1SQXG

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqxG00
1NTMG 1SQQG 3TGUG 4D6TG 1SQVG 4PD4H 3CWBG 4U3FG 3L75G 3CXHH 3CX5H 1BGYG 1PPJG 5KLVG 3H1LG 3H1IG 1BCCG 1EZVG 2IBZG 2A06G 1SQBG 1KB9H 3L74G 3L71G 1L0LG 2FYUG 3H1HG 1KYOH 1NU1G 3H1JG 3L70G 3L72G 3L73G 2BCCG 3BCCG 1PP9G 1SQXG 1L0NG 1BE3G 1P84H 1NTZG 1NTKG 3H1KG 1SQPG
chains in the Genus database with same CATH superfamily
2O01H 1L0NK 4L73A 2YNYA 4RO0A 4XE5B 3CC2P 4M3LA 4WY4D 1H88A 1CSBA 2BCCE 2E5YA 5AW7B 4RESB 1MUUA 5KLVK 2OTKE 2YXRB 5B5EE 1G2CB 5GTHH 1KILA 1ZN5A 3H1IJ 2KOGA 2ZFCA 4NPEA 3B5NB 4LLHA 1PV3A 1BGYG 2C9LY 1ZLLA 3L70J 4R4MA 1LWUB 2YO2A 1VL2A 1S2EA 4L76A 3L75D 3SFDC 1JUNA 1R8EA 3CWBJ 5B5EH 1KQSO 1L0LK 1NYHA 2AEMA 3TF5A 2KB7P 3L71D 3H1HJ 4N6JA 1LNQA 1CI6A 2A45G 2YIUB 4N78D 2OQQA 1TU3F 1KYOD 2QJKC 1OFCX 1S72P 2A45H 2K37A 3R4YA 3RBZA 3H1IE 2N9BA 4ASVA 3L70E 3HD7A 1T2KC 3H1KE 3PTZA 2N1TA 3H1IG 3GHGB 1DX7A 3CWBE 1SQVJ 2KS1A 1PP9G 1HTLC 2I1JA 1H0TA 1H8AA 3SWYA 5AW8B 4ASWA 4L75A 4H13D 1VQKP 2YXQB 1FBMA 1W2BO 1EZVG 2JWDA 3H1HG 4DZOA 1RF1B 4GKGA 1QL1A 1JB0J 3JCUE 3E1IA 1T3JA 4H44B 3D6YA 5DJUB 1VDFA 3NMDA 3MGNA 1URQC 4JQ0D 2IBZE 2RN0A 2AXTE 2WMMA 1SQVG 5GTIH 3JCUH 3CXHE 1IFDA 3CMAP 5AVYB 3AE8C 1SQXD 1M57D 1NVOA 3OAKA 1Q90D 4CPGA 2E76C 2IBZG 3E1RA 1D7MA 2Q3EA 1JY2P 4WY4C 3E7KA 2FYZA 5AVTB 2PAJA 3EFGA 1DH3A 3TNUA 2CK3H 4C7NB 2J5UA 5BU5A 4JBZA 3L74D 1OXZA 2AXTH 3RK3D 3CXHH 5L8RJ 1NTZJ 1YJ9P 3L71G 3OJAB 3OA7A 4W80A 2Q1KA 1P84H 1FC2C 1N7SD 5TISH 2QJYC 1L4AB 1YIJP 3Q1MA 2N9YB 2QE7H 3M0DC 2A45I 4LC1A 4Y28J 1OVUA 3VOPA 4HYTB 4UB8E 4W7ZA 5AVQB 3I56P 1KV4A 2HODB 3F5HA 1FJKA 1NTZE 3SSUA 3GMAA 2JDIH 1G1JA 2LR2A 2WTYA 2I8DA 5KLVD 3H1LD 2M0BA 2IZ1A 1JY2O 1GK4A 3Q2YA 4GOEA 5KTBA 1OZHA 1EZVI 1KN7A 2HR3A 4H13C 3WUVA 2WPQA 3CX5I 3CCLP 2LKMA 4I7ZC 2XKMA 2R44A 1FZFA 3S4RA 3MUDA 2W6AA 3CCJP 4D6TJ 3QH9A 2K9YA 2ZYGA 1SQXG 4N3YB 2PFXA 1USEA 1FS0E 3FXDA 5CCHA 1KFNA 1ZMEC 2O3JA 5KAFE 3Q5RA 3U1AA 3BCCJ 1GL2C 2W83C 3O6QB 1SLQA 5AVSB 1KB9H 2OYIC 1VPCA 1W2EA 2IFMA 2IBZI 2KZIA 3S1KA 1NO4A 1EDLA 2J58A 1IFMA 1SQBD 2G8YA 2E74B 1AVYA 3P8CE 5KAFH 1FZCB 2P58A 2O1KA 1ZV8A 4RKUJ 3RL0B 1MKMA 3RK3C 1P84I 1HF9A 1RF0C 3RK2B 4D6TG 2Y9YA 2HLOA 3A2AA 3BCCE 3SWFA 1KFMA 1HGZA 1N7SC 3LIDA 2E5TA 4JYBA 1PGPA 1LTBC 3MTUE 2IDBA 3M0AA 5AVUB 3BCCG 1HVVA 2B87A 4AQRD 3AE3C 1JCDA 3UIAA 3T97A 2HYNA 2H43A 3HD7D 3HUSC 3HE4B 5APXA 4R4LA 3M91A 4WVZA 2N1TD 1DEBA 4OVNF 3TGUD 2M5AB 5BU8B 1LP1B 2B9BA 2HPCB 2FFDC 1RE3A 1JTHA 4H0LD 2CPBA 4EDFA 1WT6A 2XZRA 4GDOA 1ZW0A 3BRTB 5E79E 2FYUJ 2NPSC 3L37A 2KLVA 1OW8A 1DEEG 2Q9IA 3CCVP 2PRRA 4U3FD 1M1JC 1IK7A 1N73B 1G2CA 1N7SA 2ZJSE 1NTZK 2AEFA 2BCCD 1NU1J 3L73J 1J1EB 1LTSC 1KQGB 1BE3J 1LWUA 1SQPJ 2ZXXA 2JEEA 3IAOA 4HJGH 4QMAA 1DIPA 4DOJA 1NWQA 2OYHC 1VF5B 2ITAA 2WT7B 1SP4A 2SPZA 2FYUE 1Y8AA 1KB9I 3V4WA 2BASA 1Q81Q 5H2FH 3M9HA 3VP8A 1GZLA 1SQBG 5KJ7D 2WSCH 3P7KA 1SFCD 1SVFA 2RKLA 3NFQA 2R5BA 3M9QA 5CCGD 4K35A 3ABVC 4IFDK 2ZXEB 4PV1C 1NU1E 1CZQA 3A0HE 1SQPE 1PL5A 1KILC 3U59A 3L73G 2NZ2A 1BE3G 2R5DA 2Z5HA 3FX0A 2L91A 1Y9BA 3AEBC 1YI2P 4PJ0H 2FKWB 2E75D 3U1CA 2E74D 3A0HH 1IFPA 4OGQB 1FZGA 3H1KD 1JY3N 2HG5D 1GL2B 1QLED 3GW6A 1M90Q 1U7MA 1LTTC 3TGUG 1BCCJ 2Q6QA 1RF1A 3R2PA 2D2CB 3WUUA 1FJPA 4BWNA 3BASA 2C9NY 1T3UA 1IK9A 1BGYE 3HD7C 2R3CA 1OW7A 2KNCB 2N1TC 1AVOA 2YKQA 4DT0A 4U3FG 3AE6C 1K04A 2JWAA 4H0LC 1PP9J 1FDOA 5K5GB 2WITA 2ZYAA 3CCRP 2YMYA 2RH0A 1N7LA 3GLMA 1BCCE 2P67A 3GF7A 1J1DB 2YKOA 3H1JD 4C7NA 2QG4A 1GMJA 2LXBA 1NTKD 5KLIC 1BCCG 1NTMD 1IFIA 4Y99C 1Y47A 2KSJA 3H32B 2IZ0A 2Z5IA 5CCHD 1NAFA 2Q5UA 1PP9E 2MKVA 2WQYC 1L4AA 2Z4EA 1PIXA 1HGVA 3SFEC 1HJBA 1EZVE 3IFMA 1LGHB 2KZJA 3H1HE 3JC22 3CX5E 3G6EP 1JOCA 2QEXP 1SFCC 3V4QA 1HBWA 1SQQD 2HODA 1FAVA 1BSHA 1AQ5A 1R5LA 2OARA 3L75J 1ZRTE 2FYUK 1N8RQ 1ZR2A 5GTIE 1PGQA 3L72D 2O01N 3L71J 3CX5H 1Q2NA 2FYNC 5AW1B 4EI2A 1RH5B 3HE5B 1JMBA 1LT9B 1SQVE 4XA4A 2E75C 1NU1K 1JM0A 2ZYDA 3G71P 2KXPB 2O1JA 1S9KD 2JO1A 3MIWA 1SQPK 2KUBA 4U7JA 2P10A 3KDPB 2ZT9B 5KJ7A 3L75E 1IJDB 1SFCA 2M3BA 4KHXA 3CLQA 5KAIE 1L2PA 1P84E 2K88A 5CCGA 2G3AA 3L71E 5TISE 4PD4D 1RQVA 3L75G 4W7YA 4TT3H 2FY8A 3FXEA 4EYYQ 2OYOA 4N78E 2XU6A 4GT1A 3VP9A 5KKZC 4IFMA 5KAIH 1NTMG 3V6IA 3B5ND 1EDJA 2WPVB 1KYOH 5C39A 2IYPA 2UWJE 1GW4A 2IFNA 4IL6X 3MUDC 2JKVA 2WSFJ 3AE2C 1HWTC 3W68A 1L0ND 1SQXJ 3AE5C 2KS1B 1MZ9A 5CCHC 3PRJA 2L5GB 4YXDC 1H0TB 3P8MC 5APWA 3CMEP 2Y0EA 3L74J 2K9JA 1FZEA 1VQPP 1QL2A 5KLIB 5AW4B 1LP1A 3KPEA 1EC5A 2HPCA 2QJKB 3FWNA 3Q5SA 2QIWA 2FXPA 1L0LD 1LJ2A 1SQXE 4ZKUA 3AE4C 1KB9E 2C0WA 2QM8A 2HFED 3GF3A 2KP8A 2JR8A 2YMKA 3O8ZA 2A06D 3L74E 3ITKA 3IN6A 3RK3E 2WSFH 1GW3A 2XNDH 3CC7P 1YQ4C 1NKZB 1LTJC 4I1LA 5AW9B 1HH0A 1GU4A 4ZMDA 4H44D 4B86A 3L74G 1S5LH 3TNUB 5AVWB 3RBXA 5KLVJ 1PGJA 3H1LJ 2WT7A 3VYIA 3IR9A 2POHA 3A5TA 1UIIA 1IZNB 2IPPA 1SQVK 1RQUA 4IFFA 1RE3C 5DJTB 4D6TE 2ZT9D 1AA0A 1URQB 1YQ3C 2IX7C 1BSNA 3CPWO 4DCKA 3H6PA 1EDIA 1KYOI 2IYOA 1YHQP 2VRSA 2P1JA 2E76B 1LT1A 3CCUP 3BVHA 1M8OB 1PPJD 1L0NG 5CBOA 1LTJA 3B5NC 3H1LE 1JY2N 4WY4B 1LWUC 2W90A 3MD0A 1FOSE 5CHXA 1QVFO 1S5LX 5KLVG 1L4AD 3CL3D 1J2JB 3H1LG 2R32A 1VQ4P 2E42A 2WWWA 2WSCJ 1JNMA 1SQBJ 2YIUC 1G1IA 1KC8Q 1Q82Q 4LGDE 2QJYB 3S9OA 3EWKA 5EFWB 3TSIA 1L0LG 1JY3O 2J59M 3ZDMA 3HTKB 1JMMA 4ZNCA 2QVAA 4L74A 1K73Q 1EDKA 2WSEJ 3EFFK 3B5NA 1YJNP 3M9BA 1VQNP 3LIEA 5H2FE 1MV8A 1KQFB 1BGYD 4RJTA 1KILE 1SQBE 3AE9C 1HJ0A 1W5CE 1X8YA 4HKZH 1X9VA 1LTIC 5M1BA 3TGUJ 1RF1C 3GG2A 4TLFA 1AV1A 2YKPA 5APYA 3NXSA 1PFIA 1SQXK 3CCMP 1GDTA 4DJGA 4H13B 4H44C 4PJ0E 2ZVNB 2P2UA 3VMXA 2Q3IA 3L73E 3KZIH 4JF7A 1BE3E 3A0BH 4I7ZB 2GA1A 2H89C 3AEAC 3G4SP 3GHGA 1T8ZA 3VN0A 4U3FJ 4WB4A 1H89A 2E43A 3H1ID 1N86A 2LXCB 2QA4P 1E5WA 2W27A 1NOHA 1M1KQ 3L70D 1PPJG 2WSEH 2BCCJ 2PGDA 3BATA 1OVVA 1GK6A 3AEGC 2GM4A 3TGUE 4I2LC 3WU2H 3CWBD 4OWFA 3RL0D 3B4SA 2OYIB 3D6ZA 1URQD 3RK2D 3H1HD 1WMKA 4C7RA 5CBNA 2XV5A 4U3FE 4C46A 3PJSK 1LT9A 1M7LA 3RK3B 1L4AC 1NKNA 2WSSH 2Y0DA 4NPFX 3V5BA 4WBAA 1LTGC 3TK1A 1R5SA 1OWAA 1ZXGA 1SQVD 3H25A 1NGMB 1N7SB 2BCCG 3TDKA 2IBZD 2WZ7A 2KIKA 1RY3A 2OGUA 3CXHD 2AXCA 2FBWC 4JYCA 4NPDA 3D70A 3H1KJ 1AQTA 3HUSB 4BRYB 5AVVB 5CMZA 1P84D 5CJ4A 2FFDB 1A02J 1NJIQ 1USDA 1RE4A 1NAYA 1EQ7A 1N2DC 1YYCA 3I5CA 1VQ7P 2K3RA 2NPSB 3N4XA 2MJZA 3WMM0 2KSEA 2BEQD 1VQLP 3CD6P 1IC2A 1M1JB 1VF5D 5KJ7C 1JCCA 3JSVC 4KJMA 2QJPC 2XDJA 5CCGC 3P32A 1VQ6P 3BRVB 2V7QJ 3L70G 1SQBK 3L4FA 4JPZB 1Q7YQ 3V2PA 3H1KG 5B66E 3AEEC 2OYHB 3CWBG 1YITP 3H1JJ 4GODA 1K05A 4EIJA 4IL6E 1NTZD 1OMIA 1NTKJ 2KI7B 1NTMJ 4UB6E 1IO4A 3G3ZA 1Q86Q 1YJWP 2E74C 2FXOA 5B66H 2H88C 1FZCC 3RL0g 2P7JA 4O9BA 1S4XA 1XTCC 3RL0C 2FXMA 2WPRA 4PV1B 4IL6H 3IF4A 2NRGA 3C9IA 1FU1A 3RK2C 4OGQD 4UB6H 3V2QA 1GL2D 2W6JH 1KILB 2RMZA 3N7NA 1FDMA 3MZWB 3H1JE 1KMIZ 1PZQA 3C8VA 1NH4A 1NTKE 4HB1A 2D2CD 1IFNA 1XTGB 1NTME 5AW3B 1SQQJ 2V7QH 3O6QA 1KB9D 3H1JG 1KYOE 1U7JA 2PP6A 4IOIH 3USSA 4GOFA 1UIXA 1KD1Q 3V2RA 1NTKG 3L35A 1CI6B 3L72J 3EQ2A 2W6BA 5AW0B 1VQ5P 2KYVA 1FZCA 1A02F 5APQA 3F89A 1URQA 2BEZF 5TJHA 3HD7B 3WUTA 4EOTA 1VQMP 2N1TB 3P8CD 2DW3A 1SQQE 5AW5B 4AUWA 4D6TD 1M56D 4H0LB 1N73C 3AEDC 3Q5PA 1ZOYC 3OW2O 1SS1A 4A7PA 3MHVA 1SQQG 1EXJA 1BDCA 3VMYA 3L72E 1J1EC 4WY4A 2CPSA 1X22A 1DD3A 3BCCD 2Q7CA 1QEXA 1HUCA 2H7HA 1KQLA 3HE4A 1VF5C 3L72G 3PH0A 2NPSD 1KORA 2M5AA 1NTZG 4Y99B 1S9KE 4GIFA 4K3AA 1KZUB 4UB8H 2Y0CA 2WVRA 1E79H 1MFTA 3D71A 3QWOC 1RHZB 3CC4P 1S5LE 5AVZB 5AW2B 1KTMA 1FDIA 2JP3A 3KQGA 1S3JA 3HTKA 3M0DA 4PD4E 1N73A 4I6MC 2R3SA 3FWLA 4YPCA 1L0NJ 2GUVA 1SFCB 2QJPB 1MFZA 1VQOP 4AYCA 2KK7A 5AVXB 2V4HA 3I55P 1ZR4A 3PLNA 4PD4H 4OGQC 3KHUA 1JY3P 3HRNA 3G9RA 1VQ8P 2JJLA 1QVGO 4PV1D 5APTA 1JO5A 2FYNB 2H8PD 2OTJP 2D2CC 4KT0J 3CXHI 1KILD 2I1KA 3MP7B 2E75B 3VMZA 3L36A 2FYUD 1L0LJ 4XFJA 1L0NE 5AVRB 4BXLA 1GD2E 1OVRA 3RGUA 1OX3A 5KLVE 1ZP0C 1NTKK 1DD4A 1CW5A 1NTMK 1NU1D 3L73D 1BE3D 2XNXA 1YTZT 1X0TA 5APVA 1FZBA 1SQPD 3VTPC 2KLUA 1GL2A 1J1DC 2M8RA 3KYQA 1IFJA 1K8AQ 3AECC 2K9JB 5KKZB 2OYIA 4HH2A 1Z56A 3CI9A 1L0LE 3NTNA 2AEJA 2WPSA 4YXWH 1U57A 5AW6B 2B89A 3Q3DA 2A06E 3PP5A 1SQQK 1RF0A 2ZVOB 2KNCA 1AFOA 3GHGC 2OTLP 1FE6A 3B8EB 1LTAC 3B71A 2A06G 2M3EA 5BVZA 1PGOA 2QM7A 4MN4C 1T6AA 3II6A 3A3YB 4Z1MH 3CCSP 2C0XA 3KZIE 5E79H 3CCEP 1K9MQ 1WRGA 3AE7C 3A0BE 3LW5J 1AJYA 2YO3A 1T2KD 3HUSA 3PHLA 3KXDA 4BRYA 4PD4I 1VQ9P 1BCCD 1FOSF 2O01J 3VMAA 2K1AA 1BDDA 2FFDA 3H32A 1LT9C 3FGAD 3M06A 1OIPA 3WU2E 1OW6A 3CCQP 2FYUG 2NPSA 1PPJE 4YTPC 4OH8B 2QSIA 3A7OA 1QGKB 1EXIA 1M1JA 1X79B 5CJ0A 3K5BA 3AE1C 2ZT9C 1S1CX 1PP9D 5APSA 1JEKA 3AEFC 2Y9ZA 1LTJB 1NU1G 2B87B 1GU5A 1QX8A 2ZAEB 1BGYJ 4ZKPA 2QRXA 1GTWA 1FZAA 1SQPG 3T97B 4WWIA 1EZVD 3SWKA 5APUA 3CX5D 1NHLA 2OYHA 2B88A 3TYYA 2W8ZA 2GUSA 3LW5H 1YTZI 3C1LA 1JTHB 3HE5A 3V2NA 1RE4C 5GTHE 1YBKA 1ZRTD 2E76D 3W67A
chains in the Genus database with same CATH topology
1NTMG 1SQQG 3TGUG 4D6TG 1SQVG 4PD4H 3CWBG 4U3FG 3L75G 3CXHH 3CX5H 1BGYG 1PPJG 5KLVG 3H1LG 3H1IG 1BCCG 1EZVG 2IBZG 2A06G 1SQBG 1KB9H 3L74G 3L71G 1L0LG 2FYUG 3H1HG 1KYOH 1NU1G 3H1JG 3L70G 3L72G 3L73G 2BCCG 3BCCG 1PP9G 1SQXG 1L0NG 1BE3G 1P84H 1NTZG 1NTKG 3H1KG 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM G;  1SQQ G;  3TGU G;  4D6T G;  1SQV G;  4PD4 H;  3CWB G;  4U3F G;  3L75 G;  3CXH H;  3CX5 H;  1BGY G;  1PPJ G;  5KLV G;  3H1L G;  3H1I G;  1BCC G;  1EZV G;  2IBZ G;  2A06 G;  1SQB G;  1KB9 H;  3L74 G;  3L71 G;  1L0L G;  2FYU G;  3H1H G;  1KYO H;  1NU1 G;  3H1J G;  3L70 G;  3L72 G;  3L73 G;  2BCC G;  3BCC G;  1PP9 G;  1SQX G;  1L0N G;  1BE3 G;  1P84 H;  1NTZ G;  1NTK G;  3H1K G;  1SQP G; 
#chains in the Genus database with same CATH topology
 2O01 H;  1L0N K;  4L73 A;  2YNY A;  4RO0 A;  4XE5 B;  3CC2 P;  4M3L A;  4WY4 D;  1H88 A;  1CSB A;  2BCC E;  2E5Y A;  5AW7 B;  4RES B;  1MUU A;  5KLV K;  2OTK E;  2YXR B;  5B5E E;  1G2C B;  5GTH H;  1KIL A;  1ZN5 A;  3H1I J;  2KOG A;  2ZFC A;  4NPE A;  3B5N B;  4LLH A;  1PV3 A;  1BGY G;  2C9L Y;  1ZLL A;  3L70 J;  4R4M A;  1LWU B;  2YO2 A;  1VL2 A;  1S2E A;  4L76 A;  3L75 D;  3SFD C;  1JUN A;  1R8E A;  3CWB J;  5B5E H;  1KQS O;  1L0L K;  1NYH A;  2AEM A;  3TF5 A;  2KB7 P;  3L71 D;  3H1H J;  4N6J A;  1LNQ A;  1CI6 A;  2A45 G;  2YIU B;  4N78 D;  2OQQ A;  1TU3 F;  1KYO D;  2QJK C;  1OFC X;  1S72 P;  2A45 H;  2K37 A;  3R4Y A;  3RBZ A;  3H1I E;  2N9B A;  4ASV A;  3L70 E;  3HD7 A;  1T2K C;  3H1K E;  3PTZ A;  2N1T A;  3H1I G;  3GHG B;  1DX7 A;  3CWB E;  1SQV J;  2KS1 A;  1PP9 G;  1HTL C;  2I1J A;  1H0T A;  1H8A A;  3SWY A;  5AW8 B;  4ASW A;  4L75 A;  4H13 D;  1VQK P;  2YXQ B;  1FBM A;  1W2B O;  1EZV G;  2JWD A;  3H1H G;  4DZO A;  1RF1 B;  4GKG A;  1QL1 A;  1JB0 J;  3JCU E;  3E1I A;  1T3J A;  4H44 B;  3D6Y A;  5DJU B;  1VDF A;  3NMD A;  3MGN A;  1URQ C;  4JQ0 D;  2IBZ E;  2RN0 A;  2AXT E;  2WMM A;  1SQV G;  5GTI H;  3JCU H;  3CXH E;  1IFD A;  3CMA P;  5AVY B;  3AE8 C;  1SQX D;  1M57 D;  1NVO A;  3OAK A;  1Q90 D;  4CPG A;  2E76 C;  2IBZ G;  3E1R A;  1D7M A;  2Q3E A;  1JY2 P;  4WY4 C;  3E7K A;  2FYZ A;  5AVT B;  2PAJ A;  3EFG A;  1DH3 A;  3TNU A;  2CK3 H;  4C7N B;  2J5U A;  5BU5 A;  4JBZ A;  3L74 D;  1OXZ A;  2AXT H;  3RK3 D;  3CXH H;  5L8R J;  1NTZ J;  1YJ9 P;  3L71 G;  3OJA B;  3OA7 A;  4W80 A;  2Q1K A;  1P84 H;  1FC2 C;  1N7S D;  5TIS H;  2QJY C;  1L4A B;  1YIJ P;  3Q1M A;  2N9Y B;  2QE7 H;  3M0D C;  2A45 I;  4LC1 A;  4Y28 J;  1OVU A;  3VOP A;  4HYT B;  4UB8 E;  4W7Z A;  5AVQ B;  3I56 P;  1KV4 A;  2HOD B;  3F5H A;  1FJK A;  1NTZ E;  3SSU A;  3GMA A;  2JDI H;  1G1J A;  2LR2 A;  2WTY A;  2I8D A;  5KLV D;  3H1L D;  2M0B A;  2IZ1 A;  1JY2 O;  1GK4 A;  3Q2Y A;  4GOE A;  5KTB A;  1OZH A;  1EZV I;  1KN7 A;  2HR3 A;  4H13 C;  3WUV A;  2WPQ A;  3CX5 I;  3CCL P;  2LKM A;  4I7Z C;  2XKM A;  2R44 A;  1FZF A;  3S4R A;  3MUD A;  2W6A A;  3CCJ P;  4D6T J;  3QH9 A;  2K9Y A;  2ZYG A;  1SQX G;  4N3Y B;  2PFX A;  1USE A;  1FS0 E;  3FXD A;  5CCH A;  1KFN A;  1ZME C;  2O3J A;  5KAF E;  3Q5R A;  3U1A A;  3BCC J;  1GL2 C;  2W83 C;  3O6Q B;  1SLQ A;  5AVS B;  1KB9 H;  2OYI C;  1VPC A;  1W2E A;  2IFM A;  2IBZ I;  2KZI A;  3S1K A;  1NO4 A;  1EDL A;  2J58 A;  1IFM A;  1SQB D;  2G8Y A;  2E74 B;  1AVY A;  3P8C E;  5KAF H;  1FZC B;  2P58 A;  2O1K A;  1ZV8 A;  4RKU J;  3RL0 B;  1MKM A;  3RK3 C;  1P84 I;  1HF9 A;  1RF0 C;  3RK2 B;  4D6T G;  2Y9Y A;  2HLO A;  3A2A A;  3BCC E;  3SWF A;  1KFM A;  1HGZ A;  1N7S C;  3LID A;  2E5T A;  4JYB A;  1PGP A;  1LTB C;  3MTU E;  2IDB A;  3M0A A;  5AVU B;  3BCC G;  1HVV A;  2B87 A;  4AQR D;  3AE3 C;  1JCD A;  3UIA A;  3T97 A;  2HYN A;  2H43 A;  3HD7 D;  3HUS C;  3HE4 B;  5APX A;  4R4L A;  3M91 A;  4WVZ A;  2N1T D;  1DEB A;  4OVN F;  3TGU D;  2M5A B;  5BU8 B;  1LP1 B;  2B9B A;  2HPC B;  2FFD C;  1RE3 A;  1JTH A;  4H0L D;  2CPB A;  4EDF A;  1WT6 A;  2XZR A;  4GDO A;  1ZW0 A;  3BRT B;  5E79 E;  2FYU J;  2NPS C;  3L37 A;  2KLV A;  1OW8 A;  1DEE G;  2Q9I A;  3CCV P;  2PRR A;  4U3F D;  1M1J C;  1IK7 A;  1N73 B;  1G2C A;  1N7S A;  2ZJS E;  1NTZ K;  2AEF A;  2BCC D;  1NU1 J;  3L73 J;  1J1E B;  1LTS C;  1KQG B;  1BE3 J;  1LWU A;  1SQP J;  2ZXX A;  2JEE A;  3IAO A;  4HJG H;  4QMA A;  1DIP A;  4DOJ A;  1NWQ A;  2OYH C;  1VF5 B;  2ITA A;  2WT7 B;  1SP4 A;  2SPZ A;  2FYU E;  1Y8A A;  1KB9 I;  3V4W A;  2BAS A;  1Q81 Q;  5H2F H;  3M9H A;  3VP8 A;  1GZL A;  1SQB G;  5KJ7 D;  2WSC H;  3P7K A;  1SFC D;  1SVF A;  2RKL A;  3NFQ A;  2R5B A;  3M9Q A;  5CCG D;  4K35 A;  3ABV C;  4IFD K;  2ZXE B;  4PV1 C;  1NU1 E;  1CZQ A;  3A0H E;  1SQP E;  1PL5 A;  1KIL C;  3U59 A;  3L73 G;  2NZ2 A;  1BE3 G;  2R5D A;  2Z5H A;  3FX0 A;  2L91 A;  1Y9B A;  3AEB C;  1YI2 P;  4PJ0 H;  2FKW B;  2E75 D;  3U1C A;  2E74 D;  3A0H H;  1IFP A;  4OGQ B;  1FZG A;  3H1K D;  1JY3 N;  2HG5 D;  1GL2 B;  1QLE D;  3GW6 A;  1M90 Q;  1U7M A;  1LTT C;  3TGU G;  1BCC J;  2Q6Q A;  1RF1 A;  3R2P A;  2D2C B;  3WUU A;  1FJP A;  4BWN A;  3BAS A;  2C9N Y;  1T3U A;  1IK9 A;  1BGY E;  3HD7 C;  2R3C A;  1OW7 A;  2KNC B;  2N1T C;  1AVO A;  2YKQ A;  4DT0 A;  4U3F G;  3AE6 C;  1K04 A;  2JWA A;  4H0L C;  1PP9 J;  1FDO A;  5K5G B;  2WIT A;  2ZYA A;  3CCR P;  2YMY A;  2RH0 A;  1N7L A;  3GLM A;  1BCC E;  2P67 A;  3GF7 A;  1J1D B;  2YKO A;  3H1J D;  4C7N A;  2QG4 A;  1GMJ A;  2LXB A;  1NTK D;  5KLI C;  1BCC G;  1NTM D;  1IFI A;  4Y99 C;  1Y47 A;  2KSJ A;  3H32 B;  2IZ0 A;  2Z5I A;  5CCH D;  1NAF A;  2Q5U A;  1PP9 E;  2MKV A;  2WQY C;  1L4A A;  2Z4E A;  1PIX A;  1HGV A;  3SFE C;  1HJB A;  1EZV E;  3IFM A;  1LGH B;  2KZJ A;  3H1H E;  3JC2 2;  3CX5 E;  3G6E P;  1JOC A;  2QEX P;  1SFC C;  3V4Q A;  1HBW A;  1SQQ D;  2HOD A;  1FAV A;  1BSH A;  1AQ5 A;  1R5L A;  2OAR A;  3L75 J;  1ZRT E;  2FYU K;  1N8R Q;  1ZR2 A;  5GTI E;  1PGQ A;  3L72 D;  2O01 N;  3L71 J;  3CX5 H;  1Q2N A;  2FYN C;  5AW1 B;  4EI2 A;  1RH5 B;  3HE5 B;  1JMB A;  1LT9 B;  1SQV E;  4XA4 A;  2E75 C;  1NU1 K;  1JM0 A;  2ZYD A;  3G71 P;  2KXP B;  2O1J A;  1S9K D;  2JO1 A;  3MIW A;  1SQP K;  2KUB A;  4U7J A;  2P10 A;  3KDP B;  2ZT9 B;  5KJ7 A;  3L75 E;  1IJD B;  1SFC A;  2M3B A;  4KHX A;  3CLQ A;  5KAI E;  1L2P A;  1P84 E;  2K88 A;  5CCG A;  2G3A A;  3L71 E;  5TIS E;  4PD4 D;  1RQV A;  3L75 G;  4W7Y A;  4TT3 H;  2FY8 A;  3FXE A;  4EYY Q;  2OYO A;  4N78 E;  2XU6 A;  4GT1 A;  3VP9 A;  5KKZ C;  4IFM A;  5KAI H;  1NTM G;  3V6I A;  3B5N D;  1EDJ A;  2WPV B;  1KYO H;  5C39 A;  2IYP A;  2UWJ E;  1GW4 A;  2IFN A;  4IL6 X;  3MUD C;  2JKV A;  2WSF J;  3AE2 C;  1HWT C;  3W68 A;  1L0N D;  1SQX J;  3AE5 C;  2KS1 B;  1MZ9 A;  5CCH C;  3PRJ A;  2L5G B;  4YXD C;  1H0T B;  3P8M C;  5APW A;  3CME P;  2Y0E A;  3L74 J;  2K9J A;  1FZE A;  1VQP P;  1QL2 A;  5KLI B;  5AW4 B;  1LP1 A;  3KPE A;  1EC5 A;  2HPC A;  2QJK B;  3FWN A;  3Q5S A;  2QIW A;  2FXP A;  1L0L D;  1LJ2 A;  1SQX E;  4ZKU A;  3AE4 C;  1KB9 E;  2C0W A;  2QM8 A;  2HFE D;  3GF3 A;  2KP8 A;  2JR8 A;  2YMK A;  3O8Z A;  2A06 D;  3L74 E;  3ITK A;  3IN6 A;  3RK3 E;  2WSF H;  1GW3 A;  2XND H;  3CC7 P;  1YQ4 C;  1NKZ B;  1LTJ C;  4I1L A;  5AW9 B;  1HH0 A;  1GU4 A;  4ZMD A;  4H44 D;  4B86 A;  3L74 G;  1S5L H;  3TNU B;  5AVW B;  3RBX A;  5KLV J;  1PGJ A;  3H1L J;  2WT7 A;  3VYI A;  3IR9 A;  2POH A;  3A5T A;  1UII A;  1IZN B;  2IPP A;  1SQV K;  1RQU A;  4IFF A;  1RE3 C;  5DJT B;  4D6T E;  2ZT9 D;  1AA0 A;  1URQ B;  1YQ3 C;  2IX7 C;  1BSN A;  3CPW O;  4DCK A;  3H6P A;  1EDI A;  1KYO I;  2IYO A;  1YHQ P;  2VRS A;  2P1J A;  2E76 B;  1LT1 A;  3CCU P;  3BVH A;  1M8O B;  1PPJ D;  1L0N G;  5CBO A;  1LTJ A;  3B5N C;  3H1L E;  1JY2 N;  4WY4 B;  1LWU C;  2W90 A;  3MD0 A;  1FOS E;  5CHX A;  1QVF O;  1S5L X;  5KLV G;  1L4A D;  3CL3 D;  1J2J B;  3H1L G;  2R32 A;  1VQ4 P;  2E42 A;  2WWW A;  2WSC J;  1JNM A;  1SQB J;  2YIU C;  1G1I A;  1KC8 Q;  1Q82 Q;  4LGD E;  2QJY B;  3S9O A;  3EWK A;  5EFW B;  3TSI A;  1L0L G;  1JY3 O;  2J59 M;  3ZDM A;  3HTK B;  1JMM A;  4ZNC A;  2QVA A;  4L74 A;  1K73 Q;  1EDK A;  2WSE J;  3EFF K;  3B5N A;  1YJN P;  3M9B A;  1VQN P;  3LIE A;  5H2F E;  1MV8 A;  1KQF B;  1BGY D;  4RJT A;  1KIL E;  1SQB E;  3AE9 C;  1HJ0 A;  1W5C E;  1X8Y A;  4HKZ H;  1X9V A;  1LTI C;  5M1B A;  3TGU J;  1RF1 C;  3GG2 A;  4TLF A;  1AV1 A;  2YKP A;  5APY A;  3NXS A;  1PFI A;  1SQX K;  3CCM P;  1GDT A;  4DJG A;  4H13 B;  4H44 C;  4PJ0 E;  2ZVN B;  2P2U A;  3VMX A;  2Q3I A;  3L73 E;  3KZI H;  4JF7 A;  1BE3 E;  3A0B H;  4I7Z B;  2GA1 A;  2H89 C;  3AEA C;  3G4S P;  3GHG A;  1T8Z A;  3VN0 A;  4U3F J;  4WB4 A;  1H89 A;  2E43 A;  3H1I D;  1N86 A;  2LXC B;  2QA4 P;  1E5W A;  2W27 A;  1NOH A;  1M1K Q;  3L70 D;  1PPJ G;  2WSE H;  2BCC J;  2PGD A;  3BAT A;  1OVV A;  1GK6 A;  3AEG C;  2GM4 A;  3TGU E;  4I2L C;  3WU2 H;  3CWB D;  4OWF A;  3RL0 D;  3B4S A;  2OYI B;  3D6Z A;  1URQ D;  3RK2 D;  3H1H D;  1WMK A;  4C7R A;  5CBN A;  2XV5 A;  4U3F E;  4C46 A;  3PJS K;  1LT9 A;  1M7L A;  3RK3 B;  1L4A C;  1NKN A;  2WSS H;  2Y0D A;  4NPF X;  3V5B A;  4WBA A;  1LTG C;  3TK1 A;  1R5S A;  1OWA A;  1ZXG A;  1SQV D;  3H25 A;  1NGM B;  1N7S B;  2BCC G;  3TDK A;  2IBZ D;  2WZ7 A;  2KIK A;  1RY3 A;  2OGU A;  3CXH D;  2AXC A;  2FBW C;  4JYC A;  4NPD A;  3D70 A;  3H1K J;  1AQT A;  3HUS B;  4BRY B;  5AVV B;  5CMZ A;  1P84 D;  5CJ4 A;  2FFD B;  1A02 J;  1NJI Q;  1USD A;  1RE4 A;  1NAY A;  1EQ7 A;  1N2D C;  1YYC A;  3I5C A;  1VQ7 P;  2K3R A;  2NPS B;  3N4X A;  2MJZ A;  3WMM 0;  2KSE A;  2BEQ D;  1VQL P;  3CD6 P;  1IC2 A;  1M1J B;  1VF5 D;  5KJ7 C;  1JCC A;  3JSV C;  4KJM A;  2QJP C;  2XDJ A;  5CCG C;  3P32 A;  1VQ6 P;  3BRV B;  2V7Q J;  3L70 G;  1SQB K;  3L4F A;  4JPZ B;  1Q7Y Q;  3V2P A;  3H1K G;  5B66 E;  3AEE C;  2OYH B;  3CWB G;  1YIT P;  3H1J J;  4GOD A;  1K05 A;  4EIJ A;  4IL6 E;  1NTZ D;  1OMI A;  1NTK J;  2KI7 B;  1NTM J;  4UB6 E;  1IO4 A;  3G3Z A;  1Q86 Q;  1YJW P;  2E74 C;  2FXO A;  5B66 H;  2H88 C;  1FZC C;  3RL0 g;  2P7J A;  4O9B A;  1S4X A;  1XTC C;  3RL0 C;  2FXM A;  2WPR A;  4PV1 B;  4IL6 H;  3IF4 A;  2NRG A;  3C9I A;  1FU1 A;  3RK2 C;  4OGQ D;  4UB6 H;  3V2Q A;  1GL2 D;  2W6J H;  1KIL B;  2RMZ A;  3N7N A;  1FDM A;  3MZW B;  3H1J E;  1KMI Z;  1PZQ A;  3C8V A;  1NH4 A;  1NTK E;  4HB1 A;  2D2C D;  1IFN A;  1XTG B;  1NTM E;  5AW3 B;  1SQQ J;  2V7Q H;  3O6Q A;  1KB9 D;  3H1J G;  1KYO E;  1U7J A;  2PP6 A;  4IOI H;  3USS A;  4GOF A;  1UIX A;  1KD1 Q;  3V2R A;  1NTK G;  3L35 A;  1CI6 B;  3L72 J;  3EQ2 A;  2W6B A;  5AW0 B;  1VQ5 P;  2KYV A;  1FZC A;  1A02 F;  5APQ A;  3F89 A;  1URQ A;  2BEZ F;  5TJH A;  3HD7 B;  3WUT A;  4EOT A;  1VQM P;  2N1T B;  3P8C D;  2DW3 A;  1SQQ E;  5AW5 B;  4AUW A;  4D6T D;  1M56 D;  4H0L B;  1N73 C;  3AED C;  3Q5P A;  1ZOY C;  3OW2 O;  1SS1 A;  4A7P A;  3MHV A;  1SQQ G;  1EXJ A;  1BDC A;  3VMY A;  3L72 E;  1J1E C;  4WY4 A;  2CPS A;  1X22 A;  1DD3 A;  3BCC D;  2Q7C A;  1QEX A;  1HUC A;  2H7H A;  1KQL A;  3HE4 A;  1VF5 C;  3L72 G;  3PH0 A;  2NPS D;  1KOR A;  2M5A A;  1NTZ G;  4Y99 B;  1S9K E;  4GIF A;  4K3A A;  1KZU B;  4UB8 H;  2Y0C A;  2WVR A;  1E79 H;  1MFT A;  3D71 A;  3QWO C;  1RHZ B;  3CC4 P;  1S5L E;  5AVZ B;  5AW2 B;  1KTM A;  1FDI A;  2JP3 A;  3KQG A;  1S3J A;  3HTK A;  3M0D A;  4PD4 E;  1N73 A;  4I6M C;  2R3S A;  3FWL A;  4YPC A;  1L0N J;  2GUV A;  1SFC B;  2QJP B;  1MFZ A;  1VQO P;  4AYC A;  2KK7 A;  5AVX B;  2V4H A;  3I55 P;  1ZR4 A;  3PLN A;  4PD4 H;  4OGQ C;  3KHU A;  1JY3 P;  3HRN A;  3G9R A;  1VQ8 P;  2JJL A;  1QVG O;  4PV1 D;  5APT A;  1JO5 A;  2FYN B;  2H8P D;  2OTJ P;  2D2C C;  4KT0 J;  3CXH I;  1KIL D;  2I1K A;  3MP7 B;  2E75 B;  3VMZ A;  3L36 A;  2FYU D;  1L0L J;  4XFJ A;  1L0N E;  5AVR B;  4BXL A;  1GD2 E;  1OVR A;  3RGU A;  1OX3 A;  5KLV E;  1ZP0 C;  1NTK K;  1DD4 A;  1CW5 A;  1NTM K;  1NU1 D;  3L73 D;  1BE3 D;  2XNX A;  1YTZ T;  1X0T A;  5APV A;  1FZB A;  1SQP D;  3VTP C;  2KLU A;  1GL2 A;  1J1D C;  2M8R A;  3KYQ A;  1IFJ A;  1K8A Q;  3AEC C;  2K9J B;  5KKZ B;  2OYI A;  4HH2 A;  1Z56 A;  3CI9 A;  1L0L E;  3NTN A;  2AEJ A;  2WPS A;  4YXW H;  1U57 A;  5AW6 B;  2B89 A;  3Q3D A;  2A06 E;  3PP5 A;  1SQQ K;  1RF0 A;  2ZVO B;  2KNC A;  1AFO A;  3GHG C;  2OTL P;  1FE6 A;  3B8E B;  1LTA C;  3B71 A;  2A06 G;  2M3E A;  5BVZ A;  1PGO A;  2QM7 A;  4MN4 C;  1T6A A;  3II6 A;  3A3Y B;  4Z1M H;  3CCS P;  2C0X A;  3KZI E;  5E79 H;  3CCE P;  1K9M Q;  1WRG A;  3AE7 C;  3A0B E;  3LW5 J;  1AJY A;  2YO3 A;  1T2K D;  3HUS A;  3PHL A;  3KXD A;  4BRY A;  4PD4 I;  1VQ9 P;  1BCC D;  1FOS F;  2O01 J;  3VMA A;  2K1A A;  1BDD A;  2FFD A;  3H32 A;  1LT9 C;  3FGA D;  3M06 A;  1OIP A;  3WU2 E;  1OW6 A;  3CCQ P;  2FYU G;  2NPS A;  1PPJ E;  4YTP C;  4OH8 B;  2QSI A;  3A7O A;  1QGK B;  1EXI A;  1M1J A;  1X79 B;  5CJ0 A;  3K5B A;  3AE1 C;  2ZT9 C;  1S1C X;  1PP9 D;  5APS A;  1JEK A;  3AEF C;  2Y9Z A;  1LTJ B;  1NU1 G;  2B87 B;  1GU5 A;  1QX8 A;  2ZAE B;  1BGY J;  4ZKP A;  2QRX A;  1GTW A;  1FZA A;  1SQP G;  3T97 B;  4WWI A;  1EZV D;  3SWK A;  5APU A;  3CX5 D;  1NHL A;  2OYH A;  2B88 A;  3TYY A;  2W8Z A;  2GUS A;  3LW5 H;  1YTZ I;  3C1L A;  1JTH B;  3HE5 A;  3V2N A;  1RE4 C;  5GTH E;  1YBK A;  1ZRT D;  2E76 D;  3W67 A; 
#chains in the Genus database with same CATH homology
 1NTM G;  1SQQ G;  3TGU G;  4D6T G;  1SQV G;  4PD4 H;  3CWB G;  4U3F G;  3L75 G;  3CXH H;  3CX5 H;  1BGY G;  1PPJ G;  5KLV G;  3H1L G;  3H1I G;  1BCC G;  1EZV G;  2IBZ G;  2A06 G;  1SQB G;  1KB9 H;  3L74 G;  3L71 G;  1L0L G;  2FYU G;  3H1H G;  1KYO H;  1NU1 G;  3H1J G;  3L70 G;  3L72 G;  3L73 G;  2BCC G;  3BCC G;  1PP9 G;  1SQX G;  1L0N G;  1BE3 G;  1P84 H;  1NTZ G;  1NTK G;  3H1K G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...