJLA 3TYYA 5AW5B 1MFZA 1S9KE 2R32A 1X8YA 3VMXA 2XV5A 1T2KD 2YO2A 2N9BA 1KQLA 4HYTB 3SWFA 2WT7B 1YYCA 2XU6A 1CZQA 5APQA 1JUNA 1NWQA 3V4WA 3MD0A 3VN0A 2C9NY 1MUUA 5AVXB 2WT7A 5AVYB 3V4QA 3NFQA 1HJBA 3VMYA 1G2CB 3NMDA 3M0AA 5APVA 4KHXA 5APWA 3V5BA 5AW9B 3HE4B 3KDPB 2C9LY 3A7OA 3OAKA 1MV8A 3NTNA 3NXSA 2R5BA 2H7HA 3P32A 2Z5HA 3UIAA 2XZRA 5AVWB 1GU4A 1H89A 3LIDA 4AQRD 5AVRB 5AW8B 2WPQA 3B8EB 3O8ZA 3HE5B 2Q7CA 1H88A 2Q5UA 3LIEA 5AVTB 3TNUB 1HWTC 1A02J 1GD2E 5AW7B 5APYA 3M9BA 1S9KD 1JNMA 5AW1B 3MGNA 2ZFCA 4EOTA 3T97A 4C46A 1FAVA 2IPPA 2QM7A 1DH3A 2WPSA 1OWAA 1OXZA 3M9HA 1J2JB 5AVQB 3P7KA 3L36A 3L35A 4I6MC 4LC1A 5CMZA 3IR9A 3HE4A 2WTYA 5APTA 4JYBA 3VTPC 4JYCA 4AUWA 2QM8A 5AVVB 1GK4A 3M91A 4C7NB 2YO3A 2YNYA 1A02F 1GTWA 5APXA 2E42A 4C7NA 2Q3IA 5AVZB 5AVUB 1NAFA 4XE5B 2P7JA 4RESB 3HE5A 4GKGA 2ZXEB 5AW3B 3TNUA 2KP8A 3P8MC 4B86A 1CSBA 5AW0B 2P67A 2W6AA 3I5CA 2W27A 3TK1A 1FOSE 3VMZA 2WWWA 2VRSA 5AW6B 5APUA 4GT1A 4AYCA 4M3LA 3L37A 2Z5IA 1SLQA 3A3YB 1H8AA 1GZLA 1T2KC 5AW4B 5AVSB 4DZOA 1SP4A 2P2UA 2WPRA 3VYIA 3A2AA 5APSA 3HTKA 1HBWA 1FOSF 2R5DA 5AW2B 2BASA 2E43A 4I2LC 1CI6B
chains in the Genus database with same CATH superfamily
3Q2YA 4RO0A 1NTKK 2RH0A 2FYUK 2HFED 2ZXXA 2JR8A 3AE7C 2B88A 3L4FA 1MFZA 3KZIH 1KD1Q 2KLUA 3H1KG 3MD0A 2WVRA 4PD4I 3H1LE 1XTCC 2RKLA 1EXIA 2Y0EA 2LXBA 1NTKE 2FYUE 3LW5H 2BCCJ 1LP1A 2ZJSE 4GDOA 2HLOA 1BE3D 1WT6A 1EQ7A 3GLMA 5APYA 1PP9J 2E74C 2FXPA 1QVFO 1YIJP 3EFGA 3H1IJ 1RHZB 2GUVA 2ZYDA 5BU8B 2LKMA 5B66H 5CBOA 2KUBA 1M1JA 1SQBJ 2YMKA 1ZRTD 4WBAA 2D2CD 4K3AA 2KP8A 4B86A 4DT0A 2BEQD 2BCCG 2WSFH 1VQMP 2B9BA 4UB6E 4M3LA 1U57A 2OARA 3RK2D 3H32B 4JQ0D 1EZVI 1HBWA 3MZWB 4U3FD 3KQGA 2IBZE 3H1IG 2M5AB 1GU5A 1P84I 3R4YA 4EDFA 3L72J 3V2PA 1FC2C 2W6JH 4YXDC 2HG5D 1JY2N 1JY3N 2I8DA 4ASVA 1LTAC 1SQPJ 2WT7A 1JM0A 5AVYB 3H32A 3H1HJ 3Q5PA 2ZAEB 1EDJA 2Q9IA 1JY3O 4N78E 4DOJA 3F5HA 3RK3E 2R5BA 1BSHA 3CWBD 2M5AA 1TU3F 2WSSH 1VQ5P 5AW8B 1OFCX 5KJ7D 3PLNA 2QJYC 1S9KD 2D2CC 3MGNA 1SQQJ 3MUDC 1AQ5A 1NTMG 4NPEA 3L72G 4OGQD 3O6QA 3CCSP 2FXOA 1LT9B 1ZV8A 1NGMB 2Y0CA 1SQPG 2L91A 3RK2C 5AVZB 1YQ4C 4XE5B 2XKMA 3H1KE 2ZT9D 2KLVA 3GHGB 3D70A 1HH0A 1FZCB 3CXHD 2KB7P 4ZMDA 2N1TA 1YI2P 4YXWH 1NH4A 3M06A 2BCCD 1KYOI 2FYNB 2JKVA 1K04A 3GHGA 3PRJA 1ZP0C 4WY4A 1FZCA 3AE3C 3CCVP 4L73A 2Z4EA 1PP9D 3PP5A 2J5UA 3T97B 4NPFX 3S1KA 5KJ7C 2OYIC 3CXHE 2YKPA 3H1ID 3NMDA 5BU5A 3II6A 1DIPA 3GF7A 1YQ3C 5CCGD 4OGQC 2Q6QA 1SQBD 3A0HH 1LNQA 1X9VA 1A02J 1KORA 1IC2A 3V2QA 3T97A 1KV4A 1NTZJ 2ZT9C 2N9YB 5TISH 2J59M 2JO1A 4LC1A 3H1IE 1GL2B 1KN7A 2YNYA 5E79H 3SWYA 4BRYB 1AVOA 3P8CE 2QJPB 1HVVA 2L5GB 2W6AA 4ZKUA 3L72D 1KILE 1GW3A 2W27A 4LLHA 2O01N 2OYHA 2IZ1A 2MJZA 3L37A 1NTMK 4IFDK 2POHA 1SQPD 1GL2A 2P2UA 3A2AA 4ASWA 3H1HD 3HTKA 5AW2B 1NTZG 2PFXA 1SQPK 1FBMA 1RF0A 1VQ4P 1KB9H 2IZ0A 1IO4A 2QA4P 3JCUH 3SFDC 5H2FH 2N9BA 4IL6X 3B71A 5CCGC 1JEKA 1NTME 2HPCA 5L8RJ 1FZFA 2B87B 2JWAA 2OQQA 1HGVA 1RF1B 3NXSA 1OZHA 2H7HA 1SQVG 3C8VA 2K3RA 1LGHB 1NVOA 2ZYAA 4I7ZC 2A45G 1KILA 1PPJG 3PTZA 3IF4A 3AE4C 1YTZI 1LWUC 2B87A 2G3AA 3RL0D 4OVNF 1BCCJ 1ZOYC 2QJKB 5KAFE 1LTSC 2E42A 4PV1D 4GKGA 1DD4A 1J1DC 1J1EB 1VF5B 1YJNP 1L2PA 4XA4A 5DJTB 1Z56A 2NPSA 1JB0J 3H1JG 1Q81Q 1QLED 1EXJA 1PGQA 2IYPA 1P84E 1LTJB 1LTIC 3RL0g 2KOGA 1N73B 1VL2A 4H44B 1L4AD 3BCCJ 1VQ9P 4HYTB 1ZMEC 2XU6A 5KKZC 3G71P 1NTZD 1SFCB 1RE4C 2BEZF 1YHQP 1N7SA 1NTZK 2AXTH 3RL0C 3LW5J 4Y99C 4AQRD 1BE3G 2XNXA 2KK7A 5CJ4A 2FFDB 1AVYA 2O01H 4D6TE 4H0LD 5AW1B 4PV1C 2IPPA 2WSEH 3CXHI 3HD7B 1WMKA 2KS1B 1OXZA 1KMIZ 3M9HA 5KLIC 1SQVD 4EIJA 5CMZA 2K9JB 3CX5D 1GTWA 1SQVK 1YBKA 2YMYA 1PPJD 1HTLC 2PRRA 5B5EH 1Y8AA 1JTHB 2QSIA 3HD7A 3FX0A 1L4AC 1MFTA 1NU1J 1AJYA 2K9JA 1U7JA 1SQVE 1SVFA 1BGYJ 3I56P 1R5LA 5M1BA 3CX5E 1KYOE 4U3FG 2O1KA 2XDJA 4UB8E 1VPCA 3AEEC 1PPJE 2XV5A 2O1JA 1FZEA 1T2KD 1JTHA 3L73J 3G4SP 3HUSB 5AVXB 3NFQA 2YIUB 3L71J 3QH9A 4PJ0E 2W83C 4IL6E 4H0LC 1LP1B 3CWBG 1NU1G 1BCCD 2KXPB 3WU2E 5AVRB 3H25A 2Q7CA 3LIEA 2E5TA 1BGYG 3TGUE 1PIXA 1Q90D 3HUSA 3N4XA 3HRNA 3M0DC 3H1JE 1K05A 1IFNA 2C0WA 1M7LA 1M1JB 2E74B 2JP3A 4W7ZA 2Q3IA 3MP7B 3L71G 5GTIH 4IFMA 4H13D 3I5CA 2OTLP 3BCCD 3TK1A 1FOSE 3VMZA 1ZXGA 1VQNP 1T2KC 3OJAB 3AECC 4WWIA 5GTHH 1T6AA 1IFJA 1BE3E 1JY2P 1CI6A 1M8OB 1LTBC 4IFFA 2WZ7A 3CC2P 2PAJA 2WT7B 3WUTA 2B89A 1R5SA 2V7QJ 3CCEP 4WVZA 1PP9G 2P1JA 1Q86Q 2WITA 3B5ND 3V2RA 2Y0DA 3M0AA 2I1JA 1ZRTE 1OVUA 1EDIA 3FWLA 2XZRA 3R2PA 1SQBG 3MIWA 1Q2NA 5AW7B 1VQKP 2KSJA 1JNMA 3EQ2A 4EOTA 1H0TB 4H13C 1FZGA 1SQXJ 3IAOA 3O6QB 3AE6C 1LTTC 1XTGB 1NU1D 4U3FE 1S5LH 3TF5A 3CCJP 1BGYD 1JMMA 1NU1K 3MTUE 4OH8B 1PGJA 2FXMA 2ZXEB 5B66E 5BVZA 3G9RA 3CMAP 3JSVC 1H0TA 1OW8A 1Q7YQ 4N3YB 2NRGA 1OW7A 1W2BO 4AYCA 2N1TB 3FXEA 3RK2B 2YKQA 3KXDA 2ZVNB 3RK3B 3CWBE 3L71D 3H1HG 2HODA 3MUDA 1VQ7P 3B5NC 1FZBA 1HUCA 4OWFA 4WY4B 1ZR4A 1S9KE 1KZUB 2YO2A 3SWFA 1LT9C 2I1KA 3ABVC 3RBXA 1SQQG 3L75J 3AE2C 3TDKA 3CX5I 1S4XA 2A45I 1GMJA 1FZCC 2V7QH 3BRTB 1FJKA 1AV1A 1L0NJ 1K8AQ 4ZNCA 3A0BE 2KIKA 1S72P 1USDA 4I1LA 2GA1A 2PGDA 3V2NA 2OGUA 5TJHA 5KLVJ 1Q82Q 2BCCE 1L0LJ 2QG4A 5KJ7A 2OYIA 1SQBK 2ZT9B 3P8MC 1CSBA 4PD4H 1T3UA 4EYYQ 2R44A 1PP9E 2OYHB 1OVRA 2WWWA 3FXDA 1SLQA 2IFMA 4C7RA 5CCHD 3L74J 3HTKB 4HH2A 5APSA 1NAYA 3Q3DA 2E43A 1SQBE 1UIIA 3CPWO 2LXCB 3AE5C 5AW5B 3L70J 4WB4A 2IYOA 1PFIA 2HPCB 1L0LG 1URQD 2H43A 3V4WA 2XNDH 2AEMA 4JPZB 2QJPC 4PD4D 3HE4B 3NTNA 2GM4A 1KC8Q 3LIDA 3O8ZA 3L72E 1KILB 3TNUB 3Q1MA 1DD3A 1SQQD 4C46A 2O01J 2V4HA 2YXQB 3PHLA 1SQPE 1SQQK 2WSEJ 1J2JB 3H1HE 4RJTA 4GIFA 3HE4A 1NO4A 5APTA 4JYBA 1P84H 3OA7A 5CCGA 3BATA 5TISE 5CCHC 1A02F 2M0BA 4BWNA 4JBZA 1NAFA 1LWUB 3TNUA 1IK7A 3W67A 2JDIH 1IZNB 1X79B 3C1LA 5E79E 3FWNA 1KB9D 1SQQE 1GDTA 5AW6B 3H1LJ 1RF1C 3CLQA 2WSCJ 2NPSB 5AVSB 2IFNA 2WPVB 1MZ9A 5CJ0A 1URQC 3OW2O 1JOCA 1IFPA 1NTKJ 2FYUJ 3L75D 1K9MQ 4KJMA 2NZ2A 3D71A 2BASA 2UWJE 1SFCD 3KHUA 1LWUA 3FGAD 1OMIA 3RGUA 1FDMA 1L0ND 1YYCA 3M9QA 3WUVA 5H2FE 1N7SB 5APWA 1SS1A 1KQGB 4HKZH 2E76B 3IFMA 3P32A 1Y9BA 2CK3H 3VMAA 1J1EC 1VQ8P 1GU4A 1BCCG 1L0LD 2KZIA 1IJDB 1RH5B 2KYVA 1FZAA 5CBNA 1N7LA 1YJWP 1DEEG 2OTJP 3M9BA 1L0LK 3AE1C 1YJ9P 2WPSA 2RN0A 3RL0B 1VDFA 4Y99B 1LTJC 1NOHA 4I6MC 1N73C 4JYCA 1KYOH 3L74D 1NKZB 1W2EA 5KAIE 2KZJA 4C7NA 1L0LE 5KLIB 1RE4A 2E75D 1FJPA 1NJIQ 1SFCC 1OX3A 1D7MA 3BCCG 1NTZE 4IL6H 3ITKA 1E79H 1FOSF 2R5DA 4IOIH 2FFDC 3G6EP 2WSCH 1G1JA 3Q5SA 1WRGA 3D6YA 2C9NY 3U59A 3AEAC 3VP8A 3GG2A 2K1AA 4CPGA 1HJBA 3VMYA 5AW9B 2M8RA 3VOPA 3N7NA 1M1KQ 1HJ0A 1L4AA 2ZYGA 3RBZA 3H1KJ 3CMEP 1YTZT 2H88C 2P10A 4LGDE 2W90A 1RE3C 1VQOP 4GOEA 1FAVA 4R4MA 2E75C 1QX8A 2KNCA 5AVQB 3P7KA 3H1LD 3L36A 3W68A 1GK4A 3WMM0 4UB6H 5AW3B 2YIUC 2HYNA 2A06G 2M3BA 1OVVA 3L73G 1IK9A 4Y28J 1H8AA 1KTMA 4O9BA 5B5EE 1OIPA 1SP4A 1JMBA 1BCCE 1CI6B 3M0DA 3WUUA 4NPDA 1NKNA 2JJLA 3TYYA 1JO5A 1M1JC 1JUNA 1CZQA 2FY8A 3VN0A 1KQSO 3QWOC 3CCLP 1ZN5A 3SFEC 2GUSA 4KT0J 3PH0A 3CCMP 1JY3P 4KHXA 4N6JA 4L74A 3OAKA 2JWDA 4L76A 2Y9ZA 2Z5HA 1EDLA 2K88A 2FYZA 2IBZD 3B8EB 3CC7P 3HE5B 3BCCE 1KB9I 1UIXA 3MHVA 4HJGH 3KZIE 1YITP 2J58A 1BSNA 1S1CX 3SSUA 2G8YA 1KQFB 2N1TD 1M90Q 2YO3A 4N78D 3U1AA 3GMAA 5AVUB 3RK3D 5K5GB 3HE5A 4H13B 2AXCA 1N86A 4U7JA 1G1IA 1AA0A 1NTMJ 4YPCA 2QE7H 3S4RA 1E5WA 4WY4D 5APUA 5GTIE 1R8EA 1USEA 2OTKE 1NHLA 5AW4B 1QL1A 2QJYB 4DZOA 3GF3A 2D2CB 2AEFA 2HODB 2Y9YA 2P58A 3CCUP 1GK6A 1JY2O 1BDCA 3AE8C 2A06D 2O3JA 5GTHE 2R3CA 3KPEA 3A0BH 1X8YA 3VMXA 5C39A 3CXHH 3L73D 2QEXP 3G3ZA 1AFOA 3H1KD 1KQLA 3TSIA 3B5NB 1NU1E 1KFMA 1BGYE 1JCDA 2C9LY 1SQXG 3A7OA 1FS0E 2W6BA 5CHXA 2A06E 2N1TC 1N8RQ 1H88A 1HWTC 3L73E 1FE6A 1RY3A 3RK3C 1QL2A 1VQPP 1LTGC 2QRXA 3B5NA 2QM7A 1BDDA 1OWAA 1W5CE 3L71E 1QEXA 3GHGC 4WY4C 1KFNA 1GL2D 2OYIB 1QGKB 1LT9A 1U7MA 1VQLP 1S5LE 5AW0B 2P67A 4TT3H 4OGQB 2IDBA 2VRSA 4GT1A 2FYNC 3IN6A 3H6PA 1GZLA 3SWKA 1FDIA 3L75G 3Q5RA 2YKOA 3EWKA 4R4LA 3KYQA 1K73Q 1DX7A 1EZVG 3D6ZA 3P8CD 2OYOA 4A7PA 2AEJA 4D6TJ 2C0XA 1L0NG 2SPZA 2MKVA 1KILD 1MUUA 3V4QA 1RQVA 2IX7C 1G2CB 1PGOA 5APVA 3V5BA 1MV8A 2H89C 4BXLA 3E7KA 2OYHC 3UIAA 1GW4A 5KLVG 2WPQA 2Q5UA 2QVAA 1GL2C 3E1RA 2FBWC 3I55P 4EI2A 1PGPA 1RF0C 1NTMD 1SQXD 5KAFH 1G2CA 3BASA 5KTBA 1Y47A 1SQVJ 3IR9A 4D6TG 3VTPC 1SQXK 5AVVB 3USSA 2NPSD 3M91A 3L74G 1HGZA 5APXA 1ZW0A 4BRYA 2P7JA 4RESB 2Q1KA 3A0HE 1S2EA 3L70G 3CCRP 1T3JA 3JC22 1VF5D 4ZKPA 2PP6A 3A3YB 4PD4E 4I7ZB 1SQXE 2ZVOB 2KI7B 1JCCA 3BRVB 1N2DC 1KILC 4HB1A 3CL3D 1N7SD 5DJUB 3A5TA 2CPBA 2IBZI 1NYHA 2E76D 2R32A 3TGUJ 4H44D 1URQB 1PZQA 4YTPC 3PJSK 2K37A 5CCHA 3B4SA 1ZR2A 4W7YA 3H1JJ 4W80A 4L75A 3ZDMA 1J1DB 5KAIH 1ZLLA 1EZVD 3GW6A 1EC5A 1RF1A 5AVWB 3BVHA 3AEBC 1P84D 1IFDA 4JF7A 1URQA 1KB9E 2NPSC 1GD2E 2JEEA 3JCUE 2FKWB 2RMZA 3AE9C 1L0NK 2ZFCA 1PL5A 2QJKC 4DJGA 1DH3A 4DCKA 4K35A 1X0TA 3HD7D 3L75E 3TGUG 2LR2A 3L35A 3H1LG 2WTYA 2Q3EA 4TLFA 1VF5C 5KKZB 2QM8A 5KLVD 1BE3J 1MKMA 4C7NB 1EZVE 3F89A 1NTKG 2FYUG 1PV3A 5KLVK 3CI9A 4MN4C 1EDKA 1L0NE 3EFFK 1FDOA 4RKUJ 1N7SC 1T8ZA 5EFWB 4D6TD 1IFIA 2E76C 2WMMA 4H44C 3CX5H 1OW6A 3AEFC 2WPRA 2A45H 2H8PD 4PV1B 4UB8H 2CPSA 5KLVE 1VQ6P 1X22A 3U1CA 1LTJA 2R3SA 3L70D 1N73A 1DEBA 4PJ0H 2WQYC 4QMAA 5APQA 3CC4P 1NWQA 3CD6P 4GODA 3AEDC 2HR3A 2KSEA 2E5YA 3L74E 2DW3A 3WU2H 4U3FJ 1RQUA 2W8ZA 3KDPB 1SFCA 1FU1A 1L4AB 2K9YA 3HD7C 1H89A 2QIWA 1KYOD 2IBZG 3L70E 5AVTB 3AEGC 2YXRB 2FFDA 2M3EA 1S3JA 2KNCB 3V6IA 4Z1MH 2WSFJ 2KS1A 3CWBJ 1LJ2A 3CCQP 4AUWA 1QVGO 1LT1A 1M56D 3VP9A 2E74D 3K5BA 4H0LB 2AXTE 2E75B 2ITAA 1IFMA 1CW5A 1HF9A 3TGUD 1AQTA 3S9OA 3E1IA 2Z5IA 4GOFA 1S5LX 1M57D 4XFJA 3H1JD 3VYIA 1NTKD 2FYUD 3C9IA 1RE3A 3HUSC 4I2LC
chains in the Genus database with same CATH topology
1GK6A 1JY2O 1LTJB 1LTIC 1NTKK 2FYUK 2HFED 2KOGA 1N73B 2R3CA 3L4FA 5AW5B 3KPEA 1MFZA 1L4AD 4WB4A 1X8YA 3VMXA 1AFOA 3G3ZA 1PFIA 2HPCB 1KQLA 1URQD 4HYTB 2XU6A 2H43A 3V4WA 3MD0A 3TSIA 1XTCC 3B5NB 1KFMA 1SFCB 1RE4C 1JCDA 3HE4B 2C9LY 1N7SA 3A7OA 3LW5H 3NTNA 1NTZK 2GM4A 2W6BA 3RL0C 2HLOA 4Y99C 5CHXA 3LIDA 4AQRD 2XNXA 3O8ZA 2N1TC 1H88A 1WT6A 1KILB 5CJ4A 1HWTC 3TNUB 1EQ7A 2FFDB 5APYA 2O01H 5AW1B 1RY3A 3RK3C 1QL2A 4C46A 2IPPA 1LTGC 2WSEH 3B5NA 3HD7B 2QM7A 3EFGA 1OWAA 1OXZA 1SQQK 3M9HA 1J2JB 2GUVA 5BU8B 4GIFA 4EIJA 3GHGC 5CMZA 3HE4A 1NO4A 2LKMA 4JYBA 5APTA 4WY4C 1KFNA 5CCGA 3OA7A 1M1JA 1GL2D 2OYIB 3BATA 5CCHC 1A02F 1GTWA 1SQVK 1LT9A 4WBAA 1NAFA 2YMYA 1LWUB 3TNUA 2KP8A 4B86A 1HTLC 5AW0B 2P67A 1X79B 2WSFH 1JTHB 3HD7A 2VRSA 1GDTA 5AW6B 4GT1A 4M3LA 1L4AC 1RF1C 3CLQA 3H6PA 1GZLA 2OARA 2NPSB 5AVSB 2IFNA 1MZ9A 5CJ0A 3H32B 3RK2D 1URQC 1JOCA 1SVFA 1HBWA 2BASA 3KQGA 2YKOA 1SFCD 3KYQA 2O1KA 1GU5A 1LWUA 2XDJA 1DX7A 1VPCA 3P8CD 3V2PA 1FDMA 2XV5A 2O1JA 1FZEA 1T2KD 1JTHA 2HG5D 1JY2N 2C0XA 1JY3N 1YYCA 3HUSB 1KILD 1LTAC 1MUUA 3M9QA 5AVXB 2WT7A 5AVYB 3V4QA 3NFQA 3H32A 2IX7C 1G2CB 1N7SB 5APVA 2Q9IA 5APWA 3V5BA 1JY3O 4N78E 1MV8A 4DOJA 2R5BA 3IFMA 3P32A 2OYHC 3UIAA 1J1EC 1GU4A 5AVRB 1GW4A 5AW8B 2WPQA 1IJDB 2Q7CA 5KJ7D 2KYVA 2Q5UA 1FZAA 3LIEA 1N7LA 1GL2C 3M9BA 1S9KD 1L0LK 3HUSA 3MGNA 3N4XA 3HRNA 1AQ5A 1RF0C 3M0DC 2WPSA 3RL0B 1VDFA 1G2CA 4Y99B 1LTJC 1IFNA 1NOHA 2C0WA 3BASA 1M7LA 4I6MC 1N73C 5KTBA 3IR9A 1M1JB 3VTPC 4JYCA 1SQXK 1LT9B 1ZV8A 5AVVB 2NPSD 3M91A 1NKZB 4W7ZA 1HGZA 5APXA 1W2EA 3RK2C 4C7NA 2Q3IA 5AVZB 4XE5B 2P7JA 4RESB 2XKMA 4IFMA 1RE4A 2KLVA 1FJPA 3GHGB 3I5CA 1SFCC 1HH0A 3TK1A 1FZCB 1FOSE 3VMZA 1T3JA 4ZKPA 2PP6A 3A3YB 2KB7P 1T2KC 3OJAB 2N1TA 1JCCA 1NH4A 3BRVB 1N2DC 1IFJA 1KILC 1FOSF 2R5DA 2FFDC 1JY2P 3CL3D 3M06A 1N7SD 3A5TA 2CPBA 1CI6A 1LTBC 4IFFA 2WZ7A 2R32A 2WSCH 1G1JA 3GHGA 1URQB 4WY4A 1FZCA 2PAJA 1WRGA 2WT7B 5CCHA 2Z4EA 1ZR2A 3PP5A 2C9NY 4W7YA 2P1JA 5KJ7C 3U59A 3VP8A 2OYIC 4W80A 2WITA 2YKPA 3B5ND 1HJBA 1J1DB 3VMYA 3V2RA 3NMDA 3M0AA 5BU5A 2I1JA 5AW9B 2M8RA 3II6A 1ZLLA 3VOPA 3N7NA 5CCGD 1RF1A 1L4AA 2XZRA 5AVWB 3R2PA 3BVHA 1IFDA 3MIWA 4JF7A 1URQA 1X9VA 1YTZT 2NPSC 1A02J 1GD2E 5AW7B 2KSJA 2JEEA 4LGDE 1JNMA 2FKWB 1IC2A 1RE3C 3EQ2A 3V2QA 1L0NK 2ZFCA 4EOTA 3T97A 1FAVA 1DH3A 1FZGA 3HD7D 5AVQB 3P7KA 3L36A 3L35A 2J59M 1LTTC 4LC1A 1XTGB 2WTYA 1GL2B 2QM8A 1GK4A 4C7NB 2YNYA 3SWYA 1JMMA 1NU1K 3P8CE 3WMM0 3MTUE 4OH8B 5KLVK 2FXMA 3CI9A 2ZXEB 1HVVA 5AW3B 5BVZA 2L5GB 2HYNA 2M3BA 2W6AA 4ZKUA 4LLHA 1GW3A 1N7SC 2W27A 1T8ZA 4N3YB 2OYHA 2MJZA 1IFIA 4AYCA 1IK9A 3L37A 1NTMK 2N1TB 1H8AA 3RK2B 4IFDK 2YKQA 4O9BA 2POHA 1SP4A 1GL2A 2A45H 2P2UA 2WPRA 2H8PD 3A2AA 3RK3B 3HTKA 2CPSA 5AW2B 2HODA 1CI6B 1SQPK 3MUDA 1FBMA 1RF0A 3B5NC 1FZBA 1HUCA 3M0DA 3U1CA 1IO4A 1NKNA 2JJLA 1LTJA 3TYYA 4WY4B 1ZR4A 1S9KE 1N73A 1JO5A 1DEBA 1KZUB 2YO2A 2N9BA 5CCGC 3SWFA 1M1JC 2HPCA 5APQA 1JUNA 1CZQA 1NWQA 3VN0A 1LT9C 2I1KA 1ZN5A 1FZFA 2GUSA 1JY3P 4KHXA 4N6JA 3KDPB 1SFCA 1FU1A 3OAKA 1HGVA 1RF1B 1L4AB 3NXSA 3HD7C 2H7HA 2Z5HA 2A45I 1FZCC 2FYZA 1H89A 3BRTB 1FJKA 3B8EB 1LGHB 3HE5B 5AVTB 2A45G 1KILA 2FFDA 2J58A 4I1LA 1YTZI 1LWUC 3RL0D 3V2NA 2N1TD 4AUWA 2YO3A 3VP9A 4N78D 3U1AA 1LTSC 2E42A 5KJ7A 5AVUB 3RK3D 2OYIA 3HE5A 1SQBK 4GKGA 3P8MC 1CSBA 1N86A 1T3UA 1IFMA 1J1DC 1G1IA 2OYHB 1CW5A 1J1EB 2WWWA 1E5WA 4WY4D 5APUA 3E1IA 2Z5IA 4XA4A 1SLQA 1NHLA 2IFMA 4C7RA 5AW4B 1QL1A 5CCHD 4DZOA 1Z56A 2NPSA 3HTKB 4HH2A 3VYIA 5APSA 2HODB 3C9IA 1RE3A 3HUSC 2E43A 4I2LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK6 A;  3KQG A;  3M06 A;  1HUC A;  3M0D A;  3A5T A;  1GU5 A;  1CI6 A;  2R3C A;  1IO4 A;  2JJL A;  3TYY A;  5AW5 B;  1MFZ A;  1S9K E;  2R32 A;  1X8Y A;  3VMX A;  2XV5 A;  1T2K D;  2YO2 A;  2N9B A;  1KQL A;  4HYT B;  3SWF A;  2WT7 B;  1YYC A;  2XU6 A;  1CZQ A;  5APQ A;  1JUN A;  1NWQ A;  3V4W A;  3MD0 A;  3VN0 A;  2C9N Y;  1MUU A;  5AVX B;  2WT7 A;  5AVY B;  3V4Q A;  3NFQ A;  1HJB A;  3VMY A;  1G2C B;  3NMD A;  3M0A A;  5APV A;  4KHX A;  5APW A;  3V5B A;  5AW9 B;  3HE4 B;  3KDP B;  2C9L Y;  3A7O A;  3OAK A;  1MV8 A;  3NTN A;  3NXS A;  2R5B A;  2H7H A;  3P32 A;  2Z5H A;  3UIA A;  2XZR A;  5AVW B;  1GU4 A;  1H89 A;  3LID A;  4AQR D;  5AVR B;  5AW8 B;  2WPQ A;  3B8E B;  3O8Z A;  3HE5 B;  2Q7C A;  1H88 A;  2Q5U A;  3LIE A;  5AVT B;  3TNU B;  1HWT C;  1A02 J;  1GD2 E;  5AW7 B;  5APY A;  3M9B A;  1S9K D;  1JNM A;  5AW1 B;  3MGN A;  2ZFC A;  4EOT A;  3T97 A;  4C46 A;  1FAV A;  2IPP A;  2QM7 A;  1DH3 A;  2WPS A;  1OWA A;  1OXZ A;  3M9H A;  1J2J B;  5AVQ B;  3P7K A;  3L36 A;  3L35 A;  4I6M C;  4LC1 A;  5CMZ A;  3IR9 A;  3HE4 A;  2WTY A;  5APT A;  4JYB A;  3VTP C;  4JYC A;  4AUW A;  2QM8 A;  5AVV B;  1GK4 A;  3M91 A;  4C7N B;  2YO3 A;  2YNY A;  1A02 F;  1GTW A;  5APX A;  2E42 A;  4C7N A;  2Q3I A;  5AVZ B;  5AVU B;  1NAF A;  4XE5 B;  2P7J A;  4RES B;  3HE5 A;  4GKG A;  2ZXE B;  5AW3 B;  3TNU A;  2KP8 A;  3P8M C;  4B86 A;  1CSB A;  5AW0 B;  2P67 A;  2W6A A;  3I5C A;  2W27 A;  3TK1 A;  1FOS E;  3VMZ A;  2WWW A;  2VRS A;  5AW6 B;  5APU A;  4GT1 A;  4AYC A;  4M3L A;  3L37 A;  2Z5I A;  1SLQ A;  3A3Y B;  1H8A A;  1GZL A;  1T2K C;  5AW4 B;  5AVS B;  4DZO A;  1SP4 A;  2P2U A;  2WPR A;  3VYI A;  3A2A A;  5APS A;  3HTK A;  1HBW A;  1FOS F;  2R5D A;  5AW2 B;  2BAS A;  2E43 A;  4I2L C;  1CI6 B; 
#chains in the Genus database with same CATH topology
 3Q2Y A;  4RO0 A;  1NTK K;  2RH0 A;  2FYU K;  2HFE D;  2ZXX A;  2JR8 A;  3AE7 C;  2B88 A;  3L4F A;  1MFZ A;  3KZI H;  1KD1 Q;  2KLU A;  3H1K G;  3MD0 A;  2WVR A;  4PD4 I;  3H1L E;  1XTC C;  2RKL A;  1EXI A;  2Y0E A;  2LXB A;  1NTK E;  2FYU E;  3LW5 H;  2BCC J;  1LP1 A;  2ZJS E;  4GDO A;  2HLO A;  1BE3 D;  1WT6 A;  1EQ7 A;  3GLM A;  5APY A;  1PP9 J;  2E74 C;  2FXP A;  1QVF O;  1YIJ P;  3EFG A;  3H1I J;  1RHZ B;  2GUV A;  2ZYD A;  5BU8 B;  2LKM A;  5B66 H;  5CBO A;  2KUB A;  1M1J A;  1SQB J;  2YMK A;  1ZRT D;  4WBA A;  2D2C D;  4K3A A;  2KP8 A;  4B86 A;  4DT0 A;  2BEQ D;  2BCC G;  2WSF H;  1VQM P;  2B9B A;  4UB6 E;  4M3L A;  1U57 A;  2OAR A;  3RK2 D;  3H32 B;  4JQ0 D;  1EZV I;  1HBW A;  3MZW B;  4U3F D;  3KQG A;  2IBZ E;  3H1I G;  2M5A B;  1GU5 A;  1P84 I;  3R4Y A;  4EDF A;  3L72 J;  3V2P A;  1FC2 C;  2W6J H;  4YXD C;  2HG5 D;  1JY2 N;  1JY3 N;  2I8D A;  4ASV A;  1LTA C;  1SQP J;  2WT7 A;  1JM0 A;  5AVY B;  3H32 A;  3H1H J;  3Q5P A;  2ZAE B;  1EDJ A;  2Q9I A;  1JY3 O;  4N78 E;  4DOJ A;  3F5H A;  3RK3 E;  2R5B A;  1BSH A;  3CWB D;  2M5A A;  1TU3 F;  2WSS H;  1VQ5 P;  5AW8 B;  1OFC X;  5KJ7 D;  3PLN A;  2QJY C;  1S9K D;  2D2C C;  3MGN A;  1SQQ J;  3MUD C;  1AQ5 A;  1NTM G;  4NPE A;  3L72 G;  4OGQ D;  3O6Q A;  3CCS P;  2FXO A;  1LT9 B;  1ZV8 A;  1NGM B;  2Y0C A;  1SQP G;  2L91 A;  3RK2 C;  5AVZ B;  1YQ4 C;  4XE5 B;  2XKM A;  3H1K E;  2ZT9 D;  2KLV A;  3GHG B;  3D70 A;  1HH0 A;  1FZC B;  3CXH D;  2KB7 P;  4ZMD A;  2N1T A;  1YI2 P;  4YXW H;  1NH4 A;  3M06 A;  2BCC D;  1KYO I;  2FYN B;  2JKV A;  1K04 A;  3GHG A;  3PRJ A;  1ZP0 C;  4WY4 A;  1FZC A;  3AE3 C;  3CCV P;  4L73 A;  2Z4E A;  1PP9 D;  3PP5 A;  2J5U A;  3T97 B;  4NPF X;  3S1K A;  5KJ7 C;  2OYI C;  3CXH E;  2YKP A;  3H1I D;  3NMD A;  5BU5 A;  3II6 A;  1DIP A;  3GF7 A;  1YQ3 C;  5CCG D;  4OGQ C;  2Q6Q A;  1SQB D;  3A0H H;  1LNQ A;  1X9V A;  1A02 J;  1KOR A;  1IC2 A;  3V2Q A;  3T97 A;  1KV4 A;  1NTZ J;  2ZT9 C;  2N9Y B;  5TIS H;  2J59 M;  2JO1 A;  4LC1 A;  3H1I E;  1GL2 B;  1KN7 A;  2YNY A;  5E79 H;  3SWY A;  4BRY B;  1AVO A;  3P8C E;  2QJP B;  1HVV A;  2L5G B;  2W6A A;  4ZKU A;  3L72 D;  1KIL E;  1GW3 A;  2W27 A;  4LLH A;  2O01 N;  2OYH A;  2IZ1 A;  2MJZ A;  3L37 A;  1NTM K;  4IFD K;  2POH A;  1SQP D;  1GL2 A;  2P2U A;  3A2A A;  4ASW A;  3H1H D;  3HTK A;  5AW2 B;  1NTZ G;  2PFX A;  1SQP K;  1FBM A;  1RF0 A;  1VQ4 P;  1KB9 H;  2IZ0 A;  1IO4 A;  2QA4 P;  3JCU H;  3SFD C;  5H2F H;  2N9B A;  4IL6 X;  3B71 A;  5CCG C;  1JEK A;  1NTM E;  2HPC A;  5L8R J;  1FZF A;  2B87 B;  2JWA A;  2OQQ A;  1HGV A;  1RF1 B;  3NXS A;  1OZH A;  2H7H A;  1SQV G;  3C8V A;  2K3R A;  1LGH B;  1NVO A;  2ZYA A;  4I7Z C;  2A45 G;  1KIL A;  1PPJ G;  3PTZ A;  3IF4 A;  3AE4 C;  1YTZ I;  1LWU C;  2B87 A;  2G3A A;  3RL0 D;  4OVN F;  1BCC J;  1ZOY C;  2QJK B;  5KAF E;  1LTS C;  2E42 A;  4PV1 D;  4GKG A;  1DD4 A;  1J1D C;  1J1E B;  1VF5 B;  1YJN P;  1L2P A;  4XA4 A;  5DJT B;  1Z56 A;  2NPS A;  1JB0 J;  3H1J G;  1Q81 Q;  1QLE D;  1EXJ A;  1PGQ A;  2IYP A;  1P84 E;  1LTJ B;  1LTI C;  3RL0 g;  2KOG A;  1N73 B;  1VL2 A;  4H44 B;  1L4A D;  3BCC J;  1VQ9 P;  4HYT B;  1ZME C;  2XU6 A;  5KKZ C;  3G71 P;  1NTZ D;  1SFC B;  1RE4 C;  2BEZ F;  1YHQ P;  1N7S A;  1NTZ K;  2AXT H;  3RL0 C;  3LW5 J;  4Y99 C;  4AQR D;  1BE3 G;  2XNX A;  2KK7 A;  5CJ4 A;  2FFD B;  1AVY A;  2O01 H;  4D6T E;  4H0L D;  5AW1 B;  4PV1 C;  2IPP A;  2WSE H;  3CXH I;  3HD7 B;  1WMK A;  2KS1 B;  1OXZ A;  1KMI Z;  3M9H A;  5KLI C;  1SQV D;  4EIJ A;  5CMZ A;  2K9J B;  3CX5 D;  1GTW A;  1SQV K;  1YBK A;  2YMY A;  1PPJ D;  1HTL C;  2PRR A;  5B5E H;  1Y8A A;  1JTH B;  2QSI A;  3HD7 A;  3FX0 A;  1L4A C;  1MFT A;  1NU1 J;  1AJY A;  2K9J A;  1U7J A;  1SQV E;  1SVF A;  1BGY J;  3I56 P;  1R5L A;  5M1B A;  3CX5 E;  1KYO E;  4U3F G;  2O1K A;  2XDJ A;  4UB8 E;  1VPC A;  3AEE C;  1PPJ E;  2XV5 A;  2O1J A;  1FZE A;  1T2K D;  1JTH A;  3L73 J;  3G4S P;  3HUS B;  5AVX B;  3NFQ A;  2YIU B;  3L71 J;  3QH9 A;  4PJ0 E;  2W83 C;  4IL6 E;  4H0L C;  1LP1 B;  3CWB G;  1NU1 G;  1BCC D;  2KXP B;  3WU2 E;  5AVR B;  3H25 A;  2Q7C A;  3LIE A;  2E5T A;  1BGY G;  3TGU E;  1PIX A;  1Q90 D;  3HUS A;  3N4X A;  3HRN A;  3M0D C;  3H1J E;  1K05 A;  1IFN A;  2C0W A;  1M7L A;  1M1J B;  2E74 B;  2JP3 A;  4W7Z A;  2Q3I A;  3MP7 B;  3L71 G;  5GTI H;  4IFM A;  4H13 D;  3I5C A;  2OTL P;  3BCC D;  3TK1 A;  1FOS E;  3VMZ A;  1ZXG A;  1VQN P;  1T2K C;  3OJA B;  3AEC C;  4WWI A;  5GTH H;  1T6A A;  1IFJ A;  1BE3 E;  1JY2 P;  1CI6 A;  1M8O B;  1LTB C;  4IFF A;  2WZ7 A;  3CC2 P;  2PAJ A;  2WT7 B;  3WUT A;  2B89 A;  1R5S A;  2V7Q J;  3CCE P;  4WVZ A;  1PP9 G;  2P1J A;  1Q86 Q;  2WIT A;  3B5N D;  3V2R A;  2Y0D A;  3M0A A;  2I1J A;  1ZRT E;  1OVU A;  1EDI A;  3FWL A;  2XZR A;  3R2P A;  1SQB G;  3MIW A;  1Q2N A;  5AW7 B;  1VQK P;  2KSJ A;  1JNM A;  3EQ2 A;  4EOT A;  1H0T B;  4H13 C;  1FZG A;  1SQX J;  3IAO A;  3O6Q B;  3AE6 C;  1LTT C;  1XTG B;  1NU1 D;  4U3F E;  1S5L H;  3TF5 A;  3CCJ P;  1BGY D;  1JMM A;  1NU1 K;  3MTU E;  4OH8 B;  1PGJ A;  2FXM A;  2ZXE B;  5B66 E;  5BVZ A;  3G9R A;  3CMA P;  3JSV C;  1H0T A;  1OW8 A;  1Q7Y Q;  4N3Y B;  2NRG A;  1OW7 A;  1W2B O;  4AYC A;  2N1T B;  3FXE A;  3RK2 B;  2YKQ A;  3KXD A;  2ZVN B;  3RK3 B;  3CWB E;  3L71 D;  3H1H G;  2HOD A;  3MUD A;  1VQ7 P;  3B5N C;  1FZB A;  1HUC A;  4OWF A;  4WY4 B;  1ZR4 A;  1S9K E;  1KZU B;  2YO2 A;  3SWF A;  1LT9 C;  2I1K A;  3ABV C;  3RBX A;  1SQQ G;  3L75 J;  3AE2 C;  3TDK A;  3CX5 I;  1S4X A;  2A45 I;  1GMJ A;  1FZC C;  2V7Q H;  3BRT B;  1FJK A;  1AV1 A;  1L0N J;  1K8A Q;  4ZNC A;  3A0B E;  2KIK A;  1S72 P;  1USD A;  4I1L A;  2GA1 A;  2PGD A;  3V2N A;  2OGU A;  5TJH A;  5KLV J;  1Q82 Q;  2BCC E;  1L0L J;  2QG4 A;  5KJ7 A;  2OYI A;  1SQB K;  2ZT9 B;  3P8M C;  1CSB A;  4PD4 H;  1T3U A;  4EYY Q;  2R44 A;  1PP9 E;  2OYH B;  1OVR A;  2WWW A;  3FXD A;  1SLQ A;  2IFM A;  4C7R A;  5CCH D;  3L74 J;  3HTK B;  4HH2 A;  5APS A;  1NAY A;  3Q3D A;  2E43 A;  1SQB E;  1UII A;  3CPW O;  2LXC B;  3AE5 C;  5AW5 B;  3L70 J;  4WB4 A;  2IYO A;  1PFI A;  2HPC B;  1L0L G;  1URQ D;  2H43 A;  3V4W A;  2XND H;  2AEM A;  4JPZ B;  2QJP C;  4PD4 D;  3HE4 B;  3NTN A;  2GM4 A;  1KC8 Q;  3LID A;  3O8Z A;  3L72 E;  1KIL B;  3TNU B;  3Q1M A;  1DD3 A;  1SQQ D;  4C46 A;  2O01 J;  2V4H A;  2YXQ B;  3PHL A;  1SQP E;  1SQQ K;  2WSE J;  1J2J B;  3H1H E;  4RJT A;  4GIF A;  3HE4 A;  1NO4 A;  5APT A;  4JYB A;  1P84 H;  3OA7 A;  5CCG A;  3BAT A;  5TIS E;  5CCH C;  1A02 F;  2M0B A;  4BWN A;  4JBZ A;  1NAF A;  1LWU B;  3TNU A;  1IK7 A;  3W67 A;  2JDI H;  1IZN B;  1X79 B;  3C1L A;  5E79 E;  3FWN A;  1KB9 D;  1SQQ E;  1GDT A;  5AW6 B;  3H1L J;  1RF1 C;  3CLQ A;  2WSC J;  2NPS B;  5AVS B;  2IFN A;  2WPV B;  1MZ9 A;  5CJ0 A;  1URQ C;  3OW2 O;  1JOC A;  1IFP A;  1NTK J;  2FYU J;  3L75 D;  1K9M Q;  4KJM A;  2NZ2 A;  3D71 A;  2BAS A;  2UWJ E;  1SFC D;  3KHU A;  1LWU A;  3FGA D;  1OMI A;  3RGU A;  1FDM A;  1L0N D;  1YYC A;  3M9Q A;  3WUV A;  5H2F E;  1N7S B;  5APW A;  1SS1 A;  1KQG B;  4HKZ H;  2E76 B;  3IFM A;  3P32 A;  1Y9B A;  2CK3 H;  3VMA A;  1J1E C;  1VQ8 P;  1GU4 A;  1BCC G;  1L0L D;  2KZI A;  1IJD B;  1RH5 B;  2KYV A;  1FZA A;  5CBN A;  1N7L A;  1YJW P;  1DEE G;  2OTJ P;  3M9B A;  1L0L K;  3AE1 C;  1YJ9 P;  2WPS A;  2RN0 A;  3RL0 B;  1VDF A;  4Y99 B;  1LTJ C;  1NOH A;  4I6M C;  1N73 C;  4JYC A;  1KYO H;  3L74 D;  1NKZ B;  1W2E A;  5KAI E;  2KZJ A;  4C7N A;  1L0L E;  5KLI B;  1RE4 A;  2E75 D;  1FJP A;  1NJI Q;  1SFC C;  1OX3 A;  1D7M A;  3BCC G;  1NTZ E;  4IL6 H;  3ITK A;  1E79 H;  1FOS F;  2R5D A;  4IOI H;  2FFD C;  3G6E P;  2WSC H;  1G1J A;  3Q5S A;  1WRG A;  3D6Y A;  2C9N Y;  3U59 A;  3AEA C;  3VP8 A;  3GG2 A;  2K1A A;  4CPG A;  1HJB A;  3VMY A;  5AW9 B;  2M8R A;  3VOP A;  3N7N A;  1M1K Q;  1HJ0 A;  1L4A A;  2ZYG A;  3RBZ A;  3H1K J;  3CME P;  1YTZ T;  2H88 C;  2P10 A;  4LGD E;  2W90 A;  1RE3 C;  1VQO P;  4GOE A;  1FAV A;  4R4M A;  2E75 C;  1QX8 A;  2KNC A;  5AVQ B;  3P7K A;  3H1L D;  3L36 A;  3W68 A;  1GK4 A;  3WMM 0;  4UB6 H;  5AW3 B;  2YIU C;  2HYN A;  2A06 G;  2M3B A;  1OVV A;  3L73 G;  1IK9 A;  4Y28 J;  1H8A A;  1KTM A;  4O9B A;  5B5E E;  1OIP A;  1SP4 A;  1JMB A;  1BCC E;  1CI6 B;  3M0D A;  3WUU A;  4NPD A;  1NKN A;  2JJL A;  3TYY A;  1JO5 A;  1M1J C;  1JUN A;  1CZQ A;  2FY8 A;  3VN0 A;  1KQS O;  3QWO C;  3CCL P;  1ZN5 A;  3SFE C;  2GUS A;  4KT0 J;  3PH0 A;  3CCM P;  1JY3 P;  4KHX A;  4N6J A;  4L74 A;  3OAK A;  2JWD A;  4L76 A;  2Y9Z A;  2Z5H A;  1EDL A;  2K88 A;  2FYZ A;  2IBZ D;  3B8E B;  3CC7 P;  3HE5 B;  3BCC E;  1KB9 I;  1UIX A;  3MHV A;  4HJG H;  3KZI E;  1YIT P;  2J58 A;  1BSN A;  1S1C X;  3SSU A;  2G8Y A;  1KQF B;  2N1T D;  1M90 Q;  2YO3 A;  4N78 D;  3U1A A;  3GMA A;  5AVU B;  3RK3 D;  5K5G B;  3HE5 A;  4H13 B;  2AXC A;  1N86 A;  4U7J A;  1G1I A;  1AA0 A;  1NTM J;  4YPC A;  2QE7 H;  3S4R A;  1E5W A;  4WY4 D;  5APU A;  5GTI E;  1R8E A;  1USE A;  2OTK E;  1NHL A;  5AW4 B;  1QL1 A;  2QJY B;  4DZO A;  3GF3 A;  2D2C B;  2AEF A;  2HOD B;  2Y9Y A;  2P58 A;  3CCU P;  1GK6 A;  1JY2 O;  1BDC A;  3AE8 C;  2A06 D;  2O3J A;  5GTH E;  2R3C A;  3KPE A;  3A0B H;  1X8Y A;  3VMX A;  5C39 A;  3CXH H;  3L73 D;  2QEX P;  3G3Z A;  1AFO A;  3H1K D;  1KQL A;  3TSI A;  3B5N B;  1NU1 E;  1KFM A;  1BGY E;  1JCD A;  2C9L Y;  1SQX G;  3A7O A;  1FS0 E;  2W6B A;  5CHX A;  2A06 E;  2N1T C;  1N8R Q;  1H88 A;  1HWT C;  3L73 E;  1FE6 A;  1RY3 A;  3RK3 C;  1QL2 A;  1VQP P;  1LTG C;  2QRX A;  3B5N A;  2QM7 A;  1BDD A;  1OWA A;  1W5C E;  3L71 E;  1QEX A;  3GHG C;  4WY4 C;  1KFN A;  1GL2 D;  2OYI B;  1QGK B;  1LT9 A;  1U7M A;  1VQL P;  1S5L E;  5AW0 B;  2P67 A;  4TT3 H;  4OGQ B;  2IDB A;  2VRS A;  4GT1 A;  2FYN C;  3IN6 A;  3H6P A;  1GZL A;  3SWK A;  1FDI A;  3L75 G;  3Q5R A;  2YKO A;  3EWK A;  4R4L A;  3KYQ A;  1K73 Q;  1DX7 A;  1EZV G;  3D6Z A;  3P8C D;  2OYO A;  4A7P A;  2AEJ A;  4D6T J;  2C0X A;  1L0N G;  2SPZ A;  2MKV A;  1KIL D;  1MUU A;  3V4Q A;  1RQV A;  2IX7 C;  1G2C B;  1PGO A;  5APV A;  3V5B A;  1MV8 A;  2H89 C;  4BXL A;  3E7K A;  2OYH C;  3UIA A;  1GW4 A;  5KLV G;  2WPQ A;  2Q5U A;  2QVA A;  1GL2 C;  3E1R A;  2FBW C;  3I55 P;  4EI2 A;  1PGP A;  1RF0 C;  1NTM D;  1SQX D;  5KAF H;  1G2C A;  3BAS A;  5KTB A;  1Y47 A;  1SQV J;  3IR9 A;  4D6T G;  3VTP C;  1SQX K;  5AVV B;  3USS A;  2NPS D;  3M91 A;  3L74 G;  1HGZ A;  5APX A;  1ZW0 A;  4BRY A;  2P7J A;  4RES B;  2Q1K A;  3A0H E;  1S2E A;  3L70 G;  3CCR P;  1T3J A;  3JC2 2;  1VF5 D;  4ZKP A;  2PP6 A;  3A3Y B;  4PD4 E;  4I7Z B;  1SQX E;  2ZVO B;  2KI7 B;  1JCC A;  3BRV B;  1N2D C;  1KIL C;  4HB1 A;  3CL3 D;  1N7S D;  5DJU B;  3A5T A;  2CPB A;  2IBZ I;  1NYH A;  2E76 D;  2R32 A;  3TGU J;  4H44 D;  1URQ B;  1PZQ A;  4YTP C;  3PJS K;  2K37 A;  5CCH A;  3B4S A;  1ZR2 A;  4W7Y A;  3H1J J;  4W80 A;  4L75 A;  3ZDM A;  1J1D B;  5KAI H;  1ZLL A;  1EZV D;  3GW6 A;  1EC5 A;  1RF1 A;  5AVW B;  3BVH A;  3AEB C;  1P84 D;  1IFD A;  4JF7 A;  1URQ A;  1KB9 E;  2NPS C;  1GD2 E;  2JEE A;  3JCU E;  2FKW B;  2RMZ A;  3AE9 C;  1L0N K;  2ZFC A;  1PL5 A;  2QJK C;  4DJG A;  1DH3 A;  4DCK A;  4K35 A;  1X0T A;  3HD7 D;  3L75 E;  3TGU G;  2LR2 A;  3L35 A;  3H1L G;  2WTY A;  2Q3E A;  4TLF A;  1VF5 C;  5KKZ B;  2QM8 A;  5KLV D;  1BE3 J;  1MKM A;  4C7N B;  1EZV E;  3F89 A;  1NTK G;  2FYU G;  1PV3 A;  5KLV K;  3CI9 A;  4MN4 C;  1EDK A;  1L0N E;  3EFF K;  1FDO A;  4RKU J;  1N7S C;  1T8Z A;  5EFW B;  4D6T D;  1IFI A;  2E76 C;  2WMM A;  4H44 C;  3CX5 H;  1OW6 A;  3AEF C;  2WPR A;  2A45 H;  2H8P D;  4PV1 B;  4UB8 H;  2CPS A;  5KLV E;  1VQ6 P;  1X22 A;  3U1C A;  1LTJ A;  2R3S A;  3L70 D;  1N73 A;  1DEB A;  4PJ0 H;  2WQY C;  4QMA A;  5APQ A;  3CC4 P;  1NWQ A;  3CD6 P;  4GOD A;  3AED C;  2HR3 A;  2KSE A;  2E5Y A;  3L74 E;  2DW3 A;  3WU2 H;  4U3F J;  1RQU A;  2W8Z A;  3KDP B;  1SFC A;  1FU1 A;  1L4A B;  2K9Y A;  3HD7 C;  1H89 A;  2QIW A;  1KYO D;  2IBZ G;  3L70 E;  5AVT B;  3AEG C;  2YXR B;  2FFD A;  2M3E A;  1S3J A;  2KNC B;  3V6I A;  4Z1M H;  2WSF J;  2KS1 A;  3CWB J;  1LJ2 A;  3CCQ P;  4AUW A;  1QVG O;  1LT1 A;  1M56 D;  3VP9 A;  2E74 D;  3K5B A;  4H0L B;  2AXT E;  2E75 B;  2ITA A;  1IFM A;  1CW5 A;  1HF9 A;  3TGU D;  1AQT A;  3S9O A;  3E1I A;  2Z5I A;  4GOF A;  1S5L X;  1M57 D;  4XFJ A;  3H1J D;  3VYI A;  1NTK D;  2FYU D;  3C9I A;  1RE3 A;  3HUS C;  4I2L C; 
#chains in the Genus database with same CATH homology
 1GK6 A;  1JY2 O;  1LTJ B;  1LTI C;  1NTK K;  2FYU K;  2HFE D;  2KOG A;  1N73 B;  2R3C A;  3L4F A;  5AW5 B;  3KPE A;  1MFZ A;  1L4A D;  4WB4 A;  1X8Y A;  3VMX A;  1AFO A;  3G3Z A;  1PFI A;  2HPC B;  1KQL A;  1URQ D;  4HYT B;  2XU6 A;  2H43 A;  3V4W A;  3MD0 A;  3TSI A;  1XTC C;  3B5N B;  1KFM A;  1SFC B;  1RE4 C;  1JCD A;  3HE4 B;  2C9L Y;  1N7S A;  3A7O A;  3LW5 H;  3NTN A;  1NTZ K;  2GM4 A;  2W6B A;  3RL0 C;  2HLO A;  4Y99 C;  5CHX A;  3LID A;  4AQR D;  2XNX A;  3O8Z A;  2N1T C;  1H88 A;  1WT6 A;  1KIL B;  5CJ4 A;  1HWT C;  3TNU B;  1EQ7 A;  2FFD B;  5APY A;  2O01 H;  5AW1 B;  1RY3 A;  3RK3 C;  1QL2 A;  4C46 A;  2IPP A;  1LTG C;  2WSE H;  3B5N A;  3HD7 B;  2QM7 A;  3EFG A;  1OWA A;  1OXZ A;  1SQQ K;  3M9H A;  1J2J B;  2GUV A;  5BU8 B;  4GIF A;  4EIJ A;  3GHG C;  5CMZ A;  3HE4 A;  1NO4 A;  2LKM A;  4JYB A;  5APT A;  4WY4 C;  1KFN A;  5CCG A;  3OA7 A;  1M1J A;  1GL2 D;  2OYI B;  3BAT A;  5CCH C;  1A02 F;  1GTW A;  1SQV K;  1LT9 A;  4WBA A;  1NAF A;  2YMY A;  1LWU B;  3TNU A;  2KP8 A;  4B86 A;  1HTL C;  5AW0 B;  2P67 A;  1X79 B;  2WSF H;  1JTH B;  3HD7 A;  2VRS A;  1GDT A;  5AW6 B;  4GT1 A;  4M3L A;  1L4A C;  1RF1 C;  3CLQ A;  3H6P A;  1GZL A;  2OAR A;  2NPS B;  5AVS B;  2IFN A;  1MZ9 A;  5CJ0 A;  3H32 B;  3RK2 D;  1URQ C;  1JOC A;  1SVF A;  1HBW A;  2BAS A;  3KQG A;  2YKO A;  1SFC D;  3KYQ A;  2O1K A;  1GU5 A;  1LWU A;  2XDJ A;  1DX7 A;  1VPC A;  3P8C D;  3V2P A;  1FDM A;  2XV5 A;  2O1J A;  1FZE A;  1T2K D;  1JTH A;  2HG5 D;  1JY2 N;  2C0X A;  1JY3 N;  1YYC A;  3HUS B;  1KIL D;  1LTA C;  1MUU A;  3M9Q A;  5AVX B;  2WT7 A;  5AVY B;  3V4Q A;  3NFQ A;  3H32 A;  2IX7 C;  1G2C B;  1N7S B;  5APV A;  2Q9I A;  5APW A;  3V5B A;  1JY3 O;  4N78 E;  1MV8 A;  4DOJ A;  2R5B A;  3IFM A;  3P32 A;  2OYH C;  3UIA A;  1J1E C;  1GU4 A;  5AVR B;  1GW4 A;  5AW8 B;  2WPQ A;  1IJD B;  2Q7C A;  5KJ7 D;  2KYV A;  2Q5U A;  1FZA A;  3LIE A;  1N7L A;  1GL2 C;  3M9B A;  1S9K D;  1L0L K;  3HUS A;  3MGN A;  3N4X A;  3HRN A;  1AQ5 A;  1RF0 C;  3M0D C;  2WPS A;  3RL0 B;  1VDF A;  1G2C A;  4Y99 B;  1LTJ C;  1IFN A;  1NOH A;  2C0W A;  3BAS A;  1M7L A;  4I6M C;  1N73 C;  5KTB A;  3IR9 A;  1M1J B;  3VTP C;  4JYC A;  1SQX K;  1LT9 B;  1ZV8 A;  5AVV B;  2NPS D;  3M91 A;  1NKZ B;  4W7Z A;  1HGZ A;  5APX A;  1W2E A;  3RK2 C;  4C7N A;  2Q3I A;  5AVZ B;  4XE5 B;  2P7J A;  4RES B;  2XKM A;  4IFM A;  1RE4 A;  2KLV A;  1FJP A;  3GHG B;  3I5C A;  1SFC C;  1HH0 A;  3TK1 A;  1FZC B;  1FOS E;  3VMZ A;  1T3J A;  4ZKP A;  2PP6 A;  3A3Y B;  2KB7 P;  1T2K C;  3OJA B;  2N1T A;  1JCC A;  1NH4 A;  3BRV B;  1N2D C;  1IFJ A;  1KIL C;  1FOS F;  2R5D A;  2FFD C;  1JY2 P;  3CL3 D;  3M06 A;  1N7S D;  3A5T A;  2CPB A;  1CI6 A;  1LTB C;  4IFF A;  2WZ7 A;  2R32 A;  2WSC H;  1G1J A;  3GHG A;  1URQ B;  4WY4 A;  1FZC A;  2PAJ A;  1WRG A;  2WT7 B;  5CCH A;  2Z4E A;  1ZR2 A;  3PP5 A;  2C9N Y;  4W7Y A;  2P1J A;  5KJ7 C;  3U59 A;  3VP8 A;  2OYI C;  4W80 A;  2WIT A;  2YKP A;  3B5N D;  1HJB A;  1J1D B;  3VMY A;  3V2R A;  3NMD A;  3M0A A;  5BU5 A;  2I1J A;  5AW9 B;  2M8R A;  3II6 A;  1ZLL A;  3VOP A;  3N7N A;  5CCG D;  1RF1 A;  1L4A A;  2XZR A;  5AVW B;  3R2P A;  3BVH A;  1IFD A;  3MIW A;  4JF7 A;  1URQ A;  1X9V A;  1YTZ T;  2NPS C;  1A02 J;  1GD2 E;  5AW7 B;  2KSJ A;  2JEE A;  4LGD E;  1JNM A;  2FKW B;  1IC2 A;  1RE3 C;  3EQ2 A;  3V2Q A;  1L0N K;  2ZFC A;  4EOT A;  3T97 A;  1FAV A;  1DH3 A;  1FZG A;  3HD7 D;  5AVQ B;  3P7K A;  3L36 A;  3L35 A;  2J59 M;  1LTT C;  4LC1 A;  1XTG B;  2WTY A;  1GL2 B;  2QM8 A;  1GK4 A;  4C7N B;  2YNY A;  3SWY A;  1JMM A;  1NU1 K;  3P8C E;  3WMM 0;  3MTU E;  4OH8 B;  5KLV K;  2FXM A;  3CI9 A;  2ZXE B;  1HVV A;  5AW3 B;  5BVZ A;  2L5G B;  2HYN A;  2M3B A;  2W6A A;  4ZKU A;  4LLH A;  1GW3 A;  1N7S C;  2W27 A;  1T8Z A;  4N3Y B;  2OYH A;  2MJZ A;  1IFI A;  4AYC A;  1IK9 A;  3L37 A;  1NTM K;  2N1T B;  1H8A A;  3RK2 B;  4IFD K;  2YKQ A;  4O9B A;  2POH A;  1SP4 A;  1GL2 A;  2A45 H;  2P2U A;  2WPR A;  2H8P D;  3A2A A;  3RK3 B;  3HTK A;  2CPS A;  5AW2 B;  2HOD A;  1CI6 B;  1SQP K;  3MUD A;  1FBM A;  1RF0 A;  3B5N C;  1FZB A;  1HUC A;  3M0D A;  3U1C A;  1IO4 A;  1NKN A;  2JJL A;  1LTJ A;  3TYY A;  4WY4 B;  1ZR4 A;  1S9K E;  1N73 A;  1JO5 A;  1DEB A;  1KZU B;  2YO2 A;  2N9B A;  5CCG C;  3SWF A;  1M1J C;  2HPC A;  5APQ A;  1JUN A;  1CZQ A;  1NWQ A;  3VN0 A;  1LT9 C;  2I1K A;  1ZN5 A;  1FZF A;  2GUS A;  1JY3 P;  4KHX A;  4N6J A;  3KDP B;  1SFC A;  1FU1 A;  3OAK A;  1HGV A;  1RF1 B;  1L4A B;  3NXS A;  3HD7 C;  2H7H A;  2Z5H A;  2A45 I;  1FZC C;  2FYZ A;  1H89 A;  3BRT B;  1FJK A;  3B8E B;  1LGH B;  3HE5 B;  5AVT B;  2A45 G;  1KIL A;  2FFD A;  2J58 A;  4I1L A;  1YTZ I;  1LWU C;  3RL0 D;  3V2N A;  2N1T D;  4AUW A;  2YO3 A;  3VP9 A;  4N78 D;  3U1A A;  1LTS C;  2E42 A;  5KJ7 A;  5AVU B;  3RK3 D;  2OYI A;  3HE5 A;  1SQB K;  4GKG A;  3P8M C;  1CSB A;  1N86 A;  1T3U A;  1IFM A;  1J1D C;  1G1I A;  2OYH B;  1CW5 A;  1J1E B;  2WWW A;  1E5W A;  4WY4 D;  5APU A;  3E1I A;  2Z5I A;  4XA4 A;  1SLQ A;  1NHL A;  2IFM A;  4C7R A;  5AW4 B;  1QL1 A;  5CCH D;  4DZO A;  1Z56 A;  2NPS A;  3HTK B;  4HH2 A;  3VYI A;  5APS A;  2HOD B;  3C9I A;  1RE3 A;  3HUS C;  2E43 A;  4I2L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...