1NTMK

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
51
structure length
51
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ntmK00
3CLQA 2WSEH 2O01H 3M9QA 3LW5H 4IFDK 2WSCH 1SQQK 1L0LK 3G3ZA 2WSFH 1NTMK 1NTKK 1NU1K 1SQPK 1SQVK 1SQXK 2FYUK 2LKMA 5KLVK 2J59M 1NTZK 1SQBK 2OARA 1L0NK
chains in the Genus database with same CATH superfamily
3CLQA 1FBMA 2GUSA 3CCVP 5KJ7A 1ZP0C 3BATA 2H8PD 4WWIA 4JPZB 1VQKP 2BASA 2KSEA 3AECC 1A02F 2Q3IA 2M0BA 1SFCD 3CCJP 1HH0A 1S2EA 3HD7A 2QEXP 4JF7A 1ZRTE 1YI2P 1CI6B 1GW3A 4M3LA 5TISE 1EZVD 2IBZE 3L75J 1NKNA 2WVRA 3L70D 3Q2YA 2Y9ZA 1VQ9P 1N7LA 2N9YB 3H1KJ 5CHXA 1AQ5A 1LT9A 1RE4A 2QJPC 4DZOA 1DD4A 2W6JH 1OIPA 3GF3A 1NTMG 1W2BO 2B87A 2LR2A 5M1BA 5KAFE 1K05A 1JCDA 3VTPC 1OW6A 1P84E 2A45G 1HJBA 1BE3D 4GOFA 1L4AD 2XDJA 3PHLA 2IZ1A 1FDMA 3ZDMA 2OTLP 2WSCH 3CC7P 1T3UA 1QL1A 3P8CE 1GL2B 1Y47A 1KILB 1OVVA 5APWA 4C7NA 1JY2O 1NOHA 1SQVJ 3QWOC 4GKGA 1EZVI 2HODA 1HUCA 3A0HH 5CCHD 3VMZA 3L70G 5GTIH 3HUSA 1YBKA 5AW6B 2D2CB 1M1JB 3AEAC 1NTZD 2QM8A 4Z1MH 1L0ND 5B66H 1SQBJ 3CCEP 1NTKE 3CX5I 1NTKG 3GMAA 1SFCA 4ASVA 2YXQB 2BEQD 5TJHA 3V2QA 3BCCD 2OQQA 1BE3G 1M1KQ 1IC2A 4NPDA 4JBZA 1SQPJ 1ZLLA 3CWBJ 2K88A 1DH3A 3RGUA 3D70A 2JDIH 2XU6A 2NRGA 4WY4B 4BWNA 2P7JA 3CCUP 1GW4A 1BCCJ 4XA4A 1H89A 3CX5H 2WSCJ 1J1EB 1ZR2A 2H89C 4N78E 2FBWC 1JMMA 2ZT9D 2IYPA 1RF1B 1RE3C 3L36A 1L4AA 4D6TJ 1YTZT 3A5TA 1RHZB 5BVZA 3G6EP 3I55P 2J58A 2PAJA 4NPEA 1GTWA 3C1LA 1FJPA 4PV1D 1LWUA 2PRRA 1RF0C 1EDLA 2E76C 2WT7B 2E74C 1N73A 3C8VA 3G3ZA 1LTAC 3MZWB 1KQSO 3BVHA 3SFDC 3B71A 3R4YA 1EDKA 2BCCE 3B5NC 3A0BE 2BCCG 1MV8A 2IFMA 5CCHA 1FE6A 2WSEH 2IYOA 4RESB 2GA1A 4U7JA 3TGUJ 2ZYDA 1BSNA 3WUUA 5AVXB 3CXHD 3CMEP 3MUDA 2E74B 3H1JE 3L71E 5C39A 5BU8B 3ABVC 4Y28J 1NH4A 1KQFB 1SQQE 1Y8AA 2N1TD 3NXSA 1OXZA 1SQQG 1AFOA 2OGUA 1IFNA 4EIJA 1L0LD 4DT0A 3RL0C 5APVA 2KYVA 1OVUA 2JO1A 3AE6C 1KQGB 1M8OB 1VQMP 1KC8Q 3I5CA 1AV1A 1KYOE 1NKZB 2QA4P 2Q3EA 2ITAA 3AEGC 2RH0A 3FXEA 3VYIA 1IFMA 4K35A 1U57A 3H1LE 2JEEA 3L73E 3H1LG 3TF5A 1HJ0A 3H1IG 1NTZJ 1G1JA 3CXHI 1L0NJ 2WSEJ 3CCLP 1GDTA 4KT0J 2KXPB 2FYUE 5APSA 1IFJA 2E75C 3VN0A 2ZVOB 2FYUK 1IK7A 3BCCJ 2LKMA 3FWNA 2OARA 4YXDC 3RK3B 1IFPA 1BSHA 3HE5A 3CXHH 1OW7A 2GUVA 4LGDE 2FXMA 2WITA 5DJUB 2KOGA 4EI2A 3H32A 3D6ZA 4U3FD 3AE4C 4I1LA 2IX7C 2WSSH 1KB9I 1PV3A 4DJGA 2N1TA 1PPJD 1RY3A 1KZUB 3SFEC 4OGQB 1DEBA 5CBNA 3CI9A 1TU3F 3TK1A 3GF7A 2PP6A 1NU1G 2G3AA 1KB9H 1JY3O 2PGDA 4YPCA 4C7RA 5KTBA 3JCUE 3FGAD 3RL0g 3T97A 1FZCC 1N2DC 1X79B 5AW2B 1EXJA 1R5LA 1YIJP 3KZIE 1KQLA 4ZKPA 5B5EE 3KYQA 1DX7A 1IZNB 3UIAA 2KS1A 3E7KA 1K73Q 2R44A 5AW0B 3L35A 5H2FH 1S4XA 3TDKA 4U3FG 5KLVK 1UIIA 1VQ8P 4C7NB 4EDFA 3PTZA 2KLUA 4OWFA 1IO4A 2HPCA 4H13B 3Q5SA 1L2PA 1EDIA 4Y99B 1QL2A 2HODB 1BGYD 5CCGC 3M0DA 3HUSB 4ZMDA 1FOSF 1AA0A 2A06E 3IR9A 2C0XA 1MFZA 3BRVB 4JYCA 2KNCA 4H0LC 1FDOA 1KFMA 1M56D 1YQ4C 3S9OA 1NHLA 3EFFK 1JY2N 1S5LE 2J59M 1J1DB 4RJTA 3KHUA 3L75E 3L75G 1Q81Q 2C9LY 1GU4A 3H1KE 1G2CA 3CL3D 1LTIC 1SQXG 1ZMEC 1URQD 1FZFA 4R4LA 4XE5B 1OVRA 1PGPA 2IBZD 3V2NA 2I8DA 1PGJA 1S3JA 3RK3E 2WQYC 1MZ9A 1L4AB 1RQUA 1NTMD 3CCSP 1BGYG 3GW6A 2Z4EA 3RK2D 3L72G 1AQTA 3GHGA 1LTBC 1ZOYC 1R5SA 2N9BA 1P84D 4A7PA 1WMKA 1LWUB 2AXTH 2ZXEB 1PP9E 1PP9G 3V5BA 2JWDA 1SQVE 4I6MC 2QJYB 1N73B 2FXPA 1QEXA 1SQVK 2ZYGA 1MKMA 1FZGA 1GD2E 3P8CD 5AVYB 1JY3P 5APXA 3E1RA 3KXDA 2DW3A 2WPRA 4GIFA 2QIWA 1SQBE 4UB8H 2ZXXA 2IBZG 5EFWB 1SQBK 3OA7A 3N7NA 1GL2C 2POHA 5KLIB 1KILC 3CCMP 1SQPE 3CWBE 1W5CE 1SQPK 1VL2A 2M3BA 1NTKD 3AE1C 3K5BA 2MKVA 2A45I 1BCCE 2IZ0A 1P84I 1BCCG 1URQA 2OYHA 3Q5RA 1LTJA 1NVOA 3H1HJ 1YYCA 3O6QA 4NPFX 2D2CC 2R5DA 1M1JC 2ZT9B 2JWAA 2NZ2A 4D6TE 2R5BA 2FFDA 1N8RQ 2KK7A 2IFNA 2A45H 1P84H 1MFTA 1T6AA 4N78D 2WPQA 3OW2O 1ZW0A 2H7HA 2P1JA 1GZLA 5GTIE 4I7ZC 1GU5A 2YKOA 4DCKA 1FAVA 4WY4C 3AE2C 5B66E 1JEKA 1PGOA 3C9IA 2NPSC 3Q3DA 2B88A 1J1EC 2QRXA 3BASA 3JC22 1E79H 2XV5A 1AVOA 1RF1C 3TGUE 3O8ZA 2WPSA 1LTGC 4I7ZB 2BCCD 3H32B 3CX5E 3A7OA 3W67A 4LC1A 1HBWA 2NPSB 2N1TB 2R3CA 1A02J 4L74A 1JOCA 1NTMJ 4RKUJ 1T2KC 4PJ0E 3L71D 1S1CX 3G71P 1KMIZ 1SQQD 1FZEA 3HRNA 2BEZF 1DD3A 5CJ4A 3WU2H 3T97B 1IFDA 2XZRA 3L74E 3L74G 1YITP 2R32A 3MIWA 3RBZA 3M9BA 4ZKUA 1JTHA 3PLNA 2AEMA 1KYOD 1VQ4P 1GMJA 2K1AA 1S9KE 1NTZK 2WMMA 1L0NK 3M06A 2V4HA 3L70J 3BRTB 3H1LD 3V6IA 1ZV8A 3BCCE 2OYIA 3EFGA 3H1ID 4TLFA 1JY3N 2YMKA 2Y9YA 2HPCB 4H44C 1BDDA 5APYA 1NTKJ 4WBAA 1HTLC 3H1JG 1BE3J 2XNDH 4UB6E 3L71G 1NGMB 4WB4A 1JY2P 1USDA 1HGZA 2KI7B 3FWLA 3AEFC 3II6A 1KILE 1R8EA 5CJ0A 2E5YA 3B8EB 2LXBA 1N7SC 5AW3B 2YIUB 3NTNA 4H44B 2O01H 2ZFCA 4IFDK 1CSBA 4PD4D 3RBXA 1KYOI 2QVAA 2CPSA 4K3AA 3HE4A 3CCRP 3FXDA 3RK3C 3E1IA 5KJ7C 1VF5C 3L73G 3OJAB 1OX3A 2QSIA 3D6YA 1X22A 1N7SB 2WPVB 4ZNCA 1NU1D 2FYUG 3WUVA 2CK3H 3VMYA 3GHGB 1VQOP 3IFMA 2Q6QA 3CXHE 3HD7C 5GTHH 2W27A 3CD6P 1VF5B 3R2PA 5AW9B 3S1KA 4OGQC 5CBOA 2KSJA 3HTKA 1EC5A 1LT9C 3OAKA 2Q9IA 1RE4C 1FZAA 2E76D 2E74D 4PD4I 1L0LK 2WZ7A 2O01J 3ITKA 1E5WA 3HD7B 1SQQJ 3B5ND 3LIDA 2Q7CA 1YTZI 1M7LA 2YXRB 3VP9A 1NAFA 2Y0DA 1KB9E 3TNUA 1QVGO 1LT9B 2QJKB 4PD4H 2J5UA 3SWYA 4LLHA 2HYNA 2A06D 2OTJP 2PFXA 2B87B 1VQPP 1OMIA 1H8AA 2K3RA 3CC4P 4H13C 2YMYA 1JO5A 1LTJB 4Y99C 2E5TA 3N4XA 3L75D 1HVVA 5H2FE 3RL0D 3HUSC 3O6QB 3H1IJ 2I1KA 5KLVE 2FYNB 1U7JA 5KLVG 1SQXD 1Z56A 3JCUH 2Z5IA 2FFDB 5AVUB 2AXCA 1SFCC 3RK2B 3PP5A 1RE3A 1J1DC 2KZIA 5AVSB 1LJ2A 1L0LJ 1HGVA 2P2UA 4KHXA 3L72D 3V4QA 1RF0A 1U7MA 4AQRD 3CCQP 2YO3A 1PIXA 2M5AA 1PGQA 1H88A 2A06G 3JSVC 1LP1A 2E75D 1PP9D 4QMAA 2WSFJ 3W68A 1S72P 1SFCB 1SQVD 1JB0J 5E79H 4IL6E 4HYTB 3V2PA 1LNQA 3B5NA 2RMZA 3MHVA 1L4AC 2KP8A 4GT1A 5AVVB 3U1AA 1K04A 4L76A 1H0TA 2YNYA 3H1KG 2M3EA 1FDIA 1VQ5P 4EOTA 1ZRTD 1LWUC 2YKPA 1NU1J 4W7ZA 1RQVA 1SQBD 2QJYC 1N73C 2FXOA 1ZXGA 2B9BA 5AW4B 5KAIH 1KORA 3M91A 1SQPD 1VDFA 2P67A 3CWBD 2JP3A 3H1HE 4BRYA 3AE8C 3A2AA 2AXTE 3M9QA 1BCCD 1EDJA 2O3JA 1J2JB 1VQ6P 3VP8A 1OZHA 1LTTC 4U3FJ 2HFED 2AEJA 1M57D 1JNMA 3MUDC 1SQVG 4OVNF 3S4RA 1JTHB 5KLIC 2H88C 1JUNA 3WMM0 4D6TD 4C46A 3V4WA 3Q1MA 5AVTB 2OYIB 4UB8E 3SWKA 1KV4A 2IBZI 1LT1A 1SQBG 3AE5C 3M9HA 3AE7C 2ZT9C 5CMZA 2K9JA 2E42A 1CW5A 4HB1A 1SQPG 1KN7A 3CWBG 1PFIA 5CCGD 1X9VA 5TISH 1G1IA 3F5HA 1NWQA 3D71A 1SQXJ 1XTCC 3TGUD 1YJNP 2QM7A 4PV1C 1FJKA 3AEEC 3EWKA 3MD0A 1NTME 1EXIA 4H0LD 1NTMK 2ZAEB 3CX5D 4WVZA 1T3JA 2MJZA 1Q7YQ 1D7MA 5KAFH 3HE4B 4D6TG 1YJWP 1NJIQ 1BGYJ 1NAYA 3L72J 1Q90D 1VPCA 1RH5B 5AW8B 2ZYAA 2QJPB 3A0HE 2C9NY 2FY8A 4PV1B 3P7KA 4HJGH 2Q5UA 4JQ0D 1PP9J 1YQ3C 1FU1A 1FZCA 3EQ2A 1QLED 3MTUE 1UIXA 4YXWH 2G8YA 4BXLA 4B86A 1EZVE 2FYZA 2N1TC 1EZVG 3L74D 3L70E 1GK6A 1CZQA 3HE5B 2KLVA 2IPPA 3HTKB 3TGUG 3B4SA 5DJTB 2Y0CA 4DOJA 1S9KD 1AJYA 5L8RJ 1DEEG 1FS0E 3A3YB 4AUWA 1NTKK 1XTGB 2QE7H 3M0AA 1BE3E 1QX8A 2Q1KA 2L91A 4ASWA 1IK9A 3SSUA 3U1CA 2K37A 5AW5B 5CCGA 1YHQP 3FX0A 2XKMA 4L75A 2QG4A 3H1JD 2HG5D 1AVYA 5APUA 4XFJA 3TNUB 3PRJA 3WU2E 1JCCA 3V2RA 2JKVA 4OH8B 1GL2D 2AEFA 1KILD 1NYHA 2Z5HA 3G4SP 3USSA 4EYYQ 4PJ0H 3G9RA 2FKWB 1JM0A 2P58A 1NTZE 3M0DC 2KS1B 1L0NE 1NTZG 1L0NG 2SPZA 2I1JA 1IJDB 3L73D 1USEA 2D2CD 3BCCG 1SP4A 3NFQA 3H6PA 2YIUC 1K9MQ 1K8AQ 3P8MC 3TYYA 2JR8A 2C0WA 2V7QH 2FYUD 3MP7B 2HR3A 5AVWB 1KTMA 3P32A 3A0BH 1CI6A 3CC2P 2GM4A 1LGHB 3CMAP 2JJLA 2M5AB 5AW7B 2E76B 1X8YA 1LP1B 4WY4D 2XNXA 2KNCB 3KDPB 2NPSD 1N86A 2M8RA 3B5NB 1FZBA 1SQQK 4UB6H 3AEBC 3AEDC 3L4FA 2YKQA 4O9BA 1BDCA 1H0TB 3GHGC 1G2CB 2KIKA 3PH0A 1KFNA 1QGKB 1GK4A 3AE3C 1GL2A 4IOIH 1KILA 2K9YA 1QVFO 1KB9D 4JYBA 3F89A 4KJMA 3WUTA 1KYOH 1PL5A 2LXCB 3L74J 1IFIA 2KZJA 3VMAA 1T2KD 4BRYB 5GTHE 3RL0B 3H1IE 2O01N 1LTSC 2V7QJ 1Q82Q 1Q2NA 1SS1A 1X0TA 1MUUA 2BCCJ 3VOPA 3LIEA 4HH2A 1M1JA 2B89A 5AVZB 4W7YA 1WRGA 2QJKC 5KLVD 4YTPC 1L0LE 1L0LG 1ZN5A 2O1KA 3IF4A 2OTKE 3H1JJ 2R3SA 3L71J 2WTYA 4IL6X 4GODA 1URQC 1SVFA 1S5LX 2OYHC 1LTJC 1EQ7A 4GOEA 2E75B 4PD4E 4WY4A 2W6BA 4RO0A 3LW5H 4HKZH 2NPSA 2WSFH 2FYNC 4W80A 4H44D 2K9JB 1DIPA 2H43A 2FFDC 1M90Q 1OFCX 2KUBA 1RF1A 3TSIA 1JMBA 3RK2C 2WWWA 4AYCA 2P10A 4TT3H 1NU1E 1URQB 2OYHB 5K5GB 3GG2A 1Y9BA 3H1LJ 4I2LC 3L73J 1NU1K 1VQ7P 4IFFA 4IFMA 3H1KD 3IN6A 1N7SD 2OYOA 1VQLP 4N3YB 1NO4A 3KQGA 2WT7A 2FYUJ 4L73A 3KPEA 2UWJE 2ZVNB 3KZIH 5B5EH 3RK3D 4U3FE 3NMDA 5KJ7D 3Q5PA 1VF5D 4MN4C 3MGNA 4N6JA 2O1JA 3H1HD 5AW1B 1FZCB 2E43A 2W6AA 5APTA 1PPJE 3LW5J 1PPJG 1SLQA 5E79E 4R4MA 5AVRB 1PZQA 3GLMA 3SWFA 3HD7D 5KKZC 1HF9A 3IAOA 3L37A 4OGQD 1HWTC 5APQA 1YJ9P 2ZJSE 5BU5A 3CPWO 2IDBA 4IL6H 2KB7P 2RKLA 2YO2A 3H25A 2W8ZA 1S5LH 2RN0A 1OWAA 5KAIE 1ZR4A 2VRSA 1FOSE 1VQNP 5KKZB 1SQXE 3PJSK 1T8ZA 1SQXK 4GDOA 2CPBA 3QH9A 2L5GB 1KD1Q 1Q86Q 3H1HG 5CCHC 4H0LB 1FC2C 3VMXA 2OYIC 2W90A 1N7SA 5AVQB 5KLVJ 1W2EA 2HLOA 3I56P 3AE9C 3U59A 1BGYE 3L72E 4CPGA 1WT6A 1OW8A 2Y0EA 4H13D 2W83C
chains in the Genus database with same CATH topology
1N7SC 3CLQA 5AW3B 4DOJA 3NTNA 1S9KD 1FBMA 1X79B 2O01H 5AW2B 2GUSA 2ZFCA 5KJ7A 3BATA 4IFDK 2H8PD 1KQLA 4ZKPA 1CSBA 3A3YB 4AUWA 3KYQA 1DX7A 1NTKK 1XTGB 2CPSA 3UIAA 3M0AA 5AW0B 3L35A 3HE4A 3RK3C 1IK9A 3E1IA 5KLVK 2BASA 4C7NB 3U1CA 1A02F 5KJ7C 2Q3IA 5AW5B 5CCGA 3OJAB 1SFCD 2XKMA 1HH0A 2HG5D 5APUA 3HD7A 1IO4A 2HPCA 1N7SB 4JF7A 3TNUB 1CI6B 1JCCA 1GW3A 4M3LA 4Y99B 1QL2A 1NKNA 3V2RA 2HODB 4OH8B 5CCGC 1N7LA 1GL2D 3M0DA 3HUSB 5CHXA 1AQ5A 1KILD 1LT9A 3VMYA 1RE4A 3GHGB 4DZOA 3IFMA 1FOSF 3HD7C 2Z5HA 3IR9A 2W27A 2C0XA 3R2PA 1MFZA 5AW9B 2FKWB 3BRVB 4JYCA 1KFMA 2KSJA 1JCDA 3VTPC 1NHLA 3HTKA 3M0DC 2A45G 1HJBA 1LT9C 3OAKA 1JY2N 2J59M 2Q9IA 1J1DB 1RE4C 1L4AD 1FZAA 2XDJA 1FDMA 2I1JA 1IJDB 2WSCH 1L0LK 2C9LY 1GU4A 2WZ7A 1T3UA 1QL1A 1SP4A 3NFQA 3P8CE 1GL2B 3H6PA 1G2CA 1KILB 3CL3D 1LTIC 1E5WA 3HD7B 5APWA 3P8MC 3B5ND 3TYYA 1URQD 3LIDA 4C7NA 1FZFA 2Q7CA 1JY2O 4XE5B 2C0WA 1YTZI 1NOHA 5AVWB 3V2NA 1M7LA 3VP9A 1NAFA 3P32A 3TNUA 1CI6A 1LT9B 2GM4A 1LGHB 4GKGA 3SWYA 1MZ9A 4LLHA 2HYNA 1L4AB 2JJLA 2HODA 5AW7B 1HUCA 1X8YA 5CCHD 3VMZA 3HUSA 4WY4D 2Z4EA 3RK2D 2XNXA 1H8AA 5AW6B 3GHGA 1LTBC 1M1JB 3KDPB 2NPSD 2N9BA 2QM8A 2YMYA 1JO5A 1LWUB 1N86A 2M8RA 2ZXEB 3B5NB 1FZBA 1SQQK 1LTJB 4Y99C 3N4XA 3L4FA 1HVVA 3V5BA 2YKQA 1SFCA 4I6MC 3RL0D 3V2QA 4O9BA 1N73B 3HUSC 1SQVK 1FZGA 2I1KA 1GD2E 1IC2A 3GHGC 3P8CD 1G2CB 5AVYB 1Z56A 2Z5IA 1ZLLA 2FFDB 1DH3A 1KFNA 1GK4A 1JY3P 5APXA 5AVUB 2XU6A 1GL2A 1SFCC 4WY4B 2WPRA 3RK2B 1KILA 2P7JA 4GIFA 3PP5A 1GW4A 1RE3A 4XA4A 1H89A 4JYBA 1J1DC 1J1EB 1ZR2A 1IFIA 5AVSB 4N78E 1HGVA 1SQBK 1JMMA 2P2UA 1T2KD 3OA7A 4KHXA 3RL0B 3N7NA 1RF1B 1GL2C 2POHA 3V4QA 1LTSC 1KILC 1RE3C 1RF0A 3L36A 1L4AA 4AQRD 1MUUA 2YO3A 1YTZT 3A5TA 3VOPA 1H88A 5BVZA 3LIEA 1SQPK 2J58A 2PAJA 2M3BA 1GTWA 1SFCB 4HH2A 1M1JA 1FJPA 2A45I 5AVZB 4HYTB 3V2PA 4W7YA 1WRGA 1LWUA 3B5NA 1URQA 2OYHA 1LTJA 1RF0C 1L4AC 2KP8A 4GT1A 5AVVB 3U1AA 2WT7B 1ZN5A 2O1KA 3G3ZA 1YYCA 1LTAC 1N73A 2YNYA 3BVHA 2R5DA 2WTYA 1M1JC 4EOTA 2R5BA 2FFDA 1LWUC 2IFNA 2YKPA 3B5NC 1URQC 1SVFA 2A45H 2OYHC 1LTJC 1EQ7A 1MV8A 2IFMA 4W7ZA 5CCHA 2WSEH 4N78D 4WY4A 2W6BA 3LW5H 4RESB 2WPQA 1N73C 2H7HA 2NPSA 2P1JA 2WSFH 4W80A 5AW4B 1GZLA 5AVXB 2H43A 3M91A 2FFDC 1VDFA 2P67A 3MUDA 1GU5A 2YKOA 1FAVA 1RF1A 3TSIA 3A2AA 4WY4C 3RK2C 5BU8B 2WWWA 3M9QA 4AYCA 1NH4A 3C9IA 2NPSC 1J2JB 2N1TD 3VP8A 3NXSA 1LTTC 1OXZA 1J1EC 1AFOA 2HFED 1URQB 2OYHB 1IFNA 4I2LC 3BASA 1NU1K 4EIJA 1JNMA 2XV5A 4IFFA 1JTHB 3RL0C 4IFMA 1RF1C 1N7SD 5APVA 3O8ZA 2KYVA 4N3YB 1JUNA 2WPSA 1NO4A 3WMM0 1LTGC 3KQGA 4C46A 2WT7A 3H32B 3V4WA 3I5CA 3KPEA 3A7OA 5AVTB 1NKZB 4LC1A 2OYIB 1HBWA 2NPSB 3RK3D 3VYIA 1IFMA 2N1TB 2R3CA 1A02J 3NMDA 5KJ7D 1JOCA 2JEEA 3MGNA 3M9HA 4N6JA 2O1JA 5AW1B 1T2KC 1FZCB 2E43A 2W6AA 5CMZA 1G1JA 2E42A 5APTA 1CW5A 1GDTA 1FZEA 1SLQA 3HRNA 5APSA 1PFIA 1IFJA 5CCGD 3VN0A 5CJ4A 2FYUK 1X9VA 2LKMA 1G1IA 5AVRB 1NWQA 2OARA 1IFDA 2XZRA 3SWFA 3HD7D 1XTCC 2QM7A 1FJKA 3RK3B 3MD0A 3L37A 2R32A 3MIWA 3HE5A 3M9BA 1HWTC 1NTMK 4ZKUA 1JTHA 5APQA 2GUVA 4LGDE 5BU5A 1T3JA 2MJZA 1S9KE 2FXMA 2WITA 3HE4B 1NTZK 2KOGA 3H32A 1L0NK 3M06A 2KB7P 2YO2A 4I1LA 2IX7C 3BRTB 1OWAA 1ZR4A 1ZV8A 2VRSA 2OYIA 3EFGA 1VPCA 1FOSE 5AW8B 2C9NY 2N1TA 1JY3N 2HPCB 1T8ZA 3P7KA 1SQXK 1RY3A 2CPBA 2Q5UA 5APYA 1FU1A 1KZUB 2L5GB 5CCHC 4WBAA 1FZCA 3EQ2A 1HTLC 3MTUE 1DEBA 3VMXA 2OYIC 1N7SA 3CI9A 5AVQB 3TK1A 1W2EA 2PP6A 4B86A 2FYZA 2N1TC 4WB4A 2HLOA 1JY2P 3U59A 1JY3O 1HGZA 1GK6A 4C7RA 1CZQA 3HE5B 5KTBA 2KLVA 3II6A 3T97A 5CJ0A 3B8EB 1FZCC 2IPPA 1WT6A 3HTKB 1N2DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLQ A;  2WSE H;  2O01 H;  3M9Q A;  3LW5 H;  4IFD K;  2WSC H;  1SQQ K;  1L0L K;  3G3Z A;  2WSF H;  1NTM K;  1NTK K;  1NU1 K;  1SQP K;  1SQV K;  1SQX K;  2FYU K;  2LKM A;  5KLV K;  2J59 M;  1NTZ K;  1SQB K;  2OAR A;  1L0N K; 
#chains in the Genus database with same CATH topology
 3CLQ A;  1FBM A;  2GUS A;  3CCV P;  5KJ7 A;  1ZP0 C;  3BAT A;  2H8P D;  4WWI A;  4JPZ B;  1VQK P;  2BAS A;  2KSE A;  3AEC C;  1A02 F;  2Q3I A;  2M0B A;  1SFC D;  3CCJ P;  1HH0 A;  1S2E A;  3HD7 A;  2QEX P;  4JF7 A;  1ZRT E;  1YI2 P;  1CI6 B;  1GW3 A;  4M3L A;  5TIS E;  1EZV D;  2IBZ E;  3L75 J;  1NKN A;  2WVR A;  3L70 D;  3Q2Y A;  2Y9Z A;  1VQ9 P;  1N7L A;  2N9Y B;  3H1K J;  5CHX A;  1AQ5 A;  1LT9 A;  1RE4 A;  2QJP C;  4DZO A;  1DD4 A;  2W6J H;  1OIP A;  3GF3 A;  1NTM G;  1W2B O;  2B87 A;  2LR2 A;  5M1B A;  5KAF E;  1K05 A;  1JCD A;  3VTP C;  1OW6 A;  1P84 E;  2A45 G;  1HJB A;  1BE3 D;  4GOF A;  1L4A D;  2XDJ A;  3PHL A;  2IZ1 A;  1FDM A;  3ZDM A;  2OTL P;  2WSC H;  3CC7 P;  1T3U A;  1QL1 A;  3P8C E;  1GL2 B;  1Y47 A;  1KIL B;  1OVV A;  5APW A;  4C7N A;  1JY2 O;  1NOH A;  1SQV J;  3QWO C;  4GKG A;  1EZV I;  2HOD A;  1HUC A;  3A0H H;  5CCH D;  3VMZ A;  3L70 G;  5GTI H;  3HUS A;  1YBK A;  5AW6 B;  2D2C B;  1M1J B;  3AEA C;  1NTZ D;  2QM8 A;  4Z1M H;  1L0N D;  5B66 H;  1SQB J;  3CCE P;  1NTK E;  3CX5 I;  1NTK G;  3GMA A;  1SFC A;  4ASV A;  2YXQ B;  2BEQ D;  5TJH A;  3V2Q A;  3BCC D;  2OQQ A;  1BE3 G;  1M1K Q;  1IC2 A;  4NPD A;  4JBZ A;  1SQP J;  1ZLL A;  3CWB J;  2K88 A;  1DH3 A;  3RGU A;  3D70 A;  2JDI H;  2XU6 A;  2NRG A;  4WY4 B;  4BWN A;  2P7J A;  3CCU P;  1GW4 A;  1BCC J;  4XA4 A;  1H89 A;  3CX5 H;  2WSC J;  1J1E B;  1ZR2 A;  2H89 C;  4N78 E;  2FBW C;  1JMM A;  2ZT9 D;  2IYP A;  1RF1 B;  1RE3 C;  3L36 A;  1L4A A;  4D6T J;  1YTZ T;  3A5T A;  1RHZ B;  5BVZ A;  3G6E P;  3I55 P;  2J58 A;  2PAJ A;  4NPE A;  1GTW A;  3C1L A;  1FJP A;  4PV1 D;  1LWU A;  2PRR A;  1RF0 C;  1EDL A;  2E76 C;  2WT7 B;  2E74 C;  1N73 A;  3C8V A;  3G3Z A;  1LTA C;  3MZW B;  1KQS O;  3BVH A;  3SFD C;  3B71 A;  3R4Y A;  1EDK A;  2BCC E;  3B5N C;  3A0B E;  2BCC G;  1MV8 A;  2IFM A;  5CCH A;  1FE6 A;  2WSE H;  2IYO A;  4RES B;  2GA1 A;  4U7J A;  3TGU J;  2ZYD A;  1BSN A;  3WUU A;  5AVX B;  3CXH D;  3CME P;  3MUD A;  2E74 B;  3H1J E;  3L71 E;  5C39 A;  5BU8 B;  3ABV C;  4Y28 J;  1NH4 A;  1KQF B;  1SQQ E;  1Y8A A;  2N1T D;  3NXS A;  1OXZ A;  1SQQ G;  1AFO A;  2OGU A;  1IFN A;  4EIJ A;  1L0L D;  4DT0 A;  3RL0 C;  5APV A;  2KYV A;  1OVU A;  2JO1 A;  3AE6 C;  1KQG B;  1M8O B;  1VQM P;  1KC8 Q;  3I5C A;  1AV1 A;  1KYO E;  1NKZ B;  2QA4 P;  2Q3E A;  2ITA A;  3AEG C;  2RH0 A;  3FXE A;  3VYI A;  1IFM A;  4K35 A;  1U57 A;  3H1L E;  2JEE A;  3L73 E;  3H1L G;  3TF5 A;  1HJ0 A;  3H1I G;  1NTZ J;  1G1J A;  3CXH I;  1L0N J;  2WSE J;  3CCL P;  1GDT A;  4KT0 J;  2KXP B;  2FYU E;  5APS A;  1IFJ A;  2E75 C;  3VN0 A;  2ZVO B;  2FYU K;  1IK7 A;  3BCC J;  2LKM A;  3FWN A;  2OAR A;  4YXD C;  3RK3 B;  1IFP A;  1BSH A;  3HE5 A;  3CXH H;  1OW7 A;  2GUV A;  4LGD E;  2FXM A;  2WIT A;  5DJU B;  2KOG A;  4EI2 A;  3H32 A;  3D6Z A;  4U3F D;  3AE4 C;  4I1L A;  2IX7 C;  2WSS H;  1KB9 I;  1PV3 A;  4DJG A;  2N1T A;  1PPJ D;  1RY3 A;  1KZU B;  3SFE C;  4OGQ B;  1DEB A;  5CBN A;  3CI9 A;  1TU3 F;  3TK1 A;  3GF7 A;  2PP6 A;  1NU1 G;  2G3A A;  1KB9 H;  1JY3 O;  2PGD A;  4YPC A;  4C7R A;  5KTB A;  3JCU E;  3FGA D;  3RL0 g;  3T97 A;  1FZC C;  1N2D C;  1X79 B;  5AW2 B;  1EXJ A;  1R5L A;  1YIJ P;  3KZI E;  1KQL A;  4ZKP A;  5B5E E;  3KYQ A;  1DX7 A;  1IZN B;  3UIA A;  2KS1 A;  3E7K A;  1K73 Q;  2R44 A;  5AW0 B;  3L35 A;  5H2F H;  1S4X A;  3TDK A;  4U3F G;  5KLV K;  1UII A;  1VQ8 P;  4C7N B;  4EDF A;  3PTZ A;  2KLU A;  4OWF A;  1IO4 A;  2HPC A;  4H13 B;  3Q5S A;  1L2P A;  1EDI A;  4Y99 B;  1QL2 A;  2HOD B;  1BGY D;  5CCG C;  3M0D A;  3HUS B;  4ZMD A;  1FOS F;  1AA0 A;  2A06 E;  3IR9 A;  2C0X A;  1MFZ A;  3BRV B;  4JYC A;  2KNC A;  4H0L C;  1FDO A;  1KFM A;  1M56 D;  1YQ4 C;  3S9O A;  1NHL A;  3EFF K;  1JY2 N;  1S5L E;  2J59 M;  1J1D B;  4RJT A;  3KHU A;  3L75 E;  3L75 G;  1Q81 Q;  2C9L Y;  1GU4 A;  3H1K E;  1G2C A;  3CL3 D;  1LTI C;  1SQX G;  1ZME C;  1URQ D;  1FZF A;  4R4L A;  4XE5 B;  1OVR A;  1PGP A;  2IBZ D;  3V2N A;  2I8D A;  1PGJ A;  1S3J A;  3RK3 E;  2WQY C;  1MZ9 A;  1L4A B;  1RQU A;  1NTM D;  3CCS P;  1BGY G;  3GW6 A;  2Z4E A;  3RK2 D;  3L72 G;  1AQT A;  3GHG A;  1LTB C;  1ZOY C;  1R5S A;  2N9B A;  1P84 D;  4A7P A;  1WMK A;  1LWU B;  2AXT H;  2ZXE B;  1PP9 E;  1PP9 G;  3V5B A;  2JWD A;  1SQV E;  4I6M C;  2QJY B;  1N73 B;  2FXP A;  1QEX A;  1SQV K;  2ZYG A;  1MKM A;  1FZG A;  1GD2 E;  3P8C D;  5AVY B;  1JY3 P;  5APX A;  3E1R A;  3KXD A;  2DW3 A;  2WPR A;  4GIF A;  2QIW A;  1SQB E;  4UB8 H;  2ZXX A;  2IBZ G;  5EFW B;  1SQB K;  3OA7 A;  3N7N A;  1GL2 C;  2POH A;  5KLI B;  1KIL C;  3CCM P;  1SQP E;  3CWB E;  1W5C E;  1SQP K;  1VL2 A;  2M3B A;  1NTK D;  3AE1 C;  3K5B A;  2MKV A;  2A45 I;  1BCC E;  2IZ0 A;  1P84 I;  1BCC G;  1URQ A;  2OYH A;  3Q5R A;  1LTJ A;  1NVO A;  3H1H J;  1YYC A;  3O6Q A;  4NPF X;  2D2C C;  2R5D A;  1M1J C;  2ZT9 B;  2JWA A;  2NZ2 A;  4D6T E;  2R5B A;  2FFD A;  1N8R Q;  2KK7 A;  2IFN A;  2A45 H;  1P84 H;  1MFT A;  1T6A A;  4N78 D;  2WPQ A;  3OW2 O;  1ZW0 A;  2H7H A;  2P1J A;  1GZL A;  5GTI E;  4I7Z C;  1GU5 A;  2YKO A;  4DCK A;  1FAV A;  4WY4 C;  3AE2 C;  5B66 E;  1JEK A;  1PGO A;  3C9I A;  2NPS C;  3Q3D A;  2B88 A;  1J1E C;  2QRX A;  3BAS A;  3JC2 2;  1E79 H;  2XV5 A;  1AVO A;  1RF1 C;  3TGU E;  3O8Z A;  2WPS A;  1LTG C;  4I7Z B;  2BCC D;  3H32 B;  3CX5 E;  3A7O A;  3W67 A;  4LC1 A;  1HBW A;  2NPS B;  2N1T B;  2R3C A;  1A02 J;  4L74 A;  1JOC A;  1NTM J;  4RKU J;  1T2K C;  4PJ0 E;  3L71 D;  1S1C X;  3G71 P;  1KMI Z;  1SQQ D;  1FZE A;  3HRN A;  2BEZ F;  1DD3 A;  5CJ4 A;  3WU2 H;  3T97 B;  1IFD A;  2XZR A;  3L74 E;  3L74 G;  1YIT P;  2R32 A;  3MIW A;  3RBZ A;  3M9B A;  4ZKU A;  1JTH A;  3PLN A;  2AEM A;  1KYO D;  1VQ4 P;  1GMJ A;  2K1A A;  1S9K E;  1NTZ K;  2WMM A;  1L0N K;  3M06 A;  2V4H A;  3L70 J;  3BRT B;  3H1L D;  3V6I A;  1ZV8 A;  3BCC E;  2OYI A;  3EFG A;  3H1I D;  4TLF A;  1JY3 N;  2YMK A;  2Y9Y A;  2HPC B;  4H44 C;  1BDD A;  5APY A;  1NTK J;  4WBA A;  1HTL C;  3H1J G;  1BE3 J;  2XND H;  4UB6 E;  3L71 G;  1NGM B;  4WB4 A;  1JY2 P;  1USD A;  1HGZ A;  2KI7 B;  3FWL A;  3AEF C;  3II6 A;  1KIL E;  1R8E A;  5CJ0 A;  2E5Y A;  3B8E B;  2LXB A;  1N7S C;  5AW3 B;  2YIU B;  3NTN A;  4H44 B;  2O01 H;  2ZFC A;  4IFD K;  1CSB A;  4PD4 D;  3RBX A;  1KYO I;  2QVA A;  2CPS A;  4K3A A;  3HE4 A;  3CCR P;  3FXD A;  3RK3 C;  3E1I A;  5KJ7 C;  1VF5 C;  3L73 G;  3OJA B;  1OX3 A;  2QSI A;  3D6Y A;  1X22 A;  1N7S B;  2WPV B;  4ZNC A;  1NU1 D;  2FYU G;  3WUV A;  2CK3 H;  3VMY A;  3GHG B;  1VQO P;  3IFM A;  2Q6Q A;  3CXH E;  3HD7 C;  5GTH H;  2W27 A;  3CD6 P;  1VF5 B;  3R2P A;  5AW9 B;  3S1K A;  4OGQ C;  5CBO A;  2KSJ A;  3HTK A;  1EC5 A;  1LT9 C;  3OAK A;  2Q9I A;  1RE4 C;  1FZA A;  2E76 D;  2E74 D;  4PD4 I;  1L0L K;  2WZ7 A;  2O01 J;  3ITK A;  1E5W A;  3HD7 B;  1SQQ J;  3B5N D;  3LID A;  2Q7C A;  1YTZ I;  1M7L A;  2YXR B;  3VP9 A;  1NAF A;  2Y0D A;  1KB9 E;  3TNU A;  1QVG O;  1LT9 B;  2QJK B;  4PD4 H;  2J5U A;  3SWY A;  4LLH A;  2HYN A;  2A06 D;  2OTJ P;  2PFX A;  2B87 B;  1VQP P;  1OMI A;  1H8A A;  2K3R A;  3CC4 P;  4H13 C;  2YMY A;  1JO5 A;  1LTJ B;  4Y99 C;  2E5T A;  3N4X A;  3L75 D;  1HVV A;  5H2F E;  3RL0 D;  3HUS C;  3O6Q B;  3H1I J;  2I1K A;  5KLV E;  2FYN B;  1U7J A;  5KLV G;  1SQX D;  1Z56 A;  3JCU H;  2Z5I A;  2FFD B;  5AVU B;  2AXC A;  1SFC C;  3RK2 B;  3PP5 A;  1RE3 A;  1J1D C;  2KZI A;  5AVS B;  1LJ2 A;  1L0L J;  1HGV A;  2P2U A;  4KHX A;  3L72 D;  3V4Q A;  1RF0 A;  1U7M A;  4AQR D;  3CCQ P;  2YO3 A;  1PIX A;  2M5A A;  1PGQ A;  1H88 A;  2A06 G;  3JSV C;  1LP1 A;  2E75 D;  1PP9 D;  4QMA A;  2WSF J;  3W68 A;  1S72 P;  1SFC B;  1SQV D;  1JB0 J;  5E79 H;  4IL6 E;  4HYT B;  3V2P A;  1LNQ A;  3B5N A;  2RMZ A;  3MHV A;  1L4A C;  2KP8 A;  4GT1 A;  5AVV B;  3U1A A;  1K04 A;  4L76 A;  1H0T A;  2YNY A;  3H1K G;  2M3E A;  1FDI A;  1VQ5 P;  4EOT A;  1ZRT D;  1LWU C;  2YKP A;  1NU1 J;  4W7Z A;  1RQV A;  1SQB D;  2QJY C;  1N73 C;  2FXO A;  1ZXG A;  2B9B A;  5AW4 B;  5KAI H;  1KOR A;  3M91 A;  1SQP D;  1VDF A;  2P67 A;  3CWB D;  2JP3 A;  3H1H E;  4BRY A;  3AE8 C;  3A2A A;  2AXT E;  3M9Q A;  1BCC D;  1EDJ A;  2O3J A;  1J2J B;  1VQ6 P;  3VP8 A;  1OZH A;  1LTT C;  4U3F J;  2HFE D;  2AEJ A;  1M57 D;  1JNM A;  3MUD C;  1SQV G;  4OVN F;  3S4R A;  1JTH B;  5KLI C;  2H88 C;  1JUN A;  3WMM 0;  4D6T D;  4C46 A;  3V4W A;  3Q1M A;  5AVT B;  2OYI B;  4UB8 E;  3SWK A;  1KV4 A;  2IBZ I;  1LT1 A;  1SQB G;  3AE5 C;  3M9H A;  3AE7 C;  2ZT9 C;  5CMZ A;  2K9J A;  2E42 A;  1CW5 A;  4HB1 A;  1SQP G;  1KN7 A;  3CWB G;  1PFI A;  5CCG D;  1X9V A;  5TIS H;  1G1I A;  3F5H A;  1NWQ A;  3D71 A;  1SQX J;  1XTC C;  3TGU D;  1YJN P;  2QM7 A;  4PV1 C;  1FJK A;  3AEE C;  3EWK A;  3MD0 A;  1NTM E;  1EXI A;  4H0L D;  1NTM K;  2ZAE B;  3CX5 D;  4WVZ A;  1T3J A;  2MJZ A;  1Q7Y Q;  1D7M A;  5KAF H;  3HE4 B;  4D6T G;  1YJW P;  1NJI Q;  1BGY J;  1NAY A;  3L72 J;  1Q90 D;  1VPC A;  1RH5 B;  5AW8 B;  2ZYA A;  2QJP B;  3A0H E;  2C9N Y;  2FY8 A;  4PV1 B;  3P7K A;  4HJG H;  2Q5U A;  4JQ0 D;  1PP9 J;  1YQ3 C;  1FU1 A;  1FZC A;  3EQ2 A;  1QLE D;  3MTU E;  1UIX A;  4YXW H;  2G8Y A;  4BXL A;  4B86 A;  1EZV E;  2FYZ A;  2N1T C;  1EZV G;  3L74 D;  3L70 E;  1GK6 A;  1CZQ A;  3HE5 B;  2KLV A;  2IPP A;  3HTK B;  3TGU G;  3B4S A;  5DJT B;  2Y0C A;  4DOJ A;  1S9K D;  1AJY A;  5L8R J;  1DEE G;  1FS0 E;  3A3Y B;  4AUW A;  1NTK K;  1XTG B;  2QE7 H;  3M0A A;  1BE3 E;  1QX8 A;  2Q1K A;  2L91 A;  4ASW A;  1IK9 A;  3SSU A;  3U1C A;  2K37 A;  5AW5 B;  5CCG A;  1YHQ P;  3FX0 A;  2XKM A;  4L75 A;  2QG4 A;  3H1J D;  2HG5 D;  1AVY A;  5APU A;  4XFJ A;  3TNU B;  3PRJ A;  3WU2 E;  1JCC A;  3V2R A;  2JKV A;  4OH8 B;  1GL2 D;  2AEF A;  1KIL D;  1NYH A;  2Z5H A;  3G4S P;  3USS A;  4EYY Q;  4PJ0 H;  3G9R A;  2FKW B;  1JM0 A;  2P58 A;  1NTZ E;  3M0D C;  2KS1 B;  1L0N E;  1NTZ G;  1L0N G;  2SPZ A;  2I1J A;  1IJD B;  3L73 D;  1USE A;  2D2C D;  3BCC G;  1SP4 A;  3NFQ A;  3H6P A;  2YIU C;  1K9M Q;  1K8A Q;  3P8M C;  3TYY A;  2JR8 A;  2C0W A;  2V7Q H;  2FYU D;  3MP7 B;  2HR3 A;  5AVW B;  1KTM A;  3P32 A;  3A0B H;  1CI6 A;  3CC2 P;  2GM4 A;  1LGH B;  3CMA P;  2JJL A;  2M5A B;  5AW7 B;  2E76 B;  1X8Y A;  1LP1 B;  4WY4 D;  2XNX A;  2KNC B;  3KDP B;  2NPS D;  1N86 A;  2M8R A;  3B5N B;  1FZB A;  1SQQ K;  4UB6 H;  3AEB C;  3AED C;  3L4F A;  2YKQ A;  4O9B A;  1BDC A;  1H0T B;  3GHG C;  1G2C B;  2KIK A;  3PH0 A;  1KFN A;  1QGK B;  1GK4 A;  3AE3 C;  1GL2 A;  4IOI H;  1KIL A;  2K9Y A;  1QVF O;  1KB9 D;  4JYB A;  3F89 A;  4KJM A;  3WUT A;  1KYO H;  1PL5 A;  2LXC B;  3L74 J;  1IFI A;  2KZJ A;  3VMA A;  1T2K D;  4BRY B;  5GTH E;  3RL0 B;  3H1I E;  2O01 N;  1LTS C;  2V7Q J;  1Q82 Q;  1Q2N A;  1SS1 A;  1X0T A;  1MUU A;  2BCC J;  3VOP A;  3LIE A;  4HH2 A;  1M1J A;  2B89 A;  5AVZ B;  4W7Y A;  1WRG A;  2QJK C;  5KLV D;  4YTP C;  1L0L E;  1L0L G;  1ZN5 A;  2O1K A;  3IF4 A;  2OTK E;  3H1J J;  2R3S A;  3L71 J;  2WTY A;  4IL6 X;  4GOD A;  1URQ C;  1SVF A;  1S5L X;  2OYH C;  1LTJ C;  1EQ7 A;  4GOE A;  2E75 B;  4PD4 E;  4WY4 A;  2W6B A;  4RO0 A;  3LW5 H;  4HKZ H;  2NPS A;  2WSF H;  2FYN C;  4W80 A;  4H44 D;  2K9J B;  1DIP A;  2H43 A;  2FFD C;  1M90 Q;  1OFC X;  2KUB A;  1RF1 A;  3TSI A;  1JMB A;  3RK2 C;  2WWW A;  4AYC A;  2P10 A;  4TT3 H;  1NU1 E;  1URQ B;  2OYH B;  5K5G B;  3GG2 A;  1Y9B A;  3H1L J;  4I2L C;  3L73 J;  1NU1 K;  1VQ7 P;  4IFF A;  4IFM A;  3H1K D;  3IN6 A;  1N7S D;  2OYO A;  1VQL P;  4N3Y B;  1NO4 A;  3KQG A;  2WT7 A;  2FYU J;  4L73 A;  3KPE A;  2UWJ E;  2ZVN B;  3KZI H;  5B5E H;  3RK3 D;  4U3F E;  3NMD A;  5KJ7 D;  3Q5P A;  1VF5 D;  4MN4 C;  3MGN A;  4N6J A;  2O1J A;  3H1H D;  5AW1 B;  1FZC B;  2E43 A;  2W6A A;  5APT A;  1PPJ E;  3LW5 J;  1PPJ G;  1SLQ A;  5E79 E;  4R4M A;  5AVR B;  1PZQ A;  3GLM A;  3SWF A;  3HD7 D;  5KKZ C;  1HF9 A;  3IAO A;  3L37 A;  4OGQ D;  1HWT C;  5APQ A;  1YJ9 P;  2ZJS E;  5BU5 A;  3CPW O;  2IDB A;  4IL6 H;  2KB7 P;  2RKL A;  2YO2 A;  3H25 A;  2W8Z A;  1S5L H;  2RN0 A;  1OWA A;  5KAI E;  1ZR4 A;  2VRS A;  1FOS E;  1VQN P;  5KKZ B;  1SQX E;  3PJS K;  1T8Z A;  1SQX K;  4GDO A;  2CPB A;  3QH9 A;  2L5G B;  1KD1 Q;  1Q86 Q;  3H1H G;  5CCH C;  4H0L B;  1FC2 C;  3VMX A;  2OYI C;  2W90 A;  1N7S A;  5AVQ B;  5KLV J;  1W2E A;  2HLO A;  3I56 P;  3AE9 C;  3U59 A;  1BGY E;  3L72 E;  4CPG A;  1WT6 A;  1OW8 A;  2Y0E A;  4H13 D;  2W83 C; 
#chains in the Genus database with same CATH homology
 1N7S C;  3CLQ A;  5AW3 B;  4DOJ A;  3NTN A;  1S9K D;  1FBM A;  1X79 B;  2O01 H;  5AW2 B;  2GUS A;  2ZFC A;  5KJ7 A;  3BAT A;  4IFD K;  2H8P D;  1KQL A;  4ZKP A;  1CSB A;  3A3Y B;  4AUW A;  3KYQ A;  1DX7 A;  1NTK K;  1XTG B;  2CPS A;  3UIA A;  3M0A A;  5AW0 B;  3L35 A;  3HE4 A;  3RK3 C;  1IK9 A;  3E1I A;  5KLV K;  2BAS A;  4C7N B;  3U1C A;  1A02 F;  5KJ7 C;  2Q3I A;  5AW5 B;  5CCG A;  3OJA B;  1SFC D;  2XKM A;  1HH0 A;  2HG5 D;  5APU A;  3HD7 A;  1IO4 A;  2HPC A;  1N7S B;  4JF7 A;  3TNU B;  1CI6 B;  1JCC A;  1GW3 A;  4M3L A;  4Y99 B;  1QL2 A;  1NKN A;  3V2R A;  2HOD B;  4OH8 B;  5CCG C;  1N7L A;  1GL2 D;  3M0D A;  3HUS B;  5CHX A;  1AQ5 A;  1KIL D;  1LT9 A;  3VMY A;  1RE4 A;  3GHG B;  4DZO A;  3IFM A;  1FOS F;  3HD7 C;  2Z5H A;  3IR9 A;  2W27 A;  2C0X A;  3R2P A;  1MFZ A;  5AW9 B;  2FKW B;  3BRV B;  4JYC A;  1KFM A;  2KSJ A;  1JCD A;  3VTP C;  1NHL A;  3HTK A;  3M0D C;  2A45 G;  1HJB A;  1LT9 C;  3OAK A;  1JY2 N;  2J59 M;  2Q9I A;  1J1D B;  1RE4 C;  1L4A D;  1FZA A;  2XDJ A;  1FDM A;  2I1J A;  1IJD B;  2WSC H;  1L0L K;  2C9L Y;  1GU4 A;  2WZ7 A;  1T3U A;  1QL1 A;  1SP4 A;  3NFQ A;  3P8C E;  1GL2 B;  3H6P A;  1G2C A;  1KIL B;  3CL3 D;  1LTI C;  1E5W A;  3HD7 B;  5APW A;  3P8M C;  3B5N D;  3TYY A;  1URQ D;  3LID A;  4C7N A;  1FZF A;  2Q7C A;  1JY2 O;  4XE5 B;  2C0W A;  1YTZ I;  1NOH A;  5AVW B;  3V2N A;  1M7L A;  3VP9 A;  1NAF A;  3P32 A;  3TNU A;  1CI6 A;  1LT9 B;  2GM4 A;  1LGH B;  4GKG A;  3SWY A;  1MZ9 A;  4LLH A;  2HYN A;  1L4A B;  2JJL A;  2HOD A;  5AW7 B;  1HUC A;  1X8Y A;  5CCH D;  3VMZ A;  3HUS A;  4WY4 D;  2Z4E A;  3RK2 D;  2XNX A;  1H8A A;  5AW6 B;  3GHG A;  1LTB C;  1M1J B;  3KDP B;  2NPS D;  2N9B A;  2QM8 A;  2YMY A;  1JO5 A;  1LWU B;  1N86 A;  2M8R A;  2ZXE B;  3B5N B;  1FZB A;  1SQQ K;  1LTJ B;  4Y99 C;  3N4X A;  3L4F A;  1HVV A;  3V5B A;  2YKQ A;  1SFC A;  4I6M C;  3RL0 D;  3V2Q A;  4O9B A;  1N73 B;  3HUS C;  1SQV K;  1FZG A;  2I1K A;  1GD2 E;  1IC2 A;  3GHG C;  3P8C D;  1G2C B;  5AVY B;  1Z56 A;  2Z5I A;  1ZLL A;  2FFD B;  1DH3 A;  1KFN A;  1GK4 A;  1JY3 P;  5APX A;  5AVU B;  2XU6 A;  1GL2 A;  1SFC C;  4WY4 B;  2WPR A;  3RK2 B;  1KIL A;  2P7J A;  4GIF A;  3PP5 A;  1GW4 A;  1RE3 A;  4XA4 A;  1H89 A;  4JYB A;  1J1D C;  1J1E B;  1ZR2 A;  1IFI A;  5AVS B;  4N78 E;  1HGV A;  1SQB K;  1JMM A;  2P2U A;  1T2K D;  3OA7 A;  4KHX A;  3RL0 B;  3N7N A;  1RF1 B;  1GL2 C;  2POH A;  3V4Q A;  1LTS C;  1KIL C;  1RE3 C;  1RF0 A;  3L36 A;  1L4A A;  4AQR D;  1MUU A;  2YO3 A;  1YTZ T;  3A5T A;  3VOP A;  1H88 A;  5BVZ A;  3LIE A;  1SQP K;  2J58 A;  2PAJ A;  2M3B A;  1GTW A;  1SFC B;  4HH2 A;  1M1J A;  1FJP A;  2A45 I;  5AVZ B;  4HYT B;  3V2P A;  4W7Y A;  1WRG A;  1LWU A;  3B5N A;  1URQ A;  2OYH A;  1LTJ A;  1RF0 C;  1L4A C;  2KP8 A;  4GT1 A;  5AVV B;  3U1A A;  2WT7 B;  1ZN5 A;  2O1K A;  3G3Z A;  1YYC A;  1LTA C;  1N73 A;  2YNY A;  3BVH A;  2R5D A;  2WTY A;  1M1J C;  4EOT A;  2R5B A;  2FFD A;  1LWU C;  2IFN A;  2YKP A;  3B5N C;  1URQ C;  1SVF A;  2A45 H;  2OYH C;  1LTJ C;  1EQ7 A;  1MV8 A;  2IFM A;  4W7Z A;  5CCH A;  2WSE H;  4N78 D;  4WY4 A;  2W6B A;  3LW5 H;  4RES B;  2WPQ A;  1N73 C;  2H7H A;  2NPS A;  2P1J A;  2WSF H;  4W80 A;  5AW4 B;  1GZL A;  5AVX B;  2H43 A;  3M91 A;  2FFD C;  1VDF A;  2P67 A;  3MUD A;  1GU5 A;  2YKO A;  1FAV A;  1RF1 A;  3TSI A;  3A2A A;  4WY4 C;  3RK2 C;  5BU8 B;  2WWW A;  3M9Q A;  4AYC A;  1NH4 A;  3C9I A;  2NPS C;  1J2J B;  2N1T D;  3VP8 A;  3NXS A;  1LTT C;  1OXZ A;  1J1E C;  1AFO A;  2HFE D;  1URQ B;  2OYH B;  1IFN A;  4I2L C;  3BAS A;  1NU1 K;  4EIJ A;  1JNM A;  2XV5 A;  4IFF A;  1JTH B;  3RL0 C;  4IFM A;  1RF1 C;  1N7S D;  5APV A;  3O8Z A;  2KYV A;  4N3Y B;  1JUN A;  2WPS A;  1NO4 A;  3WMM 0;  1LTG C;  3KQG A;  4C46 A;  2WT7 A;  3H32 B;  3V4W A;  3I5C A;  3KPE A;  3A7O A;  5AVT B;  1NKZ B;  4LC1 A;  2OYI B;  1HBW A;  2NPS B;  3RK3 D;  3VYI A;  1IFM A;  2N1T B;  2R3C A;  1A02 J;  3NMD A;  5KJ7 D;  1JOC A;  2JEE A;  3MGN A;  3M9H A;  4N6J A;  2O1J A;  5AW1 B;  1T2K C;  1FZC B;  2E43 A;  2W6A A;  5CMZ A;  1G1J A;  2E42 A;  5APT A;  1CW5 A;  1GDT A;  1FZE A;  1SLQ A;  3HRN A;  5APS A;  1PFI A;  1IFJ A;  5CCG D;  3VN0 A;  5CJ4 A;  2FYU K;  1X9V A;  2LKM A;  1G1I A;  5AVR B;  1NWQ A;  2OAR A;  1IFD A;  2XZR A;  3SWF A;  3HD7 D;  1XTC C;  2QM7 A;  1FJK A;  3RK3 B;  3MD0 A;  3L37 A;  2R32 A;  3MIW A;  3HE5 A;  3M9B A;  1HWT C;  1NTM K;  4ZKU A;  1JTH A;  5APQ A;  2GUV A;  4LGD E;  5BU5 A;  1T3J A;  2MJZ A;  1S9K E;  2FXM A;  2WIT A;  3HE4 B;  1NTZ K;  2KOG A;  3H32 A;  1L0N K;  3M06 A;  2KB7 P;  2YO2 A;  4I1L A;  2IX7 C;  3BRT B;  1OWA A;  1ZR4 A;  1ZV8 A;  2VRS A;  2OYI A;  3EFG A;  1VPC A;  1FOS E;  5AW8 B;  2C9N Y;  2N1T A;  1JY3 N;  2HPC B;  1T8Z A;  3P7K A;  1SQX K;  1RY3 A;  2CPB A;  2Q5U A;  5APY A;  1FU1 A;  1KZU B;  2L5G B;  5CCH C;  4WBA A;  1FZC A;  3EQ2 A;  1HTL C;  3MTU E;  1DEB A;  3VMX A;  2OYI C;  1N7S A;  3CI9 A;  5AVQ B;  3TK1 A;  1W2E A;  2PP6 A;  4B86 A;  2FYZ A;  2N1T C;  4WB4 A;  2HLO A;  1JY2 P;  3U59 A;  1JY3 O;  1HGZ A;  1GK6 A;  4C7R A;  1CZQ A;  3HE5 B;  5KTB A;  2KLV A;  3II6 A;  3T97 A;  5CJ0 A;  3B8E B;  1FZC C;  2IPP A;  1WT6 A;  3HTK B;  1N2D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...