1SQXG

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqxG00
1BE3G 1NTZG 3L70G 3H1JG 3H1IG 1BGYG 1PP9G 3H1KG 1NTKG 2A06G 4U3FG 4PD4H 1NU1G 3CXHH 3H1HG 3CWBG 3L73G 1SQVG 1PPJG 1P84H 1BCCG 3BCCG 1EZVG 3L71G 2IBZG 2BCCG 3H1LG 1NTMG 3L75G 4D6TG 1SQQG 3L74G 1KYOH 1SQBG 1SQPG 1KB9H 2FYUG 3TGUG 1L0NG 1L0LG 3CX5H 1SQXG 3L72G 5KLVG
chains in the Genus database with same CATH superfamily
1L0LJ 4KJMA 1H0TB 1BDDA 1GDTA 3ZDMA 3HD7D 4DOJA 3AE1C 4EYYQ 2H89C 2FXMA 2IPPA 2KIKA 5L8RJ 1S4XA 1IFNA 2OGUA 4PD4D 3HD7B 2ZVNB 3M0DA 2KS1A 5K5GB 5APUA 2P1JA 1OIPA 2AEJA 3RL0C 1NTKE 3L71J 4U7JA 4OH8B 1VDFA 4Y99C 3MUDA 1QL2A 4A7PA 3I55P 3L71E 3L35A 5DJTB 2FYUK 4YPCA 1OW7A 1NTZK 2PP6A 4UB6H 1FE6A 4L74A 1Q81Q 3BCCG 2KI7B 5APWA 2OYHB 3KZIH 1L4AA 3A3YB 1NU1D 2WITA 3LIDA 1GW4A 3RL0g 1HUCA 2R3CA 2Y0DA 1MKMA 4LLHA 1AJYA 4AUWA 1AV1A 2ITAA 5B5EE 3C9IA 1YYCA 1SQVJ 3HUSA 4NPDA 1PP9D 2ZYAA 1FJPA 1L0LG 2KOGA 3E1IA 4WY4C 2I8DA 2FFDA 3L72J 1GD2E 1J1EB 3GG2A 1KZUB 2XNXA 3E7KA 3PH0A 4H0LC 2XU6A 2KSEA 2OTJP 2HPCB 3H1HD 1MV8A 1P84E 1GL2C 3WU2E 4CPGA 1U7MA 1FZCB 1LTAC 3C8VA 5CBNA 2HODA 4W7ZA 1BE3D 3L71G 2ZAEB 1BCCJ 1NU1K 2NPSC 1YJNP 1E79H 1PGOA 2Q3EA 3L4FA 1LWUA 3U59A 1SQQE 1FDIA 3RK3D 1YJWP 1KTMA 1D7MA 5CBOA 2XZRA 3SWKA 3KHUA 1PGQA 1M1JB 1S3JA 2W6AA 2JO1A 2PRRA 3NTNA 2AEMA 4NPFX 4PJ0E 4GDOA 3CXHH 1HGVA 2V4HA 2WQYC 3AE5C 2YKOA 3QH9A 4DT0A 2WTYA 5CCGC 3L75J 5KJ7D 2WT7A 5AVQB 4EI2A 2M5AA 3L75E 2IBZI 1UIXA 3II6A 4L75A 2P2UA 1S5LH 3V2RA 2R5DA 2IX7C 3RL0D 1XTGB 2K9JB 3CPWO 4ZKUA 2CPBA 4C46A 3L74J 1PFIA 3IF4A 1SQVD 3NFQA 3CI9A 3FWLA 3Q5RA 2WSFH 2KUBA 2ZVOB 1DX7A 1JTHB 1AA0A 2QEXP 2OARA 1YBKA 1BCCG 3L72D 3RL0B 5CMZA 1JB0J 1SQQG 3CCQP 2A06D 2UWJE 2BASA 1CI6A 2KXPB 1LJ2A 1QEXA 2L5GB 1VQNP 2W90A 1PZQA 3AE8C 1G2CA 2BEZF 4IL6H 4GKGA 1IJDB 2H43A 1BCCD 3AE9C 2KLVA 2RN0A 1SQBE 3AE2C 1DH3A 5AVZB 1A02J 1SLQA 3BVHA 2KP8A 3L75G 1FOSE 1PGPA 2WPVB 1SQVK 2P58A 3BRTB 1JCCA 3CL3D 1X9VA 4UB6E 1RQUA 1W2EA 2PFXA 1GW3A 1GL2D 4XA4A 4HB1A 4TLFA 1HJBA 3KZIE 2FYZA 1KILE 1FJKA 2IYPA 4Y28J 2CPSA 2G3AA 1NO4A 1BGYD 1YQ3C 3L74G 3GF3A 1FOSF 1PPJD 1GL2B 3V2PA 2Y0CA 3PLNA 3Q5PA 2QA4P 3H1IJ 1ZRTE 3GMAA 1FDMA 1YHQP 2GA1A 3P32A 3FXEA 3M0DC 5C39A 1KYOH 2FYNB 4H44C 3HE4A 3C1LA 1NTME 4GOEA 2IBZD 4DJGA 3H1JJ 1KN7A 3MUDC 3W67A 2M3EA 4ZMDA 2JEEA 3O6QA 2H8PD 3L70D 3CC4P 3A0BE 1RQVA 2N9YB 1RE4A 2N1TA 1MZ9A 1SQBG 2OTLP 1M1KQ 2O01N 3LW5H 4D6TE 4NPEA 2JWDA 2J58A 1MUUA 2R5BA 1L4AC 1FZEA 2FY8A 1SQPD 2YIUC 4JYBA 1VQ9P 1EZVG 3PJSK 3Q1MA 5APXA 3H1KD 4UB8H 1G1JA 1YTZT 1IFPA 2Q1KA 3HUSC 2O1KA 2FYUE 1IO4A 1NH4A 5CCGA 2YO2A 3A5TA 3CMAP 3MZWB 1SQXE 3AEDC 5AW0B 2FFDC 2HG5D 3U1CA 2N9BA 1KB9H 1RF1B 3CXHE 3CD6P 1ZW0A 1SFCA 1YI2P 3H1IG 2YMYA 3P8MC 4LGDE 2XV5A 1ZXGA 1FZGA 1N7SD 3AE3C 4Z1MH 2H88C 3JSVC 4YTPC 1CZQA 1VF5C 2HLOA 1S5LE 3JCUH 5GTHH 3RBZA 3TYYA 1SQPK 3MP7B 5CCHA 3MIWA 1OVRA 1EXJA 1L0ND 1LWUC 2A45G 3IFMA 2WSSH 3OW2O 1LP1A 3MTUE 3CWBD 1KILA 1YIJP 2R44A 3SFEC 1S5LX 1JY2O 3R4YA 3VMYA 3W68A 2WSCJ 3H1JD 1IK9A 3T97B 2W27A 1W2BO 3KXDA 1QLED 1SQXG 3FX0A 1OVUA 1KORA 4IL6E 2WVRA 1VQOP 1WT6A 2FKWB 5BU8B 3CCVP 2D2CC 3HTKA 1HH0A 2Z5HA 2B87B 3P8CE 1ZLLA 1HWTC 2SPZA 5TISH 1L0NK 3OA7A 3S1KA 3V5BA 5AW8B 4N6JA 3G3ZA 1DIPA 3B5NA 4IL6X 1ZR2A 5APYA 3O8ZA 2KS1B 4WB4A 3PTZA 3HE5A 1KQFB 5AW6B 3L73E 4C7NA 2QRXA 4H13C 4IFFA 1JM0A 3A0HH 3H32A 2YKQA 4MN4C 1NTKJ 1BE3E 3TGUD 1DEBA 3CCSP 3PHLA 1NJIQ 1M90Q 3CC2P 3AEGC 1T3UA 2XDJA 3B8EB 3F5HA 3AEBC 3RK3E 1OVVA 2OYOA 2YNYA 2YIUB 3RBXA 1KYOE 4L76A 1URQD 1MFZA 2K3RA 3WUUA 4ASWA 3FGAD 4W80A 1NGMB 2K37A 3HUSB 3MD0A 1N2DC 2YMKA 2O1JA 1OW8A 1LTSC 5AW3B 2FFDB 1URQB 2E74D 3AE4C 2XNDH 2LKMA 4K35A 1N7LA 3L36A 1OMIA 2P7JA 3BCCD 2WSEJ 1P84I 2OYHA 2KNCA 1X8YA 2V7QJ 4UB8E 3IAOA 2E74B 2Q7CA 4I2LC 1JEKA 1LTJA 2HODB 2IZ0A 1MFTA 1KMIZ 4BWNA 3CCRP 2Q6QA 1GTWA 3TNUB 1NTKG 1S2EA 3RK2C 1QX8A 1KB9E 1LWUB 1L0LD 2A06E 3V4QA 1SQQJ 2O01H 1VL2A 3CX5H 1SP4A 4N78D 2ZYDA 1RE4C 2N1TC 2OQQA 5KKZB 1S9KD 3KPEA 5GTHE 1T3JA 2D2CD 4HJGH 2QM8A 1NTKD 1M7LA 2QJPB 4GODA 1FC2C 3L71D 1YQ4C 1GK4A 2LXCB 2WT7B 5KLVE 3SWFA 3MHVA 1JY3N 2D2CB 2W83C 3K5BA 1YITP 1ZMEC 2ZYGA 3SWYA 3CC7P 1N73A 3VOPA 2IFNA 2VRSA 3I56P 1L0LK 4PD4H 1FS0E 1BGYE 1SFCC 4U3FE 2LXBA 3G4SP 2Q5UA 1IFDA 1HTLC 1CI6B 1FAVA 1NTKK 1AFOA 5AW9B 2K9YA 5TISE 3G71P 2G8YA 5CCHC 2W6JH 4Y99B 1JY3O 2B9BA 2IBZE 1G2CB 1P84D 2QE7H 1R5SA 1OX3A 5KJ7A 3L70E 1OZHA 1KILC 1LT1A 5M1BA 3FXDA 3A0HE 2QVAA 1JCDA 1SQBJ 3VMXA 4WY4D 5H2FH 3VYIA 1EDJA 4K3AA 1EZVI 2GUVA 1PV3A 4BXLA 1FDOA 1SQPE 1SQQD 5AW5B 2M0BA 1H89A 4AYCA 1U7JA 3H1KE 4JYCA 2IYOA 3Q2YA 4H0LD 1ZR4A 4WY4B 1PL5A 1Y9BA 2C0XA 2B89A 1L2PA 4I7ZC 4U3FG 3RK2D 3M91A 3I5CA 4RKUJ 2DW3A 5AW7B 1U57A 5KLIC 1GMJA 4H0LB 2NPSD 4M3LA 5AVWB 3B5NC 1Q2NA 2N1TD 1T8ZA 3L75D 1CSBA 2OYIA 1LTIC 3HE4B 1RE3C 3RK2B 3D70A 2E75C 3BASA 2BCCJ 1NTMJ 2NPSB 3OJAB 3O6QB 1SQQK 2L91A 2BCCE 2A45I 2N1TB 1LNQA 3GHGA 3Q3DA 3L74D 1BSHA 1Q7YQ 1K05A 5CCGD 3H1LJ 4D6TJ 2Y0EA 3CWBE 5AVSB 4HH2A 1NYHA 4BRYA 3H1LE 3HD7C 3U1AA 5AVVB 2PGDA 1TU3F 5AVTB 4WBAA 2M3BA 3CX5E 1SFCD 1QL1A 2Z4EA 4KHXA 2K88A 2AXTH 2FYUJ 2LR2A 4RESB 3CXHI 1SQXJ 3PRJA 3CLQA 2FXOA 2WZ7A 1SQBD 1EXIA 1NTZE 1SFCB 1RHZB 3EFFK 2OYHC 3IN6A 1IZNB 1JY2N 5AVRB 4LC1A 3EQ2A 3CCUP 1LT9A 1EZVD 1LTJC 1KFMA 3WUVA 2P67A 3F89A 1WRGA 2RMZA 2J59M 4JPZB 2BCCG 1NTMG 4L73A 4R4LA 1X79B 4PD4E 2C0WA 2Y9YA 1JUNA 3VMAA 3TK1A 4JBZA 5B66H 1GU4A 1YTZI 1LP1B 1J1EC 3TGUE 3USSA 1ZRTD 2WSFJ 3H1LG 1OW6A 3N4XA 3H1ID 4D6TG 3GLMA 1J2JB 2KLUA 1UIIA 2WPQA 4W7YA 5KAFH 1SQBK 5AVYB 1AQTA 1DEEG 2P10A 4PJ0H 2NRGA 1IFMA 4TT3H 3Q5SA 1NU1J 3BATA 1CW5A 2IDBA 1K9MQ 1Q90D 2HR3A 4I6MC 2FYUG 1NU1E 2JJLA 1BDCA 3GF7A 3EFGA 1NTZG 1RF0C 2MJZA 3HTKB 1N7SA 1IK7A 1OXZA 1S1CX 2E75D 4IOIH 1N73C 3CCLP 3KDPB 2W6BA 1PP9E 5H2FE 5E79H 5KLIB 1Z56A 1M56D 2CK3H 3JC22 3R2PA 4H44D 3VMZA 2QJYC 3B5NB 3BCCE 1HVVA 1AVYA 3HE5B 5BVZA 3V4WA 3VP8A 3RK3C 4C7NB 4ZNCA 2BEQD 2E75B 1SQXD 2J5UA 3L73J 3H32B 3NXSA 1VQMP 4H44B 3H1HE 1RE3A 1LTGC 4DZOA 3CXHD 1BE3J 5BU5A 3GW6A 1L4AD 1IC2A 3AE6C 1L0LE 2WPSA 2MKVA 1KYOI 2B87A 4JQ0D 4OWFA 2RKLA 1NKZB 1H0TA 2AXCA 2KZJA 3S4RA 2B88A 3ABVC 5KJ7C 1ZN5A 4N78E 1VQ5P 5KTBA 1HF9A 1S9KE 4RO0A 1L4AB 3AECC 1NAFA 1NU1G 2JDIH 3L37A 2Z5IA 5CJ0A 1T6AA 3VTPC 2H7HA 1KD1Q 4JF7A 3HD7A 2YXQB 4HKZH 4XE5B 5AW4B 4GOFA 3HRNA 1BSNA 2ZT9C 1PP9G 1N86A 3LW5J 1SQXK 1ZOYC 2OTKE 3AEAC 2KNCB 1VF5D 4XFJA 3V2QA 3FWNA 1KV4A 3P7KA 1GZLA 3VN0A 1LTJB 2QSIA 1EDIA 1ZP0C 2JKVA 2AXTE 3H1HG 3L73G 2YO3A 1KB9I 5KAIH 2E5YA 1VQKP 5AVUB 2OYIC 2POHA 4C7RA 1VF5B 1VPCA 1SQVE 1BE3G 1QVGO 1URQA 4QMAA 3P8CD 3M9HA 2IZ1A 1IFIA 3L72E 2WWWA 5APVA 3SSUA 3GHGC 1OWAA 3RGUA 5GTIH 3L73D 3A0BH 1LTTC 4EIJA 2A45H 3JCUE 1FU1A 2HPCA 4N3YB 4YXDC 1N8RQ 3TNUA 5B66E 2KK7A 1JNMA 3BRVB 4ZKPA 1H88A 1FZCA 1QVFO 2FYNC 3A7OA 5APQA 1T2KC 1BCCE 4RJTA 1FZAA 5KLVJ 1JOCA 1NKNA 1QGKB 1N73B 3UIAA 4PV1C 1KYOD 2M5AB 4WWIA 1VQLP 5KAFE 1RF0A 5AVXB 2NZ2A 3TSIA 2KZIA 2QM7A 2KB7P 4OGQC 2QJYB 4WVZA 4DCKA 2Q9IA 1G1IA 2WPRA 3LIEA 1K8AQ 4H13D 4I1LA 1M1JA 3RK3B 1BGYJ 5APSA 1LTBC 4U3FJ 1SQVG 3MGNA 1LT9C 1WMKA 1VQ6P 2IFMA 1JY2P 3G6EP 1FZFA 3CMEP 1X22A 4B86A 1PPJE 3L72G 4H13B 1GK6A 5E79E 1NWQA 2A06G 2QJKC 2FBWC 3WUTA 5TJHA 3ITKA 2QIWA 1Y47A 1SVFA 1RF1C 4EDFA 1JMMA 2ZT9D 3L70J 3L74E 1VQ8P 4ASVA 2K9JA 2YKPA 1KB9D 3M0AA 2K1AA 2HFED 1EQ7A 1SQPJ 1K73Q 1JTHA 5KLVG 3H6PA 2ZT9B 2WSCH 3EWKA 3D71A 2E43A 3H1KJ 5CHXA 1H8AA 1Q86Q 1NOHA 1NHLA 1KFNA 1LGHB 1N7SC 2JP3A 3OAKA 2Y9ZA 2QG4A 1XTCC 2RH0A 1Q82Q 1GU5A 1YJ9P 1KC8Q 3AEFC 1BGYG 2ZXXA 3N7NA 3M9QA 3IR9A 1PPJG 5AW2B 5KLVD 2ZJSE 5APTA 2OYIB 1EC5A 1J1DC 2O3JA 3NMDA 3TDKA 1X0TA 3TF5A 1EZVE 3KYQA 1NAYA 1ZV8A 1FBMA 2C9LY 4WY4A 2IBZG 3GHGB 3S9OA 4IFDK 1EDLA 4U3FD 1T2KD 3V2NA 3SFDC 3B4SA 1L0NJ 2GUSA 3L70G 2E76C 5KAIE 1KQSO 1A02F 4PV1D 1L0NE 5AW1B 4BRYB 1JO5A 3H1IE 3CWBJ 3CX5I 1GL2A 2E42A 2AEFA 4OGQD 3D6ZA 1SQPG 3CCEP 2I1KA 2O01J 3WMM0 3H1KG 5KLVK 1DD3A 2NPSA 4PV1B 3QWOC 2XKMA 5GTIE 4AQRD 1M57D 3H1JE 2PAJA 3AE7C 3H25A 2W8ZA 4HYTB 4OGQB 4EOTA 5B5EH 1NTZJ 1JMBA 2WMMA 2M8RA 1LT9B 1IFJA 2C9NY 2KSJA 3PP5A 2JR8A 1DD4A 3V6IA 1W5CE 5CCHD 2Q3IA 2WSEH 4PD4I 5CJ4A 2KYVA 1HBWA 2V7QH 2QJKB 2R32A 5DJUB 4R4MA 1KILD 1P84H 4IFMA 1URQC 3WU2H 2I1JA 2JWAA 3M06A 3D6YA 2ZFCA 1R5LA 3CCJP 1L0NG 3TGUJ 1HJ0A 3KQGA 3CCMP 1S72P 1USEA 2R3SA 1HGZA 2FXPA 4GT1A 3B71A 3CWBG 1KILB 1RF1A 1K04A 2E74C 2ZXEB 5EFWB 2E5TA 1OFCX 3VP9A 3M9BA 3H1JG 1NVOA 2BCCD 1NTMD 3E1RA 2GM4A 1FZCC 1SS1A 1AVOA 2HYNA 4GIFA 1N7SB 1VQPP 1Y8AA 3B5ND 1USDA 1RH5B 1VQ7P 3H1LD 4OVNF 4D6TD 4O9BA 4YXWH 4I7ZB 5KKZC 1PP9J 1JY3P 1AQ5A 1VQ4P 3CX5D 1M1JC 1J1DB 3A2AA 3BCCJ 4KT0J 1EDKA 3G9RA 2QJPC 2E76D 1R8EA 1E5WA 2YXRB 1FZBA 1PIXA 1PGJA 1KQGB 3T97A 2FYUD 1NTZD 3H1HJ 1KQLA 1RY3A 1M8OB 3TGUG 3AEEC 1NTMK 2E76B
chains in the Genus database with same CATH topology
1BE3G 1NTZG 3L70G 3H1JG 3H1IG 1BGYG 1PP9G 3H1KG 1NTKG 2A06G 4U3FG 4PD4H 1NU1G 3CXHH 3H1HG 3CWBG 3L73G 1SQVG 1PPJG 1P84H 1BCCG 3BCCG 1EZVG 3L71G 2IBZG 2BCCG 3H1LG 1NTMG 3L75G 4D6TG 1SQQG 3L74G 1KYOH 1SQBG 1SQPG 1KB9H 2FYUG 3TGUG 1L0NG 1L0LG 3CX5H 1SQXG 3L72G 5KLVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 G;  1NTZ G;  3L70 G;  3H1J G;  3H1I G;  1BGY G;  1PP9 G;  3H1K G;  1NTK G;  2A06 G;  4U3F G;  4PD4 H;  1NU1 G;  3CXH H;  3H1H G;  3CWB G;  3L73 G;  1SQV G;  1PPJ G;  1P84 H;  1BCC G;  3BCC G;  1EZV G;  3L71 G;  2IBZ G;  2BCC G;  3H1L G;  1NTM G;  3L75 G;  4D6T G;  1SQQ G;  3L74 G;  1KYO H;  1SQB G;  1SQP G;  1KB9 H;  2FYU G;  3TGU G;  1L0N G;  1L0L G;  3CX5 H;  1SQX G;  3L72 G;  5KLV G; 
#chains in the Genus database with same CATH topology
 1L0L J;  4KJM A;  1H0T B;  1BDD A;  1GDT A;  3ZDM A;  3HD7 D;  4DOJ A;  3AE1 C;  4EYY Q;  2H89 C;  2FXM A;  2IPP A;  2KIK A;  5L8R J;  1S4X A;  1IFN A;  2OGU A;  4PD4 D;  3HD7 B;  2ZVN B;  3M0D A;  2KS1 A;  5K5G B;  5APU A;  2P1J A;  1OIP A;  2AEJ A;  3RL0 C;  1NTK E;  3L71 J;  4U7J A;  4OH8 B;  1VDF A;  4Y99 C;  3MUD A;  1QL2 A;  4A7P A;  3I55 P;  3L71 E;  3L35 A;  5DJT B;  2FYU K;  4YPC A;  1OW7 A;  1NTZ K;  2PP6 A;  4UB6 H;  1FE6 A;  4L74 A;  1Q81 Q;  3BCC G;  2KI7 B;  5APW A;  2OYH B;  3KZI H;  1L4A A;  3A3Y B;  1NU1 D;  2WIT A;  3LID A;  1GW4 A;  3RL0 g;  1HUC A;  2R3C A;  2Y0D A;  1MKM A;  4LLH A;  1AJY A;  4AUW A;  1AV1 A;  2ITA A;  5B5E E;  3C9I A;  1YYC A;  1SQV J;  3HUS A;  4NPD A;  1PP9 D;  2ZYA A;  1FJP A;  1L0L G;  2KOG A;  3E1I A;  4WY4 C;  2I8D A;  2FFD A;  3L72 J;  1GD2 E;  1J1E B;  3GG2 A;  1KZU B;  2XNX A;  3E7K A;  3PH0 A;  4H0L C;  2XU6 A;  2KSE A;  2OTJ P;  2HPC B;  3H1H D;  1MV8 A;  1P84 E;  1GL2 C;  3WU2 E;  4CPG A;  1U7M A;  1FZC B;  1LTA C;  3C8V A;  5CBN A;  2HOD A;  4W7Z A;  1BE3 D;  3L71 G;  2ZAE B;  1BCC J;  1NU1 K;  2NPS C;  1YJN P;  1E79 H;  1PGO A;  2Q3E A;  3L4F A;  1LWU A;  3U59 A;  1SQQ E;  1FDI A;  3RK3 D;  1YJW P;  1KTM A;  1D7M A;  5CBO A;  2XZR A;  3SWK A;  3KHU A;  1PGQ A;  1M1J B;  1S3J A;  2W6A A;  2JO1 A;  2PRR A;  3NTN A;  2AEM A;  4NPF X;  4PJ0 E;  4GDO A;  3CXH H;  1HGV A;  2V4H A;  2WQY C;  3AE5 C;  2YKO A;  3QH9 A;  4DT0 A;  2WTY A;  5CCG C;  3L75 J;  5KJ7 D;  2WT7 A;  5AVQ B;  4EI2 A;  2M5A A;  3L75 E;  2IBZ I;  1UIX A;  3II6 A;  4L75 A;  2P2U A;  1S5L H;  3V2R A;  2R5D A;  2IX7 C;  3RL0 D;  1XTG B;  2K9J B;  3CPW O;  4ZKU A;  2CPB A;  4C46 A;  3L74 J;  1PFI A;  3IF4 A;  1SQV D;  3NFQ A;  3CI9 A;  3FWL A;  3Q5R A;  2WSF H;  2KUB A;  2ZVO B;  1DX7 A;  1JTH B;  1AA0 A;  2QEX P;  2OAR A;  1YBK A;  1BCC G;  3L72 D;  3RL0 B;  5CMZ A;  1JB0 J;  1SQQ G;  3CCQ P;  2A06 D;  2UWJ E;  2BAS A;  1CI6 A;  2KXP B;  1LJ2 A;  1QEX A;  2L5G B;  1VQN P;  2W90 A;  1PZQ A;  3AE8 C;  1G2C A;  2BEZ F;  4IL6 H;  4GKG A;  1IJD B;  2H43 A;  1BCC D;  3AE9 C;  2KLV A;  2RN0 A;  1SQB E;  3AE2 C;  1DH3 A;  5AVZ B;  1A02 J;  1SLQ A;  3BVH A;  2KP8 A;  3L75 G;  1FOS E;  1PGP A;  2WPV B;  1SQV K;  2P58 A;  3BRT B;  1JCC A;  3CL3 D;  1X9V A;  4UB6 E;  1RQU A;  1W2E A;  2PFX A;  1GW3 A;  1GL2 D;  4XA4 A;  4HB1 A;  4TLF A;  1HJB A;  3KZI E;  2FYZ A;  1KIL E;  1FJK A;  2IYP A;  4Y28 J;  2CPS A;  2G3A A;  1NO4 A;  1BGY D;  1YQ3 C;  3L74 G;  3GF3 A;  1FOS F;  1PPJ D;  1GL2 B;  3V2P A;  2Y0C A;  3PLN A;  3Q5P A;  2QA4 P;  3H1I J;  1ZRT E;  3GMA A;  1FDM A;  1YHQ P;  2GA1 A;  3P32 A;  3FXE A;  3M0D C;  5C39 A;  1KYO H;  2FYN B;  4H44 C;  3HE4 A;  3C1L A;  1NTM E;  4GOE A;  2IBZ D;  4DJG A;  3H1J J;  1KN7 A;  3MUD C;  3W67 A;  2M3E A;  4ZMD A;  2JEE A;  3O6Q A;  2H8P D;  3L70 D;  3CC4 P;  3A0B E;  1RQV A;  2N9Y B;  1RE4 A;  2N1T A;  1MZ9 A;  1SQB G;  2OTL P;  1M1K Q;  2O01 N;  3LW5 H;  4D6T E;  4NPE A;  2JWD A;  2J58 A;  1MUU A;  2R5B A;  1L4A C;  1FZE A;  2FY8 A;  1SQP D;  2YIU C;  4JYB A;  1VQ9 P;  1EZV G;  3PJS K;  3Q1M A;  5APX A;  3H1K D;  4UB8 H;  1G1J A;  1YTZ T;  1IFP A;  2Q1K A;  3HUS C;  2O1K A;  2FYU E;  1IO4 A;  1NH4 A;  5CCG A;  2YO2 A;  3A5T A;  3CMA P;  3MZW B;  1SQX E;  3AED C;  5AW0 B;  2FFD C;  2HG5 D;  3U1C A;  2N9B A;  1KB9 H;  1RF1 B;  3CXH E;  3CD6 P;  1ZW0 A;  1SFC A;  1YI2 P;  3H1I G;  2YMY A;  3P8M C;  4LGD E;  2XV5 A;  1ZXG A;  1FZG A;  1N7S D;  3AE3 C;  4Z1M H;  2H88 C;  3JSV C;  4YTP C;  1CZQ A;  1VF5 C;  2HLO A;  1S5L E;  3JCU H;  5GTH H;  3RBZ A;  3TYY A;  1SQP K;  3MP7 B;  5CCH A;  3MIW A;  1OVR A;  1EXJ A;  1L0N D;  1LWU C;  2A45 G;  3IFM A;  2WSS H;  3OW2 O;  1LP1 A;  3MTU E;  3CWB D;  1KIL A;  1YIJ P;  2R44 A;  3SFE C;  1S5L X;  1JY2 O;  3R4Y A;  3VMY A;  3W68 A;  2WSC J;  3H1J D;  1IK9 A;  3T97 B;  2W27 A;  1W2B O;  3KXD A;  1QLE D;  1SQX G;  3FX0 A;  1OVU A;  1KOR A;  4IL6 E;  2WVR A;  1VQO P;  1WT6 A;  2FKW B;  5BU8 B;  3CCV P;  2D2C C;  3HTK A;  1HH0 A;  2Z5H A;  2B87 B;  3P8C E;  1ZLL A;  1HWT C;  2SPZ A;  5TIS H;  1L0N K;  3OA7 A;  3S1K A;  3V5B A;  5AW8 B;  4N6J A;  3G3Z A;  1DIP A;  3B5N A;  4IL6 X;  1ZR2 A;  5APY A;  3O8Z A;  2KS1 B;  4WB4 A;  3PTZ A;  3HE5 A;  1KQF B;  5AW6 B;  3L73 E;  4C7N A;  2QRX A;  4H13 C;  4IFF A;  1JM0 A;  3A0H H;  3H32 A;  2YKQ A;  4MN4 C;  1NTK J;  1BE3 E;  3TGU D;  1DEB A;  3CCS P;  3PHL A;  1NJI Q;  1M90 Q;  3CC2 P;  3AEG C;  1T3U A;  2XDJ A;  3B8E B;  3F5H A;  3AEB C;  3RK3 E;  1OVV A;  2OYO A;  2YNY A;  2YIU B;  3RBX A;  1KYO E;  4L76 A;  1URQ D;  1MFZ A;  2K3R A;  3WUU A;  4ASW A;  3FGA D;  4W80 A;  1NGM B;  2K37 A;  3HUS B;  3MD0 A;  1N2D C;  2YMK A;  2O1J A;  1OW8 A;  1LTS C;  5AW3 B;  2FFD B;  1URQ B;  2E74 D;  3AE4 C;  2XND H;  2LKM A;  4K35 A;  1N7L A;  3L36 A;  1OMI A;  2P7J A;  3BCC D;  2WSE J;  1P84 I;  2OYH A;  2KNC A;  1X8Y A;  2V7Q J;  4UB8 E;  3IAO A;  2E74 B;  2Q7C A;  4I2L C;  1JEK A;  1LTJ A;  2HOD B;  2IZ0 A;  1MFT A;  1KMI Z;  4BWN A;  3CCR P;  2Q6Q A;  1GTW A;  3TNU B;  1NTK G;  1S2E A;  3RK2 C;  1QX8 A;  1KB9 E;  1LWU B;  1L0L D;  2A06 E;  3V4Q A;  1SQQ J;  2O01 H;  1VL2 A;  3CX5 H;  1SP4 A;  4N78 D;  2ZYD A;  1RE4 C;  2N1T C;  2OQQ A;  5KKZ B;  1S9K D;  3KPE A;  5GTH E;  1T3J A;  2D2C D;  4HJG H;  2QM8 A;  1NTK D;  1M7L A;  2QJP B;  4GOD A;  1FC2 C;  3L71 D;  1YQ4 C;  1GK4 A;  2LXC B;  2WT7 B;  5KLV E;  3SWF A;  3MHV A;  1JY3 N;  2D2C B;  2W83 C;  3K5B A;  1YIT P;  1ZME C;  2ZYG A;  3SWY A;  3CC7 P;  1N73 A;  3VOP A;  2IFN A;  2VRS A;  3I56 P;  1L0L K;  4PD4 H;  1FS0 E;  1BGY E;  1SFC C;  4U3F E;  2LXB A;  3G4S P;  2Q5U A;  1IFD A;  1HTL C;  1CI6 B;  1FAV A;  1NTK K;  1AFO A;  5AW9 B;  2K9Y A;  5TIS E;  3G71 P;  2G8Y A;  5CCH C;  2W6J H;  4Y99 B;  1JY3 O;  2B9B A;  2IBZ E;  1G2C B;  1P84 D;  2QE7 H;  1R5S A;  1OX3 A;  5KJ7 A;  3L70 E;  1OZH A;  1KIL C;  1LT1 A;  5M1B A;  3FXD A;  3A0H E;  2QVA A;  1JCD A;  1SQB J;  3VMX A;  4WY4 D;  5H2F H;  3VYI A;  1EDJ A;  4K3A A;  1EZV I;  2GUV A;  1PV3 A;  4BXL A;  1FDO A;  1SQP E;  1SQQ D;  5AW5 B;  2M0B A;  1H89 A;  4AYC A;  1U7J A;  3H1K E;  4JYC A;  2IYO A;  3Q2Y A;  4H0L D;  1ZR4 A;  4WY4 B;  1PL5 A;  1Y9B A;  2C0X A;  2B89 A;  1L2P A;  4I7Z C;  4U3F G;  3RK2 D;  3M91 A;  3I5C A;  4RKU J;  2DW3 A;  5AW7 B;  1U57 A;  5KLI C;  1GMJ A;  4H0L B;  2NPS D;  4M3L A;  5AVW B;  3B5N C;  1Q2N A;  2N1T D;  1T8Z A;  3L75 D;  1CSB A;  2OYI A;  1LTI C;  3HE4 B;  1RE3 C;  3RK2 B;  3D70 A;  2E75 C;  3BAS A;  2BCC J;  1NTM J;  2NPS B;  3OJA B;  3O6Q B;  1SQQ K;  2L91 A;  2BCC E;  2A45 I;  2N1T B;  1LNQ A;  3GHG A;  3Q3D A;  3L74 D;  1BSH A;  1Q7Y Q;  1K05 A;  5CCG D;  3H1L J;  4D6T J;  2Y0E A;  3CWB E;  5AVS B;  4HH2 A;  1NYH A;  4BRY A;  3H1L E;  3HD7 C;  3U1A A;  5AVV B;  2PGD A;  1TU3 F;  5AVT B;  4WBA A;  2M3B A;  3CX5 E;  1SFC D;  1QL1 A;  2Z4E A;  4KHX A;  2K88 A;  2AXT H;  2FYU J;  2LR2 A;  4RES B;  3CXH I;  1SQX J;  3PRJ A;  3CLQ A;  2FXO A;  2WZ7 A;  1SQB D;  1EXI A;  1NTZ E;  1SFC B;  1RHZ B;  3EFF K;  2OYH C;  3IN6 A;  1IZN B;  1JY2 N;  5AVR B;  4LC1 A;  3EQ2 A;  3CCU P;  1LT9 A;  1EZV D;  1LTJ C;  1KFM A;  3WUV A;  2P67 A;  3F89 A;  1WRG A;  2RMZ A;  2J59 M;  4JPZ B;  2BCC G;  1NTM G;  4L73 A;  4R4L A;  1X79 B;  4PD4 E;  2C0W A;  2Y9Y A;  1JUN A;  3VMA A;  3TK1 A;  4JBZ A;  5B66 H;  1GU4 A;  1YTZ I;  1LP1 B;  1J1E C;  3TGU E;  3USS A;  1ZRT D;  2WSF J;  3H1L G;  1OW6 A;  3N4X A;  3H1I D;  4D6T G;  3GLM A;  1J2J B;  2KLU A;  1UII A;  2WPQ A;  4W7Y A;  5KAF H;  1SQB K;  5AVY B;  1AQT A;  1DEE G;  2P10 A;  4PJ0 H;  2NRG A;  1IFM A;  4TT3 H;  3Q5S A;  1NU1 J;  3BAT A;  1CW5 A;  2IDB A;  1K9M Q;  1Q90 D;  2HR3 A;  4I6M C;  2FYU G;  1NU1 E;  2JJL A;  1BDC A;  3GF7 A;  3EFG A;  1NTZ G;  1RF0 C;  2MJZ A;  3HTK B;  1N7S A;  1IK7 A;  1OXZ A;  1S1C X;  2E75 D;  4IOI H;  1N73 C;  3CCL P;  3KDP B;  2W6B A;  1PP9 E;  5H2F E;  5E79 H;  5KLI B;  1Z56 A;  1M56 D;  2CK3 H;  3JC2 2;  3R2P A;  4H44 D;  3VMZ A;  2QJY C;  3B5N B;  3BCC E;  1HVV A;  1AVY A;  3HE5 B;  5BVZ A;  3V4W A;  3VP8 A;  3RK3 C;  4C7N B;  4ZNC A;  2BEQ D;  2E75 B;  1SQX D;  2J5U A;  3L73 J;  3H32 B;  3NXS A;  1VQM P;  4H44 B;  3H1H E;  1RE3 A;  1LTG C;  4DZO A;  3CXH D;  1BE3 J;  5BU5 A;  3GW6 A;  1L4A D;  1IC2 A;  3AE6 C;  1L0L E;  2WPS A;  2MKV A;  1KYO I;  2B87 A;  4JQ0 D;  4OWF A;  2RKL A;  1NKZ B;  1H0T A;  2AXC A;  2KZJ A;  3S4R A;  2B88 A;  3ABV C;  5KJ7 C;  1ZN5 A;  4N78 E;  1VQ5 P;  5KTB A;  1HF9 A;  1S9K E;  4RO0 A;  1L4A B;  3AEC C;  1NAF A;  1NU1 G;  2JDI H;  3L37 A;  2Z5I A;  5CJ0 A;  1T6A A;  3VTP C;  2H7H A;  1KD1 Q;  4JF7 A;  3HD7 A;  2YXQ B;  4HKZ H;  4XE5 B;  5AW4 B;  4GOF A;  3HRN A;  1BSN A;  2ZT9 C;  1PP9 G;  1N86 A;  3LW5 J;  1SQX K;  1ZOY C;  2OTK E;  3AEA C;  2KNC B;  1VF5 D;  4XFJ A;  3V2Q A;  3FWN A;  1KV4 A;  3P7K A;  1GZL A;  3VN0 A;  1LTJ B;  2QSI A;  1EDI A;  1ZP0 C;  2JKV A;  2AXT E;  3H1H G;  3L73 G;  2YO3 A;  1KB9 I;  5KAI H;  2E5Y A;  1VQK P;  5AVU B;  2OYI C;  2POH A;  4C7R A;  1VF5 B;  1VPC A;  1SQV E;  1BE3 G;  1QVG O;  1URQ A;  4QMA A;  3P8C D;  3M9H A;  2IZ1 A;  1IFI A;  3L72 E;  2WWW A;  5APV A;  3SSU A;  3GHG C;  1OWA A;  3RGU A;  5GTI H;  3L73 D;  3A0B H;  1LTT C;  4EIJ A;  2A45 H;  3JCU E;  1FU1 A;  2HPC A;  4N3Y B;  4YXD C;  1N8R Q;  3TNU A;  5B66 E;  2KK7 A;  1JNM A;  3BRV B;  4ZKP A;  1H88 A;  1FZC A;  1QVF O;  2FYN C;  3A7O A;  5APQ A;  1T2K C;  1BCC E;  4RJT A;  1FZA A;  5KLV J;  1JOC A;  1NKN A;  1QGK B;  1N73 B;  3UIA A;  4PV1 C;  1KYO D;  2M5A B;  4WWI A;  1VQL P;  5KAF E;  1RF0 A;  5AVX B;  2NZ2 A;  3TSI A;  2KZI A;  2QM7 A;  2KB7 P;  4OGQ C;  2QJY B;  4WVZ A;  4DCK A;  2Q9I A;  1G1I A;  2WPR A;  3LIE A;  1K8A Q;  4H13 D;  4I1L A;  1M1J A;  3RK3 B;  1BGY J;  5APS A;  1LTB C;  4U3F J;  1SQV G;  3MGN A;  1LT9 C;  1WMK A;  1VQ6 P;  2IFM A;  1JY2 P;  3G6E P;  1FZF A;  3CME P;  1X22 A;  4B86 A;  1PPJ E;  3L72 G;  4H13 B;  1GK6 A;  5E79 E;  1NWQ A;  2A06 G;  2QJK C;  2FBW C;  3WUT A;  5TJH A;  3ITK A;  2QIW A;  1Y47 A;  1SVF A;  1RF1 C;  4EDF A;  1JMM A;  2ZT9 D;  3L70 J;  3L74 E;  1VQ8 P;  4ASV A;  2K9J A;  2YKP A;  1KB9 D;  3M0A A;  2K1A A;  2HFE D;  1EQ7 A;  1SQP J;  1K73 Q;  1JTH A;  5KLV G;  3H6P A;  2ZT9 B;  2WSC H;  3EWK A;  3D71 A;  2E43 A;  3H1K J;  5CHX A;  1H8A A;  1Q86 Q;  1NOH A;  1NHL A;  1KFN A;  1LGH B;  1N7S C;  2JP3 A;  3OAK A;  2Y9Z A;  2QG4 A;  1XTC C;  2RH0 A;  1Q82 Q;  1GU5 A;  1YJ9 P;  1KC8 Q;  3AEF C;  1BGY G;  2ZXX A;  3N7N A;  3M9Q A;  3IR9 A;  1PPJ G;  5AW2 B;  5KLV D;  2ZJS E;  5APT A;  2OYI B;  1EC5 A;  1J1D C;  2O3J A;  3NMD A;  3TDK A;  1X0T A;  3TF5 A;  1EZV E;  3KYQ A;  1NAY A;  1ZV8 A;  1FBM A;  2C9L Y;  4WY4 A;  2IBZ G;  3GHG B;  3S9O A;  4IFD K;  1EDL A;  4U3F D;  1T2K D;  3V2N A;  3SFD C;  3B4S A;  1L0N J;  2GUS A;  3L70 G;  2E76 C;  5KAI E;  1KQS O;  1A02 F;  4PV1 D;  1L0N E;  5AW1 B;  4BRY B;  1JO5 A;  3H1I E;  3CWB J;  3CX5 I;  1GL2 A;  2E42 A;  2AEF A;  4OGQ D;  3D6Z A;  1SQP G;  3CCE P;  2I1K A;  2O01 J;  3WMM 0;  3H1K G;  5KLV K;  1DD3 A;  2NPS A;  4PV1 B;  3QWO C;  2XKM A;  5GTI E;  4AQR D;  1M57 D;  3H1J E;  2PAJ A;  3AE7 C;  3H25 A;  2W8Z A;  4HYT B;  4OGQ B;  4EOT A;  5B5E H;  1NTZ J;  1JMB A;  2WMM A;  2M8R A;  1LT9 B;  1IFJ A;  2C9N Y;  2KSJ A;  3PP5 A;  2JR8 A;  1DD4 A;  3V6I A;  1W5C E;  5CCH D;  2Q3I A;  2WSE H;  4PD4 I;  5CJ4 A;  2KYV A;  1HBW A;  2V7Q H;  2QJK B;  2R32 A;  5DJU B;  4R4M A;  1KIL D;  1P84 H;  4IFM A;  1URQ C;  3WU2 H;  2I1J A;  2JWA A;  3M06 A;  3D6Y A;  2ZFC A;  1R5L A;  3CCJ P;  1L0N G;  3TGU J;  1HJ0 A;  3KQG A;  3CCM P;  1S72 P;  1USE A;  2R3S A;  1HGZ A;  2FXP A;  4GT1 A;  3B71 A;  3CWB G;  1KIL B;  1RF1 A;  1K04 A;  2E74 C;  2ZXE B;  5EFW B;  2E5T A;  1OFC X;  3VP9 A;  3M9B A;  3H1J G;  1NVO A;  2BCC D;  1NTM D;  3E1R A;  2GM4 A;  1FZC C;  1SS1 A;  1AVO A;  2HYN A;  4GIF A;  1N7S B;  1VQP P;  1Y8A A;  3B5N D;  1USD A;  1RH5 B;  1VQ7 P;  3H1L D;  4OVN F;  4D6T D;  4O9B A;  4YXW H;  4I7Z B;  5KKZ C;  1PP9 J;  1JY3 P;  1AQ5 A;  1VQ4 P;  3CX5 D;  1M1J C;  1J1D B;  3A2A A;  3BCC J;  4KT0 J;  1EDK A;  3G9R A;  2QJP C;  2E76 D;  1R8E A;  1E5W A;  2YXR B;  1FZB A;  1PIX A;  1PGJ A;  1KQG B;  3T97 A;  2FYU D;  1NTZ D;  3H1H J;  1KQL A;  1RY3 A;  1M8O B;  3TGU G;  3AEE C;  1NTM K;  2E76 B; 
#chains in the Genus database with same CATH homology
 1BE3 G;  1NTZ G;  3L70 G;  3H1J G;  3H1I G;  1BGY G;  1PP9 G;  3H1K G;  1NTK G;  2A06 G;  4U3F G;  4PD4 H;  1NU1 G;  3CXH H;  3H1H G;  3CWB G;  3L73 G;  1SQV G;  1PPJ G;  1P84 H;  1BCC G;  3BCC G;  1EZV G;  3L71 G;  2IBZ G;  2BCC G;  3H1L G;  1NTM G;  3L75 G;  4D6T G;  1SQQ G;  3L74 G;  1KYO H;  1SQB G;  1SQP G;  1KB9 H;  2FYU G;  3TGU G;  1L0N G;  1L0L G;  3CX5 H;  1SQX G;  3L72 G;  5KLV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...