5BU8B

Hk620 tail needle crystallized at ph 7.5 and derivatized with xenon
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
AYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords DNA stabilization protein
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Salmonella phage hk620
total genus 57
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bu8B01
3VP8A 2JEEA 4O9BA 3OJAB 3HRNA 4ZKUA 4GIFA 4N78D 4I1LA 2FXMA 3BASA 3N7NA 1IC2A 3P8CD 5BVZA 3BATA 1X79B 4N3YB 5KTBA 1WT6A 2POHA 4ZKPA 3U1CA 1NKNA 5BU5A 3VP9A 3U59A 5BU8B 3C9IA 3N4XA 3U1AA
chains in the Genus database with same CATH superfamily
1YYCA 3L75J 2IZ1A 3WU2E 1SQBK 2B89A 5AVXB 1KB9I 5KLVG 2YKOA 3KYQA 4ZNCA 4YXDC 1KYOH 4RO0A 4C7NB 1GDTA 3H1JG 1GTWA 4TT3H 3Q5SA 1KQSO 2Q1KA 5KLVD 5APUA 5BVZA 3H1JD 3I56P 1CSBA 1DEBA 1JMMA 1GMJA 3AEDC 2OTLP 1QL2A 1RQVA 2WZ7A 1GL2C 1U7JA 3H6PA 2ZVOB 1PP9E 1FZGA 3B71A 5APTA 1DEEG 1JTHB 3CPWO 1GL2A 1IFNA 3TGUE 5KLVJ 1L4AC 1M90Q 2LXCB 4JYCA 3U1CA 3A7OA 1Q90D 2IYPA 3H1JJ 2R3SA 1R5LA 3AE3C 2KK7A 1G1IA 1L4AA 4IL6H 1ZP0C 3HE4A 2V7QJ 4DOJA 4I7ZC 1H89A 1T6AA 2SPZA 5EFWB 1J1DC 1S4XA 3OAKA 2Y0DA 4BWNA 1BSNA 2YO2A 1USDA 1J1EC 1AQ5A 1E5WA 4IL6X 1NTKE 1Q2NA 3PTZA 3BRVB 3LW5H 1LTBC 1GD2E 1JCDA 3GW6A 1EZVI 3H1IE 2W83C 1Y47A 1KILC 4N78E 5APQA 2Y9ZA 3LIDA 1S5LH 4EYYQ 1A02J 1OFCX 4KJMA 1NO4A 2O01N 1Y8AA 1H8AA 1HF9A 1KILA 2IYOA 3RK2B 1ZN5A 1JNMA 3TSIA 1VQ7P 1WT6A 2FBWC 1L2PA 1JOCA 3H1LE 3C8VA 2D2CB 2RN0A 5CBOA 2E75B 3G71P 2IFMA 4KT0J 1KILE 1X79B 2B87B 2N1TD 3RL0C 1N7SD 5E79E 1VF5B 4PV1B 2N9BA 1SFCD 1DD4A 4BRYB 2K9YA 1CI6A 2MKVA 1AVYA 1M1JC 3CXHH 3RK3B 3GF7A 3P8MC 3Q3DA 4N6JA 3L73E 1M1JA 2WSFJ 3B5NB 2WQYC 4GIFA 1EXIA 2ZXXA 2ZYGA 5KTBA 1YQ3C 2YNYA 2M5AB 1HJ0A 1NU1E 1SQBG 1W2EA 3E7KA 1OMIA 3U1AA 4C7NA 1L0LK 1PIXA 1FU1A 1S9KE 4L75A 2FKWB 1RE3C 1JO5A 1MFZA 1SQBD 3KDPB 1X9VA 3SWYA 2ZT9B 1QX8A 3T97B 1Q81Q 1RE3A 2FY8A 4JYBA 3MUDC 5C39A 3P32A 1KB9E 1LTAC 1NTKG 3AE9C 4ASWA 2OGUA 5AW2B 2XU6A 4L76A 1YI2P 3SWFA 2YMYA 1KQLA 1GL2D 3NTNA 3MUDA 3H1IG 2JKVA 2QJKB 1NAYA 1JTHA 3W67A 1NTKD 1SQBJ 2ZVNB 2WMMA 3CI9A 1NJIQ 1LTJB 1L4AD 2WITA 3H1ID 3M9HA 4LLHA 5TJHA 3L71E 2WSCJ 3BATA 3A3YB 3E1RA 3H1LG 1VQ9P 1L0LE 5BU5A 1M56D 3L70E 5KAFE 3FWNA 2K37A 1P84H 3V2RA 1HGVA 3USSA 4DCKA 1K04A 3MTUE 3H1IJ 2IBZI 1G2CB 4PJ0H 1XTCC 1PL5A 2Y0CA 1OVVA 4RESB 3L74G 3EFFK 3L75E 3GLMA 4DT0A 2KIKA 2POHA 2BASA 3L74D 2H8PD 2KP8A 5GTHE 3L73G 3H25A 4IFDK 4OGQB 1EZVE 3FWLA 1JY2N 2Q3IA 3MGNA 1EXJA 1NU1G 3AEAC 2OYHB 2ZYDA 3PH0A 1A02F 3L73D 2QJYB 1VL2A 4PV1C 4GKGA 3EQ2A 1YHQP 1L0NK 3L74J 3M9BA 3RL0D 4NPDA 3C1LA 1HJBA 3BASA 2YXRB 1MZ9A 2QM7A 3WU2H 2FYUK 4N3YB 4OVNF 4M3LA 1FZBA 3VMXA 1KN7A 4B86A 5H2FH 1VQLP 3L73J 2O01H 2AXCA 1URQB 2QVAA 5AVVB 1N7LA 1T3UA 1YTZI 1IJDB 3MIWA 1KB9D 1FZFA 2FYNC 1VQ6P 4ZMDA 2M8RA 1Q82Q 1EDIA 3ZDMA 1GU4A 1NGMB 2J58A 1T2KC 1NTZE 3O8ZA 1D7MA 4JPZB 2HG5D 3HE5B 1AA0A 2E76B 2C0XA 1SQPK 5AW5B 1FBMA 4I6MC 4GT1A 1L0LG 1LP1B 2H88C 4H44B 4OWFA 3L70G 4UB8E 2IPPA 1FZCC 3HUSB 4EOTA 2QJPC 1OVRA 1PFIA 3T97A 2W6BA 2FXPA 4WY4B 2K3RA 3AE8C 1J2JB 4Y28J 3TNUA 1ZV8A 3V4WA 1RE4A 1FZCA 4HH2A 1LT9B 1L0LD 2QJKC 3L70D 3FXDA 2W6AA 2NPSC 3CX5H 5KKZB 5APSA 2JJLA 4W80A 5AW0B 1KYOI 1RH5B 2RKLA 1NTME 2WSEH 2NPSA 1T3JA 3AE1C 1R8EA 1DX7A 3K5BA 4JF7A 2JO1A 2OTKE 1N7SC 1CW5A 5TISH 2XNXA 1L0LJ 2WSSH 1BGYG 3L70J 1GW3A 4HKZH 3AEBC 1EZVG 4RJTA 3OJAB 1N86A 3KZIH 2CPSA 2W90A 2NRGA 1IZNB 3II6A 3VYIA 3KHUA 2M0BA 2ZXEB 1BGYD 2AXTE 3M06A 1W5CE 1EZVD 2Z5HA 3IFMA 1RF1C 2K1AA 4HYTB 2JEEA 1IFPA 2R3CA 4ASVA 1RF1A 2AEFA 4JBZA 1N73B 2YXQB 5APWA 1FZAA 5AW1B 3KQGA 3JSVC 3SFDC 4DZOA 1BGYJ 1VPCA 1VQ4P 1OZHA 2ZFCA 3WUTA 3A0BH 5E79H 5KLIB 1ZMEC 3CCRP 2P58A 2E75D 4XE5B 3SWKA 4L74A 3AE5C 1FZEA 3AECC 1NTZG 5AVWB 1H88A 3LIEA 2W8ZA 3CCUP 4PV1D 3L72J 2PAJA 4K3AA 2JWAA 3JC22 4YXWH 2QG4A 1FAVA 2A06E 1L0NG 3P7KA 2OYIB 5AVRB 1NTZD 2Q7CA 3V4QA 1SQBE 5APXA 4EI2A 3TK1A 5M1BA 2RH0A 2FYUG 2Y0EA 3AE4C 1LWUB 2WT7A 1L0ND 2WPRA 3B4SA 1VQKP 1IO4A 1OW6A 1NTMG 1SQQK 2FYUD 3H32A 4U7JA 2ZYAA 1SQXK 4UB6E 4H0LB 3TDKA 2NZ2A 3CWBG 4PD4H 1GW4A 3JCUE 1NTZJ 1HBWA 2FXMA 1NTMD 2Q9IA 3ABVC 3CMAP 1T2KD 4H13B 3IR9A 1L0NJ 3V2PA 3CWBD 3CXHI 1VDFA 1LGHB 4W7YA 3CC7P 1KD1Q 2FYUJ 2E74B 3SFEC 1TU3F 1JEKA 1KMIZ 5KKZC 1LT9A 2I1JA 1UIXA 1SQPD 1NTMJ 3C9IA 1QLED 2NPSD 1S3JA 3CWBJ 5KAFH 1AVOA 4GDOA 1BDDA 1H0TA 5DJUB 2XKMA 4D6TE 2A45I 2IBZG 1FJKA 1SQPJ 3L74E 2WWWA 3AEFC 2W6JH 2HFED 1KYOE 3CC4P 5AVYB 3KXDA 1JM0A 3ITKA 1QEXA 1FOSE 2IBZD 4Y99B 1SP4A 4HJGH 1HVVA 5GTIE 4EDFA 1AJYA 3WUVA 3R4YA 2E5TA 2A06G 2OYOA 2R5DA 1ZR2A 1NKZB 1QVGO 2QE7H 3WMM0 1KTMA 1EDKA 2YKPA 1FDOA 2FFDB 1P84I 5APYA 2A06D 4WVZA 1IK7A 4OGQD 4AQRD 1EC5A 3D71A 1N2DC 2FYZA 1FE6A 1U57A 1ZRTD 3BCCE 1KC8Q 1JY3O 3CL3D 1NAFA 1JB0J 2KYVA 2M3BA 2WPQA 2V7QH 2KNCB 3CCLP 4LGDE 3UIAA 2OYIA 4GOEA 1LWUC 2HPCB 2KI7B 1SQVK 3FX0A 2E42A 2GUSA 1AQTA 1ZW0A 3S4RA 1JY3P 2J5UA 1S5LE 1LWUA 1VQ8P 1SLQA 5KAIH 3E1IA 1LTTC 3AEEC 4UB8H 2HODB 2JWDA 2GA1A 3IAOA 1BSHA 3VMZA 3VTPC 3EWKA 2N1TB 2YO3A 4U3FE 1LTSC 1RY3A 2KUBA 1K8AQ 4D6TG 1EDJA 3P8CE 2O3JA 2ZJSE 1SFCB 1JCCA 3RK2C 2K9JB 1YIJP 2KOGA 1T8ZA 1ZLLA 3EFGA 4D6TD 1M8OB 1G1JA 1S1CX 2YIUB 5KLVK 2KSEA 4XA4A 1KYOD 1BGYE 2D2CC 2M3EA 2E75C 4RKUJ 3CCQP 1IC2A 1SQXJ 2L5GB 4YTPC 1FDIA 4WB4A 2O1KA 4D6TJ 1VF5C 5DJTB 3SSUA 2B87A 2XDJA 1BCCJ 3PP5A 4XFJA 1Q7YQ 3L72E 3NFQA 3QWOC 3BCCG 1OWAA 3CX5I 2WSFH 4Z1MH 4BRYA 2I8DA 2AEJA 3RK3C 1GL2B 1EDLA 4C7RA 2IDBA 2KLUA 3B5NC 3BCCD 2UWJE 5B5EE 3B5NA 1K05A 1L4AB 1HWTC 3D6ZA 3CLQA 1DH3A 2IFNA 2M5AA 1KFMA 2QSIA 2FFDA 4I7ZB 3I55P 2XNDH 2ZT9C 3CMEP 5CJ4A 3BCCJ 2QRXA 1J1DB 3RK3E 1L0NE 5CCHC 1RE4C 3CCMP 2FXOA 1J1EB 2LKMA 2QM8A 3AE2C 2Z4EA 1M57D 2FYUE 5CCHA 4U3FG 2C9LY 3AEGC 1EQ7A 2E43A 1IFDA 1KILB 2WSCH 1BE3E 3PJSK 3LW5J 1LTJC 3PRJA 4U3FD 2KXPB 3MZWB 2IZ0A 3HTKB 3MD0A 3CWBE 1FC2C 1LTJA 3P8CD 2R44A 3NMDA 1SQVG 4C46A 1MFTA 3M0DC 3S9OA 1YJWP 3KPEA 3NXSA 1SQPE 4U3FJ 3M0DA 1SQVD 1CZQA 1U7MA 4KHXA 3RL0B 2KS1B 1YQ4C 1G2CA 2O1JA 5CCGC 3CXHD 3M9QA 2XV5A 1CI6B 2GUVA 2R32A 3HD7B 3L72G 1WMKA 5CCGA 5K5GB 4W7ZA 3RK2D 3A0HE 1SQVJ 1M1JB 2HR3A 4IFMA 3N4XA 4GOFA 1JY2O 4OGQC 5CJ0A 4PD4I 3L72D 3VMAA 2I1KA 3HRNA 2IBZE 2D2CD 2P1JA 2A45G 5AVSB 4NPEA 2OYHC 1VQ5P 5H2FE 2QJYC 3GG2A 4WBAA 1K9MQ 2OYHA 4QMAA 1N8RQ 2ITAA 2P7JA 1VF5D 1JY2P 5GTIH 1NTKK 2PFXA 2G8YA 4ZKPA 1NYHA 2LR2A 5L8RJ 4YPCA 2OARA 2HLOA 1JY3N 1ZRTE 2B9BA 1URQC 3RK3D 2QA4P 1JMBA 1PGJA 3OW2O 3B5ND 2KB7P 1URQA 5AVQB 1BE3G 3U59A 1E79H 2G3AA 1HGZA 2YMKA 1Z56A 3GHGB 2H7HA 3GMAA 2JR8A 3CX5E 4OH8B 2Z5IA 1R5SA 2BCCE 1P84D 3MHVA 2E76C 1NH4A 1KB9H 2WTYA 1BE3D 1VQPP 5AVTB 2K88A 3A2AA 3H1KG 4H44C 1FOSF 3HE5A 3HUSC 4TLFA 2ZT9D 1LP1A 4WY4C 1SQPG 1YITP 5TISE 5CCHD 3Q5RA 3HUSA 1LT9C 3H1KD 5AW6B 5CBNA 4WY4A 3L4FA 1GU5A 3M91A 1BE3J 3KZIE 4DJGA 3H1HE 3CD6P 5B66E 1BDCA 1IFJA 1SQQE 3HTKA 5KJ7C 1SQXE 3H1KJ 2P10A 1S5LX 2Q5UA 5KJ7A 4JQ0D 1NU1K 2C0WA 1AV1A 1MUUA 1VQMP 1BCCE 4IOIH 1ZR4A 1OVUA 5AW3B 3F89A 2BEQD 3L35A 3IF4A 1GZLA 2IX7C 3A0BE 3V6IA 3TF5A 1HUCA 1PPJE 3VP8A 1YBKA 5GTHH 2KS1A 3HD7C 1N73C 4EIJA 3B8EB 1NVOA 5CCGD 1YTZT 3HD7A 1N73A 1PP9G 1JUNA 5AW7B 1VQOP 5KLIC 3TGUG 1GK4A 1Y9BA 1SS1A 1VQNP 1YJ9P 1PP9D 2HYNA 4IL6E 2O01J 2FYNB 4HB1A 1HTLC 2H43A 3L37A 2L91A 3TGUD 1PZQA 2KLVA 2BCCG 2Q6QA 4GODA 1QGKB 2VRSA 2MJZA 2WPSA 2OYIC 1LNQA 4LC1A 4PD4E 3VP9A 3MP7B 3TNUB 1MKMA 3CX5D 5B5EH 2A45H 2BCCD 1FZCB 1Q86Q 5CHXA 1PP9J 2QJPB 1XTGB 1KQFB 2Y9YA 4K35A 3TGUJ 4R4MA 1DD3A 3BVHA 2QEXP 3IN6A 2LXBA 3Q2YA 2NPSB 1URQD 1NKNA 3G9RA 3PHLA 1IFIA 1K73Q 1OW7A 3GHGC 3H1HG 4H0LC 2RMZA 4WWIA 2R5BA 1KZUB 2BCCJ 4N78D 1SQQG 3GHGA 4MN4C 3VN0A 4H13C 1SQXG 1N7SB 1OX3A 2N9YB 2WSEJ 3H1HD 3CC2P 3V2QA 1PV3A 2E76D 3AE6C 3W68A 3A5TA 4H44D 1SQQD 1NTKJ 2E74C 1UIIA 1BCCG 1LTIC 1M1KQ 2V4HA 1SQXD 3H1LD 3O6QB 4WY4D 3RGUA 2YKQA 1PGOA 1NHLA 2C9NY 1SQVE 2BEZF 1RF1B 1BCCD 1PPJG 3H1HJ 4A7PA 1OIPA 1KILD 1ZOYC 2OTJP 3Q5PA 1PGQA 1SQQJ 4NPFX 3CXHE 2WVRA 1LT1A 3H1LJ 1PPJD 3WUUA 3GF3A 5KJ7D 1KV4A 2Q3EA 2AXTH 1QVFO 1LTGC 3V5BA 3Q1MA 3FGAD 1NTZK 5AVUB 4IFFA 1ZXGA 3TYYA 4Y99C 1FJPA 3A0HH 3OA7A 2J59M 2PP6A 3AE7C 4O9BA 3RBXA 1RHZB 1MV8A 1LJ2A 3CCEP 1NU1D 3I5CA 3CCVP 1USEA 2KZJA 2JDIH 2OQQA 5KLVE 3HD7D 1IK9A 1M7LA 1W2BO 1X0TA 3HE4B 1S9KD 2ZAEB 3H1JE 2WT7B 2FFDC 3V2NA 3RBZA 3L36A 1NTMK 2CK3H 3CCJP 1S72P 4AYCA 4PD4D 5AW9B 3H32B 1KFNA 2E5YA 3G6EP 1NU1J 1OW8A 3G4SP 1X8YA 3D70A 4L73A 1RF0C 3PLNA 3F5HA 3VMYA 3L71G 4AUWA 1WRGA 2B88A 4ZKUA 4BXLA 1DIPA 5KAIE 3RL0g 1RF0A 5AVZB 3D6YA 1SVFA 3R2PA 2QIWA 2KZIA 1P84E 3L71D 1YJNP 5APVA 2KNCA 1KORA 1X22A 2GM4A 1NWQA 4I2LC 3G3ZA 4PJ0E 2H89C 4I1LA 4UB6H 3JCUH 2HPCA 2XZRA 1GK6A 2P2UA 3FXEA 2W27A 3H1KE 1NOHA 1HH0A 3L75G 2JP3A 1FS0E 1H0TB 3S1KA 2WPVB 1OXZA 3L71J 2DW3A 2N1TC 5CMZA 1IFMA 4CPGA 4H0LD 2HODA 3BRTB 1QL1A 1S2EA 2PGDA 2N1TA 3L75D 3VOPA 2CPBA 1N7SA 5BU8B 1SFCC 1KQGB 4H13D 2P67A 5AW8B 2PRRA 3N7NA 2AEMA 1SFCA 3M0AA 1FDMA 2E74D 2K9JA 3QH9A 5B66H 3O6QA 5AW4B 4R4LA 3CCSP 2YIUC 1PGPA 1RQUA 2KSJA 1AFOA
chains in the Genus database with same CATH topology
1LWUC 1YYCA 2HPCB 1SQVK 2O01H 2E42A 1SQBK 2GUSA 1URQB 5AVXB 5AVVB 1N7LA 1T3UA 1JY3P 1IFJA 1YTZI 3HTKA 5KJ7C 1LWUA 2YKOA 3KYQA 1IJDB 3MIWA 4C7NB 1FZFA 1SLQA 1GDTA 1GTWA 2M8RA 2Q5UA 5KJ7A 3E1IA 1NU1K 1LTTC 2C0WA 1GU4A 2HODB 2J58A 1T2KC 3O8ZA 1MUUA 3VMZA 3VTPC 5APUA 2N1TB 2HG5D 2YO3A 3HE5B 1LTSC 1ZR4A 2C0XA 1SQPK 5AW5B 5BVZA 1CSBA 1FBMA 4I6MC 4GT1A 5AW3B 1DEBA 1JMMA 1RY3A 3L35A 1GZLA 2IX7C 1QL2A 2IPPA 2WZ7A 1FZCC 3P8CE 3HUSB 1GL2C 4EOTA 3H6PA 1SFCB 1JCCA 1PFIA 1HUCA 3T97A 2W6BA 3VP8A 4WY4B 1J2JB 3TNUA 1FZGA 3RK2C 3HD7C 1ZV8A 5APTA 3V4WA 1RE4A 1JTHB 1FZCA 4HH2A 1N73C 1LT9B 1GL2A 4EIJA 2KOGA 1IFNA 3B8EB 1T8ZA 1ZLLA 5CCGD 3EFGA 2W6AA 2NPSC 1L4AC 1G1JA 5APSA 2JJLA 4W80A 4JYCA 1YTZT 3U1CA 3HD7A 5AW0B 3A7OA 1N73A 5KLVK 4XA4A 2WSEH 2NPSA 1T3JA 1G1IA 1L4AA 1JUNA 3HE4A 5AW7B 1DX7A 4DOJA 4JF7A 1H89A 1GK4A 1IC2A 1N7SC 1CW5A 2L5GB 1J1DC 2XNXA 2HYNA 4WB4A 3OAKA 2O1KA 1HTLC 1GW3A 2YO2A 3L37A 2H43A 1J1EC 1AQ5A 1E5WA 2KLVA 2XDJA 1N86A 3OJAB 3PP5A 2CPSA 3BRVB 3LW5H 1LTBC 1GD2E 1JCDA 2VRSA 3II6A 3VYIA 3NFQA 2ZXEB 2MJZA 2WPSA 2OYIC 1OWAA 2WSFH 4LC1A 1KILC 3M06A 4N78E 5APQA 3VP9A 2Z5HA 3IFMA 3TNUB 1RF1C 3LIDA 1A02J 3RK3C 2A45H 1FZCB 1GL2B 1NO4A 5CHXA 4HYTB 1H8AA 4C7RA 2JEEA 1XTGB 1KILA 2R3CA 3B5NC 3RK2B 1RF1A 1ZN5A 1JNMA 3TSIA 1N73B 5APWA 3BVHA 1WT6A 3B5NA 1FZAA 2NPSB 5AW1B 1L4AB 1URQD 1HWTC 3KQGA 3CLQA 1JOCA 1NKNA 4DZOA 1DH3A 1IFIA 3GHGC 2IFNA 1VPCA 2R5BA 2ZFCA 1KFMA 1KZUB 4N78D 2FFDA 3GHGA 2IFMA 3VN0A 1X79B 1N7SB 4XE5B 5CJ4A 2N1TD 1J1DB 3V2QA 3RL0C 5CCHC 1N7SD 1RE4C 1FZEA 3A5TA 5AVWB 1J1EB 2LKMA 2QM8A 2N9BA 1H88A 2Z4EA 3LIEA 1LTIC 5CCHA 2C9LY 1SFCD 1EQ7A 2PAJA 4WY4D 1FAVA 2E43A 1CI6A 3P7KA 2OYIB 5AVRB 1IFDA 1M1JC 2YKQA 1KILB 2Q7CA 2WSCH 1NHLA 3V4QA 2C9NY 1RF1B 5APXA 3TK1A 1LTJC 3RK3B 1KILD 3P8MC 4N6JA 3HTKB 3MD0A 1M1JA 1LWUB 3B5NB 4GIFA 2WT7A 2WPRA 1LTJA 3P8CD 3NMDA 5KTBA 2YNYA 1IO4A 1SQQK 3H32A 1W2EA 4C46A 3M0DC 5KJ7D 1SQXK 3U1AA 3KPEA 4C7NA 1L0LK 1GW4A 3NXSA 1LTGC 3V5BA 1HBWA 1FU1A 1S9KE 2FKWB 2FXMA 3M0DA 1RE3C 1NTZK 1JO5A 5AVUB 1MFZA 3KDPB 2Q9IA 1X9VA 4IFFA 1T2KD 3SWYA 3TYYA 3IR9A 1CZQA 4Y99C 3V2PA 1FJPA 4KHXA 3RL0B 1RE3A 1VDFA 1LGHB 4JYBA 1G2CA 3P32A 2O1JA 5CCGC 3OA7A 4W7YA 1LTAC 2J59M 2PP6A 3M9QA 4O9BA 5AW2B 2XV5A 1CI6B 2XU6A 1MV8A 2GUVA 3SWFA 2YMYA 2R32A 3I5CA 1KQLA 1GL2D 3HD7B 3NTNA 3MUDA 5CCGA 4W7ZA 1JTHA 3RK2D 3HD7D 1LT9A 2OYIA 1IK9A 2I1JA 1M7LA 1M1JB 3HE4B 1S9KD 2FFDC 2WT7B 4IFMA 3C9IA 3CI9A 3N4XA 3V2NA 1JY2O 2NPSD 1LTJB 1L4AD 5CJ0A 3L36A 2WITA 1NTMK 3M9HA 4LLHA 2I1KA 3HRNA 4AYCA 5AW9B 3H32B 2P1JA 2A45G 1KFNA 3BATA 5AVSB 3A3YB 2OYHC 2XKMA 5BU5A 1X8YA 4WBAA 2A45I 1RF0C 2OYHA 3VMYA 3V2RA 1FJKA 4AUWA 1WRGA 2WWWA 4ZKUA 1HGVA 2HFED 2P7JA 3MTUE 5AVYB 1JY2P 1NTKK 1RF0A 5AVZB 1G2CB 4ZKPA 1XTCC 1SVFA 3R2PA 1FOSE 4Y99B 4RESB 2OARA 2HLOA 5APVA 1SP4A 1JY3N 2GM4A 1NWQA 1HVVA 4I2LC 3G3ZA 1URQC 4I1LA 3RK3D 2HPCA 2R5DA 2XZRA 1GK6A 1ZR2A 1NKZB 3B5ND 2P2UA 2POHA 2KB7P 1URQA 2BASA 5AVQB 2W27A 2H8PD 2KP8A 1NOHA 3U59A 3WMM0 1HH0A 1HGZA 2YKPA 2FFDB 1Z56A 3GHGB 4IFDK 5APYA 2H7HA 1OXZA 1JY2N 2Q3IA 2N1TC 5CMZA 4OH8B 2Z5IA 1IFMA 3MGNA 1NH4A 4AQRD 2HODA 2WTYA 3BRTB 1QL1A 1N2DC 5AVTB 3A2AA 2FYZA 1FOSF 2OYHB 2N1TA 1A02F 3HE5A 3HUSC 3VOPA 2CPBA 1N7SA 5BU8B 1SFCC 4GKGA 1JY3O 3CL3D 3EQ2A 1NAFA 1L0NK 4WY4C 2P67A 3M9BA 5AW8B 3RL0D 5CCHD 3HUSA 2KYVA 1LT9C 1HJBA 3BASA 2M3BA 2WPQA 3M0AA 1MZ9A 1SFCA 3N7NA 5AW6B 2QM7A 2FYUK 4WY4A 1FDMA 4N3YB 3L4FA 4M3LA 5AW4B 1GU5A 1FZBA 3VMXA 3M91A 4LGDE 4B86A 1AFOA 2KSJA 3UIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP8 A;  2JEE A;  4O9B A;  3OJA B;  3HRN A;  4ZKU A;  4GIF A;  4N78 D;  4I1L A;  2FXM A;  3BAS A;  3N7N A;  1IC2 A;  3P8C D;  5BVZ A;  3BAT A;  1X79 B;  4N3Y B;  5KTB A;  1WT6 A;  2POH A;  4ZKP A;  3U1C A;  1NKN A;  5BU5 A;  3VP9 A;  3U59 A;  5BU8 B;  3C9I A;  3N4X A;  3U1A A; 
#chains in the Genus database with same CATH topology
 1YYC A;  3L75 J;  2IZ1 A;  3WU2 E;  1SQB K;  2B89 A;  5AVX B;  1KB9 I;  5KLV G;  2YKO A;  3KYQ A;  4ZNC A;  4YXD C;  1KYO H;  4RO0 A;  4C7N B;  1GDT A;  3H1J G;  1GTW A;  4TT3 H;  3Q5S A;  1KQS O;  2Q1K A;  5KLV D;  5APU A;  5BVZ A;  3H1J D;  3I56 P;  1CSB A;  1DEB A;  1JMM A;  1GMJ A;  3AED C;  2OTL P;  1QL2 A;  1RQV A;  2WZ7 A;  1GL2 C;  1U7J A;  3H6P A;  2ZVO B;  1PP9 E;  1FZG A;  3B71 A;  5APT A;  1DEE G;  1JTH B;  3CPW O;  1GL2 A;  1IFN A;  3TGU E;  5KLV J;  1L4A C;  1M90 Q;  2LXC B;  4JYC A;  3U1C A;  3A7O A;  1Q90 D;  2IYP A;  3H1J J;  2R3S A;  1R5L A;  3AE3 C;  2KK7 A;  1G1I A;  1L4A A;  4IL6 H;  1ZP0 C;  3HE4 A;  2V7Q J;  4DOJ A;  4I7Z C;  1H89 A;  1T6A A;  2SPZ A;  5EFW B;  1J1D C;  1S4X A;  3OAK A;  2Y0D A;  4BWN A;  1BSN A;  2YO2 A;  1USD A;  1J1E C;  1AQ5 A;  1E5W A;  4IL6 X;  1NTK E;  1Q2N A;  3PTZ A;  3BRV B;  3LW5 H;  1LTB C;  1GD2 E;  1JCD A;  3GW6 A;  1EZV I;  3H1I E;  2W83 C;  1Y47 A;  1KIL C;  4N78 E;  5APQ A;  2Y9Z A;  3LID A;  1S5L H;  4EYY Q;  1A02 J;  1OFC X;  4KJM A;  1NO4 A;  2O01 N;  1Y8A A;  1H8A A;  1HF9 A;  1KIL A;  2IYO A;  3RK2 B;  1ZN5 A;  1JNM A;  3TSI A;  1VQ7 P;  1WT6 A;  2FBW C;  1L2P A;  1JOC A;  3H1L E;  3C8V A;  2D2C B;  2RN0 A;  5CBO A;  2E75 B;  3G71 P;  2IFM A;  4KT0 J;  1KIL E;  1X79 B;  2B87 B;  2N1T D;  3RL0 C;  1N7S D;  5E79 E;  1VF5 B;  4PV1 B;  2N9B A;  1SFC D;  1DD4 A;  4BRY B;  2K9Y A;  1CI6 A;  2MKV A;  1AVY A;  1M1J C;  3CXH H;  3RK3 B;  3GF7 A;  3P8M C;  3Q3D A;  4N6J A;  3L73 E;  1M1J A;  2WSF J;  3B5N B;  2WQY C;  4GIF A;  1EXI A;  2ZXX A;  2ZYG A;  5KTB A;  1YQ3 C;  2YNY A;  2M5A B;  1HJ0 A;  1NU1 E;  1SQB G;  1W2E A;  3E7K A;  1OMI A;  3U1A A;  4C7N A;  1L0L K;  1PIX A;  1FU1 A;  1S9K E;  4L75 A;  2FKW B;  1RE3 C;  1JO5 A;  1MFZ A;  1SQB D;  3KDP B;  1X9V A;  3SWY A;  2ZT9 B;  1QX8 A;  3T97 B;  1Q81 Q;  1RE3 A;  2FY8 A;  4JYB A;  3MUD C;  5C39 A;  3P32 A;  1KB9 E;  1LTA C;  1NTK G;  3AE9 C;  4ASW A;  2OGU A;  5AW2 B;  2XU6 A;  4L76 A;  1YI2 P;  3SWF A;  2YMY A;  1KQL A;  1GL2 D;  3NTN A;  3MUD A;  3H1I G;  2JKV A;  2QJK B;  1NAY A;  1JTH A;  3W67 A;  1NTK D;  1SQB J;  2ZVN B;  2WMM A;  3CI9 A;  1NJI Q;  1LTJ B;  1L4A D;  2WIT A;  3H1I D;  3M9H A;  4LLH A;  5TJH A;  3L71 E;  2WSC J;  3BAT A;  3A3Y B;  3E1R A;  3H1L G;  1VQ9 P;  1L0L E;  5BU5 A;  1M56 D;  3L70 E;  5KAF E;  3FWN A;  2K37 A;  1P84 H;  3V2R A;  1HGV A;  3USS A;  4DCK A;  1K04 A;  3MTU E;  3H1I J;  2IBZ I;  1G2C B;  4PJ0 H;  1XTC C;  1PL5 A;  2Y0C A;  1OVV A;  4RES B;  3L74 G;  3EFF K;  3L75 E;  3GLM A;  4DT0 A;  2KIK A;  2POH A;  2BAS A;  3L74 D;  2H8P D;  2KP8 A;  5GTH E;  3L73 G;  3H25 A;  4IFD K;  4OGQ B;  1EZV E;  3FWL A;  1JY2 N;  2Q3I A;  3MGN A;  1EXJ A;  1NU1 G;  3AEA C;  2OYH B;  2ZYD A;  3PH0 A;  1A02 F;  3L73 D;  2QJY B;  1VL2 A;  4PV1 C;  4GKG A;  3EQ2 A;  1YHQ P;  1L0N K;  3L74 J;  3M9B A;  3RL0 D;  4NPD A;  3C1L A;  1HJB A;  3BAS A;  2YXR B;  1MZ9 A;  2QM7 A;  3WU2 H;  2FYU K;  4N3Y B;  4OVN F;  4M3L A;  1FZB A;  3VMX A;  1KN7 A;  4B86 A;  5H2F H;  1VQL P;  3L73 J;  2O01 H;  2AXC A;  1URQ B;  2QVA A;  5AVV B;  1N7L A;  1T3U A;  1YTZ I;  1IJD B;  3MIW A;  1KB9 D;  1FZF A;  2FYN C;  1VQ6 P;  4ZMD A;  2M8R A;  1Q82 Q;  1EDI A;  3ZDM A;  1GU4 A;  1NGM B;  2J58 A;  1T2K C;  1NTZ E;  3O8Z A;  1D7M A;  4JPZ B;  2HG5 D;  3HE5 B;  1AA0 A;  2E76 B;  2C0X A;  1SQP K;  5AW5 B;  1FBM A;  4I6M C;  4GT1 A;  1L0L G;  1LP1 B;  2H88 C;  4H44 B;  4OWF A;  3L70 G;  4UB8 E;  2IPP A;  1FZC C;  3HUS B;  4EOT A;  2QJP C;  1OVR A;  1PFI A;  3T97 A;  2W6B A;  2FXP A;  4WY4 B;  2K3R A;  3AE8 C;  1J2J B;  4Y28 J;  3TNU A;  1ZV8 A;  3V4W A;  1RE4 A;  1FZC A;  4HH2 A;  1LT9 B;  1L0L D;  2QJK C;  3L70 D;  3FXD A;  2W6A A;  2NPS C;  3CX5 H;  5KKZ B;  5APS A;  2JJL A;  4W80 A;  5AW0 B;  1KYO I;  1RH5 B;  2RKL A;  1NTM E;  2WSE H;  2NPS A;  1T3J A;  3AE1 C;  1R8E A;  1DX7 A;  3K5B A;  4JF7 A;  2JO1 A;  2OTK E;  1N7S C;  1CW5 A;  5TIS H;  2XNX A;  1L0L J;  2WSS H;  1BGY G;  3L70 J;  1GW3 A;  4HKZ H;  3AEB C;  1EZV G;  4RJT A;  3OJA B;  1N86 A;  3KZI H;  2CPS A;  2W90 A;  2NRG A;  1IZN B;  3II6 A;  3VYI A;  3KHU A;  2M0B A;  2ZXE B;  1BGY D;  2AXT E;  3M06 A;  1W5C E;  1EZV D;  2Z5H A;  3IFM A;  1RF1 C;  2K1A A;  4HYT B;  2JEE A;  1IFP A;  2R3C A;  4ASV A;  1RF1 A;  2AEF A;  4JBZ A;  1N73 B;  2YXQ B;  5APW A;  1FZA A;  5AW1 B;  3KQG A;  3JSV C;  3SFD C;  4DZO A;  1BGY J;  1VPC A;  1VQ4 P;  1OZH A;  2ZFC A;  3WUT A;  3A0B H;  5E79 H;  5KLI B;  1ZME C;  3CCR P;  2P58 A;  2E75 D;  4XE5 B;  3SWK A;  4L74 A;  3AE5 C;  1FZE A;  3AEC C;  1NTZ G;  5AVW B;  1H88 A;  3LIE A;  2W8Z A;  3CCU P;  4PV1 D;  3L72 J;  2PAJ A;  4K3A A;  2JWA A;  3JC2 2;  4YXW H;  2QG4 A;  1FAV A;  2A06 E;  1L0N G;  3P7K A;  2OYI B;  5AVR B;  1NTZ D;  2Q7C A;  3V4Q A;  1SQB E;  5APX A;  4EI2 A;  3TK1 A;  5M1B A;  2RH0 A;  2FYU G;  2Y0E A;  3AE4 C;  1LWU B;  2WT7 A;  1L0N D;  2WPR A;  3B4S A;  1VQK P;  1IO4 A;  1OW6 A;  1NTM G;  1SQQ K;  2FYU D;  3H32 A;  4U7J A;  2ZYA A;  1SQX K;  4UB6 E;  4H0L B;  3TDK A;  2NZ2 A;  3CWB G;  4PD4 H;  1GW4 A;  3JCU E;  1NTZ J;  1HBW A;  2FXM A;  1NTM D;  2Q9I A;  3ABV C;  3CMA P;  1T2K D;  4H13 B;  3IR9 A;  1L0N J;  3V2P A;  3CWB D;  3CXH I;  1VDF A;  1LGH B;  4W7Y A;  3CC7 P;  1KD1 Q;  2FYU J;  2E74 B;  3SFE C;  1TU3 F;  1JEK A;  1KMI Z;  5KKZ C;  1LT9 A;  2I1J A;  1UIX A;  1SQP D;  1NTM J;  3C9I A;  1QLE D;  2NPS D;  1S3J A;  3CWB J;  5KAF H;  1AVO A;  4GDO A;  1BDD A;  1H0T A;  5DJU B;  2XKM A;  4D6T E;  2A45 I;  2IBZ G;  1FJK A;  1SQP J;  3L74 E;  2WWW A;  3AEF C;  2W6J H;  2HFE D;  1KYO E;  3CC4 P;  5AVY B;  3KXD A;  1JM0 A;  3ITK A;  1QEX A;  1FOS E;  2IBZ D;  4Y99 B;  1SP4 A;  4HJG H;  1HVV A;  5GTI E;  4EDF A;  1AJY A;  3WUV A;  3R4Y A;  2E5T A;  2A06 G;  2OYO A;  2R5D A;  1ZR2 A;  1NKZ B;  1QVG O;  2QE7 H;  3WMM 0;  1KTM A;  1EDK A;  2YKP A;  1FDO A;  2FFD B;  1P84 I;  5APY A;  2A06 D;  4WVZ A;  1IK7 A;  4OGQ D;  4AQR D;  1EC5 A;  3D71 A;  1N2D C;  2FYZ A;  1FE6 A;  1U57 A;  1ZRT D;  3BCC E;  1KC8 Q;  1JY3 O;  3CL3 D;  1NAF A;  1JB0 J;  2KYV A;  2M3B A;  2WPQ A;  2V7Q H;  2KNC B;  3CCL P;  4LGD E;  3UIA A;  2OYI A;  4GOE A;  1LWU C;  2HPC B;  2KI7 B;  1SQV K;  3FX0 A;  2E42 A;  2GUS A;  1AQT A;  1ZW0 A;  3S4R A;  1JY3 P;  2J5U A;  1S5L E;  1LWU A;  1VQ8 P;  1SLQ A;  5KAI H;  3E1I A;  1LTT C;  3AEE C;  4UB8 H;  2HOD B;  2JWD A;  2GA1 A;  3IAO A;  1BSH A;  3VMZ A;  3VTP C;  3EWK A;  2N1T B;  2YO3 A;  4U3F E;  1LTS C;  1RY3 A;  2KUB A;  1K8A Q;  4D6T G;  1EDJ A;  3P8C E;  2O3J A;  2ZJS E;  1SFC B;  1JCC A;  3RK2 C;  2K9J B;  1YIJ P;  2KOG A;  1T8Z A;  1ZLL A;  3EFG A;  4D6T D;  1M8O B;  1G1J A;  1S1C X;  2YIU B;  5KLV K;  2KSE A;  4XA4 A;  1KYO D;  1BGY E;  2D2C C;  2M3E A;  2E75 C;  4RKU J;  3CCQ P;  1IC2 A;  1SQX J;  2L5G B;  4YTP C;  1FDI A;  4WB4 A;  2O1K A;  4D6T J;  1VF5 C;  5DJT B;  3SSU A;  2B87 A;  2XDJ A;  1BCC J;  3PP5 A;  4XFJ A;  1Q7Y Q;  3L72 E;  3NFQ A;  3QWO C;  3BCC G;  1OWA A;  3CX5 I;  2WSF H;  4Z1M H;  4BRY A;  2I8D A;  2AEJ A;  3RK3 C;  1GL2 B;  1EDL A;  4C7R A;  2IDB A;  2KLU A;  3B5N C;  3BCC D;  2UWJ E;  5B5E E;  3B5N A;  1K05 A;  1L4A B;  1HWT C;  3D6Z A;  3CLQ A;  1DH3 A;  2IFN A;  2M5A A;  1KFM A;  2QSI A;  2FFD A;  4I7Z B;  3I55 P;  2XND H;  2ZT9 C;  3CME P;  5CJ4 A;  3BCC J;  2QRX A;  1J1D B;  3RK3 E;  1L0N E;  5CCH C;  1RE4 C;  3CCM P;  2FXO A;  1J1E B;  2LKM A;  2QM8 A;  3AE2 C;  2Z4E A;  1M57 D;  2FYU E;  5CCH A;  4U3F G;  2C9L Y;  3AEG C;  1EQ7 A;  2E43 A;  1IFD A;  1KIL B;  2WSC H;  1BE3 E;  3PJS K;  3LW5 J;  1LTJ C;  3PRJ A;  4U3F D;  2KXP B;  3MZW B;  2IZ0 A;  3HTK B;  3MD0 A;  3CWB E;  1FC2 C;  1LTJ A;  3P8C D;  2R44 A;  3NMD A;  1SQV G;  4C46 A;  1MFT A;  3M0D C;  3S9O A;  1YJW P;  3KPE A;  3NXS A;  1SQP E;  4U3F J;  3M0D A;  1SQV D;  1CZQ A;  1U7M A;  4KHX A;  3RL0 B;  2KS1 B;  1YQ4 C;  1G2C A;  2O1J A;  5CCG C;  3CXH D;  3M9Q A;  2XV5 A;  1CI6 B;  2GUV A;  2R32 A;  3HD7 B;  3L72 G;  1WMK A;  5CCG A;  5K5G B;  4W7Z A;  3RK2 D;  3A0H E;  1SQV J;  1M1J B;  2HR3 A;  4IFM A;  3N4X A;  4GOF A;  1JY2 O;  4OGQ C;  5CJ0 A;  4PD4 I;  3L72 D;  3VMA A;  2I1K A;  3HRN A;  2IBZ E;  2D2C D;  2P1J A;  2A45 G;  5AVS B;  4NPE A;  2OYH C;  1VQ5 P;  5H2F E;  2QJY C;  3GG2 A;  4WBA A;  1K9M Q;  2OYH A;  4QMA A;  1N8R Q;  2ITA A;  2P7J A;  1VF5 D;  1JY2 P;  5GTI H;  1NTK K;  2PFX A;  2G8Y A;  4ZKP A;  1NYH A;  2LR2 A;  5L8R J;  4YPC A;  2OAR A;  2HLO A;  1JY3 N;  1ZRT E;  2B9B A;  1URQ C;  3RK3 D;  2QA4 P;  1JMB A;  1PGJ A;  3OW2 O;  3B5N D;  2KB7 P;  1URQ A;  5AVQ B;  1BE3 G;  3U59 A;  1E79 H;  2G3A A;  1HGZ A;  2YMK A;  1Z56 A;  3GHG B;  2H7H A;  3GMA A;  2JR8 A;  3CX5 E;  4OH8 B;  2Z5I A;  1R5S A;  2BCC E;  1P84 D;  3MHV A;  2E76 C;  1NH4 A;  1KB9 H;  2WTY A;  1BE3 D;  1VQP P;  5AVT B;  2K88 A;  3A2A A;  3H1K G;  4H44 C;  1FOS F;  3HE5 A;  3HUS C;  4TLF A;  2ZT9 D;  1LP1 A;  4WY4 C;  1SQP G;  1YIT P;  5TIS E;  5CCH D;  3Q5R A;  3HUS A;  1LT9 C;  3H1K D;  5AW6 B;  5CBN A;  4WY4 A;  3L4F A;  1GU5 A;  3M91 A;  1BE3 J;  3KZI E;  4DJG A;  3H1H E;  3CD6 P;  5B66 E;  1BDC A;  1IFJ A;  1SQQ E;  3HTK A;  5KJ7 C;  1SQX E;  3H1K J;  2P10 A;  1S5L X;  2Q5U A;  5KJ7 A;  4JQ0 D;  1NU1 K;  2C0W A;  1AV1 A;  1MUU A;  1VQM P;  1BCC E;  4IOI H;  1ZR4 A;  1OVU A;  5AW3 B;  3F89 A;  2BEQ D;  3L35 A;  3IF4 A;  1GZL A;  2IX7 C;  3A0B E;  3V6I A;  3TF5 A;  1HUC A;  1PPJ E;  3VP8 A;  1YBK A;  5GTH H;  2KS1 A;  3HD7 C;  1N73 C;  4EIJ A;  3B8E B;  1NVO A;  5CCG D;  1YTZ T;  3HD7 A;  1N73 A;  1PP9 G;  1JUN A;  5AW7 B;  1VQO P;  5KLI C;  3TGU G;  1GK4 A;  1Y9B A;  1SS1 A;  1VQN P;  1YJ9 P;  1PP9 D;  2HYN A;  4IL6 E;  2O01 J;  2FYN B;  4HB1 A;  1HTL C;  2H43 A;  3L37 A;  2L91 A;  3TGU D;  1PZQ A;  2KLV A;  2BCC G;  2Q6Q A;  4GOD A;  1QGK B;  2VRS A;  2MJZ A;  2WPS A;  2OYI C;  1LNQ A;  4LC1 A;  4PD4 E;  3VP9 A;  3MP7 B;  3TNU B;  1MKM A;  3CX5 D;  5B5E H;  2A45 H;  2BCC D;  1FZC B;  1Q86 Q;  5CHX A;  1PP9 J;  2QJP B;  1XTG B;  1KQF B;  2Y9Y A;  4K35 A;  3TGU J;  4R4M A;  1DD3 A;  3BVH A;  2QEX P;  3IN6 A;  2LXB A;  3Q2Y A;  2NPS B;  1URQ D;  1NKN A;  3G9R A;  3PHL A;  1IFI A;  1K73 Q;  1OW7 A;  3GHG C;  3H1H G;  4H0L C;  2RMZ A;  4WWI A;  2R5B A;  1KZU B;  2BCC J;  4N78 D;  1SQQ G;  3GHG A;  4MN4 C;  3VN0 A;  4H13 C;  1SQX G;  1N7S B;  1OX3 A;  2N9Y B;  2WSE J;  3H1H D;  3CC2 P;  3V2Q A;  1PV3 A;  2E76 D;  3AE6 C;  3W68 A;  3A5T A;  4H44 D;  1SQQ D;  1NTK J;  2E74 C;  1UII A;  1BCC G;  1LTI C;  1M1K Q;  2V4H A;  1SQX D;  3H1L D;  3O6Q B;  4WY4 D;  3RGU A;  2YKQ A;  1PGO A;  1NHL A;  2C9N Y;  1SQV E;  2BEZ F;  1RF1 B;  1BCC D;  1PPJ G;  3H1H J;  4A7P A;  1OIP A;  1KIL D;  1ZOY C;  2OTJ P;  3Q5P A;  1PGQ A;  1SQQ J;  4NPF X;  3CXH E;  2WVR A;  1LT1 A;  3H1L J;  1PPJ D;  3WUU A;  3GF3 A;  5KJ7 D;  1KV4 A;  2Q3E A;  2AXT H;  1QVF O;  1LTG C;  3V5B A;  3Q1M A;  3FGA D;  1NTZ K;  5AVU B;  4IFF A;  1ZXG A;  3TYY A;  4Y99 C;  1FJP A;  3A0H H;  3OA7 A;  2J59 M;  2PP6 A;  3AE7 C;  4O9B A;  3RBX A;  1RHZ B;  1MV8 A;  1LJ2 A;  3CCE P;  1NU1 D;  3I5C A;  3CCV P;  1USE A;  2KZJ A;  2JDI H;  2OQQ A;  5KLV E;  3HD7 D;  1IK9 A;  1M7L A;  1W2B O;  1X0T A;  3HE4 B;  1S9K D;  2ZAE B;  3H1J E;  2WT7 B;  2FFD C;  3V2N A;  3RBZ A;  3L36 A;  1NTM K;  2CK3 H;  3CCJ P;  1S72 P;  4AYC A;  4PD4 D;  5AW9 B;  3H32 B;  1KFN A;  2E5Y A;  3G6E P;  1NU1 J;  1OW8 A;  3G4S P;  1X8Y A;  3D70 A;  4L73 A;  1RF0 C;  3PLN A;  3F5H A;  3VMY A;  3L71 G;  4AUW A;  1WRG A;  2B88 A;  4ZKU A;  4BXL A;  1DIP A;  5KAI E;  3RL0 g;  1RF0 A;  5AVZ B;  3D6Y A;  1SVF A;  3R2P A;  2QIW A;  2KZI A;  1P84 E;  3L71 D;  1YJN P;  5APV A;  2KNC A;  1KOR A;  1X22 A;  2GM4 A;  1NWQ A;  4I2L C;  3G3Z A;  4PJ0 E;  2H89 C;  4I1L A;  4UB6 H;  3JCU H;  2HPC A;  2XZR A;  1GK6 A;  2P2U A;  3FXE A;  2W27 A;  3H1K E;  1NOH A;  1HH0 A;  3L75 G;  2JP3 A;  1FS0 E;  1H0T B;  3S1K A;  2WPV B;  1OXZ A;  3L71 J;  2DW3 A;  2N1T C;  5CMZ A;  1IFM A;  4CPG A;  4H0L D;  2HOD A;  3BRT B;  1QL1 A;  1S2E A;  2PGD A;  2N1T A;  3L75 D;  3VOP A;  2CPB A;  1N7S A;  5BU8 B;  1SFC C;  1KQG B;  4H13 D;  2P67 A;  5AW8 B;  2PRR A;  3N7N A;  2AEM A;  1SFC A;  3M0A A;  1FDM A;  2E74 D;  2K9J A;  3QH9 A;  5B66 H;  3O6Q A;  5AW4 B;  4R4L A;  3CCS P;  2YIU C;  1PGP A;  1RQU A;  2KSJ A;  1AFO A; 
#chains in the Genus database with same CATH homology
 1LWU C;  1YYC A;  2HPC B;  1SQV K;  2O01 H;  2E42 A;  1SQB K;  2GUS A;  1URQ B;  5AVX B;  5AVV B;  1N7L A;  1T3U A;  1JY3 P;  1IFJ A;  1YTZ I;  3HTK A;  5KJ7 C;  1LWU A;  2YKO A;  3KYQ A;  1IJD B;  3MIW A;  4C7N B;  1FZF A;  1SLQ A;  1GDT A;  1GTW A;  2M8R A;  2Q5U A;  5KJ7 A;  3E1I A;  1NU1 K;  1LTT C;  2C0W A;  1GU4 A;  2HOD B;  2J58 A;  1T2K C;  3O8Z A;  1MUU A;  3VMZ A;  3VTP C;  5APU A;  2N1T B;  2HG5 D;  2YO3 A;  3HE5 B;  1LTS C;  1ZR4 A;  2C0X A;  1SQP K;  5AW5 B;  5BVZ A;  1CSB A;  1FBM A;  4I6M C;  4GT1 A;  5AW3 B;  1DEB A;  1JMM A;  1RY3 A;  3L35 A;  1GZL A;  2IX7 C;  1QL2 A;  2IPP A;  2WZ7 A;  1FZC C;  3P8C E;  3HUS B;  1GL2 C;  4EOT A;  3H6P A;  1SFC B;  1JCC A;  1PFI A;  1HUC A;  3T97 A;  2W6B A;  3VP8 A;  4WY4 B;  1J2J B;  3TNU A;  1FZG A;  3RK2 C;  3HD7 C;  1ZV8 A;  5APT A;  3V4W A;  1RE4 A;  1JTH B;  1FZC A;  4HH2 A;  1N73 C;  1LT9 B;  1GL2 A;  4EIJ A;  2KOG A;  1IFN A;  3B8E B;  1T8Z A;  1ZLL A;  5CCG D;  3EFG A;  2W6A A;  2NPS C;  1L4A C;  1G1J A;  5APS A;  2JJL A;  4W80 A;  4JYC A;  1YTZ T;  3U1C A;  3HD7 A;  5AW0 B;  3A7O A;  1N73 A;  5KLV K;  4XA4 A;  2WSE H;  2NPS A;  1T3J A;  1G1I A;  1L4A A;  1JUN A;  3HE4 A;  5AW7 B;  1DX7 A;  4DOJ A;  4JF7 A;  1H89 A;  1GK4 A;  1IC2 A;  1N7S C;  1CW5 A;  2L5G B;  1J1D C;  2XNX A;  2HYN A;  4WB4 A;  3OAK A;  2O1K A;  1HTL C;  1GW3 A;  2YO2 A;  3L37 A;  2H43 A;  1J1E C;  1AQ5 A;  1E5W A;  2KLV A;  2XDJ A;  1N86 A;  3OJA B;  3PP5 A;  2CPS A;  3BRV B;  3LW5 H;  1LTB C;  1GD2 E;  1JCD A;  2VRS A;  3II6 A;  3VYI A;  3NFQ A;  2ZXE B;  2MJZ A;  2WPS A;  2OYI C;  1OWA A;  2WSF H;  4LC1 A;  1KIL C;  3M06 A;  4N78 E;  5APQ A;  3VP9 A;  2Z5H A;  3IFM A;  3TNU B;  1RF1 C;  3LID A;  1A02 J;  3RK3 C;  2A45 H;  1FZC B;  1GL2 B;  1NO4 A;  5CHX A;  4HYT B;  1H8A A;  4C7R A;  2JEE A;  1XTG B;  1KIL A;  2R3C A;  3B5N C;  3RK2 B;  1RF1 A;  1ZN5 A;  1JNM A;  3TSI A;  1N73 B;  5APW A;  3BVH A;  1WT6 A;  3B5N A;  1FZA A;  2NPS B;  5AW1 B;  1L4A B;  1URQ D;  1HWT C;  3KQG A;  3CLQ A;  1JOC A;  1NKN A;  4DZO A;  1DH3 A;  1IFI A;  3GHG C;  2IFN A;  1VPC A;  2R5B A;  2ZFC A;  1KFM A;  1KZU B;  4N78 D;  2FFD A;  3GHG A;  2IFM A;  3VN0 A;  1X79 B;  1N7S B;  4XE5 B;  5CJ4 A;  2N1T D;  1J1D B;  3V2Q A;  3RL0 C;  5CCH C;  1N7S D;  1RE4 C;  1FZE A;  3A5T A;  5AVW B;  1J1E B;  2LKM A;  2QM8 A;  2N9B A;  1H88 A;  2Z4E A;  3LIE A;  1LTI C;  5CCH A;  2C9L Y;  1SFC D;  1EQ7 A;  2PAJ A;  4WY4 D;  1FAV A;  2E43 A;  1CI6 A;  3P7K A;  2OYI B;  5AVR B;  1IFD A;  1M1J C;  2YKQ A;  1KIL B;  2Q7C A;  2WSC H;  1NHL A;  3V4Q A;  2C9N Y;  1RF1 B;  5APX A;  3TK1 A;  1LTJ C;  3RK3 B;  1KIL D;  3P8M C;  4N6J A;  3HTK B;  3MD0 A;  1M1J A;  1LWU B;  3B5N B;  4GIF A;  2WT7 A;  2WPR A;  1LTJ A;  3P8C D;  3NMD A;  5KTB A;  2YNY A;  1IO4 A;  1SQQ K;  3H32 A;  1W2E A;  4C46 A;  3M0D C;  5KJ7 D;  1SQX K;  3U1A A;  3KPE A;  4C7N A;  1L0L K;  1GW4 A;  3NXS A;  1LTG C;  3V5B A;  1HBW A;  1FU1 A;  1S9K E;  2FKW B;  2FXM A;  3M0D A;  1RE3 C;  1NTZ K;  1JO5 A;  5AVU B;  1MFZ A;  3KDP B;  2Q9I A;  1X9V A;  4IFF A;  1T2K D;  3SWY A;  3TYY A;  3IR9 A;  1CZQ A;  4Y99 C;  3V2P A;  1FJP A;  4KHX A;  3RL0 B;  1RE3 A;  1VDF A;  1LGH B;  4JYB A;  1G2C A;  3P32 A;  2O1J A;  5CCG C;  3OA7 A;  4W7Y A;  1LTA C;  2J59 M;  2PP6 A;  3M9Q A;  4O9B A;  5AW2 B;  2XV5 A;  1CI6 B;  2XU6 A;  1MV8 A;  2GUV A;  3SWF A;  2YMY A;  2R32 A;  3I5C A;  1KQL A;  1GL2 D;  3HD7 B;  3NTN A;  3MUD A;  5CCG A;  4W7Z A;  1JTH A;  3RK2 D;  3HD7 D;  1LT9 A;  2OYI A;  1IK9 A;  2I1J A;  1M7L A;  1M1J B;  3HE4 B;  1S9K D;  2FFD C;  2WT7 B;  4IFM A;  3C9I A;  3CI9 A;  3N4X A;  3V2N A;  1JY2 O;  2NPS D;  1LTJ B;  1L4A D;  5CJ0 A;  3L36 A;  2WIT A;  1NTM K;  3M9H A;  4LLH A;  2I1K A;  3HRN A;  4AYC A;  5AW9 B;  3H32 B;  2P1J A;  2A45 G;  1KFN A;  3BAT A;  5AVS B;  3A3Y B;  2OYH C;  2XKM A;  5BU5 A;  1X8Y A;  4WBA A;  2A45 I;  1RF0 C;  2OYH A;  3VMY A;  3V2R A;  1FJK A;  4AUW A;  1WRG A;  2WWW A;  4ZKU A;  1HGV A;  2HFE D;  2P7J A;  3MTU E;  5AVY B;  1JY2 P;  1NTK K;  1RF0 A;  5AVZ B;  1G2C B;  4ZKP A;  1XTC C;  1SVF A;  3R2P A;  1FOS E;  4Y99 B;  4RES B;  2OAR A;  2HLO A;  5APV A;  1SP4 A;  1JY3 N;  2GM4 A;  1NWQ A;  1HVV A;  4I2L C;  3G3Z A;  1URQ C;  4I1L A;  3RK3 D;  2HPC A;  2R5D A;  2XZR A;  1GK6 A;  1ZR2 A;  1NKZ B;  3B5N D;  2P2U A;  2POH A;  2KB7 P;  1URQ A;  2BAS A;  5AVQ B;  2W27 A;  2H8P D;  2KP8 A;  1NOH A;  3U59 A;  3WMM 0;  1HH0 A;  1HGZ A;  2YKP A;  2FFD B;  1Z56 A;  3GHG B;  4IFD K;  5APY A;  2H7H A;  1OXZ A;  1JY2 N;  2Q3I A;  2N1T C;  5CMZ A;  4OH8 B;  2Z5I A;  1IFM A;  3MGN A;  1NH4 A;  4AQR D;  2HOD A;  2WTY A;  3BRT B;  1QL1 A;  1N2D C;  5AVT B;  3A2A A;  2FYZ A;  1FOS F;  2OYH B;  2N1T A;  1A02 F;  3HE5 A;  3HUS C;  3VOP A;  2CPB A;  1N7S A;  5BU8 B;  1SFC C;  4GKG A;  1JY3 O;  3CL3 D;  3EQ2 A;  1NAF A;  1L0N K;  4WY4 C;  2P67 A;  3M9B A;  5AW8 B;  3RL0 D;  5CCH D;  3HUS A;  2KYV A;  1LT9 C;  1HJB A;  3BAS A;  2M3B A;  2WPQ A;  3M0A A;  1MZ9 A;  1SFC A;  3N7N A;  5AW6 B;  2QM7 A;  2FYU K;  4WY4 A;  1FDM A;  4N3Y B;  3L4F A;  4M3L A;  5AW4 B;  1GU5 A;  1FZB A;  3VMX A;  3M91 A;  4LGD E;  4B86 A;  1AFO A;  2KSJ A;  3UIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...