1NTMK

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
51
structure length
51
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 15
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ntmK00
1SQPK 2WSEH 3M9QA 1L0NK 2WSFH 1NTKK 1SQQK 2O01H 1SQBK 3LW5H 4IFDK 1NU1K 1NTMK 1L0LK 5KLVK 2OARA 1SQVK 2J59M 3G3ZA 1SQXK 1NTZK 2LKMA 2FYUK 2WSCH 3CLQA
chains in the Genus database with same CATH superfamily
1GW4A 3CPWO 3Q3DA 1L4AA 3O6QA 1NU1E 3L71D 1BGYJ 2NPSD 1SS1A 1FDMA 5GTIE 1OVUA 3Q2YA 1LGHB 1AVOA 2BASA 1URQC 1L0ND 1BGYG 1SQQD 2NPSC 2LXBA 2HODB 3AEGC 4PD4H 1SQPJ 3AEFC 1SQQE 1AQ5A 4JF7A 2DW3A 5CJ4A 4H0LC 2B88A 2CK3H 3AE6C 2PRRA 1SQPG 5KLVJ 4ZMDA 1KYOH 2WSCJ 4ZKUA 2AEFA 1Q86Q 4KHXA 1S1CX 1HTLC 2OTKE 3TYYA 1JY2P 5KLVG 1BDDA 1KB9D 2J59M 1NTZD 4ZKPA 2ZYGA 1KB9E 1NTZE 1RE3C 3CL3D 2OQQA 1S3JA 1HF9A 3L73J 3AE9C 4GDOA 1BE3D 2NZ2A 4L75A 1SP4A 1EDKA 5AW8B 1BE3E 1KMIZ 5AW5B 3L75J 3KPEA 1T3UA 3PLNA 1IO4A 3L73G 5KKZB 4W7ZA 1YI2P 2E76B 1Y47A 1GDTA 3L75G 3S4RA 1S72P 2IFNA 2WPSA 5M1BA 5B66H 1QL1A 1LTJA 1FZEA 1OMIA 5APSA 2KS1B 1A02J 3H1LD 2HLOA 1PGJA 3H1LE 1S5LE 2P2UA 4DZOA 2C0WA 3CXHI 1K9MQ 4NPFX 5KKZC 1IK7A 2Y9YA 5BU8B 1QLED 3SFDC 3VMXA 2QJYC 1HVVA 3CC4P 1UIXA 3L35A 1NVOA 3L70D 3L70E 1FOSF 2FYNB 2M3BA 1N8RQ 5AW0B 2KOGA 3A0HE 2WSSH 2V7QH 5AVTB 1M1JA 3JCUE 1PFIA 2YKOA 3FX0A 1MZ9A 1JY2N 4PD4I 1RE4A 2IFMA 2FXMA 4TLFA 2WMMA 1W2EA 1Q81Q 2FYNC 2Z5IA 2A06G 1KYOI 3HE5A 3CMEP 3R4YA 4WWIA 2NRGA 3VMAA 3U1AA 1SQBG 4JQ0D 4N78E 4LLHA 2ZXXA 1KQSO 1KILA 2BEZF 1Q7YQ 3TSIA 1H0TB 1X9VA 5CHXA 1SQPD 3I56P 2H7HA 1SQPE 5KJ7A 1NYHA 4O9BA 5CCHA 1HJBA 4PJ0E 3BCCD 2HFED 1FU1A 2QJPB 4WB4A 2ZT9D 3BCCE 1NKNA 1LTAC 1GU5A 4YTPC 2P1JA 3AEEC 5AW7B 1N7LA 3ZDMA 1QVFO 2KI7B 5BVZA 1ZRTD 4K35A 1LT1A 2QEXP 5KAIH 4PV1D 1N73B 1BSHA 4EIJA 5GTIH 2KXPB 2OYHA 3WU2E 5TISE 3L75D 2WSFH 2FYUJ 3L75E 2K3RA 4N6JA 1NU1K 4ASVA 1WRGA 3RK2D 3SWYA 3HD7D 4I1LA 1VQNP 3H1HJ 1YIJP 1H88A 2IZ0A 1JTHB 2OARA 1H8AA 2FYUG 1OWAA 4JBZA 1YTZT 1FZAA 1HH0A 3O8ZA 3H1HG 1SQQK 1URQA 4IFFA 5CJ0A 2B87A 3IAOA 1N73C 2OYIB 5AVRB 2E74D 1YQ4C 2Y0EA 3M9HA 2D2CD 3RL0B 3KQGA 1Q2NA 3H1JJ 4H44D 5APXA 2WSEJ 1KB9H 3I55P 1SQXJ 3MGNA 1PP9J 2E74C 1X22A 2A45G 1KD1Q 2D2CC 3CX5E 3H1JG 1EZVG 2KLUA 2JO1A 1SQXG 2GUSA 4IL6X 1PP9G 1NTZK 1ZV8A 4GIFA 2K1AA 1K05A 2WPRA 2Q7CA 1MV8A 4JYBA 4C7RA 3JC22 2HODA 1PPJG 2W90A 2N1TB 3TK1A 2OYIC 1ZR4A 4JPZB 1EDIA 5AW3B 3VP8A 1U57A 2IDBA 1OZHA 3BATA 2OTLP 3RK3D 1HJ0A 3RK3E 2E43A 4R4MA 4WY4D 1QVGO 3S1KA 2KZIA 2C9LY 1S5LH 2QJKC 1VL2A 3AE5C 1M1KQ 1N7SD 2A06D 4OGQB 2A06E 5B5EE 3BRVB 4LC1A 3GMAA 4WBAA 1VQKP 2P10A 4N3YB 4RJTA 3WMM0 1GL2D 1JMBA 3EFFK 1MUUA 3H6PA 2Q3IA 2KB7P 3EQ2A 2WPQA 3USSA 1SQVJ 2R5DA 5E79E 1GL2C 2GUVA 3OAKA 2Y9ZA 1HGZA 3EFGA 1SQVG 2YO3A 3C1LA 3P32A 2JWDA 3A0HH 3FGAD 2KS1A 4OGQC 1KILE 2B89A 3JCUH 1SFCD 2C9NY 2XNXA 1KQLA 4IFMA 1YJWP 1T2KC 2ITAA 2YIUC 1LT9C 1JY2O 3N4XA 1N2DC 1NAFA 4RESB 1DD4A 3M91A 3M0DC 3V6IA 4AUWA 2JP3A 2CPSA 1SVFA 2B9BA 1DD3A 2NPSB 4UB8E 3L72D 1FC2C 1USEA 1KB9I 2FYUE 2PGDA 1L2PA 3V2QA 3W68A 1OW8A 1R5LA 2N9YB 1FDOA 3H1HD 2WVRA 1NU1D 1ZOYC 3H1HE 2H43A 4NPEA 4D6TD 3OJAB 4D6TE 2JWAA 4U3FD 1IK9A 3B5ND 4U3FE 2WSCH 1SQPK 2JJLA 5AW9B 2MJZA 4HJGH 1FS0E 2YKQA 1JEKA 3B5NC 1DEEG 3CMAP 4CPGA 3H1JE 1EZVE 3D6ZA 1PP9E 5CBOA 3AE4C 3TGUD 3B71A 3TGUE 1S4XA 1QEXA 3WU2H 5TISH 1PPJE 1NTKJ 1GZLA 5KLIC 1H0TA 2FY8A 4I6MC 2O1KA 1NTKG 2W8ZA 2E5TA 1KN7A 4C46A 3AEAC 1PV3A 3P7KA 5H2FH 5APQA 1PGQA 1NTMJ 1BDCA 4DJGA 2PFXA 1OFCX 1OX3A 2JEEA 3MIWA 1NTMG 4C7NB 1LTGC 5CBNA 4QMAA 3KZIH 2QJYB 4BRYB 3FWLA 1X79B 3L36A 1N73A 5CMZA 1KQFB 1DX7A 1EDJA 4YXDC 3A0BE 1RQVA 1XTGB 3H1KJ 2HG5D 3HTKB 3NFQA 5KAFH 2KK7A 1WT6A 4IL6E 1JTHA 5TJHA 3H1KG 2JR8A 2GM4A 1VQMP 2RN0A 2HYNA 2ZJSE 1NKZB 1FZCB 2E75D 2OYIA 4DT0A 3CCUP 4H13D 1D7MA 2RKLA 1BSNA 3C8VA 3BRTB 2KSJA 5AVYB 2KLVA 1OW7A 1AJYA 4JYCA 3FWNA 5B5EH 1YQ3C 2R32A 2SPZA 3VYIA 1JMMA 3GF7A 3ITKA 2W6BA 1L0LJ 3P8CD 2O1JA 3P8CE 2JKVA 1FZCC 2W83C 1BCCJ 2N1TA 5E79H 1L0LG 3EWKA 2R5BA 1K8AQ 3VTPC 4L76A 1SQBJ 1BCCG 3M0AA 3M9BA 1KFMA 2P58A 1M57D 3V2NA 1GK6A 1LTBC 5CCGD 1NGMB 2IBZG 4N78D 2O01H 1VQ6P 1BGYD 2ZT9B 1RF0C 1BGYE 2QVAA 3FXEA 1YHQP 2M0BA 2I8DA 1L4AD 2UWJE 5AW1B 2V7QJ 1JO5A 4RKUJ 1LTTC 3MUDA 2HPCB 3NXSA 3CCQP 5DJTB 2ZYDA 4I2LC 3VP9A 4GOEA 3H1IJ 5DJUB 3LW5H 1RH5B 2W6JH 4PV1B 1JCDA 5KLVD 4UB8H 3LIDA 5KLVE 1JM0A 1GU4A 3E1RA 1R5SA 2XNDH 3H1IG 3UIAA 3AE1C 1AFOA 5AVZB 3GLMA 3WUTA 3G9RA 2AEMA 1IFIA 3V2RA 2ZT9C 1EC5A 1NTKE 3RK2B 3MHVA 5APTA 3HD7B 3RBXA 1GD2E 1LWUB 1HWTC 5APYA 2FYUK 3L73D 2QSIA 2WPVB 3L73E 4PD4E 3CCJP 5AW2B 1MKMA 2W6AA 4PV1C 3AECC 1FJKA 2E74B 3CCEP 1NTME 3P8MC 4KT0J 2D2CB 3CI9A 2FXPA 1KYOE 2PP6A 3GF3A 3MZWB 2WZ7A 4H44B 3TDKA 2O3JA 1FZBA 1NO4A 2P7JA 3RK2C 2WWWA 1LNQA 3HD7C 1NOHA 2XDJA 3PRJA 1LWUC 2NPSA 3B5NA 2IZ1A 3IF4A 2ZXEB 2WTYA 1CI6B 4HYTB 3H1KD 1RQUA 2LKMA 3K5BA 3H1KE 3L71J 1IFNA 4HKZH 4WVZA 4IOIH 3AEDC 4GT1A 1JUNA 3F89A 1IC2A 3CX5D 1LTSC 1L0NJ 3L71G 5AVUB 3RL0g 3CCMP 3ABVC 4H44C 2QJKB 3RK3B 3V4QA 3KDPB 2QRXA 3LIEA 4WY4B 2ZYAA 5K5GB 1L0NG 1SQQG 1RE3A 5B66E 1PZQA 4UB6E 2J5UA 3QH9A 1N7SB 3TF5A 1P84D 4OH8B 2MKVA 1P84E 1ZP0C 1VQPP 3V5BA 2R44A 5BU5A 1K04A 1E79H 1XTCC 3MD0A 2WT7B 3N7NA 1L0LD 4AYCA 1GL2B 2QG4A 3HE4B 1L0LE 1E5WA 3RK3C 2M5AB 1A02F 1T6AA 1FAVA 1NTZG 3L4FA 4WY4C 4Z1MH 1KC8Q 3G3ZA 1BCCE 2KIKA 2N9BA 1KQGB 1WMKA 2YNYA 2IBZD 5GTHE 1SQBD 3U59A 1NHLA 2IBZE 2XU6A 1SQBE 1G2CB 2OYOA 1GTWA 3L74J 2Z4EA 1N7SC 1JB0J 5KTBA 1M56D 3T97B 3D71A 2YIUB 1LT9B 3KHUA 1ZXGA 3BVHA 1VF5D 3D70A 1SFCB 3GHGB 2KNCB 1NH4A 1KFNA 3L74G 3V4WA 2M8RA 4C7NA 4XA4A 5EFWB 1J1DB 4BRYA 3WUUA 1NWQA 1KILD 4TT3H 2E5YA 3RBZA 3WUVA 1QL2A 3H1IE 3HTKA 5KJ7D 3PHLA 5CCHD 4Y28J 1SFCC 2BEQD 3GHGC 1EZVI 3H32B 1FZCA 1J1DC 1YITP 4YXWH 3A5TA 2POHA 1VQ7P 4OVNF 3B5NB 5APUA 2QE7H 3IR9A 4XFJA 2FYUD 1ZN5A 2FXOA 1HBWA 3HRNA 5APWA 3KYQA 1RF0A 4PJ0H 2AXTE 3NMDA 1IFPA 1JY3P 3GW6A 3G4SP 5KLIB 1VDFA 4XE5B 1KORA 4HB1A 2O01N 5KAIE 1GK4A 2ZFCA 1URQD 2R3CA 3H1JD 5KLVK 1EZVD 3L71E 1EXJA 2K88A 4Y99B 3Q1MA 3Q5PA 4EI2A 1J1EB 1SQXD 3HUSB 1YTZI 1PP9D 4H0LD 1SQXE 1S2EA 2L5GB 2RH0A 4R4LA 3IFMA 1NTKK 1L0NE 1PPJD 1KTMA 1M90Q 3E1IA 2K37A 2KYVA 4NPDA 3BCCJ 2HPCA 3RGUA 5AVWB 5APVA 1HUCA 2BCCJ 2J58A 1VQOP 4W80A 2FFDB 1UIIA 3BCCG 4LGDE 1ZMEC 1NTMK 1W2BO 1TU3F 2G8YA 4Y99C 3PP5A 1NAYA 5AVSB 1J1EC 1LTIC 2BCCG 3HUSC 1YJNP 5L8RJ 1EQ7A 5AW6B 3G6EP 1RY3A 3C9IA 3W67A 1AVYA 1YJ9P 4DOJA 3HD7A 3V2PA 3VN0A 2K9JB 1LWUA 4HH2A 3CX5H 4KJMA 1FOSE 1OIPA 2Y0DA 3CLQA 1PIXA 2FFDC 3L74D 2GA1A 4M3LA 3Q5RA 3L74E 2E75B 1CZQA 3KXDA 4UB6H 4H13B 1SQVD 1S9KD 1FJPA 2KP8A 2OGUA 1SQVE 2QIWA 1NJIQ 1S9KE 2ZAEB 3CCLP 1P84H 3JSVC 2E76D 1HGVA 4I7ZB 2YMYA 3PTZA 1CI6A 1MFTA 1JY3N 1DH3A 3L37A 1JNMA 2E76C 3OW2O 2YMKA 1W5CE 2E75C 2Q1KA 1OVVA 1N86A 3CCSP 1RF1B 2Q6QA 1J2JB 5GTHH 1L0LK 4H13C 1LP1B 1IZNB 1OXZA 3B4SA 2E42A 4GOFA 4WY4A 4DCKA 3VMYA 1ZR2A 4I7ZC 3AE7C 3VMZA 1SQBK 2Z5HA 1L4AB 1EDLA 3O6QB 1CSBA 3CD6P 2RMZA 2R3SA 1N7SA 3QWOC 3AEBC 4BXLA 1JOCA 3A7OA 1KZUB 2KUBA 1RF1C 3CXHD 4OWFA 4K3AA 3CXHE 2WT7A 3R2PA 2I1KA 2WQYC 1EXIA 1GL2A 3HE4A 3MTUE 1MFZA 3VOPA 2M5AA 2Q5UA 2M3EA 1M7LA 5CCGC 1K73Q 1OVRA 5AW4B 4EDFA 1IFMA 3CWBJ 2W27A 1L4AC 2PAJA 1G2CA 2QA4P 3T97A 4A7PA 1LT9A 3CWBG 4W7YA 1SFCA 4YPCA 3GHGA 2KNCA 1T3JA 3M0DA 4MN4C 3II6A 5AVQB 2ZVNB 1AV1A 4EOTA 1USDA 3CC7P 1NTKD 3IN6A 2O01J 3AE2C 2QM8A 1Y9BA 3D6YA 3CCVP 1U7JA 1VQ9P 3CX5I 3E7KA 2BCCD 2YKPA 1JCCA 2BCCE 2G3AA 2Q9IA 2AXTH 4PD4D 2QM7A 1G1JA 1U7MA 1IFJA 1CW5A 2WITA 3PH0A 3LW5J 1DEBA 1T8ZA 1NTMD 1ZRTE 1LJ2A 1LTJB 2YXQB 2Y0CA 1KYOD 2V4HA 2A45H 1KV4A 3L72J 1P84I 2WSEH 5AVXB 1PGOA 3H32A 1G1IA 1YBKA 2QJPC 4EYYQ 2H88C 3CC2P 1FBMA 3A3YB 3L72G 1ZW0A 2XKMA 1Q82Q 4BWNA 1Z56A 1NU1J 3M06A 4D6TJ 4GODA 1SQXK 3AE8C 4L73A 4U3FJ 2LR2A 2ZVOB 2L91A 1L0NK 3TNUA 2WSFJ 1NU1G 1X8YA 5H2FE 2YO2A 4D6TG 1QGKB 1LTJC 1Q90D 3G71P 5C39A 2IBZI 1M8OB 1GMJA 4U3FG 1SQQJ 3F5HA 1VQLP 3M9QA 2FBWC 2IPPA 3KZIE 2Q3EA 3TGUJ 1S5LX 2P67A 2KSEA 3OA7A 4B86A 3HUSA 1M1JB 5AVVB 3SSUA 3TGUG 3RL0D 1FE6A 1NTZJ 5KAFE 3A0BH 4ASWA 2FYZA 1SLQA 1X0TA 3I5CA 1VQ5P 3A2AA 2IX7C 1H89A 4GKGA 3RL0C 1VF5B 1BE3J 4IL6H 1BCCD 3B8EB 1FZFA 3HE5B 1FZGA 1PGPA 1GW3A 2FFDA 1BE3G 1PL5A 2N1TD 2CPBA 1M1JC 1KILB 1VQ8P 1SQVK 4L74A 3Q5SA 2N1TC 1RE4C 1Y8AA 1JY3O 1ZLLA 3FXDA 3PJSK 3H1LJ 1AA0A 1VF5C 2IYOA 2K9JA 1R8EA 3NTNA 3BASA 2OTJP 3CWBD 2I1JA 2XZRA 1IFDA 3CWBE 3H1LG 1AQTA 3H1ID 4OGQD 2JDIH 2VRSA 2AXCA 2AEJA 2KZJA 3GG2A 1IJDB 1KILC 3AE3C 3MUDC 1YYCA 2A45I 1T2KD 4RO0A 4AQRD 5KJ7C 3L70J 5CCHC 2H8PD 2IYPA 2OYHB 1VQ4P 3SWKA 3SWFA 3CXHH 3MP7B 1FDIA 3U1CA 3L70G 1OW6A 2K9YA 1DIPA 3CCRP 3H25A 2LXCB 4U7JA 4ZNCA 2YXRB 1RHZB 3S9OA 1RF1A 3TNUB 2FKWB 4IFDK 1URQB 1VPCA 1LP1A 2B87B 2HR3A 3SFEC 3L72E 2OYHC 4H0LB 2H89C 2C0XA 1QX8A 5CCGA 2XV5A
chains in the Genus database with same CATH topology
1GW4A 2E43A 1IFIA 3V2RA 4WY4D 1HGVA 2C9LY 3RK2B 1L4AA 5APTA 2YMYA 3HD7B 1GD2E 1CI6A 1LWUB 2NPSD 1JY3N 1DH3A 1FDMA 3L37A 1HWTC 1JNMA 5APYA 1N7SD 2FYUK 1LGHB 5AW2B 1N86A 2BASA 1S9KE 1URQC 2W6AA 2NPSC 2HODB 1RF1B 3BRVB 1AQ5A 1J2JB 4JF7A 4LC1A 1FJKA 5CJ4A 1L0LK 4WBAA 4N3YB 3WMM0 1GL2D 1OXZA 3P8MC 3CI9A 2PP6A 2WZ7A 2E42A 1MUUA 3H6PA 2Q3IA 4WY4A 1FZBA 2KB7P 3EQ2A 2WPQA 4ZKUA 1NO4A 3VMYA 2P7JA 2R5DA 3RK2C 1ZR2A 1GL2C 2GUVA 2WWWA 4KHXA 1HTLC 3HD7C 3OAKA 3TYYA 3VMZA 1JY2P 1NOHA 2XDJA 1SQBK 2Z5HA 1L4AB 1LWUC 2NPSA 3B5NA 1CSBA 1HGZA 3EFGA 2YO3A 1N7SA 2ZXEB 1AFOA 2WTYA 1CI6B 3P32A 4HYTB 2J59M 4ZKPA 1JOCA 2LKMA 3A7OA 1KZUB 1RE3C 1IFNA 3CL3D 1SFCD 2C9NY 2XNXA 1KQLA 1RF1C 4IFMA 4GT1A 2WT7A 3R2PA 2I1KA 1JUNA 1IC2A 1T2KC 1SP4A 1GL2A 1LT9C 5AW8B 3HE4A 3MTUE 1LTSC 1MFZA 5AVUB 3VOPA 1JY2O 3N4XA 5AW5B 1N2DC 2Q5UA 3KPEA 1T3UA 1NAFA 4RESB 3RK3B 1IO4A 3M91A 1M7LA 3V4QA 3M0DC 5CCGC 4AUWA 2CPSA 3KDPB 3LIEA 4WY4B 4W7ZA 1SVFA 5AW4B 1IFMA 2W27A 1GDTA 1RE3A 1L4AC 2IFNA 2PAJA 2WPSA 1G2CA 1QL1A 2NPSB 3T97A 1LTJA 1LT9A 1FZEA 1N7SB 5APSA 4W7YA 1SFCA 4OH8B 3GHGA 1A02J 1T3JA 3M0DA 2HLOA 3V5BA 3II6A 5AVQB 5BU5A 3V2QA 4EOTA 2P2UA 4DZOA 1XTCC 3MD0A 2C0WA 2WT7B 2QM8A 3N7NA 2H43A 4AYCA 1GL2B 3HE4B 3RK3C 1E5WA 3OJAB 1A02F 1IK9A 2YKPA 1FAVA 3B5ND 3L4FA 4WY4C 1JCCA 3G3ZA 2Q9IA 2N9BA 2WSCH 1SQPK 2JJLA 5AW9B 2QM7A 5BU8B 2YNYA 1G1JA 2MJZA 1IFJA 3VMXA 1HVVA 1CW5A 2WITA 2YKQA 3B5NC 3U59A 1NHLA 2XU6A 1DEBA 1T8ZA 1G2CB 1GTWA 2Z4EA 1N7SC 3L35A 5KTBA 1LTJB 1LT9B 3BVHA 2A45H 1FOSF 1SFCB 2M3BA 3GHGB 2WSEH 1NH4A 1KFNA 3V4WA 5AVXB 3H32A 2M8RA 1G1IA 4C7NA 5AW0B 4XA4A 1FBMA 1J1DB 3A3YB 2KOGA 2XKMA 1GZLA 1Z56A 5AVTB 3M06A 1M1JA 1NWQA 4I6MC 1KILD 1PFIA 1SQXK 2YKOA 2O1KA 1QL2A 1MZ9A 1JY2N 1L0NK 1RE4A 3TNUA 3HTKA 2IFMA 5KJ7D 1X8YA 2FXMA 5CCHD 2YO2A 1LTJC 4C46A 3P7KA 5APQA 1W2EA 1SFCC 2Z5IA 3GHGC 3HE5A 3M9QA 3U1AA 2IPPA 3H32B 1FZCA 1J1DC 4N78E 2JEEA 3MIWA 4C7NB 1LTGC 3A5TA 4LLHA 2POHA 3B5NB 1KILA 2P67A 1X79B 3L36A 1N73A 5CMZA 3OA7A 4B86A 5APUA 3TSIA 1DX7A 3HUSA 1M1JB 1X9VA 3IR9A 5AVVB 5CHXA 1ZN5A 3RL0D 2H7HA 5KJ7A 1XTGB 4O9BA 1HBWA 3HRNA 5CCHA 1HJBA 2HG5D 3HTKB 2FYZA 2HFED 1FU1A 3NFQA 1SLQA 3I5CA 5APWA 3KYQA 4WB4A 1RF0A 1WT6A 3A2AA 2IX7C 1H89A 4GKGA 3RL0C 1JTHA 1NKNA 1LTAC 3NMDA 1GU5A 3B8EB 1JY3P 2P1JA 1FZFA 3HE5B 5AW7B 2GM4A 1VDFA 1N7LA 4XE5B 1FZGA 1GW3A 2FFDA 2HYNA 1NKZB 5BVZA 1FZCB 1GK4A 2N1TD 2ZFCA 2OYIA 1URQD 2CPBA 2R3CA 1M1JC 1KILB 5KLVK 1N73B 4Y99B 1SQVK 1J1EB 3HUSB 4EIJA 1YTZI 2N1TC 2OYHA 3BRTB 1RE4C 2L5GB 2KSJA 5AVYB 2KLVA 3IFMA 1JY3O 1ZLLA 2WSFH 1NTKK 4JYCA 4N6JA 1NU1K 2R32A 1WRGA 3RK2D 3E1IA 3SWYA 3VYIA 3HD7D 4I1LA 1JMMA 3NTNA 3BASA 1H88A 2KYVA 1JTHB 2OARA 1H8AA 2I1JA 2W6BA 2HPCA 2XZRA 1IFDA 5AVWB 3P8CD 1OWAA 5APVA 2O1JA 1YTZT 1FZAA 1HH0A 1HUCA 2J58A 3P8CE 1FZCC 3O8ZA 4W80A 2N1TA 2VRSA 2FFDB 1SQQK 1URQA 4IFFA 4LGDE 2R5BA 5CJ0A 1IJDB 1KILC 1NTMK 1N73C 2OYIB 4Y99C 3PP5A 3VTPC 1J1EC 1LTIC 5AVSB 1YYCA 3HUSC 5AVRB 2A45I 1T2KD 3M0AA 3M9HA 1EQ7A 5AW6B 4AQRD 3RL0B 3KQGA 3M9BA 1KFMA 5KJ7C 5CCHC 5APXA 1RY3A 2H8PD 3V2NA 1GK6A 3C9IA 2OYHB 1LTBC 3MGNA 5CCGD 4N78D 2O01H 4DOJA 3HD7A 2A45G 3SWFA 1RF0C 3V2PA 3VN0A 3U1CA 1LWUA 1L4AD 4HH2A 5AW1B 1JO5A 2GUSA 1LTTC 3MUDA 2HPCB 1FOSE 3NXSA 1NTZK 1ZV8A 4GIFA 3CLQA 2WPRA 2Q7CA 2FFDC 1MV8A 4JYBA 4I2LC 3VP9A 4M3LA 4C7RA 2HODA 1RF1A 2N1TB 3TK1A 3TNUB 2OYIC 2FKWB 3LW5H 4IFDK 1URQB 1VPCA 1ZR4A 5AW3B 1JCDA 1CZQA 3VP8A 3LIDA 1GU4A 3BATA 1S9KD 1FJPA 2KP8A 3UIAA 3RK3D 2C0XA 2OYHC 5AVZB 5CCGA 2XV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP K;  2WSE H;  3M9Q A;  1L0N K;  2WSF H;  1NTK K;  1SQQ K;  2O01 H;  1SQB K;  3LW5 H;  4IFD K;  1NU1 K;  1NTM K;  1L0L K;  5KLV K;  2OAR A;  1SQV K;  2J59 M;  3G3Z A;  1SQX K;  1NTZ K;  2LKM A;  2FYU K;  2WSC H;  3CLQ A; 
#chains in the Genus database with same CATH topology
 1GW4 A;  3CPW O;  3Q3D A;  1L4A A;  3O6Q A;  1NU1 E;  3L71 D;  1BGY J;  2NPS D;  1SS1 A;  1FDM A;  5GTI E;  1OVU A;  3Q2Y A;  1LGH B;  1AVO A;  2BAS A;  1URQ C;  1L0N D;  1BGY G;  1SQQ D;  2NPS C;  2LXB A;  2HOD B;  3AEG C;  4PD4 H;  1SQP J;  3AEF C;  1SQQ E;  1AQ5 A;  4JF7 A;  2DW3 A;  5CJ4 A;  4H0L C;  2B88 A;  2CK3 H;  3AE6 C;  2PRR A;  1SQP G;  5KLV J;  4ZMD A;  1KYO H;  2WSC J;  4ZKU A;  2AEF A;  1Q86 Q;  4KHX A;  1S1C X;  1HTL C;  2OTK E;  3TYY A;  1JY2 P;  5KLV G;  1BDD A;  1KB9 D;  2J59 M;  1NTZ D;  4ZKP A;  2ZYG A;  1KB9 E;  1NTZ E;  1RE3 C;  3CL3 D;  2OQQ A;  1S3J A;  1HF9 A;  3L73 J;  3AE9 C;  4GDO A;  1BE3 D;  2NZ2 A;  4L75 A;  1SP4 A;  1EDK A;  5AW8 B;  1BE3 E;  1KMI Z;  5AW5 B;  3L75 J;  3KPE A;  1T3U A;  3PLN A;  1IO4 A;  3L73 G;  5KKZ B;  4W7Z A;  1YI2 P;  2E76 B;  1Y47 A;  1GDT A;  3L75 G;  3S4R A;  1S72 P;  2IFN A;  2WPS A;  5M1B A;  5B66 H;  1QL1 A;  1LTJ A;  1FZE A;  1OMI A;  5APS A;  2KS1 B;  1A02 J;  3H1L D;  2HLO A;  1PGJ A;  3H1L E;  1S5L E;  2P2U A;  4DZO A;  2C0W A;  3CXH I;  1K9M Q;  4NPF X;  5KKZ C;  1IK7 A;  2Y9Y A;  5BU8 B;  1QLE D;  3SFD C;  3VMX A;  2QJY C;  1HVV A;  3CC4 P;  1UIX A;  3L35 A;  1NVO A;  3L70 D;  3L70 E;  1FOS F;  2FYN B;  2M3B A;  1N8R Q;  5AW0 B;  2KOG A;  3A0H E;  2WSS H;  2V7Q H;  5AVT B;  1M1J A;  3JCU E;  1PFI A;  2YKO A;  3FX0 A;  1MZ9 A;  1JY2 N;  4PD4 I;  1RE4 A;  2IFM A;  2FXM A;  4TLF A;  2WMM A;  1W2E A;  1Q81 Q;  2FYN C;  2Z5I A;  2A06 G;  1KYO I;  3HE5 A;  3CME P;  3R4Y A;  4WWI A;  2NRG A;  3VMA A;  3U1A A;  1SQB G;  4JQ0 D;  4N78 E;  4LLH A;  2ZXX A;  1KQS O;  1KIL A;  2BEZ F;  1Q7Y Q;  3TSI A;  1H0T B;  1X9V A;  5CHX A;  1SQP D;  3I56 P;  2H7H A;  1SQP E;  5KJ7 A;  1NYH A;  4O9B A;  5CCH A;  1HJB A;  4PJ0 E;  3BCC D;  2HFE D;  1FU1 A;  2QJP B;  4WB4 A;  2ZT9 D;  3BCC E;  1NKN A;  1LTA C;  1GU5 A;  4YTP C;  2P1J A;  3AEE C;  5AW7 B;  1N7L A;  3ZDM A;  1QVF O;  2KI7 B;  5BVZ A;  1ZRT D;  4K35 A;  1LT1 A;  2QEX P;  5KAI H;  4PV1 D;  1N73 B;  1BSH A;  4EIJ A;  5GTI H;  2KXP B;  2OYH A;  3WU2 E;  5TIS E;  3L75 D;  2WSF H;  2FYU J;  3L75 E;  2K3R A;  4N6J A;  1NU1 K;  4ASV A;  1WRG A;  3RK2 D;  3SWY A;  3HD7 D;  4I1L A;  1VQN P;  3H1H J;  1YIJ P;  1H88 A;  2IZ0 A;  1JTH B;  2OAR A;  1H8A A;  2FYU G;  1OWA A;  4JBZ A;  1YTZ T;  1FZA A;  1HH0 A;  3O8Z A;  3H1H G;  1SQQ K;  1URQ A;  4IFF A;  5CJ0 A;  2B87 A;  3IAO A;  1N73 C;  2OYI B;  5AVR B;  2E74 D;  1YQ4 C;  2Y0E A;  3M9H A;  2D2C D;  3RL0 B;  3KQG A;  1Q2N A;  3H1J J;  4H44 D;  5APX A;  2WSE J;  1KB9 H;  3I55 P;  1SQX J;  3MGN A;  1PP9 J;  2E74 C;  1X22 A;  2A45 G;  1KD1 Q;  2D2C C;  3CX5 E;  3H1J G;  1EZV G;  2KLU A;  2JO1 A;  1SQX G;  2GUS A;  4IL6 X;  1PP9 G;  1NTZ K;  1ZV8 A;  4GIF A;  2K1A A;  1K05 A;  2WPR A;  2Q7C A;  1MV8 A;  4JYB A;  4C7R A;  3JC2 2;  2HOD A;  1PPJ G;  2W90 A;  2N1T B;  3TK1 A;  2OYI C;  1ZR4 A;  4JPZ B;  1EDI A;  5AW3 B;  3VP8 A;  1U57 A;  2IDB A;  1OZH A;  3BAT A;  2OTL P;  3RK3 D;  1HJ0 A;  3RK3 E;  2E43 A;  4R4M A;  4WY4 D;  1QVG O;  3S1K A;  2KZI A;  2C9L Y;  1S5L H;  2QJK C;  1VL2 A;  3AE5 C;  1M1K Q;  1N7S D;  2A06 D;  4OGQ B;  2A06 E;  5B5E E;  3BRV B;  4LC1 A;  3GMA A;  4WBA A;  1VQK P;  2P10 A;  4N3Y B;  4RJT A;  3WMM 0;  1GL2 D;  1JMB A;  3EFF K;  1MUU A;  3H6P A;  2Q3I A;  2KB7 P;  3EQ2 A;  2WPQ A;  3USS A;  1SQV J;  2R5D A;  5E79 E;  1GL2 C;  2GUV A;  3OAK A;  2Y9Z A;  1HGZ A;  3EFG A;  1SQV G;  2YO3 A;  3C1L A;  3P32 A;  2JWD A;  3A0H H;  3FGA D;  2KS1 A;  4OGQ C;  1KIL E;  2B89 A;  3JCU H;  1SFC D;  2C9N Y;  2XNX A;  1KQL A;  4IFM A;  1YJW P;  1T2K C;  2ITA A;  2YIU C;  1LT9 C;  1JY2 O;  3N4X A;  1N2D C;  1NAF A;  4RES B;  1DD4 A;  3M91 A;  3M0D C;  3V6I A;  4AUW A;  2JP3 A;  2CPS A;  1SVF A;  2B9B A;  1DD3 A;  2NPS B;  4UB8 E;  3L72 D;  1FC2 C;  1USE A;  1KB9 I;  2FYU E;  2PGD A;  1L2P A;  3V2Q A;  3W68 A;  1OW8 A;  1R5L A;  2N9Y B;  1FDO A;  3H1H D;  2WVR A;  1NU1 D;  1ZOY C;  3H1H E;  2H43 A;  4NPE A;  4D6T D;  3OJA B;  4D6T E;  2JWA A;  4U3F D;  1IK9 A;  3B5N D;  4U3F E;  2WSC H;  1SQP K;  2JJL A;  5AW9 B;  2MJZ A;  4HJG H;  1FS0 E;  2YKQ A;  1JEK A;  3B5N C;  1DEE G;  3CMA P;  4CPG A;  3H1J E;  1EZV E;  3D6Z A;  1PP9 E;  5CBO A;  3AE4 C;  3TGU D;  3B71 A;  3TGU E;  1S4X A;  1QEX A;  3WU2 H;  5TIS H;  1PPJ E;  1NTK J;  1GZL A;  5KLI C;  1H0T A;  2FY8 A;  4I6M C;  2O1K A;  1NTK G;  2W8Z A;  2E5T A;  1KN7 A;  4C46 A;  3AEA C;  1PV3 A;  3P7K A;  5H2F H;  5APQ A;  1PGQ A;  1NTM J;  1BDC A;  4DJG A;  2PFX A;  1OFC X;  1OX3 A;  2JEE A;  3MIW A;  1NTM G;  4C7N B;  1LTG C;  5CBN A;  4QMA A;  3KZI H;  2QJY B;  4BRY B;  3FWL A;  1X79 B;  3L36 A;  1N73 A;  5CMZ A;  1KQF B;  1DX7 A;  1EDJ A;  4YXD C;  3A0B E;  1RQV A;  1XTG B;  3H1K J;  2HG5 D;  3HTK B;  3NFQ A;  5KAF H;  2KK7 A;  1WT6 A;  4IL6 E;  1JTH A;  5TJH A;  3H1K G;  2JR8 A;  2GM4 A;  1VQM P;  2RN0 A;  2HYN A;  2ZJS E;  1NKZ B;  1FZC B;  2E75 D;  2OYI A;  4DT0 A;  3CCU P;  4H13 D;  1D7M A;  2RKL A;  1BSN A;  3C8V A;  3BRT B;  2KSJ A;  5AVY B;  2KLV A;  1OW7 A;  1AJY A;  4JYC A;  3FWN A;  5B5E H;  1YQ3 C;  2R32 A;  2SPZ A;  3VYI A;  1JMM A;  3GF7 A;  3ITK A;  2W6B A;  1L0L J;  3P8C D;  2O1J A;  3P8C E;  2JKV A;  1FZC C;  2W83 C;  1BCC J;  2N1T A;  5E79 H;  1L0L G;  3EWK A;  2R5B A;  1K8A Q;  3VTP C;  4L76 A;  1SQB J;  1BCC G;  3M0A A;  3M9B A;  1KFM A;  2P58 A;  1M57 D;  3V2N A;  1GK6 A;  1LTB C;  5CCG D;  1NGM B;  2IBZ G;  4N78 D;  2O01 H;  1VQ6 P;  1BGY D;  2ZT9 B;  1RF0 C;  1BGY E;  2QVA A;  3FXE A;  1YHQ P;  2M0B A;  2I8D A;  1L4A D;  2UWJ E;  5AW1 B;  2V7Q J;  1JO5 A;  4RKU J;  1LTT C;  3MUD A;  2HPC B;  3NXS A;  3CCQ P;  5DJT B;  2ZYD A;  4I2L C;  3VP9 A;  4GOE A;  3H1I J;  5DJU B;  3LW5 H;  1RH5 B;  2W6J H;  4PV1 B;  1JCD A;  5KLV D;  4UB8 H;  3LID A;  5KLV E;  1JM0 A;  1GU4 A;  3E1R A;  1R5S A;  2XND H;  3H1I G;  3UIA A;  3AE1 C;  1AFO A;  5AVZ B;  3GLM A;  3WUT A;  3G9R A;  2AEM A;  1IFI A;  3V2R A;  2ZT9 C;  1EC5 A;  1NTK E;  3RK2 B;  3MHV A;  5APT A;  3HD7 B;  3RBX A;  1GD2 E;  1LWU B;  1HWT C;  5APY A;  2FYU K;  3L73 D;  2QSI A;  2WPV B;  3L73 E;  4PD4 E;  3CCJ P;  5AW2 B;  1MKM A;  2W6A A;  4PV1 C;  3AEC C;  1FJK A;  2E74 B;  3CCE P;  1NTM E;  3P8M C;  4KT0 J;  2D2C B;  3CI9 A;  2FXP A;  1KYO E;  2PP6 A;  3GF3 A;  3MZW B;  2WZ7 A;  4H44 B;  3TDK A;  2O3J A;  1FZB A;  1NO4 A;  2P7J A;  3RK2 C;  2WWW A;  1LNQ A;  3HD7 C;  1NOH A;  2XDJ A;  3PRJ A;  1LWU C;  2NPS A;  3B5N A;  2IZ1 A;  3IF4 A;  2ZXE B;  2WTY A;  1CI6 B;  4HYT B;  3H1K D;  1RQU A;  2LKM A;  3K5B A;  3H1K E;  3L71 J;  1IFN A;  4HKZ H;  4WVZ A;  4IOI H;  3AED C;  4GT1 A;  1JUN A;  3F89 A;  1IC2 A;  3CX5 D;  1LTS C;  1L0N J;  3L71 G;  5AVU B;  3RL0 g;  3CCM P;  3ABV C;  4H44 C;  2QJK B;  3RK3 B;  3V4Q A;  3KDP B;  2QRX A;  3LIE A;  4WY4 B;  2ZYA A;  5K5G B;  1L0N G;  1SQQ G;  1RE3 A;  5B66 E;  1PZQ A;  4UB6 E;  2J5U A;  3QH9 A;  1N7S B;  3TF5 A;  1P84 D;  4OH8 B;  2MKV A;  1P84 E;  1ZP0 C;  1VQP P;  3V5B A;  2R44 A;  5BU5 A;  1K04 A;  1E79 H;  1XTC C;  3MD0 A;  2WT7 B;  3N7N A;  1L0L D;  4AYC A;  1GL2 B;  2QG4 A;  3HE4 B;  1L0L E;  1E5W A;  3RK3 C;  2M5A B;  1A02 F;  1T6A A;  1FAV A;  1NTZ G;  3L4F A;  4WY4 C;  4Z1M H;  1KC8 Q;  3G3Z A;  1BCC E;  2KIK A;  2N9B A;  1KQG B;  1WMK A;  2YNY A;  2IBZ D;  5GTH E;  1SQB D;  3U59 A;  1NHL A;  2IBZ E;  2XU6 A;  1SQB E;  1G2C B;  2OYO A;  1GTW A;  3L74 J;  2Z4E A;  1N7S C;  1JB0 J;  5KTB A;  1M56 D;  3T97 B;  3D71 A;  2YIU B;  1LT9 B;  3KHU A;  1ZXG A;  3BVH A;  1VF5 D;  3D70 A;  1SFC B;  3GHG B;  2KNC B;  1NH4 A;  1KFN A;  3L74 G;  3V4W A;  2M8R A;  4C7N A;  4XA4 A;  5EFW B;  1J1D B;  4BRY A;  3WUU A;  1NWQ A;  1KIL D;  4TT3 H;  2E5Y A;  3RBZ A;  3WUV A;  1QL2 A;  3H1I E;  3HTK A;  5KJ7 D;  3PHL A;  5CCH D;  4Y28 J;  1SFC C;  2BEQ D;  3GHG C;  1EZV I;  3H32 B;  1FZC A;  1J1D C;  1YIT P;  4YXW H;  3A5T A;  2POH A;  1VQ7 P;  4OVN F;  3B5N B;  5APU A;  2QE7 H;  3IR9 A;  4XFJ A;  2FYU D;  1ZN5 A;  2FXO A;  1HBW A;  3HRN A;  5APW A;  3KYQ A;  1RF0 A;  4PJ0 H;  2AXT E;  3NMD A;  1IFP A;  1JY3 P;  3GW6 A;  3G4S P;  5KLI B;  1VDF A;  4XE5 B;  1KOR A;  4HB1 A;  2O01 N;  5KAI E;  1GK4 A;  2ZFC A;  1URQ D;  2R3C A;  3H1J D;  5KLV K;  1EZV D;  3L71 E;  1EXJ A;  2K88 A;  4Y99 B;  3Q1M A;  3Q5P A;  4EI2 A;  1J1E B;  1SQX D;  3HUS B;  1YTZ I;  1PP9 D;  4H0L D;  1SQX E;  1S2E A;  2L5G B;  2RH0 A;  4R4L A;  3IFM A;  1NTK K;  1L0N E;  1PPJ D;  1KTM A;  1M90 Q;  3E1I A;  2K37 A;  2KYV A;  4NPD A;  3BCC J;  2HPC A;  3RGU A;  5AVW B;  5APV A;  1HUC A;  2BCC J;  2J58 A;  1VQO P;  4W80 A;  2FFD B;  1UII A;  3BCC G;  4LGD E;  1ZME C;  1NTM K;  1W2B O;  1TU3 F;  2G8Y A;  4Y99 C;  3PP5 A;  1NAY A;  5AVS B;  1J1E C;  1LTI C;  2BCC G;  3HUS C;  1YJN P;  5L8R J;  1EQ7 A;  5AW6 B;  3G6E P;  1RY3 A;  3C9I A;  3W67 A;  1AVY A;  1YJ9 P;  4DOJ A;  3HD7 A;  3V2P A;  3VN0 A;  2K9J B;  1LWU A;  4HH2 A;  3CX5 H;  4KJM A;  1FOS E;  1OIP A;  2Y0D A;  3CLQ A;  1PIX A;  2FFD C;  3L74 D;  2GA1 A;  4M3L A;  3Q5R A;  3L74 E;  2E75 B;  1CZQ A;  3KXD A;  4UB6 H;  4H13 B;  1SQV D;  1S9K D;  1FJP A;  2KP8 A;  2OGU A;  1SQV E;  2QIW A;  1NJI Q;  1S9K E;  2ZAE B;  3CCL P;  1P84 H;  3JSV C;  2E76 D;  1HGV A;  4I7Z B;  2YMY A;  3PTZ A;  1CI6 A;  1MFT A;  1JY3 N;  1DH3 A;  3L37 A;  1JNM A;  2E76 C;  3OW2 O;  2YMK A;  1W5C E;  2E75 C;  2Q1K A;  1OVV A;  1N86 A;  3CCS P;  1RF1 B;  2Q6Q A;  1J2J B;  5GTH H;  1L0L K;  4H13 C;  1LP1 B;  1IZN B;  1OXZ A;  3B4S A;  2E42 A;  4GOF A;  4WY4 A;  4DCK A;  3VMY A;  1ZR2 A;  4I7Z C;  3AE7 C;  3VMZ A;  1SQB K;  2Z5H A;  1L4A B;  1EDL A;  3O6Q B;  1CSB A;  3CD6 P;  2RMZ A;  2R3S A;  1N7S A;  3QWO C;  3AEB C;  4BXL A;  1JOC A;  3A7O A;  1KZU B;  2KUB A;  1RF1 C;  3CXH D;  4OWF A;  4K3A A;  3CXH E;  2WT7 A;  3R2P A;  2I1K A;  2WQY C;  1EXI A;  1GL2 A;  3HE4 A;  3MTU E;  1MFZ A;  3VOP A;  2M5A A;  2Q5U A;  2M3E A;  1M7L A;  5CCG C;  1K73 Q;  1OVR A;  5AW4 B;  4EDF A;  1IFM A;  3CWB J;  2W27 A;  1L4A C;  2PAJ A;  1G2C A;  2QA4 P;  3T97 A;  4A7P A;  1LT9 A;  3CWB G;  4W7Y A;  1SFC A;  4YPC A;  3GHG A;  2KNC A;  1T3J A;  3M0D A;  4MN4 C;  3II6 A;  5AVQ B;  2ZVN B;  1AV1 A;  4EOT A;  1USD A;  3CC7 P;  1NTK D;  3IN6 A;  2O01 J;  3AE2 C;  2QM8 A;  1Y9B A;  3D6Y A;  3CCV P;  1U7J A;  1VQ9 P;  3CX5 I;  3E7K A;  2BCC D;  2YKP A;  1JCC A;  2BCC E;  2G3A A;  2Q9I A;  2AXT H;  4PD4 D;  2QM7 A;  1G1J A;  1U7M A;  1IFJ A;  1CW5 A;  2WIT A;  3PH0 A;  3LW5 J;  1DEB A;  1T8Z A;  1NTM D;  1ZRT E;  1LJ2 A;  1LTJ B;  2YXQ B;  2Y0C A;  1KYO D;  2V4H A;  2A45 H;  1KV4 A;  3L72 J;  1P84 I;  2WSE H;  5AVX B;  1PGO A;  3H32 A;  1G1I A;  1YBK A;  2QJP C;  4EYY Q;  2H88 C;  3CC2 P;  1FBM A;  3A3Y B;  3L72 G;  1ZW0 A;  2XKM A;  1Q82 Q;  4BWN A;  1Z56 A;  1NU1 J;  3M06 A;  4D6T J;  4GOD A;  1SQX K;  3AE8 C;  4L73 A;  4U3F J;  2LR2 A;  2ZVO B;  2L91 A;  1L0N K;  3TNU A;  2WSF J;  1NU1 G;  1X8Y A;  5H2F E;  2YO2 A;  4D6T G;  1QGK B;  1LTJ C;  1Q90 D;  3G71 P;  5C39 A;  2IBZ I;  1M8O B;  1GMJ A;  4U3F G;  1SQQ J;  3F5H A;  1VQL P;  3M9Q A;  2FBW C;  2IPP A;  3KZI E;  2Q3E A;  3TGU J;  1S5L X;  2P67 A;  2KSE A;  3OA7 A;  4B86 A;  3HUS A;  1M1J B;  5AVV B;  3SSU A;  3TGU G;  3RL0 D;  1FE6 A;  1NTZ J;  5KAF E;  3A0B H;  4ASW A;  2FYZ A;  1SLQ A;  1X0T A;  3I5C A;  1VQ5 P;  3A2A A;  2IX7 C;  1H89 A;  4GKG A;  3RL0 C;  1VF5 B;  1BE3 J;  4IL6 H;  1BCC D;  3B8E B;  1FZF A;  3HE5 B;  1FZG A;  1PGP A;  1GW3 A;  2FFD A;  1BE3 G;  1PL5 A;  2N1T D;  2CPB A;  1M1J C;  1KIL B;  1VQ8 P;  1SQV K;  4L74 A;  3Q5S A;  2N1T C;  1RE4 C;  1Y8A A;  1JY3 O;  1ZLL A;  3FXD A;  3PJS K;  3H1L J;  1AA0 A;  1VF5 C;  2IYO A;  2K9J A;  1R8E A;  3NTN A;  3BAS A;  2OTJ P;  3CWB D;  2I1J A;  2XZR A;  1IFD A;  3CWB E;  3H1L G;  1AQT A;  3H1I D;  4OGQ D;  2JDI H;  2VRS A;  2AXC A;  2AEJ A;  2KZJ A;  3GG2 A;  1IJD B;  1KIL C;  3AE3 C;  3MUD C;  1YYC A;  2A45 I;  1T2K D;  4RO0 A;  4AQR D;  5KJ7 C;  3L70 J;  5CCH C;  2H8P D;  2IYP A;  2OYH B;  1VQ4 P;  3SWK A;  3SWF A;  3CXH H;  3MP7 B;  1FDI A;  3U1C A;  3L70 G;  1OW6 A;  2K9Y A;  1DIP A;  3CCR P;  3H25 A;  2LXC B;  4U7J A;  4ZNC A;  2YXR B;  1RHZ B;  3S9O A;  1RF1 A;  3TNU B;  2FKW B;  4IFD K;  1URQ B;  1VPC A;  1LP1 A;  2B87 B;  2HR3 A;  3SFE C;  3L72 E;  2OYH C;  4H0L B;  2H89 C;  2C0X A;  1QX8 A;  5CCG A;  2XV5 A; 
#chains in the Genus database with same CATH homology
 1GW4 A;  2E43 A;  1IFI A;  3V2R A;  4WY4 D;  1HGV A;  2C9L Y;  3RK2 B;  1L4A A;  5APT A;  2YMY A;  3HD7 B;  1GD2 E;  1CI6 A;  1LWU B;  2NPS D;  1JY3 N;  1DH3 A;  1FDM A;  3L37 A;  1HWT C;  1JNM A;  5APY A;  1N7S D;  2FYU K;  1LGH B;  5AW2 B;  1N86 A;  2BAS A;  1S9K E;  1URQ C;  2W6A A;  2NPS C;  2HOD B;  1RF1 B;  3BRV B;  1AQ5 A;  1J2J B;  4JF7 A;  4LC1 A;  1FJK A;  5CJ4 A;  1L0L K;  4WBA A;  4N3Y B;  3WMM 0;  1GL2 D;  1OXZ A;  3P8M C;  3CI9 A;  2PP6 A;  2WZ7 A;  2E42 A;  1MUU A;  3H6P A;  2Q3I A;  4WY4 A;  1FZB A;  2KB7 P;  3EQ2 A;  2WPQ A;  4ZKU A;  1NO4 A;  3VMY A;  2P7J A;  2R5D A;  3RK2 C;  1ZR2 A;  1GL2 C;  2GUV A;  2WWW A;  4KHX A;  1HTL C;  3HD7 C;  3OAK A;  3TYY A;  3VMZ A;  1JY2 P;  1NOH A;  2XDJ A;  1SQB K;  2Z5H A;  1L4A B;  1LWU C;  2NPS A;  3B5N A;  1CSB A;  1HGZ A;  3EFG A;  2YO3 A;  1N7S A;  2ZXE B;  1AFO A;  2WTY A;  1CI6 B;  3P32 A;  4HYT B;  2J59 M;  4ZKP A;  1JOC A;  2LKM A;  3A7O A;  1KZU B;  1RE3 C;  1IFN A;  3CL3 D;  1SFC D;  2C9N Y;  2XNX A;  1KQL A;  1RF1 C;  4IFM A;  4GT1 A;  2WT7 A;  3R2P A;  2I1K A;  1JUN A;  1IC2 A;  1T2K C;  1SP4 A;  1GL2 A;  1LT9 C;  5AW8 B;  3HE4 A;  3MTU E;  1LTS C;  1MFZ A;  5AVU B;  3VOP A;  1JY2 O;  3N4X A;  5AW5 B;  1N2D C;  2Q5U A;  3KPE A;  1T3U A;  1NAF A;  4RES B;  3RK3 B;  1IO4 A;  3M91 A;  1M7L A;  3V4Q A;  3M0D C;  5CCG C;  4AUW A;  2CPS A;  3KDP B;  3LIE A;  4WY4 B;  4W7Z A;  1SVF A;  5AW4 B;  1IFM A;  2W27 A;  1GDT A;  1RE3 A;  1L4A C;  2IFN A;  2PAJ A;  2WPS A;  1G2C A;  1QL1 A;  2NPS B;  3T97 A;  1LTJ A;  1LT9 A;  1FZE A;  1N7S B;  5APS A;  4W7Y A;  1SFC A;  4OH8 B;  3GHG A;  1A02 J;  1T3J A;  3M0D A;  2HLO A;  3V5B A;  3II6 A;  5AVQ B;  5BU5 A;  3V2Q A;  4EOT A;  2P2U A;  4DZO A;  1XTC C;  3MD0 A;  2C0W A;  2WT7 B;  2QM8 A;  3N7N A;  2H43 A;  4AYC A;  1GL2 B;  3HE4 B;  3RK3 C;  1E5W A;  3OJA B;  1A02 F;  1IK9 A;  2YKP A;  1FAV A;  3B5N D;  3L4F A;  4WY4 C;  1JCC A;  3G3Z A;  2Q9I A;  2N9B A;  2WSC H;  1SQP K;  2JJL A;  5AW9 B;  2QM7 A;  5BU8 B;  2YNY A;  1G1J A;  2MJZ A;  1IFJ A;  3VMX A;  1HVV A;  1CW5 A;  2WIT A;  2YKQ A;  3B5N C;  3U59 A;  1NHL A;  2XU6 A;  1DEB A;  1T8Z A;  1G2C B;  1GTW A;  2Z4E A;  1N7S C;  3L35 A;  5KTB A;  1LTJ B;  1LT9 B;  3BVH A;  2A45 H;  1FOS F;  1SFC B;  2M3B A;  3GHG B;  2WSE H;  1NH4 A;  1KFN A;  3V4W A;  5AVX B;  3H32 A;  2M8R A;  1G1I A;  4C7N A;  5AW0 B;  4XA4 A;  1FBM A;  1J1D B;  3A3Y B;  2KOG A;  2XKM A;  1GZL A;  1Z56 A;  5AVT B;  3M06 A;  1M1J A;  1NWQ A;  4I6M C;  1KIL D;  1PFI A;  1SQX K;  2YKO A;  2O1K A;  1QL2 A;  1MZ9 A;  1JY2 N;  1L0N K;  1RE4 A;  3TNU A;  3HTK A;  2IFM A;  5KJ7 D;  1X8Y A;  2FXM A;  5CCH D;  2YO2 A;  1LTJ C;  4C46 A;  3P7K A;  5APQ A;  1W2E A;  1SFC C;  2Z5I A;  3GHG C;  3HE5 A;  3M9Q A;  3U1A A;  2IPP A;  3H32 B;  1FZC A;  1J1D C;  4N78 E;  2JEE A;  3MIW A;  4C7N B;  1LTG C;  3A5T A;  4LLH A;  2POH A;  3B5N B;  1KIL A;  2P67 A;  1X79 B;  3L36 A;  1N73 A;  5CMZ A;  3OA7 A;  4B86 A;  5APU A;  3TSI A;  1DX7 A;  3HUS A;  1M1J B;  1X9V A;  3IR9 A;  5AVV B;  5CHX A;  1ZN5 A;  3RL0 D;  2H7H A;  5KJ7 A;  1XTG B;  4O9B A;  1HBW A;  3HRN A;  5CCH A;  1HJB A;  2HG5 D;  3HTK B;  2FYZ A;  2HFE D;  1FU1 A;  3NFQ A;  1SLQ A;  3I5C A;  5APW A;  3KYQ A;  4WB4 A;  1RF0 A;  1WT6 A;  3A2A A;  2IX7 C;  1H89 A;  4GKG A;  3RL0 C;  1JTH A;  1NKN A;  1LTA C;  3NMD A;  1GU5 A;  3B8E B;  1JY3 P;  2P1J A;  1FZF A;  3HE5 B;  5AW7 B;  2GM4 A;  1VDF A;  1N7L A;  4XE5 B;  1FZG A;  1GW3 A;  2FFD A;  2HYN A;  1NKZ B;  5BVZ A;  1FZC B;  1GK4 A;  2N1T D;  2ZFC A;  2OYI A;  1URQ D;  2CPB A;  2R3C A;  1M1J C;  1KIL B;  5KLV K;  1N73 B;  4Y99 B;  1SQV K;  1J1E B;  3HUS B;  4EIJ A;  1YTZ I;  2N1T C;  2OYH A;  3BRT B;  1RE4 C;  2L5G B;  2KSJ A;  5AVY B;  2KLV A;  3IFM A;  1JY3 O;  1ZLL A;  2WSF H;  1NTK K;  4JYC A;  4N6J A;  1NU1 K;  2R32 A;  1WRG A;  3RK2 D;  3E1I A;  3SWY A;  3VYI A;  3HD7 D;  4I1L A;  1JMM A;  3NTN A;  3BAS A;  1H88 A;  2KYV A;  1JTH B;  2OAR A;  1H8A A;  2I1J A;  2W6B A;  2HPC A;  2XZR A;  1IFD A;  5AVW B;  3P8C D;  1OWA A;  5APV A;  2O1J A;  1YTZ T;  1FZA A;  1HH0 A;  1HUC A;  2J58 A;  3P8C E;  1FZC C;  3O8Z A;  4W80 A;  2N1T A;  2VRS A;  2FFD B;  1SQQ K;  1URQ A;  4IFF A;  4LGD E;  2R5B A;  5CJ0 A;  1IJD B;  1KIL C;  1NTM K;  1N73 C;  2OYI B;  4Y99 C;  3PP5 A;  3VTP C;  1J1E C;  1LTI C;  5AVS B;  1YYC A;  3HUS C;  5AVR B;  2A45 I;  1T2K D;  3M0A A;  3M9H A;  1EQ7 A;  5AW6 B;  4AQR D;  3RL0 B;  3KQG A;  3M9B A;  1KFM A;  5KJ7 C;  5CCH C;  5APX A;  1RY3 A;  2H8P D;  3V2N A;  1GK6 A;  3C9I A;  2OYH B;  1LTB C;  3MGN A;  5CCG D;  4N78 D;  2O01 H;  4DOJ A;  3HD7 A;  2A45 G;  3SWF A;  1RF0 C;  3V2P A;  3VN0 A;  3U1C A;  1LWU A;  1L4A D;  4HH2 A;  5AW1 B;  1JO5 A;  2GUS A;  1LTT C;  3MUD A;  2HPC B;  1FOS E;  3NXS A;  1NTZ K;  1ZV8 A;  4GIF A;  3CLQ A;  2WPR A;  2Q7C A;  2FFD C;  1MV8 A;  4JYB A;  4I2L C;  3VP9 A;  4M3L A;  4C7R A;  2HOD A;  1RF1 A;  2N1T B;  3TK1 A;  3TNU B;  2OYI C;  2FKW B;  3LW5 H;  4IFD K;  1URQ B;  1VPC A;  1ZR4 A;  5AW3 B;  1JCD A;  1CZQ A;  3VP8 A;  3LID A;  1GU4 A;  3BAT A;  1S9K D;  1FJP A;  2KP8 A;  3UIA A;  3RK3 D;  2C0X A;  2OYH C;  5AVZ B;  5CCG A;  2XV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...