5BU8B

Hk620 tail needle crystallized at ph 7.5 and derivatized with xenon
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
b'AYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
molecule keywords DNA stabilization protein
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 57
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bu8B01
1WT6A 5BU5A 5KTBA 3N4XA 4ZKUA 3U1CA 3N7NA 3HRNA 1X79B 4GIFA 1NKNA 3C9IA 2JEEA 3BATA 4N78D 3VP9A 2FXMA 4I1LA 1IC2A 5BVZA 3U59A 3P8CD 3VP8A 4ZKPA 4N3YB 2POHA 5BU8B 3U1AA 3BASA 4O9BA 3OJAB
chains in the Genus database with same CATH superfamily
1GL2B 4NPEA 2XNXA 3L4FA 3HUSC 2E74D 5AVWB 2YO3A 3TSIA 1L0NK 1WMKA 2KSEA 1SQVG 4R4MA 1SQXE 1Q82Q 2O01H 2W6AA 2K9JA 5KAIE 1GL2D 5AVSB 2IYPA 4U3FG 3AEFC 1JY2P 4B86A 1FE6A 1J1DC 2DW3A 2W27A 3CXHH 4GIFA 3E1IA 1SQBK 5AVZB 3H6PA 2QJYC 1SQVJ 3SFDC 2BCCJ 1LTAC 1A02J 3WUTA 1EC5A 3H1ID 4D6TE 1KYOE 1FDIA 2M0BA 2C0WA 3PLNA 2IZ0A 1K73Q 3TDKA 3ZDMA 1N7SC 1M1JC 1JTHB 1FZCC 3USSA 3V2RA 1PGOA 5AW7B 1SLQA 1OX3A 1N73C 2O01J 3RL0D 1J1EB 2FKWB 4MN4C 2H7HA 1URQD 2OYHA 1X0TA 5APTA 3H1KJ 5GTHH 1BGYD 1MKMA 1LNQA 1ZMEC 4UB6H 1K9MQ 1G1JA 2FYNC 4AUWA 3IAOA 3GMAA 3ITKA 5APWA 4H0LC 1ZOYC 2YNYA 1FOSF 5AVRB 1USEA 3U1CA 3CX5E 1HJBA 2GUSA 4L73A 1EDIA 2K3RA 3LIEA 5AW1B 1Q86Q 1L0LD 3OW2O 2LXBA 2FYUD 2IX7C 2OQQA 2ZVNB 1HWTC 1HGZA 1S3JA 1KILD 3VP9A 1BE3G 3MZWB 5M1BA 3L74J 3L35A 5AVVB 2WSEH 1HJ0A 4EIJA 2D2CB 1MUUA 1LT1A 2OTJP 1BCCD 2IFNA 2A06G 3CWBG 3S9OA 1FOSE 1EZVG 1NTZJ 1M90Q 1S9KE 4KT0J 1DX7A 2D2CD 1SQQD 2R5BA 4TT3H 1OVVA 1YITP 1E79H 2E74C 1PGQA 4UB8E 3L72G 4I7ZB 1RE4C 1ZR4A 1YJWP 4ASWA 4OGQB 1EXJA 5KLVE 1GL2C 1M57D 1L0NJ 1OXZA 2HR3A 3I56P 3M0AA 1HH0A 3CWBJ 2R44A 1MZ9A 1LGHB 3M9BA 3L70E 3NTNA 2YIUB 2P10A 5KAFH 2KOGA 5APQA 1FJPA 4OGQD 4H44B 2A45I 1YYCA 3A7OA 1Q2NA 2WSEJ 3L71G 2ITAA 1NTKG 5TISE 3BATA 1NU1G 1SQBJ 1NWQA 2NPSB 1S72P 3RK3B 4JYBA 1PPJE 1KV4A 1VQPP 4H44D 1IO4A 1ZXGA 1JTHA 1JO5A 5CCGA 1PGJA 1BDDA 3AE2C 2NPSD 1LTBC 1VQ7P 2A45G 1QVGO 2P7JA 3FWLA 3PJSK 3L71J 2ZXXA 1U57A 3RL0C 2V7QH 3L75D 2AEMA 1URQC 2QEXP 4PD4D 1AJYA 2M8RA 3V2QA 1VQOP 2HPCB 3H1JD 3AEBC 3H1HD 2OYIC 1NTMK 1KFNA 4HB1A 1KN7A 3BCCG 1UIXA 2RN0A 4GOEA 3A0BH 1BSNA 2SPZA 1JY3P 1Q90D 4TLFA 1VF5B 3H1IE 1SQXK 3CCQP 5AW6B 3BCCJ 5B5EE 3W68A 1KORA 1KILC 2E42A 5CJ0A 2M5AA 1CW5A 1VF5D 2V7QJ 4K35A 5CCHD 3VOPA 2B87B 2PP6A 1OVUA 1FBMA 3MUDC 4A7PA 1LTJB 2QJKB 3RL0g 4WVZA 4O9BA 1BGYE 1PP9G 4WY4A 2ZYGA 1E5WA 5GTIE 2Q7CA 2KZJA 1X9VA 1DH3A 1U7JA 1QLED 2W6JH 2D2CC 1KYOD 2WSCH 1AA0A 3BVHA 4JPZB 3HUSB 1JOCA 1VQ5P 2W6BA 5E79E 3CMEP 2WZ7A 2C9LY 1ZN5A 1NAFA 1NKNA 3SWFA 1L0LE 2FYUE 3H1LG 2YO2A 4KHXA 2WT7B 4OGQC 1J1DB 4BRYB 5APUA 1KILE 1WRGA 2IBZD 2QJYB 3GW6A 1GMJA 3HD7A 1RE3A 3CC4P 1H0TA 4H44C 4GDOA 1BSHA 1KB9I 3VTPC 1FZEA 1H8AA 2WSCJ 3JC22 3H1LJ 3M0DC 2NPSC 2FY8A 3TGUE 1RF1C 3N7NA 3S4RA 3HE4B 1FZCB 3F5HA 2MKVA 1KQFB 1NTMG 2AEFA 2JEEA 1SQQE 1N73B 4XFJA 2POHA 2QRXA 3B5NA 4U3FD 1JNMA 1NOHA 3HTKB 2FYNB 2BEZF 3C1LA 4PV1B 1K05A 2YKPA 4H0LB 1NTMJ 1GW4A 2AEJA 4C46A 2B89A 1PFIA 1SQPK 2I8DA 4PV1D 3GHGA 2E76B 1LWUB 3P7KA 3A5TA 2B87A 1S5LE 5KLVK 2O1JA 1SQXJ 3H32B 3AE1C 1VF5C 5CCHC 2PRRA 5CBOA 2E76D 2HODB 2H43A 3L70D 1ZRTD 4C7RA 2HLOA 3FWNA 5L8RJ 2Y0DA 3L75E 5C39A 3L37A 3M9QA 4PD4E 4WBAA 3QWOC 1Z56A 2KXPB 1IFPA 1W2EA 2CPBA 3HUSA 2L5GB 1P84I 2QJKC 3CX5H 4D6TJ 5KJ7D 2OARA 3ABVC 3H25A 5B66E 3O8ZA 5H2FE 2Q1KA 3V2NA 1EDJA 1M7LA 3D71A 3V2PA 2ZYDA 2BCCG 5CBNA 2N1TB 2FFDB 3MD0A 3L73E 1BE3D 3TF5A 5BU8B 2P2UA 4C7NB 3I55P 2AXTH 3CXHI 2N1TD 3SSUA 1N7SA 3AE9C 4AYCA 2A06D 1M1JA 4K3AA 1G2CA 1N73A 3M91A 1YBKA 3H1KG 3QH9A 4UB8H 2ZYAA 2V4HA 3RL0B 3L72D 1URQB 1ZV8A 2Q9IA 2KS1B 2OGUA 2QM8A 5AVQB 4LLHA 1SQPG 2FYZA 1Y9BA 3VN0A 1QVFO 2OYIB 4GODA 2KI7B 2XV5A 3E7KA 3CCUP 1GU4A 2M3BA 1NTKD 3LW5H 3FX0A 1N8RQ 1NU1D 1LTIC 5EFWB 2IBZE 4OWFA 4PV1C 3CCJP 3FXEA 1SQPJ 3CCEP 3L74G 3M9HA 5CCGD 1VPCA 2ZVOB 2FBWC 1L0LK 1KILB 3CCRP 3CCSP 1PPJG 2FYUK 1KD1Q 5KLVJ 3CPWO 2E76C 1NH4A 3M06A 1LWUC 1X8YA 4R4LA 2JR8A 1LTTC 2IDBA 1T8ZA 1NTZG 3SWYA 1HTLC 1EZVI 1AV1A 1M56D 1SQVE 3AEEC 1T6AA 1DD3A 2KLUA 3TNUB 1KZUB 2WSFH 4IL6E 3GF7A 4U3FE 3KZIE 3V6IA 3LW5J 3B71A 4LGDE 1OW7A 4IOIH 4DZOA 2O01N 5BU5A 5AVYB 3PRJA 4JF7A 5KJ7C 1HVVA 1L0NG 1GL2A 4YPCA 4ASVA 3KDPB 3TGUD 1JUNA 2JP3A 1FC2C 4RJTA 1SQQK 2XDJA 3HE5B 4YXDC 1RF0A 4QMAA 2G3AA 4BXLA 3A0HE 1AQ5A 3CXHE 1SQBG 2QVAA 1NKZB 2XZRA 1IJDB 4HYTB 1VQ9P 1BDCA 2XNDH 1ZRTE 2N9YB 1KFMA 2N1TC 2FFDC 2WSFJ 1PP9D 3CCLP 3WU2H 1QL2A 3WUUA 2P1JA 1CZQA 1KTMA 2Y9YA 4I1LA 2YKQA 3D70A 1RF1B 2H8PD 3U1AA 2XKMA 3AE8C 1USDA 3H1IJ 5KTBA 5GTHE 1VQ4P 2ZXEB 3G71P 1YTZI 2AXCA 3VMZA 2B88A 2P58A 4GKGA 3EFFK 1BGYJ 2O3JA 2QA4P 1CI6B 1BE3E 2OTLP 3HD7D 5AW0B 3FXDA 2FYUG 4DT0A 2WMMA 1GTWA 3F89A 5KKZC 3Q5RA 1LP1B 4IFMA 2Y9ZA 3VMXA 1AQTA 1N2DC 2A06E 3CWBE 5CCGC 1YTZT 1EZVE 3AECC 1YJ9P 1OZHA 1S1CX 2HG5D 2Q3EA 3MUDA 2E75B 2ZT9D 3U59A 4JQ0D 1L0LJ 3Q5SA 1KC8Q 3BASA 2FYUJ 1GW3A 4EOTA 1BCCG 3G9RA 3L73D 1QL1A 4GOFA 1K8AQ 1KB9D 1VQMP 3L72E 4L76A 2E75D 1IFDA 1JB0J 1OIPA 5DJTB 3VMYA 1PV3A 4YTPC 1NO4A 1JCDA 2KNCB 1FZFA 3AE7C 3NXSA 3E1RA 3L71E 1PIXA 1NTKE 1EDKA 1BCCJ 3HRNA 1NU1E 2RMZA 3C9IA 1L4AB 1OFCX 4AQRD 1SFCD 2OTKE 1SQQJ 2Z5HA 2R5DA 2YKOA 1LT9B 4JBZA 5AW4B 1R5LA 1AFOA 1L4AD 3D6YA 3AEDC 3CL3D 1CSBA 1ZP0C 3T97B 2R3CA 4Z1MH 1YQ3C 4U7JA 4PD4H 3R4YA 2NPSA 3VMAA 2JJLA 3Q3DA 4PJ0H 3EQ2A 3RK2D 4EDFA 1SS1A 2LKMA 3TK1A 2JDIH 2K88A 2YXQB 2Z5IA 5APYA 3BCCE 1VQNP 5AW9B 5B66H 1U7MA 1PZQA 5H2FH 1FZBA 1PGPA 3H1JG 1GD2E 3H1HG 2K9JB 3EFGA 5CHXA 4DCKA 1SQVK 1P84D 1SQVD 2HPCA 5KAIH 2BCCD 2W8ZA 3CLQA 3L75J 3A0BE 4L74A 2E5YA 2VRSA 3V4WA 1MFTA 4L75A 4W7YA 1LP1A 4W7ZA 3H1JJ 5TJHA 1IZNB 3W67A 4EI2A 3H1HJ 4DJGA 1SQXG 4HJGH 1Y47A 1PP9E 1JM0A 5CCHA 1DEEG 2KK7A 3H1KD 2BASA 1Q7YQ 3IFMA 1KQGB 4JYCA 1KYOH 1S4XA 3CC2P 2FXPA 2GM4A 3CI9A 2K1AA 2ZT9C 3Q1MA 1HUCA 4I6MC 3CXHD 1T3UA 5CJ4A 2OYHB 1TU3F 2GA1A 4DOJA 1LTJA 2E75C 3CMAP 4D6TG 2G8YA 1FAVA 3H1LE 3PHLA 4ZKPA 3R2PA 3GLMA 3MGNA 3KHUA 4HH2A 1AVOA 3CX5I 1SFCC 3L74D 1T3JA 1RH5B 3MIWA 1L4AC 4Y28J 1SP4A 2LR2A 2R32A 2PGDA 2WT7A 4BRYA 3NFQA 1NTZD 1LT9C 3BRVB 1MFZA 2ZJSE 4I2LC 3PP5A 3JCUE 2CPSA 1NJIQ 5AW2B 2L91A 1KB9E 3K5BA 2XU6A 3RK2C 2WITA 2IFMA 4ZNCA 2WWWA 2H88C 1X79B 3B8EB 2Q6QA 1L0ND 4N78D 3CWBD 1EZVD 3HE4A 1FZCA 2J59M 2Q3IA 2QG4A 2KSJA 2ZFCA 1EQ7A 2QIWA 2Z4EA 1VQKP 3GG2A 1EDLA 3A0HH 1UIIA 1JY2O 1HF9A 1SQBD 3HTKA 2MJZA 3VP8A 2PFXA 3RBZA 1OWAA 2NZ2A 1KMIZ 3V4QA 1M1KQ 1VQ8P 4U3FJ 2O1KA 2WTYA 1H89A 1A02F 5TISH 1NTKK 3L71D 5KKZB 3RBXA 4RESB 1NU1K 5KLVG 5APXA 2IPPA 2YMYA 1LWUA 4CPGA 3MHVA 3L70G 2JWAA 2KLVA 1FDMA 2H89C 3H32A 1NAYA 3BRTB 3Q2YA 2PAJA 3SWKA 2HODA 1T2KD 1DIPA 3II6A 3V5BA 1S5LX 3CD6P 2WPSA 1QGKB 1XTGB 1N86A 5APSA 2W83C 5KJ7A 1GDTA 2JKVA 3L36A 1P84E 2OYHC 5AVUB 2QJPC 3L70J 1FDOA 2BCCE 2M3EA 5K5GB 4XA4A 1RQUA 3P32A 4Y99C 3WMM0 1FZGA 3BCCD 2QSIA 5KLIC 1DD4A 1S2EA 1RE4A 2IYOA 1JCCA 4GT1A 1RY3A 1ZW0A 2M5AB 3H1KE 2LXCB 2N1TA 2FFDA 1OW6A 5B5EH 3G3ZA 3G4SP 4IFDK 2AXTE 1L2PA 4C7NA 2HFED 3C8VA 1VQLP 2KB7P 2QM7A 1NGMB 4WY4B 1BE3J 1SQPE 3H1IG 1OMIA 1N7LA 1GU5A 1FJKA 5GTIH 2YMKA 1H88A 1HGVA 4WY4D 5DJUB 3EWKA 3AEAC 3AE3C 3G6EP 2WSSH 1URQA 3LIDA 1KQSO 2KS1A 3OA7A 3SFEC 1RF0C 1Y8AA 1VDFA 1BGYG 2J5UA 5E79H 2A45H 3PTZA 3L74E 3UIAA 3D6ZA 1JY2N 3L72J 2OYIA 4UB6E 1JEKA 1OW8A 4H13B 2C0XA 3H1LD 1AVYA 3HD7B 3Q5PA 1NTZE 3CCVP 2GUVA 4LC1A 1H0TB 1LTSC 3RK3D 4H13D 3A2AA 4N6JA 2WPRA 1L0LG 1NTKJ 3CCMP 4XE5B 1NU1J 1QEXA 2KUBA 4HKZH 2WPQA 3OJAB 1KILA 2ZT9B 1ZLLA 1OVRA 3P8MC 1L0NE 4N78E 3KYQA 1T2KC 1W5CE 1J1EC 2K37A 2IZ1A 3P8CD 1NTMD 3TNUA 3B5NB 2I1KA 3TYYA 5AVXB 4OVNF 5APVA 2FXOA 4OH8B 1SQBE 3TGUG 3IN6A 3KPEA 3B5ND 1JY3O 2FXMA 1SQQG 1GZLA 1J2JB 1SQXD 1VL2A 4IL6X 3NMDA 2R3SA 1GK4A 3GHGB 2K9YA 3HE5A 3MTUE 2B9BA 1D7MA 1SFCB 3RGUA 2KIKA 1MV8A 1RHZB 1JMMA 2RH0A 5AW8B 3TGUJ 1S5LH 3AE6C 2E43A 1NHLA 5KAFE 2N9BA 3I5CA 3WU2E 3IF4A 4D6TD 3RK2B 1ZR2A 4BWNA 3O6QB 5AW5B 2Q5UA 3MP7B 4PD4I 3M0DA 3AEGC 4WY4C 1RF1A 1PP9J 4KJMA 1IK7A 5AW3B 2KP8A 1IK9A 1IFMA 1IC2A 1R8EA 4I7ZC 3L75G 1LTGC 3PH0A 1Q81Q 1PL5A 1IFIA 1IFNA 2YIUC 3JCUH 4RKUJ 1QX8A 3CX5D 1HBWA 1YHQP 2KYVA 1CI6A 1GK6A 4N3YB 1M8OB 1KB9H 2JWDA 3B4SA 1BCCE 4EYYQ 2WVRA 3IR9A 3RK3C 2ZAEB 3VYIA 1N7SB 4H13C 1M1JB 1G2CB 1YI2P 2KZIA 2BEQD 3HD7C 3JSVC 1DEBA 1RE3C 3AE4C 2W90A 3L73G 1N7SD 1KQLA 2P67A 1EXIA 2I1JA 2NRGA 1FZAA 1XTCC 1KYOI 5AVTB 4M3LA 1YJNP 1K04A 3GF3A 1X22A 1SVFA 2CK3H 2WPVB 1S9KD 3FGAD 2C9NY 2QJPB 1R5SA 2KNCA 4NPFX 3L73J 1SQPD 2WQYC 1JMBA 3N4XA 4ZMDA 3B5NC 4H0LD 4NPDA 3WUVA 4W80A 4Y99B 1SFCA 2J58A 5KLIB 1JY3N 3CC7P 4IFFA 2JO1A 5KLVD 1L4AA 1NYHA 2IBZI 3S1KA 1WT6A 3RK3E 1FU1A 4WB4A 2UWJE 1VQ6P 2QE7H 1LT9A 3A3YB 1RQVA 2HYNA 3GHGC 1YIJP 2Y0CA 1NVOA 4YXWH 5BVZA 2YXRB 3T97A 1LJ2A 2E5TA 3O6QA 1PPJD 3H1JE 4PJ0E 2IBZG 1LTJC 1G1IA 3H1HE 1P84H 4RO0A 5CMZA 4ZKUA 1NTZK 2Y0EA 3P8CE 1NTME 1W2BO 2RKLA 4WWIA 3AE5C 2E74B 3KQGA 2OYOA 4IL6H 1IFJA 1YQ4C 1FS0E 3KZIH 3OAKA 3KXDA
chains in the Genus database with same CATH topology
1GL2B 3M0DC 4IFMA 2NPSC 3VMXA 2XNXA 3L4FA 3HUSC 1N2DC 5CCGC 1RE4A 5AVWB 1YTZT 1RF1C 3N7NA 1JCCA 2YO3A 3HE4B 3TSIA 1FZCB 1L0NK 2HG5D 3MUDA 2JEEA 1N73B 2O01H 2W6AA 4GT1A 3U59A 1RY3A 1GL2D 5AVSB 2POHA 3BASA 2N1TA 2FFDA 1GW3A 4EOTA 3G3ZA 1QL1A 1JY2P 3B5NA 4IFDK 1JNMA 4B86A 1NOHA 3HTKB 4C7NA 1J1DC 2HFED 2W27A 1IFDA 4GIFA 3E1IA 1SQBK 3VMYA 5AVZB 2KB7P 3H6PA 1NO4A 2QM7A 1JCDA 4WY4B 2YKPA 1FZFA 1GW4A 4C46A 1LTAC 3NXSA 1A02J 1N7LA 1GU5A 1PFIA 1SQPK 1FJKA 1H88A 1HGVA 3GHGA 3HRNA 4WY4D 2C0WA 3C9IA 1L4AB 1LWUB 3P7KA 3A5TA 1N7SC 1M1JC 5KLVK 1JTHB 4AQRD 1FZCC 3V2RA 2O1JA 1SFCD 1URQA 2Z5HA 2R5DA 3LIDA 5AW7B 1SLQA 1LT9B 2YKOA 3H32B 3OA7A 1N73C 5AW4B 1RF0C 5CCHC 1VDFA 3RL0D 1J1EB 2FKWB 2H7HA 1AFOA 1URQD 2OYHA 1L4AD 2HODB 5APTA 2A45H 2H43A 3CL3D 4C7RA 1CSBA 2HLOA 3UIAA 1JY2N 2R3CA 2OYIA 1G1JA 4AUWA 3L37A 3M9QA 4WBAA 2C0XA 1Z56A 2NPSA 5APWA 2JJLA 3HD7B 1W2EA 3EQ2A 2CPBA 3HUSA 3RK2D 2L5GB 2YNYA 1FOSF 2GUVA 4LC1A 5AVRB 3U1CA 1LTSC 3RK3D 2LKMA 3TK1A 1HJBA 2GUSA 5KJ7D 2Z5IA 3A2AA 2OARA 5APYA 4N6JA 2WPRA 3LIEA 4XE5B 5AW1B 5AW9B 2IX7C 2WPQA 3OJAB 1KILA 3O8ZA 1FZBA 1HWTC 1ZLLA 3P8MC 3V2NA 1HGZA 4N78E 3KYQA 1GD2E 1T2KC 1KILD 3EFGA 1M7LA 5CHXA 3V2PA 1J1EC 1SQVK 3VP9A 2N1TB 2FFDB 3MD0A 3P8CD 2HPCA 3CLQA 3L35A 3B5NB 5AVVB 2I1KA 3TNUA 2WSEH 5BU8B 2P2UA 3TYYA 4C7NB 4EIJA 2VRSA 5AVXB 1MUUA 3V4WA 5APVA 4OH8B 4W7YA 2IFNA 2N1TD 4W7ZA 1FOSE 3KPEA 1N7SA 3B5ND 4AYCA 1S9KE 1M1JA 1JY3O 2FXMA 1DX7A 1G2CA 1GZLA 1J2JB 2R5BA 1N73A 5CCHA 3M91A 3NMDA 1GK4A 3GHGB 3HE5A 3MTUE 2BASA 1SFCB 3IFMA 4JYCA 1RE4C 1ZR4A 2GM4A 3CI9A 3RL0B 1MV8A 1URQB 1ZV8A 1JMMA 1GL2C 5AW8B 1HUCA 2Q9IA 1OXZA 3M0AA 1HH0A 4I6MC 1T3UA 5CJ4A 1MZ9A 1LGHB 2QM8A 5AVQB 2OYHB 3M9BA 2E43A 4LLHA 1NHLA 2FYZA 3VN0A 4DOJA 1LTJA 3NTNA 2KOGA 5APQA 1FJPA 2N9BA 3I5CA 2OYIB 2A45I 1YYCA 3A7OA 2XV5A 1GU4A 3RK2B 3BATA 1ZR2A 2M3BA 1FAVA 3LW5H 5AW5B 1NWQA 2NPSB 2Q5UA 3RK3B 4JYBA 4ZKPA 1LTIC 3R2PA 1IO4A 3MGNA 3M0DA 1JTHA 4HH2A 1JO5A 4WY4C 5CCGA 1RF1A 2NPSD 1LTBC 2A45G 5AW3B 2KP8A 2P7JA 3M9HA 5CCGD 1IK9A 1IFMA 1SFCC 1VPCA 1IC2A 1L0LK 1KILB 1LTGC 2FYUK 1T3JA 3RL0C 1URQC 3MIWA 1L4AC 1NH4A 3M06A 1LWUC 1X8YA 1LTTC 1SP4A 2R32A 1T8ZA 2M8RA 3V2QA 2WT7A 3SWYA 1IFIA 1HTLC 3NFQA 1IFNA 2HPCB 1LT9C 3BRVB 1MFZA 3TNUB 4I2LC 3PP5A 2CPSA 2OYIC 1NTMK 1KFNA 1HBWA 2KYVA 1KZUB 5AW2B 1CI6A 1GK6A 2WSFH 4N3YB 2XU6A 3RK2C 4LGDE 2WITA 2IFMA 3IR9A 3RK3C 3VYIA 4DZOA 5BU5A 1N7SB 5AVYB 4JF7A 1M1JB 5KJ7C 1HVVA 1JY3P 2WWWA 1G2CB 1X79B 1GL2A 3B8EB 3KDPB 3HD7C 4N78D 1DEBA 1RE3C 1JUNA 3HE4A 1FZCA 2J59M 2Q3IA 1SQQK 2XDJA 1SQXK 3HE5B 1N7SD 1KQLA 1RF0A 2P67A 5AW6B 2I1JA 2KSJA 2ZFCA 1EQ7A 2E42A 1KILC 1FZAA 1XTCC 2Z4EA 5CJ0A 1CW5A 5CCHD 5AVTB 4M3LA 3VOPA 1AQ5A 1JY2O 2PP6A 1NKZB 2XZRA 1FBMA 3HTKA 2MJZA 1SVFA 1IJDB 3VP8A 1LTJB 4HYTB 1S9KD 2C9NY 4O9BA 1OWAA 4WY4A 1E5WA 3V4QA 1KFMA 2N1TC 2FFDC 2Q7CA 1QL2A 3N4XA 1X9VA 3B5NC 1DH3A 4W80A 2P1JA 2O1KA 4Y99B 2WTYA 1H89A 1SFCA 1A02F 1CZQA 1NTKK 2J58A 2WSCH 1JY3N 4RESB 1NU1K 4I1LA 5APXA 2YKQA 3BVHA 2IPPA 4IFFA 2YMYA 1L4AA 3HUSB 1RF1B 1LWUA 1JOCA 2H8PD 3U1AA 2XKMA 1WT6A 2W6BA 1FU1A 4WB4A 2KLVA 1FDMA 5KTBA 2WZ7A 1LT9A 3H32A 2C9LY 3A3YB 3BRTB 2PAJA 1ZN5A 2ZXEB 1NAFA 2HYNA 1NKNA 3GHGC 3SWFA 2HODA 1T2KD 1YTZI 5BVZA 3II6A 3T97A 3V5BA 3VMZA 2YO2A 2WPSA 4KHXA 1XTGB 2WT7B 1J1DB 1N86A 5APSA 5APUA 4GKGA 1LTJC 5KJ7A 1G1IA 1GDTA 1WRGA 5CMZA 3L36A 2OYHC 4ZKUA 5AVUB 1NTZK 3HD7A 3P8CE 1CI6B 1RE3A 4XA4A 3HD7D 3KQGA 5AW0B 3P32A 1GTWA 3VTPC 4Y99C 1IFJA 3WMM0 1FZEA 1FZGA 1H8AA 3OAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT6 A;  5BU5 A;  5KTB A;  3N4X A;  4ZKU A;  3U1C A;  3N7N A;  3HRN A;  1X79 B;  4GIF A;  1NKN A;  3C9I A;  2JEE A;  3BAT A;  4N78 D;  3VP9 A;  2FXM A;  4I1L A;  1IC2 A;  5BVZ A;  3U59 A;  3P8C D;  3VP8 A;  4ZKP A;  4N3Y B;  2POH A;  5BU8 B;  3U1A A;  3BAS A;  4O9B A;  3OJA B; 
#chains in the Genus database with same CATH topology
 1GL2 B;  4NPE A;  2XNX A;  3L4F A;  3HUS C;  2E74 D;  5AVW B;  2YO3 A;  3TSI A;  1L0N K;  1WMK A;  2KSE A;  1SQV G;  4R4M A;  1SQX E;  1Q82 Q;  2O01 H;  2W6A A;  2K9J A;  5KAI E;  1GL2 D;  5AVS B;  2IYP A;  4U3F G;  3AEF C;  1JY2 P;  4B86 A;  1FE6 A;  1J1D C;  2DW3 A;  2W27 A;  3CXH H;  4GIF A;  3E1I A;  1SQB K;  5AVZ B;  3H6P A;  2QJY C;  1SQV J;  3SFD C;  2BCC J;  1LTA C;  1A02 J;  3WUT A;  1EC5 A;  3H1I D;  4D6T E;  1KYO E;  1FDI A;  2M0B A;  2C0W A;  3PLN A;  2IZ0 A;  1K73 Q;  3TDK A;  3ZDM A;  1N7S C;  1M1J C;  1JTH B;  1FZC C;  3USS A;  3V2R A;  1PGO A;  5AW7 B;  1SLQ A;  1OX3 A;  1N73 C;  2O01 J;  3RL0 D;  1J1E B;  2FKW B;  4MN4 C;  2H7H A;  1URQ D;  2OYH A;  1X0T A;  5APT A;  3H1K J;  5GTH H;  1BGY D;  1MKM A;  1LNQ A;  1ZME C;  4UB6 H;  1K9M Q;  1G1J A;  2FYN C;  4AUW A;  3IAO A;  3GMA A;  3ITK A;  5APW A;  4H0L C;  1ZOY C;  2YNY A;  1FOS F;  5AVR B;  1USE A;  3U1C A;  3CX5 E;  1HJB A;  2GUS A;  4L73 A;  1EDI A;  2K3R A;  3LIE A;  5AW1 B;  1Q86 Q;  1L0L D;  3OW2 O;  2LXB A;  2FYU D;  2IX7 C;  2OQQ A;  2ZVN B;  1HWT C;  1HGZ A;  1S3J A;  1KIL D;  3VP9 A;  1BE3 G;  3MZW B;  5M1B A;  3L74 J;  3L35 A;  5AVV B;  2WSE H;  1HJ0 A;  4EIJ A;  2D2C B;  1MUU A;  1LT1 A;  2OTJ P;  1BCC D;  2IFN A;  2A06 G;  3CWB G;  3S9O A;  1FOS E;  1EZV G;  1NTZ J;  1M90 Q;  1S9K E;  4KT0 J;  1DX7 A;  2D2C D;  1SQQ D;  2R5B A;  4TT3 H;  1OVV A;  1YIT P;  1E79 H;  2E74 C;  1PGQ A;  4UB8 E;  3L72 G;  4I7Z B;  1RE4 C;  1ZR4 A;  1YJW P;  4ASW A;  4OGQ B;  1EXJ A;  5KLV E;  1GL2 C;  1M57 D;  1L0N J;  1OXZ A;  2HR3 A;  3I56 P;  3M0A A;  1HH0 A;  3CWB J;  2R44 A;  1MZ9 A;  1LGH B;  3M9B A;  3L70 E;  3NTN A;  2YIU B;  2P10 A;  5KAF H;  2KOG A;  5APQ A;  1FJP A;  4OGQ D;  4H44 B;  2A45 I;  1YYC A;  3A7O A;  1Q2N A;  2WSE J;  3L71 G;  2ITA A;  1NTK G;  5TIS E;  3BAT A;  1NU1 G;  1SQB J;  1NWQ A;  2NPS B;  1S72 P;  3RK3 B;  4JYB A;  1PPJ E;  1KV4 A;  1VQP P;  4H44 D;  1IO4 A;  1ZXG A;  1JTH A;  1JO5 A;  5CCG A;  1PGJ A;  1BDD A;  3AE2 C;  2NPS D;  1LTB C;  1VQ7 P;  2A45 G;  1QVG O;  2P7J A;  3FWL A;  3PJS K;  3L71 J;  2ZXX A;  1U57 A;  3RL0 C;  2V7Q H;  3L75 D;  2AEM A;  1URQ C;  2QEX P;  4PD4 D;  1AJY A;  2M8R A;  3V2Q A;  1VQO P;  2HPC B;  3H1J D;  3AEB C;  3H1H D;  2OYI C;  1NTM K;  1KFN A;  4HB1 A;  1KN7 A;  3BCC G;  1UIX A;  2RN0 A;  4GOE A;  3A0B H;  1BSN A;  2SPZ A;  1JY3 P;  1Q90 D;  4TLF A;  1VF5 B;  3H1I E;  1SQX K;  3CCQ P;  5AW6 B;  3BCC J;  5B5E E;  3W68 A;  1KOR A;  1KIL C;  2E42 A;  5CJ0 A;  2M5A A;  1CW5 A;  1VF5 D;  2V7Q J;  4K35 A;  5CCH D;  3VOP A;  2B87 B;  2PP6 A;  1OVU A;  1FBM A;  3MUD C;  4A7P A;  1LTJ B;  2QJK B;  3RL0 g;  4WVZ A;  4O9B A;  1BGY E;  1PP9 G;  4WY4 A;  2ZYG A;  1E5W A;  5GTI E;  2Q7C A;  2KZJ A;  1X9V A;  1DH3 A;  1U7J A;  1QLE D;  2W6J H;  2D2C C;  1KYO D;  2WSC H;  1AA0 A;  3BVH A;  4JPZ B;  3HUS B;  1JOC A;  1VQ5 P;  2W6B A;  5E79 E;  3CME P;  2WZ7 A;  2C9L Y;  1ZN5 A;  1NAF A;  1NKN A;  3SWF A;  1L0L E;  2FYU E;  3H1L G;  2YO2 A;  4KHX A;  2WT7 B;  4OGQ C;  1J1D B;  4BRY B;  5APU A;  1KIL E;  1WRG A;  2IBZ D;  2QJY B;  3GW6 A;  1GMJ A;  3HD7 A;  1RE3 A;  3CC4 P;  1H0T A;  4H44 C;  4GDO A;  1BSH A;  1KB9 I;  3VTP C;  1FZE A;  1H8A A;  2WSC J;  3JC2 2;  3H1L J;  3M0D C;  2NPS C;  2FY8 A;  3TGU E;  1RF1 C;  3N7N A;  3S4R A;  3HE4 B;  1FZC B;  3F5H A;  2MKV A;  1KQF B;  1NTM G;  2AEF A;  2JEE A;  1SQQ E;  1N73 B;  4XFJ A;  2POH A;  2QRX A;  3B5N A;  4U3F D;  1JNM A;  1NOH A;  3HTK B;  2FYN B;  2BEZ F;  3C1L A;  4PV1 B;  1K05 A;  2YKP A;  4H0L B;  1NTM J;  1GW4 A;  2AEJ A;  4C46 A;  2B89 A;  1PFI A;  1SQP K;  2I8D A;  4PV1 D;  3GHG A;  2E76 B;  1LWU B;  3P7K A;  3A5T A;  2B87 A;  1S5L E;  5KLV K;  2O1J A;  1SQX J;  3H32 B;  3AE1 C;  1VF5 C;  5CCH C;  2PRR A;  5CBO A;  2E76 D;  2HOD B;  2H43 A;  3L70 D;  1ZRT D;  4C7R A;  2HLO A;  3FWN A;  5L8R J;  2Y0D A;  3L75 E;  5C39 A;  3L37 A;  3M9Q A;  4PD4 E;  4WBA A;  3QWO C;  1Z56 A;  2KXP B;  1IFP A;  1W2E A;  2CPB A;  3HUS A;  2L5G B;  1P84 I;  2QJK C;  3CX5 H;  4D6T J;  5KJ7 D;  2OAR A;  3ABV C;  3H25 A;  5B66 E;  3O8Z A;  5H2F E;  2Q1K A;  3V2N A;  1EDJ A;  1M7L A;  3D71 A;  3V2P A;  2ZYD A;  2BCC G;  5CBN A;  2N1T B;  2FFD B;  3MD0 A;  3L73 E;  1BE3 D;  3TF5 A;  5BU8 B;  2P2U A;  4C7N B;  3I55 P;  2AXT H;  3CXH I;  2N1T D;  3SSU A;  1N7S A;  3AE9 C;  4AYC A;  2A06 D;  1M1J A;  4K3A A;  1G2C A;  1N73 A;  3M91 A;  1YBK A;  3H1K G;  3QH9 A;  4UB8 H;  2ZYA A;  2V4H A;  3RL0 B;  3L72 D;  1URQ B;  1ZV8 A;  2Q9I A;  2KS1 B;  2OGU A;  2QM8 A;  5AVQ B;  4LLH A;  1SQP G;  2FYZ A;  1Y9B A;  3VN0 A;  1QVF O;  2OYI B;  4GOD A;  2KI7 B;  2XV5 A;  3E7K A;  3CCU P;  1GU4 A;  2M3B A;  1NTK D;  3LW5 H;  3FX0 A;  1N8R Q;  1NU1 D;  1LTI C;  5EFW B;  2IBZ E;  4OWF A;  4PV1 C;  3CCJ P;  3FXE A;  1SQP J;  3CCE P;  3L74 G;  3M9H A;  5CCG D;  1VPC A;  2ZVO B;  2FBW C;  1L0L K;  1KIL B;  3CCR P;  3CCS P;  1PPJ G;  2FYU K;  1KD1 Q;  5KLV J;  3CPW O;  2E76 C;  1NH4 A;  3M06 A;  1LWU C;  1X8Y A;  4R4L A;  2JR8 A;  1LTT C;  2IDB A;  1T8Z A;  1NTZ G;  3SWY A;  1HTL C;  1EZV I;  1AV1 A;  1M56 D;  1SQV E;  3AEE C;  1T6A A;  1DD3 A;  2KLU A;  3TNU B;  1KZU B;  2WSF H;  4IL6 E;  3GF7 A;  4U3F E;  3KZI E;  3V6I A;  3LW5 J;  3B71 A;  4LGD E;  1OW7 A;  4IOI H;  4DZO A;  2O01 N;  5BU5 A;  5AVY B;  3PRJ A;  4JF7 A;  5KJ7 C;  1HVV A;  1L0N G;  1GL2 A;  4YPC A;  4ASV A;  3KDP B;  3TGU D;  1JUN A;  2JP3 A;  1FC2 C;  4RJT A;  1SQQ K;  2XDJ A;  3HE5 B;  4YXD C;  1RF0 A;  4QMA A;  2G3A A;  4BXL A;  3A0H E;  1AQ5 A;  3CXH E;  1SQB G;  2QVA A;  1NKZ B;  2XZR A;  1IJD B;  4HYT B;  1VQ9 P;  1BDC A;  2XND H;  1ZRT E;  2N9Y B;  1KFM A;  2N1T C;  2FFD C;  2WSF J;  1PP9 D;  3CCL P;  3WU2 H;  1QL2 A;  3WUU A;  2P1J A;  1CZQ A;  1KTM A;  2Y9Y A;  4I1L A;  2YKQ A;  3D70 A;  1RF1 B;  2H8P D;  3U1A A;  2XKM A;  3AE8 C;  1USD A;  3H1I J;  5KTB A;  5GTH E;  1VQ4 P;  2ZXE B;  3G71 P;  1YTZ I;  2AXC A;  3VMZ A;  2B88 A;  2P58 A;  4GKG A;  3EFF K;  1BGY J;  2O3J A;  2QA4 P;  1CI6 B;  1BE3 E;  2OTL P;  3HD7 D;  5AW0 B;  3FXD A;  2FYU G;  4DT0 A;  2WMM A;  1GTW A;  3F89 A;  5KKZ C;  3Q5R A;  1LP1 B;  4IFM A;  2Y9Z A;  3VMX A;  1AQT A;  1N2D C;  2A06 E;  3CWB E;  5CCG C;  1YTZ T;  1EZV E;  3AEC C;  1YJ9 P;  1OZH A;  1S1C X;  2HG5 D;  2Q3E A;  3MUD A;  2E75 B;  2ZT9 D;  3U59 A;  4JQ0 D;  1L0L J;  3Q5S A;  1KC8 Q;  3BAS A;  2FYU J;  1GW3 A;  4EOT A;  1BCC G;  3G9R A;  3L73 D;  1QL1 A;  4GOF A;  1K8A Q;  1KB9 D;  1VQM P;  3L72 E;  4L76 A;  2E75 D;  1IFD A;  1JB0 J;  1OIP A;  5DJT B;  3VMY A;  1PV3 A;  4YTP C;  1NO4 A;  1JCD A;  2KNC B;  1FZF A;  3AE7 C;  3NXS A;  3E1R A;  3L71 E;  1PIX A;  1NTK E;  1EDK A;  1BCC J;  3HRN A;  1NU1 E;  2RMZ A;  3C9I A;  1L4A B;  1OFC X;  4AQR D;  1SFC D;  2OTK E;  1SQQ J;  2Z5H A;  2R5D A;  2YKO A;  1LT9 B;  4JBZ A;  5AW4 B;  1R5L A;  1AFO A;  1L4A D;  3D6Y A;  3AED C;  3CL3 D;  1CSB A;  1ZP0 C;  3T97 B;  2R3C A;  4Z1M H;  1YQ3 C;  4U7J A;  4PD4 H;  3R4Y A;  2NPS A;  3VMA A;  2JJL A;  3Q3D A;  4PJ0 H;  3EQ2 A;  3RK2 D;  4EDF A;  1SS1 A;  2LKM A;  3TK1 A;  2JDI H;  2K88 A;  2YXQ B;  2Z5I A;  5APY A;  3BCC E;  1VQN P;  5AW9 B;  5B66 H;  1U7M A;  1PZQ A;  5H2F H;  1FZB A;  1PGP A;  3H1J G;  1GD2 E;  3H1H G;  2K9J B;  3EFG A;  5CHX A;  4DCK A;  1SQV K;  1P84 D;  1SQV D;  2HPC A;  5KAI H;  2BCC D;  2W8Z A;  3CLQ A;  3L75 J;  3A0B E;  4L74 A;  2E5Y A;  2VRS A;  3V4W A;  1MFT A;  4L75 A;  4W7Y A;  1LP1 A;  4W7Z A;  3H1J J;  5TJH A;  1IZN B;  3W67 A;  4EI2 A;  3H1H J;  4DJG A;  1SQX G;  4HJG H;  1Y47 A;  1PP9 E;  1JM0 A;  5CCH A;  1DEE G;  2KK7 A;  3H1K D;  2BAS A;  1Q7Y Q;  3IFM A;  1KQG B;  4JYC A;  1KYO H;  1S4X A;  3CC2 P;  2FXP A;  2GM4 A;  3CI9 A;  2K1A A;  2ZT9 C;  3Q1M A;  1HUC A;  4I6M C;  3CXH D;  1T3U A;  5CJ4 A;  2OYH B;  1TU3 F;  2GA1 A;  4DOJ A;  1LTJ A;  2E75 C;  3CMA P;  4D6T G;  2G8Y A;  1FAV A;  3H1L E;  3PHL A;  4ZKP A;  3R2P A;  3GLM A;  3MGN A;  3KHU A;  4HH2 A;  1AVO A;  3CX5 I;  1SFC C;  3L74 D;  1T3J A;  1RH5 B;  3MIW A;  1L4A C;  4Y28 J;  1SP4 A;  2LR2 A;  2R32 A;  2PGD A;  2WT7 A;  4BRY A;  3NFQ A;  1NTZ D;  1LT9 C;  3BRV B;  1MFZ A;  2ZJS E;  4I2L C;  3PP5 A;  3JCU E;  2CPS A;  1NJI Q;  5AW2 B;  2L91 A;  1KB9 E;  3K5B A;  2XU6 A;  3RK2 C;  2WIT A;  2IFM A;  4ZNC A;  2WWW A;  2H88 C;  1X79 B;  3B8E B;  2Q6Q A;  1L0N D;  4N78 D;  3CWB D;  1EZV D;  3HE4 A;  1FZC A;  2J59 M;  2Q3I A;  2QG4 A;  2KSJ A;  2ZFC A;  1EQ7 A;  2QIW A;  2Z4E A;  1VQK P;  3GG2 A;  1EDL A;  3A0H H;  1UII A;  1JY2 O;  1HF9 A;  1SQB D;  3HTK A;  2MJZ A;  3VP8 A;  2PFX A;  3RBZ A;  1OWA A;  2NZ2 A;  1KMI Z;  3V4Q A;  1M1K Q;  1VQ8 P;  4U3F J;  2O1K A;  2WTY A;  1H89 A;  1A02 F;  5TIS H;  1NTK K;  3L71 D;  5KKZ B;  3RBX A;  4RES B;  1NU1 K;  5KLV G;  5APX A;  2IPP A;  2YMY A;  1LWU A;  4CPG A;  3MHV A;  3L70 G;  2JWA A;  2KLV A;  1FDM A;  2H89 C;  3H32 A;  1NAY A;  3BRT B;  3Q2Y A;  2PAJ A;  3SWK A;  2HOD A;  1T2K D;  1DIP A;  3II6 A;  3V5B A;  1S5L X;  3CD6 P;  2WPS A;  1QGK B;  1XTG B;  1N86 A;  5APS A;  2W83 C;  5KJ7 A;  1GDT A;  2JKV A;  3L36 A;  1P84 E;  2OYH C;  5AVU B;  2QJP C;  3L70 J;  1FDO A;  2BCC E;  2M3E A;  5K5G B;  4XA4 A;  1RQU A;  3P32 A;  4Y99 C;  3WMM 0;  1FZG A;  3BCC D;  2QSI A;  5KLI C;  1DD4 A;  1S2E A;  1RE4 A;  2IYO A;  1JCC A;  4GT1 A;  1RY3 A;  1ZW0 A;  2M5A B;  3H1K E;  2LXC B;  2N1T A;  2FFD A;  1OW6 A;  5B5E H;  3G3Z A;  3G4S P;  4IFD K;  2AXT E;  1L2P A;  4C7N A;  2HFE D;  3C8V A;  1VQL P;  2KB7 P;  2QM7 A;  1NGM B;  4WY4 B;  1BE3 J;  1SQP E;  3H1I G;  1OMI A;  1N7L A;  1GU5 A;  1FJK A;  5GTI H;  2YMK A;  1H88 A;  1HGV A;  4WY4 D;  5DJU B;  3EWK A;  3AEA C;  3AE3 C;  3G6E P;  2WSS H;  1URQ A;  3LID A;  1KQS O;  2KS1 A;  3OA7 A;  3SFE C;  1RF0 C;  1Y8A A;  1VDF A;  1BGY G;  2J5U A;  5E79 H;  2A45 H;  3PTZ A;  3L74 E;  3UIA A;  3D6Z A;  1JY2 N;  3L72 J;  2OYI A;  4UB6 E;  1JEK A;  1OW8 A;  4H13 B;  2C0X A;  3H1L D;  1AVY A;  3HD7 B;  3Q5P A;  1NTZ E;  3CCV P;  2GUV A;  4LC1 A;  1H0T B;  1LTS C;  3RK3 D;  4H13 D;  3A2A A;  4N6J A;  2WPR A;  1L0L G;  1NTK J;  3CCM P;  4XE5 B;  1NU1 J;  1QEX A;  2KUB A;  4HKZ H;  2WPQ A;  3OJA B;  1KIL A;  2ZT9 B;  1ZLL A;  1OVR A;  3P8M C;  1L0N E;  4N78 E;  3KYQ A;  1T2K C;  1W5C E;  1J1E C;  2K37 A;  2IZ1 A;  3P8C D;  1NTM D;  3TNU A;  3B5N B;  2I1K A;  3TYY A;  5AVX B;  4OVN F;  5APV A;  2FXO A;  4OH8 B;  1SQB E;  3TGU G;  3IN6 A;  3KPE A;  3B5N D;  1JY3 O;  2FXM A;  1SQQ G;  1GZL A;  1J2J B;  1SQX D;  1VL2 A;  4IL6 X;  3NMD A;  2R3S A;  1GK4 A;  3GHG B;  2K9Y A;  3HE5 A;  3MTU E;  2B9B A;  1D7M A;  1SFC B;  3RGU A;  2KIK A;  1MV8 A;  1RHZ B;  1JMM A;  2RH0 A;  5AW8 B;  3TGU J;  1S5L H;  3AE6 C;  2E43 A;  1NHL A;  5KAF E;  2N9B A;  3I5C A;  3WU2 E;  3IF4 A;  4D6T D;  3RK2 B;  1ZR2 A;  4BWN A;  3O6Q B;  5AW5 B;  2Q5U A;  3MP7 B;  4PD4 I;  3M0D A;  3AEG C;  4WY4 C;  1RF1 A;  1PP9 J;  4KJM A;  1IK7 A;  5AW3 B;  2KP8 A;  1IK9 A;  1IFM A;  1IC2 A;  1R8E A;  4I7Z C;  3L75 G;  1LTG C;  3PH0 A;  1Q81 Q;  1PL5 A;  1IFI A;  1IFN A;  2YIU C;  3JCU H;  4RKU J;  1QX8 A;  3CX5 D;  1HBW A;  1YHQ P;  2KYV A;  1CI6 A;  1GK6 A;  4N3Y B;  1M8O B;  1KB9 H;  2JWD A;  3B4S A;  1BCC E;  4EYY Q;  2WVR A;  3IR9 A;  3RK3 C;  2ZAE B;  3VYI A;  1N7S B;  4H13 C;  1M1J B;  1G2C B;  1YI2 P;  2KZI A;  2BEQ D;  3HD7 C;  3JSV C;  1DEB A;  1RE3 C;  3AE4 C;  2W90 A;  3L73 G;  1N7S D;  1KQL A;  2P67 A;  1EXI A;  2I1J A;  2NRG A;  1FZA A;  1XTC C;  1KYO I;  5AVT B;  4M3L A;  1YJN P;  1K04 A;  3GF3 A;  1X22 A;  1SVF A;  2CK3 H;  2WPV B;  1S9K D;  3FGA D;  2C9N Y;  2QJP B;  1R5S A;  2KNC A;  4NPF X;  3L73 J;  1SQP D;  2WQY C;  1JMB A;  3N4X A;  4ZMD A;  3B5N C;  4H0L D;  4NPD A;  3WUV A;  4W80 A;  4Y99 B;  1SFC A;  2J58 A;  5KLI B;  1JY3 N;  3CC7 P;  4IFF A;  2JO1 A;  5KLV D;  1L4A A;  1NYH A;  2IBZ I;  3S1K A;  1WT6 A;  3RK3 E;  1FU1 A;  4WB4 A;  2UWJ E;  1VQ6 P;  2QE7 H;  1LT9 A;  3A3Y B;  1RQV A;  2HYN A;  3GHG C;  1YIJ P;  2Y0C A;  1NVO A;  4YXW H;  5BVZ A;  2YXR B;  3T97 A;  1LJ2 A;  2E5T A;  3O6Q A;  1PPJ D;  3H1J E;  4PJ0 E;  2IBZ G;  1LTJ C;  1G1I A;  3H1H E;  1P84 H;  4RO0 A;  5CMZ A;  4ZKU A;  1NTZ K;  2Y0E A;  3P8C E;  1NTM E;  1W2B O;  2RKL A;  4WWI A;  3AE5 C;  2E74 B;  3KQG A;  2OYO A;  4IL6 H;  1IFJ A;  1YQ4 C;  1FS0 E;  3KZI H;  3OAK A;  3KXD A; 
#chains in the Genus database with same CATH homology
 1GL2 B;  3M0D C;  4IFM A;  2NPS C;  3VMX A;  2XNX A;  3L4F A;  3HUS C;  1N2D C;  5CCG C;  1RE4 A;  5AVW B;  1YTZ T;  1RF1 C;  3N7N A;  1JCC A;  2YO3 A;  3HE4 B;  3TSI A;  1FZC B;  1L0N K;  2HG5 D;  3MUD A;  2JEE A;  1N73 B;  2O01 H;  2W6A A;  4GT1 A;  3U59 A;  1RY3 A;  1GL2 D;  5AVS B;  2POH A;  3BAS A;  2N1T A;  2FFD A;  1GW3 A;  4EOT A;  3G3Z A;  1QL1 A;  1JY2 P;  3B5N A;  4IFD K;  1JNM A;  4B86 A;  1NOH A;  3HTK B;  4C7N A;  1J1D C;  2HFE D;  2W27 A;  1IFD A;  4GIF A;  3E1I A;  1SQB K;  3VMY A;  5AVZ B;  2KB7 P;  3H6P A;  1NO4 A;  2QM7 A;  1JCD A;  4WY4 B;  2YKP A;  1FZF A;  1GW4 A;  4C46 A;  1LTA C;  3NXS A;  1A02 J;  1N7L A;  1GU5 A;  1PFI A;  1SQP K;  1FJK A;  1H88 A;  1HGV A;  3GHG A;  3HRN A;  4WY4 D;  2C0W A;  3C9I A;  1L4A B;  1LWU B;  3P7K A;  3A5T A;  1N7S C;  1M1J C;  5KLV K;  1JTH B;  4AQR D;  1FZC C;  3V2R A;  2O1J A;  1SFC D;  1URQ A;  2Z5H A;  2R5D A;  3LID A;  5AW7 B;  1SLQ A;  1LT9 B;  2YKO A;  3H32 B;  3OA7 A;  1N73 C;  5AW4 B;  1RF0 C;  5CCH C;  1VDF A;  3RL0 D;  1J1E B;  2FKW B;  2H7H A;  1AFO A;  1URQ D;  2OYH A;  1L4A D;  2HOD B;  5APT A;  2A45 H;  2H43 A;  3CL3 D;  4C7R A;  1CSB A;  2HLO A;  3UIA A;  1JY2 N;  2R3C A;  2OYI A;  1G1J A;  4AUW A;  3L37 A;  3M9Q A;  4WBA A;  2C0X A;  1Z56 A;  2NPS A;  5APW A;  2JJL A;  3HD7 B;  1W2E A;  3EQ2 A;  2CPB A;  3HUS A;  3RK2 D;  2L5G B;  2YNY A;  1FOS F;  2GUV A;  4LC1 A;  5AVR B;  3U1C A;  1LTS C;  3RK3 D;  2LKM A;  3TK1 A;  1HJB A;  2GUS A;  5KJ7 D;  2Z5I A;  3A2A A;  2OAR A;  5APY A;  4N6J A;  2WPR A;  3LIE A;  4XE5 B;  5AW1 B;  5AW9 B;  2IX7 C;  2WPQ A;  3OJA B;  1KIL A;  3O8Z A;  1FZB A;  1HWT C;  1ZLL A;  3P8M C;  3V2N A;  1HGZ A;  4N78 E;  3KYQ A;  1GD2 E;  1T2K C;  1KIL D;  3EFG A;  1M7L A;  5CHX A;  3V2P A;  1J1E C;  1SQV K;  3VP9 A;  2N1T B;  2FFD B;  3MD0 A;  3P8C D;  2HPC A;  3CLQ A;  3L35 A;  3B5N B;  5AVV B;  2I1K A;  3TNU A;  2WSE H;  5BU8 B;  2P2U A;  3TYY A;  4C7N B;  4EIJ A;  2VRS A;  5AVX B;  1MUU A;  3V4W A;  5APV A;  4OH8 B;  4W7Y A;  2IFN A;  2N1T D;  4W7Z A;  1FOS E;  3KPE A;  1N7S A;  3B5N D;  4AYC A;  1S9K E;  1M1J A;  1JY3 O;  2FXM A;  1DX7 A;  1G2C A;  1GZL A;  1J2J B;  2R5B A;  1N73 A;  5CCH A;  3M91 A;  3NMD A;  1GK4 A;  3GHG B;  3HE5 A;  3MTU E;  2BAS A;  1SFC B;  3IFM A;  4JYC A;  1RE4 C;  1ZR4 A;  2GM4 A;  3CI9 A;  3RL0 B;  1MV8 A;  1URQ B;  1ZV8 A;  1JMM A;  1GL2 C;  5AW8 B;  1HUC A;  2Q9I A;  1OXZ A;  3M0A A;  1HH0 A;  4I6M C;  1T3U A;  5CJ4 A;  1MZ9 A;  1LGH B;  2QM8 A;  5AVQ B;  2OYH B;  3M9B A;  2E43 A;  4LLH A;  1NHL A;  2FYZ A;  3VN0 A;  4DOJ A;  1LTJ A;  3NTN A;  2KOG A;  5APQ A;  1FJP A;  2N9B A;  3I5C A;  2OYI B;  2A45 I;  1YYC A;  3A7O A;  2XV5 A;  1GU4 A;  3RK2 B;  3BAT A;  1ZR2 A;  2M3B A;  1FAV A;  3LW5 H;  5AW5 B;  1NWQ A;  2NPS B;  2Q5U A;  3RK3 B;  4JYB A;  4ZKP A;  1LTI C;  3R2P A;  1IO4 A;  3MGN A;  3M0D A;  1JTH A;  4HH2 A;  1JO5 A;  4WY4 C;  5CCG A;  1RF1 A;  2NPS D;  1LTB C;  2A45 G;  5AW3 B;  2KP8 A;  2P7J A;  3M9H A;  5CCG D;  1IK9 A;  1IFM A;  1SFC C;  1VPC A;  1IC2 A;  1L0L K;  1KIL B;  1LTG C;  2FYU K;  1T3J A;  3RL0 C;  1URQ C;  3MIW A;  1L4A C;  1NH4 A;  3M06 A;  1LWU C;  1X8Y A;  1LTT C;  1SP4 A;  2R32 A;  1T8Z A;  2M8R A;  3V2Q A;  2WT7 A;  3SWY A;  1IFI A;  1HTL C;  3NFQ A;  1IFN A;  2HPC B;  1LT9 C;  3BRV B;  1MFZ A;  3TNU B;  4I2L C;  3PP5 A;  2CPS A;  2OYI C;  1NTM K;  1KFN A;  1HBW A;  2KYV A;  1KZU B;  5AW2 B;  1CI6 A;  1GK6 A;  2WSF H;  4N3Y B;  2XU6 A;  3RK2 C;  4LGD E;  2WIT A;  2IFM A;  3IR9 A;  3RK3 C;  3VYI A;  4DZO A;  5BU5 A;  1N7S B;  5AVY B;  4JF7 A;  1M1J B;  5KJ7 C;  1HVV A;  1JY3 P;  2WWW A;  1G2C B;  1X79 B;  1GL2 A;  3B8E B;  3KDP B;  3HD7 C;  4N78 D;  1DEB A;  1RE3 C;  1JUN A;  3HE4 A;  1FZC A;  2J59 M;  2Q3I A;  1SQQ K;  2XDJ A;  1SQX K;  3HE5 B;  1N7S D;  1KQL A;  1RF0 A;  2P67 A;  5AW6 B;  2I1J A;  2KSJ A;  2ZFC A;  1EQ7 A;  2E42 A;  1KIL C;  1FZA A;  1XTC C;  2Z4E A;  5CJ0 A;  1CW5 A;  5CCH D;  5AVT B;  4M3L A;  3VOP A;  1AQ5 A;  1JY2 O;  2PP6 A;  1NKZ B;  2XZR A;  1FBM A;  3HTK A;  2MJZ A;  1SVF A;  1IJD B;  3VP8 A;  1LTJ B;  4HYT B;  1S9K D;  2C9N Y;  4O9B A;  1OWA A;  4WY4 A;  1E5W A;  3V4Q A;  1KFM A;  2N1T C;  2FFD C;  2Q7C A;  1QL2 A;  3N4X A;  1X9V A;  3B5N C;  1DH3 A;  4W80 A;  2P1J A;  2O1K A;  4Y99 B;  2WTY A;  1H89 A;  1SFC A;  1A02 F;  1CZQ A;  1NTK K;  2J58 A;  2WSC H;  1JY3 N;  4RES B;  1NU1 K;  4I1L A;  5APX A;  2YKQ A;  3BVH A;  2IPP A;  4IFF A;  2YMY A;  1L4A A;  3HUS B;  1RF1 B;  1LWU A;  1JOC A;  2H8P D;  3U1A A;  2XKM A;  1WT6 A;  2W6B A;  1FU1 A;  4WB4 A;  2KLV A;  1FDM A;  5KTB A;  2WZ7 A;  1LT9 A;  3H32 A;  2C9L Y;  3A3Y B;  3BRT B;  2PAJ A;  1ZN5 A;  2ZXE B;  1NAF A;  2HYN A;  1NKN A;  3GHG C;  3SWF A;  2HOD A;  1T2K D;  1YTZ I;  5BVZ A;  3II6 A;  3T97 A;  3V5B A;  3VMZ A;  2YO2 A;  2WPS A;  4KHX A;  1XTG B;  2WT7 B;  1J1D B;  1N86 A;  5APS A;  5APU A;  4GKG A;  1LTJ C;  5KJ7 A;  1G1I A;  1GDT A;  1WRG A;  5CMZ A;  3L36 A;  2OYH C;  4ZKU A;  5AVU B;  1NTZ K;  3HD7 A;  3P8C E;  1CI6 B;  1RE3 A;  4XA4 A;  3HD7 D;  3KQG A;  5AW0 B;  3P32 A;  1GTW A;  3VTP C;  4Y99 C;  1IFJ A;  3WMM 0;  1FZE A;  1FZG A;  1H8A A;  3OAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...