1SQXG

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqxG00
1SQXG 1P84H 1NTZG 1EZVG 1SQBG 2IBZG 1BE3G 1SQVG 1NTMG 4PD4H 1BGYG 1KYOH 1PPJG 4D6TG 5KLVG 3H1JG 1NTKG 3CXHH 3H1LG 1SQQG 2A06G 3H1HG 3L73G 3L71G 1PP9G 1KB9H 3CX5H 2FYUG 3TGUG 3BCCG 3H1KG 3H1IG 1NU1G 1BCCG 3L72G 4U3FG 3L70G 3L75G 3L74G 2BCCG 3CWBG 1SQPG 1L0LG 1L0NG
chains in the Genus database with same CATH superfamily
2K9JB 1SS1A 4LGDE 3BCCD 4C7RA 1K04A 1DH3A 3KHUA 4D6TG 3PTZA 5B66E 1GL2A 2VRSA 3Q3DA 2H43A 3CMEP 1BE3D 1QX8A 1J2JB 3CX5H 3O6QB 3R4YA 1QLED 3H1KG 2I1KA 5APUA 3L36A 3S4RA 3H32B 4UB8H 5KTBA 2R3SA 2FYUK 2Q5UA 2N9BA 3PH0A 3HUSA 4A7PA 5E79H 2IBZD 5APVA 1IFMA 2POHA 5CCGC 3L72G 1NAYA 1RH5B 1NTKJ 3RL0D 1FOSF 1GW3A 1M1JC 1FU1A 2N1TD 3FXDA 3L74E 4H13C 1N73A 1X22A 3L70J 3K5BA 4GOEA 1CI6B 1RQVA 5KJ7D 4B86A 2QM7A 2YNYA 2E75D 3I55P 5AW5B 2M0BA 4L75A 1Z56A 1W2EA 3II6A 2OTLP 1PGOA 1FZFA 4DOJA 1NU1D 3USSA 4R4MA 2Q6QA 2Y9YA 1VQMP 1PP9G 3RGUA 4Z1MH 4DCKA 2QSIA 2WITA 3H1JE 5KLVD 5TJHA 2BEQD 1S3JA 3OAKA 4PD4D 1LTSC 5B5EE 3TGUD 3AEFC 2JWAA 4PV1C 1USDA 3LIDA 1NOHA 3CWBJ 5APQA 1KILC 3A2AA 1VQ4P 3CI9A 3H1LD 2AXTH 2C0XA 3B5NA 2M5AB 3L73J 1Q2NA 2ZYAA 3FWLA 1K8AQ 3L72E 3V6IA 1JEKA 1W5CE 3L71G 1DX7A 1J1EC 4RO0A 1BCCG 2XKMA 4UB8E 2D2CB 2FYNB 2P1JA 4N6JA 2KIKA 2FBWC 3P8CE 4DT0A 3CCRP 4C7NB 3PP5A 4OVNF 2QE7H 1OX3A 1LTGC 3AE6C 1SQXJ 1KTMA 2Z4EA 1EC5A 1NTMK 5AVTB 3TNUA 4Y99B 4TT3H 1GMJA 1M56D 3PLNA 5APXA 3LW5J 1NTMG 4BXLA 1Q7YQ 1OMIA 3EWKA 1L0NJ 1LTJA 2R5BA 2GUVA 3VTPC 1RF1B 2Y0DA 1Y8AA 1NAFA 1URQD 3VMYA 3CD6P 3RL0C 2C0WA 2N1TC 1HF9A 1S1CX 1LWUA 3FWNA 3TDKA 2B88A 1LTIC 1EZVE 2A06G 1NVOA 5KJ7C 4D6TD 2K9JA 5AVYB 2GM4A 3H1KD 5BU5A 2E74C 3IR9A 2JEEA 3C1LA 3OA7A 1JCCA 2OYIA 3WUTA 2AXTE 3KPEA 2OGUA 3MD0A 3CCLP 3ITKA 3TF5A 2YO3A 1R5SA 3H32A 2M8RA 3MZWB 2E43A 4ZNCA 3L72D 2IDBA 3WUVA 2P67A 1GL2C 1FE6A 1IFJA 1SFCD 2FFDC 1NTZJ 1FZCB 3AECC 2WPSA 2C9NY 2WSCJ 2E42A 1M90Q 2W8ZA 2WPVB 2QJYC 3VOPA 1CI6A 3CCEP 3H1IJ 3HUSC 2SPZA 2HFED 1ZN5A 1SQPJ 3AE8C 5M1BA 2PGDA 2KYVA 1NTKE 3AE5C 1WRGA 2A45I 1KMIZ 2A06E 1PP9D 4WY4A 2NPSD 2KNCB 3L70E 2AEFA 2FYZA 3RK2B 2O01N 1KZUB 1KB9E 1L0LK 3V2PA 2A45G 1SQXK 5AW6B 1RE3C 2L5GB 1L0LG 1SQXG 2W83C 5KAFH 3BRVB 2ZT9B 3VN0A 4IFMA 1CW5A 1DEEG 2IYOA 3A0HH 1L0NK 2H89C 1H88A 3HD7B 1BGYE 1VQ7P 1VQLP 3VP8A 2M5AA 2IX7C 5AVRB 1E79H 1IC2A 1L0NG 2R44A 5AW9B 1FC2C 3L71D 4XFJA 1X9VA 4PJ0H 3WU2E 1IFPA 1BCCD 2O1KA 3CWBE 1KQFB 1WMKA 5KLIC 1AV1A 1NH4A 3VP9A 2QJPC 1QVFO 2H88C 2YO2A 3AE7C 1NO4A 3B5NC 3GF7A 3L73E 1W2BO 2HYNA 2YIUC 1FBMA 4Y28J 3KYQA 4OGQB 2FY8A 1NTMD 1HJBA 4IL6E 1ZMEC 2J59M 4YTPC 2R3CA 1P84H 2QEXP 1FZBA 4WB4A 2HR3A 4HH2A 1BSNA 3JCUE 5CHXA 2YKQA 1GU5A 3M0AA 4C46A 1NTZK 1VF5B 1RF1A 1OXZA 3MHVA 1ZLLA 2IFMA 5CCGD 3SFDC 3B4SA 1VQPP 1A02J 1NTZG 1GD2E 1YJ9P 3CC2P 1RQUA 4H13D 1N7LA 2KI7B 3A5TA 1L0NE 2B9BA 1LTJC 2E76C 3GHGB 1SQPG 3F89A 2GUSA 1SQQJ 3L4FA 3V5BA 4H44C 1IK7A 1LT9C 1VPCA 4WBAA 1IFNA 2KUBA 3CCSP 1DD3A 3D6ZA 4PJ0E 3H6PA 1KYOH 4YXDC 3GF3A 1N7SA 1JY3O 4PV1D 3FXEA 1LTTC 2MKVA 2Y0EA 2RMZA 1FZCA 1KILD 1SQBJ 2WSEH 2ZAEB 1X79B 3G4SP 2K9YA 3L74G 1MKMA 1JUNA 1G2CA 5AVSB 2KZIA 1G1IA 3MIWA 1P84E 2IPPA 2B89A 1NHLA 3GLMA 2KNCA 1GW4A 3PRJA 1IZNB 3H1IE 2YXRB 1L0LD 1SQPE 1T6AA 3H1JG 1SQXD 4GODA 1LNQA 5H2FH 4L76A 1H8AA 2Q3EA 1FDMA 2RN0A 3NTNA 2OYIB 3UIAA 2Q3IA 3HTKB 2XNDH 4NPDA 4M3LA 3JSVC 2RH0A 5CCHA 1L0ND 3CX5I 2WZ7A 3HD7A 2Q7CA 5AW2B 3HE4B 1S5LE 4AUWA 4YXWH 1YBKA 5C39A 1UIXA 2JKVA 2WVRA 3Q5SA 5KAIH 2ZJSE 3CXHE 2ZXXA 1RE4A 1LP1B 5APSA 3VYIA 3IAOA 3IFMA 2WSSH 3H1HE 3OW2O 2RKLA 1KYOE 3M06A 2E74D 4WY4B 1D7MA 1QGKB 4L73A 4AYCA 2D2CC 2H8PD 3Q2YA 2FYNC 5AW8B 3D71A 1BGYJ 3A7OA 2JJLA 3AEEC 4H0LB 3KDPB 1MZ9A 4KHXA 1EDJA 4W7YA 1XTGB 2PFXA 1GL2D 3L75J 1EZVI 1NTZD 1WT6A 2IZ0A 2WSFH 4Y99C 4I6MC 3V2QA 3KZIH 4BRYB 1SQVJ 1K73Q 4I7ZB 2KSEA 2BASA 3RK3B 4ZMDA 4WVZA 2ZT9D 1EZVG 2CK3H 1JM0A 3V2RA 3W67A 2JDIH 1SQPD 5H2FE 4K35A 3MUDA 1Q86Q 3JC22 1K05A 2KS1B 4HB1A 3CX5E 3GHGA 1RF1C 1LTAC 2KSJA 2QM8A 1KORA 2AEMA 1S9KE 3S9OA 4N78E 5E79E 3AEDC 2PAJA 2BCCJ 2QA4P 3TSIA 1VQ5P 4DJGA 2BEZF 5KAIE 3HE5A 1SQQE 1PFIA 3WUUA 4OGQD 2W6BA 4NPFX 3L74D 3BCCJ 4XA4A 1KFMA 1HUCA 1U57A 1AVYA 1OW8A 2N9YB 4DZOA 1BE3J 1M1KQ 3BVHA 3P7KA 2HLOA 1AQ5A 2R32A 2XDJA 2YXQB 3AEGC 1QEXA 1NTKK 3MGNA 5GTHH 1BSHA 5KKZB 1T2KC 1JTHB 1Y47A 3PHLA 4IOIH 1NTKG 3ZDMA 3CCMP 1KB9I 2J5UA 2KLUA 1SQBE 4XE5B 1GZLA 3L70G 3H1JD 1AA0A 1J1EB 4NPEA 3B5ND 1BDCA 3LIEA 2WTYA 1ZOYC 1QL2A 4JBZA 1PPJG 2G8YA 1AQTA 3RBZA 2W27A 2KB7P 1Q82Q 3HTKA 3RK2C 4R4LA 2P10A 1FJPA 1N8RQ 2NZ2A 3BASA 1YQ3C 1BGYG 1NU1J 1R5LA 3HE4A 1AVOA 1FZEA 1N7SB 2I8DA 1GK6A 1T3UA 3TYYA 3CWBG 5AVQB 3RL0g 1L4AA 2ZT9C 3NFQA 1VQOP 2V7QH 3RL0B 2Q9IA 2KOGA 3TGUJ 5CCHC 3P8CD 3Q5RA 1YQ4C 3VMZA 2ITAA 2JP3A 1RF0A 1LP1A 3HD7C 1R8EA 2FXMA 5CJ4A 1G2CB 3L73G 1VDFA 2J58A 3FX0A 2E76D 1HWTC 3B8EB 2E75B 2A45H 1N73C 1RE4C 4TLFA 4H44D 5BVZA 3RK3E 1YTZI 1KFNA 2QJKB 1EXIA 1PPJE 3AE4C 3FGAD 1JY2P 1U7JA 4OGQC 2YKOA 4GDOA 3T97B 4YPCA 1IK9A 1M7LA 2IYPA 4BRYA 1EZVD 1DEBA 3SFEC 3CL3D 2HG5D 2FFDB 2OTKE 4O9BA 2FKWB 3H1HJ 2KLVA 2KXPB 3L75E 1JMMA 2KS1A 1VF5C 3N7NA 1FZGA 1SQVE 3CMAP 2K3RA 2WSEJ 1SLQA 2L91A 3MTUE 2PP6A 3GMAA 3MUDC 2WWWA 4EYYQ 3GHGC 2KK7A 2UWJE 2ZVNB 1G1JA 3U1AA 2XNXA 3G3ZA 2W90A 1MFTA 4EDFA 5AW7B 4WY4D 3ABVC 3SWKA 2C9LY 2BCCE 3H1KJ 1ZRTE 4PD4H 1YTZT 4U3FJ 2XU6A 1VQ9P 3D6YA 1P84I 2HODB 1PV3A 1NTKD 1HH0A 1Q81Q 2IZ1A 3I5CA 2A06D 5AVXB 1IJDB 3BCCE 4W80A 1JTHA 1URQB 5TISH 3L70D 1JY2N 2FYUJ 3M9HA 3AE3C 3V4WA 3U59A 4CPGA 1KB9D 1BE3E 1SQPK 1S72P 2WT7B 4UB6H 3R2PA 2QJPB 2QVAA 1PPJD 3H1IG 3MP7B 3CCJP 2W6JH 1EDLA 5KAFE 1KV4A 1AJYA 1SP4A 1LWUC 2OYHB 2YIUB 3U1CA 3A0HE 3C8VA 2IBZE 3IF4A 2E5YA 1GTWA 1BGYD 1E5WA 2D2CD 1LTBC 4EOTA 4KJMA 3HE5B 1GU4A 1NJIQ 1U7MA 4GOFA 3CXHI 1L2PA 1IO4A 3CWBD 4IFFA 5EFWB 2E5TA 1VQKP 1PZQA 2Q1KA 2XZRA 1UIIA 2OYIC 1DD4A 2CPBA 2YMYA 1SVFA 1SFCB 4ZKUA 4BWNA 1S2EA 1KYOI 3L73D 2P58A 1NU1E 3B71A 2OARA 2N1TA 4LLHA 2WSFJ 3H1HG 5AW4B 2QG4A 5KJ7A 1PGPA 5APWA 5KLVE 1N86A 1YJNP 2O01J 2OYOA 4PD4E 3TGUE 3L71J 5B5EH 2NPSB 1BCCJ 1ZXGA 2PRRA 3AE1C 4I2LC 3H1LE 1OFCX 1LJ2A 5TISE 1J1DB 4WY4C 3T97A 2P7JA 3G6EP 4OH8B 4UB6E 3V4QA 1H89A 3CC7P 5APTA 1ZW0A 2FFDA 1RY3A 1GDTA 1NTMJ 4U3FG 4H0LC 3P8MC 1YHQP 2I1JA 2ZFCA 1T2KD 1EDIA 1N7SD 1L4AB 3NXSA 4I7ZC 4JPZB 1RHZB 3M9BA 2MJZA 3RK3C 2FYUG 2JO1A 3N4XA 1JMBA 3I56P 3CCUP 1SQQK 2NRGA 3OJAB 4L74A 1NYHA 1SQQG 1NKNA 2FXOA 1RE3A 4JQ0D 3RK2D 2YKPA 1A02F 1X8YA 3EFFK 2CPSA 2HODA 1FOSE 4D6TE 1SQBK 1VQNP 3E7KA 1P84D 2O01H 2HPCB 2ZXEB 1URQA 2ZYGA 1HVVA 2GA1A 3H1KE 1SQBG 4ASVA 3H1ID 1OZHA 4U3FE 5CCHD 1H0TB 1M1JB 2W6AA 5CBOA 1M57D 4EI2A 3HD7D 2WT7A 1ZP0C 4HJGH 4H13B 1FJKA 2AXCA 3A0BH 1XTCC 1MUUA 1LGHB 5KKZC 3BRTB 3EFGA 2OYHA 4KT0J 1HTLC 2FYUE 2V7QJ 2ZYDA 1ZR4A 2G3AA 1VQ6P 4ZKPA 1N2DC 5L8RJ 4WWIA 2OTJP 1YIJP 1JB0J 2K37A 1JOCA 3CXHD 3SWYA 5CMZA 1L0LJ 4HKZH 4PV1B 1SFCA 4RKUJ 1KILB 3H1HD 1PP9E 1KYOD 1T3JA 1N7SC 2KZJA 1VF5D 2K1AA 1FZCC 3WMM0 3EQ2A 4GKGA 1KB9H 2R5DA 2B87B 3GG2A 1IFIA 1KQLA 1KN7A 3E1RA 1OWAA 1QVGO 1CSBA 2JR8A 3CCVP 2NPSA 4MN4C 3L35A 1KC8Q 2WPQA 2WPRA 1LT9A 3KZIE 1KQGB 1PGQA 2LXBA 5AW3B 2E75C 1OW6A 5AW0B 1IFDA 1T8ZA 3L71E 5CJ0A 1KD1Q 1JCDA 3CCQP 1BCCE 4U3FD 3A3YB 1JNMA 3WU2H 3L37A 3C9IA 2QJKC 3BATA 3A0BE 3VMAA 3O6QA 3CX5D 2QRXA 4QMAA 3KQGA 1SQVK 3L75G 1EQ7A 5KLVJ 3S1KA 2IFNA 2FYUD 4GT1A 1SQVG 1S9KD 4AQRD 2FXPA 4N78D 2K88A 2N1TB 1NTME 3D70A 2OQQA 4IL6H 3SSUA 1SQQD 1USEA 1HBWA 3M0DA 3H1LJ 5DJTB 1FS0E 1TU3F 3JCUH 2E74B 1YJWP 3QH9A 2AEJA 3SWFA 1VL2A 2QIWA 1EXJA 3G71P 1FDOA 2BCCG 5GTHE 5AW1B 4LC1A 2Y0CA 3LW5H 1S4XA 3TK1A 2XV5A 4IL6X 1GK4A 1SQBD 2P2UA 1GL2B 5K5GB 4I1LA 1HJ0A 3BCCG 4JF7A 2HPCA 5CCGA 3Q1MA 1JY3P 4OWFA 1VQ8P 5DJUB 1Q90D 1H0TA 1M1JA 1BE3G 3G9RA 2LR2A 3HRNA 2WQYC 3L74J 1QL1A 2IBZI 2QJYB 1KQSO 3HUSB 2Z5HA 1AFOA 1CZQA 1PGJA 1URQC 1L4AD 3AEBC 3F5HA 3P32A 2M3BA 2IBZG 1LT1A 2M3EA 3PJSK 1OVUA 2H7HA 1N73B 1KILE 1JO5A 4W7ZA 2DW3A 1Y9BA 1BDDA 4D6TJ 3H1JJ 2OYHC 5AVVB 2YMKA 4C7NA 2O3JA 3M91A 4JYCA 1NU1K 1EDKA 1M8OB 4HYTB 4K3AA 1KILA 2LKMA 1NU1G 3E1IA 5AVWB 2LXCB 5AVUB 4H0LD 5GTIH 4PD4I 3KXDA 5CBNA 5KLVK 5APYA 2WSCH 4N3YB 1L0LE 5KLVG 1SQXE 3L72J 3W68A 1OVVA 1FAVA 3QWOC 1SFCC 1OVRA 1YITP 2B87A 5B66H 1NKZB 5KLIB 3RK3D 3AE9C 3TGUG 5AVZB 1ZR2A 3O8ZA 2ZVOB 4JYBA 1DIPA 3B5NB 3NMDA 1JY3N 1HGZA 3H1LG 2Y9ZA 2O1JA 3CLQA 3CC4P 1S5LH 3AE2C 1FZAA 1YYCA 2NPSC 3V2NA 2V4HA 3M9QA 1PP9J 3L75D 2WMMA 1K9MQ 3CXHH 1JY2O 1NWQA 1OIPA 1SQVD 1J1DC 3CPWO 1PL5A 1OW7A 3TNUB 4GIFA 4RJTA 4RESB 1S5LX 1YI2P 2JWDA 5BU8B 4U7JA 1NGMB 1PIXA 3H25A 1LTJB 3VMXA 4ASWA 1FDIA 1X0TA 3IN6A 1MV8A 3AEAC 2Z5IA 2E76B 3GW6A 1L4AC 4IFDK 1MFZA 2BCCD 1ZRTD 1RF0C 1LWUB 1NTZE 4H44B 4EIJA 1LT9B 5GTIE 1HGVA 1ZV8A 3Q5PA 3RBXA 3M0DC 2KP8A
chains in the Genus database with same CATH topology
1SQXG 1P84H 1NTZG 1EZVG 1SQBG 2IBZG 1BE3G 1SQVG 1NTMG 4PD4H 1BGYG 1KYOH 1PPJG 4D6TG 5KLVG 3H1JG 1NTKG 3CXHH 3H1LG 1SQQG 2A06G 3H1HG 3L73G 3L71G 1PP9G 1KB9H 3CX5H 2FYUG 3TGUG 3BCCG 3H1KG 3H1IG 1NU1G 1BCCG 3L72G 4U3FG 3L70G 3L75G 3L74G 2BCCG 3CWBG 1SQPG 1L0LG 1L0NG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX G;  1P84 H;  1NTZ G;  1EZV G;  1SQB G;  2IBZ G;  1BE3 G;  1SQV G;  1NTM G;  4PD4 H;  1BGY G;  1KYO H;  1PPJ G;  4D6T G;  5KLV G;  3H1J G;  1NTK G;  3CXH H;  3H1L G;  1SQQ G;  2A06 G;  3H1H G;  3L73 G;  3L71 G;  1PP9 G;  1KB9 H;  3CX5 H;  2FYU G;  3TGU G;  3BCC G;  3H1K G;  3H1I G;  1NU1 G;  1BCC G;  3L72 G;  4U3F G;  3L70 G;  3L75 G;  3L74 G;  2BCC G;  3CWB G;  1SQP G;  1L0L G;  1L0N G; 
#chains in the Genus database with same CATH topology
 2K9J B;  1SS1 A;  4LGD E;  3BCC D;  4C7R A;  1K04 A;  1DH3 A;  3KHU A;  4D6T G;  3PTZ A;  5B66 E;  1GL2 A;  2VRS A;  3Q3D A;  2H43 A;  3CME P;  1BE3 D;  1QX8 A;  1J2J B;  3CX5 H;  3O6Q B;  3R4Y A;  1QLE D;  3H1K G;  2I1K A;  5APU A;  3L36 A;  3S4R A;  3H32 B;  4UB8 H;  5KTB A;  2R3S A;  2FYU K;  2Q5U A;  2N9B A;  3PH0 A;  3HUS A;  4A7P A;  5E79 H;  2IBZ D;  5APV A;  1IFM A;  2POH A;  5CCG C;  3L72 G;  1NAY A;  1RH5 B;  1NTK J;  3RL0 D;  1FOS F;  1GW3 A;  1M1J C;  1FU1 A;  2N1T D;  3FXD A;  3L74 E;  4H13 C;  1N73 A;  1X22 A;  3L70 J;  3K5B A;  4GOE A;  1CI6 B;  1RQV A;  5KJ7 D;  4B86 A;  2QM7 A;  2YNY A;  2E75 D;  3I55 P;  5AW5 B;  2M0B A;  4L75 A;  1Z56 A;  1W2E A;  3II6 A;  2OTL P;  1PGO A;  1FZF A;  4DOJ A;  1NU1 D;  3USS A;  4R4M A;  2Q6Q A;  2Y9Y A;  1VQM P;  1PP9 G;  3RGU A;  4Z1M H;  4DCK A;  2QSI A;  2WIT A;  3H1J E;  5KLV D;  5TJH A;  2BEQ D;  1S3J A;  3OAK A;  4PD4 D;  1LTS C;  5B5E E;  3TGU D;  3AEF C;  2JWA A;  4PV1 C;  1USD A;  3LID A;  1NOH A;  3CWB J;  5APQ A;  1KIL C;  3A2A A;  1VQ4 P;  3CI9 A;  3H1L D;  2AXT H;  2C0X A;  3B5N A;  2M5A B;  3L73 J;  1Q2N A;  2ZYA A;  3FWL A;  1K8A Q;  3L72 E;  3V6I A;  1JEK A;  1W5C E;  3L71 G;  1DX7 A;  1J1E C;  4RO0 A;  1BCC G;  2XKM A;  4UB8 E;  2D2C B;  2FYN B;  2P1J A;  4N6J A;  2KIK A;  2FBW C;  3P8C E;  4DT0 A;  3CCR P;  4C7N B;  3PP5 A;  4OVN F;  2QE7 H;  1OX3 A;  1LTG C;  3AE6 C;  1SQX J;  1KTM A;  2Z4E A;  1EC5 A;  1NTM K;  5AVT B;  3TNU A;  4Y99 B;  4TT3 H;  1GMJ A;  1M56 D;  3PLN A;  5APX A;  3LW5 J;  1NTM G;  4BXL A;  1Q7Y Q;  1OMI A;  3EWK A;  1L0N J;  1LTJ A;  2R5B A;  2GUV A;  3VTP C;  1RF1 B;  2Y0D A;  1Y8A A;  1NAF A;  1URQ D;  3VMY A;  3CD6 P;  3RL0 C;  2C0W A;  2N1T C;  1HF9 A;  1S1C X;  1LWU A;  3FWN A;  3TDK A;  2B88 A;  1LTI C;  1EZV E;  2A06 G;  1NVO A;  5KJ7 C;  4D6T D;  2K9J A;  5AVY B;  2GM4 A;  3H1K D;  5BU5 A;  2E74 C;  3IR9 A;  2JEE A;  3C1L A;  3OA7 A;  1JCC A;  2OYI A;  3WUT A;  2AXT E;  3KPE A;  2OGU A;  3MD0 A;  3CCL P;  3ITK A;  3TF5 A;  2YO3 A;  1R5S A;  3H32 A;  2M8R A;  3MZW B;  2E43 A;  4ZNC A;  3L72 D;  2IDB A;  3WUV A;  2P67 A;  1GL2 C;  1FE6 A;  1IFJ A;  1SFC D;  2FFD C;  1NTZ J;  1FZC B;  3AEC C;  2WPS A;  2C9N Y;  2WSC J;  2E42 A;  1M90 Q;  2W8Z A;  2WPV B;  2QJY C;  3VOP A;  1CI6 A;  3CCE P;  3H1I J;  3HUS C;  2SPZ A;  2HFE D;  1ZN5 A;  1SQP J;  3AE8 C;  5M1B A;  2PGD A;  2KYV A;  1NTK E;  3AE5 C;  1WRG A;  2A45 I;  1KMI Z;  2A06 E;  1PP9 D;  4WY4 A;  2NPS D;  2KNC B;  3L70 E;  2AEF A;  2FYZ A;  3RK2 B;  2O01 N;  1KZU B;  1KB9 E;  1L0L K;  3V2P A;  2A45 G;  1SQX K;  5AW6 B;  1RE3 C;  2L5G B;  1L0L G;  1SQX G;  2W83 C;  5KAF H;  3BRV B;  2ZT9 B;  3VN0 A;  4IFM A;  1CW5 A;  1DEE G;  2IYO A;  3A0H H;  1L0N K;  2H89 C;  1H88 A;  3HD7 B;  1BGY E;  1VQ7 P;  1VQL P;  3VP8 A;  2M5A A;  2IX7 C;  5AVR B;  1E79 H;  1IC2 A;  1L0N G;  2R44 A;  5AW9 B;  1FC2 C;  3L71 D;  4XFJ A;  1X9V A;  4PJ0 H;  3WU2 E;  1IFP A;  1BCC D;  2O1K A;  3CWB E;  1KQF B;  1WMK A;  5KLI C;  1AV1 A;  1NH4 A;  3VP9 A;  2QJP C;  1QVF O;  2H88 C;  2YO2 A;  3AE7 C;  1NO4 A;  3B5N C;  3GF7 A;  3L73 E;  1W2B O;  2HYN A;  2YIU C;  1FBM A;  4Y28 J;  3KYQ A;  4OGQ B;  2FY8 A;  1NTM D;  1HJB A;  4IL6 E;  1ZME C;  2J59 M;  4YTP C;  2R3C A;  1P84 H;  2QEX P;  1FZB A;  4WB4 A;  2HR3 A;  4HH2 A;  1BSN A;  3JCU E;  5CHX A;  2YKQ A;  1GU5 A;  3M0A A;  4C46 A;  1NTZ K;  1VF5 B;  1RF1 A;  1OXZ A;  3MHV A;  1ZLL A;  2IFM A;  5CCG D;  3SFD C;  3B4S A;  1VQP P;  1A02 J;  1NTZ G;  1GD2 E;  1YJ9 P;  3CC2 P;  1RQU A;  4H13 D;  1N7L A;  2KI7 B;  3A5T A;  1L0N E;  2B9B A;  1LTJ C;  2E76 C;  3GHG B;  1SQP G;  3F89 A;  2GUS A;  1SQQ J;  3L4F A;  3V5B A;  4H44 C;  1IK7 A;  1LT9 C;  1VPC A;  4WBA A;  1IFN A;  2KUB A;  3CCS P;  1DD3 A;  3D6Z A;  4PJ0 E;  3H6P A;  1KYO H;  4YXD C;  3GF3 A;  1N7S A;  1JY3 O;  4PV1 D;  3FXE A;  1LTT C;  2MKV A;  2Y0E A;  2RMZ A;  1FZC A;  1KIL D;  1SQB J;  2WSE H;  2ZAE B;  1X79 B;  3G4S P;  2K9Y A;  3L74 G;  1MKM A;  1JUN A;  1G2C A;  5AVS B;  2KZI A;  1G1I A;  3MIW A;  1P84 E;  2IPP A;  2B89 A;  1NHL A;  3GLM A;  2KNC A;  1GW4 A;  3PRJ A;  1IZN B;  3H1I E;  2YXR B;  1L0L D;  1SQP E;  1T6A A;  3H1J G;  1SQX D;  4GOD A;  1LNQ A;  5H2F H;  4L76 A;  1H8A A;  2Q3E A;  1FDM A;  2RN0 A;  3NTN A;  2OYI B;  3UIA A;  2Q3I A;  3HTK B;  2XND H;  4NPD A;  4M3L A;  3JSV C;  2RH0 A;  5CCH A;  1L0N D;  3CX5 I;  2WZ7 A;  3HD7 A;  2Q7C A;  5AW2 B;  3HE4 B;  1S5L E;  4AUW A;  4YXW H;  1YBK A;  5C39 A;  1UIX A;  2JKV A;  2WVR A;  3Q5S A;  5KAI H;  2ZJS E;  3CXH E;  2ZXX A;  1RE4 A;  1LP1 B;  5APS A;  3VYI A;  3IAO A;  3IFM A;  2WSS H;  3H1H E;  3OW2 O;  2RKL A;  1KYO E;  3M06 A;  2E74 D;  4WY4 B;  1D7M A;  1QGK B;  4L73 A;  4AYC A;  2D2C C;  2H8P D;  3Q2Y A;  2FYN C;  5AW8 B;  3D71 A;  1BGY J;  3A7O A;  2JJL A;  3AEE C;  4H0L B;  3KDP B;  1MZ9 A;  4KHX A;  1EDJ A;  4W7Y A;  1XTG B;  2PFX A;  1GL2 D;  3L75 J;  1EZV I;  1NTZ D;  1WT6 A;  2IZ0 A;  2WSF H;  4Y99 C;  4I6M C;  3V2Q A;  3KZI H;  4BRY B;  1SQV J;  1K73 Q;  4I7Z B;  2KSE A;  2BAS A;  3RK3 B;  4ZMD A;  4WVZ A;  2ZT9 D;  1EZV G;  2CK3 H;  1JM0 A;  3V2R A;  3W67 A;  2JDI H;  1SQP D;  5H2F E;  4K35 A;  3MUD A;  1Q86 Q;  3JC2 2;  1K05 A;  2KS1 B;  4HB1 A;  3CX5 E;  3GHG A;  1RF1 C;  1LTA C;  2KSJ A;  2QM8 A;  1KOR A;  2AEM A;  1S9K E;  3S9O A;  4N78 E;  5E79 E;  3AED C;  2PAJ A;  2BCC J;  2QA4 P;  3TSI A;  1VQ5 P;  4DJG A;  2BEZ F;  5KAI E;  3HE5 A;  1SQQ E;  1PFI A;  3WUU A;  4OGQ D;  2W6B A;  4NPF X;  3L74 D;  3BCC J;  4XA4 A;  1KFM A;  1HUC A;  1U57 A;  1AVY A;  1OW8 A;  2N9Y B;  4DZO A;  1BE3 J;  1M1K Q;  3BVH A;  3P7K A;  2HLO A;  1AQ5 A;  2R32 A;  2XDJ A;  2YXQ B;  3AEG C;  1QEX A;  1NTK K;  3MGN A;  5GTH H;  1BSH A;  5KKZ B;  1T2K C;  1JTH B;  1Y47 A;  3PHL A;  4IOI H;  1NTK G;  3ZDM A;  3CCM P;  1KB9 I;  2J5U A;  2KLU A;  1SQB E;  4XE5 B;  1GZL A;  3L70 G;  3H1J D;  1AA0 A;  1J1E B;  4NPE A;  3B5N D;  1BDC A;  3LIE A;  2WTY A;  1ZOY C;  1QL2 A;  4JBZ A;  1PPJ G;  2G8Y A;  1AQT A;  3RBZ A;  2W27 A;  2KB7 P;  1Q82 Q;  3HTK A;  3RK2 C;  4R4L A;  2P10 A;  1FJP A;  1N8R Q;  2NZ2 A;  3BAS A;  1YQ3 C;  1BGY G;  1NU1 J;  1R5L A;  3HE4 A;  1AVO A;  1FZE A;  1N7S B;  2I8D A;  1GK6 A;  1T3U A;  3TYY A;  3CWB G;  5AVQ B;  3RL0 g;  1L4A A;  2ZT9 C;  3NFQ A;  1VQO P;  2V7Q H;  3RL0 B;  2Q9I A;  2KOG A;  3TGU J;  5CCH C;  3P8C D;  3Q5R A;  1YQ4 C;  3VMZ A;  2ITA A;  2JP3 A;  1RF0 A;  1LP1 A;  3HD7 C;  1R8E A;  2FXM A;  5CJ4 A;  1G2C B;  3L73 G;  1VDF A;  2J58 A;  3FX0 A;  2E76 D;  1HWT C;  3B8E B;  2E75 B;  2A45 H;  1N73 C;  1RE4 C;  4TLF A;  4H44 D;  5BVZ A;  3RK3 E;  1YTZ I;  1KFN A;  2QJK B;  1EXI A;  1PPJ E;  3AE4 C;  3FGA D;  1JY2 P;  1U7J A;  4OGQ C;  2YKO A;  4GDO A;  3T97 B;  4YPC A;  1IK9 A;  1M7L A;  2IYP A;  4BRY A;  1EZV D;  1DEB A;  3SFE C;  3CL3 D;  2HG5 D;  2FFD B;  2OTK E;  4O9B A;  2FKW B;  3H1H J;  2KLV A;  2KXP B;  3L75 E;  1JMM A;  2KS1 A;  1VF5 C;  3N7N A;  1FZG A;  1SQV E;  3CMA P;  2K3R A;  2WSE J;  1SLQ A;  2L91 A;  3MTU E;  2PP6 A;  3GMA A;  3MUD C;  2WWW A;  4EYY Q;  3GHG C;  2KK7 A;  2UWJ E;  2ZVN B;  1G1J A;  3U1A A;  2XNX A;  3G3Z A;  2W90 A;  1MFT A;  4EDF A;  5AW7 B;  4WY4 D;  3ABV C;  3SWK A;  2C9L Y;  2BCC E;  3H1K J;  1ZRT E;  4PD4 H;  1YTZ T;  4U3F J;  2XU6 A;  1VQ9 P;  3D6Y A;  1P84 I;  2HOD B;  1PV3 A;  1NTK D;  1HH0 A;  1Q81 Q;  2IZ1 A;  3I5C A;  2A06 D;  5AVX B;  1IJD B;  3BCC E;  4W80 A;  1JTH A;  1URQ B;  5TIS H;  3L70 D;  1JY2 N;  2FYU J;  3M9H A;  3AE3 C;  3V4W A;  3U59 A;  4CPG A;  1KB9 D;  1BE3 E;  1SQP K;  1S72 P;  2WT7 B;  4UB6 H;  3R2P A;  2QJP B;  2QVA A;  1PPJ D;  3H1I G;  3MP7 B;  3CCJ P;  2W6J H;  1EDL A;  5KAF E;  1KV4 A;  1AJY A;  1SP4 A;  1LWU C;  2OYH B;  2YIU B;  3U1C A;  3A0H E;  3C8V A;  2IBZ E;  3IF4 A;  2E5Y A;  1GTW A;  1BGY D;  1E5W A;  2D2C D;  1LTB C;  4EOT A;  4KJM A;  3HE5 B;  1GU4 A;  1NJI Q;  1U7M A;  4GOF A;  3CXH I;  1L2P A;  1IO4 A;  3CWB D;  4IFF A;  5EFW B;  2E5T A;  1VQK P;  1PZQ A;  2Q1K A;  2XZR A;  1UII A;  2OYI C;  1DD4 A;  2CPB A;  2YMY A;  1SVF A;  1SFC B;  4ZKU A;  4BWN A;  1S2E A;  1KYO I;  3L73 D;  2P58 A;  1NU1 E;  3B71 A;  2OAR A;  2N1T A;  4LLH A;  2WSF J;  3H1H G;  5AW4 B;  2QG4 A;  5KJ7 A;  1PGP A;  5APW A;  5KLV E;  1N86 A;  1YJN P;  2O01 J;  2OYO A;  4PD4 E;  3TGU E;  3L71 J;  5B5E H;  2NPS B;  1BCC J;  1ZXG A;  2PRR A;  3AE1 C;  4I2L C;  3H1L E;  1OFC X;  1LJ2 A;  5TIS E;  1J1D B;  4WY4 C;  3T97 A;  2P7J A;  3G6E P;  4OH8 B;  4UB6 E;  3V4Q A;  1H89 A;  3CC7 P;  5APT A;  1ZW0 A;  2FFD A;  1RY3 A;  1GDT A;  1NTM J;  4U3F G;  4H0L C;  3P8M C;  1YHQ P;  2I1J A;  2ZFC A;  1T2K D;  1EDI A;  1N7S D;  1L4A B;  3NXS A;  4I7Z C;  4JPZ B;  1RHZ B;  3M9B A;  2MJZ A;  3RK3 C;  2FYU G;  2JO1 A;  3N4X A;  1JMB A;  3I56 P;  3CCU P;  1SQQ K;  2NRG A;  3OJA B;  4L74 A;  1NYH A;  1SQQ G;  1NKN A;  2FXO A;  1RE3 A;  4JQ0 D;  3RK2 D;  2YKP A;  1A02 F;  1X8Y A;  3EFF K;  2CPS A;  2HOD A;  1FOS E;  4D6T E;  1SQB K;  1VQN P;  3E7K A;  1P84 D;  2O01 H;  2HPC B;  2ZXE B;  1URQ A;  2ZYG A;  1HVV A;  2GA1 A;  3H1K E;  1SQB G;  4ASV A;  3H1I D;  1OZH A;  4U3F E;  5CCH D;  1H0T B;  1M1J B;  2W6A A;  5CBO A;  1M57 D;  4EI2 A;  3HD7 D;  2WT7 A;  1ZP0 C;  4HJG H;  4H13 B;  1FJK A;  2AXC A;  3A0B H;  1XTC C;  1MUU A;  1LGH B;  5KKZ C;  3BRT B;  3EFG A;  2OYH A;  4KT0 J;  1HTL C;  2FYU E;  2V7Q J;  2ZYD A;  1ZR4 A;  2G3A A;  1VQ6 P;  4ZKP A;  1N2D C;  5L8R J;  4WWI A;  2OTJ P;  1YIJ P;  1JB0 J;  2K37 A;  1JOC A;  3CXH D;  3SWY A;  5CMZ A;  1L0L J;  4HKZ H;  4PV1 B;  1SFC A;  4RKU J;  1KIL B;  3H1H D;  1PP9 E;  1KYO D;  1T3J A;  1N7S C;  2KZJ A;  1VF5 D;  2K1A A;  1FZC C;  3WMM 0;  3EQ2 A;  4GKG A;  1KB9 H;  2R5D A;  2B87 B;  3GG2 A;  1IFI A;  1KQL A;  1KN7 A;  3E1R A;  1OWA A;  1QVG O;  1CSB A;  2JR8 A;  3CCV P;  2NPS A;  4MN4 C;  3L35 A;  1KC8 Q;  2WPQ A;  2WPR A;  1LT9 A;  3KZI E;  1KQG B;  1PGQ A;  2LXB A;  5AW3 B;  2E75 C;  1OW6 A;  5AW0 B;  1IFD A;  1T8Z A;  3L71 E;  5CJ0 A;  1KD1 Q;  1JCD A;  3CCQ P;  1BCC E;  4U3F D;  3A3Y B;  1JNM A;  3WU2 H;  3L37 A;  3C9I A;  2QJK C;  3BAT A;  3A0B E;  3VMA A;  3O6Q A;  3CX5 D;  2QRX A;  4QMA A;  3KQG A;  1SQV K;  3L75 G;  1EQ7 A;  5KLV J;  3S1K A;  2IFN A;  2FYU D;  4GT1 A;  1SQV G;  1S9K D;  4AQR D;  2FXP A;  4N78 D;  2K88 A;  2N1T B;  1NTM E;  3D70 A;  2OQQ A;  4IL6 H;  3SSU A;  1SQQ D;  1USE A;  1HBW A;  3M0D A;  3H1L J;  5DJT B;  1FS0 E;  1TU3 F;  3JCU H;  2E74 B;  1YJW P;  3QH9 A;  2AEJ A;  3SWF A;  1VL2 A;  2QIW A;  1EXJ A;  3G71 P;  1FDO A;  2BCC G;  5GTH E;  5AW1 B;  4LC1 A;  2Y0C A;  3LW5 H;  1S4X A;  3TK1 A;  2XV5 A;  4IL6 X;  1GK4 A;  1SQB D;  2P2U A;  1GL2 B;  5K5G B;  4I1L A;  1HJ0 A;  3BCC G;  4JF7 A;  2HPC A;  5CCG A;  3Q1M A;  1JY3 P;  4OWF A;  1VQ8 P;  5DJU B;  1Q90 D;  1H0T A;  1M1J A;  1BE3 G;  3G9R A;  2LR2 A;  3HRN A;  2WQY C;  3L74 J;  1QL1 A;  2IBZ I;  2QJY B;  1KQS O;  3HUS B;  2Z5H A;  1AFO A;  1CZQ A;  1PGJ A;  1URQ C;  1L4A D;  3AEB C;  3F5H A;  3P32 A;  2M3B A;  2IBZ G;  1LT1 A;  2M3E A;  3PJS K;  1OVU A;  2H7H A;  1N73 B;  1KIL E;  1JO5 A;  4W7Z A;  2DW3 A;  1Y9B A;  1BDD A;  4D6T J;  3H1J J;  2OYH C;  5AVV B;  2YMK A;  4C7N A;  2O3J A;  3M91 A;  4JYC A;  1NU1 K;  1EDK A;  1M8O B;  4HYT B;  4K3A A;  1KIL A;  2LKM A;  1NU1 G;  3E1I A;  5AVW B;  2LXC B;  5AVU B;  4H0L D;  5GTI H;  4PD4 I;  3KXD A;  5CBN A;  5KLV K;  5APY A;  2WSC H;  4N3Y B;  1L0L E;  5KLV G;  1SQX E;  3L72 J;  3W68 A;  1OVV A;  1FAV A;  3QWO C;  1SFC C;  1OVR A;  1YIT P;  2B87 A;  5B66 H;  1NKZ B;  5KLI B;  3RK3 D;  3AE9 C;  3TGU G;  5AVZ B;  1ZR2 A;  3O8Z A;  2ZVO B;  4JYB A;  1DIP A;  3B5N B;  3NMD A;  1JY3 N;  1HGZ A;  3H1L G;  2Y9Z A;  2O1J A;  3CLQ A;  3CC4 P;  1S5L H;  3AE2 C;  1FZA A;  1YYC A;  2NPS C;  3V2N A;  2V4H A;  3M9Q A;  1PP9 J;  3L75 D;  2WMM A;  1K9M Q;  3CXH H;  1JY2 O;  1NWQ A;  1OIP A;  1SQV D;  1J1D C;  3CPW O;  1PL5 A;  1OW7 A;  3TNU B;  4GIF A;  4RJT A;  4RES B;  1S5L X;  1YI2 P;  2JWD A;  5BU8 B;  4U7J A;  1NGM B;  1PIX A;  3H25 A;  1LTJ B;  3VMX A;  4ASW A;  1FDI A;  1X0T A;  3IN6 A;  1MV8 A;  3AEA C;  2Z5I A;  2E76 B;  3GW6 A;  1L4A C;  4IFD K;  1MFZ A;  2BCC D;  1ZRT D;  1RF0 C;  1LWU B;  1NTZ E;  4H44 B;  4EIJ A;  1LT9 B;  5GTI E;  1HGV A;  1ZV8 A;  3Q5P A;  3RBX A;  3M0D C;  2KP8 A; 
#chains in the Genus database with same CATH homology
 1SQX G;  1P84 H;  1NTZ G;  1EZV G;  1SQB G;  2IBZ G;  1BE3 G;  1SQV G;  1NTM G;  4PD4 H;  1BGY G;  1KYO H;  1PPJ G;  4D6T G;  5KLV G;  3H1J G;  1NTK G;  3CXH H;  3H1L G;  1SQQ G;  2A06 G;  3H1H G;  3L73 G;  3L71 G;  1PP9 G;  1KB9 H;  3CX5 H;  2FYU G;  3TGU G;  3BCC G;  3H1K G;  3H1I G;  1NU1 G;  1BCC G;  3L72 G;  4U3F G;  3L70 G;  3L75 G;  3L74 G;  2BCC G;  3CWB G;  1SQP G;  1L0L G;  1L0N G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...