4N3YB

Crystal structure of rabex-5cc and rabaptin-5c21 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
83
structure length
83
Chain Sequence
ETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords Rab5 GDP/GTP exchange factor
publication title Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 83
sequence length 83
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n3yB00
3VP9A 1NKNA 5BU5A 3P8CD 4N78D 1IC2A 1WT6A 2POHA 3N7NA 1X79B 4O9BA 3U1AA 3VP8A 3U59A 5BU8B 3BATA 4I1LA 2FXMA 4ZKUA 3C9IA 3N4XA 4N3YB 3OJAB 5KTBA 3HRNA 3BASA 3U1CA 4ZKPA 5BVZA 4GIFA 2JEEA
chains in the Genus database with same CATH superfamily
1J1DB 2K1AA 3G3ZA 2WZ7A 2IBZI 1WT6A 3AE1C 3N7NA 2PFXA 1JY3O 3B4SA 2ITAA 3MZWB 4TT3H 1YTZT 3RBXA 3CX5H 2ZT9B 2V4HA 4PJ0H 3VTPC 2J58A 3RGUA 2Y9ZA 1NJIQ 4Y99B 2JKVA 5E79E 2BCCD 1KD1Q 1K04A 2WWWA 2KNCA 1N7SC 2BCCE 2KS1B 4NPDA 5DJTB 4EDFA 4U3FD 4M3LA 2OYOA 3AEFC 4IL6X 1GK6A 2Z4EA 1L0NK 1ZLLA 1EDKA 5CMZA 2Z5IA 1KORA 5AW7B 2WSSH 1FJPA 2ZAEB 4GT1A 3H1JD 4H13B 4LLHA 4IL6H 3RK2C 2YKOA 3I56P 3H1JE 1S3JA 3H32B 1LTBC 5KLIC 3RL0D 1X8YA 4WB4A 2A06D 3H1LE 3BCCD 4GKGA 2XNXA 1L4AA 2A06E 1QL1A 1HUCA 3BCCE 2FXPA 5CHXA 2XKMA 3BRVB 3M91A 3CCRP 1G2CB 1ZOYC 1VL2A 4U3FG 3B5NA 2QVAA 1WMKA 3O8ZA 2GUVA 1GK4A 3U1CA 3HE5A 4MN4C 3A5TA 5B5EH 1OX3A 1YYCA 3L70J 1BDCA 1BE3D 1FJKA 3MD0A 1GL2C 3RK3C 2JDIH 3L35A 1YIJP 1BE3E 1AJYA 1YQ3C 3A0HE 1N7SB 3M06A 1S9KD 1NOHA 4HH2A 4L74A 4IFDK 1CZQA 1SQPJ 2J59M 1S9KE 2M3BA 1N86A 1ZXGA 1LTIC 5H2FH 2W6JH 4UB8E 3LW5J 2IX7C 1DEBA 4RESB 2H8PD 1BGYD 2M5AB 1HTLC 3CC2P 1BGYE 3L37A 3RK2B 1PGQA 2I8DA 4GODA 5CJ4A 1RH5B 4W7ZA 4XE5B 1NTKD 2XU6A 5KLIB 3ABVC 2ZT9D 4DCKA 3CCUP 1NTKE 1K8AQ 1VQ7P 3A0BE 2N9BA 1PGJA 2FYUJ 1ZP0C 2P58A 5BVZA 2Q7CA 1SFCC 2IYOA 4HB1A 2IZ0A 1LT1A 1YJ9P 3O6QA 1AV1A 3H1KD 2G8YA 2FBWC 5AVQB 1PFIA 2AXTH 2POHA 5KKZC 2D2CC 1YBKA 3H1KE 4ZKUA 1GL2B 1RF0A 3RK3B 2ZYAA 2OYHC 1NTZJ 2H88C 2O1KA 3AE8C 2YMYA 1GW4A 1VDFA 4H13D 3C8VA 1KN7A 5APVA 2R5BA 1YJNP 1X79B 3PJSK 1VQOP 2E76D 1MFTA 4I7ZC 3CLQA 1K05A 1LWUA 2H89C 3AEBC 1MUUA 2ZYDA 1FE6A 4YXDC 1RE3A 1W2BO 1FZCA 1URQA 2B9BA 1JEKA 2YXRB 2QM8A 3MP7B 1LTAC 4D6TD 1NWQA 1AVYA 4EOTA 3CXHD 1U7MA 2DW3A 4NPEA 1IFJA 3CXHE 5KJ7D 3AE4C 3TGUJ 2Q3EA 1LTSC 3AE6C 1IFIA 2OTLP 3L70G 4KT0J 3HRNA 4JYCA 1KC8Q 3CCEP 1SQVD 3L72J 2Y9YA 3NMDA 1SFCB 4I6MC 1KYOI 1RE4A 1M1KQ 1SQPG 1EDLA 2WQYC 3VP8A 3U59A 2R32A 5KKZB 5CCHA 2D2CB 3KDPB 4UB6H 1LP1B 1KILA 2BEZF 5M1BA 1FZGA 2OYHB 1SQBJ 4LC1A 1L2PA 3HE4A 2IDBA 2NPSA 2FFDA 3GG2A 2QM7A 1JTHA 2KI7B 1L0LJ 3CMEP 3CX5I 3RK2D 2ZFCA 2WPQA 4I7ZB 1TU3F 1IJDB 3V4WA 4WY4D 3CWBD 3L36A 3M0DC 3CWBE 3VMAA 1PP9D 1P84I 1X9VA 2W83C 3W68A 1LTJC 1EXIA 1PP9E 3OAKA 1LT9A 3K5BA 1E79H 1OVRA 2KS1A 1PPJG 2FYUG 4IOIH 3CI9A 2WPRA 1VQPP 1AQTA 1H89A 3H1HD 1OW6A 2Q5UA 2I1KA 1ZV8A 3AEEC 3P8CE 1JB0J 3IF4A 1UIIA 1H0TB 1SVFA 1GL2D 3H1HE 2B87B 1FZFA 2W8ZA 4RKUJ 1JMMA 5CBNA 3CCSP 3EFFK 1BSNA 4IFFA 4RO0A 3TF5A 1NTZG 4N78D 3OW2O 3FXDA 1QEXA 1VQNP 4DOJA 2K37A 2JWDA 2BCCJ 3NXSA 4PD4D 1QVGO 1HGZA 2HODA 2K88A 4XFJA 2YNYA 4PD4E 1HGVA 3EWKA 4U3FJ 1KB9I 3TYYA 2YKQA 3H1ID 3R2PA 1NU1G 5BU8B 3PHLA 1USDA 1VQ8P 1Y47A 2CPSA 1ZW0A 4W80A 2CPBA 3Q5PA 1HF9A 2AXCA 3F5HA 3H1JJ 3JCUE 1PGOA 4BRYB 2NRGA 3WU2E 4U7JA 1YQ4C 3AE7C 4I1LA 4A7PA 3W67A 1HJ0A 3I55P 5AW8B 1LTJB 1S5LX 1SQQG 1HH0A 2XV5A 1N7SA 1T8ZA 1FS0E 1SFCD 3Q2YA 4C7NA 2E76C 2E74D 3USSA 1S5LH 3VMXA 1IFNA 2ZVOB 3H1IG 5B66E 4K3AA 3AECC 1SP4A 1SS1A 1FDMA 3RL0g 3HD7A 3G9RA 1VF5C 1BE3J 3WUUA 1SQBG 3CCVP 1NTMD 1X22A 4AUWA 5AVTB 3MUDA 3KQGA 1L0LG 1NTME 2KYVA 1GTWA 1GW3A 5E79H 1SQPK 5GTIE 3HTKA 5KJ7C 2QE7H 3V2QA 4WBAA 1AA0A 3CD6P 2BASA 2FY8A 2FXMA 2VRSA 1AQ5A 1SQXD 3JSVC 4H44C 3CPWO 3HUSC 1T2KC 1SQXE 1SLQA 2WPVB 1HJBA 2OYIC 5C39A 1NGMB 5CCGA 5AW3B 4IFMA 1NTKJ 3SWYA 3PP5A 3BASA 1U7JA 1P84E 1VQKP 2GUSA 2L5GB 2C9NY 4YXWH 3V6IA 1DIPA 2E76B 2KSEA 3H1LD 3V5BA 4OGQD 5KLVD 4WY4C 3SFDC 3EQ2A 4XA4A 2BCCG 2FYUK 2HYNA 5KLVE 3GLMA 2WSCH 2WPSA 1HVVA 1VF5B 1W2EA 1FOSE 5AVZB 2R44A 1YHQP 1M7LA 4ZKPA 1JNMA 2JO1A 1Y9BA 1NTZK 2XZRA 3A0HH 1VPCA 2FYNC 3V2RA 4TLFA 2QJPB 3H1JG 1D7MA 2IFMA 2ZXEB 4KJMA 1Q81Q 3H1LG 1KB9E 3QWOC 4H44B 3HUSB 5GTHE 1NU1K 2A06G 1QLED 1BCCD 4GDOA 3BCCG 4UB8H 2OYIB 1BCCE 4BXLA 1BSHA 4AQRD 1EQ7A 1J1EC 1RF1A 1K9MQ 4D6TJ 2Q6QA 5AW1B 1LTTC 1CI6B 2O3JA 3L74D 1HWTC 3SWFA 3L74E 1SQQK 2GA1A 5KAFE 1BE3G 1FZEA 3A7OA 4WY4B 3A0BH 1SQVJ 5APUA 2HR3A 1T6AA 1XTGB 4CPGA 3D70A 1R5SA 2IBZD 2B89A 3NTNA 4AYCA 3CCQP 2SPZA 3VP9A 1SQBK 2IBZE 5AVYB 1QVFO 2P10A 2KUBA 3VOPA 2E74C 4YPCA 4DT0A 1BGYG 1MV8A 1L0LK 4JF7A 2JJLA 2FYNB 5CJ0A 2P7JA 2WVRA 2CK3H 2YIUC 2O01N 1H0TA 2XDJA 2N1TD 1WRGA 1EZVI 1NTKG 1OVUA 5APYA 1S72P 1GD2E 1IFMA 2L91A 3KZIE 2JR8A 3M9QA 4PV1D 1J1EB 1S4XA 1NU1J 1FAVA 2GM4A 3Q5RA 3H1HJ 4O9BA 1VF5D 2WT7A 5APTA 3H1KG 1M1JA 1H8AA 2E42A 2YO2A 4JQ0D 3CXHH 3KPEA 1NAYA 1M90Q 2OTJP 1HBWA 2IYPA 1OZHA 1LTGC 2QG4A 1RQVA 1NKZB 1SQQJ 2P67A 4BRYA 1U57A 1FZAA 3HE5B 2HPCB 2LXBA 2C9LY 4JPZB 1N73A 4H44D 5TISE 1T2KD 1VQLP 3H1IJ 2MKVA 1Q90D 2E74B 1L0ND 2LKMA 4OGQC 1BDDA 3G71P 3AE3C 3JC22 1L0NE 4GOFA 1J2JB 4ZNCA 3GHGA 2K9JB 2YIUB 4ASVA 1GDTA 5AVSB 4D6TG 1DH3A 1LWUC 3P7KA 1VQMP 1OWAA 5AVWB 1JCCA 1VQ6P 1RE3C 1RY3A 4OVNF 1FZCC 1IO4A 1ZN5A 2LR2A 1MZ9A 2KXPB 1G1JA 2OQQA 1SQVG 3E1RA 3VN0A 1OIPA 1XTCC 1PIXA 3D71A 4EI2A 1JCDA 2E5TA 2YO3A 3P8CD 3SWKA 1Y8AA 1VQ4P 4HKZH 3Q5SA 2QJYC 3M9HA 2W6BA 4BWNA 3S1KA 3L71D 1RE4C 3O6QB 3IN6A 1FU1A 2K9YA 2W90A 2WSFH 5CCGD 2K3RA 2M3EA 3L71E 3CCLP 4JYBA 1JY2N 2QRXA 5AW2B 3CWBG 3H6PA 4PD4H 1Z56A 3FGAD 4DJGA 4HYTB 1SQXJ 1VQ9P 4OGQB 1A02F 1PP9G 2AEMA 3H32A 3TDKA 2WSEJ 2C0WA 1OFCX 2P1JA 5TJHA 3TGUD 4RJTA 2KP8A 3L75D 1LWUB 2V7QH 1NHLA 1FDIA 3MIWA 4ZMDA 3TGUE 1G2CA 3L75E 3SFEC 3JCUH 1EZVE 1L4AD 1NTKK 3H1HG 3WU2H 3AE5C 2N9YB 1NVOA 1H88A 1NO4A 1FZCB 2JEEA 3LIEA 3L72D 5AVUB 2IPPA 5BU5A 3L73D 3B5ND 5EFWB 5APQA 3L72E 1AFOA 5AW9B 3V2PA 3L73E 3H1LJ 1LT9C 5KJ7A 5KLVJ 4JBZA 3C9IA 3M0AA 2H43A 1KQLA 2N1TC 1RHZB 2Y0CA 3BCCJ 1N2DC 5KAIH 3I5CA 3VMZA 1K73Q 3AEDC 2OARA 2WSCJ 5DJUB 3HUSA 3VMYA 3ZDMA 5B66H 5KAIE 4PV1C 2RKLA 2YXQB 2OYIA 1DEEG 3FXEA 2QJYB 4GIFA 1N8RQ 1CI6A 1USEA 2M5AA 1PL5A 3PRJA 2O01J 1DX7A 5GTIH 2KOGA 3OJAB 3A3YB 5KTBA 3HE4B 1NH4A 1PGPA 1KYOD 3NFQA 2FKWB 1JTHB 1KV4A 1NKNA 2JP3A 4L73A 2H7HA 4WY4A 1EDJA 1BCCJ 1KYOE 5APWA 2NZ2A 4C7RA 2QJPC 3TK1A 1JY3N 1CSBA 2XNDH 2KLVA 2PP6A 2ZJSE 2E5YA 4DZOA 3S9OA 1S2EA 3CX5D 2PRRA 1GU5A 1BGYJ 2WSEH 1EC5A 4H0LD 1KMIZ 3L74J 3LIDA 3CX5E 2WMMA 1GZLA 4HJGH 1KFMA 4PJ0E 3B8EB 3KXDA 2R3SA 1LT9B 3N4XA 1P84H 1LNQA 5AW0B 2QJKC 1NTMG 3Q1MA 2YMKA 1P84D 2N1TB 1GL2A 3WUVA 2Z5HA 2KZJA 1SQVK 2ZVNB 1IC2A 5CBOA 4U3FE 2HFED 1MFZA 2ZYGA 3BATA 3HD7C 4L75A 2B88A 4PV1B 1KZUB 2E75D 2O1JA 1SQXG 1Q7YQ 3H1KJ 3MUDC 1YTZI 2HODB 2A45H 3CXHI 3GF7A 2JWAA 4IL6E 1R5LA 1FC2C 2HG5D 3VYIA 2YKPA 1URQD 3AEGC 2W27A 2O01H 3T97B 4Z1MH 4WVZA 3E7KA 3S4RA 1KB9H 5GTHH 1KB9D 3MTUE 2KLUA 2HPCA 5CCGC 1M8OB 5KLVG 1FBMA 1OW8A 3P8MC 3TNUB 1PV3A 1NYHA 4N6JA 1SFCA 5B5EE 1ZR2A 1DD3A 3F89A 1CW5A 3OA7A 1FOSF 5APSA 2A45G 2C0XA 1LP1A 2QJKB 4C7NB 3CCMP 5AW4B 2K9JA 2PAJA 2WTYA 1JY2P 2OYHA 5KAFH 3G6EP 5AVXB 5CCHD 2M8RA 3PLNA 1KQGB 3FX0A 3E1IA 1L4AC 1KILD 4OH8B 2Y0DA 2KK7A 3HD7B 1DD4A 2NPSD 5H2FE 3FWNA 1KILE 5AW5B 1T3UA 1JO5A 3B5NC 3EFGA 2QA4P 2Y0EA 3GF3A 3TSIA 1L0NJ 1BCCG 1FDOA 2R3CA 3GW6A 2AEJA 3UIAA 3HTKB 2RN0A 2Q1KA 1EDIA 1KTMA 2KNCB 1PZQA 2E43A 3MHVA 4R4LA 1AVOA 3L74G 1E5WA 2Q3IA 2AEFA 3AE9C 1QX8A 3CWBJ 1GU4A 4PD4I 3D6YA 2B87A 4ASWA 3KZIH 1JOCA 1T3JA 1RF1C 2FXOA 3CMAP 1PP9J 4QMAA 3U1AA 1GMJA 1A02J 2I1JA 2BEQD 2AXTE 4EYYQ 1N7LA 3PTZA 1OVVA 1JUNA 2KSJA 1IZNB 2IBZG 3L70D 3AE2C 1NTMK 3L70E 2FYZA 1YI2P 2OGUA 3II6A 1FZBA 1L4AB 3L71J 4H0LC 1SQPD 2WSFJ 3R4YA 1SQPE 3B5NB 4KHXA 1JY3P 2KIKA 3M0DA 5TISH 1S1CX 3LW5H 1SQXK 5AW6B 3IR9A 3BVHA 4OWFA 1QGKB 1KQSO 1LTJA 4D6TE 2G3AA 2LXCB 1M57D 1RF0C 3L75J 3WMM0 3P32A 3QH9A 3C1LA 2V7QJ 4I2LC 4N3YB 1N7SD 2E75C 4LGDE 1YITP 1NAFA 2W6AA 1Q2NA 1LGHB 1IK7A 3L73J 4YTPC 3BRTB 3CC7P 3KHUA 1SQVE 1KQFB 3RL0C 1RF1B 3A2AA 5AVRB 5KLVK 1PPJD 3MGNA 3HD7D 2FYUD 4WWIA 1MKMA 1URQC 1PPJE 4UB6E 3V4QA 3RBZA 2FYUE 1M1JC 2R5DA 3WUTA 4W7YA 3G4SP 2UWJE 2M0BA 3M9BA 1IFDA 1VQ5P 1OXZA 1L0NG 1NTZD 4H0LB 4L76A 1NTZE 2KZIA 1NTMJ 3KYQA 1N73C 2IZ1A 1Q86Q 5L8RJ 1ZRTD 3FWLA 1NU1D 5AVVB 2N1TA 1ZMEC 1G1IA 2RMZA 5CCHC 1ZRTE 1NU1E 1JY2O 1IFPA 2HLOA 3GHGC 1KILC 2QIWA 3V2NA 4GOEA 2NPSC 3RK3D 2FFDC 1Q82Q 3CCJP 4EIJA 2E75B 4C46A 1KFNA 1J1DC 2A45I 3RK3E 1M56D 1X0TA 1LJ2A 2J5UA 1SQQD 1EZVD 4N78E 3RL0B 2OTKE 2ZT9C 1SQQE 2QEXP 3D6ZA 2ZXXA 1IK9A 4B86A 2P2UA 1URQB 1QL2A 4Y99C 3L71G 2WT7B 1M1JB 5K5GB 1OW7A 3IAOA 1JMBA 3T97A 3H1IE 3ITKA 2IFNA 3GMAA 1R8EA 1OMIA 2RH0A 1SQBD 2MJZA 1EXJA 1SQBE 1L0LD 1RQUA 3TNUA 1UIXA 2WITA 4NPFX 2Q9IA 1L0LE 1N73B 3TGUG 1ZR4A 3L75G 1EZVG 1JM0A 1YJWP 3AEAC 3B71A 4H13C 3Q3DA 3PH0A 5APXA 3H25A 2PGDA 3IFMA 3L72G 3L73G 2D2CD 1W5CE 3GHGB 1KILB 2KB7P 4K35A 1KYOH 4Y28J 2NPSB 3SSUA 2QSIA 3CL3D 3L4FA 2FFDB 1S5LE 3CC4P 4R4MA
chains in the Genus database with same CATH topology
1FBMA 1J1DB 1FAVA 3G3ZA 2WZ7A 3P8MC 2GM4A 3TNUB 3CI9A 2WPRA 1WT6A 1H89A 3N7NA 4O9BA 4N6JA 2Q5UA 1SFCA 2I1KA 1JY3O 1ZV8A 3P8CE 2WT7A 1ZR2A 5APTA 1CW5A 1M1JA 1H8AA 3OA7A 2E42A 1SVFA 1FOSF 2YO2A 1GL2D 1YTZT 1FZFA 5APSA 2A45G 3KPEA 1HBWA 3VTPC 2C0XA 1LTGC 2J58A 1JMMA 4C7NB 5AW4B 2PAJA 2WTYA 1JY2P 2OYHA 4IFFA 4N78D 4Y99B 5AVXB 5CCHD 1NKZB 4DOJA 2M8RA 2P67A 3NXSA 2WWWA 1HGZA 1N7SC 3E1IA 1FZAA 1L4AC 1KILD 2HODA 3HE5B 4OH8B 2HPCB 3HD7B 2YNYA 2NPSD 2C9LY 5AW5B 1N73A 1T3UA 1HGVA 1JO5A 1T2KD 3TYYA 4M3LA 3B5NC 3EFGA 2YKQA 3R2PA 3TSIA 1GK6A 2LKMA 5BU8B 2Z4EA 1L0NK 1ZLLA 2R3CA 5CMZA 3UIAA 1J2JB 2CPSA 2Z5IA 3HTKB 5AW7B 3GHGA 4W80A 2CPBA 1FJPA 1GDTA 4GT1A 5AVSB 4LLHA 3RK2C 1DH3A 1LWUC 2YKOA 3P7KA 1OWAA 5AVWB 2E43A 3H32B 1JCCA 4I1LA 1LTBC 3RL0D 1E5WA 1RE3C 5AW8B 2Q3IA 1X8YA 4WB4A 1LTJB 1RY3A 1FZCC 4GKGA 1IO4A 1HH0A 1GU4A 2XV5A 1N7SA 2XNXA 1L4AA 1ZN5A 1QL1A 1HUCA 1T8ZA 1JOCA 1MZ9A 1SFCD 1T3JA 1G1JA 5CHXA 1RF1C 2XKMA 3BRVB 3M91A 4C7NA 1G2CB 3U1AA 1A02J 3B5NA 3VMXA 1IFNA 2I1JA 3O8ZA 3VN0A 2GUVA 1GK4A 1N7LA 1SP4A 1XTCC 3U1CA 3HE5A 1FDMA 1JUNA 3HD7A 3A5TA 2KSJA 1YYCA 1JCDA 2YO3A 3P8CD 1FJKA 3MD0A 1NTMK 1GL2C 3RK3C 4AUWA 5AVTB 3L35A 3M9HA 2FYZA 2W6BA 3II6A 1FZBA 3MUDA 3KQGA 1N7SB 2KYVA 3M06A 1L4AB 1S9KD 1NOHA 4HH2A 1RE4C 1GTWA 1GW3A 4IFDK 1CZQA 1FU1A 2J59M 2WSFH 1SQPK 1S9KE 2M3BA 1N86A 5CCGD 3HTKA 4JYBA 3V2QA 5KJ7C 1JY2N 4WBAA 5AW2B 1LTIC 3B5NB 3H6PA 4KHXA 1JY3P 1Z56A 2BASA 4HYTB 3M0DA 2FXMA 2VRSA 1AQ5A 3LW5H 1A02F 1SQXK 5AW6B 3IR9A 2IX7C 3H32A 3HUSC 3BVHA 1DEBA 4RESB 2H8PD 1T2KC 1LTJA 1SLQA 1HTLC 2C0WA 2P1JA 1HJBA 2OYIC 1RF0C 3WMM0 3P32A 2KP8A 3L37A 3RK2B 5CCGA 1LWUB 5AW3B 1NHLA 3MIWA 4I2LC 4IFMA 5CJ4A 1G2CA 4N3YB 4W7ZA 4XE5B 1N7SD 2XU6A 1L4AD 1NTKK 3SWYA 4LGDE 1H88A 3PP5A 3BASA 1NAFA 2W6AA 1NO4A 1FZCB 1LGHB 2JEEA 3LIEA 5AVUB 2IPPA 3BRTB 5BU5A 2GUSA 3B5ND 2L5GB 2C9NY 5APQA 1AFOA 5AW9B 3RL0C 3V2PA 1RF1B 2N9BA 1LT9C 3A2AA 5KJ7A 3V5BA 3C9IA 3M0AA 2H43A 5AVRB 4WY4C 5KLVK 1KQLA 3MGNA 3HD7D 2N1TC 3EQ2A 4XA4A 1N2DC 2FYUK 2HYNA 3I5CA 3VMZA 5BVZA 1URQC 2WSCH 2Q7CA 1SFCC 2WPSA 3V4QA 2OARA 1HVVA 1M1JC 2R5DA 3HUSA 3VMYA 4W7YA 5AVQB 1PFIA 2POHA 1W2EA 2OYIA 4ZKUA 1GL2B 1RF0A 3RK3B 3M9BA 1FOSE 1IFDA 5AVZB 2OYHC 1M7LA 1OXZA 2O1KA 4ZKPA 1JNMA 1NTZK 2YMYA 1GW4A 4GIFA 2XZRA 1VDFA 1CI6A 1VPCA 5APVA 2R5BA 1X79B 3V2RA 3KYQA 1N73C 3CLQA 1DX7A 2KOGA 2IFMA 1LWUA 2ZXEB 3OJAB 3A3YB 5KTBA 3HE4B 1NH4A 1MUUA 3NFQA 2FKWB 1JTHB 3HUSB 1NKNA 1NU1K 1RE3A 5AVVB 2H7HA 4WY4A 5APWA 2N1TA 1G1IA 5CCHC 4C7RA 1FZCA 1JY2O 3TK1A 1JY3N 1URQA 2HLOA 2OYIB 1CSBA 3GHGC 1KILC 2KLVA 2PP6A 3V2NA 2QM8A 4AQRD 1EQ7A 2NPSC 3RK3D 4DZOA 1J1EC 1RF1A 2FFDC 1LTAC 5AW1B 4EIJA 1LTTC 1CI6B 4C46A 1GU5A 2WSEH 1NWQA 4EOTA 1KFNA 1J1DC 2A45I 3LIDA 1GZLA 1HWTC 1IFJA 1KFMA 5KJ7D 3SWFA 1LTSC 3B8EB 1SQQK 1IFIA 4N78E 3RL0B 1LT9B 3N4XA 3HRNA 5AW0B 1FZEA 3A7OA 4JYCA 1IK9A 4B86A 4WY4B 2N1TB 1GL2A 2P2UA 2Z5HA 1SQVK 1URQB 1QL2A 3NMDA 4Y99C 1SFCB 5APUA 2WT7B 4I6MC 1RE4A 1M1JB 1IC2A 2HFED 1MFZA 3VP8A 1XTGB 3U59A 3T97A 2R32A 3BATA 3HD7C 5CCHA 3KDPB 2IFNA 1KZUB 1KILA 3NTNA 1FZGA 2OYHB 4AYCA 4LC1A 3HE4A 2O1JA 2NPSA 3VP9A 1SQBK 2FFDA 5AVYB 2MJZA 2QM7A 1JTHA 3VOPA 1YTZI 2HODB 1MV8A 2A45H 3RK2D 1L0LK 4JF7A 3TNUA 2JJLA 2ZFCA 5CJ0A 2WPQA 2WITA 2P7JA 2Q9IA 1N73B 1ZR4A 2HG5D 1IJDB 3V4WA 4WY4D 3VYIA 2XDJA 2N1TD 1WRGA 2YKPA 3L36A 1URQD 3M0DC 5APYA 5APXA 2W27A 2O01H 1GD2E 1IFMA 1X9VA 3IFMA 1LTJC 3M9QA 3MTUE 3GHGB 1KILB 2KB7P 2NPSB 3CL3D 1J1EB 3OAKA 2HPCA 3L4FA 2FFDB 1LT9A 5CCGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP9 A;  1NKN A;  5BU5 A;  3P8C D;  4N78 D;  1IC2 A;  1WT6 A;  2POH A;  3N7N A;  1X79 B;  4O9B A;  3U1A A;  3VP8 A;  3U59 A;  5BU8 B;  3BAT A;  4I1L A;  2FXM A;  4ZKU A;  3C9I A;  3N4X A;  4N3Y B;  3OJA B;  5KTB A;  3HRN A;  3BAS A;  3U1C A;  4ZKP A;  5BVZ A;  4GIF A;  2JEE A; 
#chains in the Genus database with same CATH topology
 1J1D B;  2K1A A;  3G3Z A;  2WZ7 A;  2IBZ I;  1WT6 A;  3AE1 C;  3N7N A;  2PFX A;  1JY3 O;  3B4S A;  2ITA A;  3MZW B;  4TT3 H;  1YTZ T;  3RBX A;  3CX5 H;  2ZT9 B;  2V4H A;  4PJ0 H;  3VTP C;  2J58 A;  3RGU A;  2Y9Z A;  1NJI Q;  4Y99 B;  2JKV A;  5E79 E;  2BCC D;  1KD1 Q;  1K04 A;  2WWW A;  2KNC A;  1N7S C;  2BCC E;  2KS1 B;  4NPD A;  5DJT B;  4EDF A;  4U3F D;  4M3L A;  2OYO A;  3AEF C;  4IL6 X;  1GK6 A;  2Z4E A;  1L0N K;  1ZLL A;  1EDK A;  5CMZ A;  2Z5I A;  1KOR A;  5AW7 B;  2WSS H;  1FJP A;  2ZAE B;  4GT1 A;  3H1J D;  4H13 B;  4LLH A;  4IL6 H;  3RK2 C;  2YKO A;  3I56 P;  3H1J E;  1S3J A;  3H32 B;  1LTB C;  5KLI C;  3RL0 D;  1X8Y A;  4WB4 A;  2A06 D;  3H1L E;  3BCC D;  4GKG A;  2XNX A;  1L4A A;  2A06 E;  1QL1 A;  1HUC A;  3BCC E;  2FXP A;  5CHX A;  2XKM A;  3BRV B;  3M91 A;  3CCR P;  1G2C B;  1ZOY C;  1VL2 A;  4U3F G;  3B5N A;  2QVA A;  1WMK A;  3O8Z A;  2GUV A;  1GK4 A;  3U1C A;  3HE5 A;  4MN4 C;  3A5T A;  5B5E H;  1OX3 A;  1YYC A;  3L70 J;  1BDC A;  1BE3 D;  1FJK A;  3MD0 A;  1GL2 C;  3RK3 C;  2JDI H;  3L35 A;  1YIJ P;  1BE3 E;  1AJY A;  1YQ3 C;  3A0H E;  1N7S B;  3M06 A;  1S9K D;  1NOH A;  4HH2 A;  4L74 A;  4IFD K;  1CZQ A;  1SQP J;  2J59 M;  1S9K E;  2M3B A;  1N86 A;  1ZXG A;  1LTI C;  5H2F H;  2W6J H;  4UB8 E;  3LW5 J;  2IX7 C;  1DEB A;  4RES B;  2H8P D;  1BGY D;  2M5A B;  1HTL C;  3CC2 P;  1BGY E;  3L37 A;  3RK2 B;  1PGQ A;  2I8D A;  4GOD A;  5CJ4 A;  1RH5 B;  4W7Z A;  4XE5 B;  1NTK D;  2XU6 A;  5KLI B;  3ABV C;  2ZT9 D;  4DCK A;  3CCU P;  1NTK E;  1K8A Q;  1VQ7 P;  3A0B E;  2N9B A;  1PGJ A;  2FYU J;  1ZP0 C;  2P58 A;  5BVZ A;  2Q7C A;  1SFC C;  2IYO A;  4HB1 A;  2IZ0 A;  1LT1 A;  1YJ9 P;  3O6Q A;  1AV1 A;  3H1K D;  2G8Y A;  2FBW C;  5AVQ B;  1PFI A;  2AXT H;  2POH A;  5KKZ C;  2D2C C;  1YBK A;  3H1K E;  4ZKU A;  1GL2 B;  1RF0 A;  3RK3 B;  2ZYA A;  2OYH C;  1NTZ J;  2H88 C;  2O1K A;  3AE8 C;  2YMY A;  1GW4 A;  1VDF A;  4H13 D;  3C8V A;  1KN7 A;  5APV A;  2R5B A;  1YJN P;  1X79 B;  3PJS K;  1VQO P;  2E76 D;  1MFT A;  4I7Z C;  3CLQ A;  1K05 A;  1LWU A;  2H89 C;  3AEB C;  1MUU A;  2ZYD A;  1FE6 A;  4YXD C;  1RE3 A;  1W2B O;  1FZC A;  1URQ A;  2B9B A;  1JEK A;  2YXR B;  2QM8 A;  3MP7 B;  1LTA C;  4D6T D;  1NWQ A;  1AVY A;  4EOT A;  3CXH D;  1U7M A;  2DW3 A;  4NPE A;  1IFJ A;  3CXH E;  5KJ7 D;  3AE4 C;  3TGU J;  2Q3E A;  1LTS C;  3AE6 C;  1IFI A;  2OTL P;  3L70 G;  4KT0 J;  3HRN A;  4JYC A;  1KC8 Q;  3CCE P;  1SQV D;  3L72 J;  2Y9Y A;  3NMD A;  1SFC B;  4I6M C;  1KYO I;  1RE4 A;  1M1K Q;  1SQP G;  1EDL A;  2WQY C;  3VP8 A;  3U59 A;  2R32 A;  5KKZ B;  5CCH A;  2D2C B;  3KDP B;  4UB6 H;  1LP1 B;  1KIL A;  2BEZ F;  5M1B A;  1FZG A;  2OYH B;  1SQB J;  4LC1 A;  1L2P A;  3HE4 A;  2IDB A;  2NPS A;  2FFD A;  3GG2 A;  2QM7 A;  1JTH A;  2KI7 B;  1L0L J;  3CME P;  3CX5 I;  3RK2 D;  2ZFC A;  2WPQ A;  4I7Z B;  1TU3 F;  1IJD B;  3V4W A;  4WY4 D;  3CWB D;  3L36 A;  3M0D C;  3CWB E;  3VMA A;  1PP9 D;  1P84 I;  1X9V A;  2W83 C;  3W68 A;  1LTJ C;  1EXI A;  1PP9 E;  3OAK A;  1LT9 A;  3K5B A;  1E79 H;  1OVR A;  2KS1 A;  1PPJ G;  2FYU G;  4IOI H;  3CI9 A;  2WPR A;  1VQP P;  1AQT A;  1H89 A;  3H1H D;  1OW6 A;  2Q5U A;  2I1K A;  1ZV8 A;  3AEE C;  3P8C E;  1JB0 J;  3IF4 A;  1UII A;  1H0T B;  1SVF A;  1GL2 D;  3H1H E;  2B87 B;  1FZF A;  2W8Z A;  4RKU J;  1JMM A;  5CBN A;  3CCS P;  3EFF K;  1BSN A;  4IFF A;  4RO0 A;  3TF5 A;  1NTZ G;  4N78 D;  3OW2 O;  3FXD A;  1QEX A;  1VQN P;  4DOJ A;  2K37 A;  2JWD A;  2BCC J;  3NXS A;  4PD4 D;  1QVG O;  1HGZ A;  2HOD A;  2K88 A;  4XFJ A;  2YNY A;  4PD4 E;  1HGV A;  3EWK A;  4U3F J;  1KB9 I;  3TYY A;  2YKQ A;  3H1I D;  3R2P A;  1NU1 G;  5BU8 B;  3PHL A;  1USD A;  1VQ8 P;  1Y47 A;  2CPS A;  1ZW0 A;  4W80 A;  2CPB A;  3Q5P A;  1HF9 A;  2AXC A;  3F5H A;  3H1J J;  3JCU E;  1PGO A;  4BRY B;  2NRG A;  3WU2 E;  4U7J A;  1YQ4 C;  3AE7 C;  4I1L A;  4A7P A;  3W67 A;  1HJ0 A;  3I55 P;  5AW8 B;  1LTJ B;  1S5L X;  1SQQ G;  1HH0 A;  2XV5 A;  1N7S A;  1T8Z A;  1FS0 E;  1SFC D;  3Q2Y A;  4C7N A;  2E76 C;  2E74 D;  3USS A;  1S5L H;  3VMX A;  1IFN A;  2ZVO B;  3H1I G;  5B66 E;  4K3A A;  3AEC C;  1SP4 A;  1SS1 A;  1FDM A;  3RL0 g;  3HD7 A;  3G9R A;  1VF5 C;  1BE3 J;  3WUU A;  1SQB G;  3CCV P;  1NTM D;  1X22 A;  4AUW A;  5AVT B;  3MUD A;  3KQG A;  1L0L G;  1NTM E;  2KYV A;  1GTW A;  1GW3 A;  5E79 H;  1SQP K;  5GTI E;  3HTK A;  5KJ7 C;  2QE7 H;  3V2Q A;  4WBA A;  1AA0 A;  3CD6 P;  2BAS A;  2FY8 A;  2FXM A;  2VRS A;  1AQ5 A;  1SQX D;  3JSV C;  4H44 C;  3CPW O;  3HUS C;  1T2K C;  1SQX E;  1SLQ A;  2WPV B;  1HJB A;  2OYI C;  5C39 A;  1NGM B;  5CCG A;  5AW3 B;  4IFM A;  1NTK J;  3SWY A;  3PP5 A;  3BAS A;  1U7J A;  1P84 E;  1VQK P;  2GUS A;  2L5G B;  2C9N Y;  4YXW H;  3V6I A;  1DIP A;  2E76 B;  2KSE A;  3H1L D;  3V5B A;  4OGQ D;  5KLV D;  4WY4 C;  3SFD C;  3EQ2 A;  4XA4 A;  2BCC G;  2FYU K;  2HYN A;  5KLV E;  3GLM A;  2WSC H;  2WPS A;  1HVV A;  1VF5 B;  1W2E A;  1FOS E;  5AVZ B;  2R44 A;  1YHQ P;  1M7L A;  4ZKP A;  1JNM A;  2JO1 A;  1Y9B A;  1NTZ K;  2XZR A;  3A0H H;  1VPC A;  2FYN C;  3V2R A;  4TLF A;  2QJP B;  3H1J G;  1D7M A;  2IFM A;  2ZXE B;  4KJM A;  1Q81 Q;  3H1L G;  1KB9 E;  3QWO C;  4H44 B;  3HUS B;  5GTH E;  1NU1 K;  2A06 G;  1QLE D;  1BCC D;  4GDO A;  3BCC G;  4UB8 H;  2OYI B;  1BCC E;  4BXL A;  1BSH A;  4AQR D;  1EQ7 A;  1J1E C;  1RF1 A;  1K9M Q;  4D6T J;  2Q6Q A;  5AW1 B;  1LTT C;  1CI6 B;  2O3J A;  3L74 D;  1HWT C;  3SWF A;  3L74 E;  1SQQ K;  2GA1 A;  5KAF E;  1BE3 G;  1FZE A;  3A7O A;  4WY4 B;  3A0B H;  1SQV J;  5APU A;  2HR3 A;  1T6A A;  1XTG B;  4CPG A;  3D70 A;  1R5S A;  2IBZ D;  2B89 A;  3NTN A;  4AYC A;  3CCQ P;  2SPZ A;  3VP9 A;  1SQB K;  2IBZ E;  5AVY B;  1QVF O;  2P10 A;  2KUB A;  3VOP A;  2E74 C;  4YPC A;  4DT0 A;  1BGY G;  1MV8 A;  1L0L K;  4JF7 A;  2JJL A;  2FYN B;  5CJ0 A;  2P7J A;  2WVR A;  2CK3 H;  2YIU C;  2O01 N;  1H0T A;  2XDJ A;  2N1T D;  1WRG A;  1EZV I;  1NTK G;  1OVU A;  5APY A;  1S72 P;  1GD2 E;  1IFM A;  2L91 A;  3KZI E;  2JR8 A;  3M9Q A;  4PV1 D;  1J1E B;  1S4X A;  1NU1 J;  1FAV A;  2GM4 A;  3Q5R A;  3H1H J;  4O9B A;  1VF5 D;  2WT7 A;  5APT A;  3H1K G;  1M1J A;  1H8A A;  2E42 A;  2YO2 A;  4JQ0 D;  3CXH H;  3KPE A;  1NAY A;  1M90 Q;  2OTJ P;  1HBW A;  2IYP A;  1OZH A;  1LTG C;  2QG4 A;  1RQV A;  1NKZ B;  1SQQ J;  2P67 A;  4BRY A;  1U57 A;  1FZA A;  3HE5 B;  2HPC B;  2LXB A;  2C9L Y;  4JPZ B;  1N73 A;  4H44 D;  5TIS E;  1T2K D;  1VQL P;  3H1I J;  2MKV A;  1Q90 D;  2E74 B;  1L0N D;  2LKM A;  4OGQ C;  1BDD A;  3G71 P;  3AE3 C;  3JC2 2;  1L0N E;  4GOF A;  1J2J B;  4ZNC A;  3GHG A;  2K9J B;  2YIU B;  4ASV A;  1GDT A;  5AVS B;  4D6T G;  1DH3 A;  1LWU C;  3P7K A;  1VQM P;  1OWA A;  5AVW B;  1JCC A;  1VQ6 P;  1RE3 C;  1RY3 A;  4OVN F;  1FZC C;  1IO4 A;  1ZN5 A;  2LR2 A;  1MZ9 A;  2KXP B;  1G1J A;  2OQQ A;  1SQV G;  3E1R A;  3VN0 A;  1OIP A;  1XTC C;  1PIX A;  3D71 A;  4EI2 A;  1JCD A;  2E5T A;  2YO3 A;  3P8C D;  3SWK A;  1Y8A A;  1VQ4 P;  4HKZ H;  3Q5S A;  2QJY C;  3M9H A;  2W6B A;  4BWN A;  3S1K A;  3L71 D;  1RE4 C;  3O6Q B;  3IN6 A;  1FU1 A;  2K9Y A;  2W90 A;  2WSF H;  5CCG D;  2K3R A;  2M3E A;  3L71 E;  3CCL P;  4JYB A;  1JY2 N;  2QRX A;  5AW2 B;  3CWB G;  3H6P A;  4PD4 H;  1Z56 A;  3FGA D;  4DJG A;  4HYT B;  1SQX J;  1VQ9 P;  4OGQ B;  1A02 F;  1PP9 G;  2AEM A;  3H32 A;  3TDK A;  2WSE J;  2C0W A;  1OFC X;  2P1J A;  5TJH A;  3TGU D;  4RJT A;  2KP8 A;  3L75 D;  1LWU B;  2V7Q H;  1NHL A;  1FDI A;  3MIW A;  4ZMD A;  3TGU E;  1G2C A;  3L75 E;  3SFE C;  3JCU H;  1EZV E;  1L4A D;  1NTK K;  3H1H G;  3WU2 H;  3AE5 C;  2N9Y B;  1NVO A;  1H88 A;  1NO4 A;  1FZC B;  2JEE A;  3LIE A;  3L72 D;  5AVU B;  2IPP A;  5BU5 A;  3L73 D;  3B5N D;  5EFW B;  5APQ A;  3L72 E;  1AFO A;  5AW9 B;  3V2P A;  3L73 E;  3H1L J;  1LT9 C;  5KJ7 A;  5KLV J;  4JBZ A;  3C9I A;  3M0A A;  2H43 A;  1KQL A;  2N1T C;  1RHZ B;  2Y0C A;  3BCC J;  1N2D C;  5KAI H;  3I5C A;  3VMZ A;  1K73 Q;  3AED C;  2OAR A;  2WSC J;  5DJU B;  3HUS A;  3VMY A;  3ZDM A;  5B66 H;  5KAI E;  4PV1 C;  2RKL A;  2YXQ B;  2OYI A;  1DEE G;  3FXE A;  2QJY B;  4GIF A;  1N8R Q;  1CI6 A;  1USE A;  2M5A A;  1PL5 A;  3PRJ A;  2O01 J;  1DX7 A;  5GTI H;  2KOG A;  3OJA B;  3A3Y B;  5KTB A;  3HE4 B;  1NH4 A;  1PGP A;  1KYO D;  3NFQ A;  2FKW B;  1JTH B;  1KV4 A;  1NKN A;  2JP3 A;  4L73 A;  2H7H A;  4WY4 A;  1EDJ A;  1BCC J;  1KYO E;  5APW A;  2NZ2 A;  4C7R A;  2QJP C;  3TK1 A;  1JY3 N;  1CSB A;  2XND H;  2KLV A;  2PP6 A;  2ZJS E;  2E5Y A;  4DZO A;  3S9O A;  1S2E A;  3CX5 D;  2PRR A;  1GU5 A;  1BGY J;  2WSE H;  1EC5 A;  4H0L D;  1KMI Z;  3L74 J;  3LID A;  3CX5 E;  2WMM A;  1GZL A;  4HJG H;  1KFM A;  4PJ0 E;  3B8E B;  3KXD A;  2R3S A;  1LT9 B;  3N4X A;  1P84 H;  1LNQ A;  5AW0 B;  2QJK C;  1NTM G;  3Q1M A;  2YMK A;  1P84 D;  2N1T B;  1GL2 A;  3WUV A;  2Z5H A;  2KZJ A;  1SQV K;  2ZVN B;  1IC2 A;  5CBO A;  4U3F E;  2HFE D;  1MFZ A;  2ZYG A;  3BAT A;  3HD7 C;  4L75 A;  2B88 A;  4PV1 B;  1KZU B;  2E75 D;  2O1J A;  1SQX G;  1Q7Y Q;  3H1K J;  3MUD C;  1YTZ I;  2HOD B;  2A45 H;  3CXH I;  3GF7 A;  2JWA A;  4IL6 E;  1R5L A;  1FC2 C;  2HG5 D;  3VYI A;  2YKP A;  1URQ D;  3AEG C;  2W27 A;  2O01 H;  3T97 B;  4Z1M H;  4WVZ A;  3E7K A;  3S4R A;  1KB9 H;  5GTH H;  1KB9 D;  3MTU E;  2KLU A;  2HPC A;  5CCG C;  1M8O B;  5KLV G;  1FBM A;  1OW8 A;  3P8M C;  3TNU B;  1PV3 A;  1NYH A;  4N6J A;  1SFC A;  5B5E E;  1ZR2 A;  1DD3 A;  3F89 A;  1CW5 A;  3OA7 A;  1FOS F;  5APS A;  2A45 G;  2C0X A;  1LP1 A;  2QJK B;  4C7N B;  3CCM P;  5AW4 B;  2K9J A;  2PAJ A;  2WTY A;  1JY2 P;  2OYH A;  5KAF H;  3G6E P;  5AVX B;  5CCH D;  2M8R A;  3PLN A;  1KQG B;  3FX0 A;  3E1I A;  1L4A C;  1KIL D;  4OH8 B;  2Y0D A;  2KK7 A;  3HD7 B;  1DD4 A;  2NPS D;  5H2F E;  3FWN A;  1KIL E;  5AW5 B;  1T3U A;  1JO5 A;  3B5N C;  3EFG A;  2QA4 P;  2Y0E A;  3GF3 A;  3TSI A;  1L0N J;  1BCC G;  1FDO A;  2R3C A;  3GW6 A;  2AEJ A;  3UIA A;  3HTK B;  2RN0 A;  2Q1K A;  1EDI A;  1KTM A;  2KNC B;  1PZQ A;  2E43 A;  3MHV A;  4R4L A;  1AVO A;  3L74 G;  1E5W A;  2Q3I A;  2AEF A;  3AE9 C;  1QX8 A;  3CWB J;  1GU4 A;  4PD4 I;  3D6Y A;  2B87 A;  4ASW A;  3KZI H;  1JOC A;  1T3J A;  1RF1 C;  2FXO A;  3CMA P;  1PP9 J;  4QMA A;  3U1A A;  1GMJ A;  1A02 J;  2I1J A;  2BEQ D;  2AXT E;  4EYY Q;  1N7L A;  3PTZ A;  1OVV A;  1JUN A;  2KSJ A;  1IZN B;  2IBZ G;  3L70 D;  3AE2 C;  1NTM K;  3L70 E;  2FYZ A;  1YI2 P;  2OGU A;  3II6 A;  1FZB A;  1L4A B;  3L71 J;  4H0L C;  1SQP D;  2WSF J;  3R4Y A;  1SQP E;  3B5N B;  4KHX A;  1JY3 P;  2KIK A;  3M0D A;  5TIS H;  1S1C X;  3LW5 H;  1SQX K;  5AW6 B;  3IR9 A;  3BVH A;  4OWF A;  1QGK B;  1KQS O;  1LTJ A;  4D6T E;  2G3A A;  2LXC B;  1M57 D;  1RF0 C;  3L75 J;  3WMM 0;  3P32 A;  3QH9 A;  3C1L A;  2V7Q J;  4I2L C;  4N3Y B;  1N7S D;  2E75 C;  4LGD E;  1YIT P;  1NAF A;  2W6A A;  1Q2N A;  1LGH B;  1IK7 A;  3L73 J;  4YTP C;  3BRT B;  3CC7 P;  3KHU A;  1SQV E;  1KQF B;  3RL0 C;  1RF1 B;  3A2A A;  5AVR B;  5KLV K;  1PPJ D;  3MGN A;  3HD7 D;  2FYU D;  4WWI A;  1MKM A;  1URQ C;  1PPJ E;  4UB6 E;  3V4Q A;  3RBZ A;  2FYU E;  1M1J C;  2R5D A;  3WUT A;  4W7Y A;  3G4S P;  2UWJ E;  2M0B A;  3M9B A;  1IFD A;  1VQ5 P;  1OXZ A;  1L0N G;  1NTZ D;  4H0L B;  4L76 A;  1NTZ E;  2KZI A;  1NTM J;  3KYQ A;  1N73 C;  2IZ1 A;  1Q86 Q;  5L8R J;  1ZRT D;  3FWL A;  1NU1 D;  5AVV B;  2N1T A;  1ZME C;  1G1I A;  2RMZ A;  5CCH C;  1ZRT E;  1NU1 E;  1JY2 O;  1IFP A;  2HLO A;  3GHG C;  1KIL C;  2QIW A;  3V2N A;  4GOE A;  2NPS C;  3RK3 D;  2FFD C;  1Q82 Q;  3CCJ P;  4EIJ A;  2E75 B;  4C46 A;  1KFN A;  1J1D C;  2A45 I;  3RK3 E;  1M56 D;  1X0T A;  1LJ2 A;  2J5U A;  1SQQ D;  1EZV D;  4N78 E;  3RL0 B;  2OTK E;  2ZT9 C;  1SQQ E;  2QEX P;  3D6Z A;  2ZXX A;  1IK9 A;  4B86 A;  2P2U A;  1URQ B;  1QL2 A;  4Y99 C;  3L71 G;  2WT7 B;  1M1J B;  5K5G B;  1OW7 A;  3IAO A;  1JMB A;  3T97 A;  3H1I E;  3ITK A;  2IFN A;  3GMA A;  1R8E A;  1OMI A;  2RH0 A;  1SQB D;  2MJZ A;  1EXJ A;  1SQB E;  1L0L D;  1RQU A;  3TNU A;  1UIX A;  2WIT A;  4NPF X;  2Q9I A;  1L0L E;  1N73 B;  3TGU G;  1ZR4 A;  3L75 G;  1EZV G;  1JM0 A;  1YJW P;  3AEA C;  3B71 A;  4H13 C;  3Q3D A;  3PH0 A;  5APX A;  3H25 A;  2PGD A;  3IFM A;  3L72 G;  3L73 G;  2D2C D;  1W5C E;  3GHG B;  1KIL B;  2KB7 P;  4K35 A;  1KYO H;  4Y28 J;  2NPS B;  3SSU A;  2QSI A;  3CL3 D;  3L4F A;  2FFD B;  1S5L E;  3CC4 P;  4R4M A; 
#chains in the Genus database with same CATH homology
 1FBM A;  1J1D B;  1FAV A;  3G3Z A;  2WZ7 A;  3P8M C;  2GM4 A;  3TNU B;  3CI9 A;  2WPR A;  1WT6 A;  1H89 A;  3N7N A;  4O9B A;  4N6J A;  2Q5U A;  1SFC A;  2I1K A;  1JY3 O;  1ZV8 A;  3P8C E;  2WT7 A;  1ZR2 A;  5APT A;  1CW5 A;  1M1J A;  1H8A A;  3OA7 A;  2E42 A;  1SVF A;  1FOS F;  2YO2 A;  1GL2 D;  1YTZ T;  1FZF A;  5APS A;  2A45 G;  3KPE A;  1HBW A;  3VTP C;  2C0X A;  1LTG C;  2J58 A;  1JMM A;  4C7N B;  5AW4 B;  2PAJ A;  2WTY A;  1JY2 P;  2OYH A;  4IFF A;  4N78 D;  4Y99 B;  5AVX B;  5CCH D;  1NKZ B;  4DOJ A;  2M8R A;  2P67 A;  3NXS A;  2WWW A;  1HGZ A;  1N7S C;  3E1I A;  1FZA A;  1L4A C;  1KIL D;  2HOD A;  3HE5 B;  4OH8 B;  2HPC B;  3HD7 B;  2YNY A;  2NPS D;  2C9L Y;  5AW5 B;  1N73 A;  1T3U A;  1HGV A;  1JO5 A;  1T2K D;  3TYY A;  4M3L A;  3B5N C;  3EFG A;  2YKQ A;  3R2P A;  3TSI A;  1GK6 A;  2LKM A;  5BU8 B;  2Z4E A;  1L0N K;  1ZLL A;  2R3C A;  5CMZ A;  3UIA A;  1J2J B;  2CPS A;  2Z5I A;  3HTK B;  5AW7 B;  3GHG A;  4W80 A;  2CPB A;  1FJP A;  1GDT A;  4GT1 A;  5AVS B;  4LLH A;  3RK2 C;  1DH3 A;  1LWU C;  2YKO A;  3P7K A;  1OWA A;  5AVW B;  2E43 A;  3H32 B;  1JCC A;  4I1L A;  1LTB C;  3RL0 D;  1E5W A;  1RE3 C;  5AW8 B;  2Q3I A;  1X8Y A;  4WB4 A;  1LTJ B;  1RY3 A;  1FZC C;  4GKG A;  1IO4 A;  1HH0 A;  1GU4 A;  2XV5 A;  1N7S A;  2XNX A;  1L4A A;  1ZN5 A;  1QL1 A;  1HUC A;  1T8Z A;  1JOC A;  1MZ9 A;  1SFC D;  1T3J A;  1G1J A;  5CHX A;  1RF1 C;  2XKM A;  3BRV B;  3M91 A;  4C7N A;  1G2C B;  3U1A A;  1A02 J;  3B5N A;  3VMX A;  1IFN A;  2I1J A;  3O8Z A;  3VN0 A;  2GUV A;  1GK4 A;  1N7L A;  1SP4 A;  1XTC C;  3U1C A;  3HE5 A;  1FDM A;  1JUN A;  3HD7 A;  3A5T A;  2KSJ A;  1YYC A;  1JCD A;  2YO3 A;  3P8C D;  1FJK A;  3MD0 A;  1NTM K;  1GL2 C;  3RK3 C;  4AUW A;  5AVT B;  3L35 A;  3M9H A;  2FYZ A;  2W6B A;  3II6 A;  1FZB A;  3MUD A;  3KQG A;  1N7S B;  2KYV A;  3M06 A;  1L4A B;  1S9K D;  1NOH A;  4HH2 A;  1RE4 C;  1GTW A;  1GW3 A;  4IFD K;  1CZQ A;  1FU1 A;  2J59 M;  2WSF H;  1SQP K;  1S9K E;  2M3B A;  1N86 A;  5CCG D;  3HTK A;  4JYB A;  3V2Q A;  5KJ7 C;  1JY2 N;  4WBA A;  5AW2 B;  1LTI C;  3B5N B;  3H6P A;  4KHX A;  1JY3 P;  1Z56 A;  2BAS A;  4HYT B;  3M0D A;  2FXM A;  2VRS A;  1AQ5 A;  3LW5 H;  1A02 F;  1SQX K;  5AW6 B;  3IR9 A;  2IX7 C;  3H32 A;  3HUS C;  3BVH A;  1DEB A;  4RES B;  2H8P D;  1T2K C;  1LTJ A;  1SLQ A;  1HTL C;  2C0W A;  2P1J A;  1HJB A;  2OYI C;  1RF0 C;  3WMM 0;  3P32 A;  2KP8 A;  3L37 A;  3RK2 B;  5CCG A;  1LWU B;  5AW3 B;  1NHL A;  3MIW A;  4I2L C;  4IFM A;  5CJ4 A;  1G2C A;  4N3Y B;  4W7Z A;  4XE5 B;  1N7S D;  2XU6 A;  1L4A D;  1NTK K;  3SWY A;  4LGD E;  1H88 A;  3PP5 A;  3BAS A;  1NAF A;  2W6A A;  1NO4 A;  1FZC B;  1LGH B;  2JEE A;  3LIE A;  5AVU B;  2IPP A;  3BRT B;  5BU5 A;  2GUS A;  3B5N D;  2L5G B;  2C9N Y;  5APQ A;  1AFO A;  5AW9 B;  3RL0 C;  3V2P A;  1RF1 B;  2N9B A;  1LT9 C;  3A2A A;  5KJ7 A;  3V5B A;  3C9I A;  3M0A A;  2H43 A;  5AVR B;  4WY4 C;  5KLV K;  1KQL A;  3MGN A;  3HD7 D;  2N1T C;  3EQ2 A;  4XA4 A;  1N2D C;  2FYU K;  2HYN A;  3I5C A;  3VMZ A;  5BVZ A;  1URQ C;  2WSC H;  2Q7C A;  1SFC C;  2WPS A;  3V4Q A;  2OAR A;  1HVV A;  1M1J C;  2R5D A;  3HUS A;  3VMY A;  4W7Y A;  5AVQ B;  1PFI A;  2POH A;  1W2E A;  2OYI A;  4ZKU A;  1GL2 B;  1RF0 A;  3RK3 B;  3M9B A;  1FOS E;  1IFD A;  5AVZ B;  2OYH C;  1M7L A;  1OXZ A;  2O1K A;  4ZKP A;  1JNM A;  1NTZ K;  2YMY A;  1GW4 A;  4GIF A;  2XZR A;  1VDF A;  1CI6 A;  1VPC A;  5APV A;  2R5B A;  1X79 B;  3V2R A;  3KYQ A;  1N73 C;  3CLQ A;  1DX7 A;  2KOG A;  2IFM A;  1LWU A;  2ZXE B;  3OJA B;  3A3Y B;  5KTB A;  3HE4 B;  1NH4 A;  1MUU A;  3NFQ A;  2FKW B;  1JTH B;  3HUS B;  1NKN A;  1NU1 K;  1RE3 A;  5AVV B;  2H7H A;  4WY4 A;  5APW A;  2N1T A;  1G1I A;  5CCH C;  4C7R A;  1FZC A;  1JY2 O;  3TK1 A;  1JY3 N;  1URQ A;  2HLO A;  2OYI B;  1CSB A;  3GHG C;  1KIL C;  2KLV A;  2PP6 A;  3V2N A;  2QM8 A;  4AQR D;  1EQ7 A;  2NPS C;  3RK3 D;  4DZO A;  1J1E C;  1RF1 A;  2FFD C;  1LTA C;  5AW1 B;  4EIJ A;  1LTT C;  1CI6 B;  4C46 A;  1GU5 A;  2WSE H;  1NWQ A;  4EOT A;  1KFN A;  1J1D C;  2A45 I;  3LID A;  1GZL A;  1HWT C;  1IFJ A;  1KFM A;  5KJ7 D;  3SWF A;  1LTS C;  3B8E B;  1SQQ K;  1IFI A;  4N78 E;  3RL0 B;  1LT9 B;  3N4X A;  3HRN A;  5AW0 B;  1FZE A;  3A7O A;  4JYC A;  1IK9 A;  4B86 A;  4WY4 B;  2N1T B;  1GL2 A;  2P2U A;  2Z5H A;  1SQV K;  1URQ B;  1QL2 A;  3NMD A;  4Y99 C;  1SFC B;  5APU A;  2WT7 B;  4I6M C;  1RE4 A;  1M1J B;  1IC2 A;  2HFE D;  1MFZ A;  3VP8 A;  1XTG B;  3U59 A;  3T97 A;  2R32 A;  3BAT A;  3HD7 C;  5CCH A;  3KDP B;  2IFN A;  1KZU B;  1KIL A;  3NTN A;  1FZG A;  2OYH B;  4AYC A;  4LC1 A;  3HE4 A;  2O1J A;  2NPS A;  3VP9 A;  1SQB K;  2FFD A;  5AVY B;  2MJZ A;  2QM7 A;  1JTH A;  3VOP A;  1YTZ I;  2HOD B;  1MV8 A;  2A45 H;  3RK2 D;  1L0L K;  4JF7 A;  3TNU A;  2JJL A;  2ZFC A;  5CJ0 A;  2WPQ A;  2WIT A;  2P7J A;  2Q9I A;  1N73 B;  1ZR4 A;  2HG5 D;  1IJD B;  3V4W A;  4WY4 D;  3VYI A;  2XDJ A;  2N1T D;  1WRG A;  2YKP A;  3L36 A;  1URQ D;  3M0D C;  5APY A;  5APX A;  2W27 A;  2O01 H;  1GD2 E;  1IFM A;  1X9V A;  3IFM A;  1LTJ C;  3M9Q A;  3MTU E;  3GHG B;  1KIL B;  2KB7 P;  2NPS B;  3CL3 D;  1J1E B;  3OAK A;  2HPC A;  3L4F A;  2FFD B;  1LT9 A;  5CCG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...