5BU8B

Hk620 tail needle crystallized at ph 7.5 and derivatized with xenon
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
178
structure length
178
Chain Sequence
b'AYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA stabilization protein
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 57
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bu8B01
3U59A 4ZKUA 1NKNA 3OJAB 4GIFA 3VP8A 3C9IA 4N3YB 3U1AA 2FXMA 4N78D 3HRNA 3N4XA 4ZKPA 3BATA 2POHA 1WT6A 3N7NA 2JEEA 3BASA 5BVZA 1IC2A 5BU5A 4O9BA 3U1CA 3VP9A 3P8CD 4I1LA 1X79B 5KTBA 5BU8B
chains in the Genus database with same CATH superfamily
4GIFA 5CMZA 2OYHB 2WITA 3CX5I 3AE1C 1DD4A 5EFWB 3MIWA 3M9HA 5APUA 5CHXA 3PHLA 1BE3G 1VQ7P 5BU8B 2JR8A 1SQBD 2FFDB 2IDBA 1SQBJ 1RQVA 1YJWP 2LR2A 2JWDA 4Y99B 4YXDC 3HRNA 1GL2B 2AXTH 1VQ6P 4KJMA 1FZAA 3VP9A 1OX3A 2ZAEB 2H88C 4C46A 4TT3H 2MJZA 4QMAA 2QM7A 1OWAA 2Y0DA 5B66E 2WMMA 2WSEJ 2NPSA 2XNDH 1EDIA 4WVZA 1L0LE 3CCVP 1NTZK 3BVHA 1SQXE 1P84H 1LT9C 1OXZA 2R32A 3H1KE 4TLFA 1BGYD 4EYYQ 3RK3E 4BWNA 5BVZA 3BRVB 1QVFO 4O9BA 2N1TA 1VF5D 4JYBA 5KLVG 1NTMD 1NVOA 1VQ4P 1NTMJ 3GHGA 1NYHA 1RH5B 1KV4A 1VF5C 1S9KD 4ZMDA 3D71A 3L75D 4GOFA 2JEEA 4IFMA 2YIUC 1RHZB 3A5TA 3L75J 2NPSB 3B5NA 1N73C 1SFCA 3TGUE 3HUSA 2PRRA 5M1BA 2AXTE 5DJUB 2W83C 2WPVB 1SQQD 2N1TB 4LC1A 2B88A 2HR3A 3SWFA 2PGDA 3V2NA 3M0DA 3GHGB 5CCHC 1OVVA 1MKMA 1NH4A 3KPEA 3CMEP 1W2EA 2FKWB 3RL0D 3H6PA 5AW3B 1EZVD 3L72G 2W27A 1GU5A 3B5NB 1S5LH 1SFCB 2K37A 2E43A 1VPCA 3HUSB 2YKOA 3IR9A 3MHVA 1YTZI 1HUCA 2Q3EA 3VMAA 1NU1D 3FXDA 5KLVK 1VQMP 2HG5D 1NU1J 1KORA 2QJKC 3MUDA 3L74D 2W8ZA 3L74J 5AVUB 2XV5A 2IFMA 4MN4C 1NTZD 3A3YB 4AYCA 3BCCD 1NTZJ 1KYOH 3W67A 3BCCJ 1KILD 1JY2O 5TISH 2J58A 1J1DB 4I7ZC 1HJBA 1T6AA 1L0NG 3GW6A 2KSJA 2Q6QA 2FYNC 1U57A 3JSVC 1S2EA 1LTBC 5KLIB 5APYA 2OTLP 1X8YA 1LTJC 2ZFCA 1PZQA 1X79B 3MZWB 4OH8B 1CZQA 2K3RA 1VQ8P 1JOCA 1ZXGA 3B4SA 5CCGA 2WTYA 1BE3D 4WB4A 1SP4A 1BE3J 1GZLA 2Q5UA 3H1IE 2D2CD 4IL6X 1U7JA 2QJYB 5CJ0A 1A02F 2NZ2A 3FWLA 2P67A 1Z56A 1S5LE 1PGOA 1EZVI 3S9OA 2G3AA 3U1CA 4U3FG 2XKMA 1FZCC 3AEEC 3T97A 2KXPB 4H13B 3O6QA 4HYTB 5GTIH 5KKZB 1T2KD 2KOGA 1RF0C 3CC7P 2Q1KA 2WSCH 4C7NB 1KYOE 3CWBG 2Q3IA 5TISE 3KZIE 1T2KC 1NAYA 1S5LX 4DCKA 2GA1A 3PH0A 2KSEA 1SQVG 5KAIE 1OIPA 2XNXA 1GW4A 2KP8A 5KLVD 5AW5B 3O8ZA 1QL2A 5KLVJ 2OYIA 1KB9D 4U7JA 1PP9G 4PJ0H 1DIPA 4H44B 5DJTB 5AW9B 4DJGA 3VP8A 3S1KA 1SS1A 2C0XA 4PV1B 4WY4C 5AVYB 2C0WA 3CC2P 1IC2A 3CCLP 3L37A 5AW1B 4D6TG 3GMAA 1ZOYC 2LXCB 2OYHC 1P84D 4ZKPA 3Q3DA 5E79E 1N2DC 2A06G 2JKVA 2WSSH 3HD7A 2OYIB 1LP1A 1OVUA 3M06A 3II6A 2YMYA 2E76B 2FFDC 3A0HE 3LW5H 4N78E 2A45H 1X22A 2YMKA 1G2CA 1PV3A 3V4WA 2K9JA 2KK7A 3I55P 3L73G 4Y99C 3CD6P 3F5HA 5GTIE 1GL2C 4KHXA 3L72J 2FYUG 1USEA 3V2QA 2Y0CA 1BGYE 1GK4A 1FDOA 3H1HE 2BCCE 5L8RJ 4GODA 2W6AA 1ZR4A 1RE4A 3L71G 1T8ZA 4JPZB 3P32A 1RF1A 5AW8B 3HD7B 1LP1B 2YO2A 2JJLA 1NGMB 2FXPA 4PJ0E 1QEXA 3RK3B 5H2FH 2R44A 2K9JB 4DZOA 3P7KA 1L0ND 2R5DA 1KB9I 3L35A 3SWYA 1L0NJ 4YPCA 3KDPB 5KTBA 2MKVA 1RY3A 4OWFA 1M7LA 4R4LA 3H1JG 1SQQE 3OAKA 4EI2A 2NPSC 1YYCA 1RF1B 1NOHA 3SFEC 1LWUA 2HODB 1LGHB 3V5BA 1YBKA 1EQ7A 3CXHI 1P84I 2RN0A 1YI2P 1GW3A 2XU6A 3L70E 1FDMA 3A2AA 2N1TC 2K88A 3H25A 4ZNCA 2Z5HA 1CI6A 1NKNA 4U3FD 4N3YB 4WWIA 3TSIA 1KZUB 1M57D 2B9BA 4U3FJ 1SQPE 2WZ7A 3B71A 2CPSA 2ZT9B 1LWUB 3B5NC 4OGQB 1SFCC 3CWBD 3HUSC 1URQA 1NJIQ 3CWBJ 5H2FE 4Z1MH 1SQXG 1K8AQ 3AE9C 4A7PA 1SQVD 1JMBA 1H89A 2L5GB 4RO0A 1SQVJ 3H1KG 1JY2N 5AW4B 2WWWA 1FS0E 1CI6B 2QVAA 1JCCA 3M0DC 4C7RA 1PP9D 2ZVNB 3BRTB 2Z5IA 2WVRA 1PP9J 1GD2E 3CL3D 2KNCA 1W2BO 2KLUA 3MGNA 1FZEA 1M1JC 1H88A 2JWAA 2IBZE 1SQPK 4L73A 1T3UA 4D6TD 4D6TJ 5KLIC 1BCCE 1NTKE 1ZW0A 3G9RA 1S3JA 1E79H 5AW0B 1SLQA 2N9YB 2P10A 3G3ZA 4I2LC 5KAFE 3TGUG 2M5AA 1OW7A 5AVTB 3Q1MA 1JY3N 2HPCA 2A06D 3MUDC 1L4AA 1HVVA 1IO4A 2WSCJ 1ZP0C 4GDOA 4L74A 1KQFB 2WPRA 5APVA 3LIDA 3RBZA 2QIWA 2AEFA 2KIKA 1GU4A 2O01H 2V4HA 2KNCB 4EOTA 3L73D 3HTKA 3NXSA 4RESB 3L73J 2XDJA 3CX5H 1VQNP 2QJYC 2VRSA 3WUUA 1ZRTD 4IL6H 1L0LK 2FYUD 1PIXA 3GG2A 1RE3A 2FYUJ 1SQXK 1Q86Q 2H8PD 3AEFC 1K05A 1VQOP 1BSHA 5CCHD 2E74B 4PD4D 3PJSK 2M5AB 4H13C 3KYQA 3L71D 2KUBA 3FXEA 2HPCB 1L4AB 2B87A 3C8VA 3L71J 1YITP 3PRJA 3EFFK 3M0AA 2R5BA 1BDDA 1IK9A 1PPJE 3HTKB 1DEBA 2FXOA 3A0BE 1VQ9P 1IK7A 3ZDMA 2WSFH 1X0TA 2M3EA 3BASA 2E75B 1SVFA 3C1LA 1LT9A 3H1JD 3CXHE 4NPEA 2OQQA 3H1JJ 5APQA 4YXWH 2BEQD 3G71P 2B87B 2M0BA 3CMAP 1JTHA 1AQ5A 3G4SP 3V4QA 3KZIH 1SQPJ 3M91A 1QVGO 2ITAA 3S4RA 3L36A 3H1LE 5KAIH 3M9BA 4JBZA 1M8OB 3CX5E 4IL6E 3H1IG 2YO3A 2FY8A 2LXBA 4NPFX 2RMZA 2OYIC 2JDIH 1N73A 1EXJA 1LT9B 1QX8A 2E76C 1VDFA 1PGQA 5GTHH 2B89A 2ZYGA 4HH2A 3P8CE 5BU5A 1YJ9P 1PL5A 1JTHB 2N9BA 4HKZH 1JY3O 4PD4I 1LJ2A 2KZIA 1L0LJ 1YQ4C 1SQXD 3AEDC 1VQ5P 1FBMA 3EQ2A 1VF5B 2YKQA 1SQXJ 3WUVA 5E79H 3H1KD 2J59M 4JQ0D 1K04A 3H1KJ 3CCMP 3RK3D 1JMMA 4IFDK 1OFCX 2WSEH 3A0HH 1IFIA 1AVYA 1JNMA 1L2PA 4UB6E 3RK3C 3RK2B 2LKMA 2W6BA 2YKPA 2XZRA 3AE2C 1HTLC 3TNUA 1YHQP 4N6JA 3TGUD 4UB8E 3JCUE 2ZVOB 3TGUJ 1Q82Q 1USDA 1LT1A 4R4MA 5AVZB 1RF1C 1KTMA 4BXLA 4DT0A 2IYOA 4HJGH 4EDFA 4WY4D 1FU1A 3T97B 1KILA 1ZR2A 2G8YA 3RL0B 3VTPC 1N7SD 3O6QB 1N7LA 4XA4A 1LTJA 2KZJA 5GTHE 2IPPA 3CCJP 3Q5RA 3KHUA 1SQBE 2P7JA 2QJKB 1N7SC 3AECC 1FOSF 2R3SA 4ASWA 2YXRB 3R2PA 3TNUB 2P2UA 5CJ4A 2ZYDA 2M8RA 3VMYA 1FZBA 1IFJA 3IFMA 4OGQD 4K3AA 1BGYG 1U7MA 4NPDA 5KJ7D 1PGJA 3H1HG 1GL2D 2BCCG 1HH0A 2ZT9C 2E5YA 1NHLA 2QJPB 1CW5A 1KILB 4OGQC 1DX7A 2YNYA 5KJ7C 3L72D 3CCRP 1WT6A 3VYIA 2Y9YA 1LTJB 2UWJE 3TF5A 1DD3A 2M3BA 4AQRD 2QA4P 1K9MQ 2QG4A 1EDJA 3E1IA 1SQBK 2O3JA 3MP7B 1NTME 1LTTC 2RKLA 2A06E 1S72P 1XTCC 2ZYAA 4IFFA 5AVSB 1AVOA 1S9KE 1LTIC 2V7QH 2Q9IA 3CCQP 2D2CB 3L75E 1FZFA 3TK1A 1G2CB 1Q7YQ 1IFMA 3QH9A 1ZN5A 4W7YA 1YTZT 5APTA 5B5EH 3H1ID 2CPBA 2FBWC 1IFNA 2A45G 3H1IJ 2NPSD 4W7ZA 3L70G 3CPWO 1VQPP 2IZ0A 4L76A 3Q5PA 4XFJA 5AVVB 2R3CA 3U59A 1IFDA 4ZKUA 2WSFJ 3OJAB 1HBWA 1SQPG 1Q90D 2N1TD 2KB7P 1KFMA 1Q81Q 2BEZF 1EZVE 1KQSO 1ZV8A 3ABVC 1GMJA 1HGZA 3K5BA 5KAFH 2O1JA 2W90A 2FFDA 2IZ1A 2Y0EA 1KYOD 2YXQB 3AEAC 2QEXP 2KYVA 1L4AC 3H32A 3Q5SA 1NU1E 2P58A 3AE7C 3GHGC 3KQGA 3B5ND 2BASA 1SFCD 3L74E 4GOEA 3WUTA 5AVWB 3D6YA 1X9VA 1J2JB 3Q2YA 1SQQK 2KLVA 2E75D 1NTZE 3BCCE 1GK6A 3SWKA 1AJYA 1MV8A 1KILE 1L0LG 3V6IA 1RE3C 3V2RA 2E75C 1FJPA 1HF9A 2IBZG 1LNQA 1AA0A 1G1JA 1JO5A 3SSUA 3USSA 1KD1Q 1OW8A 1FAVA 5B5EE 1RQUA 2NRGA 1BCCG 1NTKG 4K35A 1KB9H 3U1AA 1OVRA 3H32B 3G6EP 2E42A 1J1EB 4M3LA 3JC22 1WRGA 2GM4A 1NU1K 1J1DC 3NTNA 4JYCA 1BE3E 1EDLA 3A0BH 2HYNA 1XTGB 4Y28J 4N78D 3CCUP 3UIAA 2K9YA 3RL0g 1URQB 2Z4EA 1OMIA 1IJDB 1HGVA 2CK3H 1N8RQ 3CXHH 4JF7A 3E1RA 4LLHA 2H43A 5AVXB 3EFGA 3PTZA 1BGYJ 3H1HD 4RKUJ 2BCCD 2C9NY 3H1HJ 2BCCJ 1H8AA 3AE4C 3M9QA 4H0LB 1JB0J 3HE5A 4KT0J 1A02J 4XE5B 1KYOI 3W68A 2ZXEB 2GUVA 1FJKA 3AEBC 5CBNA 4H13D 1KFNA 1LTSC 2C9LY 1FE6A 1PPJG 5AW2B 1AFOA 3V2PA 5CCGD 2KS1A 3RK2D 3SFDC 3D70A 1NTKK 5KLVE 1JCDA 5KKZC 3I56P 1QL1A 5CCGC 1KB9E 3QWOC 3RK2C 3GF7A 2AEMA 3FGAD 4WBAA 3HE5B 1SQQJ 2AEJA 2OTKE 5APWA 4AUWA 1KN7A 4IOIH 1GTWA 2IFNA 1AQTA 3N7NA 1M1JA 2HLOA 1S1CX 1DH3A 3LW5J 4H44D 3IAOA 3GLMA 3F89A 3H1LG 1JUNA 3L70D 3FX0A 1IFPA 3L70J 4UB6H 4PV1D 2KS1B 5AW6B 1P84E 1YIJP 4ASVA 3RL0C 2DW3A 4H44C 3C9IA 1MFZA 3AE5C 1FZGA 3N4XA 4PV1C 1LTAC 1EXIA 1SQPD 2OARA 3AE3C 2AXCA 3MTUE 1R5LA 3L72E 1R8EA 3IF4A 1IZNB 3P8MC 2PP6A 4UB8H 3JCUH 1YQ3C 1T3JA 1MFTA 3LIEA 2GUSA 2E76D 2I1JA 1K73Q 3OA7A 1M1JB 2V7QJ 4I6MC 3MD0A 1MUUA 1UIIA 2QJPC 1KILC 1G1IA 2FXMA 2KI7B 1Y8AA 2J5UA 3VN0A 2K1AA 4HB1A 2I1KA 2PFXA 1YJNP 1L0LD 3KXDA 3TDKA 1VQKP 1R5SA 2IBZD 5CCHA 4OVNF 3HD7D 1L0NE 3HE4A 3BATA 1GDTA 2YIUB 4C7NA 3L4FA 3PP5A 4BRYA 1LTGC 1BCCD 1NTKD 3NMDA 2OGUA 3HD7C 2W6JH 1BCCJ 1NTKJ 1N73B 1CSBA 1JY2P 2D2CC 5AW7B 2A45I 2L91A 1Q2NA 1DEEG 2WT7A 4LGDE 3AEGC 2OYOA 1SQBG 3HE4B 1M1KQ 3ITKA 4RJTA 1HJ0A 1RE4C 4BRYB 3RGUA 1L0NK 2WQYC 4U3FE 1BSNA 2H89C 1PGPA 1JY3P 2ZJSE 3VOPA 2PAJA 1UIXA 5APSA 1TU3F 2QM8A 1Y9BA 1KQLA 1BDCA 2IX7C 1N86A 3CI9A 2O1KA 1Y47A 2WT7B 3CWBE 1QLED 1PPJD 4EIJA 3WU2H 1EC5A 2ZT9D 1EDKA 1SQVE 4PD4H 1AV1A 3OW2O 3B8EB 4I7ZB 5APXA 3CC4P 3A7OA 1LWUC 2Q7CA 3R4YA 2IBZI 1PP9E 2FYNB 2JP3A 3CXHD 1FC2C 4YTPC 1NTMG 1VQLP 1OW6A 1FZCA 1E5WA 4GT1A 1HWTC 2WPQA 3D6ZA 1KC8Q 2OTJP 4D6TE 3L75G 4DOJA 1JM0A 2O01N 5K5GB 3TYYA 3H1LD 1RF0A 2O01J 3H1LJ 2JO1A 3CX5D 1J1EC 2IYPA 1KMIZ 4CPGA 1D7MA 1SQVK 1URQD 5C39A 1W5CE 1ZLLA 1NAFA 3EWKA 1SQQG 3E7KA 2ZXXA 2HFED 1H0TA 1URQC 3L73E 3NFQA 1VL2A 3CCSP 2HODA 2QE7H 1FZCB 1NWQA 2QRXA 3FWNA 3P8CD 1KQGB 1NKZB 1MZ9A 1ZRTE 2FYUE 1M56D 4H0LD 1M90Q 1EZVG 5AVRB 2Y9ZA 3VMZA 3PLNA 4B86A 4WY4A 4GKGA 3WU2E 1N7SA 4PD4E 4H0LC 3L71E 1QGKB 3GF3A 2E5TA 4W80A 2OYHA 1NU1G 1ZMEC 1NTMK 5CBOA 5B66H 2SPZA 2RH0A 1OZHA 1FDIA 3L74G 2E74D 2POHA 2QSIA 1H0TB 3IN6A 3CCEP 2WPSA 1L4AD 2I8DA 1NTZG 5TJHA 3BCCG 2E74C 4L75A 5KJ7A 1FOSE 3AE6C 3RBXA 2FYZA 1GL2A 3AE8C 1WMKA 3WMM0 1PFIA 3CLQA 3I5CA 2P1JA 1S4XA 4WY4B 1NO4A 2FYUK 3H1JE 3VMXA 1N7SB 5AVQB 4I1LA 1JEKA 2H7HA
chains in the Genus database with same CATH topology
3RK2D 2FFDC 3LW5H 1NTKK 4N78E 2A45H 4GIFA 5CMZA 2OYHB 1FBMA 1G2CA 3EQ2A 1JCDA 2YKQA 3V4WA 1QL1A 4Y99C 2WITA 1GL2C 5CCGC 2J59M 4KHXA 3MIWA 3M9HA 5APUA 3RK2C 5CHXA 3RK3D 1JMMA 4IFDK 4WBAA 3V2QA 3HE5B 2WSEH 5BU8B 1IFIA 1GK4A 5APWA 2FFDB 1JNMA 4AUWA 3RK3C 1GTWA 2IFNA 4Y99B 2W6AA 3HRNA 1GL2B 1ZR4A 3N7NA 1RE4A 3RK2B 1M1JA 2LKMA 2HLOA 1T8ZA 2W6BA 3P32A 1RF1A 1DH3A 5AW8B 1FZAA 3VP9A 2YKPA 3HD7B 1JUNA 2XZRA 2YO2A 1HTLC 3TNUA 2JJLA 5AW6B 3RL0C 3RK3B 4C46A 2MJZA 3C9IA 4N6JA 1MFZA 1FZGA 3N4XA 2QM7A 1OWAA 4DZOA 3P7KA 2NPSA 2R5DA 3L35A 1LTAC 3SWYA 1NTZK 2OARA 5AVZB 1RF1C 3KDPB 3BVHA 5KTBA 3MTUE 4WY4D 1FU1A 1RY3A 1LT9C 1OXZA 1KILA 2R32A 1ZR2A 3RL0B 1M7LA 3VTPC 3P8MC 2PP6A 1N7SD 1N7LA 1T3JA 3LIEA 2GUSA 4XA4A 1LTJA 3OAKA 2IPPA 5BVZA 2I1JA 3BRVB 4O9BA 2N1TA 2P7JA 1M1JB 2NPSC 3OA7A 4I6MC 1YYCA 1RF1B 1NOHA 4JYBA 3MD0A 1LWUA 1N7SC 1FOSF 2HODB 1MUUA 1LGHB 3V5BA 3R2PA 1EQ7A 3TNUB 2P2UA 1KILC 3GHGA 5CJ4A 1G1IA 2M8RA 2FXMA 3VMYA 1S9KD 1FZBA 1IFJA 1GW3A 2XU6A 3IFMA 2JEEA 4IFMA 1FDMA 3A5TA 2NPSB 5KJ7D 3VN0A 3A2AA 2N1TC 1GL2D 1HH0A 2I1KA 3B5NA 1N73C 1SFCA 1NHLA 2Z5HA 1CI6A 1NKNA 1CW5A 3HUSA 1KILB 1DX7A 5CCHA 2YNYA 4N3YB 3HD7D 5KJ7C 3TSIA 1KZUB 3HE4A 3BATA 1WT6A 3VYIA 1GDTA 4C7NA 3L4FA 1LTJB 3PP5A 2WZ7A 2M3BA 1LTGC 4AQRD 2N1TB 4LC1A 2CPSA 3NMDA 3HD7C 1LWUB 1N73B 1CSBA 3B5NC 3SWFA 3E1IA 1JY2P 1SFCC 3M0DA 3V2NA 1SQBK 3HUSC 3GHGB 5AW7B 1URQA 5CCHC 2A45I 1NH4A 3KPEA 1W2EA 2FKWB 3RL0D 1LTTC 3H6PA 5AW3B 1H89A 2L5GB 1XTCC 2WT7A 2W27A 4IFFA 1JY2N 4LGDE 5AVSB 1GU5A 5AW4B 3B5NB 2WWWA 1S9KE 1LTIC 1SFCB 2Q9IA 1CI6B 2E43A 1JCCA 1VPCA 3HUSB 1FZFA 2YKOA 3IR9A 3TK1A 3M0DC 4C7RA 1G2CB 1YTZI 3HE4B 3BRTB 2Z5IA 1IFMA 1HUCA 1GD2E 3CL3D 1ZN5A 4W7YA 5KLVK 1RE4C 1YTZT 2HG5D 3MGNA 1FZEA 1M1JC 1H88A 1L0NK 5APTA 3MUDA 2CPBA 1SQPK 1IFNA 1T3UA 2A45G 5AVUB 2XV5A 2NPSD 2IFMA 1JY3P 4W7ZA 3A3YB 4AYCA 3VOPA 2PAJA 5APSA 2QM8A 1KILD 1JY2O 5AW0B 1SLQA 2J58A 1KQLA 1J1DB 3G3ZA 4I2LC 2IX7C 1N86A 3CI9A 5AVVB 1HJBA 2O1KA 2R3CA 5AVTB 1IFDA 1JY3N 3U59A 4ZKUA 1L4AA 2WT7B 2HPCA 1HVVA 1IO4A 3OJAB 2KSJA 1HBWA 4EIJA 1LTBC 2N1TD 2KB7P 1KFMA 2WPRA 5APYA 5APVA 3LIDA 1ZV8A 1HGZA 1GU4A 1X8YA 1LTJC 2O1JA 2ZFCA 3B8EB 2O01H 4EOTA 2FFDA 5APXA 1X79B 3HTKA 3NXSA 4OH8B 4RESB 3A7OA 1CZQA 2XDJA 1LWUC 2Q7CA 2KYVA 2VRSA 1JOCA 1L4AC 5CCGA 3H32A 2WTYA 1L0LK 4WB4A 1RE3A 3GHGC 1SP4A 1SQXK 3KQGA 2H8PD 3B5ND 1GZLA 1FZCA 2BASA 2Q5UA 1SFCD 1E5WA 4GT1A 1HWTC 2WPQA 5AVWB 5CCHD 1X9VA 1J2JB 4DOJA 3KYQA 1SQQK 2KLVA 2HPCB 5CJ0A 1L4AB 1A02F 1GK6A 2P67A 3TYYA 1Z56A 1RF0A 1MV8A 1RE3C 1J1EC 3V2RA 3U1CA 1FJPA 2XKMA 1JO5A 1FZCC 1G1JA 3M0AA 3T97A 2R5BA 1IK9A 1SQVK 1URQD 3HTKB 1FAVA 1ZLLA 1NAFA 1DEBA 4HYTB 3U1AA 2HFED 3H32B 1T2KD 2KOGA 1RF0C 2E42A 2WSFH 1J1EB 3BASA 4M3LA 1URQC 3NFQA 1SVFA 2WSCH 2HODA 1WRGA 4C7NB 1FZCB 2GM4A 1NWQA 2Q3IA 1LT9A 3P8CD 1NKZB 1NU1K 1J1DC 1T2KC 3NTNA 1MZ9A 4JYCA 5APQA 2XNXA 5AVRB 1GW4A 2HYNA 3VMZA 4B86A 2KP8A 1XTGB 4WY4A 4N78D 5AW5B 4GKGA 3UIAA 3O8ZA 1QL2A 1JTHA 1URQB 2OYIA 2Z4EA 1AQ5A 1N7SA 1IJDB 1HGVA 3V4QA 4JF7A 3M91A 4LLHA 3L36A 4W80A 2OYHA 3M9BA 2H43A 5AVXB 5AW9B 1NTMK 3EFGA 3VP8A 2POHA 2C0XA 2YO3A 4WY4C 2C9NY 5AVYB 2C0WA 1IC2A 1H8AA 3L37A 2WPSA 5AW1B 1L4AD 3M9QA 2OYIC 3HE5A 1A02J 1N73A 4XE5B 1LT9B 5KJ7A 1FOSE 1VDFA 2OYHC 2FYZA 2ZXEB 1GL2A 2GUVA 3WMM0 1PFIA 3CLQA 3I5CA 2P1JA 4ZKPA 1FJKA 4WY4B 4HH2A 1NO4A 1N2DC 2FYUK 3P8CE 1KFNA 5BU5A 1LTSC 1JTHB 3HD7A 2C9LY 2OYIB 2N9BA 5AW2B 3VMXA 1N7SB 3M06A 1JY3O 5AVQB 3II6A 1AFOA 4I1LA 3V2PA 5CCGD 2YMYA 2H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U59 A;  4ZKU A;  1NKN A;  3OJA B;  4GIF A;  3VP8 A;  3C9I A;  4N3Y B;  3U1A A;  2FXM A;  4N78 D;  3HRN A;  3N4X A;  4ZKP A;  3BAT A;  2POH A;  1WT6 A;  3N7N A;  2JEE A;  3BAS A;  5BVZ A;  1IC2 A;  5BU5 A;  4O9B A;  3U1C A;  3VP9 A;  3P8C D;  4I1L A;  1X79 B;  5KTB A;  5BU8 B; 
#chains in the Genus database with same CATH topology
 4GIF A;  5CMZ A;  2OYH B;  2WIT A;  3CX5 I;  3AE1 C;  1DD4 A;  5EFW B;  3MIW A;  3M9H A;  5APU A;  5CHX A;  3PHL A;  1BE3 G;  1VQ7 P;  5BU8 B;  2JR8 A;  1SQB D;  2FFD B;  2IDB A;  1SQB J;  1RQV A;  1YJW P;  2LR2 A;  2JWD A;  4Y99 B;  4YXD C;  3HRN A;  1GL2 B;  2AXT H;  1VQ6 P;  4KJM A;  1FZA A;  3VP9 A;  1OX3 A;  2ZAE B;  2H88 C;  4C46 A;  4TT3 H;  2MJZ A;  4QMA A;  2QM7 A;  1OWA A;  2Y0D A;  5B66 E;  2WMM A;  2WSE J;  2NPS A;  2XND H;  1EDI A;  4WVZ A;  1L0L E;  3CCV P;  1NTZ K;  3BVH A;  1SQX E;  1P84 H;  1LT9 C;  1OXZ A;  2R32 A;  3H1K E;  4TLF A;  1BGY D;  4EYY Q;  3RK3 E;  4BWN A;  5BVZ A;  3BRV B;  1QVF O;  4O9B A;  2N1T A;  1VF5 D;  4JYB A;  5KLV G;  1NTM D;  1NVO A;  1VQ4 P;  1NTM J;  3GHG A;  1NYH A;  1RH5 B;  1KV4 A;  1VF5 C;  1S9K D;  4ZMD A;  3D71 A;  3L75 D;  4GOF A;  2JEE A;  4IFM A;  2YIU C;  1RHZ B;  3A5T A;  3L75 J;  2NPS B;  3B5N A;  1N73 C;  1SFC A;  3TGU E;  3HUS A;  2PRR A;  5M1B A;  2AXT E;  5DJU B;  2W83 C;  2WPV B;  1SQQ D;  2N1T B;  4LC1 A;  2B88 A;  2HR3 A;  3SWF A;  2PGD A;  3V2N A;  3M0D A;  3GHG B;  5CCH C;  1OVV A;  1MKM A;  1NH4 A;  3KPE A;  3CME P;  1W2E A;  2FKW B;  3RL0 D;  3H6P A;  5AW3 B;  1EZV D;  3L72 G;  2W27 A;  1GU5 A;  3B5N B;  1S5L H;  1SFC B;  2K37 A;  2E43 A;  1VPC A;  3HUS B;  2YKO A;  3IR9 A;  3MHV A;  1YTZ I;  1HUC A;  2Q3E A;  3VMA A;  1NU1 D;  3FXD A;  5KLV K;  1VQM P;  2HG5 D;  1NU1 J;  1KOR A;  2QJK C;  3MUD A;  3L74 D;  2W8Z A;  3L74 J;  5AVU B;  2XV5 A;  2IFM A;  4MN4 C;  1NTZ D;  3A3Y B;  4AYC A;  3BCC D;  1NTZ J;  1KYO H;  3W67 A;  3BCC J;  1KIL D;  1JY2 O;  5TIS H;  2J58 A;  1J1D B;  4I7Z C;  1HJB A;  1T6A A;  1L0N G;  3GW6 A;  2KSJ A;  2Q6Q A;  2FYN C;  1U57 A;  3JSV C;  1S2E A;  1LTB C;  5KLI B;  5APY A;  2OTL P;  1X8Y A;  1LTJ C;  2ZFC A;  1PZQ A;  1X79 B;  3MZW B;  4OH8 B;  1CZQ A;  2K3R A;  1VQ8 P;  1JOC A;  1ZXG A;  3B4S A;  5CCG A;  2WTY A;  1BE3 D;  4WB4 A;  1SP4 A;  1BE3 J;  1GZL A;  2Q5U A;  3H1I E;  2D2C D;  4IL6 X;  1U7J A;  2QJY B;  5CJ0 A;  1A02 F;  2NZ2 A;  3FWL A;  2P67 A;  1Z56 A;  1S5L E;  1PGO A;  1EZV I;  3S9O A;  2G3A A;  3U1C A;  4U3F G;  2XKM A;  1FZC C;  3AEE C;  3T97 A;  2KXP B;  4H13 B;  3O6Q A;  4HYT B;  5GTI H;  5KKZ B;  1T2K D;  2KOG A;  1RF0 C;  3CC7 P;  2Q1K A;  2WSC H;  4C7N B;  1KYO E;  3CWB G;  2Q3I A;  5TIS E;  3KZI E;  1T2K C;  1NAY A;  1S5L X;  4DCK A;  2GA1 A;  3PH0 A;  2KSE A;  1SQV G;  5KAI E;  1OIP A;  2XNX A;  1GW4 A;  2KP8 A;  5KLV D;  5AW5 B;  3O8Z A;  1QL2 A;  5KLV J;  2OYI A;  1KB9 D;  4U7J A;  1PP9 G;  4PJ0 H;  1DIP A;  4H44 B;  5DJT B;  5AW9 B;  4DJG A;  3VP8 A;  3S1K A;  1SS1 A;  2C0X A;  4PV1 B;  4WY4 C;  5AVY B;  2C0W A;  3CC2 P;  1IC2 A;  3CCL P;  3L37 A;  5AW1 B;  4D6T G;  3GMA A;  1ZOY C;  2LXC B;  2OYH C;  1P84 D;  4ZKP A;  3Q3D A;  5E79 E;  1N2D C;  2A06 G;  2JKV A;  2WSS H;  3HD7 A;  2OYI B;  1LP1 A;  1OVU A;  3M06 A;  3II6 A;  2YMY A;  2E76 B;  2FFD C;  3A0H E;  3LW5 H;  4N78 E;  2A45 H;  1X22 A;  2YMK A;  1G2C A;  1PV3 A;  3V4W A;  2K9J A;  2KK7 A;  3I55 P;  3L73 G;  4Y99 C;  3CD6 P;  3F5H A;  5GTI E;  1GL2 C;  4KHX A;  3L72 J;  2FYU G;  1USE A;  3V2Q A;  2Y0C A;  1BGY E;  1GK4 A;  1FDO A;  3H1H E;  2BCC E;  5L8R J;  4GOD A;  2W6A A;  1ZR4 A;  1RE4 A;  3L71 G;  1T8Z A;  4JPZ B;  3P32 A;  1RF1 A;  5AW8 B;  3HD7 B;  1LP1 B;  2YO2 A;  2JJL A;  1NGM B;  2FXP A;  4PJ0 E;  1QEX A;  3RK3 B;  5H2F H;  2R44 A;  2K9J B;  4DZO A;  3P7K A;  1L0N D;  2R5D A;  1KB9 I;  3L35 A;  3SWY A;  1L0N J;  4YPC A;  3KDP B;  5KTB A;  2MKV A;  1RY3 A;  4OWF A;  1M7L A;  4R4L A;  3H1J G;  1SQQ E;  3OAK A;  4EI2 A;  2NPS C;  1YYC A;  1RF1 B;  1NOH A;  3SFE C;  1LWU A;  2HOD B;  1LGH B;  3V5B A;  1YBK A;  1EQ7 A;  3CXH I;  1P84 I;  2RN0 A;  1YI2 P;  1GW3 A;  2XU6 A;  3L70 E;  1FDM A;  3A2A A;  2N1T C;  2K88 A;  3H25 A;  4ZNC A;  2Z5H A;  1CI6 A;  1NKN A;  4U3F D;  4N3Y B;  4WWI A;  3TSI A;  1KZU B;  1M57 D;  2B9B A;  4U3F J;  1SQP E;  2WZ7 A;  3B71 A;  2CPS A;  2ZT9 B;  1LWU B;  3B5N C;  4OGQ B;  1SFC C;  3CWB D;  3HUS C;  1URQ A;  1NJI Q;  3CWB J;  5H2F E;  4Z1M H;  1SQX G;  1K8A Q;  3AE9 C;  4A7P A;  1SQV D;  1JMB A;  1H89 A;  2L5G B;  4RO0 A;  1SQV J;  3H1K G;  1JY2 N;  5AW4 B;  2WWW A;  1FS0 E;  1CI6 B;  2QVA A;  1JCC A;  3M0D C;  4C7R A;  1PP9 D;  2ZVN B;  3BRT B;  2Z5I A;  2WVR A;  1PP9 J;  1GD2 E;  3CL3 D;  2KNC A;  1W2B O;  2KLU A;  3MGN A;  1FZE A;  1M1J C;  1H88 A;  2JWA A;  2IBZ E;  1SQP K;  4L73 A;  1T3U A;  4D6T D;  4D6T J;  5KLI C;  1BCC E;  1NTK E;  1ZW0 A;  3G9R A;  1S3J A;  1E79 H;  5AW0 B;  1SLQ A;  2N9Y B;  2P10 A;  3G3Z A;  4I2L C;  5KAF E;  3TGU G;  2M5A A;  1OW7 A;  5AVT B;  3Q1M A;  1JY3 N;  2HPC A;  2A06 D;  3MUD C;  1L4A A;  1HVV A;  1IO4 A;  2WSC J;  1ZP0 C;  4GDO A;  4L74 A;  1KQF B;  2WPR A;  5APV A;  3LID A;  3RBZ A;  2QIW A;  2AEF A;  2KIK A;  1GU4 A;  2O01 H;  2V4H A;  2KNC B;  4EOT A;  3L73 D;  3HTK A;  3NXS A;  4RES B;  3L73 J;  2XDJ A;  3CX5 H;  1VQN P;  2QJY C;  2VRS A;  3WUU A;  1ZRT D;  4IL6 H;  1L0L K;  2FYU D;  1PIX A;  3GG2 A;  1RE3 A;  2FYU J;  1SQX K;  1Q86 Q;  2H8P D;  3AEF C;  1K05 A;  1VQO P;  1BSH A;  5CCH D;  2E74 B;  4PD4 D;  3PJS K;  2M5A B;  4H13 C;  3KYQ A;  3L71 D;  2KUB A;  3FXE A;  2HPC B;  1L4A B;  2B87 A;  3C8V A;  3L71 J;  1YIT P;  3PRJ A;  3EFF K;  3M0A A;  2R5B A;  1BDD A;  1IK9 A;  1PPJ E;  3HTK B;  1DEB A;  2FXO A;  3A0B E;  1VQ9 P;  1IK7 A;  3ZDM A;  2WSF H;  1X0T A;  2M3E A;  3BAS A;  2E75 B;  1SVF A;  3C1L A;  1LT9 A;  3H1J D;  3CXH E;  4NPE A;  2OQQ A;  3H1J J;  5APQ A;  4YXW H;  2BEQ D;  3G71 P;  2B87 B;  2M0B A;  3CMA P;  1JTH A;  1AQ5 A;  3G4S P;  3V4Q A;  3KZI H;  1SQP J;  3M91 A;  1QVG O;  2ITA A;  3S4R A;  3L36 A;  3H1L E;  5KAI H;  3M9B A;  4JBZ A;  1M8O B;  3CX5 E;  4IL6 E;  3H1I G;  2YO3 A;  2FY8 A;  2LXB A;  4NPF X;  2RMZ A;  2OYI C;  2JDI H;  1N73 A;  1EXJ A;  1LT9 B;  1QX8 A;  2E76 C;  1VDF A;  1PGQ A;  5GTH H;  2B89 A;  2ZYG A;  4HH2 A;  3P8C E;  5BU5 A;  1YJ9 P;  1PL5 A;  1JTH B;  2N9B A;  4HKZ H;  1JY3 O;  4PD4 I;  1LJ2 A;  2KZI A;  1L0L J;  1YQ4 C;  1SQX D;  3AED C;  1VQ5 P;  1FBM A;  3EQ2 A;  1VF5 B;  2YKQ A;  1SQX J;  3WUV A;  5E79 H;  3H1K D;  2J59 M;  4JQ0 D;  1K04 A;  3H1K J;  3CCM P;  3RK3 D;  1JMM A;  4IFD K;  1OFC X;  2WSE H;  3A0H H;  1IFI A;  1AVY A;  1JNM A;  1L2P A;  4UB6 E;  3RK3 C;  3RK2 B;  2LKM A;  2W6B A;  2YKP A;  2XZR A;  3AE2 C;  1HTL C;  3TNU A;  1YHQ P;  4N6J A;  3TGU D;  4UB8 E;  3JCU E;  2ZVO B;  3TGU J;  1Q82 Q;  1USD A;  1LT1 A;  4R4M A;  5AVZ B;  1RF1 C;  1KTM A;  4BXL A;  4DT0 A;  2IYO A;  4HJG H;  4EDF A;  4WY4 D;  1FU1 A;  3T97 B;  1KIL A;  1ZR2 A;  2G8Y A;  3RL0 B;  3VTP C;  1N7S D;  3O6Q B;  1N7L A;  4XA4 A;  1LTJ A;  2KZJ A;  5GTH E;  2IPP A;  3CCJ P;  3Q5R A;  3KHU A;  1SQB E;  2P7J A;  2QJK B;  1N7S C;  3AEC C;  1FOS F;  2R3S A;  4ASW A;  2YXR B;  3R2P A;  3TNU B;  2P2U A;  5CJ4 A;  2ZYD A;  2M8R A;  3VMY A;  1FZB A;  1IFJ A;  3IFM A;  4OGQ D;  4K3A A;  1BGY G;  1U7M A;  4NPD A;  5KJ7 D;  1PGJ A;  3H1H G;  1GL2 D;  2BCC G;  1HH0 A;  2ZT9 C;  2E5Y A;  1NHL A;  2QJP B;  1CW5 A;  1KIL B;  4OGQ C;  1DX7 A;  2YNY A;  5KJ7 C;  3L72 D;  3CCR P;  1WT6 A;  3VYI A;  2Y9Y A;  1LTJ B;  2UWJ E;  3TF5 A;  1DD3 A;  2M3B A;  4AQR D;  2QA4 P;  1K9M Q;  2QG4 A;  1EDJ A;  3E1I A;  1SQB K;  2O3J A;  3MP7 B;  1NTM E;  1LTT C;  2RKL A;  2A06 E;  1S72 P;  1XTC C;  2ZYA A;  4IFF A;  5AVS B;  1AVO A;  1S9K E;  1LTI C;  2V7Q H;  2Q9I A;  3CCQ P;  2D2C B;  3L75 E;  1FZF A;  3TK1 A;  1G2C B;  1Q7Y Q;  1IFM A;  3QH9 A;  1ZN5 A;  4W7Y A;  1YTZ T;  5APT A;  5B5E H;  3H1I D;  2CPB A;  2FBW C;  1IFN A;  2A45 G;  3H1I J;  2NPS D;  4W7Z A;  3L70 G;  3CPW O;  1VQP P;  2IZ0 A;  4L76 A;  3Q5P A;  4XFJ A;  5AVV B;  2R3C A;  3U59 A;  1IFD A;  4ZKU A;  2WSF J;  3OJA B;  1HBW A;  1SQP G;  1Q90 D;  2N1T D;  2KB7 P;  1KFM A;  1Q81 Q;  2BEZ F;  1EZV E;  1KQS O;  1ZV8 A;  3ABV C;  1GMJ A;  1HGZ A;  3K5B A;  5KAF H;  2O1J A;  2W90 A;  2FFD A;  2IZ1 A;  2Y0E A;  1KYO D;  2YXQ B;  3AEA C;  2QEX P;  2KYV A;  1L4A C;  3H32 A;  3Q5S A;  1NU1 E;  2P58 A;  3AE7 C;  3GHG C;  3KQG A;  3B5N D;  2BAS A;  1SFC D;  3L74 E;  4GOE A;  3WUT A;  5AVW B;  3D6Y A;  1X9V A;  1J2J B;  3Q2Y A;  1SQQ K;  2KLV A;  2E75 D;  1NTZ E;  3BCC E;  1GK6 A;  3SWK A;  1AJY A;  1MV8 A;  1KIL E;  1L0L G;  3V6I A;  1RE3 C;  3V2R A;  2E75 C;  1FJP A;  1HF9 A;  2IBZ G;  1LNQ A;  1AA0 A;  1G1J A;  1JO5 A;  3SSU A;  3USS A;  1KD1 Q;  1OW8 A;  1FAV A;  5B5E E;  1RQU A;  2NRG A;  1BCC G;  1NTK G;  4K35 A;  1KB9 H;  3U1A A;  1OVR A;  3H32 B;  3G6E P;  2E42 A;  1J1E B;  4M3L A;  3JC2 2;  1WRG A;  2GM4 A;  1NU1 K;  1J1D C;  3NTN A;  4JYC A;  1BE3 E;  1EDL A;  3A0B H;  2HYN A;  1XTG B;  4Y28 J;  4N78 D;  3CCU P;  3UIA A;  2K9Y A;  3RL0 g;  1URQ B;  2Z4E A;  1OMI A;  1IJD B;  1HGV A;  2CK3 H;  1N8R Q;  3CXH H;  4JF7 A;  3E1R A;  4LLH A;  2H43 A;  5AVX B;  3EFG A;  3PTZ A;  1BGY J;  3H1H D;  4RKU J;  2BCC D;  2C9N Y;  3H1H J;  2BCC J;  1H8A A;  3AE4 C;  3M9Q A;  4H0L B;  1JB0 J;  3HE5 A;  4KT0 J;  1A02 J;  4XE5 B;  1KYO I;  3W68 A;  2ZXE B;  2GUV A;  1FJK A;  3AEB C;  5CBN A;  4H13 D;  1KFN A;  1LTS C;  2C9L Y;  1FE6 A;  1PPJ G;  5AW2 B;  1AFO A;  3V2P A;  5CCG D;  2KS1 A;  3RK2 D;  3SFD C;  3D70 A;  1NTK K;  5KLV E;  1JCD A;  5KKZ C;  3I56 P;  1QL1 A;  5CCG C;  1KB9 E;  3QWO C;  3RK2 C;  3GF7 A;  2AEM A;  3FGA D;  4WBA A;  3HE5 B;  1SQQ J;  2AEJ A;  2OTK E;  5APW A;  4AUW A;  1KN7 A;  4IOI H;  1GTW A;  2IFN A;  1AQT A;  3N7N A;  1M1J A;  2HLO A;  1S1C X;  1DH3 A;  3LW5 J;  4H44 D;  3IAO A;  3GLM A;  3F89 A;  3H1L G;  1JUN A;  3L70 D;  3FX0 A;  1IFP A;  3L70 J;  4UB6 H;  4PV1 D;  2KS1 B;  5AW6 B;  1P84 E;  1YIJ P;  4ASV A;  3RL0 C;  2DW3 A;  4H44 C;  3C9I A;  1MFZ A;  3AE5 C;  1FZG A;  3N4X A;  4PV1 C;  1LTA C;  1EXI A;  1SQP D;  2OAR A;  3AE3 C;  2AXC A;  3MTU E;  1R5L A;  3L72 E;  1R8E A;  3IF4 A;  1IZN B;  3P8M C;  2PP6 A;  4UB8 H;  3JCU H;  1YQ3 C;  1T3J A;  1MFT A;  3LIE A;  2GUS A;  2E76 D;  2I1J A;  1K73 Q;  3OA7 A;  1M1J B;  2V7Q J;  4I6M C;  3MD0 A;  1MUU A;  1UII A;  2QJP C;  1KIL C;  1G1I A;  2FXM A;  2KI7 B;  1Y8A A;  2J5U A;  3VN0 A;  2K1A A;  4HB1 A;  2I1K A;  2PFX A;  1YJN P;  1L0L D;  3KXD A;  3TDK A;  1VQK P;  1R5S A;  2IBZ D;  5CCH A;  4OVN F;  3HD7 D;  1L0N E;  3HE4 A;  3BAT A;  1GDT A;  2YIU B;  4C7N A;  3L4F A;  3PP5 A;  4BRY A;  1LTG C;  1BCC D;  1NTK D;  3NMD A;  2OGU A;  3HD7 C;  2W6J H;  1BCC J;  1NTK J;  1N73 B;  1CSB A;  1JY2 P;  2D2C C;  5AW7 B;  2A45 I;  2L91 A;  1Q2N A;  1DEE G;  2WT7 A;  4LGD E;  3AEG C;  2OYO A;  1SQB G;  3HE4 B;  1M1K Q;  3ITK A;  4RJT A;  1HJ0 A;  1RE4 C;  4BRY B;  3RGU A;  1L0N K;  2WQY C;  4U3F E;  1BSN A;  2H89 C;  1PGP A;  1JY3 P;  2ZJS E;  3VOP A;  2PAJ A;  1UIX A;  5APS A;  1TU3 F;  2QM8 A;  1Y9B A;  1KQL A;  1BDC A;  2IX7 C;  1N86 A;  3CI9 A;  2O1K A;  1Y47 A;  2WT7 B;  3CWB E;  1QLE D;  1PPJ D;  4EIJ A;  3WU2 H;  1EC5 A;  2ZT9 D;  1EDK A;  1SQV E;  4PD4 H;  1AV1 A;  3OW2 O;  3B8E B;  4I7Z B;  5APX A;  3CC4 P;  3A7O A;  1LWU C;  2Q7C A;  3R4Y A;  2IBZ I;  1PP9 E;  2FYN B;  2JP3 A;  3CXH D;  1FC2 C;  4YTP C;  1NTM G;  1VQL P;  1OW6 A;  1FZC A;  1E5W A;  4GT1 A;  1HWT C;  2WPQ A;  3D6Z A;  1KC8 Q;  2OTJ P;  4D6T E;  3L75 G;  4DOJ A;  1JM0 A;  2O01 N;  5K5G B;  3TYY A;  3H1L D;  1RF0 A;  2O01 J;  3H1L J;  2JO1 A;  3CX5 D;  1J1E C;  2IYP A;  1KMI Z;  4CPG A;  1D7M A;  1SQV K;  1URQ D;  5C39 A;  1W5C E;  1ZLL A;  1NAF A;  3EWK A;  1SQQ G;  3E7K A;  2ZXX A;  2HFE D;  1H0T A;  1URQ C;  3L73 E;  3NFQ A;  1VL2 A;  3CCS P;  2HOD A;  2QE7 H;  1FZC B;  1NWQ A;  2QRX A;  3FWN A;  3P8C D;  1KQG B;  1NKZ B;  1MZ9 A;  1ZRT E;  2FYU E;  1M56 D;  4H0L D;  1M90 Q;  1EZV G;  5AVR B;  2Y9Z A;  3VMZ A;  3PLN A;  4B86 A;  4WY4 A;  4GKG A;  3WU2 E;  1N7S A;  4PD4 E;  4H0L C;  3L71 E;  1QGK B;  3GF3 A;  2E5T A;  4W80 A;  2OYH A;  1NU1 G;  1ZME C;  1NTM K;  5CBO A;  5B66 H;  2SPZ A;  2RH0 A;  1OZH A;  1FDI A;  3L74 G;  2E74 D;  2POH A;  2QSI A;  1H0T B;  3IN6 A;  3CCE P;  2WPS A;  1L4A D;  2I8D A;  1NTZ G;  5TJH A;  3BCC G;  2E74 C;  4L75 A;  5KJ7 A;  1FOS E;  3AE6 C;  3RBX A;  2FYZ A;  1GL2 A;  3AE8 C;  1WMK A;  3WMM 0;  1PFI A;  3CLQ A;  3I5C A;  2P1J A;  1S4X A;  4WY4 B;  1NO4 A;  2FYU K;  3H1J E;  3VMX A;  1N7S B;  5AVQ B;  4I1L A;  1JEK A;  2H7H A; 
#chains in the Genus database with same CATH homology
 3RK2 D;  2FFD C;  3LW5 H;  1NTK K;  4N78 E;  2A45 H;  4GIF A;  5CMZ A;  2OYH B;  1FBM A;  1G2C A;  3EQ2 A;  1JCD A;  2YKQ A;  3V4W A;  1QL1 A;  4Y99 C;  2WIT A;  1GL2 C;  5CCG C;  2J59 M;  4KHX A;  3MIW A;  3M9H A;  5APU A;  3RK2 C;  5CHX A;  3RK3 D;  1JMM A;  4IFD K;  4WBA A;  3V2Q A;  3HE5 B;  2WSE H;  5BU8 B;  1IFI A;  1GK4 A;  5APW A;  2FFD B;  1JNM A;  4AUW A;  3RK3 C;  1GTW A;  2IFN A;  4Y99 B;  2W6A A;  3HRN A;  1GL2 B;  1ZR4 A;  3N7N A;  1RE4 A;  3RK2 B;  1M1J A;  2LKM A;  2HLO A;  1T8Z A;  2W6B A;  3P32 A;  1RF1 A;  1DH3 A;  5AW8 B;  1FZA A;  3VP9 A;  2YKP A;  3HD7 B;  1JUN A;  2XZR A;  2YO2 A;  1HTL C;  3TNU A;  2JJL A;  5AW6 B;  3RL0 C;  3RK3 B;  4C46 A;  2MJZ A;  3C9I A;  4N6J A;  1MFZ A;  1FZG A;  3N4X A;  2QM7 A;  1OWA A;  4DZO A;  3P7K A;  2NPS A;  2R5D A;  3L35 A;  1LTA C;  3SWY A;  1NTZ K;  2OAR A;  5AVZ B;  1RF1 C;  3KDP B;  3BVH A;  5KTB A;  3MTU E;  4WY4 D;  1FU1 A;  1RY3 A;  1LT9 C;  1OXZ A;  1KIL A;  2R32 A;  1ZR2 A;  3RL0 B;  1M7L A;  3VTP C;  3P8M C;  2PP6 A;  1N7S D;  1N7L A;  1T3J A;  3LIE A;  2GUS A;  4XA4 A;  1LTJ A;  3OAK A;  2IPP A;  5BVZ A;  2I1J A;  3BRV B;  4O9B A;  2N1T A;  2P7J A;  1M1J B;  2NPS C;  3OA7 A;  4I6M C;  1YYC A;  1RF1 B;  1NOH A;  4JYB A;  3MD0 A;  1LWU A;  1N7S C;  1FOS F;  2HOD B;  1MUU A;  1LGH B;  3V5B A;  3R2P A;  1EQ7 A;  3TNU B;  2P2U A;  1KIL C;  3GHG A;  5CJ4 A;  1G1I A;  2M8R A;  2FXM A;  3VMY A;  1S9K D;  1FZB A;  1IFJ A;  1GW3 A;  2XU6 A;  3IFM A;  2JEE A;  4IFM A;  1FDM A;  3A5T A;  2NPS B;  5KJ7 D;  3VN0 A;  3A2A A;  2N1T C;  1GL2 D;  1HH0 A;  2I1K A;  3B5N A;  1N73 C;  1SFC A;  1NHL A;  2Z5H A;  1CI6 A;  1NKN A;  1CW5 A;  3HUS A;  1KIL B;  1DX7 A;  5CCH A;  2YNY A;  4N3Y B;  3HD7 D;  5KJ7 C;  3TSI A;  1KZU B;  3HE4 A;  3BAT A;  1WT6 A;  3VYI A;  1GDT A;  4C7N A;  3L4F A;  1LTJ B;  3PP5 A;  2WZ7 A;  2M3B A;  1LTG C;  4AQR D;  2N1T B;  4LC1 A;  2CPS A;  3NMD A;  3HD7 C;  1LWU B;  1N73 B;  1CSB A;  3B5N C;  3SWF A;  3E1I A;  1JY2 P;  1SFC C;  3M0D A;  3V2N A;  1SQB K;  3HUS C;  3GHG B;  5AW7 B;  1URQ A;  5CCH C;  2A45 I;  1NH4 A;  3KPE A;  1W2E A;  2FKW B;  3RL0 D;  1LTT C;  3H6P A;  5AW3 B;  1H89 A;  2L5G B;  1XTC C;  2WT7 A;  2W27 A;  4IFF A;  1JY2 N;  4LGD E;  5AVS B;  1GU5 A;  5AW4 B;  3B5N B;  2WWW A;  1S9K E;  1LTI C;  1SFC B;  2Q9I A;  1CI6 B;  2E43 A;  1JCC A;  1VPC A;  3HUS B;  1FZF A;  2YKO A;  3IR9 A;  3TK1 A;  3M0D C;  4C7R A;  1G2C B;  1YTZ I;  3HE4 B;  3BRT B;  2Z5I A;  1IFM A;  1HUC A;  1GD2 E;  3CL3 D;  1ZN5 A;  4W7Y A;  5KLV K;  1RE4 C;  1YTZ T;  2HG5 D;  3MGN A;  1FZE A;  1M1J C;  1H88 A;  1L0N K;  5APT A;  3MUD A;  2CPB A;  1SQP K;  1IFN A;  1T3U A;  2A45 G;  5AVU B;  2XV5 A;  2NPS D;  2IFM A;  1JY3 P;  4W7Z A;  3A3Y B;  4AYC A;  3VOP A;  2PAJ A;  5APS A;  2QM8 A;  1KIL D;  1JY2 O;  5AW0 B;  1SLQ A;  2J58 A;  1KQL A;  1J1D B;  3G3Z A;  4I2L C;  2IX7 C;  1N86 A;  3CI9 A;  5AVV B;  1HJB A;  2O1K A;  2R3C A;  5AVT B;  1IFD A;  1JY3 N;  3U59 A;  4ZKU A;  1L4A A;  2WT7 B;  2HPC A;  1HVV A;  1IO4 A;  3OJA B;  2KSJ A;  1HBW A;  4EIJ A;  1LTB C;  2N1T D;  2KB7 P;  1KFM A;  2WPR A;  5APY A;  5APV A;  3LID A;  1ZV8 A;  1HGZ A;  1GU4 A;  1X8Y A;  1LTJ C;  2O1J A;  2ZFC A;  3B8E B;  2O01 H;  4EOT A;  2FFD A;  5APX A;  1X79 B;  3HTK A;  3NXS A;  4OH8 B;  4RES B;  3A7O A;  1CZQ A;  2XDJ A;  1LWU C;  2Q7C A;  2KYV A;  2VRS A;  1JOC A;  1L4A C;  5CCG A;  3H32 A;  2WTY A;  1L0L K;  4WB4 A;  1RE3 A;  3GHG C;  1SP4 A;  1SQX K;  3KQG A;  2H8P D;  3B5N D;  1GZL A;  1FZC A;  2BAS A;  2Q5U A;  1SFC D;  1E5W A;  4GT1 A;  1HWT C;  2WPQ A;  5AVW B;  5CCH D;  1X9V A;  1J2J B;  4DOJ A;  3KYQ A;  1SQQ K;  2KLV A;  2HPC B;  5CJ0 A;  1L4A B;  1A02 F;  1GK6 A;  2P67 A;  3TYY A;  1Z56 A;  1RF0 A;  1MV8 A;  1RE3 C;  1J1E C;  3V2R A;  3U1C A;  1FJP A;  2XKM A;  1JO5 A;  1FZC C;  1G1J A;  3M0A A;  3T97 A;  2R5B A;  1IK9 A;  1SQV K;  1URQ D;  3HTK B;  1FAV A;  1ZLL A;  1NAF A;  1DEB A;  4HYT B;  3U1A A;  2HFE D;  3H32 B;  1T2K D;  2KOG A;  1RF0 C;  2E42 A;  2WSF H;  1J1E B;  3BAS A;  4M3L A;  1URQ C;  3NFQ A;  1SVF A;  2WSC H;  2HOD A;  1WRG A;  4C7N B;  1FZC B;  2GM4 A;  1NWQ A;  2Q3I A;  1LT9 A;  3P8C D;  1NKZ B;  1NU1 K;  1J1D C;  1T2K C;  3NTN A;  1MZ9 A;  4JYC A;  5APQ A;  2XNX A;  5AVR B;  1GW4 A;  2HYN A;  3VMZ A;  4B86 A;  2KP8 A;  1XTG B;  4WY4 A;  4N78 D;  5AW5 B;  4GKG A;  3UIA A;  3O8Z A;  1QL2 A;  1JTH A;  1URQ B;  2OYI A;  2Z4E A;  1AQ5 A;  1N7S A;  1IJD B;  1HGV A;  3V4Q A;  4JF7 A;  3M91 A;  4LLH A;  3L36 A;  4W80 A;  2OYH A;  3M9B A;  2H43 A;  5AVX B;  5AW9 B;  1NTM K;  3EFG A;  3VP8 A;  2POH A;  2C0X A;  2YO3 A;  4WY4 C;  2C9N Y;  5AVY B;  2C0W A;  1IC2 A;  1H8A A;  3L37 A;  2WPS A;  5AW1 B;  1L4A D;  3M9Q A;  2OYI C;  3HE5 A;  1A02 J;  1N73 A;  4XE5 B;  1LT9 B;  5KJ7 A;  1FOS E;  1VDF A;  2OYH C;  2FYZ A;  2ZXE B;  1GL2 A;  2GUV A;  3WMM 0;  1PFI A;  3CLQ A;  3I5C A;  2P1J A;  4ZKP A;  1FJK A;  4WY4 B;  4HH2 A;  1NO4 A;  1N2D C;  2FYU K;  3P8C E;  1KFN A;  5BU5 A;  1LTS C;  1JTH B;  3HD7 A;  2C9L Y;  2OYI B;  2N9B A;  5AW2 B;  3VMX A;  1N7S B;  3M06 A;  1JY3 O;  5AVQ B;  3II6 A;  1AFO A;  4I1L A;  3V2P A;  5CCG D;  2YMY A;  2H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...