5BU8B

Hk620 tail needle crystallized at ph 7.5 and derivatized with xenon
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
AYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords DNA stabilization protein
total genus 57
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bu8B01
3VP9A 2FXMA 3VP8A 4O9BA 3C9IA 3HRNA 1NKNA 4N78D 4I1LA 3U59A 5BU8B 4N3YB 4ZKUA 3P8CD 1X79B 4GIFA 3U1CA 5KTBA 3N7NA 3U1AA 3N4XA 4ZKPA 1IC2A 3BATA 2JEEA 5BU5A 3BASA 2POHA 3OJAB 5BVZA 1WT6A
chains in the Genus database with same CATH superfamily
2R5DA 3AECC 3WU2H 4N78D 3AE9C 5CHXA 2O3JA 2BCCE 4UB6E 2VRSA 5APVA 5TISE 1LWUC 3Q5SA 2LR2A 1OWAA 5B66E 3U59A 3TF5A 5BU8B 2OYHC 3EFGA 3KXDA 1NU1G 1OMIA 2WWWA 1FDOA 2QVAA 5CJ0A 5AVTB 2KLVA 2Y0CA 3VOPA 1JCCA 1NTZG 3HD7A 4U3FD 1PFIA 1NTKJ 1D7MA 1LT9C 1BGYE 1X9VA 1QVGO 3MGNA 4GIFA 2C9LY 2WPRA 2KYVA 1RHZB 5KAFE 2ZVOB 1PIXA 2I8DA 3HUSC 2B87B 4AYCA 2QJKC 2YKQA 1Q2NA 2K9YA 5AVWB 2ITAA 2C0XA 3E1RA 3SFEC 5AW5B 5AW4B 3EQ2A 3RK3D 1NGMB 1M90Q 2HLOA 3L71G 1KQGB 2O1JA 3G3ZA 3RGUA 1KORA 1YQ3C 2AXTE 1AQTA 2E76B 1AV1A 3L73G 1CZQA 4PD4E 4D6TD 2OYIB 1NTME 4ASVA 1H0TA 1SQPK 3H1JJ 5DJUB 3H32A 3L73D 2Z5HA 3MIWA 1JTHB 1X22A 2JWAA 3H1IE 4GKGA 3KZIE 3K5BA 4NPDA 1URQA 2R3CA 1SQXE 3H1KE 3M9HA 5CBNA 4TT3H 3H25A 4GODA 1GL2D 2QM7A 3Q1MA 1RE3A 2ZJSE 1NOHA 4WY4A 3V4QA 4N3YB 2QM8A 4R4MA 3RL0g 4H13C 1CI6A 2NZ2A 1H8AA 1RF1B 1VQ4P 1MFZA 2WSCH 3ABVC 4U3FG 5AW7B 2JJLA 2IDBA 3L73J 1R5LA 3TYYA 4YXDC 2FY8A 4ZKPA 1NAFA 3CD6P 2Q6QA 3AE7C 1H89A 2ZXEB 1L4AB 4IL6E 1AA0A 3BRTB 1URQB 2Q5UA 3FGAD 3V2PA 1RF0C 1SFCA 1GK6A 5B5EH 1GU5A 2QE7H 3OJAB 4ASWA 1L0NG 1VQMP 1N73C 5GTHE 2JO1A 4L75A 1M8OB 2KK7A 1J1DC 3RL0D 3L75J 2IX7C 5APWA 2K37A 1JY2N 2FYUK 4Y28J 3AE1C 4L74A 2Q3IA 2YMYA 1YI2P 2K9JA 2L91A 4LGDE 2YXQB 1SQVD 1NTKK 2ZT9B 5AVZB 2QA4P 2R44A 2WPQA 1EQ7A 3H1LJ 4JBZA 5M1BA 3O6QB 1FE6A 2GM4A 3BRVB 5H2FE 2Q3EA 3GLMA 1FZCB 3W68A 1KD1Q 2AEMA 4JF7A 3BCCG 2A45H 2OTKE 1ZRTE 2OGUA 5K5GB 2CPBA 5E79E 2RMZA 1OVRA 2NRGA 2RN0A 2K9JB 3H1LE 4GT1A 3V2NA 1H88A 1Q81Q 1EDLA 2B88A 1PL5A 2FYUE 3UIAA 2FYUD 1ZMEC 1LWUB 3TGUE 1LTIC 1PGOA 3JCUE 2N1TB 1L0LD 1FZFA 3Q5RA 2XV5A 3WUUA 3L70D 1SFCB 3AE2C 1LTAC 1IFNA 5CCHC 3C1LA 3L75E 3D71A 3CCSP 1VL2A 2PRRA 1K9MQ 3RL0C 1LJ2A 3R2PA 3GHGA 2WQYC 1IO4A 3MD0A 1N7SA 1SQVG 1EZVD 3B5NC 3IF4A 3CC4P 2P10A 3V6IA 1X8YA 3BCCD 2Q9IA 3SWYA 1MV8A 1RE4C 1LTBC 2QJYB 3L37A 3S9OA 2FFDC 5AW3B 3P32A 3CMAP 1EDIA 1QX8A 1OVVA 1IJDB 1ZV8A 3CL3D 1DD3A 3A0BE 1GU4A 1ZW0A 1EZVE 1EDJA 1HGVA 1N86A 3HTKB 4K3AA 1A02J 3IR9A 3JC22 4H44D 2OTLP 3CX5H 1KFMA 3TGUJ 3WUVA 2H89C 2IBZE 3RK2D 2HPCA 2Q7CA 1J1DB 2AEJA 3VP8A 1AJYA 1ZR4A 2QJPB 1L0NE 2OARA 1FDIA 3L70E 1NTMK 1EXIA 1L0LK 1SQBE 2Z5IA 1SQVJ 3FXEA 2JKVA 1ZP0C 2YXRB 3MHVA 4AQRD 1KC8Q 3L72D 1L4AD 1KQLA 2CPSA 3WUTA 5B66H 3CC2P 1FZEA 3I5CA 5CCGC 2KZIA 1LGHB 1YBKA 2A45G 1Q86Q 2V7QH 1VQLP 1JUNA 1JB0J 4UB8H 3AEEC 3VTPC 2W6BA 3AE5C 3G9RA 4XA4A 4W80A 1SS1A 5AVVB 1PPJG 1S5LH 4I7ZC 3BVHA 5KAFH 3LIDA 4RJTA 3CXHI 1YJWP 4W7ZA 2E5YA 1KILE 3H1IG 2XZRA 4Y99C 1KTMA 2B9BA 3MTUE 3MP7B 4DZOA 2RKLA 3SWKA 2OYOA 2YIUC 1KYOI 4HB1A 2AXTH 1BDCA 2NPSA 2QG4A 3CLQA 1JY3N 1E79H 1BGYG 2IFNA 4OGQC 3L71D 1KFNA 2PFXA 4K35A 1T2KC 2XDJA 1PP9E 4KJMA 4H44C 1EZVI 1OZHA 2LXCB 2QSIA 4ZNCA 1U57A 1Y9BA 3H1LD 1M1KQ 1G2CA 4PJ0H 3ZDMA 3CCQP 2KP8A 1VF5D 2LXBA 4GOFA 5DJTB 3RK3C 2KS1A 3A3YB 1T3UA 1G1IA 4H0LD 1M1JC 2XNXA 3H6PA 4WY4B 1IZNB 1NVOA 3U1AA 4R4LA 1KB9I 3PJSK 1IFJA 1IC2A 2BASA 1RF0A 1SFCC 2IZ0A 2NPSD 2Y0DA 2QJKB 1P84H 3AEDC 1PGQA 3FXDA 3JSVC 5KAIE 3T97B 1KYOE 3KYQA 3TNUA 3AEGC 1JTHA 1SP4A 2E5TA 5KKZC 1JMMA 4IL6H 1JMBA 3L72E 4MN4C 4U3FJ 1SQQK 1GW4A 1VPCA 2FYNB 2HG5D 3E1IA 4XE5B 1FZCA 4XFJA 2BEZF 1LTTC 1SQPG 3VMYA 4Z1MH 4GOEA 1NWQA 1MKMA 3M06A 3HE5A 5KLVE 1AVOA 3L74J 3B5NB 4U7JA 1KV4A 1R8EA 5APYA 2IBZD 4HJGH 3E7KA 3L72J 3CXHD 3V4WA 3CXHE 1FZGA 1PP9J 4AUWA 5CMZA 2SPZA 1M1JA 2XNDH 2KSEA 1NJIQ 2ZYAA 1EDKA 1LNQA 2JWDA 3HE4A 3HD7D 3L74E 3N7NA 3H1JD 3N4XA 3AE3C 2O01J 3I56P 1S72P 2N1TC 3AE6C 2M5AB 3CWBJ 1VQOP 1GDTA 1Y47A 5TJHA 1MZ9A 3CWBG 1SQXD 2WSCJ 3H1KD 3G4SP 3QWOC 3C8VA 5KLVK 4HH2A 4DOJA 1FZCC 1KYOD 3P7KA 2YNYA 1DX7A 1CI6B 1QGKB 1L0NK 4LC1A 3M91A 3CCJP 3C9IA 3HRNA 3IN6A 2GA1A 2WMMA 3JCUH 5AVRB 3TNUB 1HTLC 3GMAA 3LIEA 2PAJA 3M9BA 3O8ZA 4DJGA 3Q5PA 2HODA 4RO0A 1WRGA 4QMAA 3V5BA 1W2BO 4ZMDA 3SSUA 3D6ZA 2BCCG 3L35A 1DIPA 3L74G 1NTKG 1KQSO 3H32B 2E75C 5C39A 1R5SA 1FJPA 1QL1A 4N6JA 1GL2B 4JYBA 1FZBA 2IZ1A 1RF1C 1FJKA 1T6AA 1SLQA 2R32A 1KQFB 2K1AA 3AEAC 1S9KD 3PLNA 2LKMA 1N7SD 1T8ZA 4I7ZB 5AW0B 3W67A 2FXPA 1HF9A 1L0ND 1NTMG 3A0HH 4PD4D 3PHLA 1N73B 1OVUA 2D2CD 3V2RA 1LTJB 3NXSA 5KJ7D 1YJ9P 1VQNP 3CPWO 1GL2C 3M0DA 1URQD 3ITKA 4JYCA 2A45I 5CJ4A 1USEA 1NH4A 1RH5B 1PP9D 2N9YB 3HD7C 1NTKE 4B86A 1NTZE 3OAKA 4YXWH 1FAVA 5L8RJ 4M3LA 4NPEA 5AVYB 3RK3B 2H43A 3CCEP 2QIWA 1SVFA 4I1LA 2JP3A 3WU2E 2WITA 2E76D 3AE8C 1S2EA 3D6YA 1KILB 2WSFH 1JY3P 2E75D 3BCCE 4BRYB 1HVVA 1RQUA 2ZT9D 2G3AA 2GUVA 2IFMA 1K04A 2V4HA 1KZUB 1KILD 4WWIA 1NTZJ 1SQVK 1QL2A 2BCCD 1L0LJ 1JOCA 1HUCA 3A7OA 1SQXG 3AEBC 3H1KG 4W7YA 5GTIE 1HJ0A 3RBXA 1LTGC 1KB9H 1OFCX 4PD4H 2DW3A 5AW9B 4D6TG 5AVSB 5KLVJ 1U7MA 2HYNA 1EC5A 2OQQA 3H1IJ 1KB9D 3PRJA 2FBWC 1SQXJ 1BGYJ 3BASA 1LT9A 2W83C 3H1KJ 3PTZA 1L0LE 1SQBK 1N2DC 2KOGA 3OW2O 1A02F 1HJBA 3IAOA 3KZIH 4I6MC 1BE3D 2FXMA 4DT0A 3F5HA 2YMKA 3HUSB 4H0LC 1EXJA 2Y0EA 3H1HE 2IPPA 2WSSH 1Q82Q 1XTGB 5CBOA 1DEEG 2P2UA 2ZYGA 3VYIA 3CCLP 1AVYA 4NPFX 1AFOA 1JO5A 3P8CD 1OW8A 1PZQA 3H1HJ 3F89A 1YIJP 1YITP 1LT9B 3FWNA 2E74C 4L73A 5B5EE 1K05A 1FS0E 2HODB 2IYOA 1LTSC 1SQQG 2G8YA 4EDFA 2H7HA 3CMEP 1JY3O 1MFTA 4PD4I 3BATA 2H88C 1SQQD 2A06E 1W2EA 2JR8A 2KI7B 4WY4C 4D6TJ 2KS1B 2I1JA 1OIPA 3B71A 2W8ZA 3CC7P 2KNCA 2M0BA 1P84E 1PPJE 5KAIH 1VQ8P 3A2AA 3H1LG 3CCRP 2O01N 2P1JA 1M1JB 4O9BA 1ZR2A 3RBZA 5GTHH 2CK3H 2QJYC 3KHUA 1GW3A 1DEBA 1PGJA 1YJNP 1ZRTD 1M7LA 1ZN5A 2B89A 3L36A 2W90A 1N73A 1UIIA 1IK9A 3NMDA 2R3SA 1FDMA 1S3JA 3IFMA 2ZAEB 1K8AQ 1BE3G 3VMAA 2FYUJ 5E79H 1IFMA 1SFCD 2NPSC 4I2LC 1ZLLA 3L75G 3USSA 1BDDA 2BEQD 3GF7A 5AVXB 5KLVG 1ZOYC 3TGUD 1FOSE 2J59M 4YTPC 3A5TA 2KNCB 1CW5A 1LP1A 1Y8AA 2KB7P 3L74D 2L5GB 4H13D 1NKZB 1OW6A 1T3JA 3L73E 3PH0A 2Y9YA 2M8RA 5BU5A 4Y99B 2WZ7A 4PV1D 1URQC 3VMXA 5APSA 1BCCG 4EIJA 2OYHA 3EWKA 1YTZI 3GHGC 4D6TE 2E75B 3SWFA 1VDFA 4PV1B 1WT6A 1FC2C 3L4FA 4OGQD 2E42A 1SQBJ 2GUSA 1NKNA 2Q1KA 5KLVD 4DCKA 1H0TB 3L75D 3TGUG 1L4AA 1VQ6P 2W6AA 2WPSA 2KSJA 4L76A 1QEXA 1NTZK 4H44B 1S4XA 3QH9A 1JNMA 4PV1C 5AVQB 3HUSA 1PGPA 1M56D 1NU1D 2N1TD 3CCUP 2E76C 2PP6A 3II6A 1P84I 1AQ5A 2RH0A 1QVFO 5AW2B 5KLIC 3P8MC 2C0WA 1RE4A 2WSEH 3S1KA 3L71J 1L0NJ 1RY3A 4H0LB 3CX5E 3B5NA 1K73Q 3TSIA 3FX0A 3KQGA 2N9BA 3KDPB 1S5LX 1M57D 1CSBA 2FXOA 4UB6H 2V7QJ 5TISH 1N8RQ 4C7NB 1NU1J 3RK3E 1EZVG 3GW6A 1JEKA 1NTKD 3L71E 2OYHB 4OH8B 3RK2C 1Z56A 3P8CE 2P58A 3G71P 3SFDC 2M5AA 1J1EB 1LT1A 2KXPB 2B87A 2W6JH 1T2KD 3L70G 4UB8E 3LW5H 3D70A 5CCHA 1IFIA 4C7NA 3L70J 5KKZB 1RE3C 2K3RA 1SQBG 1S9KE 2OTJP 1S5LE 5CCGA 3G6EP 2ZVNB 1SQVE 2KUBA 2YKPA 3RK2B 4EI2A 5KTBA 1NO4A 3I55P 1USDA 2WVRA 1NU1K 3FWLA 4JPZB 1X0TA 1Q7YQ 1BCCJ 1OXZA 1FU1A 5GTIH 2UWJE 3H1JG 1N7LA 3HE5B 3Q3DA 1VQ9P 1KB9E 2IBZI 1BGYD 3CCVP 2WT7A 1HBWA 3CX5D 2P7JA 4KT0J 5APUA 1NHLA 2A06G 2WSEJ 2FYNC 2FYUG 5AW6B 3TK1A 1DD4A 4WY4D 4RKUJ 2Z4EA 1L2PA 2I1KA 1GL2A 3M0DC 4EYYQ 1SQBD 1BCCE 1U7JA 2E74B 5CCHD 2W27A 1S1CX 1GMJA 1NU1E 2MKVA 2MJZA 3H1ID 4HKZH 4IOIH 4EOTA 5AVUB 3T97A 1E5WA 1FZAA 1TU3F 2E74D 4C7RA 4PJ0E 2WT7B 1L4AC 2WSFJ 2YKOA 5AW8B 3MZWB 1VF5C 4H13B 1HH0A 4YPCA 3CX5I 3LW5J 1VQ5P 1MUUA 3NFQA 4WBAA 2J5UA 1G1JA 4LLHA 3H1HD 1SQPE 1JCDA 3GG2A 2OYIA 2ZFCA 3M9QA 1PP9G 1W5CE 4OGQB 3Q2YA 3L72G 1SQXK 2YO2A 4JQ0D 5EFWB 1IFPA 3AEFC 1OX3A 1SQQJ 3GF3A 1J2JB 2XU6A 1GK4A 1BSHA 5CCGD 1YQ4C 1NTMD 1JY2P 1LP1B 1SQPJ 1RF1A 3HE4B 2ZXXA 1ZXGA 2AEFA 1N7SC 1YTZT 2D2CB 3HD7B 1QLED 4IFFA 1KYOH 3B4SA 3MUDA 1FBMA 2YIUB 5KJ7A 2OYIC 1LWUA 2FFDB 1GD2E 1BE3E 4WVZA 4BWNA 2QRXA 3O6QA 4OVNF 2K88A 1LTJA 1YYCA 3CXHH 1GTWA 1JY2O 5H2FH 1WMKA 3HTKA 4A7PA 4IFMA 4CPGA 4BXLA 2NPSB 1KILC 3H1HG 4KHXA 1GZLA 3PP5A 1UIXA 2ZT9C 2D2CC 4U3FE 2HPCB 2QEXP 1PV3A 1BE3J 2WPVB 3AE4C 3S4RA 3U1CA 1KN7A 2J58A 4C46A 2KIKA 1KILA 4BRYA 1P84D 1PPJD 3EFFK 1BSNA 2JDIH 2M3EA 1BCCD 3V2QA 4IL6X 3B8EB 4IFDK 1LTJC 2JEEA 2WTYA 2O1KA 2POHA 1SQQE 2A06D 3B5ND 4HYTB 1JM0A 1HGZA 2O01H 3CI9A 1NYHA 2H8PD 3MUDC 1Q90D 4GDOA 5APXA 3VMZA 5KJ7C 1FOSF 3VP9A 1NTZD 1OW7A 2BCCJ 2HR3A 1N7SB 3VN0A 4RESB 1L0LG 1YHQP 2IYPA 3GHGB 1G2CB 5APQA 3CWBE 1J1EC 1XTCC 1KMIZ 2N1TA 3CWBD 1VQKP 2AXCA 2Y9ZA 2C9NY 1RQVA 2R5BA 1VF5B 4WB4A 2HFED 1IK7A 2P67A 2XKMA 2YO3A 3RL0B 4ZKUA 2FKWB 1DH3A 1NAYA 1VQ7P 3TDKA 1X79B 3A0BH 2KZJA 3KPEA 5AW1B 2QJPC 3OA7A 3WMM0 1VQPP 2FYZA 2IBZG 2ZYDA 3M0AA 2FFDA 5APTA 4N78E 2E43A 3NTNA 4TLFA 5KLIB 1HWTC 1IFDA 3R4YA 4OWFA 1NTMJ 1SQPD 2PGDA 2KLUA 5BVZA 3CCMP 3H1JE 3A0HE 3BCCJ 2M3BA
chains in the Genus database with same CATH topology
2R5DA 4N78D 5CHXA 5APVA 2VRSA 1LWUC 1OWAA 3U59A 5BU8B 2OYHC 3EFGA 2WWWA 5CJ0A 5AVTB 2KLVA 3VOPA 1JCCA 3HD7A 1PFIA 1LT9C 1X9VA 3MGNA 4GIFA 2C9LY 2WPRA 2KYVA 3HUSC 4AYCA 2YKQA 5AVWB 2C0XA 5AW5B 5AW4B 3EQ2A 3RK3D 2HLOA 2O1JA 3G3ZA 1CZQA 2OYIB 1SQPK 3H32A 2Z5HA 3MIWA 1JTHB 4GKGA 1URQA 2R3CA 3M9HA 1GL2D 2QM7A 1RE3A 1NOHA 4WY4A 3V4QA 4N3YB 2QM8A 1CI6A 1H8AA 1RF1B 1MFZA 2WSCH 3TYYA 5AW7B 2JJLA 4ZKPA 1NAFA 1H89A 2ZXEB 1L4AB 3BRTB 1URQB 2Q5UA 3V2PA 1RF0C 1SFCA 1GK6A 1GU5A 1N73C 3OJAB 1J1DC 3RL0D 2IX7C 5APWA 1JY2N 2FYUK 2Q3IA 2YMYA 4LGDE 1NTKK 5AVZB 2WPQA 1EQ7A 2GM4A 3BRVB 1FZCB 4JF7A 2A45H 2CPBA 4GT1A 1H88A 3V2NA 3UIAA 1LWUB 1LTIC 2N1TB 1FZFA 2XV5A 1SFCB 1LTAC 1IFNA 5CCHC 3RL0C 3R2PA 3GHGA 1IO4A 3MD0A 1N7SA 3B5NC 1X8YA 2Q9IA 3SWYA 3L37A 1MV8A 1RE4C 1LTBC 2FFDC 5AW3B 3P32A 1IJDB 1ZV8A 3CL3D 1GU4A 1HGVA 1N86A 3HTKB 1A02J 3IR9A 1KFMA 3RK2D 2HPCA 2Q7CA 1J1DB 3VP8A 1ZR4A 2OARA 1NTMK 1L0LK 2Z5IA 4AQRD 1L4AD 1KQLA 2CPSA 1FZEA 3I5CA 5CCGC 1LGHB 2A45G 1JUNA 3VTPC 2W6BA 4XA4A 4W80A 5AVVB 3BVHA 3LIDA 4W7ZA 4Y99C 2XZRA 3MTUE 4DZOA 2NPSA 3CLQA 1JY3N 2IFNA 1KFNA 1T2KC 2XDJA 1G2CA 2KP8A 3RK3C 3A3YB 1T3UA 1G1IA 1M1JC 2XNXA 3H6PA 4WY4B 3U1AA 1IFJA 1IC2A 2BASA 1RF0A 1SFCC 2NPSD 3WMM0 2WT7A 3KYQA 3TNUA 1JTHA 1SP4A 1JMMA 1SQQK 1GW4A 1VPCA 2HG5D 3E1IA 1FZCA 4XE5B 1LTTC 3VMYA 1NWQA 3M06A 3HE5A 3B5NB 3V4WA 1FZGA 4AUWA 5CMZA 1M1JA 3HE4A 3HD7D 3N7NA 3N4XA 2N1TC 1GDTA 1MZ9A 5KLVK 4HH2A 4DOJA 1FZCC 3P7KA 2YNYA 1DX7A 1CI6B 1L0NK 4LC1A 3M91A 3C9IA 3HRNA 5AVRB 3TNUB 1HTLC 3LIEA 3M9BA 2PAJA 3O8ZA 2HODA 1WRGA 3V5BA 3L35A 3H32B 1FJPA 1QL1A 4N6JA 1GL2B 4JYBA 1FZBA 1RF1C 1FJKA 1SLQA 2R32A 1S9KD 2LKMA 1N7SD 1T8ZA 5AW0B 1N73B 3V2RA 1LTJB 3NXSA 5KJ7D 1GL2C 3M0DA 1URQD 5CJ4A 4JYCA 2A45I 1NH4A 3HD7C 4B86A 3OAKA 1FAVA 3RK3B 4M3LA 5AVYB 2H43A 1SVFA 4I1LA 2WITA 1KILB 2WSFH 1JY3P 1HVVA 2IFMA 2GUVA 1KZUB 1KILD 5AVSB 1SQVK 1QL2A 3A7OA 4W7YA 1JOCA 1HUCA 1LTGC 5AW9B 2HYNA 3BASA 2FFDB 1LT9A 1SQBK 1N2DC 2KOGA 1A02F 4I6MC 2FXMA 3HUSB 2IPPA 1XTGB 2P2UA 3VYIA 1AFOA 1JO5A 3P8CD 1LT9B 2HODB 1LTSC 2H7HA 1JY3O 3BATA 1W2EA 4WY4C 2I1JA 3A2AA 2P1JA 1M1JB 4O9BA 1ZR2A 1GW3A 1DEBA 1M7LA 1ZN5A 1N73A 3L36A 1IK9A 3NMDA 1FDMA 3IFMA 1IFMA 1SFCD 2NPSC 4I2LC 1ZLLA 1FOSE 5AVXB 2J59M 3A5TA 1CW5A 2KB7P 2L5GB 1NKZB 1T3JA 2M8RA 5BU5A 4Y99B 2WZ7A 1URQC 3VMXA 5APSA 2OYHA 4EIJA 1YTZI 3GHGC 3SWFA 1VDFA 1WT6A 3L4FA 2E42A 2GUSA 1NKNA 1L4AA 2W6AA 2WPSA 2KSJA 1NTZK 1JNMA 5AVQB 3HUSA 2N1TD 2PP6A 3II6A 1AQ5A 5AW2B 3P8MC 2C0WA 1RE4A 2WSEH 1RY3A 3B5NA 3TSIA 3KQGA 2N9BA 3KDPB 1CSBA 4C7NB 2OYHB 4OH8B 3RK2C 1Z56A 3P8CE 1J1EB 1T2KD 3LW5H 5CCHA 1IFIA 4C7NA 1RE3C 1S9KE 5CCGA 2YKPA 3RK2B 5KTBA 1NO4A 1NU1K 1OXZA 1FU1A 1N7LA 3HE5B 1HBWA 2P7JA 5APUA 1NHLA 5AW6B 3TK1A 4WY4D 2Z4EA 2I1KA 1GL2A 3M0DC 5CCHD 2W27A 4EOTA 2MJZA 5AVUB 3T97A 1E5WA 1FZAA 4C7RA 1HJBA 2WT7B 1L4AC 2YKOA 5AW8B 1HH0A 1MUUA 3NFQA 4WBAA 1G1JA 4LLHA 2OYIA 1JCDA 2ZFCA 3M9QA 1SQXK 2YO2A 1J2JB 2XU6A 1GK4A 5CCGD 1RF1A 1JY2P 3HE4B 1N7SC 1YTZT 4IFFA 3HD7B 4KHXA 5APYA 3MUDA 1FBMA 5KJ7A 2OYIC 1LWUA 1LTJA 1YYCA 1GTWA 1JY2O 3HTKA 4IFMA 2NPSB 1KILC 1GZLA 3PP5A 2HPCB 3U1CA 2J58A 4C46A 1KILA 3V2QA 3B8EB 4IFDK 1LTJC 2JEEA 2WTYA 2O1KA 2POHA 3B5ND 4HYTB 2O01H 1HGZA 3CI9A 3VMZA 2H8PD 5KJ7C 1GD2E 5APXA 1FOSF 3VP9A 1N7SB 3VN0A 4RESB 3GHGB 5APQA 1G2CB 1J1EC 1XTCC 2N1TA 2C9NY 2R5BA 4WB4A 2HFED 2P67A 2XKMA 2YO3A 3RL0B 4ZKUA 2FKWB 1DH3A 1X79B 3KPEA 5AW1B 3OA7A 2FFDA 2FYZA 3M0AA 5APTA 4N78E 2E43A 3NTNA 1HWTC 1IFDA 5BVZA 2M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP9 A;  2FXM A;  3VP8 A;  4O9B A;  3C9I A;  3HRN A;  1NKN A;  4N78 D;  4I1L A;  3U59 A;  5BU8 B;  4N3Y B;  4ZKU A;  3P8C D;  1X79 B;  4GIF A;  3U1C A;  5KTB A;  3N7N A;  3U1A A;  3N4X A;  4ZKP A;  1IC2 A;  3BAT A;  2JEE A;  5BU5 A;  3BAS A;  2POH A;  3OJA B;  5BVZ A;  1WT6 A; 
#chains in the Genus database with same CATH topology
 2R5D A;  3AEC C;  3WU2 H;  4N78 D;  3AE9 C;  5CHX A;  2O3J A;  2BCC E;  4UB6 E;  2VRS A;  5APV A;  5TIS E;  1LWU C;  3Q5S A;  2LR2 A;  1OWA A;  5B66 E;  3U59 A;  3TF5 A;  5BU8 B;  2OYH C;  3EFG A;  3KXD A;  1NU1 G;  1OMI A;  2WWW A;  1FDO A;  2QVA A;  5CJ0 A;  5AVT B;  2KLV A;  2Y0C A;  3VOP A;  1JCC A;  1NTZ G;  3HD7 A;  4U3F D;  1PFI A;  1NTK J;  1D7M A;  1LT9 C;  1BGY E;  1X9V A;  1QVG O;  3MGN A;  4GIF A;  2C9L Y;  2WPR A;  2KYV A;  1RHZ B;  5KAF E;  2ZVO B;  1PIX A;  2I8D A;  3HUS C;  2B87 B;  4AYC A;  2QJK C;  2YKQ A;  1Q2N A;  2K9Y A;  5AVW B;  2ITA A;  2C0X A;  3E1R A;  3SFE C;  5AW5 B;  5AW4 B;  3EQ2 A;  3RK3 D;  1NGM B;  1M90 Q;  2HLO A;  3L71 G;  1KQG B;  2O1J A;  3G3Z A;  3RGU A;  1KOR A;  1YQ3 C;  2AXT E;  1AQT A;  2E76 B;  1AV1 A;  3L73 G;  1CZQ A;  4PD4 E;  4D6T D;  2OYI B;  1NTM E;  4ASV A;  1H0T A;  1SQP K;  3H1J J;  5DJU B;  3H32 A;  3L73 D;  2Z5H A;  3MIW A;  1JTH B;  1X22 A;  2JWA A;  3H1I E;  4GKG A;  3KZI E;  3K5B A;  4NPD A;  1URQ A;  2R3C A;  1SQX E;  3H1K E;  3M9H A;  5CBN A;  4TT3 H;  3H25 A;  4GOD A;  1GL2 D;  2QM7 A;  3Q1M A;  1RE3 A;  2ZJS E;  1NOH A;  4WY4 A;  3V4Q A;  4N3Y B;  2QM8 A;  4R4M A;  3RL0 g;  4H13 C;  1CI6 A;  2NZ2 A;  1H8A A;  1RF1 B;  1VQ4 P;  1MFZ A;  2WSC H;  3ABV C;  4U3F G;  5AW7 B;  2JJL A;  2IDB A;  3L73 J;  1R5L A;  3TYY A;  4YXD C;  2FY8 A;  4ZKP A;  1NAF A;  3CD6 P;  2Q6Q A;  3AE7 C;  1H89 A;  2ZXE B;  1L4A B;  4IL6 E;  1AA0 A;  3BRT B;  1URQ B;  2Q5U A;  3FGA D;  3V2P A;  1RF0 C;  1SFC A;  1GK6 A;  5B5E H;  1GU5 A;  2QE7 H;  3OJA B;  4ASW A;  1L0N G;  1VQM P;  1N73 C;  5GTH E;  2JO1 A;  4L75 A;  1M8O B;  2KK7 A;  1J1D C;  3RL0 D;  3L75 J;  2IX7 C;  5APW A;  2K37 A;  1JY2 N;  2FYU K;  4Y28 J;  3AE1 C;  4L74 A;  2Q3I A;  2YMY A;  1YI2 P;  2K9J A;  2L91 A;  4LGD E;  2YXQ B;  1SQV D;  1NTK K;  2ZT9 B;  5AVZ B;  2QA4 P;  2R44 A;  2WPQ A;  1EQ7 A;  3H1L J;  4JBZ A;  5M1B A;  3O6Q B;  1FE6 A;  2GM4 A;  3BRV B;  5H2F E;  2Q3E A;  3GLM A;  1FZC B;  3W68 A;  1KD1 Q;  2AEM A;  4JF7 A;  3BCC G;  2A45 H;  2OTK E;  1ZRT E;  2OGU A;  5K5G B;  2CPB A;  5E79 E;  2RMZ A;  1OVR A;  2NRG A;  2RN0 A;  2K9J B;  3H1L E;  4GT1 A;  3V2N A;  1H88 A;  1Q81 Q;  1EDL A;  2B88 A;  1PL5 A;  2FYU E;  3UIA A;  2FYU D;  1ZME C;  1LWU B;  3TGU E;  1LTI C;  1PGO A;  3JCU E;  2N1T B;  1L0L D;  1FZF A;  3Q5R A;  2XV5 A;  3WUU A;  3L70 D;  1SFC B;  3AE2 C;  1LTA C;  1IFN A;  5CCH C;  3C1L A;  3L75 E;  3D71 A;  3CCS P;  1VL2 A;  2PRR A;  1K9M Q;  3RL0 C;  1LJ2 A;  3R2P A;  3GHG A;  2WQY C;  1IO4 A;  3MD0 A;  1N7S A;  1SQV G;  1EZV D;  3B5N C;  3IF4 A;  3CC4 P;  2P10 A;  3V6I A;  1X8Y A;  3BCC D;  2Q9I A;  3SWY A;  1MV8 A;  1RE4 C;  1LTB C;  2QJY B;  3L37 A;  3S9O A;  2FFD C;  5AW3 B;  3P32 A;  3CMA P;  1EDI A;  1QX8 A;  1OVV A;  1IJD B;  1ZV8 A;  3CL3 D;  1DD3 A;  3A0B E;  1GU4 A;  1ZW0 A;  1EZV E;  1EDJ A;  1HGV A;  1N86 A;  3HTK B;  4K3A A;  1A02 J;  3IR9 A;  3JC2 2;  4H44 D;  2OTL P;  3CX5 H;  1KFM A;  3TGU J;  3WUV A;  2H89 C;  2IBZ E;  3RK2 D;  2HPC A;  2Q7C A;  1J1D B;  2AEJ A;  3VP8 A;  1AJY A;  1ZR4 A;  2QJP B;  1L0N E;  2OAR A;  1FDI A;  3L70 E;  1NTM K;  1EXI A;  1L0L K;  1SQB E;  2Z5I A;  1SQV J;  3FXE A;  2JKV A;  1ZP0 C;  2YXR B;  3MHV A;  4AQR D;  1KC8 Q;  3L72 D;  1L4A D;  1KQL A;  2CPS A;  3WUT A;  5B66 H;  3CC2 P;  1FZE A;  3I5C A;  5CCG C;  2KZI A;  1LGH B;  1YBK A;  2A45 G;  1Q86 Q;  2V7Q H;  1VQL P;  1JUN A;  1JB0 J;  4UB8 H;  3AEE C;  3VTP C;  2W6B A;  3AE5 C;  3G9R A;  4XA4 A;  4W80 A;  1SS1 A;  5AVV B;  1PPJ G;  1S5L H;  4I7Z C;  3BVH A;  5KAF H;  3LID A;  4RJT A;  3CXH I;  1YJW P;  4W7Z A;  2E5Y A;  1KIL E;  3H1I G;  2XZR A;  4Y99 C;  1KTM A;  2B9B A;  3MTU E;  3MP7 B;  4DZO A;  2RKL A;  3SWK A;  2OYO A;  2YIU C;  1KYO I;  4HB1 A;  2AXT H;  1BDC A;  2NPS A;  2QG4 A;  3CLQ A;  1JY3 N;  1E79 H;  1BGY G;  2IFN A;  4OGQ C;  3L71 D;  1KFN A;  2PFX A;  4K35 A;  1T2K C;  2XDJ A;  1PP9 E;  4KJM A;  4H44 C;  1EZV I;  1OZH A;  2LXC B;  2QSI A;  4ZNC A;  1U57 A;  1Y9B A;  3H1L D;  1M1K Q;  1G2C A;  4PJ0 H;  3ZDM A;  3CCQ P;  2KP8 A;  1VF5 D;  2LXB A;  4GOF A;  5DJT B;  3RK3 C;  2KS1 A;  3A3Y B;  1T3U A;  1G1I A;  4H0L D;  1M1J C;  2XNX A;  3H6P A;  4WY4 B;  1IZN B;  1NVO A;  3U1A A;  4R4L A;  1KB9 I;  3PJS K;  1IFJ A;  1IC2 A;  2BAS A;  1RF0 A;  1SFC C;  2IZ0 A;  2NPS D;  2Y0D A;  2QJK B;  1P84 H;  3AED C;  1PGQ A;  3FXD A;  3JSV C;  5KAI E;  3T97 B;  1KYO E;  3KYQ A;  3TNU A;  3AEG C;  1JTH A;  1SP4 A;  2E5T A;  5KKZ C;  1JMM A;  4IL6 H;  1JMB A;  3L72 E;  4MN4 C;  4U3F J;  1SQQ K;  1GW4 A;  1VPC A;  2FYN B;  2HG5 D;  3E1I A;  4XE5 B;  1FZC A;  4XFJ A;  2BEZ F;  1LTT C;  1SQP G;  3VMY A;  4Z1M H;  4GOE A;  1NWQ A;  1MKM A;  3M06 A;  3HE5 A;  5KLV E;  1AVO A;  3L74 J;  3B5N B;  4U7J A;  1KV4 A;  1R8E A;  5APY A;  2IBZ D;  4HJG H;  3E7K A;  3L72 J;  3CXH D;  3V4W A;  3CXH E;  1FZG A;  1PP9 J;  4AUW A;  5CMZ A;  2SPZ A;  1M1J A;  2XND H;  2KSE A;  1NJI Q;  2ZYA A;  1EDK A;  1LNQ A;  2JWD A;  3HE4 A;  3HD7 D;  3L74 E;  3N7N A;  3H1J D;  3N4X A;  3AE3 C;  2O01 J;  3I56 P;  1S72 P;  2N1T C;  3AE6 C;  2M5A B;  3CWB J;  1VQO P;  1GDT A;  1Y47 A;  5TJH A;  1MZ9 A;  3CWB G;  1SQX D;  2WSC J;  3H1K D;  3G4S P;  3QWO C;  3C8V A;  5KLV K;  4HH2 A;  4DOJ A;  1FZC C;  1KYO D;  3P7K A;  2YNY A;  1DX7 A;  1CI6 B;  1QGK B;  1L0N K;  4LC1 A;  3M91 A;  3CCJ P;  3C9I A;  3HRN A;  3IN6 A;  2GA1 A;  2WMM A;  3JCU H;  5AVR B;  3TNU B;  1HTL C;  3GMA A;  3LIE A;  2PAJ A;  3M9B A;  3O8Z A;  4DJG A;  3Q5P A;  2HOD A;  4RO0 A;  1WRG A;  4QMA A;  3V5B A;  1W2B O;  4ZMD A;  3SSU A;  3D6Z A;  2BCC G;  3L35 A;  1DIP A;  3L74 G;  1NTK G;  1KQS O;  3H32 B;  2E75 C;  5C39 A;  1R5S A;  1FJP A;  1QL1 A;  4N6J A;  1GL2 B;  4JYB A;  1FZB A;  2IZ1 A;  1RF1 C;  1FJK A;  1T6A A;  1SLQ A;  2R32 A;  1KQF B;  2K1A A;  3AEA C;  1S9K D;  3PLN A;  2LKM A;  1N7S D;  1T8Z A;  4I7Z B;  5AW0 B;  3W67 A;  2FXP A;  1HF9 A;  1L0N D;  1NTM G;  3A0H H;  4PD4 D;  3PHL A;  1N73 B;  1OVU A;  2D2C D;  3V2R A;  1LTJ B;  3NXS A;  5KJ7 D;  1YJ9 P;  1VQN P;  3CPW O;  1GL2 C;  3M0D A;  1URQ D;  3ITK A;  4JYC A;  2A45 I;  5CJ4 A;  1USE A;  1NH4 A;  1RH5 B;  1PP9 D;  2N9Y B;  3HD7 C;  1NTK E;  4B86 A;  1NTZ E;  3OAK A;  4YXW H;  1FAV A;  5L8R J;  4M3L A;  4NPE A;  5AVY B;  3RK3 B;  2H43 A;  3CCE P;  2QIW A;  1SVF A;  4I1L A;  2JP3 A;  3WU2 E;  2WIT A;  2E76 D;  3AE8 C;  1S2E A;  3D6Y A;  1KIL B;  2WSF H;  1JY3 P;  2E75 D;  3BCC E;  4BRY B;  1HVV A;  1RQU A;  2ZT9 D;  2G3A A;  2GUV A;  2IFM A;  1K04 A;  2V4H A;  1KZU B;  1KIL D;  4WWI A;  1NTZ J;  1SQV K;  1QL2 A;  2BCC D;  1L0L J;  1JOC A;  1HUC A;  3A7O A;  1SQX G;  3AEB C;  3H1K G;  4W7Y A;  5GTI E;  1HJ0 A;  3RBX A;  1LTG C;  1KB9 H;  1OFC X;  4PD4 H;  2DW3 A;  5AW9 B;  4D6T G;  5AVS B;  5KLV J;  1U7M A;  2HYN A;  1EC5 A;  2OQQ A;  3H1I J;  1KB9 D;  3PRJ A;  2FBW C;  1SQX J;  1BGY J;  3BAS A;  1LT9 A;  2W83 C;  3H1K J;  3PTZ A;  1L0L E;  1SQB K;  1N2D C;  2KOG A;  3OW2 O;  1A02 F;  1HJB A;  3IAO A;  3KZI H;  4I6M C;  1BE3 D;  2FXM A;  4DT0 A;  3F5H A;  2YMK A;  3HUS B;  4H0L C;  1EXJ A;  2Y0E A;  3H1H E;  2IPP A;  2WSS H;  1Q82 Q;  1XTG B;  5CBO A;  1DEE G;  2P2U A;  2ZYG A;  3VYI A;  3CCL P;  1AVY A;  4NPF X;  1AFO A;  1JO5 A;  3P8C D;  1OW8 A;  1PZQ A;  3H1H J;  3F89 A;  1YIJ P;  1YIT P;  1LT9 B;  3FWN A;  2E74 C;  4L73 A;  5B5E E;  1K05 A;  1FS0 E;  2HOD B;  2IYO A;  1LTS C;  1SQQ G;  2G8Y A;  4EDF A;  2H7H A;  3CME P;  1JY3 O;  1MFT A;  4PD4 I;  3BAT A;  2H88 C;  1SQQ D;  2A06 E;  1W2E A;  2JR8 A;  2KI7 B;  4WY4 C;  4D6T J;  2KS1 B;  2I1J A;  1OIP A;  3B71 A;  2W8Z A;  3CC7 P;  2KNC A;  2M0B A;  1P84 E;  1PPJ E;  5KAI H;  1VQ8 P;  3A2A A;  3H1L G;  3CCR P;  2O01 N;  2P1J A;  1M1J B;  4O9B A;  1ZR2 A;  3RBZ A;  5GTH H;  2CK3 H;  2QJY C;  3KHU A;  1GW3 A;  1DEB A;  1PGJ A;  1YJN P;  1ZRT D;  1M7L A;  1ZN5 A;  2B89 A;  3L36 A;  2W90 A;  1N73 A;  1UII A;  1IK9 A;  3NMD A;  2R3S A;  1FDM A;  1S3J A;  3IFM A;  2ZAE B;  1K8A Q;  1BE3 G;  3VMA A;  2FYU J;  5E79 H;  1IFM A;  1SFC D;  2NPS C;  4I2L C;  1ZLL A;  3L75 G;  3USS A;  1BDD A;  2BEQ D;  3GF7 A;  5AVX B;  5KLV G;  1ZOY C;  3TGU D;  1FOS E;  2J59 M;  4YTP C;  3A5T A;  2KNC B;  1CW5 A;  1LP1 A;  1Y8A A;  2KB7 P;  3L74 D;  2L5G B;  4H13 D;  1NKZ B;  1OW6 A;  1T3J A;  3L73 E;  3PH0 A;  2Y9Y A;  2M8R A;  5BU5 A;  4Y99 B;  2WZ7 A;  4PV1 D;  1URQ C;  3VMX A;  5APS A;  1BCC G;  4EIJ A;  2OYH A;  3EWK A;  1YTZ I;  3GHG C;  4D6T E;  2E75 B;  3SWF A;  1VDF A;  4PV1 B;  1WT6 A;  1FC2 C;  3L4F A;  4OGQ D;  2E42 A;  1SQB J;  2GUS A;  1NKN A;  2Q1K A;  5KLV D;  4DCK A;  1H0T B;  3L75 D;  3TGU G;  1L4A A;  1VQ6 P;  2W6A A;  2WPS A;  2KSJ A;  4L76 A;  1QEX A;  1NTZ K;  4H44 B;  1S4X A;  3QH9 A;  1JNM A;  4PV1 C;  5AVQ B;  3HUS A;  1PGP A;  1M56 D;  1NU1 D;  2N1T D;  3CCU P;  2E76 C;  2PP6 A;  3II6 A;  1P84 I;  1AQ5 A;  2RH0 A;  1QVF O;  5AW2 B;  5KLI C;  3P8M C;  2C0W A;  1RE4 A;  2WSE H;  3S1K A;  3L71 J;  1L0N J;  1RY3 A;  4H0L B;  3CX5 E;  3B5N A;  1K73 Q;  3TSI A;  3FX0 A;  3KQG A;  2N9B A;  3KDP B;  1S5L X;  1M57 D;  1CSB A;  2FXO A;  4UB6 H;  2V7Q J;  5TIS H;  1N8R Q;  4C7N B;  1NU1 J;  3RK3 E;  1EZV G;  3GW6 A;  1JEK A;  1NTK D;  3L71 E;  2OYH B;  4OH8 B;  3RK2 C;  1Z56 A;  3P8C E;  2P58 A;  3G71 P;  3SFD C;  2M5A A;  1J1E B;  1LT1 A;  2KXP B;  2B87 A;  2W6J H;  1T2K D;  3L70 G;  4UB8 E;  3LW5 H;  3D70 A;  5CCH A;  1IFI A;  4C7N A;  3L70 J;  5KKZ B;  1RE3 C;  2K3R A;  1SQB G;  1S9K E;  2OTJ P;  1S5L E;  5CCG A;  3G6E P;  2ZVN B;  1SQV E;  2KUB A;  2YKP A;  3RK2 B;  4EI2 A;  5KTB A;  1NO4 A;  3I55 P;  1USD A;  2WVR A;  1NU1 K;  3FWL A;  4JPZ B;  1X0T A;  1Q7Y Q;  1BCC J;  1OXZ A;  1FU1 A;  5GTI H;  2UWJ E;  3H1J G;  1N7L A;  3HE5 B;  3Q3D A;  1VQ9 P;  1KB9 E;  2IBZ I;  1BGY D;  3CCV P;  2WT7 A;  1HBW A;  3CX5 D;  2P7J A;  4KT0 J;  5APU A;  1NHL A;  2A06 G;  2WSE J;  2FYN C;  2FYU G;  5AW6 B;  3TK1 A;  1DD4 A;  4WY4 D;  4RKU J;  2Z4E A;  1L2P A;  2I1K A;  1GL2 A;  3M0D C;  4EYY Q;  1SQB D;  1BCC E;  1U7J A;  2E74 B;  5CCH D;  2W27 A;  1S1C X;  1GMJ A;  1NU1 E;  2MKV A;  2MJZ A;  3H1I D;  4HKZ H;  4IOI H;  4EOT A;  5AVU B;  3T97 A;  1E5W A;  1FZA A;  1TU3 F;  2E74 D;  4C7R A;  4PJ0 E;  2WT7 B;  1L4A C;  2WSF J;  2YKO A;  5AW8 B;  3MZW B;  1VF5 C;  4H13 B;  1HH0 A;  4YPC A;  3CX5 I;  3LW5 J;  1VQ5 P;  1MUU A;  3NFQ A;  4WBA A;  2J5U A;  1G1J A;  4LLH A;  3H1H D;  1SQP E;  1JCD A;  3GG2 A;  2OYI A;  2ZFC A;  3M9Q A;  1PP9 G;  1W5C E;  4OGQ B;  3Q2Y A;  3L72 G;  1SQX K;  2YO2 A;  4JQ0 D;  5EFW B;  1IFP A;  3AEF C;  1OX3 A;  1SQQ J;  3GF3 A;  1J2J B;  2XU6 A;  1GK4 A;  1BSH A;  5CCG D;  1YQ4 C;  1NTM D;  1JY2 P;  1LP1 B;  1SQP J;  1RF1 A;  3HE4 B;  2ZXX A;  1ZXG A;  2AEF A;  1N7S C;  1YTZ T;  2D2C B;  3HD7 B;  1QLE D;  4IFF A;  1KYO H;  3B4S A;  3MUD A;  1FBM A;  2YIU B;  5KJ7 A;  2OYI C;  1LWU A;  2FFD B;  1GD2 E;  1BE3 E;  4WVZ A;  4BWN A;  2QRX A;  3O6Q A;  4OVN F;  2K88 A;  1LTJ A;  1YYC A;  3CXH H;  1GTW A;  1JY2 O;  5H2F H;  1WMK A;  3HTK A;  4A7P A;  4IFM A;  4CPG A;  4BXL A;  2NPS B;  1KIL C;  3H1H G;  4KHX A;  1GZL A;  3PP5 A;  1UIX A;  2ZT9 C;  2D2C C;  4U3F E;  2HPC B;  2QEX P;  1PV3 A;  1BE3 J;  2WPV B;  3AE4 C;  3S4R A;  3U1C A;  1KN7 A;  2J58 A;  4C46 A;  2KIK A;  1KIL A;  4BRY A;  1P84 D;  1PPJ D;  3EFF K;  1BSN A;  2JDI H;  2M3E A;  1BCC D;  3V2Q A;  4IL6 X;  3B8E B;  4IFD K;  1LTJ C;  2JEE A;  2WTY A;  2O1K A;  2POH A;  1SQQ E;  2A06 D;  3B5N D;  4HYT B;  1JM0 A;  1HGZ A;  2O01 H;  3CI9 A;  1NYH A;  2H8P D;  3MUD C;  1Q90 D;  4GDO A;  5APX A;  3VMZ A;  5KJ7 C;  1FOS F;  3VP9 A;  1NTZ D;  1OW7 A;  2BCC J;  2HR3 A;  1N7S B;  3VN0 A;  4RES B;  1L0L G;  1YHQ P;  2IYP A;  3GHG B;  1G2C B;  5APQ A;  3CWB E;  1J1E C;  1XTC C;  1KMI Z;  2N1T A;  3CWB D;  1VQK P;  2AXC A;  2Y9Z A;  2C9N Y;  1RQV A;  2R5B A;  1VF5 B;  4WB4 A;  2HFE D;  1IK7 A;  2P67 A;  2XKM A;  2YO3 A;  3RL0 B;  4ZKU A;  2FKW B;  1DH3 A;  1NAY A;  1VQ7 P;  3TDK A;  1X79 B;  3A0B H;  2KZJ A;  3KPE A;  5AW1 B;  2QJP C;  3OA7 A;  3WMM 0;  1VQP P;  2FYZ A;  2IBZ G;  2ZYD A;  3M0A A;  2FFD A;  5APT A;  4N78 E;  2E43 A;  3NTN A;  4TLF A;  5KLI B;  1HWT C;  1IFD A;  3R4Y A;  4OWF A;  1NTM J;  1SQP D;  2PGD A;  2KLU A;  5BVZ A;  3CCM P;  3H1J E;  3A0H E;  3BCC J;  2M3B A; 
#chains in the Genus database with same CATH homology
 2R5D A;  4N78 D;  5CHX A;  5APV A;  2VRS A;  1LWU C;  1OWA A;  3U59 A;  5BU8 B;  2OYH C;  3EFG A;  2WWW A;  5CJ0 A;  5AVT B;  2KLV A;  3VOP A;  1JCC A;  3HD7 A;  1PFI A;  1LT9 C;  1X9V A;  3MGN A;  4GIF A;  2C9L Y;  2WPR A;  2KYV A;  3HUS C;  4AYC A;  2YKQ A;  5AVW B;  2C0X A;  5AW5 B;  5AW4 B;  3EQ2 A;  3RK3 D;  2HLO A;  2O1J A;  3G3Z A;  1CZQ A;  2OYI B;  1SQP K;  3H32 A;  2Z5H A;  3MIW A;  1JTH B;  4GKG A;  1URQ A;  2R3C A;  3M9H A;  1GL2 D;  2QM7 A;  1RE3 A;  1NOH A;  4WY4 A;  3V4Q A;  4N3Y B;  2QM8 A;  1CI6 A;  1H8A A;  1RF1 B;  1MFZ A;  2WSC H;  3TYY A;  5AW7 B;  2JJL A;  4ZKP A;  1NAF A;  1H89 A;  2ZXE B;  1L4A B;  3BRT B;  1URQ B;  2Q5U A;  3V2P A;  1RF0 C;  1SFC A;  1GK6 A;  1GU5 A;  1N73 C;  3OJA B;  1J1D C;  3RL0 D;  2IX7 C;  5APW A;  1JY2 N;  2FYU K;  2Q3I A;  2YMY A;  4LGD E;  1NTK K;  5AVZ B;  2WPQ A;  1EQ7 A;  2GM4 A;  3BRV B;  1FZC B;  4JF7 A;  2A45 H;  2CPB A;  4GT1 A;  1H88 A;  3V2N A;  3UIA A;  1LWU B;  1LTI C;  2N1T B;  1FZF A;  2XV5 A;  1SFC B;  1LTA C;  1IFN A;  5CCH C;  3RL0 C;  3R2P A;  3GHG A;  1IO4 A;  3MD0 A;  1N7S A;  3B5N C;  1X8Y A;  2Q9I A;  3SWY A;  3L37 A;  1MV8 A;  1RE4 C;  1LTB C;  2FFD C;  5AW3 B;  3P32 A;  1IJD B;  1ZV8 A;  3CL3 D;  1GU4 A;  1HGV A;  1N86 A;  3HTK B;  1A02 J;  3IR9 A;  1KFM A;  3RK2 D;  2HPC A;  2Q7C A;  1J1D B;  3VP8 A;  1ZR4 A;  2OAR A;  1NTM K;  1L0L K;  2Z5I A;  4AQR D;  1L4A D;  1KQL A;  2CPS A;  1FZE A;  3I5C A;  5CCG C;  1LGH B;  2A45 G;  1JUN A;  3VTP C;  2W6B A;  4XA4 A;  4W80 A;  5AVV B;  3BVH A;  3LID A;  4W7Z A;  4Y99 C;  2XZR A;  3MTU E;  4DZO A;  2NPS A;  3CLQ A;  1JY3 N;  2IFN A;  1KFN A;  1T2K C;  2XDJ A;  1G2C A;  2KP8 A;  3RK3 C;  3A3Y B;  1T3U A;  1G1I A;  1M1J C;  2XNX A;  3H6P A;  4WY4 B;  3U1A A;  1IFJ A;  1IC2 A;  2BAS A;  1RF0 A;  1SFC C;  2NPS D;  3WMM 0;  2WT7 A;  3KYQ A;  3TNU A;  1JTH A;  1SP4 A;  1JMM A;  1SQQ K;  1GW4 A;  1VPC A;  2HG5 D;  3E1I A;  1FZC A;  4XE5 B;  1LTT C;  3VMY A;  1NWQ A;  3M06 A;  3HE5 A;  3B5N B;  3V4W A;  1FZG A;  4AUW A;  5CMZ A;  1M1J A;  3HE4 A;  3HD7 D;  3N7N A;  3N4X A;  2N1T C;  1GDT A;  1MZ9 A;  5KLV K;  4HH2 A;  4DOJ A;  1FZC C;  3P7K A;  2YNY A;  1DX7 A;  1CI6 B;  1L0N K;  4LC1 A;  3M91 A;  3C9I A;  3HRN A;  5AVR B;  3TNU B;  1HTL C;  3LIE A;  3M9B A;  2PAJ A;  3O8Z A;  2HOD A;  1WRG A;  3V5B A;  3L35 A;  3H32 B;  1FJP A;  1QL1 A;  4N6J A;  1GL2 B;  4JYB A;  1FZB A;  1RF1 C;  1FJK A;  1SLQ A;  2R32 A;  1S9K D;  2LKM A;  1N7S D;  1T8Z A;  5AW0 B;  1N73 B;  3V2R A;  1LTJ B;  3NXS A;  5KJ7 D;  1GL2 C;  3M0D A;  1URQ D;  5CJ4 A;  4JYC A;  2A45 I;  1NH4 A;  3HD7 C;  4B86 A;  3OAK A;  1FAV A;  3RK3 B;  4M3L A;  5AVY B;  2H43 A;  1SVF A;  4I1L A;  2WIT A;  1KIL B;  2WSF H;  1JY3 P;  1HVV A;  2IFM A;  2GUV A;  1KZU B;  1KIL D;  5AVS B;  1SQV K;  1QL2 A;  3A7O A;  4W7Y A;  1JOC A;  1HUC A;  1LTG C;  5AW9 B;  2HYN A;  3BAS A;  2FFD B;  1LT9 A;  1SQB K;  1N2D C;  2KOG A;  1A02 F;  4I6M C;  2FXM A;  3HUS B;  2IPP A;  1XTG B;  2P2U A;  3VYI A;  1AFO A;  1JO5 A;  3P8C D;  1LT9 B;  2HOD B;  1LTS C;  2H7H A;  1JY3 O;  3BAT A;  1W2E A;  4WY4 C;  2I1J A;  3A2A A;  2P1J A;  1M1J B;  4O9B A;  1ZR2 A;  1GW3 A;  1DEB A;  1M7L A;  1ZN5 A;  1N73 A;  3L36 A;  1IK9 A;  3NMD A;  1FDM A;  3IFM A;  1IFM A;  1SFC D;  2NPS C;  4I2L C;  1ZLL A;  1FOS E;  5AVX B;  2J59 M;  3A5T A;  1CW5 A;  2KB7 P;  2L5G B;  1NKZ B;  1T3J A;  2M8R A;  5BU5 A;  4Y99 B;  2WZ7 A;  1URQ C;  3VMX A;  5APS A;  2OYH A;  4EIJ A;  1YTZ I;  3GHG C;  3SWF A;  1VDF A;  1WT6 A;  3L4F A;  2E42 A;  2GUS A;  1NKN A;  1L4A A;  2W6A A;  2WPS A;  2KSJ A;  1NTZ K;  1JNM A;  5AVQ B;  3HUS A;  2N1T D;  2PP6 A;  3II6 A;  1AQ5 A;  5AW2 B;  3P8M C;  2C0W A;  1RE4 A;  2WSE H;  1RY3 A;  3B5N A;  3TSI A;  3KQG A;  2N9B A;  3KDP B;  1CSB A;  4C7N B;  2OYH B;  4OH8 B;  3RK2 C;  1Z56 A;  3P8C E;  1J1E B;  1T2K D;  3LW5 H;  5CCH A;  1IFI A;  4C7N A;  1RE3 C;  1S9K E;  5CCG A;  2YKP A;  3RK2 B;  5KTB A;  1NO4 A;  1NU1 K;  1OXZ A;  1FU1 A;  1N7L A;  3HE5 B;  1HBW A;  2P7J A;  5APU A;  1NHL A;  5AW6 B;  3TK1 A;  4WY4 D;  2Z4E A;  2I1K A;  1GL2 A;  3M0D C;  5CCH D;  2W27 A;  4EOT A;  2MJZ A;  5AVU B;  3T97 A;  1E5W A;  1FZA A;  4C7R A;  1HJB A;  2WT7 B;  1L4A C;  2YKO A;  5AW8 B;  1HH0 A;  1MUU A;  3NFQ A;  4WBA A;  1G1J A;  4LLH A;  2OYI A;  1JCD A;  2ZFC A;  3M9Q A;  1SQX K;  2YO2 A;  1J2J B;  2XU6 A;  1GK4 A;  5CCG D;  1RF1 A;  1JY2 P;  3HE4 B;  1N7S C;  1YTZ T;  4IFF A;  3HD7 B;  4KHX A;  5APY A;  3MUD A;  1FBM A;  5KJ7 A;  2OYI C;  1LWU A;  1LTJ A;  1YYC A;  1GTW A;  1JY2 O;  3HTK A;  4IFM A;  2NPS B;  1KIL C;  1GZL A;  3PP5 A;  2HPC B;  3U1C A;  2J58 A;  4C46 A;  1KIL A;  3V2Q A;  3B8E B;  4IFD K;  1LTJ C;  2JEE A;  2WTY A;  2O1K A;  2POH A;  3B5N D;  4HYT B;  2O01 H;  1HGZ A;  3CI9 A;  3VMZ A;  2H8P D;  5KJ7 C;  1GD2 E;  5APX A;  1FOS F;  3VP9 A;  1N7S B;  3VN0 A;  4RES B;  3GHG B;  5APQ A;  1G2C B;  1J1E C;  1XTC C;  2N1T A;  2C9N Y;  2R5B A;  4WB4 A;  2HFE D;  2P67 A;  2XKM A;  2YO3 A;  3RL0 B;  4ZKU A;  2FKW B;  1DH3 A;  1X79 B;  3KPE A;  5AW1 B;  3OA7 A;  2FFD A;  2FYZ A;  3M0A A;  5APT A;  4N78 E;  2E43 A;  3NTN A;  1HWT C;  1IFD A;  5BVZ A;  2M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...