4GKGA

Crystal structure of the s-helix linker
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
52
structure length
52
Chain Sequence
PRGSHMEERLARNALEASVEERTRDLRMARDRLETEIADHRQTTEKLQAVQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords C4-dicarboxylate transport sensor protein dctB
publication title Crystal structure of the S-Helix Linker
rcsb
source organism Sinorhizobium meliloti
total genus 22
structure length 52
sequence length 52
chains with identical sequence F
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4gkgA00
2R5DA 4EOTA 5AW9B 4JYBA 5APTA 3NMDA 3L35A 5AVQB 3HE5A 2XV5A 3KDPB 3VMZA 4C7NB 1FOSE 2C9NY 3HTKA 1OXZA 1GU4A 5AW7B 5CMZA 2E43A 5AW5B 2YNYA 4AYCA 1KQLA 2ZXEB 3KQGA 3M91A 3L36A 5AW0B 2JJLA 1H8AA 5APUA 3MD0A 5AVYB 3A7OA 1OWAA 2H7HA 4C46A 1NWQA 5AW2B 1H88A 2Q5UA 3L37A 2P2UA 3HE5B 2C9LY 1GK6A 2WWWA 4XE5B 3NTNA 1CZQA 3VTPC 3TK1A 3LIDA 5APWA 3M0DA 4M3LA 2YO3A 5APYA 5APVA 1DH3A 3V4WA 2W6AA 2Z5IA 4LC1A 1T2KD 3MGNA 2XU6A 5APXA 5AVWB 5AW3B 2VRSA 2R5BA 3M9HA 3HE4A 3LIEA 5APQA 3V4QA 1S9KD 1MFZA 5AW8B 4HYTB 3O8ZA 3VMYA 2IPPA 1FOSF 1YYCA 4I2LC 3A3YB 2Z5HA 2WPRA 2WTYA 1J2JB 3M0AA 5AW4B 1A02J 5AVSB 1JNMA 2R32A 5AVTB 1HUCA 2QM7A 2WT7A 3M06A 5AVXB 4KHXA 5AW6B 3B8EB 1S9KE 3NFQA 1CSBA 1IO4A 2ZFCA 3P32A 2Q3IA 3TNUA 1T2KC 2R3CA 1A02F 1SP4A 3VMXA 1H89A 2QM8A 3P7KA 3T97A 2WPSA 2KP8A 3P8MC 4I6MC 1GD2E 3UIAA 3NXSA 5AVZB 2E42A 3IR9A 4GKGA 1SLQA 2N9BA 2YO2A 1GZLA 1MUUA 2Q7CA 4RESB 5AW1B 1CI6A 3I5CA 2WT7B 4AQRD 5APSA 1X8YA 1HBWA 1FAVA 3A5TA 3OAKA 3SWFA 1JUNA 4JYCA 3TNUB 2XZRA 5AVUB 1GTWA 3M9BA 5AVRB 2P7JA 3HE4B 2WPQA 3A2AA 3TYYA 4DZOA 1HWTC 4AUWA 3VN0A 4C7NA 5AVVB 4B86A 1GK4A 3V5BA 1NAFA 3VYIA 1GU5A 2P67A 2W27A 1CI6B 1G2CB 4GT1A 1MV8A 2BASA 1HJBA
chains in the Genus database with same CATH superfamily
4EOTA 5AW9B 4HJGH 5KLVE 3H6PA 1U7JA 1JEKA 2O01H 2W6BA 1KZUB 4N6JA 3L36A 3RK3B 5APUA 1JTHB 5AVYB 3A7OA 1PP9D 1AJYA 3CD6P 1IFJA 2C9LY 1NTKD 1Q86Q 3N7NA 3SFEC 4IOIH 2OYHC 1N7SB 3PH0A 2O01J 4EIJA 3IFMA 4N78E 5AVWB 3CXHI 1YJ9P 4O9BA 1MFZA 1OZHA 1M1JB 2AXCA 3CC7P 4I2LC 2WTYA 1G2CA 3G71P 5AVSB 2E74B 1NTMG 4WY4B 3L75G 5AVTB 1HUCA 3CCEP 3MIWA 1Q82Q 4Y28J 2B88A 2D2CB 2A45I 5KLIB 3A0BH 3TDKA 1SQQG 4PV1D 1GZLA 3HUSC 1RF0A 4BRYB 1ZV8A 3L70D 1FAVA 2BCCJ 3D71A 1N7LA 1OW7A 1SQVD 3H1JG 3CWBE 1KB9D 5AVVB 1WRGA 2W27A 1LTJA 1GW4A 4W7YA 2K9YA 4H44B 2Y0CA 3H1HD 4D6TD 1KILA 1ZLLA 3IF4A 1Q81Q 4GODA 4OWFA 1KILD 1SQVK 5TJHA 4DJGA 1QLED 2FFDA 1PGQA 2ZXXA 1IC2A 1OVVA 3P8CE 1OX3A 3PP5A 3L74G 3Q5RA 1ZR2A 3S4RA 5KKZC 4TLFA 1IK7A 5BU8B 5APQA 3V4QA 3HE4A 2IDBA 1QEXA 3MP7B 3E7KA 2J59M 1FZCB 4WB4A 1P84I 2KOGA 4BXLA 2M5AB 2I1JA 4OGQC 2YMYA 1VQ7P 1HGVA 3C9IA 3I55P 1L4AB 4U7JA 3RGUA 1RF1C 2LXCB 1R5SA 1LT9B 3W67A 4PD4D 1S72P 2B87B 2N1TB 1GTWA 2P7JA 3RK2C 1FZAA 1NJIQ 1VQ8P 4GT1A 2LXBA 1JTHA 3GMAA 3H1ID 1JB0J 3RK3D 1BCCJ 4HKZH 3CLQA 3L72G 3F89A 3BVHA 2PAJA 1SQXG 4UB8H 3C8VA 1N7SA 2FKWB 2W6JH 1KN7A 2ZT9D 1N7SD 4KJMA 2M0BA 1M1JA 1GK6A 1RH5B 3AEFC 1IJDB 3L73G 3KXDA 1S2EA 4M3LA 5APVA 1FDIA 2Z5IA 4PJ0H 2Y9ZA 1T2KD 4WY4A 1N73B 4WY4D 2IZ1A 3MUDA 2LR2A 3H1KG 4EDFA 2WZ7A 2ZYGA 1NTME 3L75E 1NTZJ 3EQ2A 1JNMA 2D2CD 2POHA 3L71D 1JY3N 2JEEA 4BRYA 4XFJA 4YPCA 4GOEA 3GLMA 3G3ZA 2R3CA 1SQQE 2OTLP 3CCSP 2MJZA 3I5CA 2KSEA 3H1JE 4HH2A 2NRGA 1SQPJ 3CX5I 2XZRA 3M9BA 1HWTC 4H44D 1VF5C 1KD1Q 2P67A 1CI6B 3A0BE 2R3SA 1MFTA 1LT1A 2FXPA 2Q9IA 4ASWA 4H0LC 1QX8A 1HJBA 1LNQA 4H13B 3R4YA 1YHQP 5BVZA 1ZOYC 2E5YA 2HPCA 3MHVA 2RN0A 3VP8A 1H8AA 2B9BA 1LWUC 2QJPC 1KQSO 1SQBJ 1OW6A 2Q6QA 3JCUH 3L74E 1LP1B 1FZCA 2V7QJ 3VOPA 3CPWO 5CHXA 5KLVJ 3OA7A 1VQ5P 3G4SP 3PJSK 1IK9A 2HG5D 4YTPC 5AW8B 3WMM0 3ABVC 1X79B 1IFDA 2JWAA 1YYCA 1PP9G 1K05A 3GG2A 3U59A 1A02J 1L4AA 1NTKG 1LGHB 1OIPA 1L4AD 4KHXA 4N3YB 1LT9A 1TU3F 2B87A 2N1TA 1A02F 1NU1D 3P7KA 2GUSA 3UIAA 2N1TD 2A06D 2YXRB 2QEXP 1EZVD 2V4HA 3RL0g 1KB9H 2N9YB 3V2RA 4L74A 1USDA 2KS1A 2R44A 1YBKA 3N4XA 1G2CB 3L72E 4BWNA 1BSNA 1SQXE 3L70G 2OYIA 2RH0A 4C7NB 1SQVG 3CWBJ 4JF7A 2H8PD 3BCCG 1H88A 3HD7B 3R2PA 3L73E 1H0TA 3V6IA 4UB8E 3H1HG 3M0DA 4D6TG 2QJYB 1ZP0C 4GIFA 3BRTB 3O6QB 1VDFA 3CCUP 1GL2C 5AW3B 3M9HA 3LW5J 3BRVB 1RE3C 3CCMP 2IBZE 2FYUD 2PGDA 2M3BA 1X9VA 3GHGA 4PJ0E 3GF3A 5GTIH 1OMIA 2FFDB 1JCCA 3AE5C 3PRJA 3AEDC 1NH4A 1OW8A 2Q7CA 2QJKC 1CI6A 4IL6H 4DOJA 2XDJA 4PD4H 3A5TA 1J1DC 1FZFA 1ZRTD 3HE4B 3CXHD 2WVRA 1YIJP 2WSSH 3T97B 2HFED 2P10A 4H13D 2OQQA 1VQ4P 1CW5A 1W2EA 2PRRA 2CPSA 1D7MA 1LP1A 2E75C 1NTZK 1KQLA 2ZXEB 1LTTC 2KLVA 5KTBA 2H7HA 3H1IG 5H2FH 1N8RQ 1ZW0A 1USEA 2E76C 1DH3A 1Y47A 2HODA 1LTSC 2NPSC 2ZAEB 1PP9E 1U57A 1BGYD 1NTKE 3JCUE 3V2PA 1L0LD 2ZVNB 4GDOA 1J1EB 2G3AA 5E79H 1JOCA 1LJ2A 2ZT9B 1M90Q 1W5CE 3AE4C 3RK2B 5CCGA 5KJ7C 4L76A 1AVYA 4DT0A 2YO2A 5CCGD 5KAIH 1NTMJ 4PV1C 3L75J 1QVFO 1SQBK 4JYCA 1L0LK 1KYOI 3L71G 1BE3D 3TYYA 4C7NA 4YXDC 1P84D 1SQQJ 2WMMA 3K5BA 3L70E 1QL2A 1DEBA 1DX7A 1SQVE 1LTJC 1KB9E 3H1JJ 3HD7A 3H1LD 5AW7B 3GF7A 3HD7D 2IFMA 1JY2P 1VQOP 3H32A 1QL1A 3AE9C 3BCCD 3O6QA 1RE4A 1G1IA 1L0ND 3AE8C 3HE5B 1EDKA 3H1HE 3CCLP 4D6TE 1LTBC 1KILE 2IFNA 3AE7C 3E1RA 3VMYA 1KTMA 2W83C 2M8RA 1J2JB 1NYHA 3WU2E 2FBWC 2JKVA 3AECC 1GW3A 4Z1MH 1L0NK 2HPCB 2WSFH 2FYNC 2KLUA 4DCKA 3TGUD 1JY3O 2CPBA 2Q3IA 1VQLP 3D70A 3T97A 2KP8A 1E5WA 2E42A 3NXSA 3CL3D 3AE6C 1Y8AA 3B5NB 2KUBA 5APSA 1X8YA 5GTIE 5AVUB 1YQ3C 1NU1G 2A06G 1YI2P 4IL6E 1EZVG 1JY2N 4PD4E 1SS1A 5APTA 1PFIA 2C9NY 4U3FD 3RK3C 3HTKA 5CMZA 4I1LA 1S5LX 2QIWA 4JPZB 3OJAB 2JP3A 2W8ZA 4Y99C 1NWQA 3H1IE 2UWJE 2OTKE 1N7SC 1HTLC 4ZKPA 3RK3E 2GM4A 2KSJA 3L72J 2IYOA 3CX5D 1SQXJ 2KS1B 5APWA 1GMJA 1M1JC 3B71A 1HGZA 1RF1A 1EDIA 4EYYQ 3O8ZA 2E74C 4WY4C 1EC5A 2OYIB 1NGMB 5H2FE 1AQTA 2YKOA 2L5GB 3L73J 1K04A 1YTZI 3MUDC 3RK2D 1N86A 1PL5A 2D2CC 3CCQP 2WPVB 5KLIC 2K9JA 1URQB 2WSCH 3VMXA 4IFDK 1H89A 2WPSA 1HH0A 2FYUG 4JBZA 3CMEP 2HR3A 1H0TB 1SLQA 4NPFX 1Z56A 5AW1B 1PGPA 3L71E 5E79E 3SSUA 4EI2A 3CXHH 5AVRB 1EXJA 2K1AA 1AA0A 4H44C 1KQFB 1VL2A 2KYVA 5KAIE 3GHGB 4OVNF 4JYBA 3HE5A 4K3AA 2C0WA 2KZIA 3AEAC 4IL6X 2Y0EA 1DEEG 1PPJG 3CC4P 3KQGA 1FC2C 5AW0B 2JJLA 1ZR4A 1M57D 3Q1MA 1S4XA 2A45H 5L8RJ 3KPEA 1GL2B 2P2UA 1S1CX 1FJPA 1KFNA 3CMAP 1AFOA 4I7ZB 2BCCD 1S3JA 3GW6A 1NTMK 2DW3A 1FZCC 2XU6A 3RL0C 4GOFA 2KI7B 2A45G 3FX0A 1FS0E 2YKQA 1NKZB 1SFCB 3M0AA 2AEJA 3B4SA 1U7MA 3CCVP 1QGKB 3WUTA 1ZN5A 3B5NA 1L4AC 2PP6A 2Z4EA 4RKUJ 3B5ND 4IFMA 5CCHA 1PP9J 1RQVA 2KNCA 2WSEH 1BGYG 1LT9C 3IR9A 2KK7A 1KQGB 1NTKJ 5CCHD 1MUUA 1L0LG 2K3RA 2M3EA 4AQRD 1FDMA 1IFIA 1ZXGA 2HODB 1FZBA 4AUWA 1NU1E 1DD4A 1LTAC 2H88C 4HB1A 1GK4A 2A06E 2E75B 1EZVE 2BASA 2AEFA 2I8DA 1S5LH 4A7PA 3KDPB 3EFFK 1VQNP 4MN4C 5AW5B 1BE3G 4AYCA 5K5GB 1AQ5A 4JQ0D 1T8ZA 2AXTH 3AEEC 1RQUA 5DJUB 2WWWA 3L70J 2WITA 3NTNA 2Q3EA 1N73C 3G6EP 2OGUA 1SQVJ 3H1LG 3RBZA 3AE1C 1ZMEC 2GUVA 5APXA 2Y0DA 1PV3A 2OYHB 2VRSA 5B5EH 3AE2C 1S9KD 2FYZA 1L0NG 1URQA 2O1JA 1MKMA 3H1HJ 1URQD 4D6TJ 3WU2H 1BCCD 5AVXB 3H32B 5AW6B 2GA1A 1IO4A 2XNXA 2FY8A 2OTJP 3EFGA 5GTHH 2FYUE 3H1KE 1JMMA 3P8MC 3Q3DA 3HUSB 4DZOA 3KZIH 3TGUG 3Q2YA 3VMAA 3II6A 2KIKA 3SWKA 4H13C 2RKLA 1ZRTE 1GL2A 3IN6A 1NTZD 1FOSE 3NMDA 3CXHE 4LGDE 1RE3A 1GL2D 3D6ZA 1PPJD 1FU1A 4W7ZA 2Q5UA 3L37A 4UB6H 1NOHA 4XE5B 3RBXA 1KMIZ 3AEGC 3TK1A 3CX5H 1KYOD 1SFCA 4U3FG 1SQPD 1SFCD 4K35A 5KKZB 1VQ6P 2KB7P 2Z5HA 3H1IJ 2JR8A 3HTKB 2R32A 1IZNB 5KAFH 2J5UA 5CBNA 2W90A 3CCJP 4RJTA 1SQPK 4OGQB 1BGYE 2P1JA 1L0LE 1SQBD 2N9BA 1FE6A 2IBZI 5CCGC 3TSIA 2E75D 3SWFA 1HJ0A 2FXMA 1RF1B 4ZNCA 3FWNA 2WPQA 5KLVD 1NAFA 3VYIA 5EFWB 1W2BO 2BEZF 3ITKA 2HLOA 1R5LA 3A0HH 1EQ7A 2E76D 4Y99B 3TF5A 4W80A 3L71J 2NPSA 1BE3E 1IFNA 1JY2O 3CC2P 4WWIA 1WMKA 2K9JB 2NPSD 1RF0C 1LTIC 3L4FA 3M91A 4R4MA 3HD7C 1P84E 4N78D 5KLVK 5AW2B 2OYHA 1T3UA 3V2QA 1S5LE 2XKMA 2QJYC 3VTPC 2Y9YA 3H1LE 1RE4C 2YIUC 1NTKK 2HYNA 5KJ7A 1PZQA 3CI9A 5C39A 2AXTE 3FWLA 3BCCE 5KJ7D 3FXEA 1L0NE 3PHLA 1KILC 2WQYC 3Q5PA 4WBAA 1VQPP 1JO5A 1WT6A 2YKPA 3PLNA 2FFDC 2QM7A 2BCCG 1UIXA 5B5EE 3JC22 2ZFCA 3CWBD 3HUSA 1AV1A 4I6MC 1GD2E 1FZGA 1X22A 1LTGC 2WT7B 3AE3C 4L75A 1HBWA 3L74J 3OAKA 1JUNA 1MZ9A 3TGUE 2OARA 5GTHE 1BSHA 1VQ9P 3WUVA 2RMZA 1VF5B 2E5TA 5AVQB 3KZIE 1KFMA 2WSFJ 3P8CD 4H0LB 2YNYA 1XTCC 1NU1J 1GDTA 2KNCB 1X0TA 3MD0A 5TISH 3RL0B 2KXPB 1JMBA 1Q7YQ 1LWUB 4U3FE 2QJPB 1G1JA 4IFFA 4ZMDA 1OVUA 2JWDA 1KB9I 2C0XA 1HVVA 4ZKUA 4HYTB 4CPGA 1JY3P 1J1EC 2H89C 2IPPA 4R4LA 4UB6E 4YXWH 4RO0A 2ZT9C 2WPRA 3CX5E 2O3JA 4OGQD 3OW2O 1BDCA 5B66H 3M06A 1EDLA 3NFQA 2J58A 1T2KC 1PGJA 1QVGO 5AVZB 1AVOA 3W68A 5BU5A 5KAFE 1EXIA 2B89A 4L73A 2QG4A 3C1LA 1BCCG 3TNUB 3EWKA 2O1KA 1JCDA 2P58A 2H43A 2FYUJ 3H1KJ 2BEQD 1L2PA 1KORA 1Y9BA 2QVAA 3ZDMA 2PFXA 2E43A 1VQKP 1XTGB 3MZWB 1NKNA 2E74D 5DJTB 2WSCJ 4ASVA 1PGOA 1OWAA 2CK3H 3A0HE 3JSVC 1RHZB 2IBZG 1KYOH 1NTMD 2Q1KA 3L75D 1NTZG 2ZYAA 2YO3A 1M56D 4PD4I 1NVOA 2L91A 3BATA 2LKMA 3LIEA 1FBMA 3S1KA 3MTUE 1FOSF 1SQQD 3A3YB 2BCCE 3S9OA 3H1JD 2WT7A 2QA4P 1SQPG 3B8EB 2FXOA 3P32A 1SVFA 1VQMP 4TT3H 1SP4A 3B5NC 3CCRP 3D6YA 5M1BA 5CJ0A 5CCHC 2V7QH 1UIIA 1SQQK 3VP9A 5CBOA 2QJKB 1VF5D 4B86A 1J1DB 1PIXA 1BGYJ 2QRXA 3U1AA 1DIPA 1FJKA 3HRNA 1L0LJ 4H0LD 3KYQA 3QWOC 1SQBG 2N1TC 3V2NA 3PTZA 3L35A 3SWYA 3L74D 3VMZA 1OXZA 3RL0D 1LWUA 2M5AA 1BDDA 1E79H 2ZYDA 4QMAA 5KLVG 1M7LA 1P84H 4C46A 1T6AA 2WSEJ 2K37A 3M9QA 1NAYA 1HF9A 1BE3J 1K73Q 3V4WA 4OH8B 1Q90D 3MGNA 2E76B 2OYIC 5TISE 1YQ4C 4LLHA 3SFDC 3AEBC 1YTZT 4WVZA 2NPSB 2YMKA 1IFPA 4NPEA 3H1LJ 2G8YA 1URQC 3USSA 1YJNP 1S9KE 2QE7H 3TNUA 3BCCJ 2K88A 2ZJSE 3M0DC 2QM8A 2YXQB 1M1KQ 1L0NJ 1NU1K 1T3JA 4GKGA 1R8EA 4RESB 1BCCE 2IX7C 3Q5SA 5B66E 3L72D 1SQXD 2IZ0A 3A2AA 4PV1B 1NHLA 3VN0A 3CWBG 4XA4A 4C7RA 1IFMA 3LW5H 3GHGC 1N73A 1K9MQ 1YJWP 1KV4A 4KT0J 4NPDA 1MV8A 1KC8Q 3FGAD 1FDOA 2JO1A 2IYPA 2R5DA 2NZ2A 3L73D 1JM0A 2XV5A 1M8OB 1GU4A 3TGUJ 1LTJB 2YIUB 2ZVOB 1SQXK 1VPCA 1DD3A 3U1CA 2SPZA 2XNDH 3H1KD 1OVRA 4I7ZC 1Q2NA 1EDJA 1NO4A 1NTZE 1OFCX 2IBZD 1KILB 1CZQA 1EZVI 3LIDA 1RY3A 2I1KA 1PPJE 5APYA 2W6AA 4LC1A 3QH9A 3G9RA 2R5BA 1K8AQ 1SFCC 3WUUA 2MKVA 3I56P 3IAOA 1KYOE 5AW4B 2FYUK 1FZEA 3BASA 4U3FJ 1SQPE 2KZJA 3FXDA 2O01N 5CJ4A 1CSBA 2OYOA 2FYNB 3KHUA 3F5HA 1YITP 2ITAA 3E1IA 2JDIH 3V5BA 1GU5A 1SQBE 3H25A 1N2DC 2QSIA 2AEMA
chains in the Genus database with same CATH topology
4EOTA 5AW9B 4JYBA 2OYIA 5AVQB 3HE5A 2C0WA 4C7NB 3H6PA 1KFMA 3P8CD 2O01H 2W6BA 2YNYA 1XTCC 3KQGA 1KZUB 4N6JA 4JF7A 3L36A 1GDTA 5AW0B 2JJLA 3RK3B 1ZR4A 5APUA 2A45H 1JTHB 2H8PD 3MD0A 5AVYB 3A7OA 3RL0B 3KPEA 1GL2B 1H88A 2P2UA 3HD7B 3R2PA 1IFJA 2C9LY 1LWUB 1FJPA 3N7NA 1KFNA 1G1JA 2OYHC 1N7SB 3M0DA 1AFOA 4IFFA 4EIJA 1NTMK 4GIFA 3BRTB 3IFMA 1FZCC 2XU6A 4N78E 5AVWB 3RL0C 1VDFA 1GL2C 5AW3B 3M9HA 4O9BA 2C0XA 1HVVA 1MFZA 4ZKUA 4HYTB 1M1JB 1JY3P 1J1EC 3BRVB 1RE3C 2A45G 2IPPA 2M3BA 2YKQA 4I2LC 1NKZB 2WPRA 1SFCB 1X9VA 2WTYA 3M0AA 1G2CA 5AVSB 4WY4B 5AVTB 1HUCA 1ZN5A 3GHGA 3B5NA 3M06A 1L4AC 3MIWA 2PP6A 3NFQA 2J58A 2Z4EA 3B5ND 1T2KC 2FFDB 1JCCA 4IFMA 5CCHA 2WSEH 5AVZB 1NH4A 2A45I 1LT9C 3IR9A 2Q7CA 1GZLA 1MUUA 5CCHD 3HUSC 1RF0A 1CI6A 1ZV8A 5BU5A 4DOJA 4AQRD 1FDMA 1FAVA 2XDJA 3A5TA 1J1DC 1IFIA 1FZFA 1N7LA 3TNUB 2HODB 1FZBA 3HE4B 2O1KA 1JCDA 4AUWA 1LTAC 2H43A 5AVVB 1GK4A 1WRGA 2HFED 2W27A 1LTJA 1GW4A 4W7YA 2BASA 1CW5A 1W2EA 3KDPB 2CPSA 1KILA 1ZLLA 2E43A 5AW5B 1NTZK 1XTGB 4AYCA 1AQ5A 1KQLA 1T8ZA 2ZXEB 1NKNA 1KILD 1LTTC 2KLVA 1SQVK 5KTBA 1OWAA 2H7HA 2FFDA 2WWWA 2WITA 3NTNA 1IC2A 3P8CE 1N73C 3PP5A 1ZR2A 2YO3A 1DH3A 2GUVA 3BATA 5APXA 5BU8B 2HODA 2LKMA 2VRSA 5APQA 3V4QA 3HE4A 3LIEA 2OYHB 1LTSC 2NPSC 1S9KD 2FYZA 2J59M 1FBMA 1FZCB 4WB4A 3MTUE 1FOSF 1URQA 3V2PA 2O1JA 3A3YB 2KOGA 1J1EB 1URQD 1JOCA 2I1JA 2WT7A 5AVXB 3H32B 2YMYA 5AW6B 3B8EB 1IO4A 2XNXA 1HGVA 3P32A 1SVFA 3C9IA 3EFGA 1SP4A 3B5NC 3RK2B 1JMMA 5CCGA 3P8MC 1L4AB 5KJ7C 2YO2A 5CCGD 1RF1C 5CJ0A 5CCHC 1SQBK 1SQQK 3VP9A 1LT9B 4JYCA 1L0LK 2N1TB 1GTWA 3HUSB 2P7JA 4DZOA 3RK2C 3TYYA 4C7NA 4B86A 1J1DB 1FZAA 3II6A 3U1AA 1FJKA 3HRNA 4GT1A 3KYQA 1QL2A 1JTHA 1DEBA 2N1TC 1DX7A 3V2NA 1GL2A 3RK3D 1LTJC 3CLQA 1FOSE 3NMDA 3L35A 3SWYA 3VMZA 3HD7A 3BVHA 1OXZA 5AW7B 4LGDE 1LWUA 2PAJA 3RL0D 1RE3A 1GL2D 3HD7D 2IFMA 1FU1A 1JY2P 1N7SA 4W7ZA 3H32A 2FKWB 1QL1A 1M7LA 1RE4A 1N7SD 4C46A 1G1IA 2Q5UA 3L37A 3HE5B 1M1JA 1NOHA 1GK6A 4XE5B 3M9QA 3TK1A 1LTBC 1IJDB 1SFCA 4M3LA 5APVA 3V4WA 2Z5IA 1T2KD 4OH8B 4WY4A 3MGNA 1SFCD 2IFNA 1N73B 2OYIC 4WY4D 3MUDA 4LLHA 3VMYA 1YTZT 2M8RA 2KB7P 2WZ7A 2Z5HA 2NPSB 1J2JB 3HTKB 3EQ2A 1JNMA 1GW3A 2R32A 1L0NK 2POHA 2HPCB 1JY3N 1URQC 2JEEA 2WSFH 1S9KE 3G3ZA 1JY3O 2CPBA 2Q3IA 3TNUA 2R3CA 1SQPK 3M0DC 2QM8A 2P1JA 3T97A 2KP8A 1E5WA 2E42A 3NXSA 1NU1K 3CL3D 1T3JA 4GKGA 2N9BA 2MJZA 4RESB 3I5CA 3B5NB 2IX7C 5APSA 1X8YA 4HH2A 5CCGC 3TSIA 3SWFA 2FXMA 2XZRA 5AVUB 1RF1B 3M9BA 2WPQA 3A2AA 1HWTC 1NHLA 3VN0A 4XA4A 1NAFA 3VYIA 4C7RA 1IFMA 3LW5H 2P67A 3GHGC 1N73A 1CI6B 2HLOA 1MV8A 1EQ7A 2Q9IA 4Y99B 1JY2N 1HJBA 2R5DA 4W80A 2NPSA 5APTA 1PFIA 1IFNA 2XV5A 2C9NY 3RK3C 3HTKA 1GU4A 1JY2O 5CMZA 4I1LA 2NPSD 1RF0C 5BVZA 3OJAB 1LTJB 2HPCA 1LTIC 3L4FA 3M91A 1SQXK 3HD7C 3VP8A 1VPCA 4N78D 1H8AA 1LWUC 4Y99C 5KLVK 3U1CA 1NWQA 5AW2B 2OYHA 1T3UA 3V2QA 1N7SC 1HTLC 4ZKPA 2GM4A 1NO4A 2XKMA 1KILB 1CZQA 2KSJA 3VTPC 1FZCA 3VOPA 3LIDA 1RE4C 1RY3A 2I1KA 5APWA 1NTKK 2HYNA 5CHXA 5APYA 1M1JC 2W6AA 3OA7A 5KJ7A 4LC1A 3CI9A 1HGZA 1RF1A 2R5BA 1IK9A 1SFCC 5KJ7D 2HG5D 5AW8B 3WMM0 1KILC 3O8ZA 1X79B 4WY4C 1IFDA 1YYCA 4WBAA 2OYIB 1JO5A 1WT6A 2YKOA 3U59A 2L5GB 5AW4B 1L4AA 1A02J 2FYUK 1FZEA 3BASA 1YTZI 2YKPA 1LGHB 3RK2D 2FFDC 1N86A 2QM7A 1L4AD 4KHXA 5CJ4A 4N3YB 1CSBA 1LT9A 2ZFCA 2N1TA 1A02F 3HUSA 1URQB 2WSCH 3VMXA 4IFDK 1H89A 3P7KA 2GUSA 2WPSA 4I6MC 1GD2E 1HH0A 3UIAA 2N1TD 1FZGA 1LTGC 1SLQA 1Z56A 5AW1B 2WT7B 1HBWA 3OAKA 1JUNA 1MZ9A 5AVRB 2OARA 3E1IA 3V2RA 3V5BA 1GU5A 3N4XA 1G2CB 2KYVA 1N2DC 3GHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5D A;  4EOT A;  5AW9 B;  4JYB A;  5APT A;  3NMD A;  3L35 A;  5AVQ B;  3HE5 A;  2XV5 A;  3KDP B;  3VMZ A;  4C7N B;  1FOS E;  2C9N Y;  3HTK A;  1OXZ A;  1GU4 A;  5AW7 B;  5CMZ A;  2E43 A;  5AW5 B;  2YNY A;  4AYC A;  1KQL A;  2ZXE B;  3KQG A;  3M91 A;  3L36 A;  5AW0 B;  2JJL A;  1H8A A;  5APU A;  3MD0 A;  5AVY B;  3A7O A;  1OWA A;  2H7H A;  4C46 A;  1NWQ A;  5AW2 B;  1H88 A;  2Q5U A;  3L37 A;  2P2U A;  3HE5 B;  2C9L Y;  1GK6 A;  2WWW A;  4XE5 B;  3NTN A;  1CZQ A;  3VTP C;  3TK1 A;  3LID A;  5APW A;  3M0D A;  4M3L A;  2YO3 A;  5APY A;  5APV A;  1DH3 A;  3V4W A;  2W6A A;  2Z5I A;  4LC1 A;  1T2K D;  3MGN A;  2XU6 A;  5APX A;  5AVW B;  5AW3 B;  2VRS A;  2R5B A;  3M9H A;  3HE4 A;  3LIE A;  5APQ A;  3V4Q A;  1S9K D;  1MFZ A;  5AW8 B;  4HYT B;  3O8Z A;  3VMY A;  2IPP A;  1FOS F;  1YYC A;  4I2L C;  3A3Y B;  2Z5H A;  2WPR A;  2WTY A;  1J2J B;  3M0A A;  5AW4 B;  1A02 J;  5AVS B;  1JNM A;  2R32 A;  5AVT B;  1HUC A;  2QM7 A;  2WT7 A;  3M06 A;  5AVX B;  4KHX A;  5AW6 B;  3B8E B;  1S9K E;  3NFQ A;  1CSB A;  1IO4 A;  2ZFC A;  3P32 A;  2Q3I A;  3TNU A;  1T2K C;  2R3C A;  1A02 F;  1SP4 A;  3VMX A;  1H89 A;  2QM8 A;  3P7K A;  3T97 A;  2WPS A;  2KP8 A;  3P8M C;  4I6M C;  1GD2 E;  3UIA A;  3NXS A;  5AVZ B;  2E42 A;  3IR9 A;  4GKG A;  1SLQ A;  2N9B A;  2YO2 A;  1GZL A;  1MUU A;  2Q7C A;  4RES B;  5AW1 B;  1CI6 A;  3I5C A;  2WT7 B;  4AQR D;  5APS A;  1X8Y A;  1HBW A;  1FAV A;  3A5T A;  3OAK A;  3SWF A;  1JUN A;  4JYC A;  3TNU B;  2XZR A;  5AVU B;  1GTW A;  3M9B A;  5AVR B;  2P7J A;  3HE4 B;  2WPQ A;  3A2A A;  3TYY A;  4DZO A;  1HWT C;  4AUW A;  3VN0 A;  4C7N A;  5AVV B;  4B86 A;  1GK4 A;  3V5B A;  1NAF A;  3VYI A;  1GU5 A;  2P67 A;  2W27 A;  1CI6 B;  1G2C B;  4GT1 A;  1MV8 A;  2BAS A;  1HJB A; 
#chains in the Genus database with same CATH topology
 4EOT A;  5AW9 B;  4HJG H;  5KLV E;  3H6P A;  1U7J A;  1JEK A;  2O01 H;  2W6B A;  1KZU B;  4N6J A;  3L36 A;  3RK3 B;  5APU A;  1JTH B;  5AVY B;  3A7O A;  1PP9 D;  1AJY A;  3CD6 P;  1IFJ A;  2C9L Y;  1NTK D;  1Q86 Q;  3N7N A;  3SFE C;  4IOI H;  2OYH C;  1N7S B;  3PH0 A;  2O01 J;  4EIJ A;  3IFM A;  4N78 E;  5AVW B;  3CXH I;  1YJ9 P;  4O9B A;  1MFZ A;  1OZH A;  1M1J B;  2AXC A;  3CC7 P;  4I2L C;  2WTY A;  1G2C A;  3G71 P;  5AVS B;  2E74 B;  1NTM G;  4WY4 B;  3L75 G;  5AVT B;  1HUC A;  3CCE P;  3MIW A;  1Q82 Q;  4Y28 J;  2B88 A;  2D2C B;  2A45 I;  5KLI B;  3A0B H;  3TDK A;  1SQQ G;  4PV1 D;  1GZL A;  3HUS C;  1RF0 A;  4BRY B;  1ZV8 A;  3L70 D;  1FAV A;  2BCC J;  3D71 A;  1N7L A;  1OW7 A;  1SQV D;  3H1J G;  3CWB E;  1KB9 D;  5AVV B;  1WRG A;  2W27 A;  1LTJ A;  1GW4 A;  4W7Y A;  2K9Y A;  4H44 B;  2Y0C A;  3H1H D;  4D6T D;  1KIL A;  1ZLL A;  3IF4 A;  1Q81 Q;  4GOD A;  4OWF A;  1KIL D;  1SQV K;  5TJH A;  4DJG A;  1QLE D;  2FFD A;  1PGQ A;  2ZXX A;  1IC2 A;  1OVV A;  3P8C E;  1OX3 A;  3PP5 A;  3L74 G;  3Q5R A;  1ZR2 A;  3S4R A;  5KKZ C;  4TLF A;  1IK7 A;  5BU8 B;  5APQ A;  3V4Q A;  3HE4 A;  2IDB A;  1QEX A;  3MP7 B;  3E7K A;  2J59 M;  1FZC B;  4WB4 A;  1P84 I;  2KOG A;  4BXL A;  2M5A B;  2I1J A;  4OGQ C;  2YMY A;  1VQ7 P;  1HGV A;  3C9I A;  3I55 P;  1L4A B;  4U7J A;  3RGU A;  1RF1 C;  2LXC B;  1R5S A;  1LT9 B;  3W67 A;  4PD4 D;  1S72 P;  2B87 B;  2N1T B;  1GTW A;  2P7J A;  3RK2 C;  1FZA A;  1NJI Q;  1VQ8 P;  4GT1 A;  2LXB A;  1JTH A;  3GMA A;  3H1I D;  1JB0 J;  3RK3 D;  1BCC J;  4HKZ H;  3CLQ A;  3L72 G;  3F89 A;  3BVH A;  2PAJ A;  1SQX G;  4UB8 H;  3C8V A;  1N7S A;  2FKW B;  2W6J H;  1KN7 A;  2ZT9 D;  1N7S D;  4KJM A;  2M0B A;  1M1J A;  1GK6 A;  1RH5 B;  3AEF C;  1IJD B;  3L73 G;  3KXD A;  1S2E A;  4M3L A;  5APV A;  1FDI A;  2Z5I A;  4PJ0 H;  2Y9Z A;  1T2K D;  4WY4 A;  1N73 B;  4WY4 D;  2IZ1 A;  3MUD A;  2LR2 A;  3H1K G;  4EDF A;  2WZ7 A;  2ZYG A;  1NTM E;  3L75 E;  1NTZ J;  3EQ2 A;  1JNM A;  2D2C D;  2POH A;  3L71 D;  1JY3 N;  2JEE A;  4BRY A;  4XFJ A;  4YPC A;  4GOE A;  3GLM A;  3G3Z A;  2R3C A;  1SQQ E;  2OTL P;  3CCS P;  2MJZ A;  3I5C A;  2KSE A;  3H1J E;  4HH2 A;  2NRG A;  1SQP J;  3CX5 I;  2XZR A;  3M9B A;  1HWT C;  4H44 D;  1VF5 C;  1KD1 Q;  2P67 A;  1CI6 B;  3A0B E;  2R3S A;  1MFT A;  1LT1 A;  2FXP A;  2Q9I A;  4ASW A;  4H0L C;  1QX8 A;  1HJB A;  1LNQ A;  4H13 B;  3R4Y A;  1YHQ P;  5BVZ A;  1ZOY C;  2E5Y A;  2HPC A;  3MHV A;  2RN0 A;  3VP8 A;  1H8A A;  2B9B A;  1LWU C;  2QJP C;  1KQS O;  1SQB J;  1OW6 A;  2Q6Q A;  3JCU H;  3L74 E;  1LP1 B;  1FZC A;  2V7Q J;  3VOP A;  3CPW O;  5CHX A;  5KLV J;  3OA7 A;  1VQ5 P;  3G4S P;  3PJS K;  1IK9 A;  2HG5 D;  4YTP C;  5AW8 B;  3WMM 0;  3ABV C;  1X79 B;  1IFD A;  2JWA A;  1YYC A;  1PP9 G;  1K05 A;  3GG2 A;  3U59 A;  1A02 J;  1L4A A;  1NTK G;  1LGH B;  1OIP A;  1L4A D;  4KHX A;  4N3Y B;  1LT9 A;  1TU3 F;  2B87 A;  2N1T A;  1A02 F;  1NU1 D;  3P7K A;  2GUS A;  3UIA A;  2N1T D;  2A06 D;  2YXR B;  2QEX P;  1EZV D;  2V4H A;  3RL0 g;  1KB9 H;  2N9Y B;  3V2R A;  4L74 A;  1USD A;  2KS1 A;  2R44 A;  1YBK A;  3N4X A;  1G2C B;  3L72 E;  4BWN A;  1BSN A;  1SQX E;  3L70 G;  2OYI A;  2RH0 A;  4C7N B;  1SQV G;  3CWB J;  4JF7 A;  2H8P D;  3BCC G;  1H88 A;  3HD7 B;  3R2P A;  3L73 E;  1H0T A;  3V6I A;  4UB8 E;  3H1H G;  3M0D A;  4D6T G;  2QJY B;  1ZP0 C;  4GIF A;  3BRT B;  3O6Q B;  1VDF A;  3CCU P;  1GL2 C;  5AW3 B;  3M9H A;  3LW5 J;  3BRV B;  1RE3 C;  3CCM P;  2IBZ E;  2FYU D;  2PGD A;  2M3B A;  1X9V A;  3GHG A;  4PJ0 E;  3GF3 A;  5GTI H;  1OMI A;  2FFD B;  1JCC A;  3AE5 C;  3PRJ A;  3AED C;  1NH4 A;  1OW8 A;  2Q7C A;  2QJK C;  1CI6 A;  4IL6 H;  4DOJ A;  2XDJ A;  4PD4 H;  3A5T A;  1J1D C;  1FZF A;  1ZRT D;  3HE4 B;  3CXH D;  2WVR A;  1YIJ P;  2WSS H;  3T97 B;  2HFE D;  2P10 A;  4H13 D;  2OQQ A;  1VQ4 P;  1CW5 A;  1W2E A;  2PRR A;  2CPS A;  1D7M A;  1LP1 A;  2E75 C;  1NTZ K;  1KQL A;  2ZXE B;  1LTT C;  2KLV A;  5KTB A;  2H7H A;  3H1I G;  5H2F H;  1N8R Q;  1ZW0 A;  1USE A;  2E76 C;  1DH3 A;  1Y47 A;  2HOD A;  1LTS C;  2NPS C;  2ZAE B;  1PP9 E;  1U57 A;  1BGY D;  1NTK E;  3JCU E;  3V2P A;  1L0L D;  2ZVN B;  4GDO A;  1J1E B;  2G3A A;  5E79 H;  1JOC A;  1LJ2 A;  2ZT9 B;  1M90 Q;  1W5C E;  3AE4 C;  3RK2 B;  5CCG A;  5KJ7 C;  4L76 A;  1AVY A;  4DT0 A;  2YO2 A;  5CCG D;  5KAI H;  1NTM J;  4PV1 C;  3L75 J;  1QVF O;  1SQB K;  4JYC A;  1L0L K;  1KYO I;  3L71 G;  1BE3 D;  3TYY A;  4C7N A;  4YXD C;  1P84 D;  1SQQ J;  2WMM A;  3K5B A;  3L70 E;  1QL2 A;  1DEB A;  1DX7 A;  1SQV E;  1LTJ C;  1KB9 E;  3H1J J;  3HD7 A;  3H1L D;  5AW7 B;  3GF7 A;  3HD7 D;  2IFM A;  1JY2 P;  1VQO P;  3H32 A;  1QL1 A;  3AE9 C;  3BCC D;  3O6Q A;  1RE4 A;  1G1I A;  1L0N D;  3AE8 C;  3HE5 B;  1EDK A;  3H1H E;  3CCL P;  4D6T E;  1LTB C;  1KIL E;  2IFN A;  3AE7 C;  3E1R A;  3VMY A;  1KTM A;  2W83 C;  2M8R A;  1J2J B;  1NYH A;  3WU2 E;  2FBW C;  2JKV A;  3AEC C;  1GW3 A;  4Z1M H;  1L0N K;  2HPC B;  2WSF H;  2FYN C;  2KLU A;  4DCK A;  3TGU D;  1JY3 O;  2CPB A;  2Q3I A;  1VQL P;  3D70 A;  3T97 A;  2KP8 A;  1E5W A;  2E42 A;  3NXS A;  3CL3 D;  3AE6 C;  1Y8A A;  3B5N B;  2KUB A;  5APS A;  1X8Y A;  5GTI E;  5AVU B;  1YQ3 C;  1NU1 G;  2A06 G;  1YI2 P;  4IL6 E;  1EZV G;  1JY2 N;  4PD4 E;  1SS1 A;  5APT A;  1PFI A;  2C9N Y;  4U3F D;  3RK3 C;  3HTK A;  5CMZ A;  4I1L A;  1S5L X;  2QIW A;  4JPZ B;  3OJA B;  2JP3 A;  2W8Z A;  4Y99 C;  1NWQ A;  3H1I E;  2UWJ E;  2OTK E;  1N7S C;  1HTL C;  4ZKP A;  3RK3 E;  2GM4 A;  2KSJ A;  3L72 J;  2IYO A;  3CX5 D;  1SQX J;  2KS1 B;  5APW A;  1GMJ A;  1M1J C;  3B71 A;  1HGZ A;  1RF1 A;  1EDI A;  4EYY Q;  3O8Z A;  2E74 C;  4WY4 C;  1EC5 A;  2OYI B;  1NGM B;  5H2F E;  1AQT A;  2YKO A;  2L5G B;  3L73 J;  1K04 A;  1YTZ I;  3MUD C;  3RK2 D;  1N86 A;  1PL5 A;  2D2C C;  3CCQ P;  2WPV B;  5KLI C;  2K9J A;  1URQ B;  2WSC H;  3VMX A;  4IFD K;  1H89 A;  2WPS A;  1HH0 A;  2FYU G;  4JBZ A;  3CME P;  2HR3 A;  1H0T B;  1SLQ A;  4NPF X;  1Z56 A;  5AW1 B;  1PGP A;  3L71 E;  5E79 E;  3SSU A;  4EI2 A;  3CXH H;  5AVR B;  1EXJ A;  2K1A A;  1AA0 A;  4H44 C;  1KQF B;  1VL2 A;  2KYV A;  5KAI E;  3GHG B;  4OVN F;  4JYB A;  3HE5 A;  4K3A A;  2C0W A;  2KZI A;  3AEA C;  4IL6 X;  2Y0E A;  1DEE G;  1PPJ G;  3CC4 P;  3KQG A;  1FC2 C;  5AW0 B;  2JJL A;  1ZR4 A;  1M57 D;  3Q1M A;  1S4X A;  2A45 H;  5L8R J;  3KPE A;  1GL2 B;  2P2U A;  1S1C X;  1FJP A;  1KFN A;  3CMA P;  1AFO A;  4I7Z B;  2BCC D;  1S3J A;  3GW6 A;  1NTM K;  2DW3 A;  1FZC C;  2XU6 A;  3RL0 C;  4GOF A;  2KI7 B;  2A45 G;  3FX0 A;  1FS0 E;  2YKQ A;  1NKZ B;  1SFC B;  3M0A A;  2AEJ A;  3B4S A;  1U7M A;  3CCV P;  1QGK B;  3WUT A;  1ZN5 A;  3B5N A;  1L4A C;  2PP6 A;  2Z4E A;  4RKU J;  3B5N D;  4IFM A;  5CCH A;  1PP9 J;  1RQV A;  2KNC A;  2WSE H;  1BGY G;  1LT9 C;  3IR9 A;  2KK7 A;  1KQG B;  1NTK J;  5CCH D;  1MUU A;  1L0L G;  2K3R A;  2M3E A;  4AQR D;  1FDM A;  1IFI A;  1ZXG A;  2HOD B;  1FZB A;  4AUW A;  1NU1 E;  1DD4 A;  1LTA C;  2H88 C;  4HB1 A;  1GK4 A;  2A06 E;  2E75 B;  1EZV E;  2BAS A;  2AEF A;  2I8D A;  1S5L H;  4A7P A;  3KDP B;  3EFF K;  1VQN P;  4MN4 C;  5AW5 B;  1BE3 G;  4AYC A;  5K5G B;  1AQ5 A;  4JQ0 D;  1T8Z A;  2AXT H;  3AEE C;  1RQU A;  5DJU B;  2WWW A;  3L70 J;  2WIT A;  3NTN A;  2Q3E A;  1N73 C;  3G6E P;  2OGU A;  1SQV J;  3H1L G;  3RBZ A;  3AE1 C;  1ZME C;  2GUV A;  5APX A;  2Y0D A;  1PV3 A;  2OYH B;  2VRS A;  5B5E H;  3AE2 C;  1S9K D;  2FYZ A;  1L0N G;  1URQ A;  2O1J A;  1MKM A;  3H1H J;  1URQ D;  4D6T J;  3WU2 H;  1BCC D;  5AVX B;  3H32 B;  5AW6 B;  2GA1 A;  1IO4 A;  2XNX A;  2FY8 A;  2OTJ P;  3EFG A;  5GTH H;  2FYU E;  3H1K E;  1JMM A;  3P8M C;  3Q3D A;  3HUS B;  4DZO A;  3KZI H;  3TGU G;  3Q2Y A;  3VMA A;  3II6 A;  2KIK A;  3SWK A;  4H13 C;  2RKL A;  1ZRT E;  1GL2 A;  3IN6 A;  1NTZ D;  1FOS E;  3NMD A;  3CXH E;  4LGD E;  1RE3 A;  1GL2 D;  3D6Z A;  1PPJ D;  1FU1 A;  4W7Z A;  2Q5U A;  3L37 A;  4UB6 H;  1NOH A;  4XE5 B;  3RBX A;  1KMI Z;  3AEG C;  3TK1 A;  3CX5 H;  1KYO D;  1SFC A;  4U3F G;  1SQP D;  1SFC D;  4K35 A;  5KKZ B;  1VQ6 P;  2KB7 P;  2Z5H A;  3H1I J;  2JR8 A;  3HTK B;  2R32 A;  1IZN B;  5KAF H;  2J5U A;  5CBN A;  2W90 A;  3CCJ P;  4RJT A;  1SQP K;  4OGQ B;  1BGY E;  2P1J A;  1L0L E;  1SQB D;  2N9B A;  1FE6 A;  2IBZ I;  5CCG C;  3TSI A;  2E75 D;  3SWF A;  1HJ0 A;  2FXM A;  1RF1 B;  4ZNC A;  3FWN A;  2WPQ A;  5KLV D;  1NAF A;  3VYI A;  5EFW B;  1W2B O;  2BEZ F;  3ITK A;  2HLO A;  1R5L A;  3A0H H;  1EQ7 A;  2E76 D;  4Y99 B;  3TF5 A;  4W80 A;  3L71 J;  2NPS A;  1BE3 E;  1IFN A;  1JY2 O;  3CC2 P;  4WWI A;  1WMK A;  2K9J B;  2NPS D;  1RF0 C;  1LTI C;  3L4F A;  3M91 A;  4R4M A;  3HD7 C;  1P84 E;  4N78 D;  5KLV K;  5AW2 B;  2OYH A;  1T3U A;  3V2Q A;  1S5L E;  2XKM A;  2QJY C;  3VTP C;  2Y9Y A;  3H1L E;  1RE4 C;  2YIU C;  1NTK K;  2HYN A;  5KJ7 A;  1PZQ A;  3CI9 A;  5C39 A;  2AXT E;  3FWL A;  3BCC E;  5KJ7 D;  3FXE A;  1L0N E;  3PHL A;  1KIL C;  2WQY C;  3Q5P A;  4WBA A;  1VQP P;  1JO5 A;  1WT6 A;  2YKP A;  3PLN A;  2FFD C;  2QM7 A;  2BCC G;  1UIX A;  5B5E E;  3JC2 2;  2ZFC A;  3CWB D;  3HUS A;  1AV1 A;  4I6M C;  1GD2 E;  1FZG A;  1X22 A;  1LTG C;  2WT7 B;  3AE3 C;  4L75 A;  1HBW A;  3L74 J;  3OAK A;  1JUN A;  1MZ9 A;  3TGU E;  2OAR A;  5GTH E;  1BSH A;  1VQ9 P;  3WUV A;  2RMZ A;  1VF5 B;  2E5T A;  5AVQ B;  3KZI E;  1KFM A;  2WSF J;  3P8C D;  4H0L B;  2YNY A;  1XTC C;  1NU1 J;  1GDT A;  2KNC B;  1X0T A;  3MD0 A;  5TIS H;  3RL0 B;  2KXP B;  1JMB A;  1Q7Y Q;  1LWU B;  4U3F E;  2QJP B;  1G1J A;  4IFF A;  4ZMD A;  1OVU A;  2JWD A;  1KB9 I;  2C0X A;  1HVV A;  4ZKU A;  4HYT B;  4CPG A;  1JY3 P;  1J1E C;  2H89 C;  2IPP A;  4R4L A;  4UB6 E;  4YXW H;  4RO0 A;  2ZT9 C;  2WPR A;  3CX5 E;  2O3J A;  4OGQ D;  3OW2 O;  1BDC A;  5B66 H;  3M06 A;  1EDL A;  3NFQ A;  2J58 A;  1T2K C;  1PGJ A;  1QVG O;  5AVZ B;  1AVO A;  3W68 A;  5BU5 A;  5KAF E;  1EXI A;  2B89 A;  4L73 A;  2QG4 A;  3C1L A;  1BCC G;  3TNU B;  3EWK A;  2O1K A;  1JCD A;  2P58 A;  2H43 A;  2FYU J;  3H1K J;  2BEQ D;  1L2P A;  1KOR A;  1Y9B A;  2QVA A;  3ZDM A;  2PFX A;  2E43 A;  1VQK P;  1XTG B;  3MZW B;  1NKN A;  2E74 D;  5DJT B;  2WSC J;  4ASV A;  1PGO A;  1OWA A;  2CK3 H;  3A0H E;  3JSV C;  1RHZ B;  2IBZ G;  1KYO H;  1NTM D;  2Q1K A;  3L75 D;  1NTZ G;  2ZYA A;  2YO3 A;  1M56 D;  4PD4 I;  1NVO A;  2L91 A;  3BAT A;  2LKM A;  3LIE A;  1FBM A;  3S1K A;  3MTU E;  1FOS F;  1SQQ D;  3A3Y B;  2BCC E;  3S9O A;  3H1J D;  2WT7 A;  2QA4 P;  1SQP G;  3B8E B;  2FXO A;  3P32 A;  1SVF A;  1VQM P;  4TT3 H;  1SP4 A;  3B5N C;  3CCR P;  3D6Y A;  5M1B A;  5CJ0 A;  5CCH C;  2V7Q H;  1UII A;  1SQQ K;  3VP9 A;  5CBO A;  2QJK B;  1VF5 D;  4B86 A;  1J1D B;  1PIX A;  1BGY J;  2QRX A;  3U1A A;  1DIP A;  1FJK A;  3HRN A;  1L0L J;  4H0L D;  3KYQ A;  3QWO C;  1SQB G;  2N1T C;  3V2N A;  3PTZ A;  3L35 A;  3SWY A;  3L74 D;  3VMZ A;  1OXZ A;  3RL0 D;  1LWU A;  2M5A A;  1BDD A;  1E79 H;  2ZYD A;  4QMA A;  5KLV G;  1M7L A;  1P84 H;  4C46 A;  1T6A A;  2WSE J;  2K37 A;  3M9Q A;  1NAY A;  1HF9 A;  1BE3 J;  1K73 Q;  3V4W A;  4OH8 B;  1Q90 D;  3MGN A;  2E76 B;  2OYI C;  5TIS E;  1YQ4 C;  4LLH A;  3SFD C;  3AEB C;  1YTZ T;  4WVZ A;  2NPS B;  2YMK A;  1IFP A;  4NPE A;  3H1L J;  2G8Y A;  1URQ C;  3USS A;  1YJN P;  1S9K E;  2QE7 H;  3TNU A;  3BCC J;  2K88 A;  2ZJS E;  3M0D C;  2QM8 A;  2YXQ B;  1M1K Q;  1L0N J;  1NU1 K;  1T3J A;  4GKG A;  1R8E A;  4RES B;  1BCC E;  2IX7 C;  3Q5S A;  5B66 E;  3L72 D;  1SQX D;  2IZ0 A;  3A2A A;  4PV1 B;  1NHL A;  3VN0 A;  3CWB G;  4XA4 A;  4C7R A;  1IFM A;  3LW5 H;  3GHG C;  1N73 A;  1K9M Q;  1YJW P;  1KV4 A;  4KT0 J;  4NPD A;  1MV8 A;  1KC8 Q;  3FGA D;  1FDO A;  2JO1 A;  2IYP A;  2R5D A;  2NZ2 A;  3L73 D;  1JM0 A;  2XV5 A;  1M8O B;  1GU4 A;  3TGU J;  1LTJ B;  2YIU B;  2ZVO B;  1SQX K;  1VPC A;  1DD3 A;  3U1C A;  2SPZ A;  2XND H;  3H1K D;  1OVR A;  4I7Z C;  1Q2N A;  1EDJ A;  1NO4 A;  1NTZ E;  1OFC X;  2IBZ D;  1KIL B;  1CZQ A;  1EZV I;  3LID A;  1RY3 A;  2I1K A;  1PPJ E;  5APY A;  2W6A A;  4LC1 A;  3QH9 A;  3G9R A;  2R5B A;  1K8A Q;  1SFC C;  3WUU A;  2MKV A;  3I56 P;  3IAO A;  1KYO E;  5AW4 B;  2FYU K;  1FZE A;  3BAS A;  4U3F J;  1SQP E;  2KZJ A;  3FXD A;  2O01 N;  5CJ4 A;  1CSB A;  2OYO A;  2FYN B;  3KHU A;  3F5H A;  1YIT P;  2ITA A;  3E1I A;  2JDI H;  3V5B A;  1GU5 A;  1SQB E;  3H25 A;  1N2D C;  2QSI A;  2AEM A; 
#chains in the Genus database with same CATH homology
 4EOT A;  5AW9 B;  4JYB A;  2OYI A;  5AVQ B;  3HE5 A;  2C0W A;  4C7N B;  3H6P A;  1KFM A;  3P8C D;  2O01 H;  2W6B A;  2YNY A;  1XTC C;  3KQG A;  1KZU B;  4N6J A;  4JF7 A;  3L36 A;  1GDT A;  5AW0 B;  2JJL A;  3RK3 B;  1ZR4 A;  5APU A;  2A45 H;  1JTH B;  2H8P D;  3MD0 A;  5AVY B;  3A7O A;  3RL0 B;  3KPE A;  1GL2 B;  1H88 A;  2P2U A;  3HD7 B;  3R2P A;  1IFJ A;  2C9L Y;  1LWU B;  1FJP A;  3N7N A;  1KFN A;  1G1J A;  2OYH C;  1N7S B;  3M0D A;  1AFO A;  4IFF A;  4EIJ A;  1NTM K;  4GIF A;  3BRT B;  3IFM A;  1FZC C;  2XU6 A;  4N78 E;  5AVW B;  3RL0 C;  1VDF A;  1GL2 C;  5AW3 B;  3M9H A;  4O9B A;  2C0X A;  1HVV A;  1MFZ A;  4ZKU A;  4HYT B;  1M1J B;  1JY3 P;  1J1E C;  3BRV B;  1RE3 C;  2A45 G;  2IPP A;  2M3B A;  2YKQ A;  4I2L C;  1NKZ B;  2WPR A;  1SFC B;  1X9V A;  2WTY A;  3M0A A;  1G2C A;  5AVS B;  4WY4 B;  5AVT B;  1HUC A;  1ZN5 A;  3GHG A;  3B5N A;  3M06 A;  1L4A C;  3MIW A;  2PP6 A;  3NFQ A;  2J58 A;  2Z4E A;  3B5N D;  1T2K C;  2FFD B;  1JCC A;  4IFM A;  5CCH A;  2WSE H;  5AVZ B;  1NH4 A;  2A45 I;  1LT9 C;  3IR9 A;  2Q7C A;  1GZL A;  1MUU A;  5CCH D;  3HUS C;  1RF0 A;  1CI6 A;  1ZV8 A;  5BU5 A;  4DOJ A;  4AQR D;  1FDM A;  1FAV A;  2XDJ A;  3A5T A;  1J1D C;  1IFI A;  1FZF A;  1N7L A;  3TNU B;  2HOD B;  1FZB A;  3HE4 B;  2O1K A;  1JCD A;  4AUW A;  1LTA C;  2H43 A;  5AVV B;  1GK4 A;  1WRG A;  2HFE D;  2W27 A;  1LTJ A;  1GW4 A;  4W7Y A;  2BAS A;  1CW5 A;  1W2E A;  3KDP B;  2CPS A;  1KIL A;  1ZLL A;  2E43 A;  5AW5 B;  1NTZ K;  1XTG B;  4AYC A;  1AQ5 A;  1KQL A;  1T8Z A;  2ZXE B;  1NKN A;  1KIL D;  1LTT C;  2KLV A;  1SQV K;  5KTB A;  1OWA A;  2H7H A;  2FFD A;  2WWW A;  2WIT A;  3NTN A;  1IC2 A;  3P8C E;  1N73 C;  3PP5 A;  1ZR2 A;  2YO3 A;  1DH3 A;  2GUV A;  3BAT A;  5APX A;  5BU8 B;  2HOD A;  2LKM A;  2VRS A;  5APQ A;  3V4Q A;  3HE4 A;  3LIE A;  2OYH B;  1LTS C;  2NPS C;  1S9K D;  2FYZ A;  2J59 M;  1FBM A;  1FZC B;  4WB4 A;  3MTU E;  1FOS F;  1URQ A;  3V2P A;  2O1J A;  3A3Y B;  2KOG A;  1J1E B;  1URQ D;  1JOC A;  2I1J A;  2WT7 A;  5AVX B;  3H32 B;  2YMY A;  5AW6 B;  3B8E B;  1IO4 A;  2XNX A;  1HGV A;  3P32 A;  1SVF A;  3C9I A;  3EFG A;  1SP4 A;  3B5N C;  3RK2 B;  1JMM A;  5CCG A;  3P8M C;  1L4A B;  5KJ7 C;  2YO2 A;  5CCG D;  1RF1 C;  5CJ0 A;  5CCH C;  1SQB K;  1SQQ K;  3VP9 A;  1LT9 B;  4JYC A;  1L0L K;  2N1T B;  1GTW A;  3HUS B;  2P7J A;  4DZO A;  3RK2 C;  3TYY A;  4C7N A;  4B86 A;  1J1D B;  1FZA A;  3II6 A;  3U1A A;  1FJK A;  3HRN A;  4GT1 A;  3KYQ A;  1QL2 A;  1JTH A;  1DEB A;  2N1T C;  1DX7 A;  3V2N A;  1GL2 A;  3RK3 D;  1LTJ C;  3CLQ A;  1FOS E;  3NMD A;  3L35 A;  3SWY A;  3VMZ A;  3HD7 A;  3BVH A;  1OXZ A;  5AW7 B;  4LGD E;  1LWU A;  2PAJ A;  3RL0 D;  1RE3 A;  1GL2 D;  3HD7 D;  2IFM A;  1FU1 A;  1JY2 P;  1N7S A;  4W7Z A;  3H32 A;  2FKW B;  1QL1 A;  1M7L A;  1RE4 A;  1N7S D;  4C46 A;  1G1I A;  2Q5U A;  3L37 A;  3HE5 B;  1M1J A;  1NOH A;  1GK6 A;  4XE5 B;  3M9Q A;  3TK1 A;  1LTB C;  1IJD B;  1SFC A;  4M3L A;  5APV A;  3V4W A;  2Z5I A;  1T2K D;  4OH8 B;  4WY4 A;  3MGN A;  1SFC D;  2IFN A;  1N73 B;  2OYI C;  4WY4 D;  3MUD A;  4LLH A;  3VMY A;  1YTZ T;  2M8R A;  2KB7 P;  2WZ7 A;  2Z5H A;  2NPS B;  1J2J B;  3HTK B;  3EQ2 A;  1JNM A;  1GW3 A;  2R32 A;  1L0N K;  2POH A;  2HPC B;  1JY3 N;  1URQ C;  2JEE A;  2WSF H;  1S9K E;  3G3Z A;  1JY3 O;  2CPB A;  2Q3I A;  3TNU A;  2R3C A;  1SQP K;  3M0D C;  2QM8 A;  2P1J A;  3T97 A;  2KP8 A;  1E5W A;  2E42 A;  3NXS A;  1NU1 K;  3CL3 D;  1T3J A;  4GKG A;  2N9B A;  2MJZ A;  4RES B;  3I5C A;  3B5N B;  2IX7 C;  5APS A;  1X8Y A;  4HH2 A;  5CCG C;  3TSI A;  3SWF A;  2FXM A;  2XZR A;  5AVU B;  1RF1 B;  3M9B A;  2WPQ A;  3A2A A;  1HWT C;  1NHL A;  3VN0 A;  4XA4 A;  1NAF A;  3VYI A;  4C7R A;  1IFM A;  3LW5 H;  2P67 A;  3GHG C;  1N73 A;  1CI6 B;  2HLO A;  1MV8 A;  1EQ7 A;  2Q9I A;  4Y99 B;  1JY2 N;  1HJB A;  2R5D A;  4W80 A;  2NPS A;  5APT A;  1PFI A;  1IFN A;  2XV5 A;  2C9N Y;  3RK3 C;  3HTK A;  1GU4 A;  1JY2 O;  5CMZ A;  4I1L A;  2NPS D;  1RF0 C;  5BVZ A;  3OJA B;  1LTJ B;  2HPC A;  1LTI C;  3L4F A;  3M91 A;  1SQX K;  3HD7 C;  3VP8 A;  1VPC A;  4N78 D;  1H8A A;  1LWU C;  4Y99 C;  5KLV K;  3U1C A;  1NWQ A;  5AW2 B;  2OYH A;  1T3U A;  3V2Q A;  1N7S C;  1HTL C;  4ZKP A;  2GM4 A;  1NO4 A;  2XKM A;  1KIL B;  1CZQ A;  2KSJ A;  3VTP C;  1FZC A;  3VOP A;  3LID A;  1RE4 C;  1RY3 A;  2I1K A;  5APW A;  1NTK K;  2HYN A;  5CHX A;  5APY A;  1M1J C;  2W6A A;  3OA7 A;  5KJ7 A;  4LC1 A;  3CI9 A;  1HGZ A;  1RF1 A;  2R5B A;  1IK9 A;  1SFC C;  5KJ7 D;  2HG5 D;  5AW8 B;  3WMM 0;  1KIL C;  3O8Z A;  1X79 B;  4WY4 C;  1IFD A;  1YYC A;  4WBA A;  2OYI B;  1JO5 A;  1WT6 A;  2YKO A;  3U59 A;  2L5G B;  5AW4 B;  1L4A A;  1A02 J;  2FYU K;  1FZE A;  3BAS A;  1YTZ I;  2YKP A;  1LGH B;  3RK2 D;  2FFD C;  1N86 A;  2QM7 A;  1L4A D;  4KHX A;  5CJ4 A;  4N3Y B;  1CSB A;  1LT9 A;  2ZFC A;  2N1T A;  1A02 F;  3HUS A;  1URQ B;  2WSC H;  3VMX A;  4IFD K;  1H89 A;  3P7K A;  2GUS A;  2WPS A;  4I6M C;  1GD2 E;  1HH0 A;  3UIA A;  2N1T D;  1FZG A;  1LTG C;  1SLQ A;  1Z56 A;  5AW1 B;  2WT7 B;  1HBW A;  3OAK A;  1JUN A;  1MZ9 A;  5AVR B;  2OAR A;  3E1I A;  3V2R A;  3V5B A;  1GU5 A;  3N4X A;  1G2C B;  2KYV A;  1N2D C;  3GHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...