1NTMK

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
51
structure length
51
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 15
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ntmK00
1SQVK 1NTMK 1L0NK 2J59M 2FYUK 3LW5H 1NTZK 2WSFH 3CLQA 5KLVK 4IFDK 2OARA 1SQQK 2LKMA 3M9QA 1L0LK 1NTKK 2O01H 2WSEH 1SQXK 1SQBK 3G3ZA 1SQPK 2WSCH 1NU1K
chains in the Genus database with same CATH superfamily
5CJ4A 2YKQA 1XTGB 2M3EA 4GKGA 1LWUB 4H13C 3S9OA 1DIPA 2E5TA 2L91A 4C46A 2B9BA 1DH3A 1PIXA 1S3JA 2IPPA 4N6JA 1FDMA 5CHXA 2OYIC 1GL2B 1JUNA 1IJDB 3KYQA 1NTZJ 3USSA 5BVZA 1LTGC 3D70A 2H88C 3CWBJ 3FXDA 1FJKA 1Q2NA 3P8CE 2BASA 1N7SD 1SQXD 5BU5A 1FS0E 4U7JA 2O3JA 3V2QA 1A02J 3CCLP 3TGUJ 1T6AA 2Q1KA 2ZXXA 2FYUG 4Y99C 1W2BO 1AQ5A 3IAOA 4W7YA 3U1CA 4XA4A 1YJ9P 1KILB 1MFTA 2KYVA 2GA1A 2M8RA 3B4SA 2Z5IA 1VF5D 1QVFO 1GW4A 2PRRA 3C1LA 1VDFA 3WUTA 1NU1G 3ZDMA 1OW6A 1RF0A 1S1CX 5B5EH 1SQVJ 3NTNA 2Q9IA 1MV8A 1VQ4P 3AE3C 1L0ND 2JR8A 1PZQA 2RKLA 2K88A 1W5CE 3AE9C 3H1KD 3L71D 2BCCG 1IFNA 1OW8A 5AW4B 1UIXA 3L75J 1LWUA 4OVNF 3HE5B 1GZLA 4WBAA 2D2CB 2NPSC 1QLED 3P7KA 2LXCB 3WU2H 4EI2A 3TF5A 2XNXA 1K9MQ 1FZGA 2JEEA 3AECC 3H1HD 1QL1A 2QG4A 1L0LJ 3BASA 1N73A 1YBKA 1RF1B 4CPGA 3PRJA 1NTKK 2K9JB 4OGQD 3L73E 1VQ8P 1NYHA 2FFDB 3D71A 1ZXGA 3IFMA 3HE4A 4BRYA 3OW2O 2E76C 2N1TB 2HODB 1X8YA 1G2CA 3PH0A 1SQPJ 4AQRD 4JYCA 1S5LX 2KS1A 5E79E 2BCCE 2N1TA 1LTAC 1SQXE 1M1KQ 4H44D 2AXTH 1AVYA 2IZ1A 3I55P 1KTMA 2QJPC 2UWJE 2YO2A 1NU1E 2R44A 3BCCD 3ITKA 3O6QB 1CZQA 5AW7B 5M1BA 3TSIA 5AVRB 2OYOA 3L70J 4ZNCA 2WITA 2WZ7A 1NTME 2HPCB 3E1RA 1BDCA 3V2RA 1EC5A 1OVRA 5APUA 2YO3A 3GHGA 2R3SA 1ZRTD 1FZBA 1JM0A 2QJKB 5AVSB 1S2EA 1PL5A 1ZR4A 1ZN5A 5AVZB 2JJLA 3L71E 2KSEA 4I1LA 1FDOA 1NTZE 3EQ2A 1URQD 3L75G 3L74G 1LWUC 1KILC 1OXZA 1IFDA 1OW7A 2RMZA 5B66E 2H43A 3M91A 3CI9A 1P84D 2ZT9C 5KLVD 3WMM0 3VTPC 3H1JD 1T8ZA 2L5GB 3GF3A 1HWTC 2AEJA 3CC2P 1E79H 2XZRA 2M5AB 2YKPA 2WPQA 3W68A 2KNCB 2QJYC 2OTLP 1M8OB 2E75D 3IR9A 3EWKA 2FYUD 2GUVA 1KYOD 2PFXA 3HD7B 1QL2A 3H32A 3N4XA 1IO4A 4WY4A 1PFIA 2VRSA 1DEBA 1A02F 1SQPG 1EXIA 4PJ0H 2IYPA 3H1JJ 2YXRB 1USEA 1KB9D 1TU3F 3V2PA 3G71P 5KLVJ 3Q5SA 1PPJG 1GTWA 1GW3A 3C9IA 4H13B 5E79H 2M0BA 4C7RA 4ZMDA 3O8ZA 5AW8B 2H7HA 3L75E 1SQQJ 1VQOP 1ZW0A 2D2CD 3C8VA 1L0NG 4Y28J 1DX7A 4NPDA 3CXHI 1EZVD 1VQ7P 2E76D 3JC22 3MTUE 4R4LA 4JYBA 1S4XA 1FZCB 1FAVA 5B66H 4HH2A 1M56D 1FZEA 3VMZA 1GL2A 2ZT9B 3CX5E 1SQQG 2DW3A 1BSNA 2POHA 1KB9H 4HYTB 1FZCA 4H44C 2YIUC 3KQGA 3Q5PA 2Q3IA 3RK2D 1SQPE 2C0XA 1NO4A 2KSJA 1IK9A 1PP9G 4IFMA 1EQ7A 1N86A 1NH4A 2K9JA 2P10A 3AEGC 1NTZK 2PGDA 5DJTB 2E74D 2IYOA 5CCHD 3HE4B 1QVGO 1RF1A 1BE3D 4YPCA 3CMAP 1EDJA 1BCCG 5AW0B 3MP7B 3TNUB 1M90Q 4IFDK 2K1AA 1CI6B 3H1IE 3H1LE 3CCQP 1JY2P 1GU4A 1JB0J 1PP9E 1U7MA 2IBZI 2KK7A 3I5CA 4NPFX 4WWIA 4D6TD 5CCGA 2XDJA 2QSIA 3H1IJ 3H1LJ 2O1KA 1IZNB 1SQBK 1RE4C 1SQXJ 4LGDE 1NTZD 1BCCE 1WT6A 2BEZF 2I1JA 4PJ0E 1LTJC 5KKZB 1JY3P 1SQQE 2M3BA 1NVOA 4KJMA 1HGZA 1OMIA 4N3YB 3L72G 1BGYE 4U3FG 4AUWA 1EDKA 3GF7A 1SFCD 2N1TC 1SQVK 4RO0A 5AVWB 4BWNA 1M1JC 3MUDC 1RF1C 1VF5C 1LTTC 2A45I 1N2DC 3H1LD 3H1ID 3P8MC 3PTZA 1X0TA 2JO1A 4JPZB 4HJGH 4D6TJ 3MGNA 1FJPA 3LW5H 1VQ9P 1KN7A 5KAFH 5KJ7A 1EDLA 1KQLA 3H1HE 3L72J 2Q6QA 1JCDA 3TGUE 3M9HA 4GODA 4ZKPA 1BE3J 2WSFJ 5KJ7D 4ASVA 1KFMA 2WPSA 4OWFA 1YITP 3M9QA 4MN4C 3BVHA 1HJ0A 4HB1A 3PP5A 1VF5B 5KLIB 4H13D 3CD6P 1R5SA 2FY8A 4I2LC 3G3ZA 1SQPK 2W8ZA 3JCUE 2YMYA 1S5LE 3AEAC 1JOCA 3S4RA 4RKUJ 1K8AQ 2AXCA 3MZWB 3B71A 3S1KA 5GTIH 2G8YA 2BEQD 4Y99B 5K5GB 2OQQA 5KKZC 2OYHA 3H32B 1FOSE 2FBWC 3FXEA 3BRTB 3KDPB 1VQLP 1GMJA 1NTMJ 2OYIA 4BRYB 5AW5B 2IX7C 4GIFA 2WVRA 1P84E 2Y0EA 1ZV8A 1VQ6P 4KHXA 1QEXA 1RQVA 2IBZD 5CCHC 1IK7A 3L4FA 1KMIZ 1OVUA 3M0DC 1SVFA 1KQFB 1NU1J 3L75D 1SQVG 5APXA 1NTMG 3A0BH 3H1KJ 3SFEC 3V6IA 3D6ZA 3CCRP 3ABVC 2ZVNB 2ZYGA 2BCCJ 1H0TA 1PV3A 2YIUB 4H44B 3HTKB 4JBZA 2W6BA 2W90A 1URQC 3LIEA 1BE3G 2QIWA 3GHGB 2QM8A 3MUDA 2O01N 2NPSD 1N8RQ 5L8RJ 1NWQA 3EFFK 2N1TD 3GW6A 1H0TB 3CWBG 2WSSH 3CXHH 1S9KD 5DJUB 4IL6H 1R5LA 3RBXA 1KD1Q 2E75C 2O1JA 3L73G 1SFCB 4OGQC 1SQBG 4U3FD 1SQBD 4L73A 2KP8A 2A06G 3MD0A 1IFJA 1NTKG 3WUUA 5APVA 2V4HA 2OARA 4K35A 2JWDA 3AE5C 2P1JA 4I7ZB 2WTYA 1HVVA 2CK3H 1HGVA 1PGJA 1URQA 3KXDA 4N78E 3EFGA 4GT1A 1WMKA 2NZ2A 3L70G 1KORA 2FXOA 2I1KA 2JP3A 3H1JG 1L2PA 1Y9BA 1SQQD 2QJPB 2W6JH 3QWOC 3KHUA 1KYOI 4HKZH 3F5HA 1PGQA 3RK3D 5KLVG 3FGAD 2QRXA 5CBOA 4UB6E 5GTHH 5KAIE 1H89A 1URQB 3M06A 1U57A 1BCCJ 1PP9D 3E1IA 3M0DA 4I6MC 1BGYD 2NPSA 3L70E 5AVQB 2KLVA 5CCHA 3CC7P 1Y47A 2FXMA 1J1EB 3AEBC 4XE5B 4W7ZA 1BCCD 4N78D 3U59A 2FYUJ 2IDBA 3L74E 1YQ3C 1OFCX 1NTKE 2A45G 2E75B 3CL3D 3VP9A 5GTIE 3CCUP 4DOJA 1EZVI 5APSA 2HYNA 3CLQA 3KPEA 3BATA 1AV1A 2E74C 4Z1MH 5CBNA 1LP1A 2BCCD 2QVAA 4DT0A 1AQTA 4AYCA 1JY2N 2NRGA 1P84H 3CXHE 4L75A 3TYYA 1H88A 2K3RA 1SQBJ 2N9BA 1SQXK 2ZVOB 4GOFA 2GM4A 2JDIH 1X79B 3SWFA 2HLOA 1KB9I 2ZYAA 3CX5H 3LW5J 3VMAA 3Q1MA 2IBZG 2B87B 2ZXEB 4H0LC 1LP1B 4UB8E 5CMZA 3RK2B 1K05A 2I8DA 3RL0C 3VP8A 1USDA 2Z5HA 1X9VA 2OGUA 2FFDC 1L4AA 5H2FH 2E76B 1CI6A 2QJKC 3AE2C 2M5AA 3VYIA 3CCVP 1BSHA 1VQPP 1RHZB 1UIIA 1QX8A 3BCCJ 4EDFA 3WUVA 4YXWH 2OTJP 2C9NY 1KILE 2AXTE 1L4AB 1YTZI 3TGUD 1EDIA 5AW1B 1K73Q 1FZFA 1BE3E 2D2CC 2CPSA 2NPSB 2WPRA 3CXHD 3PHLA 5AW6B 1M1JA 3VMYA 3FX0A 3RL0D 1RE3A 1H8AA 2WWWA 1SQPD 2B88A 2WMMA 4R4MA 1LT9B 3BCCG 1T3UA 2LKMA 2R5BA 3CWBD 4D6TG 2W27A 1JMMA 2J5UA 2OTKE 5KJ7C 2K37A 2WSEH 3CCEP 2Y9ZA 5CCGD 4IL6X 1HUCA 1MFZA 3AE4C 2KI7B 4H0LB 4TLFA 5TISE 3L72D 4W80A 3RK2C 3WU2E 5B5EE 3FWLA 3HE5A 3IN6A 1DD3A 3L71G 1LTJB 3B5ND 3M9BA 4DCKA 1M7LA 1CSBA 4PV1D 1NTKJ 3H1HJ 1SFCA 1PGOA 3E7KA 4TT3H 2N9YB 1LTJA 3H1IG 3H1LG 1NGMB 3M0AA 1RE4A 3W67A 1GK4A 5KLVE 1L0NJ 4U3FE 2RH0A 1SQVD 4RJTA 3CMEP 1HTLC 3L71J 3A3YB 4WB4A 3L37A 1RH5B 1LNQA 4BXLA 5KTBA 1G2CB 2KUBA 1NJIQ 1GDTA 1AFOA 1HJBA 1GL2C 4RESB 2AEFA 3UIAA 1SQQK 4C7NA 1KC8Q 1JO5A 1BGYG 1L0LK 3HD7A 3F89A 1HBWA 2KXPB 4WY4B 1PPJD 4LC1A 2IFMA 5AW2B 2P58A 3T97A 1R8EA 1KFNA 1YIJP 1ZP0C 1IFIA 1JY2O 2Y9YA 1DD4A 1NHLA 3GG2A 3R2PA 1L0LG 1GK6A 1N7SC 1RY3A 3A7OA 3H1KG 3HUSA 3JCUH 4EOTA 3Q3DA 1FZCC 3B5NA 1GL2D 3L73D 1EZVG 2XU6A 1Q82Q 2XV5A 2V7QJ 3TNUA 4EYYQ 4PD4D 3HUSB 1Q81Q 2KZIA 2W83C 2LR2A 2GUSA 5BU8B 4WY4C 2XNDH 3TDKA 1KZUB 2ZYDA 4UB8H 4DZOA 2WT7A 1ZMEC 3SFDC 1L0LE 1AA0A 1KQGB 1SLQA 2KOGA 1J1EC 1Z56A 4GOEA 1EXJA 1VQNP 1VQ5P 1AJYA 1G1JA 1SQBE 1N7SA 3HUSC 3D6YA 1E5WA 1JY3O 1JTHA 1J1DC 1IFMA 1HF9A 2ZAEB 2B89A 3SWKA 4A7PA 1CW5A 3PJSK 1BDDA 1QGKB 3A0BE 3AE6C 2K9YA 3N7NA 1JTHB 2WSCJ 1KYOE 1NAYA 3R4YA 4O9BA 4PD4I 1PP9J 2FKWB 3AE1C 1N7SB 3H1KE 5AVUB 1YQ4C 2WSEJ 1KQSO 4OH8B 3AEFC 3B5NC 4IL6E 5AVVB 1T2KC 3RK3E 4D6TE 3V4QA 2XKMA 3B8EB 3CX5I 3AE8C 2CPBA 4PV1C 3KZIE 2QEXP 2KIKA 1JEKA 1PPJE 1YI2P 1T3JA 1NKNA 1OWAA 2G3AA 3GMAA 4LLHA 2R3CA 2QA4P 1ZR2A 3SWYA 4QMAA 1PGPA 5APTA 1SS1A 4YXDC 3I56P 2MKVA 1AVOA 3RGUA 1LT9C 2KNCA 2A06D 5AVTB 3TK1A 1HH0A 2E5YA 3HD7C 2MJZA 3L74D 2V7QH 1W2EA 1D7MA 1T2KD 1L0NE 1FU1A 4U3FJ 2H89C 3H1HG 1OIPA 1M57D 1YJWP 3LIDA 3CC4P 4UB6H 3Q5RA 3OAKA 3V2NA 1YHQP 4JF7A 2WT7B 1Y8AA 5CJ0A 4NPEA 5KAFE 3T97B 3V5BA 2HR3A 1X22A 1FBMA 5KLIC 1N73C 2ZFCA 1KYOH 2PAJA 2Y0CA 2WPVB 2B87A 4ASWA 1XTCC 1NAFA 1NTMK 2SPZA 4DJGA 5GTHE 3RK3B 3O6QA 3P8CD 5KAIH 4C7NB 3P32A 4JQ0D 2HPCA 1NU1D 3KZIH 4PD4E 1VL2A 3CCJP 1IC2A 5APQA 1MKMA 5AW9B 1Q7YQ 1ZRTE 3L35A 1N7LA 1L4AC 2JKVA 2IFNA 4XFJA 1OZHA 2H8PD 2KS1B 2KZJA 1FC2C 2Q5UA 2R5DA 3K5BA 3RK3C 2P7JA 3SSUA 2QE7H 1RE3C 4M3LA 2HODA 2OYIB 5AVYB 2YMKA 1S72P 2O01H 3L72E 1NTKD 1JCCA 3G9RA 2KLUA 5AVXB 3H25A 1Q90D 3PLNA 3U1AA 2WSCH 1JY3N 2Q3EA 5H2FE 1N73B 1LTSC 5AW3B 1FDIA 1L4AD 1RF0C 2PP6A 3L70D 3OJAB 3QH9A 2OYHC 1GU5A 2FFDA 2R32A 2LXBA 1NKZB 3TGUG 2HG5D 1WRGA 1LTIC 1VPCA 1FOSF 1P84I 1U7JA 2ZJSE 1BGYJ 1L0NK 1SQXG 3CWBE 3HRNA 4IFFA 3RL0g 3CCMP 2YXQB 4IOIH 3G6EP 4GDOA 1S5LH 1VQKP 3A5TA 1J1DB 1FZAA 3L36A 1G1IA 4I7ZC 3MHVA 3CPWO 2WSFH 1KV4A 2O01J 4EIJA 1YJNP 1YYCA 3HD7D 1J2JB 3NXSA 3VMXA 3AEEC 3CCSP 1M1JB 2FYUE 1S9KE 2W6AA 4H0LD 3A0HH 2E42A 2FYZA 1KILD 2C9LY 5TISH 3BRVB 3CX5D 1MZ9A 1MUUA 2Y0DA 5C39A 3B5NB 3RL0B 2ZT9D 1NOHA 1L0LD 1KILA 2QM7A 2RN0A 1OX3A 2WQYC 4L76A 4PV1B 2J58A 4L74A 4PD4H 1EZVE 3L73J 1JMBA 2Q7CA 1NU1K 3AE7C 3Q2YA 4YTPC 2P2UA 3A2AA 3GHGC 1OVVA 5EFWB 2AEMA 2A06E 1ZLLA 2ITAA 3H1JE 2E74B 3II6A 2P67A 5APYA 2E43A 3L74J 1LJ2A 3VOPA 3MIWA 1YTZT 2FXPA 3NFQA 1RQUA 2KB7P 1KB9E 2FYUK 1IFPA 1NTMD 2J59M 2YKOA 3IF4A 4WVZA 2FYNB 5TJHA 3RBZA 3G4SP 3HTKA 3NMDA 3BCCE 1LTBC 1SFCC 1ZOYC 4OGQB 1SQVE 4WY4D 5CCGC 1VQMP 1DEEG 1FE6A 1GD2E 5KLVK 1LT1A 5APWA 2FYNC 3GLMA 2JWAA 2YNYA 3VN0A 4B86A 1JNMA 1LT9A 2A45H 4ZKUA 2C0WA 1K04A 3A0HE 1SP4A 2IBZE 3AEDC 2Z4EA 2QJYB 3JSVC 3H6PA 3OA7A 1LGHB 4KT0J 2HFED 3FWNA 4K3AA 3V4WA 2OYHB 1Q86Q 1NTZG 2IZ0A
chains in the Genus database with same CATH topology
5CJ4A 2YKQA 1XTGB 4GKGA 1LWUB 4C46A 1DH3A 2IPPA 4N6JA 1FDMA 5CHXA 2OYIC 1GL2B 1JUNA 1IJDB 3KYQA 5BVZA 1LTGC 1FJKA 3P8CE 2BASA 1N7SD 5BU5A 3V2QA 1A02J 1AQ5A 4Y99C 4W7YA 3U1CA 4XA4A 1KILB 2KYVA 2M8RA 2Z5IA 1GW4A 1VDFA 1RF0A 3NTNA 2Q9IA 1MV8A 1IFNA 5AW4B 1LWUA 3HE5B 1GZLA 4WBAA 2NPSC 1FZGA 3P7KA 2XNXA 2JEEA 1QL1A 1N73A 3BASA 1RF1B 1NTKK 2FFDB 3IFMA 3HE4A 2N1TB 2HODB 1X8YA 1G2CA 4AQRD 4JYCA 2N1TA 1LTAC 2YO2A 5AW7B 1CZQA 3TSIA 1GDTA 5AVRB 2WITA 2WZ7A 2HPCB 3V2RA 5APUA 2YO3A 3GHGA 5AVSB 1FZBA 1ZR4A 1ZN5A 5AVZB 2JJLA 4I1LA 2WT7B 3EQ2A 1URQD 2H43A 1LWUC 1KILC 1OXZA 1IFDA 3M91A 3CI9A 3WMM0 3VTPC 1HWTC 1T8ZA 2L5GB 2YKPA 2XZRA 2WPQA 3IR9A 2GUVA 3HD7B 1QL2A 3H32A 3N4XA 1IO4A 4WY4A 2VRSA 1DEBA 1A02F 3V2PA 1GTWA 1GW3A 3C9IA 4C7RA 3O8ZA 5AW8B 2H7HA 3MTUE 4JYBA 1FZCB 1FAVA 4HH2A 3VMZA 1FZEA 1GL2A 4HYTB 2POHA 1FZCA 3KQGA 2Q3IA 3RK2D 2C0XA 1NO4A 2KSJA 1IK9A 4IFMA 1EQ7A 1N86A 1NH4A 5CCHD 1NTZK 1RF1A 3HE4B 5AW0B 3TNUB 4IFDK 1CI6B 1JY2P 1GU4A 5CCGA 3I5CA 2XDJA 2O1KA 1SQBK 1RE4C 4LGDE 2I1JA 1WT6A 1LTJC 1JY3P 2M3BA 1HGZA 4N3YB 4AUWA 5AVWB 1SFCD 2N1TC 1SQVK 1M1JC 1RF1C 1LTTC 2A45I 1N2DC 3P8MC 1FOSE 3MGNA 1FJPA 3LW5H 5KJ7A 1KQLA 1JCDA 3M9HA 4ZKPA 5KJ7D 1KFMA 2WPSA 3M9QA 3BVHA 3PP5A 4I2LC 3G3ZA 1SQPK 2YMYA 1JOCA 4Y99B 2OYHA 3H32B 3BRTB 3KDPB 2OYIA 2IX7C 4GIFA 1ZV8A 4KHXA 5CCHC 3L4FA 3M0DC 1SVFA 5APXA 3HTKB 1URQC 3LIEA 3GHGB 3MUDA 2QM8A 2NPSD 1NWQA 2N1TD 1S9KD 2O1JA 1SFCB 2KP8A 3MD0A 1IFJA 5APVA 2OARA 2P1JA 2WTYA 1HVVA 1HGVA 1URQA 4N78E 3EFGA 4GT1A 2I1KA 1FZFA 3RK3D 1H89A 1URQB 3M06A 3E1IA 3M0DA 4I6MC 2NPSA 5AVQB 2KLVA 5CCHA 2FXMA 1J1EB 4XE5B 4W7ZA 4N78D 3U59A 2A45G 3CL3D 3VP9A 4DOJA 2HYNA 3CLQA 3KPEA 3BATA 4AYCA 1JY2N 1H88A 3TYYA 2N9BA 2GM4A 1SQXK 3SWFA 1X79B 2HLOA 1PFIA 2ZXEB 5CMZA 3RK2B 3VP8A 3RL0C 2Z5HA 1X9VA 2FFDC 1L4AA 3VYIA 1CI6A 2C9NY 1L4AB 1YTZI 5AW1B 2NPSB 2CPSA 2WPRA 5AW6B 1M1JA 3VMYA 3RL0D 1RE3A 1H8AA 2WWWA 1LT9B 1T3UA 2LKMA 2R5BA 2W27A 1JMMA 5KJ7C 2WSEH 5CCGD 1HUCA 1MFZA 3RK2C 4W80A 3HE5A 3M9BA 1LTJB 3B5ND 1M7LA 1CSBA 1SFCA 1LTJA 3M0AA 1RE4A 1GK4A 1HTLC 3A3YB 4WB4A 3L37A 5KTBA 1AFOA 1G2CB 1HJBA 1GL2C 4RESB 3UIAA 4C7NA 1SQQK 1JO5A 1L0LK 3HD7A 1HBWA 4WY4B 5AW2B 4LC1A 2IFMA 3T97A 1KFNA 1IFIA 1JY2O 1NHLA 3R2PA 3HUSA 1N7SC 1GK6A 1RY3A 3A7OA 4EOTA 1FZCC 3B5NA 1GL2D 2XU6A 2XV5A 3TNUA 3HUSB 2GUSA 5BU8B 4WY4C 2WT7A 1KZUB 4DZOA 1SLQA 2KOGA 1J1EC 1Z56A 1G1JA 1N7SA 3HUSC 1E5WA 1JY3O 1JTHA 1J1DC 1IFMA 1CW5A 3N7NA 5AW5B 1JTHB 4O9BA 2FKWB 1N7SB 5AVUB 4OH8B 3B5NC 5AVVB 1T2KC 3V4QA 2XKMA 3B8EB 2CPBA 1T3JA 1NKNA 1OWAA 4LLHA 2R3CA 1ZR2A 3SWYA 5APTA 1LT9C 5AVTB 3TK1A 1HH0A 3HD7C 2MJZA 1W2EA 1T2KD 1FU1A 3LIDA 3OAKA 3V2NA 4JF7A 5CJ0A 3V5BA 1FBMA 1N73C 2ZFCA 2PAJA 1NAFA 1NTMK 1XTCC 3RK3B 3P8CD 4C7NB 3P32A 2HPCA 1IC2A 5APQA 5AW9B 3L35A 1N7LA 1L4AC 2IFNA 2H8PD 2R5DA 2Q5UA 3RK3C 2P7JA 1RE3C 4M3LA 2HODA 2OYIB 5AVYB 2O01H 1JCCA 5AVXB 3U1AA 2WSCH 1JY3N 1N73B 1LTSC 5AW3B 1RF0C 1L4AD 2PP6A 3OJAB 2OYHC 1GU5A 2FFDA 2R32A 1NKZB 2HG5D 1WRGA 1LTIC 1VPCA 1FOSF 4IFFA 3HRNA 1L0NK 3A5TA 1J1DB 1FZAA 3L36A 1G1IA 2WSFH 4EIJA 1YYCA 3HD7D 1J2JB 3NXSA 3VMXA 1S9KE 1DX7A 1M1JB 2E42A 2W6AA 2FYZA 1KILD 2C9LY 3BRVB 1MZ9A 1MUUA 3B5NB 3RL0B 1NOHA 1KILA 2QM7A 2J58A 2Q7CA 1NU1K 2P2UA 3A2AA 3GHGC 1ZLLA 3II6A 5APYA 2P67A 2E43A 3VOPA 3MIWA 1YTZT 3NFQA 5APSA 2KB7P 2J59M 2FYUK 2YKOA 3HTKA 3NMDA 1LTBC 1SFCC 5CCGC 4WY4D 1GD2E 5KLVK 5APWA 2YNYA 3VN0A 4B86A 1JNMA 1LT9A 2A45H 4ZKUA 2C0WA 1SP4A 2Z4EA 3H6PA 3OA7A 1LGHB 2HFED 3V4WA 2OYHB 2W6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV K;  1NTM K;  1L0N K;  2J59 M;  2FYU K;  3LW5 H;  1NTZ K;  2WSF H;  3CLQ A;  5KLV K;  4IFD K;  2OAR A;  1SQQ K;  2LKM A;  3M9Q A;  1L0L K;  1NTK K;  2O01 H;  2WSE H;  1SQX K;  1SQB K;  3G3Z A;  1SQP K;  2WSC H;  1NU1 K; 
#chains in the Genus database with same CATH topology
 5CJ4 A;  2YKQ A;  1XTG B;  2M3E A;  4GKG A;  1LWU B;  4H13 C;  3S9O A;  1DIP A;  2E5T A;  2L91 A;  4C46 A;  2B9B A;  1DH3 A;  1PIX A;  1S3J A;  2IPP A;  4N6J A;  1FDM A;  5CHX A;  2OYI C;  1GL2 B;  1JUN A;  1IJD B;  3KYQ A;  1NTZ J;  3USS A;  5BVZ A;  1LTG C;  3D70 A;  2H88 C;  3CWB J;  3FXD A;  1FJK A;  1Q2N A;  3P8C E;  2BAS A;  1N7S D;  1SQX D;  5BU5 A;  1FS0 E;  4U7J A;  2O3J A;  3V2Q A;  1A02 J;  3CCL P;  3TGU J;  1T6A A;  2Q1K A;  2ZXX A;  2FYU G;  4Y99 C;  1W2B O;  1AQ5 A;  3IAO A;  4W7Y A;  3U1C A;  4XA4 A;  1YJ9 P;  1KIL B;  1MFT A;  2KYV A;  2GA1 A;  2M8R A;  3B4S A;  2Z5I A;  1VF5 D;  1QVF O;  1GW4 A;  2PRR A;  3C1L A;  1VDF A;  3WUT A;  1NU1 G;  3ZDM A;  1OW6 A;  1RF0 A;  1S1C X;  5B5E H;  1SQV J;  3NTN A;  2Q9I A;  1MV8 A;  1VQ4 P;  3AE3 C;  1L0N D;  2JR8 A;  1PZQ A;  2RKL A;  2K88 A;  1W5C E;  3AE9 C;  3H1K D;  3L71 D;  2BCC G;  1IFN A;  1OW8 A;  5AW4 B;  1UIX A;  3L75 J;  1LWU A;  4OVN F;  3HE5 B;  1GZL A;  4WBA A;  2D2C B;  2NPS C;  1QLE D;  3P7K A;  2LXC B;  3WU2 H;  4EI2 A;  3TF5 A;  2XNX A;  1K9M Q;  1FZG A;  2JEE A;  3AEC C;  3H1H D;  1QL1 A;  2QG4 A;  1L0L J;  3BAS A;  1N73 A;  1YBK A;  1RF1 B;  4CPG A;  3PRJ A;  1NTK K;  2K9J B;  4OGQ D;  3L73 E;  1VQ8 P;  1NYH A;  2FFD B;  3D71 A;  1ZXG A;  3IFM A;  3HE4 A;  4BRY A;  3OW2 O;  2E76 C;  2N1T B;  2HOD B;  1X8Y A;  1G2C A;  3PH0 A;  1SQP J;  4AQR D;  4JYC A;  1S5L X;  2KS1 A;  5E79 E;  2BCC E;  2N1T A;  1LTA C;  1SQX E;  1M1K Q;  4H44 D;  2AXT H;  1AVY A;  2IZ1 A;  3I55 P;  1KTM A;  2QJP C;  2UWJ E;  2YO2 A;  1NU1 E;  2R44 A;  3BCC D;  3ITK A;  3O6Q B;  1CZQ A;  5AW7 B;  5M1B A;  3TSI A;  5AVR B;  2OYO A;  3L70 J;  4ZNC A;  2WIT A;  2WZ7 A;  1NTM E;  2HPC B;  3E1R A;  1BDC A;  3V2R A;  1EC5 A;  1OVR A;  5APU A;  2YO3 A;  3GHG A;  2R3S A;  1ZRT D;  1FZB A;  1JM0 A;  2QJK B;  5AVS B;  1S2E A;  1PL5 A;  1ZR4 A;  1ZN5 A;  5AVZ B;  2JJL A;  3L71 E;  2KSE A;  4I1L A;  1FDO A;  1NTZ E;  3EQ2 A;  1URQ D;  3L75 G;  3L74 G;  1LWU C;  1KIL C;  1OXZ A;  1IFD A;  1OW7 A;  2RMZ A;  5B66 E;  2H43 A;  3M91 A;  3CI9 A;  1P84 D;  2ZT9 C;  5KLV D;  3WMM 0;  3VTP C;  3H1J D;  1T8Z A;  2L5G B;  3GF3 A;  1HWT C;  2AEJ A;  3CC2 P;  1E79 H;  2XZR A;  2M5A B;  2YKP A;  2WPQ A;  3W68 A;  2KNC B;  2QJY C;  2OTL P;  1M8O B;  2E75 D;  3IR9 A;  3EWK A;  2FYU D;  2GUV A;  1KYO D;  2PFX A;  3HD7 B;  1QL2 A;  3H32 A;  3N4X A;  1IO4 A;  4WY4 A;  1PFI A;  2VRS A;  1DEB A;  1A02 F;  1SQP G;  1EXI A;  4PJ0 H;  2IYP A;  3H1J J;  2YXR B;  1USE A;  1KB9 D;  1TU3 F;  3V2P A;  3G71 P;  5KLV J;  3Q5S A;  1PPJ G;  1GTW A;  1GW3 A;  3C9I A;  4H13 B;  5E79 H;  2M0B A;  4C7R A;  4ZMD A;  3O8Z A;  5AW8 B;  2H7H A;  3L75 E;  1SQQ J;  1VQO P;  1ZW0 A;  2D2C D;  3C8V A;  1L0N G;  4Y28 J;  1DX7 A;  4NPD A;  3CXH I;  1EZV D;  1VQ7 P;  2E76 D;  3JC2 2;  3MTU E;  4R4L A;  4JYB A;  1S4X A;  1FZC B;  1FAV A;  5B66 H;  4HH2 A;  1M56 D;  1FZE A;  3VMZ A;  1GL2 A;  2ZT9 B;  3CX5 E;  1SQQ G;  2DW3 A;  1BSN A;  2POH A;  1KB9 H;  4HYT B;  1FZC A;  4H44 C;  2YIU C;  3KQG A;  3Q5P A;  2Q3I A;  3RK2 D;  1SQP E;  2C0X A;  1NO4 A;  2KSJ A;  1IK9 A;  1PP9 G;  4IFM A;  1EQ7 A;  1N86 A;  1NH4 A;  2K9J A;  2P10 A;  3AEG C;  1NTZ K;  2PGD A;  5DJT B;  2E74 D;  2IYO A;  5CCH D;  3HE4 B;  1QVG O;  1RF1 A;  1BE3 D;  4YPC A;  3CMA P;  1EDJ A;  1BCC G;  5AW0 B;  3MP7 B;  3TNU B;  1M90 Q;  4IFD K;  2K1A A;  1CI6 B;  3H1I E;  3H1L E;  3CCQ P;  1JY2 P;  1GU4 A;  1JB0 J;  1PP9 E;  1U7M A;  2IBZ I;  2KK7 A;  3I5C A;  4NPF X;  4WWI A;  4D6T D;  5CCG A;  2XDJ A;  2QSI A;  3H1I J;  3H1L J;  2O1K A;  1IZN B;  1SQB K;  1RE4 C;  1SQX J;  4LGD E;  1NTZ D;  1BCC E;  1WT6 A;  2BEZ F;  2I1J A;  4PJ0 E;  1LTJ C;  5KKZ B;  1JY3 P;  1SQQ E;  2M3B A;  1NVO A;  4KJM A;  1HGZ A;  1OMI A;  4N3Y B;  3L72 G;  1BGY E;  4U3F G;  4AUW A;  1EDK A;  3GF7 A;  1SFC D;  2N1T C;  1SQV K;  4RO0 A;  5AVW B;  4BWN A;  1M1J C;  3MUD C;  1RF1 C;  1VF5 C;  1LTT C;  2A45 I;  1N2D C;  3H1L D;  3H1I D;  3P8M C;  3PTZ A;  1X0T A;  2JO1 A;  4JPZ B;  4HJG H;  4D6T J;  3MGN A;  1FJP A;  3LW5 H;  1VQ9 P;  1KN7 A;  5KAF H;  5KJ7 A;  1EDL A;  1KQL A;  3H1H E;  3L72 J;  2Q6Q A;  1JCD A;  3TGU E;  3M9H A;  4GOD A;  4ZKP A;  1BE3 J;  2WSF J;  5KJ7 D;  4ASV A;  1KFM A;  2WPS A;  4OWF A;  1YIT P;  3M9Q A;  4MN4 C;  3BVH A;  1HJ0 A;  4HB1 A;  3PP5 A;  1VF5 B;  5KLI B;  4H13 D;  3CD6 P;  1R5S A;  2FY8 A;  4I2L C;  3G3Z A;  1SQP K;  2W8Z A;  3JCU E;  2YMY A;  1S5L E;  3AEA C;  1JOC A;  3S4R A;  4RKU J;  1K8A Q;  2AXC A;  3MZW B;  3B71 A;  3S1K A;  5GTI H;  2G8Y A;  2BEQ D;  4Y99 B;  5K5G B;  2OQQ A;  5KKZ C;  2OYH A;  3H32 B;  1FOS E;  2FBW C;  3FXE A;  3BRT B;  3KDP B;  1VQL P;  1GMJ A;  1NTM J;  2OYI A;  4BRY B;  5AW5 B;  2IX7 C;  4GIF A;  2WVR A;  1P84 E;  2Y0E A;  1ZV8 A;  1VQ6 P;  4KHX A;  1QEX A;  1RQV A;  2IBZ D;  5CCH C;  1IK7 A;  3L4F A;  1KMI Z;  1OVU A;  3M0D C;  1SVF A;  1KQF B;  1NU1 J;  3L75 D;  1SQV G;  5APX A;  1NTM G;  3A0B H;  3H1K J;  3SFE C;  3V6I A;  3D6Z A;  3CCR P;  3ABV C;  2ZVN B;  2ZYG A;  2BCC J;  1H0T A;  1PV3 A;  2YIU B;  4H44 B;  3HTK B;  4JBZ A;  2W6B A;  2W90 A;  1URQ C;  3LIE A;  1BE3 G;  2QIW A;  3GHG B;  2QM8 A;  3MUD A;  2O01 N;  2NPS D;  1N8R Q;  5L8R J;  1NWQ A;  3EFF K;  2N1T D;  3GW6 A;  1H0T B;  3CWB G;  2WSS H;  3CXH H;  1S9K D;  5DJU B;  4IL6 H;  1R5L A;  3RBX A;  1KD1 Q;  2E75 C;  2O1J A;  3L73 G;  1SFC B;  4OGQ C;  1SQB G;  4U3F D;  1SQB D;  4L73 A;  2KP8 A;  2A06 G;  3MD0 A;  1IFJ A;  1NTK G;  3WUU A;  5APV A;  2V4H A;  2OAR A;  4K35 A;  2JWD A;  3AE5 C;  2P1J A;  4I7Z B;  2WTY A;  1HVV A;  2CK3 H;  1HGV A;  1PGJ A;  1URQ A;  3KXD A;  4N78 E;  3EFG A;  4GT1 A;  1WMK A;  2NZ2 A;  3L70 G;  1KOR A;  2FXO A;  2I1K A;  2JP3 A;  3H1J G;  1L2P A;  1Y9B A;  1SQQ D;  2QJP B;  2W6J H;  3QWO C;  3KHU A;  1KYO I;  4HKZ H;  3F5H A;  1PGQ A;  3RK3 D;  5KLV G;  3FGA D;  2QRX A;  5CBO A;  4UB6 E;  5GTH H;  5KAI E;  1H89 A;  1URQ B;  3M06 A;  1U57 A;  1BCC J;  1PP9 D;  3E1I A;  3M0D A;  4I6M C;  1BGY D;  2NPS A;  3L70 E;  5AVQ B;  2KLV A;  5CCH A;  3CC7 P;  1Y47 A;  2FXM A;  1J1E B;  3AEB C;  4XE5 B;  4W7Z A;  1BCC D;  4N78 D;  3U59 A;  2FYU J;  2IDB A;  3L74 E;  1YQ3 C;  1OFC X;  1NTK E;  2A45 G;  2E75 B;  3CL3 D;  3VP9 A;  5GTI E;  3CCU P;  4DOJ A;  1EZV I;  5APS A;  2HYN A;  3CLQ A;  3KPE A;  3BAT A;  1AV1 A;  2E74 C;  4Z1M H;  5CBN A;  1LP1 A;  2BCC D;  2QVA A;  4DT0 A;  1AQT A;  4AYC A;  1JY2 N;  2NRG A;  1P84 H;  3CXH E;  4L75 A;  3TYY A;  1H88 A;  2K3R A;  1SQB J;  2N9B A;  1SQX K;  2ZVO B;  4GOF A;  2GM4 A;  2JDI H;  1X79 B;  3SWF A;  2HLO A;  1KB9 I;  2ZYA A;  3CX5 H;  3LW5 J;  3VMA A;  3Q1M A;  2IBZ G;  2B87 B;  2ZXE B;  4H0L C;  1LP1 B;  4UB8 E;  5CMZ A;  3RK2 B;  1K05 A;  2I8D A;  3RL0 C;  3VP8 A;  1USD A;  2Z5H A;  1X9V A;  2OGU A;  2FFD C;  1L4A A;  5H2F H;  2E76 B;  1CI6 A;  2QJK C;  3AE2 C;  2M5A A;  3VYI A;  3CCV P;  1BSH A;  1VQP P;  1RHZ B;  1UII A;  1QX8 A;  3BCC J;  4EDF A;  3WUV A;  4YXW H;  2OTJ P;  2C9N Y;  1KIL E;  2AXT E;  1L4A B;  1YTZ I;  3TGU D;  1EDI A;  5AW1 B;  1K73 Q;  1FZF A;  1BE3 E;  2D2C C;  2CPS A;  2NPS B;  2WPR A;  3CXH D;  3PHL A;  5AW6 B;  1M1J A;  3VMY A;  3FX0 A;  3RL0 D;  1RE3 A;  1H8A A;  2WWW A;  1SQP D;  2B88 A;  2WMM A;  4R4M A;  1LT9 B;  3BCC G;  1T3U A;  2LKM A;  2R5B A;  3CWB D;  4D6T G;  2W27 A;  1JMM A;  2J5U A;  2OTK E;  5KJ7 C;  2K37 A;  2WSE H;  3CCE P;  2Y9Z A;  5CCG D;  4IL6 X;  1HUC A;  1MFZ A;  3AE4 C;  2KI7 B;  4H0L B;  4TLF A;  5TIS E;  3L72 D;  4W80 A;  3RK2 C;  3WU2 E;  5B5E E;  3FWL A;  3HE5 A;  3IN6 A;  1DD3 A;  3L71 G;  1LTJ B;  3B5N D;  3M9B A;  4DCK A;  1M7L A;  1CSB A;  4PV1 D;  1NTK J;  3H1H J;  1SFC A;  1PGO A;  3E7K A;  4TT3 H;  2N9Y B;  1LTJ A;  3H1I G;  3H1L G;  1NGM B;  3M0A A;  1RE4 A;  3W67 A;  1GK4 A;  5KLV E;  1L0N J;  4U3F E;  2RH0 A;  1SQV D;  4RJT A;  3CME P;  1HTL C;  3L71 J;  3A3Y B;  4WB4 A;  3L37 A;  1RH5 B;  1LNQ A;  4BXL A;  5KTB A;  1G2C B;  2KUB A;  1NJI Q;  1GDT A;  1AFO A;  1HJB A;  1GL2 C;  4RES B;  2AEF A;  3UIA A;  1SQQ K;  4C7N A;  1KC8 Q;  1JO5 A;  1BGY G;  1L0L K;  3HD7 A;  3F89 A;  1HBW A;  2KXP B;  4WY4 B;  1PPJ D;  4LC1 A;  2IFM A;  5AW2 B;  2P58 A;  3T97 A;  1R8E A;  1KFN A;  1YIJ P;  1ZP0 C;  1IFI A;  1JY2 O;  2Y9Y A;  1DD4 A;  1NHL A;  3GG2 A;  3R2P A;  1L0L G;  1GK6 A;  1N7S C;  1RY3 A;  3A7O A;  3H1K G;  3HUS A;  3JCU H;  4EOT A;  3Q3D A;  1FZC C;  3B5N A;  1GL2 D;  3L73 D;  1EZV G;  2XU6 A;  1Q82 Q;  2XV5 A;  2V7Q J;  3TNU A;  4EYY Q;  4PD4 D;  3HUS B;  1Q81 Q;  2KZI A;  2W83 C;  2LR2 A;  2GUS A;  5BU8 B;  4WY4 C;  2XND H;  3TDK A;  1KZU B;  2ZYD A;  4UB8 H;  4DZO A;  2WT7 A;  1ZME C;  3SFD C;  1L0L E;  1AA0 A;  1KQG B;  1SLQ A;  2KOG A;  1J1E C;  1Z56 A;  4GOE A;  1EXJ A;  1VQN P;  1VQ5 P;  1AJY A;  1G1J A;  1SQB E;  1N7S A;  3HUS C;  3D6Y A;  1E5W A;  1JY3 O;  1JTH A;  1J1D C;  1IFM A;  1HF9 A;  2ZAE B;  2B89 A;  3SWK A;  4A7P A;  1CW5 A;  3PJS K;  1BDD A;  1QGK B;  3A0B E;  3AE6 C;  2K9Y A;  3N7N A;  1JTH B;  2WSC J;  1KYO E;  1NAY A;  3R4Y A;  4O9B A;  4PD4 I;  1PP9 J;  2FKW B;  3AE1 C;  1N7S B;  3H1K E;  5AVU B;  1YQ4 C;  2WSE J;  1KQS O;  4OH8 B;  3AEF C;  3B5N C;  4IL6 E;  5AVV B;  1T2K C;  3RK3 E;  4D6T E;  3V4Q A;  2XKM A;  3B8E B;  3CX5 I;  3AE8 C;  2CPB A;  4PV1 C;  3KZI E;  2QEX P;  2KIK A;  1JEK A;  1PPJ E;  1YI2 P;  1T3J A;  1NKN A;  1OWA A;  2G3A A;  3GMA A;  4LLH A;  2R3C A;  2QA4 P;  1ZR2 A;  3SWY A;  4QMA A;  1PGP A;  5APT A;  1SS1 A;  4YXD C;  3I56 P;  2MKV A;  1AVO A;  3RGU A;  1LT9 C;  2KNC A;  2A06 D;  5AVT B;  3TK1 A;  1HH0 A;  2E5Y A;  3HD7 C;  2MJZ A;  3L74 D;  2V7Q H;  1W2E A;  1D7M A;  1T2K D;  1L0N E;  1FU1 A;  4U3F J;  2H89 C;  3H1H G;  1OIP A;  1M57 D;  1YJW P;  3LID A;  3CC4 P;  4UB6 H;  3Q5R A;  3OAK A;  3V2N A;  1YHQ P;  4JF7 A;  2WT7 B;  1Y8A A;  5CJ0 A;  4NPE A;  5KAF E;  3T97 B;  3V5B A;  2HR3 A;  1X22 A;  1FBM A;  5KLI C;  1N73 C;  2ZFC A;  1KYO H;  2PAJ A;  2Y0C A;  2WPV B;  2B87 A;  4ASW A;  1XTC C;  1NAF A;  1NTM K;  2SPZ A;  4DJG A;  5GTH E;  3RK3 B;  3O6Q A;  3P8C D;  5KAI H;  4C7N B;  3P32 A;  4JQ0 D;  2HPC A;  1NU1 D;  3KZI H;  4PD4 E;  1VL2 A;  3CCJ P;  1IC2 A;  5APQ A;  1MKM A;  5AW9 B;  1Q7Y Q;  1ZRT E;  3L35 A;  1N7L A;  1L4A C;  2JKV A;  2IFN A;  4XFJ A;  1OZH A;  2H8P D;  2KS1 B;  2KZJ A;  1FC2 C;  2Q5U A;  2R5D A;  3K5B A;  3RK3 C;  2P7J A;  3SSU A;  2QE7 H;  1RE3 C;  4M3L A;  2HOD A;  2OYI B;  5AVY B;  2YMK A;  1S72 P;  2O01 H;  3L72 E;  1NTK D;  1JCC A;  3G9R A;  2KLU A;  5AVX B;  3H25 A;  1Q90 D;  3PLN A;  3U1A A;  2WSC H;  1JY3 N;  2Q3E A;  5H2F E;  1N73 B;  1LTS C;  5AW3 B;  1FDI A;  1L4A D;  1RF0 C;  2PP6 A;  3L70 D;  3OJA B;  3QH9 A;  2OYH C;  1GU5 A;  2FFD A;  2R32 A;  2LXB A;  1NKZ B;  3TGU G;  2HG5 D;  1WRG A;  1LTI C;  1VPC A;  1FOS F;  1P84 I;  1U7J A;  2ZJS E;  1BGY J;  1L0N K;  1SQX G;  3CWB E;  3HRN A;  4IFF A;  3RL0 g;  3CCM P;  2YXQ B;  4IOI H;  3G6E P;  4GDO A;  1S5L H;  1VQK P;  3A5T A;  1J1D B;  1FZA A;  3L36 A;  1G1I A;  4I7Z C;  3MHV A;  3CPW O;  2WSF H;  1KV4 A;  2O01 J;  4EIJ A;  1YJN P;  1YYC A;  3HD7 D;  1J2J B;  3NXS A;  3VMX A;  3AEE C;  3CCS P;  1M1J B;  2FYU E;  1S9K E;  2W6A A;  4H0L D;  3A0H H;  2E42 A;  2FYZ A;  1KIL D;  2C9L Y;  5TIS H;  3BRV B;  3CX5 D;  1MZ9 A;  1MUU A;  2Y0D A;  5C39 A;  3B5N B;  3RL0 B;  2ZT9 D;  1NOH A;  1L0L D;  1KIL A;  2QM7 A;  2RN0 A;  1OX3 A;  2WQY C;  4L76 A;  4PV1 B;  2J58 A;  4L74 A;  4PD4 H;  1EZV E;  3L73 J;  1JMB A;  2Q7C A;  1NU1 K;  3AE7 C;  3Q2Y A;  4YTP C;  2P2U A;  3A2A A;  3GHG C;  1OVV A;  5EFW B;  2AEM A;  2A06 E;  1ZLL A;  2ITA A;  3H1J E;  2E74 B;  3II6 A;  2P67 A;  5APY A;  2E43 A;  3L74 J;  1LJ2 A;  3VOP A;  3MIW A;  1YTZ T;  2FXP A;  3NFQ A;  1RQU A;  2KB7 P;  1KB9 E;  2FYU K;  1IFP A;  1NTM D;  2J59 M;  2YKO A;  3IF4 A;  4WVZ A;  2FYN B;  5TJH A;  3RBZ A;  3G4S P;  3HTK A;  3NMD A;  3BCC E;  1LTB C;  1SFC C;  1ZOY C;  4OGQ B;  1SQV E;  4WY4 D;  5CCG C;  1VQM P;  1DEE G;  1FE6 A;  1GD2 E;  5KLV K;  1LT1 A;  5APW A;  2FYN C;  3GLM A;  2JWA A;  2YNY A;  3VN0 A;  4B86 A;  1JNM A;  1LT9 A;  2A45 H;  4ZKU A;  2C0W A;  1K04 A;  3A0H E;  1SP4 A;  2IBZ E;  3AED C;  2Z4E A;  2QJY B;  3JSV C;  3H6P A;  3OA7 A;  1LGH B;  4KT0 J;  2HFE D;  3FWN A;  4K3A A;  3V4W A;  2OYH B;  1Q86 Q;  1NTZ G;  2IZ0 A; 
#chains in the Genus database with same CATH homology
 5CJ4 A;  2YKQ A;  1XTG B;  4GKG A;  1LWU B;  4C46 A;  1DH3 A;  2IPP A;  4N6J A;  1FDM A;  5CHX A;  2OYI C;  1GL2 B;  1JUN A;  1IJD B;  3KYQ A;  5BVZ A;  1LTG C;  1FJK A;  3P8C E;  2BAS A;  1N7S D;  5BU5 A;  3V2Q A;  1A02 J;  1AQ5 A;  4Y99 C;  4W7Y A;  3U1C A;  4XA4 A;  1KIL B;  2KYV A;  2M8R A;  2Z5I A;  1GW4 A;  1VDF A;  1RF0 A;  3NTN A;  2Q9I A;  1MV8 A;  1IFN A;  5AW4 B;  1LWU A;  3HE5 B;  1GZL A;  4WBA A;  2NPS C;  1FZG A;  3P7K A;  2XNX A;  2JEE A;  1QL1 A;  1N73 A;  3BAS A;  1RF1 B;  1NTK K;  2FFD B;  3IFM A;  3HE4 A;  2N1T B;  2HOD B;  1X8Y A;  1G2C A;  4AQR D;  4JYC A;  2N1T A;  1LTA C;  2YO2 A;  5AW7 B;  1CZQ A;  3TSI A;  1GDT A;  5AVR B;  2WIT A;  2WZ7 A;  2HPC B;  3V2R A;  5APU A;  2YO3 A;  3GHG A;  5AVS B;  1FZB A;  1ZR4 A;  1ZN5 A;  5AVZ B;  2JJL A;  4I1L A;  2WT7 B;  3EQ2 A;  1URQ D;  2H43 A;  1LWU C;  1KIL C;  1OXZ A;  1IFD A;  3M91 A;  3CI9 A;  3WMM 0;  3VTP C;  1HWT C;  1T8Z A;  2L5G B;  2YKP A;  2XZR A;  2WPQ A;  3IR9 A;  2GUV A;  3HD7 B;  1QL2 A;  3H32 A;  3N4X A;  1IO4 A;  4WY4 A;  2VRS A;  1DEB A;  1A02 F;  3V2P A;  1GTW A;  1GW3 A;  3C9I A;  4C7R A;  3O8Z A;  5AW8 B;  2H7H A;  3MTU E;  4JYB A;  1FZC B;  1FAV A;  4HH2 A;  3VMZ A;  1FZE A;  1GL2 A;  4HYT B;  2POH A;  1FZC A;  3KQG A;  2Q3I A;  3RK2 D;  2C0X A;  1NO4 A;  2KSJ A;  1IK9 A;  4IFM A;  1EQ7 A;  1N86 A;  1NH4 A;  5CCH D;  1NTZ K;  1RF1 A;  3HE4 B;  5AW0 B;  3TNU B;  4IFD K;  1CI6 B;  1JY2 P;  1GU4 A;  5CCG A;  3I5C A;  2XDJ A;  2O1K A;  1SQB K;  1RE4 C;  4LGD E;  2I1J A;  1WT6 A;  1LTJ C;  1JY3 P;  2M3B A;  1HGZ A;  4N3Y B;  4AUW A;  5AVW B;  1SFC D;  2N1T C;  1SQV K;  1M1J C;  1RF1 C;  1LTT C;  2A45 I;  1N2D C;  3P8M C;  1FOS E;  3MGN A;  1FJP A;  3LW5 H;  5KJ7 A;  1KQL A;  1JCD A;  3M9H A;  4ZKP A;  5KJ7 D;  1KFM A;  2WPS A;  3M9Q A;  3BVH A;  3PP5 A;  4I2L C;  3G3Z A;  1SQP K;  2YMY A;  1JOC A;  4Y99 B;  2OYH A;  3H32 B;  3BRT B;  3KDP B;  2OYI A;  2IX7 C;  4GIF A;  1ZV8 A;  4KHX A;  5CCH C;  3L4F A;  3M0D C;  1SVF A;  5APX A;  3HTK B;  1URQ C;  3LIE A;  3GHG B;  3MUD A;  2QM8 A;  2NPS D;  1NWQ A;  2N1T D;  1S9K D;  2O1J A;  1SFC B;  2KP8 A;  3MD0 A;  1IFJ A;  5APV A;  2OAR A;  2P1J A;  2WTY A;  1HVV A;  1HGV A;  1URQ A;  4N78 E;  3EFG A;  4GT1 A;  2I1K A;  1FZF A;  3RK3 D;  1H89 A;  1URQ B;  3M06 A;  3E1I A;  3M0D A;  4I6M C;  2NPS A;  5AVQ B;  2KLV A;  5CCH A;  2FXM A;  1J1E B;  4XE5 B;  4W7Z A;  4N78 D;  3U59 A;  2A45 G;  3CL3 D;  3VP9 A;  4DOJ A;  2HYN A;  3CLQ A;  3KPE A;  3BAT A;  4AYC A;  1JY2 N;  1H88 A;  3TYY A;  2N9B A;  2GM4 A;  1SQX K;  3SWF A;  1X79 B;  2HLO A;  1PFI A;  2ZXE B;  5CMZ A;  3RK2 B;  3VP8 A;  3RL0 C;  2Z5H A;  1X9V A;  2FFD C;  1L4A A;  3VYI A;  1CI6 A;  2C9N Y;  1L4A B;  1YTZ I;  5AW1 B;  2NPS B;  2CPS A;  2WPR A;  5AW6 B;  1M1J A;  3VMY A;  3RL0 D;  1RE3 A;  1H8A A;  2WWW A;  1LT9 B;  1T3U A;  2LKM A;  2R5B A;  2W27 A;  1JMM A;  5KJ7 C;  2WSE H;  5CCG D;  1HUC A;  1MFZ A;  3RK2 C;  4W80 A;  3HE5 A;  3M9B A;  1LTJ B;  3B5N D;  1M7L A;  1CSB A;  1SFC A;  1LTJ A;  3M0A A;  1RE4 A;  1GK4 A;  1HTL C;  3A3Y B;  4WB4 A;  3L37 A;  5KTB A;  1AFO A;  1G2C B;  1HJB A;  1GL2 C;  4RES B;  3UIA A;  4C7N A;  1SQQ K;  1JO5 A;  1L0L K;  3HD7 A;  1HBW A;  4WY4 B;  5AW2 B;  4LC1 A;  2IFM A;  3T97 A;  1KFN A;  1IFI A;  1JY2 O;  1NHL A;  3R2P A;  3HUS A;  1N7S C;  1GK6 A;  1RY3 A;  3A7O A;  4EOT A;  1FZC C;  3B5N A;  1GL2 D;  2XU6 A;  2XV5 A;  3TNU A;  3HUS B;  2GUS A;  5BU8 B;  4WY4 C;  2WT7 A;  1KZU B;  4DZO A;  1SLQ A;  2KOG A;  1J1E C;  1Z56 A;  1G1J A;  1N7S A;  3HUS C;  1E5W A;  1JY3 O;  1JTH A;  1J1D C;  1IFM A;  1CW5 A;  3N7N A;  5AW5 B;  1JTH B;  4O9B A;  2FKW B;  1N7S B;  5AVU B;  4OH8 B;  3B5N C;  5AVV B;  1T2K C;  3V4Q A;  2XKM A;  3B8E B;  2CPB A;  1T3J A;  1NKN A;  1OWA A;  4LLH A;  2R3C A;  1ZR2 A;  3SWY A;  5APT A;  1LT9 C;  5AVT B;  3TK1 A;  1HH0 A;  3HD7 C;  2MJZ A;  1W2E A;  1T2K D;  1FU1 A;  3LID A;  3OAK A;  3V2N A;  4JF7 A;  5CJ0 A;  3V5B A;  1FBM A;  1N73 C;  2ZFC A;  2PAJ A;  1NAF A;  1NTM K;  1XTC C;  3RK3 B;  3P8C D;  4C7N B;  3P32 A;  2HPC A;  1IC2 A;  5APQ A;  5AW9 B;  3L35 A;  1N7L A;  1L4A C;  2IFN A;  2H8P D;  2R5D A;  2Q5U A;  3RK3 C;  2P7J A;  1RE3 C;  4M3L A;  2HOD A;  2OYI B;  5AVY B;  2O01 H;  1JCC A;  5AVX B;  3U1A A;  2WSC H;  1JY3 N;  1N73 B;  1LTS C;  5AW3 B;  1RF0 C;  1L4A D;  2PP6 A;  3OJA B;  2OYH C;  1GU5 A;  2FFD A;  2R32 A;  1NKZ B;  2HG5 D;  1WRG A;  1LTI C;  1VPC A;  1FOS F;  4IFF A;  3HRN A;  1L0N K;  3A5T A;  1J1D B;  1FZA A;  3L36 A;  1G1I A;  2WSF H;  4EIJ A;  1YYC A;  3HD7 D;  1J2J B;  3NXS A;  3VMX A;  1S9K E;  1DX7 A;  1M1J B;  2E42 A;  2W6A A;  2FYZ A;  1KIL D;  2C9L Y;  3BRV B;  1MZ9 A;  1MUU A;  3B5N B;  3RL0 B;  1NOH A;  1KIL A;  2QM7 A;  2J58 A;  2Q7C A;  1NU1 K;  2P2U A;  3A2A A;  3GHG C;  1ZLL A;  3II6 A;  5APY A;  2P67 A;  2E43 A;  3VOP A;  3MIW A;  1YTZ T;  3NFQ A;  5APS A;  2KB7 P;  2J59 M;  2FYU K;  2YKO A;  3HTK A;  3NMD A;  1LTB C;  1SFC C;  5CCG C;  4WY4 D;  1GD2 E;  5KLV K;  5APW A;  2YNY A;  3VN0 A;  4B86 A;  1JNM A;  1LT9 A;  2A45 H;  4ZKU A;  2C0W A;  1SP4 A;  2Z4E A;  3H6P A;  3OA7 A;  1LGH B;  2HFE D;  3V4W A;  2OYH B;  2W6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...