5BU8B

Hk620 tail needle crystallized at ph 7.5 and derivatized with xenon
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
AYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords DNA stabilization protein
total genus 57
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bu8B01
2JEEA 3OJAB 5BU5A 3P8CD 3C9IA 3U59A 4ZKUA 1IC2A 5BVZA 4N3YB 5KTBA 4I1LA 3U1AA 1X79B 3N7NA 1WT6A 5BU8B 3HRNA 3U1CA 3VP9A 2FXMA 3VP8A 2POHA 3BATA 3BASA 3N4XA 4N78D 1NKNA 4O9BA 4GIFA 4ZKPA
chains in the Genus database with same CATH superfamily
3H1JG 2JR8A 2R5BA 3H1HE 1KILE 2JEEA 1GTWA 1RF1A 2A45H 2BCCJ 3H1JJ 2P10A 3PTZA 4IOIH 3SFDC 2HPCA 1R8EA 1EDJA 3V2RA 1E5WA 5CBNA 1LTJB 2BEQD 2R44A 1KQLA 3BCCG 4AUWA 3NTNA 1ZW0A 3L74D 2WTYA 4MN4C 2ZT9C 3M9QA 3MD0A 1DEEG 3LIEA 3RBXA 5AW4B 3G6EP 3CMAP 4NPEA 2QM7A 3CCRP 2OYIC 1JY2P 2KLVA 3H25A 1SQQJ 1NTKJ 3WUVA 2E75B 4W7ZA 5KAIH 1S9KE 3P8CE 3RGUA 1YJWP 2N9YB 1WRGA 3H1LJ 3MTUE 1L0LK 1LTIC 1SQPJ 3IFMA 2I1KA 4XA4A 5CJ4A 2QA4P 1OVRA 1BCCJ 1G2CA 1LWUB 3A7OA 1AVYA 3N4XA 1DH3A 3TGUJ 1S4XA 2E74D 2H8PD 2YXRB 1W2BO 4PJ0E 2C0WA 4H13C 1FZCB 2Q3IA 1LTGC 1FZCA 3SWFA 1SQVJ 5KAIE 2N1TC 4OWFA 3TGUG 2WPQA 2KB7P 1LNQA 3CLQA 2XNXA 2IFMA 3P8CD 2ZT9B 2E76B 1EZVI 2KK7A 2FYUJ 3C9IA 2IFNA 2KOGA 2V7QH 3H1LG 5GTIE 1KD1Q 2BCCD 1RE3A 1GL2C 1HTLC 2A06G 2WPSA 3A0BH 4KJMA 5L8RJ 3RL0g 2NPSD 3H1HG 4M3LA 3VMAA 3I55P 2WSSH 2Y9ZA 4U3FG 3VOPA 2KNCB 3FXDA 1AV1A 1IFMA 2SPZA 3AEGC 2KYVA 3Q2YA 1Z56A 2C9NY 3KZIH 2KI7B 3H1KG 3W68A 1CW5A 3D6YA 1T3UA 3GLMA 1LGHB 2GUVA 1OVVA 3EFFK 1NTZG 2VRSA 3H1HJ 4ZKPA 1Q90D 3GHGB 3A0BE 4PJ0H 1OW7A 2IDBA 3IR9A 2JDIH 4I7ZC 2FFDA 1JY2O 1GK6A 2YMYA 3AEFC 3M0DC 4A7PA 1YI2P 3AEDC 2FYUG 3SFEC 1J1DB 3CL3D 3L73J 5APQA 1SQVE 3Q1MA 1L2PA 3L75D 2Z5IA 3PJSK 1NHLA 1NTZJ 1VQMP 1GW4A 1PGQA 3IN6A 3MGNA 2DW3A 5APSA 3HTKB 1SQVG 3Q5PA 1EZVD 1FZFA 3W67A 2WPVB 3QWOC 2GA1A 1U7JA 1OVUA 3PH0A 3HUSA 2UWJE 1SFCB 2FYUD 4OVNF 1BGYJ 1SQXE 4DCKA 2P67A 4WWIA 3KZIE 3ABVC 1FZCC 5M1BA 1FZGA 4IFMA 5APUA 1SQQE 1LWUC 1W2EA 1JY3P 3M0AA 5CCHC 2LXBA 2KZJA 1ZRTE 1SVFA 1SFCC 2J5UA 2E43A 4HYTB 3RK3E 1PPJG 2MKVA 3LIDA 4JYBA 1NKZB 2QJPB 1KQFB 4BRYA 3L74E 1RE3C 4WBAA 1JNMA 2QJYB 1GL2B 3AEAC 4OGQC 1KILD 1R5LA 3MUDC 3OW2O 4PD4H 3CWBG 1QVGO 1YHQP 1LT1A 1BGYG 2K9JA 3PRJA 5B66E 1SQBG 1N7SB 2A45G 2IZ0A 2CPBA 1N7SA 3KYQA 4H0LC 4N3YB 4HKZH 3L72J 3BRTB 1PFIA 1G1IA 1EDKA 4H44D 2XNDH 1GL2A 1RHZB 3L71J 3KXDA 3FXEA 2ZFCA 3VP8A 1CSBA 3BCCE 4NPDA 4IFDK 3HD7A 4EDFA 2FFDC 1NO4A 2M8RA 5KJ7C 1QLED 1BGYD 1VQ8P 1U7MA 3CC2P 1JY3O 2A45I 2CK3H 4O9BA 2HR3A 3KHUA 3ZDMA 3B4SA 2YNYA 3H1LE 3L75G 3L70E 1FC2C 2GUSA 2IBZI 2E75C 2QVAA 3TNUA 5TJHA 5KLVJ 1RF1C 4PV1C 1JTHB 4PD4D 4R4MA 2OYIB 1HH0A 3PHLA 2E5YA 5CCGD 2IBZG 2J59M 3BRVB 4EOTA 4R4LA 2AEFA 4Z1MH 1YITP 3CCUP 2Z4EA 3FWLA 1NTMK 3B5NA 4PD4E 1PIXA 3H32A 1Y9BA 1NGMB 1FE6A 3L70D 1VQOP 3H1KD 2LXCB 2PFXA 3VMZA 1OW8A 2WITA 3U1AA 2H7HA 4Y28J 1MKMA 1EZVE 2N1TB 1RE4C 2QM8A 4JPZB 4QMAA 3L72E 4C7NA 3CPWO 2OYHA 2OYHB 1VF5B 1L0LE 1N2DC 1NTKG 1OIPA 4H13B 3LW5H 1SLQA 3CXHD 4LGDE 3I5CA 2A06D 2WPRA 2BEZF 1SQVD 2R5DA 1SFCD 3MP7B 3I56P 1FZBA 3KPEA 1NU1E 1SQXG 2AXTH 1J2JB 2IYPA 1HGZA 1PZQA 3OAKA 4W80A 1FJKA 3L75E 1OWAA 4WY4D 3PLNA 3NMDA 3SSUA 4C7NB 3MUDA 1OFCX 1PGPA 2QSIA 2KS1A 2W83C 4RKUJ 1N7SC 1SQBD 2WT7A 1SS1A 2N1TD 1JM0A 1JMBA 1FZAA 1EDIA 2NPSA 5EFWB 1KYOH 2L5GB 3S9OA 3G9RA 5B66H 4HB1A 5BVZA 2O01J 3CCVP 3RK2B 2OTJP 1FDMA 1NH4A 1QX8A 1N73B 3V6IA 1KORA 2B87B 1NTME 1LJ2A 2KLUA 2P58A 2XV5A 3HE4A 2ZYAA 2KIKA 1BSNA 3HD7C 5APYA 2XDJA 2QIWA 3H1HD 3HRNA 3KDPB 3CCMP 2JWAA 1NU1D 3R4YA 4L75A 1J1EC 1VF5D 2BCCE 2WZ7A 3VMYA 2FYNB 1ZXGA 3BATA 1KB9E 3SWKA 3TDKA 2AEJA 2ZXEB 2QJKB 3L74G 3GG2A 1KTMA 4N78D 4YPCA 3CWBJ 5KLIC 5AVZB 3NFQA 1OW6A 1IK9A 3L71E 1YYCA 2YXQB 1IO4A 4HH2A 5CHXA 2XKMA 2NRGA 1MFZA 2FBWC 2WMMA 2M3EA 3NXSA 3RK3B 2IZ1A 1YQ4C 1CI6A 1M1JB 1DD3A 1SQQK 2D2CD 3HTKA 1KFNA 2YKPA 1GZLA 3M9BA 1GW3A 4CPGA 4GOFA 1KQSO 1J1DC 3B5ND 5AW5B 2N1TA 1A02F 1SQBJ 4BWNA 1S3JA 3AE3C 2QEXP 1AQTA 4Y99B 3AE6C 3M9HA 2HODB 4I7ZB 3L73D 3O6QB 4GKGA 4WY4C 1JB0J 2E42A 1JCDA 2O01H 4XE5B 1H8AA 3JC22 1KB9H 1FOSE 4JQ0D 3CD6P 1SQVK 4D6TE 1T2KD 2JKVA 1JUNA 1VQPP 3OA7A 1LT9C 1N7SD 1PV3A 1SFCA 1K05A 1N7LA 2JP3A 3H1JE 1DD4A 2KS1B 4PD4I 2E74B 3BCCJ 4U3FD 3SWYA 4C7RA 1L0NJ 1K73Q 3H1IJ 1VQ9P 1H0TB 2G8YA 1GL2D 2YO2A 1JOCA 1ZLLA 2BCCG 1K9MQ 1N73C 1L4AB 4DZOA 1KYOE 1NTMD 3G4SP 4ZNCA 1JY3N 1EXIA 1KILC 2KSJA 3L73E 4D6TD 2K1AA 5AW0B 3D70A 1YJNP 2FKWB 1KYOI 1NWQA 1M7LA 3GF7A 1MZ9A 5B5EH 3TNUB 2ZYGA 1NTKK 3EWKA 3RK3D 3MHVA 3RBZA 2HPCB 2K9JB 1OXZA 5AW1B 5KLVD 1JEKA 2XZRA 1Q86Q 4NPFX 1LTAC 1BE3D 1MUUA 1NAYA 1P84I 2WSEH 3C1LA 1X8YA 4IL6H 4UB8E 4N6JA 1IFJA 3HUSC 5KJ7D 3CMEP 2XU6A 2FYZA 3V2NA 4JF7A 1SQPD 1G1JA 1GK4A 1AQ5A 3AE5C 1KILA 1FS0E 3L71D 1FAVA 1Q82Q 2KSEA 3H1IG 3B5NC 2P1JA 2Y0DA 3ITKA 1L0ND 1XTGB 2KUBA 2AXTE 2R32A 3BCCD 4U3FJ 3CCEP 1G2CB 1LWUA 3H1ID 5CCHA 1BDCA 1PPJE 2Q5UA 3TK1A 1KFMA 3IAOA 3M91A 1VQNP 2YKQA 4N78E 3VYIA 3LW5J 2WWWA 1GD2E 4PV1B 3GW6A 2C9LY 2W6AA 3H1JD 1ZP0C 5B5EE 1AFOA 3WUUA 4H13D 1KC8Q 2PRRA 1M1JA 1VQ4P 3RL0C 3CX5H 4TLFA 5CMZA 4L74A 2O1JA 1VQ7P 1YIJP 1M56D 2L91A 4IL6E 4UB8H 4WY4A 3V4QA 4WY4B 2RMZA 1N73A 1BE3J 2O3JA 3B8EB 1HWTC 1S2EA 1KB9I 4KHXA 4RESB 4D6TG 3HE5B 3G71P 1LP1B 3L36A 3P8MC 2OQQA 4TT3H 1LT9A 2IYOA 2ZVNB 2WT7B 2WSEJ 3L37A 5KJ7A 1Q81Q 5CJ0A 3M06A 2OTLP 2YIUC 2OTKE 1L0NK 1JCCA 3CCSP 1TU3F 1SQXK 1QL1A 1NOHA 1SQQG 2HG5D 4AYCA 3AE1C 1NU1G 2R3CA 2AXCA 3II6A 1K8AQ 1L0NE 5AW7B 2QJYC 1SQPK 4OH8B 2W6BA 1U57A 4K35A 3VN0A 1XTCC 2C0XA 3N7NA 5APVA 1FOSF 1PPJD 1BSHA 1DX7A 1Q2NA 1URQB 5AW3B 2E76D 4ASWA 1ZN5A 5APXA 3L72G 3AEBC 1BCCD 3HD7D 3TSIA 1IFPA 1T3JA 3L70G 3CXHI 3BASA 3S4RA 2WVRA 1HBWA 3G3ZA 1OX3A 5KLVK 4LC1A 1QVFO 1J1EB 1OZHA 2D2CB 3AECC 3M0DA 2Q3EA 2M5AA 1PP9G 1URQC 4ZMDA 1X22A 2W6JH 3JSVC 5KKZB 2HFED 1KILB 1NTMJ 1YTZT 1S9KD 1MFTA 1PGJA 2K37A 2W8ZA 1PL5A 1FU1A 1SQXD 3MIWA 4UB6H 4AQRD 2FFDB 2IPPA 5AW8B 1AVOA 4L73A 3K5BA 2WSCJ 2O1KA 1S1CX 1RQVA 1SQBE 5AVQB 1JY2N 1SP4A 1FZEA 2QRXA 5AVRB 1KYOD 1RH5B 1AA0A 3WUTA 1ZOYC 5KKZC 2OARA 3FWNA 1QEXA 3RL0D 1H88A 3A3YB 5BU8B 1VQKP 1KV4A 2D2CC 5K5GB 1EDLA 3AEEC 3B71A 1S5LE 1HUCA 2I8DA 3VP9A 2FXMA 1YTZI 2B9BA 2FY8A 3FX0A 1L0LJ 2BASA 3CX5E 3GHGC 4JYCA 4UB6E 5E79H 4YTPC 5TISE 1RQUA 1M90Q 1IFNA 2LR2A 3CWBD 3RL0B 2FYNC 4EYYQ 5AW6B 4RO0A 1LTTC 2IBZD 2JWDA 3TF5A 3C8VA 4Y99C 1HGVA 4D6TJ 1L0LD 1HVVA 2HYNA 4GODA 3CX5I 3D6ZA 1RE4A 1HJ0A 2B87A 2J58A 3HE4B 2OYHC 1L0LG 1NTKE 1T6AA 1ZRTD 2K3RA 5H2FE 2GM4A 3TGUE 2K9YA 1SQQD 3GMAA 5TISH 1K04A 2NPSB 1FDOA 5DJTB 1IZNB 2WSFH 4EIJA 3V4WA 2V7QJ 3GHGA 2OGUA 1X79B 2P7JA 1WMKA 2NZ2A 3HE5A 1WT6A 5C39A 1P84H 1QL2A 2P2UA 2RH0A 2ITAA 1BE3E 1X0TA 4H0LD 3EFGA 1L4AA 5H2FH 1NAFA 1KMIZ 1NU1J 3USSA 1MV8A 3P7KA 1ZMEC 2Q6QA 1GDTA 3V2PA 2WQYC 1URQD 5E79E 1UIXA 2KP8A 2E5TA 2YMKA 1NTKD 1KB9D 2M0BA 3PP5A 1IK7A 1CZQA 2ZVOB 3VMXA 1VPCA 2ZJSE 3AE9C 1VDFA 1RF1B 1ZV8A 3T97B 1PP9D 3OJAB 5BU5A 2ZT9D 3CX5D 4I2LC 3KQGA 3TYYA 1FBMA 1KZUB 3O8ZA 4U3FE 5DJUB 3S1KA 2B88A 2W27A 4ZKUA 1IC2A 2Y0CA 2LKMA 3H32B 3CCQP 3B5NB 1LTBC 1KN7A 1AJYA 4YXWH 1NTZK 1SQBK 1L4AC 1BCCG 1M57D 1LTJC 4WVZA 1USDA 2Q1KA 3L71G 1S5LX 2YO3A 1JTHA 1SQPG 4ASVA 2OYIA 1USEA 5AW2B 1JO5A 1Y47A 3HUSB 4B86A 2E74C 3MZWB 1YQ3C 2G3AA 1VQ6P 1RF0C 1VQ5P 1EZVG 2FXOA 4GDOA 1VL2A 3E1RA 5KAFE 2PAJA 3AE4C 3FGAD 3A5TA 1NKNA 1BDDA 1OMIA 2ZYDA 3CI9A 4GIFA 3P32A 1A02J 1DIPA 1P84D 3R2PA 4DOJA 4W7YA 3JCUH 1M1KQ 2Z5HA 4HJGH 3AE8C 3CXHE 3H6PA 2RKLA 2V4HA 2OYOA 1D7MA 3A2AA 5AVSB 5CCHD 4DJGA 1JMMA 1YJ9P 1T8ZA 5GTHE 1KQGB 1NTZD 2NPSC 3Q5RA 5KAFH 1PP9J 3CCJP 1QGKB 2Y9YA 4KT0J 1BCCE 3F89A 3AE7C 1GU4A 3L72D 4L76A 3RK2D 4OGQD 3RK3C 4OGQB 3D71A 4I1LA 4C46A 3CWBE 3L74J 2KNCA 3CXHH 2B89A 3L4FA 5APWA 1P84E 4RJTA 1LT9B 2M5AB 3GF3A 3UIAA 1NVOA 5AVUB 3WMM0 3CCLP 3U1CA 5CCGA 1IFDA 5KLIB 3F5HA 3H1LD 3A0HH 2I1JA 1RY3A 4H44C 2QJKC 3IF4A 1LTSC 5AW9B 1VQLP 1EXJA 5CBOA 2H89C 1ZR4A 2AEMA 1NU1K 1BGYE 3L73G 3JCUE 1URQA 2N9BA 3QH9A 4EI2A 1EQ7A 4IFFA 2K88A 4LLHA 3TGUD 3CC4P 4XFJA 3T97A 3HD7B 1S5LH 4H0LB 1L4AD 2WSCH 3V5BA 1HJBA 1LTJA 2HODA 1M1JC 1ZR2A 4IL6X 3Q3DA 1CI6B 2IBZE 1BE3G 5AVTB 1UIIA 2MJZA 1NYHA 1IJDB 4DT0A 3VTPC 3CC7P 2QJPC 1PGOA 2QG4A 2KZIA 4K3AA 4WB4A 3E1IA 2A06E 1Q7YQ 4YXDC 1DEBA 5APTA 3O6QA 1GU5A 4U7JA 1T2KC 2M3BA 3E7KA 2KXPB 3V2QA 3WU2E 1HF9A 1LP1A 1YBKA 3H1IE 2POHA 1SQPE 1EC5A 2CPSA 2HLOA 1L0NG 2WSFJ 3A0HE 3Q5SA 3BVHA 2FXPA 4H44B 3L35A 1Y8AA 2H43A 2IX7C 5AVWB 2FYUK 1H0TA 3H1KE 2H88C 5AVYB 1W5CE 2YKOA 4JBZA 4BXLA 5KLVE 4BRYB 2Q7CA 3RK2C 4GOEA 2Y0EA 5GTHH 1X9VA 1SQXJ 3U59A 2YIUB 3AE2C 1M8OB 2RN0A 5GTIH 3L75J 5KLVG 1R5SA 2QE7H 3L70J 2FYUE 5AVXB 1N8RQ 1E79H 2E76C 2W90A 3H1KJ 5KTBA 4GT1A 5AVVB 2JJLA 1S72P 1IFIA 2PGDA 2JO1A 1NTZE 1NJIQ 2ZXXA 2PP6A 1N86A 3EQ2A 2R3SA 3WU2H 4I6MC 2ZAEB 1NTMG 1H89A 2Q9IA 1GMJA 2E75D 2O01N 4PV1D 1FJPA 1FDIA 1PP9E 5CCGC 1VF5C 1RF0A
chains in the Genus database with same CATH topology
2R5BA 2JEEA 1GTWA 1RF1A 2A45H 2HPCA 3V2RA 1E5WA 4AUWA 1LTJB 1KQLA 3NTNA 2WTYA 3M9QA 3MD0A 3LIEA 5AW4B 2QM7A 2OYIC 1JY2P 2KLVA 4W7ZA 1S9KE 3P8CE 1WRGA 3MTUE 1L0LK 1LTIC 3IFMA 4XA4A 2I1KA 5CJ4A 1G2CA 1LWUB 3A7OA 1DH3A 3N4XA 2H8PD 2C0WA 1FZCB 2Q3IA 1LTGC 1FZCA 3SWFA 2N1TC 2WPQA 2KB7P 3CLQA 2XNXA 2IFMA 3P8CD 3C9IA 2IFNA 2KOGA 1RE3A 1GL2C 1HTLC 2WPSA 2NPSD 4M3LA 3VOPA 1IFMA 2KYVA 1Z56A 2C9NY 1CW5A 1T3UA 1LGHB 2GUVA 2VRSA 4ZKPA 3GHGB 3IR9A 2FFDA 1JY2O 1GK6A 2YMYA 3M0DC 1J1DB 3CL3D 5APQA 2Z5IA 1NHLA 1GW4A 3MGNA 5APSA 1FZFA 3HTKB 3HUSA 1SFCB 2P67A 1FZCC 1FZGA 4IFMA 5APUA 3M0AA 1LWUC 1W2EA 1JY3P 5CCHC 1SVFA 1SFCC 2E43A 4HYTB 3LIDA 4JYBA 1NKZB 1RE3C 4WBAA 1JNMA 1GL2B 1KILD 1N7SB 2A45G 2CPBA 1N7SA 3KYQA 4N3YB 3BRTB 1PFIA 1G1IA 1GL2A 2ZFCA 1CSBA 4IFDK 3HD7A 2FFDC 1NO4A 2M8RA 5KJ7C 1JY3O 2A45I 4O9BA 2YNYA 2GUSA 3TNUA 1JTHB 2OYIB 1HH0A 5CCGD 1NWQA 2J59M 4EOTA 3BRVB 2Z4EA 1NTMK 3B5NA 3H32A 3VMZA 2WITA 3U1AA 2H7HA 2N1TB 1RE4C 2QM8A 4C7NA 2OYHA 2OYHB 1N2DC 3LW5H 1SLQA 4LGDE 3I5CA 2WPRA 2R5DA 1SFCD 1FZBA 3KPEA 1J2JB 3OAKA 1HGZA 4W80A 4WY4D 2H43A 1FJKA 1OWAA 4C7NB 3NMDA 3MUDA 1N7SC 2WT7A 2N1TD 1FZAA 2NPSA 2L5GB 5BVZA 1FDMA 3RK2B 1NH4A 1N73B 3HE4A 2XV5A 3HD7C 5APYA 5KJ7D 1RF1C 2XDJA 3KDPB 3HRNA 1J1EC 2WZ7A 3VMYA 3BATA 2ZXEB 4N78D 5AVZB 3NFQA 1IK9A 1YYCA 1IO4A 4HH2A 5CHXA 2XKMA 1MFZA 3NXSA 3RK3B 1CI6A 1M1JB 1SQQK 3HTKA 1KFNA 2YKPA 1GZLA 3M9BA 1GW3A 1J1DC 3B5ND 5AW5B 2N1TA 1A02F 4Y99B 3M9HA 2HODB 4GKGA 4WY4C 2E42A 1JCDA 2O01H 4XE5B 1H8AA 1FOSE 1SQVK 1T2KD 1JUNA 3OA7A 1LT9C 1N7SD 1SFCA 1N7LA 3TK1A 3SWYA 4C7RA 1GL2D 2YO2A 1JOCA 1ZLLA 1N73C 1L4AB 4DZOA 1JY3N 1KILC 2KSJA 5AW0B 2FKWB 1M7LA 1MZ9A 3TNUB 1NTKK 3RK3D 2HPCB 1OXZA 5AW1B 2XZRA 1LTAC 2WSEH 1MUUA 1X8YA 4N6JA 1IFJA 3HUSC 2XU6A 2FYZA 3V2NA 4JF7A 1G1JA 1GK4A 1AQ5A 1KILA 1FAVA 3B5NC 2P1JA 1XTGB 2R32A 1G2CB 1LWUA 5CCHA 2Q5UA 1KFMA 3M91A 2YKQA 4N78E 3VYIA 2WWWA 1GD2E 2C9LY 2W6AA 1AFOA 1M1JA 3RL0C 5CMZA 2O1JA 4WY4A 3V4QA 4WY4B 1N73A 1HWTC 3B8EB 4KHXA 4RESB 3HE5B 3L36A 3P8MC 1LT9A 2WT7B 5KJ7A 5CJ0A 3M06A 1L0NK 1JCCA 1SQXK 1QL1A 1NOHA 2HG5D 4AYCA 2R3CA 3II6A 5AW7B 1SQPK 4OH8B 2W6BA 3VN0A 1DX7A 1XTCC 2C0XA 3N7NA 5APVA 1FOSF 1URQB 5AW3B 1ZN5A 5APXA 3TSIA 3HD7D 1T3JA 3BASA 1HBWA 3G3ZA 5KLVK 4LC1A 1J1EB 3M0DA 1URQC 2HFED 1KILB 1YTZT 1S9KD 3MIWA 4AQRD 1FU1A 2FFDB 2IPPA 5AW8B 2O1KA 5AVQB 1JY2N 1SP4A 1FZEA 5AVRB 2OARA 3RL0D 1H88A 3A3YB 5BU8B 1HUCA 3VP9A 2FXMA 1YTZI 3VP8A 2BASA 3GHGC 4JYCA 1IFNA 3RL0B 5AW6B 1LTTC 4Y99C 1HGVA 1HVVA 2HYNA 1RE4A 2J58A 3HE4B 2OYHC 2GM4A 2NPSB 2WSFH 4EIJA 3V4WA 3GHGA 1X79B 2P7JA 3HE5A 1WT6A 1QL2A 2P2UA 3V5BA 3EFGA 1L4AA 1NAFA 1MV8A 3P7KA 1GDTA 3V2PA 1URQD 2KP8A 3PP5A 1CZQA 3VMXA 1VPCA 1RF1B 1VDFA 1ZV8A 3OJAB 5BU5A 4I2LC 3KQGA 3TYYA 1FBMA 1KZUB 3O8ZA 4ZKUA 2W27A 1IC2A 3H32B 2LKMA 3B5NB 1LTBC 1NTZK 1SQBK 1L4AC 1LTJC 2YO3A 1JTHA 2OYIA 5AW2B 1JO5A 4B86A 3HUSB 1RF0C 2PAJA 3A5TA 1NKNA 1FJPA 3CI9A 4GIFA 1A02J 3P32A 3R2PA 4DOJA 4W7YA 2Z5HA 3H6PA 3A2AA 5AVSB 5CCHD 1JMMA 1T8ZA 2NPSC 1GU4A 3RK2D 3RK3C 4I1LA 4C46A 3L4FA 5APWA 1LT9B 3WMM0 3UIAA 5AVUB 3U1CA 5CCGA 1IFDA 2I1JA 1RY3A 5AW9B 1LTSC 1ZR4A 1NU1K 1URQA 2N9BA 1EQ7A 4IFFA 4LLHA 3T97A 3HD7B 1L4AD 2WSCH 1HJBA 1LTJA 2HODA 1M1JC 1ZR2A 1CI6B 5AVTB 2MJZA 1IJDB 3VTPC 4WB4A 3E1IA 1DEBA 5APTA 1GU5A 1T2KC 2M3BA 3V2QA 2POHA 2CPSA 2HLOA 3BVHA 3L35A 2IX7C 5AVWB 2FYUK 5AVYB 2YKOA 2Q7CA 3RK2C 1X9VA 3U59A 5AVXB 5KTBA 4GT1A 5AVVB 2JJLA 1IFIA 2PP6A 1N86A 3EQ2A 4I6MC 2Q9IA 1H89A 3L37A 5CCGC 1RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEE A;  3OJA B;  5BU5 A;  3P8C D;  3C9I A;  3U59 A;  4ZKU A;  1IC2 A;  5BVZ A;  4N3Y B;  5KTB A;  4I1L A;  3U1A A;  1X79 B;  3N7N A;  1WT6 A;  5BU8 B;  3HRN A;  3U1C A;  3VP9 A;  2FXM A;  3VP8 A;  2POH A;  3BAT A;  3BAS A;  3N4X A;  4N78 D;  1NKN A;  4O9B A;  4GIF A;  4ZKP A; 
#chains in the Genus database with same CATH topology
 3H1J G;  2JR8 A;  2R5B A;  3H1H E;  1KIL E;  2JEE A;  1GTW A;  1RF1 A;  2A45 H;  2BCC J;  3H1J J;  2P10 A;  3PTZ A;  4IOI H;  3SFD C;  2HPC A;  1R8E A;  1EDJ A;  3V2R A;  1E5W A;  5CBN A;  1LTJ B;  2BEQ D;  2R44 A;  1KQL A;  3BCC G;  4AUW A;  3NTN A;  1ZW0 A;  3L74 D;  2WTY A;  4MN4 C;  2ZT9 C;  3M9Q A;  3MD0 A;  1DEE G;  3LIE A;  3RBX A;  5AW4 B;  3G6E P;  3CMA P;  4NPE A;  2QM7 A;  3CCR P;  2OYI C;  1JY2 P;  2KLV A;  3H25 A;  1SQQ J;  1NTK J;  3WUV A;  2E75 B;  4W7Z A;  5KAI H;  1S9K E;  3P8C E;  3RGU A;  1YJW P;  2N9Y B;  1WRG A;  3H1L J;  3MTU E;  1L0L K;  1LTI C;  1SQP J;  3IFM A;  2I1K A;  4XA4 A;  5CJ4 A;  2QA4 P;  1OVR A;  1BCC J;  1G2C A;  1LWU B;  3A7O A;  1AVY A;  3N4X A;  1DH3 A;  3TGU J;  1S4X A;  2E74 D;  2H8P D;  2YXR B;  1W2B O;  4PJ0 E;  2C0W A;  4H13 C;  1FZC B;  2Q3I A;  1LTG C;  1FZC A;  3SWF A;  1SQV J;  5KAI E;  2N1T C;  4OWF A;  3TGU G;  2WPQ A;  2KB7 P;  1LNQ A;  3CLQ A;  2XNX A;  2IFM A;  3P8C D;  2ZT9 B;  2E76 B;  1EZV I;  2KK7 A;  2FYU J;  3C9I A;  2IFN A;  2KOG A;  2V7Q H;  3H1L G;  5GTI E;  1KD1 Q;  2BCC D;  1RE3 A;  1GL2 C;  1HTL C;  2A06 G;  2WPS A;  3A0B H;  4KJM A;  5L8R J;  3RL0 g;  2NPS D;  3H1H G;  4M3L A;  3VMA A;  3I55 P;  2WSS H;  2Y9Z A;  4U3F G;  3VOP A;  2KNC B;  3FXD A;  1AV1 A;  1IFM A;  2SPZ A;  3AEG C;  2KYV A;  3Q2Y A;  1Z56 A;  2C9N Y;  3KZI H;  2KI7 B;  3H1K G;  3W68 A;  1CW5 A;  3D6Y A;  1T3U A;  3GLM A;  1LGH B;  2GUV A;  1OVV A;  3EFF K;  1NTZ G;  2VRS A;  3H1H J;  4ZKP A;  1Q90 D;  3GHG B;  3A0B E;  4PJ0 H;  1OW7 A;  2IDB A;  3IR9 A;  2JDI H;  4I7Z C;  2FFD A;  1JY2 O;  1GK6 A;  2YMY A;  3AEF C;  3M0D C;  4A7P A;  1YI2 P;  3AED C;  2FYU G;  3SFE C;  1J1D B;  3CL3 D;  3L73 J;  5APQ A;  1SQV E;  3Q1M A;  1L2P A;  3L75 D;  2Z5I A;  3PJS K;  1NHL A;  1NTZ J;  1VQM P;  1GW4 A;  1PGQ A;  3IN6 A;  3MGN A;  2DW3 A;  5APS A;  3HTK B;  1SQV G;  3Q5P A;  1EZV D;  1FZF A;  3W67 A;  2WPV B;  3QWO C;  2GA1 A;  1U7J A;  1OVU A;  3PH0 A;  3HUS A;  2UWJ E;  1SFC B;  2FYU D;  4OVN F;  1BGY J;  1SQX E;  4DCK A;  2P67 A;  4WWI A;  3KZI E;  3ABV C;  1FZC C;  5M1B A;  1FZG A;  4IFM A;  5APU A;  1SQQ E;  1LWU C;  1W2E A;  1JY3 P;  3M0A A;  5CCH C;  2LXB A;  2KZJ A;  1ZRT E;  1SVF A;  1SFC C;  2J5U A;  2E43 A;  4HYT B;  3RK3 E;  1PPJ G;  2MKV A;  3LID A;  4JYB A;  1NKZ B;  2QJP B;  1KQF B;  4BRY A;  3L74 E;  1RE3 C;  4WBA A;  1JNM A;  2QJY B;  1GL2 B;  3AEA C;  4OGQ C;  1KIL D;  1R5L A;  3MUD C;  3OW2 O;  4PD4 H;  3CWB G;  1QVG O;  1YHQ P;  1LT1 A;  1BGY G;  2K9J A;  3PRJ A;  5B66 E;  1SQB G;  1N7S B;  2A45 G;  2IZ0 A;  2CPB A;  1N7S A;  3KYQ A;  4H0L C;  4N3Y B;  4HKZ H;  3L72 J;  3BRT B;  1PFI A;  1G1I A;  1EDK A;  4H44 D;  2XND H;  1GL2 A;  1RHZ B;  3L71 J;  3KXD A;  3FXE A;  2ZFC A;  3VP8 A;  1CSB A;  3BCC E;  4NPD A;  4IFD K;  3HD7 A;  4EDF A;  2FFD C;  1NO4 A;  2M8R A;  5KJ7 C;  1QLE D;  1BGY D;  1VQ8 P;  1U7M A;  3CC2 P;  1JY3 O;  2A45 I;  2CK3 H;  4O9B A;  2HR3 A;  3KHU A;  3ZDM A;  3B4S A;  2YNY A;  3H1L E;  3L75 G;  3L70 E;  1FC2 C;  2GUS A;  2IBZ I;  2E75 C;  2QVA A;  3TNU A;  5TJH A;  5KLV J;  1RF1 C;  4PV1 C;  1JTH B;  4PD4 D;  4R4M A;  2OYI B;  1HH0 A;  3PHL A;  2E5Y A;  5CCG D;  2IBZ G;  2J59 M;  3BRV B;  4EOT A;  4R4L A;  2AEF A;  4Z1M H;  1YIT P;  3CCU P;  2Z4E A;  3FWL A;  1NTM K;  3B5N A;  4PD4 E;  1PIX A;  3H32 A;  1Y9B A;  1NGM B;  1FE6 A;  3L70 D;  1VQO P;  3H1K D;  2LXC B;  2PFX A;  3VMZ A;  1OW8 A;  2WIT A;  3U1A A;  2H7H A;  4Y28 J;  1MKM A;  1EZV E;  2N1T B;  1RE4 C;  2QM8 A;  4JPZ B;  4QMA A;  3L72 E;  4C7N A;  3CPW O;  2OYH A;  2OYH B;  1VF5 B;  1L0L E;  1N2D C;  1NTK G;  1OIP A;  4H13 B;  3LW5 H;  1SLQ A;  3CXH D;  4LGD E;  3I5C A;  2A06 D;  2WPR A;  2BEZ F;  1SQV D;  2R5D A;  1SFC D;  3MP7 B;  3I56 P;  1FZB A;  3KPE A;  1NU1 E;  1SQX G;  2AXT H;  1J2J B;  2IYP A;  1HGZ A;  1PZQ A;  3OAK A;  4W80 A;  1FJK A;  3L75 E;  1OWA A;  4WY4 D;  3PLN A;  3NMD A;  3SSU A;  4C7N B;  3MUD A;  1OFC X;  1PGP A;  2QSI A;  2KS1 A;  2W83 C;  4RKU J;  1N7S C;  1SQB D;  2WT7 A;  1SS1 A;  2N1T D;  1JM0 A;  1JMB A;  1FZA A;  1EDI A;  2NPS A;  5EFW B;  1KYO H;  2L5G B;  3S9O A;  3G9R A;  5B66 H;  4HB1 A;  5BVZ A;  2O01 J;  3CCV P;  3RK2 B;  2OTJ P;  1FDM A;  1NH4 A;  1QX8 A;  1N73 B;  3V6I A;  1KOR A;  2B87 B;  1NTM E;  1LJ2 A;  2KLU A;  2P58 A;  2XV5 A;  3HE4 A;  2ZYA A;  2KIK A;  1BSN A;  3HD7 C;  5APY A;  2XDJ A;  2QIW A;  3H1H D;  3HRN A;  3KDP B;  3CCM P;  2JWA A;  1NU1 D;  3R4Y A;  4L75 A;  1J1E C;  1VF5 D;  2BCC E;  2WZ7 A;  3VMY A;  2FYN B;  1ZXG A;  3BAT A;  1KB9 E;  3SWK A;  3TDK A;  2AEJ A;  2ZXE B;  2QJK B;  3L74 G;  3GG2 A;  1KTM A;  4N78 D;  4YPC A;  3CWB J;  5KLI C;  5AVZ B;  3NFQ A;  1OW6 A;  1IK9 A;  3L71 E;  1YYC A;  2YXQ B;  1IO4 A;  4HH2 A;  5CHX A;  2XKM A;  2NRG A;  1MFZ A;  2FBW C;  2WMM A;  2M3E A;  3NXS A;  3RK3 B;  2IZ1 A;  1YQ4 C;  1CI6 A;  1M1J B;  1DD3 A;  1SQQ K;  2D2C D;  3HTK A;  1KFN A;  2YKP A;  1GZL A;  3M9B A;  1GW3 A;  4CPG A;  4GOF A;  1KQS O;  1J1D C;  3B5N D;  5AW5 B;  2N1T A;  1A02 F;  1SQB J;  4BWN A;  1S3J A;  3AE3 C;  2QEX P;  1AQT A;  4Y99 B;  3AE6 C;  3M9H A;  2HOD B;  4I7Z B;  3L73 D;  3O6Q B;  4GKG A;  4WY4 C;  1JB0 J;  2E42 A;  1JCD A;  2O01 H;  4XE5 B;  1H8A A;  3JC2 2;  1KB9 H;  1FOS E;  4JQ0 D;  3CD6 P;  1SQV K;  4D6T E;  1T2K D;  2JKV A;  1JUN A;  1VQP P;  3OA7 A;  1LT9 C;  1N7S D;  1PV3 A;  1SFC A;  1K05 A;  1N7L A;  2JP3 A;  3H1J E;  1DD4 A;  2KS1 B;  4PD4 I;  2E74 B;  3BCC J;  4U3F D;  3SWY A;  4C7R A;  1L0N J;  1K73 Q;  3H1I J;  1VQ9 P;  1H0T B;  2G8Y A;  1GL2 D;  2YO2 A;  1JOC A;  1ZLL A;  2BCC G;  1K9M Q;  1N73 C;  1L4A B;  4DZO A;  1KYO E;  1NTM D;  3G4S P;  4ZNC A;  1JY3 N;  1EXI A;  1KIL C;  2KSJ A;  3L73 E;  4D6T D;  2K1A A;  5AW0 B;  3D70 A;  1YJN P;  2FKW B;  1KYO I;  1NWQ A;  1M7L A;  3GF7 A;  1MZ9 A;  5B5E H;  3TNU B;  2ZYG A;  1NTK K;  3EWK A;  3RK3 D;  3MHV A;  3RBZ A;  2HPC B;  2K9J B;  1OXZ A;  5AW1 B;  5KLV D;  1JEK A;  2XZR A;  1Q86 Q;  4NPF X;  1LTA C;  1BE3 D;  1MUU A;  1NAY A;  1P84 I;  2WSE H;  3C1L A;  1X8Y A;  4IL6 H;  4UB8 E;  4N6J A;  1IFJ A;  3HUS C;  5KJ7 D;  3CME P;  2XU6 A;  2FYZ A;  3V2N A;  4JF7 A;  1SQP D;  1G1J A;  1GK4 A;  1AQ5 A;  3AE5 C;  1KIL A;  1FS0 E;  3L71 D;  1FAV A;  1Q82 Q;  2KSE A;  3H1I G;  3B5N C;  2P1J A;  2Y0D A;  3ITK A;  1L0N D;  1XTG B;  2KUB A;  2AXT E;  2R32 A;  3BCC D;  4U3F J;  3CCE P;  1G2C B;  1LWU A;  3H1I D;  5CCH A;  1BDC A;  1PPJ E;  2Q5U A;  3TK1 A;  1KFM A;  3IAO A;  3M91 A;  1VQN P;  2YKQ A;  4N78 E;  3VYI A;  3LW5 J;  2WWW A;  1GD2 E;  4PV1 B;  3GW6 A;  2C9L Y;  2W6A A;  3H1J D;  1ZP0 C;  5B5E E;  1AFO A;  3WUU A;  4H13 D;  1KC8 Q;  2PRR A;  1M1J A;  1VQ4 P;  3RL0 C;  3CX5 H;  4TLF A;  5CMZ A;  4L74 A;  2O1J A;  1VQ7 P;  1YIJ P;  1M56 D;  2L91 A;  4IL6 E;  4UB8 H;  4WY4 A;  3V4Q A;  4WY4 B;  2RMZ A;  1N73 A;  1BE3 J;  2O3J A;  3B8E B;  1HWT C;  1S2E A;  1KB9 I;  4KHX A;  4RES B;  4D6T G;  3HE5 B;  3G71 P;  1LP1 B;  3L36 A;  3P8M C;  2OQQ A;  4TT3 H;  1LT9 A;  2IYO A;  2ZVN B;  2WT7 B;  2WSE J;  3L37 A;  5KJ7 A;  1Q81 Q;  5CJ0 A;  3M06 A;  2OTL P;  2YIU C;  2OTK E;  1L0N K;  1JCC A;  3CCS P;  1TU3 F;  1SQX K;  1QL1 A;  1NOH A;  1SQQ G;  2HG5 D;  4AYC A;  3AE1 C;  1NU1 G;  2R3C A;  2AXC A;  3II6 A;  1K8A Q;  1L0N E;  5AW7 B;  2QJY C;  1SQP K;  4OH8 B;  2W6B A;  1U57 A;  4K35 A;  3VN0 A;  1XTC C;  2C0X A;  3N7N A;  5APV A;  1FOS F;  1PPJ D;  1BSH A;  1DX7 A;  1Q2N A;  1URQ B;  5AW3 B;  2E76 D;  4ASW A;  1ZN5 A;  5APX A;  3L72 G;  3AEB C;  1BCC D;  3HD7 D;  3TSI A;  1IFP A;  1T3J A;  3L70 G;  3CXH I;  3BAS A;  3S4R A;  2WVR A;  1HBW A;  3G3Z A;  1OX3 A;  5KLV K;  4LC1 A;  1QVF O;  1J1E B;  1OZH A;  2D2C B;  3AEC C;  3M0D A;  2Q3E A;  2M5A A;  1PP9 G;  1URQ C;  4ZMD A;  1X22 A;  2W6J H;  3JSV C;  5KKZ B;  2HFE D;  1KIL B;  1NTM J;  1YTZ T;  1S9K D;  1MFT A;  1PGJ A;  2K37 A;  2W8Z A;  1PL5 A;  1FU1 A;  1SQX D;  3MIW A;  4UB6 H;  4AQR D;  2FFD B;  2IPP A;  5AW8 B;  1AVO A;  4L73 A;  3K5B A;  2WSC J;  2O1K A;  1S1C X;  1RQV A;  1SQB E;  5AVQ B;  1JY2 N;  1SP4 A;  1FZE A;  2QRX A;  5AVR B;  1KYO D;  1RH5 B;  1AA0 A;  3WUT A;  1ZOY C;  5KKZ C;  2OAR A;  3FWN A;  1QEX A;  3RL0 D;  1H88 A;  3A3Y B;  5BU8 B;  1VQK P;  1KV4 A;  2D2C C;  5K5G B;  1EDL A;  3AEE C;  3B71 A;  1S5L E;  1HUC A;  2I8D A;  3VP9 A;  2FXM A;  1YTZ I;  2B9B A;  2FY8 A;  3FX0 A;  1L0L J;  2BAS A;  3CX5 E;  3GHG C;  4JYC A;  4UB6 E;  5E79 H;  4YTP C;  5TIS E;  1RQU A;  1M90 Q;  1IFN A;  2LR2 A;  3CWB D;  3RL0 B;  2FYN C;  4EYY Q;  5AW6 B;  4RO0 A;  1LTT C;  2IBZ D;  2JWD A;  3TF5 A;  3C8V A;  4Y99 C;  1HGV A;  4D6T J;  1L0L D;  1HVV A;  2HYN A;  4GOD A;  3CX5 I;  3D6Z A;  1RE4 A;  1HJ0 A;  2B87 A;  2J58 A;  3HE4 B;  2OYH C;  1L0L G;  1NTK E;  1T6A A;  1ZRT D;  2K3R A;  5H2F E;  2GM4 A;  3TGU E;  2K9Y A;  1SQQ D;  3GMA A;  5TIS H;  1K04 A;  2NPS B;  1FDO A;  5DJT B;  1IZN B;  2WSF H;  4EIJ A;  3V4W A;  2V7Q J;  3GHG A;  2OGU A;  1X79 B;  2P7J A;  1WMK A;  2NZ2 A;  3HE5 A;  1WT6 A;  5C39 A;  1P84 H;  1QL2 A;  2P2U A;  2RH0 A;  2ITA A;  1BE3 E;  1X0T A;  4H0L D;  3EFG A;  1L4A A;  5H2F H;  1NAF A;  1KMI Z;  1NU1 J;  3USS A;  1MV8 A;  3P7K A;  1ZME C;  2Q6Q A;  1GDT A;  3V2P A;  2WQY C;  1URQ D;  5E79 E;  1UIX A;  2KP8 A;  2E5T A;  2YMK A;  1NTK D;  1KB9 D;  2M0B A;  3PP5 A;  1IK7 A;  1CZQ A;  2ZVO B;  3VMX A;  1VPC A;  2ZJS E;  3AE9 C;  1VDF A;  1RF1 B;  1ZV8 A;  3T97 B;  1PP9 D;  3OJA B;  5BU5 A;  2ZT9 D;  3CX5 D;  4I2L C;  3KQG A;  3TYY A;  1FBM A;  1KZU B;  3O8Z A;  4U3F E;  5DJU B;  3S1K A;  2B88 A;  2W27 A;  4ZKU A;  1IC2 A;  2Y0C A;  2LKM A;  3H32 B;  3CCQ P;  3B5N B;  1LTB C;  1KN7 A;  1AJY A;  4YXW H;  1NTZ K;  1SQB K;  1L4A C;  1BCC G;  1M57 D;  1LTJ C;  4WVZ A;  1USD A;  2Q1K A;  3L71 G;  1S5L X;  2YO3 A;  1JTH A;  1SQP G;  4ASV A;  2OYI A;  1USE A;  5AW2 B;  1JO5 A;  1Y47 A;  3HUS B;  4B86 A;  2E74 C;  3MZW B;  1YQ3 C;  2G3A A;  1VQ6 P;  1RF0 C;  1VQ5 P;  1EZV G;  2FXO A;  4GDO A;  1VL2 A;  3E1R A;  5KAF E;  2PAJ A;  3AE4 C;  3FGA D;  3A5T A;  1NKN A;  1BDD A;  1OMI A;  2ZYD A;  3CI9 A;  4GIF A;  3P32 A;  1A02 J;  1DIP A;  1P84 D;  3R2P A;  4DOJ A;  4W7Y A;  3JCU H;  1M1K Q;  2Z5H A;  4HJG H;  3AE8 C;  3CXH E;  3H6P A;  2RKL A;  2V4H A;  2OYO A;  1D7M A;  3A2A A;  5AVS B;  5CCH D;  4DJG A;  1JMM A;  1YJ9 P;  1T8Z A;  5GTH E;  1KQG B;  1NTZ D;  2NPS C;  3Q5R A;  5KAF H;  1PP9 J;  3CCJ P;  1QGK B;  2Y9Y A;  4KT0 J;  1BCC E;  3F89 A;  3AE7 C;  1GU4 A;  3L72 D;  4L76 A;  3RK2 D;  4OGQ D;  3RK3 C;  4OGQ B;  3D71 A;  4I1L A;  4C46 A;  3CWB E;  3L74 J;  2KNC A;  3CXH H;  2B89 A;  3L4F A;  5APW A;  1P84 E;  4RJT A;  1LT9 B;  2M5A B;  3GF3 A;  3UIA A;  1NVO A;  5AVU B;  3WMM 0;  3CCL P;  3U1C A;  5CCG A;  1IFD A;  5KLI B;  3F5H A;  3H1L D;  3A0H H;  2I1J A;  1RY3 A;  4H44 C;  2QJK C;  3IF4 A;  1LTS C;  5AW9 B;  1VQL P;  1EXJ A;  5CBO A;  2H89 C;  1ZR4 A;  2AEM A;  1NU1 K;  1BGY E;  3L73 G;  3JCU E;  1URQ A;  2N9B A;  3QH9 A;  4EI2 A;  1EQ7 A;  4IFF A;  2K88 A;  4LLH A;  3TGU D;  3CC4 P;  4XFJ A;  3T97 A;  3HD7 B;  1S5L H;  4H0L B;  1L4A D;  2WSC H;  3V5B A;  1HJB A;  1LTJ A;  2HOD A;  1M1J C;  1ZR2 A;  4IL6 X;  3Q3D A;  1CI6 B;  2IBZ E;  1BE3 G;  5AVT B;  1UII A;  2MJZ A;  1NYH A;  1IJD B;  4DT0 A;  3VTP C;  3CC7 P;  2QJP C;  1PGO A;  2QG4 A;  2KZI A;  4K3A A;  4WB4 A;  3E1I A;  2A06 E;  1Q7Y Q;  4YXD C;  1DEB A;  5APT A;  3O6Q A;  1GU5 A;  4U7J A;  1T2K C;  2M3B A;  3E7K A;  2KXP B;  3V2Q A;  3WU2 E;  1HF9 A;  1LP1 A;  1YBK A;  3H1I E;  2POH A;  1SQP E;  1EC5 A;  2CPS A;  2HLO A;  1L0N G;  2WSF J;  3A0H E;  3Q5S A;  3BVH A;  2FXP A;  4H44 B;  3L35 A;  1Y8A A;  2H43 A;  2IX7 C;  5AVW B;  2FYU K;  1H0T A;  3H1K E;  2H88 C;  5AVY B;  1W5C E;  2YKO A;  4JBZ A;  4BXL A;  5KLV E;  4BRY B;  2Q7C A;  3RK2 C;  4GOE A;  2Y0E A;  5GTH H;  1X9V A;  1SQX J;  3U59 A;  2YIU B;  3AE2 C;  1M8O B;  2RN0 A;  5GTI H;  3L75 J;  5KLV G;  1R5S A;  2QE7 H;  3L70 J;  2FYU E;  5AVX B;  1N8R Q;  1E79 H;  2E76 C;  2W90 A;  3H1K J;  5KTB A;  4GT1 A;  5AVV B;  2JJL A;  1S72 P;  1IFI A;  2PGD A;  2JO1 A;  1NTZ E;  1NJI Q;  2ZXX A;  2PP6 A;  1N86 A;  3EQ2 A;  2R3S A;  3WU2 H;  4I6M C;  2ZAE B;  1NTM G;  1H89 A;  2Q9I A;  1GMJ A;  2E75 D;  2O01 N;  4PV1 D;  1FJP A;  1FDI A;  1PP9 E;  5CCG C;  1VF5 C;  1RF0 A; 
#chains in the Genus database with same CATH homology
 2R5B A;  2JEE A;  1GTW A;  1RF1 A;  2A45 H;  2HPC A;  3V2R A;  1E5W A;  4AUW A;  1LTJ B;  1KQL A;  3NTN A;  2WTY A;  3M9Q A;  3MD0 A;  3LIE A;  5AW4 B;  2QM7 A;  2OYI C;  1JY2 P;  2KLV A;  4W7Z A;  1S9K E;  3P8C E;  1WRG A;  3MTU E;  1L0L K;  1LTI C;  3IFM A;  4XA4 A;  2I1K A;  5CJ4 A;  1G2C A;  1LWU B;  3A7O A;  1DH3 A;  3N4X A;  2H8P D;  2C0W A;  1FZC B;  2Q3I A;  1LTG C;  1FZC A;  3SWF A;  2N1T C;  2WPQ A;  2KB7 P;  3CLQ A;  2XNX A;  2IFM A;  3P8C D;  3C9I A;  2IFN A;  2KOG A;  1RE3 A;  1GL2 C;  1HTL C;  2WPS A;  2NPS D;  4M3L A;  3VOP A;  1IFM A;  2KYV A;  1Z56 A;  2C9N Y;  1CW5 A;  1T3U A;  1LGH B;  2GUV A;  2VRS A;  4ZKP A;  3GHG B;  3IR9 A;  2FFD A;  1JY2 O;  1GK6 A;  2YMY A;  3M0D C;  1J1D B;  3CL3 D;  5APQ A;  2Z5I A;  1NHL A;  1GW4 A;  3MGN A;  5APS A;  1FZF A;  3HTK B;  3HUS A;  1SFC B;  2P67 A;  1FZC C;  1FZG A;  4IFM A;  5APU A;  3M0A A;  1LWU C;  1W2E A;  1JY3 P;  5CCH C;  1SVF A;  1SFC C;  2E43 A;  4HYT B;  3LID A;  4JYB A;  1NKZ B;  1RE3 C;  4WBA A;  1JNM A;  1GL2 B;  1KIL D;  1N7S B;  2A45 G;  2CPB A;  1N7S A;  3KYQ A;  4N3Y B;  3BRT B;  1PFI A;  1G1I A;  1GL2 A;  2ZFC A;  1CSB A;  4IFD K;  3HD7 A;  2FFD C;  1NO4 A;  2M8R A;  5KJ7 C;  1JY3 O;  2A45 I;  4O9B A;  2YNY A;  2GUS A;  3TNU A;  1JTH B;  2OYI B;  1HH0 A;  5CCG D;  1NWQ A;  2J59 M;  4EOT A;  3BRV B;  2Z4E A;  1NTM K;  3B5N A;  3H32 A;  3VMZ A;  2WIT A;  3U1A A;  2H7H A;  2N1T B;  1RE4 C;  2QM8 A;  4C7N A;  2OYH A;  2OYH B;  1N2D C;  3LW5 H;  1SLQ A;  4LGD E;  3I5C A;  2WPR A;  2R5D A;  1SFC D;  1FZB A;  3KPE A;  1J2J B;  3OAK A;  1HGZ A;  4W80 A;  4WY4 D;  2H43 A;  1FJK A;  1OWA A;  4C7N B;  3NMD A;  3MUD A;  1N7S C;  2WT7 A;  2N1T D;  1FZA A;  2NPS A;  2L5G B;  5BVZ A;  1FDM A;  3RK2 B;  1NH4 A;  1N73 B;  3HE4 A;  2XV5 A;  3HD7 C;  5APY A;  5KJ7 D;  1RF1 C;  2XDJ A;  3KDP B;  3HRN A;  1J1E C;  2WZ7 A;  3VMY A;  3BAT A;  2ZXE B;  4N78 D;  5AVZ B;  3NFQ A;  1IK9 A;  1YYC A;  1IO4 A;  4HH2 A;  5CHX A;  2XKM A;  1MFZ A;  3NXS A;  3RK3 B;  1CI6 A;  1M1J B;  1SQQ K;  3HTK A;  1KFN A;  2YKP A;  1GZL A;  3M9B A;  1GW3 A;  1J1D C;  3B5N D;  5AW5 B;  2N1T A;  1A02 F;  4Y99 B;  3M9H A;  2HOD B;  4GKG A;  4WY4 C;  2E42 A;  1JCD A;  2O01 H;  4XE5 B;  1H8A A;  1FOS E;  1SQV K;  1T2K D;  1JUN A;  3OA7 A;  1LT9 C;  1N7S D;  1SFC A;  1N7L A;  3TK1 A;  3SWY A;  4C7R A;  1GL2 D;  2YO2 A;  1JOC A;  1ZLL A;  1N73 C;  1L4A B;  4DZO A;  1JY3 N;  1KIL C;  2KSJ A;  5AW0 B;  2FKW B;  1M7L A;  1MZ9 A;  3TNU B;  1NTK K;  3RK3 D;  2HPC B;  1OXZ A;  5AW1 B;  2XZR A;  1LTA C;  2WSE H;  1MUU A;  1X8Y A;  4N6J A;  1IFJ A;  3HUS C;  2XU6 A;  2FYZ A;  3V2N A;  4JF7 A;  1G1J A;  1GK4 A;  1AQ5 A;  1KIL A;  1FAV A;  3B5N C;  2P1J A;  1XTG B;  2R32 A;  1G2C B;  1LWU A;  5CCH A;  2Q5U A;  1KFM A;  3M91 A;  2YKQ A;  4N78 E;  3VYI A;  2WWW A;  1GD2 E;  2C9L Y;  2W6A A;  1AFO A;  1M1J A;  3RL0 C;  5CMZ A;  2O1J A;  4WY4 A;  3V4Q A;  4WY4 B;  1N73 A;  1HWT C;  3B8E B;  4KHX A;  4RES B;  3HE5 B;  3L36 A;  3P8M C;  1LT9 A;  2WT7 B;  5KJ7 A;  5CJ0 A;  3M06 A;  1L0N K;  1JCC A;  1SQX K;  1QL1 A;  1NOH A;  2HG5 D;  4AYC A;  2R3C A;  3II6 A;  5AW7 B;  1SQP K;  4OH8 B;  2W6B A;  3VN0 A;  1DX7 A;  1XTC C;  2C0X A;  3N7N A;  5APV A;  1FOS F;  1URQ B;  5AW3 B;  1ZN5 A;  5APX A;  3TSI A;  3HD7 D;  1T3J A;  3BAS A;  1HBW A;  3G3Z A;  5KLV K;  4LC1 A;  1J1E B;  3M0D A;  1URQ C;  2HFE D;  1KIL B;  1YTZ T;  1S9K D;  3MIW A;  4AQR D;  1FU1 A;  2FFD B;  2IPP A;  5AW8 B;  2O1K A;  5AVQ B;  1JY2 N;  1SP4 A;  1FZE A;  5AVR B;  2OAR A;  3RL0 D;  1H88 A;  3A3Y B;  5BU8 B;  1HUC A;  3VP9 A;  2FXM A;  1YTZ I;  3VP8 A;  2BAS A;  3GHG C;  4JYC A;  1IFN A;  3RL0 B;  5AW6 B;  1LTT C;  4Y99 C;  1HGV A;  1HVV A;  2HYN A;  1RE4 A;  2J58 A;  3HE4 B;  2OYH C;  2GM4 A;  2NPS B;  2WSF H;  4EIJ A;  3V4W A;  3GHG A;  1X79 B;  2P7J A;  3HE5 A;  1WT6 A;  1QL2 A;  2P2U A;  3V5B A;  3EFG A;  1L4A A;  1NAF A;  1MV8 A;  3P7K A;  1GDT A;  3V2P A;  1URQ D;  2KP8 A;  3PP5 A;  1CZQ A;  3VMX A;  1VPC A;  1RF1 B;  1VDF A;  1ZV8 A;  3OJA B;  5BU5 A;  4I2L C;  3KQG A;  3TYY A;  1FBM A;  1KZU B;  3O8Z A;  4ZKU A;  2W27 A;  1IC2 A;  3H32 B;  2LKM A;  3B5N B;  1LTB C;  1NTZ K;  1SQB K;  1L4A C;  1LTJ C;  2YO3 A;  1JTH A;  2OYI A;  5AW2 B;  1JO5 A;  4B86 A;  3HUS B;  1RF0 C;  2PAJ A;  3A5T A;  1NKN A;  1FJP A;  3CI9 A;  4GIF A;  1A02 J;  3P32 A;  3R2P A;  4DOJ A;  4W7Y A;  2Z5H A;  3H6P A;  3A2A A;  5AVS B;  5CCH D;  1JMM A;  1T8Z A;  2NPS C;  1GU4 A;  3RK2 D;  3RK3 C;  4I1L A;  4C46 A;  3L4F A;  5APW A;  1LT9 B;  3WMM 0;  3UIA A;  5AVU B;  3U1C A;  5CCG A;  1IFD A;  2I1J A;  1RY3 A;  5AW9 B;  1LTS C;  1ZR4 A;  1NU1 K;  1URQ A;  2N9B A;  1EQ7 A;  4IFF A;  4LLH A;  3T97 A;  3HD7 B;  1L4A D;  2WSC H;  1HJB A;  1LTJ A;  2HOD A;  1M1J C;  1ZR2 A;  1CI6 B;  5AVT B;  2MJZ A;  1IJD B;  3VTP C;  4WB4 A;  3E1I A;  1DEB A;  5APT A;  1GU5 A;  1T2K C;  2M3B A;  3V2Q A;  2POH A;  2CPS A;  2HLO A;  3BVH A;  3L35 A;  2IX7 C;  5AVW B;  2FYU K;  5AVY B;  2YKO A;  2Q7C A;  3RK2 C;  1X9V A;  3U59 A;  5AVX B;  5KTB A;  4GT1 A;  5AVV B;  2JJL A;  1IFI A;  2PP6 A;  1N86 A;  3EQ2 A;  4I6M C;  2Q9I A;  1H89 A;  3L37 A;  5CCG C;  1RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...