5AW4B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw4B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw4B02
3NMDA 3HE5B 1MV8A 1HJBA 2P2UA 3OAKA 2Q5UA 2WTYA 3P8MC 3M9BA 4RESB 1A02F 1G2CB 3VN0A 2Q7CA 1MUUA 5AVVB 3MD0A 2E42A 1H8AA 3NTNA 3V5BA 3KDPB 3V4WA 3HE4A 3SWFA 2W6AA 1H88A 3MGNA 1YYCA 2WT7A 1CSBA 2QM8A 2ZXEB 1T2KD 3M06A 5CMZA 2C9NY 1CI6B 3HE4B 3T97A 5AVUB 3TNUA 2P67A 5AW9B 1FAVA 4LC1A 5AVXB 4AQRD 2E43A 1S9KD 5APXA 2N9BA 2KP8A 1FOSF 1HBWA 1GZLA 5APWA 2XU6A 1SP4A 3WGVB 3L36A 2R5DA 2BASA 1GU4A 2WPRA 3A3YB 5AW6B 1A02J 2W27A 5APTA 4GT1A 5AVQB 3V4QA 5AW5B 1OWAA 3A7OA 2YNYA 5APUA 2H7HA 2WWWA 4I2LC 3B8EB 3I5CA 4C7NA 5APSA 3A2AA 1X8YA 3HE5A 5AVRB 2WPSA 4AUWA 2XV5A 5AW7B 3P7KA 3VMXA 5AVWB 2XZRA 2C9LY 1HUCA 2JJLA 1H89A 5AVTB 3VYIA 4DZOA 1KQLA 2R32A 5AVYB 1SLQA 1GD2E 3KQGA 1GTWA 1MFZA 4AYCA 3VMYA 3VTPC 3NXSA 4JYCA 3M0AA 3TNUB 2YO3A 3UIAA 2WPQA 1NAFA 2R5BA 4EOTA 5AVSB 5AW2B 3TK1A 1JUNA 5AW3B 2WT7B 1CI6A 3A5TA 2YO2A 3M9HA 4C46A 3M91A 2QM7A 1GK6A 1J2JB 3P32A 1JNMA 2Q3IA 2P7JA 4XE5B 5AVZB 4KHXA 4HYTB 3WGUB 1IO4A 3IR9A 3L35A 4B86A 1NWQA 4RETB 3LIEA 1CZQA 3TYYA 1OXZA 4C7NB 1GU5A 1DH3A 1HWTC 2ZFCA 3LIDA 3O8ZA 3VMZA 2IPPA 2Z5HA 3HTKA 4I6MC 5APYA 3L37A 1GK4A 2VRSA 5APVA 1T2KC 5AW4B 5APQA 5AW0B 2Z5IA 4M3LA 5AW1B 1FOSE 4JYBA 5AW8B 3M0DA 4GKGA 1S9KE 3NFQA 2R3CA
chains in the Genus database with same CATH superfamily
1AVYA 4H44C 3QDJA 1NMAL 2FD6H 3OSKA 4QGYA 2BW5A 5J12C 2UXGA 2XG5A 1VDGA 1SGKA 5H4YA 5KYNA 2Y5QA 3D7PA 4PRHB 1YBKA 1AR2A 2FYNB 2QLYA 1UIIA 2C1OB 3RHWK 1IGJB 2YAMA 3U36B 1ML0A 1CVSC 1UB5B 4AIZA 3CFNA 4QXUL 3GMRA 4LASL 3ZRCC 4IDJL 2B87B 3MA7A 3EJPA 3S2CA 5D96B 4BA0A 4ZMNA 2QG4A 1KCBA 3GI9H 4ABUA 4YOKA 1GZLA 5AALA 3F89A 1FQ9C 5B38A 3DX6B 3WJLA 4UQBA 1G84A 1H8SA 1FS0E 2B7DT 43CAB 1COBA 4L8SB 2BY3A 4G1MA 3D2UB 4Y2DC 1DBML 1KFMA 1SBBA 2CLRA 5CCGC 1ZSHA 4XCFH 5AKSA 1N64L 5T1DL 1RXLA 5EO9A 2BVTA 3VP8A 4OT1L 4I2LC 3KZIE 3ZGIA 4RFNC 1P4LA 2ITFA 3JV6A 4G6JH 3RHWF 4Z76B 5E03A 3T4AA 4FTVD 2JKIS 3O8XC 5CKAA 1MRDL 4HKXA 2BP5M 4KX8A 5DJDA 4BSVB 1NO4A 1O7DC 3TJPA 1JZDC 2R32A 1ZV2A 3BUDA 2EDJA 4J12A 3GXTA 3LIUA 3CCSP 4X6CB 5A6IA 2BIHA 4I3RH 4A6YB 1A4JB 4OZFA 4AE0A 3WBDA 1SYSB 3N5AA 4BKTC 1B0GB 3I02A 3MCKA 1R3LB 2D31B 1YEFL 4Y5VA 1SUJA 4KVCL 3WLWD 1NFKA 4LVEA 4PJCB 2E86A 3MCG1 2O5YH 1HI6A 4UIMB 2VL5A 3HI6L 1NIBA 3KYQA 4EE2A 2CXKA 1JNMA 1MHHA 3K80A 4PD4D 3FFDB 3I6KA 3QO1A 4ZJ9A 4XRCB 1SYVB 5MHSE 2M1KA 2XKNB 5DHDA 3FHAA 5I1CH 2E5TA 1B2YA 1A3QA 1RJCA 5D70H 1QYGL 5IVZB 1FNSL 1SQXJ 3O8ZA 4DP4X 3H1LE 3KGRA 3OW2O 5HYIA 2Y7QA 5D2LA 2W88A 3L3OB 5B3NA 1N8RQ 4XO3A 2E74D 1IQWL 4JFPB 4CU6A 1HINL 4MJ5B 1CICC 2IPUG 3VGDA 3D4ZA 3NK3A 8PAZA 5C3LD 2CRZA 3PFUA 3IJEB 1KTJA 1DDTA 2XV6B 1C16B 1I3RA 3QI9A 3VWJA 3N9GL 5I30L 5F9DC 1Q94B 5TE6L 3CFDB 4AL8L 1OK0A 5I8OH 2WSPA 2MHAB 5CJOL 4Y7OC 3GEFA 2FXOA 1GOFA 3WIFA 3ET9F 4IBVA 1JNHB 1JRHH 2ZKHH 2DEXX 3ML9A 3TO4D 2E9WA 2VDRH 4PWIA 3U6XS 2EKSA 1TCRB 4J4PA 4KJPD 1TEGA 3U48A 3KCWA 2F7IA 4Q4IA 2WYHA 4PRPD 4AYBA 1QUNB 4QLRA 2IOMA 4WJKB 1A4CA 2ZF8A 4PGBA 4XBGA 1FDLH 1F11A 2Y36L 5CEZL 3DIFB 1RY7B 1FF5A 1M8OB 2ZKWA 4L75A 1SMOA 4NQCD 1YPZF 5B66H 3MRGA 1E4XI 5DHMC 5A43C 5JHBA 1ZHLA 4X99B 2RFXB 3CXHE 1YY9D 2Z91B 3HZMA 3SD5A 3WKMH 1MHHB 5KANI 2FDBP 4L1TA 4TQHA 2HN7A 4BK5C 1KN2H 4L73A 1F97A 2D4DA 1DUYA 2GC7C 3E3QC 1FHNA 2DIBA 2ENJA 1UC6A 3P3YA 4W9CC 1AZRA 1OP5H 2CK2A 4YHZL 4ZNCD 3FH7A 1N64H 5T1DH 3FUNA 4I89A 3A2AA 3OKMA 4WBAA 5AVRB 2JQAA 1L0LG 1II4E 3L3HA 4IKNA 3V4VA 1G0YR 1GY2A 1IE4A 2D7QA 3RY6A 5B1BB 4XC3L 2VH5H 3L3KB 4PVMA 1EZVI 4MB3A 3TFKC 5G5DB 3F7YA 4AWJC 3HN3A 3MJ8A 4FDWA 4PLKD 4Y2OA 2H2SC 3N40P 4X4YA 2JJUA 5IQ9B 1MFCH 5KVGE 1YHQP 5A2IH 1MHPH 2H2PC 3ARFB 3B9EA 4MJIE 5I18L 2AQPA 3QZLA 4YBQC 3F6LA 4XPTH 3AEGC 5DHYA 1YEHL 3BLPX 1EMTH 4YDLC 4U1SA 3E38A 3TBVA 1H5BA 2QPDB 4K7PX 2X4QB 3EDJA 4U1HB 3GMLA 5T1LB 2MTPA 5L6YH 1BLNB 4NQUA 2N1TB 3TIDB 2M2DA 3S4SB 3H1ID 5AOMA 2M3EA 1KJ3L 3H9SE 1XSJA 3G6JB 3FUJA 3H1JD 1BZOA 1JB0J 4WTXA 5A16A 3PLNA 2DLIA 1Q9LB 4PTTA 2C1PB 3LQAL 3LXAA 1ANUA 1GYUA 3H9SA 1IC1A 1S3RA 1USDA 4NNXB 1BEYL 1TVHA 1EFXD 3KJ6H 3OAWA 2AQRA 1VLXA 5JUEH 1VF5B 4N2EA 5AB2A 4HPHA 4LDOB 2CIKB 3D5OF 4LHUG 3P3SA 1WUZA 2OMYA 3D85D 5BU8B 1SLUA 4FI7A 1FO0L 3EF4A 2Z4QB 2YMXH 5E99L 4NQDE 3RK2B 5SWZA 3DRTB 2B77A 3LDBC 4P4RA 4Y4FC 5GGUA 1ONQA 2V9RA 4OZHA 4PBDA 1FFNB 1DVFB 4AQ8A 2LLGA 2GCYB 2VLRA 3BQUC 1LGHB 5FWQA 2JIXA 4YX2L 1JRHL 4YDIL 1XGQA 1KFGA 3ML8A 1P7QA 1FVEB 3QXDB 5HDQL 1DO6A 1FHGA 1OIPA 4KVNL 4JBZA 3NDYE 1S2EA 2DH3A 4LLAA 1MJUH 4M6MH 3W0WA 1ZS2A 2ED6A 4KV5E 5CCHC 2ZP0T 4OCYL 4M6NL 2Y36H 4ODBD 5CEZH 1RH5B 4TUJB 4FS0A 5CWSA 2F7RA 2ITDB 5AOIA 3TTYA 3GZKA 1F8TL 4M4RB 5FR3A 3B5HA 3QZWG 3HR5A 5JHDD 2X2YA 2E9JA 1KZQA 1OCOB 3ZHDA 1XCXA 2Z1KA 5AW5B 5DR5L 1ZHBA 3UYRL 1EO8H 4MXQD 2WQUA 1YEGH 3DYPA 2I27N 1IBYA 2F8VA 2UV3A 5CLTA 4OLEA 4UQ3B 1KOAA 2OJEA 1EZVE 5LAXB 1U3ZA 5ITFA 2WTRB 2VJ0A 4D8OA 4OLZL 3GMNB 1INEL 1EDKA 1DE4B 3T2OA 4ZPTA 3C12A 3ZDZF 2QKSA 5HDLA 4KQ4H 4NCDA 3LIZA 2CIKA 1KXTB 1GGYA 3DROA 4AI7A 3UBXG 4LLDB 2HG5B 1S7UB 2R29H 1XGZA 4R0LC 4P06A 2AVGA 3BZFB 4A2GA 3H1ZA 1WRFA 2VRKA 1BFVL 2Y2YA 5TDOA 1JPST 1U2CA 1VQ5P 4IRSD 4FHKA 3EHBC 3ZZQA 3KPNA 5EIVA 3UAEA 3BRTB 4PP1C 1EMTL 4YBLC 2QHRL 3C9NB 4DEUA 5GS0H 2DYPB 1A7QH 2ZSVA 3S9DB 5DSCB 3FQRA 2WB7A 4ZS6C 4GOSA 4IOIA 1A8ZA 2UXVA 1UM6L 1EEQA 2MMXA 3UC0H 2EIZB 3HS0C 4LSPL 1ZLDA 5KBMA 3TZVB 1N18A 3ALWA 4W9LC 4WSJA 4ICWA 3MODH 3L72G 3RTQB 4YFLI 3C5ZD 1ZLUK 4RSVA 1AMYA 4QJ4B 5E8OA 4FQCH 1PP9E 2XXMB 3AE3C 3BC9A 4AT6B 2ADJB 3BHBB 5C3TA 3KJ6L 1GYAA 3C09B 5CIPH 3FF7A 3L3OA 1X22A 1HESA 2R1YB 4KTDH 3D52A 2FNWA 5DHVB 2CDFA 2OXGB 1T0MB 3U59A 1RF1A 1P84I 1DDHA 2NY2D 1EDLA 4H8WC 3AZUA 2HZHA 1JGDA 1BXVA 1SOQA 4IYKA 5JPMB 2WLMA 1HEZB 4BGLA 5L88L 5FYKL 1E6OL 1LT1A 1A6AA 2WPGA 5J6GA 3DOSB 2HWZL 1ZRTD 3N0AA 4HWZB 1ZJBA 1Z9NA 2J8UF 3OX8B 4ASVA 1LNUA 4HV8B 5CZVH 5TE7L 5CLYA 2VWEC 3SDDB 4K5OA 3MUDA 3Q3DA 1H8LA 4WFHE 2DLFH 4GQQA 3QZWB 2H88C 2ZUYA 4PJIE 5J12B 3CFCL 4ZUUB 5BNXD 3OMNB 1ZMEC 2JVUA 1OW8A 5LKNA 3WTXA 1F02I 1XGYL 3DTXB 3EJRA 1TJHH 3OR7A 4NX0A 3UC2A 5EIIA 3L95A 4UT6A 2X3AA 4XP6H 1F3JA 3LKRB 5CGMA 5D1ZI 1LTBC 3UJIH 4L18A 2AI0H 3OAYH 2FJSA 2WWMC 2FSEB 2A83B 3RTQD 1JUFA 1TT6A 4U1KB 3UYRH 1WTGT 5KJ7D 4AUWA 3RTQA 2OSYA 4TNGA 4UDTB 5KVFH 3HC0B 1L0LD 3VMXA 4PD4K 1QX8A 2HX8A 2EDQA 3IVKA 2X1PA 2FR4A 4OCRH 2ADJA 5JIIA 4C55A 3V0VA 3D39D 2H6PB 1K2DA 4NHUB 3MNMA 4PTUB 3HR6A 3V0EA 2V9TA 1TTUA 4TULL 2BIOA 4EAEA 4G3YL 1Q2NA 3JWDC 3LXBA 4XPAL 2K9JB 4AYCA 3IYLW 3TBWB 4ZMQA 1HEJC 2R23B 4RFNB 3FT4A 3DA0A 2P24A 3F7KA 5E2WL 4Z3IA 1HL5A 1JGDB 4JQIL 4MNHB 1KCUH 5DJYA 1FSKC 4XP4L 1E3FA 3AS2A 3NIDF 5EFIB 4ZMZA 3QPQD 4KNSA 2VN7A 3GHGC 4I1RA 4ZAKA 2AZUA 3R4RA 2FHFA 4PYHA 5I1KL 4GAFB 3EJJX 4LVHB 1JVLA 1HCYA 1YSOA 1CGSL 5E9NA 4JO8A 1GYCA 4OCXL 1PBYA 1RZFL 4YXLL 2B1HH 4ZUUA 3SN6N 4I2XB 5B1JC 2X6VA 1X5XA 3MJ7B 4KKZA 5K59F 5TPWH 4KO5A 4XBPA 5JHLH 4W9JC 5BZDA 2TAAA 4J3XA 2Q3AA 3DVGA 4MDJA 1IUZA 4XXWA 4PS4L 3V5DB 1HCVA 3P0VH 1WT5A 5EBGA 2BS9A 2IZ0A 4R2GD 3WIHH 2CMRH 1NMBL 1IX2A 2Z35B 2P58A 2BVEA 3RYMA 1EEYA 3GJEA 4F8LA 3FTSA 4O9BA 4EUPH 5IHUH 1JUFB 1MIMH 4K55A 1JD7A 4U3SB 5F97E 2UWJE 5FLUA 3S37H 2B4CC 1MFAH 5K69A 1D6EA 4R97C 5HVGB 3IF1A 5FF6B 4F8OA 3FQ4A 4M7ZB 5IR1B 2HKFL 1JM0A 4U1IA 2Z92B 1CFNA 2ZOUA 4RIRB 4UYQA 2ROYA 1UZ6F 4FG0A 2QVFB 1E67A 1D5IL 2X4NA 5D5ME 1J1OH 4WU5B 2H5UA 4KITB 2AXTH 1BWMA 4RJTA 1MCNA 1G4RA 4JZOA 4O2FB 4ADJA 1XF2A 3ZTCC 1OGAD 1OHQA 4QD2E 1LEKB 1NTKE 2HWZH 2W94A 1RURH 2MWCA 3N0PB 2VWEE 2ESVA 4ZSOB 2P8MA 4TVPH 2G4GA 1DANT 4IW4C 2F8IA 1KIQB 3ZKNC 1ASOA 3P2TA 3Q1EA 4XNUL 3BUYA 4L1LA 1FVEA 3KWUA 3FT2B 1I1FA 1MSPA 2R2BA 5B7FA 1A6ZB 4IRZL 3VI3E 1KZUB 3TJHD 5BQ7B 5I66B 5BO1H 2M26A 1SQXE 3EYVB 1OCWL 4FTVE 1UVQA 5FM8A 3S98A 5I1DA 3G6AA 3HPJB 4JHWL 5HPMB 1ZA3B 3CD4A 3UTQA 5JYLA 4PJDE 3EBGA 1OWAA 4JVUA 5HYSA 4PP1D 5FDWB 5MENB 2VLJA 3T4AB 1UYWH 1XIWA 2V2TB 1FDMA 5ADPH 1CGWA 1UCBH 4RMSA 2NY0C 4YDLB 2EO9A 1YEEH 3AT9A 5E70A 3C8VA 3L08A 3VXRB 5C0GB 2ZP8A 3RLSA 1WQVT 3VMAA 4XPBH 4YSPA 1G7QA 4NFCA 1DE4A 3MFFA 2XG5B 1B3JA 1G7PB 5J1TC 1FFQA 3QI9D 5JIKA 4C4KO 5GRXG 5I75C 2E8ZA 4DT2A 4L5FH 4ZZKA 4KJQC 1IEAA 1WFOA 4N3TA 4HUMB 5D4IA 4Z95H 1OX3A 1IGJA 2JE8A 3DURB 3Q48A 3GMMA 4JQIH 4PRHE 1ZLVK 4F20A 4PJGB 5IHLB 1HYSC 4N28A 5CIPA 3UACA 3HNSH 1GGCL 5FECA 4OFPA 4UQEA 2ZWKA 2VAJA 3BP4B 2X4OB 2FE0A 5KS9E 1KILA 2P1JA 4ONGL 2OTLP 3LIEA 2QSIA 2J71A 2UWEE 2IOOA 5SV3A 1FG9C 2DQEH 2YEVB 4X7TA 4IOIB 4W9FC 4E68A 4JFFA 4LIQH 2YRLA 4MMXC 4NQEA 2BCCG 1QI3A 4KJWC 1HXMA 4LCWA 1MRCL 3DOHA 4LP4A 4EUPG 2EEFA 3I3EA 1QVGO 1GYVA 3MRJB 4YDJB 2WSEH 1ZLUH 2F1EA 1S4XA 2NY3B 1PZQA 1SXSA 2Z64C 3V55A 2BY1A 5E8EB 4K5NA 5H8DA 4YE4L 1MOEA 1OM3H 3V0FA 4G6FD 4S2SA 3SDYL 1M56D 5H94B 3RKPA 3L3JA 4DHLA 1QSFE 1PPJE 5MENE 4XC1L 1HJBA 2IAAC 1ZY9A 2X2JA 3IDNA 4KWUA 4Z7UE 3LJ3A 4L9DA 4RGNB 2OR9H 1PIFA 3W56A 4Y16B 1WP6A 4XA4A 3IKCB 3VD7A 2KZ1B 4E9VA 5EZIL 1LGVA 1TNMA 2UZIL 5IB4B 1F4AA 4N26A 4A2EA 3G5XB 3HUJB 4PCYA 43C9A 2K3RA 3TGUJ 3AADB 5ANME 2CK3H 3INUL 2NY7L 1HYSD 3DVNB 1A9VA 1T0NA 1FPTL 3LXCA 4JE0A 4FJYA 5E6IB 5FYLE 2NTSP 5BVJB 2P5EA 4FQXC 5KYWB 1N3NA 1CGYA 2BVUA 3OJ2C 4PU2A 5JW5B 3P4OA 2RB8A 3RK2C 4E9LA 3FBQA 3UMNA 3P0YL 4AX3A 1S7WA 2PXYB 3OKNB 3EYOA 1ZIBA 1Q1JH 3FUIA 1ZGLP 5E56A 1U2HA 3CVHB 1XH1A 2BSTB 4XCNB 3P2BA 3RDTC 1NC2A 3QEQD 2XKMA 5FV1L 4N5UA 4R0LB 1VFMA 2JI3A 2IWFA 4D0DB 3GQFA 2HCZX 3KLKA 3LQAC 3U0TA 1TSRA 1JVOA 3FB7A 3M1BB 2VUKA 4ICXA 3WJJA 5FYJE 3SE8L 2WCGA 5JIQA 1QLRB 3PHQA 3NRQA 1P84H 2BSED 4WGWB 4XNDA 2ADIB 3O41A 4KJYA 2F0CA 4ODTL 1CXEA 1S9WB 4NP4H 1VA9A 4PSRA 3TV3H 2QEJA 1GTWA 3AREA 4PGZA 2EUZA 4AQAB 4X9HA 4WLCA 5FYLL 4PGEA 5T5FL 5KUMA 4FQPA 2QMKA 2APVA 3PE9A 5AZEH 3F8UB 3H1IE 4MD0B 1GSMA 2OX5A 3LNHA 3WNKA 4OVNF 2X70B 1SQPJ 5SX4H 4WY4D 4NQTA 3QDME 3HRNA 3CMOH 3I9IA 5INCB 1BQUA 4WVRA 4S1DC 1JBJA 5CZRA 3MPCA 4UNIA 3JV4B 2JCCF 4H13B 3CTTA 3N91A 3WUZA 1T6BX 4LL9A 5K9QG 1WA2X 3C09C 4WHYG 3RWIB 3H1HG 5GTHH 1IO4A 3O8XD 3QJHA 4FNTA 4XMLL 4R5VA 3FQWB 1U3JA 4PTTB 3P9MB 4HKJB 4HJ0D 1WLHA 5PAZA 2ZCHL 3HC2A 4MCYB 2W60B 4IDJH 4E9SA 2ZJSL 4N8VA 3G9AB 4YZFF 1H6FA 4NQXA 2KS0A 2JF1A 1I53A 1IBGL 2CXGA 1CUOA 4Y9BA 4DQOL 2IBZI 2HH0L 3OG6B 3U9WA 1BF8A 3EO1B 2IEPA 3EZ8A 1KEMH 1AP2A 2I85A 1E3XA 5BQDA 3NEEA 3T04D 1U21A 1KYOD 3AE6C 1H6TA 4Y1TA 4QHMA 2ZUTA 1WC7A 2AV7A 3FXDA 1E5UI 3O9WB 5DEZA 4PGCA 1EUUA 1MRDH 3RVUD 1DEEA 1NJ9A 5JORB 2E7CA 1G7MA 3L72J 4HOMA 3FGAD 1L0LK 4G9DB 1NIFA 1F4WL 2GJ6D 2AJZB 4ZUWA 5E2VL 3AEEC 3RA7L 1MCBA 1D9KC 3PAUA 1HBWA 4KZCA 2XVBA 5C0DB 5JPMC 4NN7C 5EFWB 3HPLB 3B4NA 5CSZB 4OCNC 5AW6B 3LQZB 4B9GA 2ZT9C 2APWA 2VO8A 5DTFB 1J5DA 1XL6A 2X7LB 3EFFA 3DBSA 4AEEA 1G6VK 4DZBB 2PWDA 5D2NA 1QFOA 4GT0A 1JY3N 1Q9OA 3NJVA 2BSBA 3DRQB 3VGEA 5CEZE 1CL7H 2R2EA 4WWKA 3ZMEA 2EE0A 5FPIA 3QDJB 2XNAB 5DQ9B 2QSCL 3WLWC 3QEHB 1BLIA 3LCYA 4QHKI 4PJEB 3L70E 1BPLB 2XU9A 1UD6A 1THAA 1NC4A 4IKJA 4UB6E 2J6WA 1SQXG 4H0IA 2DWYA 2COVD 1AQDB 4TLUA 2WKLA 2M3BA 2YAPA 1G4MA 3TH2T 3T0EC 3VXMA 1KTDA 2JP3A 3HLAA 5G2NA 5IB2A 3TF4A 1RUKL 1YMHA 4NC2B 3T3MB 4A7GA 4P49A 5DO2D 1EZVX 2OBGA 1MQ8A 3H6JA 3RWDB 2R0ZL 1EV2E 1NTKG 4OF0A 4JHAH 1INQA 2A3TA 3KXFE 1DEEB 4KDWA 2JKSA 1WZKA 4LLQA 5IHHA 2OQQA 1SN2A 2XTJD 4C47A 2NZ9D 4Z7OF 1KC5L 4EI6B 5A3ID 3U83A 2ZKHL 4ENED 1YPZE 5DDHB 1ZV8A 5FO9B 3LKPA 2AJXH 2CBOA 5CIPB 5IKCB 1JZEA 1GJWA 4TUJA 1CWVA 2UYLB 3VA6A 4X6DB 2Y7NA 1OTSC 1J8HA 1BZ7A 3TNMA 1HJ0A 4N8PA 4X6BA 1DVUA 3BDYL 3ARQA 2ICWA 2BP8A 2ZOKB 4L4VE 1BZQK 1J9TA 1KIUA 4LOEA 4PCTA 3VJ6B 1DSWA 3ZSTA 4UT7H 1NCCH 4MNQB 2GSGA 3Q8CA 4Y5YA 2BEZF 4GBXA 3B5GA 2IGTA 2W83C 2MQGA 4BZ2L 2MQ0A 4DK6A 4D9LH 3C5JB 1Z5LA 4WKXA 3JV6B 1BE3J 4N5ED 4XI5C 2FY8A 2B4CH 2IOIA 1X5KA 4M6OH 4EOWH 3GC3A 1A66A 5E5MB 4OU3A 4YTPC 2XXCB 1KN4L 4ZQTA 3BH4A 3ATAA 1KV3A 5D1QC 3FBKA 4UM9D 1T0PB 4KO9A 1JZHA 1W80A 4Y4HD 1LNUB 2J73A 3C2AL 1ECZA 3NIGF 4HV8A 1ES0B 5KSVB 12E8L 5BZZA 4F91B 1OAKL 2HTKD 4TSBH 4PJHB 2C9NY 2E5YA 5CLXA 1J1EB 1BYPA 1KZYA 3PHOA 5C08B 1AGBB 2DM7A 3GTVA 2FBRA 4U6XB 1H3PL 4K8RC 1E4XH 4LLUB 5BS0D 4LNRA 3EJUA 1WZAA 4IL6H 3CSTA 4ODWA 1EZUA 4JFFD 3J07A 1BJMA 3HUJE 1QFUL 1CXLA 4JZJA 3FQXA 4Z78A 4BYHA 3R2PA 2K78A 2LU7A 1PZSA 1N8ZA 2ZOWA 1UCTA 5ISZE 3LV3B 1T66C 3VXUA 3UG5A 3HE6D 2JLPA 3BSGA 2XCMC 3E2HB 3FQ2A 1HHGA 3J8F7 1MY7A 2NUTA 3S36X 1IFRA 2R51A 4MJ4A 1UZ8B 4PJ8A 2AV1B 1KIUB 3WXVH 3VD3A 2UUDK 3QHZL 3PGCB 3S5LG 2KYVA 4Z7VB 2QSVA 4KH9A 4GBXB 5ECJE 2AJVL 4I85A 4NSKB 3TT3H 1P84K 2I1JA 5T1KA 4DKFH 1ETA1 2V17H 5KAFH 4HHGA 3W39B 2XETA 4I9XA 3IU3B 3KYNA 3G5WA 4B9PA 4F8QA 5ACZB 3MTUE 3BWUC 4JMNA 4PRBA 1BD2A 1U6AH 5IGXH 3QEUA 4IM8A 3N43B 2IH3A 1G87A 2DJ4A 4ODUB 5GISL 3QEQB 4AY0A 4I1PA 2YMXL 2MH4A 1NFIB 2AQ1A 2NR6C 1MZYA 5CHNB 4XP5L 1G1KA 1PQZA 3RVUC 4EZJA 4OGYL 4Y1AB 1DVSA 2B9AA 2SPZA 1UFUA 4NC0B 5EUOB 5CD3B 4ZS7H 3VD0A 1FFOB 5G55A 1QVOA 1YECL 5GJSL 5JIHA 2OL3B 3US1A 1SRDA 3TN0B 2AEFA 4L8CA 4WSKA 4TSCL 3VH8A 1B4JH 2AKRB 4ORGA 4Z7NB 4Q9QH 2KC0A 1FZCC 1QBAA 1WA0X 4IRSA 4PJ9A 4M6ML 3T1FB 3SSGA 2O6DA 1AMXA 7FABL 4DP6X 3SO3B 1RY3A 3L37A 1UWXK 4YSAA 5J9PA 4NQSB 3A67L 5I76A 5FO7B 1MRFH 2IAMD 1RUML 2JWDA 5F7BA 2AV1A 1DUZB 1I3VA 1ZT7A 1D6EB 3LKSA 3DSFL 3ILEA 3QIUB 3IVKB 3IN6A 1YJDC 1AKPA 2OQJA 4KNQA 2KSEA 5T1MA 4Y99B 3GSUB 3GSXA 4QXGH 3L5XH 5HDOA 3G5YA 3HE7B 2AAAA 5INDB 1KY7A 2J88H 3OKKA 1A7PL 3CVHL 3D05A 3FTGB 4TUOB 1FVDA 4U1HA 4OLZH 5HD8C 4J2QA 1B4TA 4MA7L 5ERWA 1PJ9A 5DJ8A 4G8FB 3S88H 3ECUA 5L2KD 4PGCB 3HE7D 5GGRB 2EDDA 4HJTA 3ZE1F 4ASWA 4JRXB 3T9WA 3ULUF 2R29L 5ICXA 1T5KA 3R8BB 5BUPA 1J7VR 2IH8A 1DQQA 4MMYA 4RGNC 2R8SH 1CD0A 5D7EA 2BNRE 3N06B 1NCDH 3NIGB 2WUBL 4L3EA 5JLZB 2FHCA 1WAEA 1I9JH 1XL4A 4G72B 1ZLSH 4LL1A 2WLLB 1Y9BA 1KPUB 1OE1A 1GS8A 1CGTA 4NM8L 2AKRA 4ORGB 4X9YA 2JH2A 1G7IB 1NGMB 5APSA 4IGBB 4Q58C 1VESA 3H1JG 1BXXA 2R1WB 5KAQG 2WC7A 4M02A 1CFQA 3TCXA 3WFEH 3DRQA 3MYZA 3PAVA 1ACYH 2Z8SA 4L1BA 1YUHB 2XWTB 4FF9A 3U6RB 3ETTA 3VB8A 5TK2A 1E6JH 3N41B 3UTPD 5C9JA 5F1OB 4IOFD 3L45A 1YY9C 2MKVA 3GXIA 3BIKB 4LARH 6CGTA 4XX5A 4GIPD 2XVLA 4AKPA 5LN4A 4JO4H 2OQJB 1AOHA 1NUGA 3IDIB 1MAML 2A4EA 1NL0L 5K9QI 3ECVA 1RZ7H 2DQCH 2IDTA 2VXUL 1CXFA 2B87A 3FU9A 3GXDA 3RIFF 1LEKA 3I55P 2CBMA 4K7PL 4NZ8A 4U1NA 2XHNA 4UM9A 2WVTA 2EUVA 1QFPA 1XGUA 3LKQB 3O3EB 5ERWB 3B7RL 2IFMA 2HLAA 1E9QB 1Q72L 1WWBX 4XMPL 1E0OB 3BD4A 5FYKH 4XNYL 5DEGA 3VXQB 3U1QA 1WHOA 1Z9OA 2PYEB 4PJBB 3QQDB 5I8EA 1QFWM 4GIFA 2C7UA 1DQQB 4MMYB 4V33A 3RWHA 5BS0A 4LLVA 5CP3H 1WICA 3LN4A 4DP5X 3RKDD 3WHE1 4I6MC 4X6CF 1G6RB 1T5WB 3NZHH 3MRRB 5APVA 1CICD 3O9WC 2NYYD 3USSA 2WZ0A 3QUXA 4BKLB 5E08H 1VZHA 2A4ZA 4DESA 4WF7A 1S4IA 2WQXA 5F9AC 1N12A 2ZTBA 4H25B 4MB1A 2J5UA 2J43A 5AW8B 1A4KB 3JCUH 5DJ6B 3RX8A 1KYOI 4J3OH 2XKSA 5SWSA 1RFDL 1LEIA 5C0EA 2VLKD 5ANMA 2W9DL 1JK9B 3P8MC 4LGRB 1U7MA 3DSFH 4M62H 2C3GA 1ZHNA 3LYRA 1JZ8A 1AI1H 3HKZA 3RWEB 3DKHA 1QUNA 3EJSA 1G7PA 1TVBA 1NAMB 3PFQA 4WNQB 5I5JA 4TQEL 3ECBB 4GMSL 1GHFL 3DOSA 4HWZA 5FA3B 2OI9C 4FADA 1LT9A 1ZRUA 3P11H 3I3BA 1AQHA 3AUVA 1NCAH 4NFBA 2VMCA 4HGWB 3P4OB 3HS8A 1LMIA 4AYEC 4N87A 3SQBB 4P23D 2BSEA 2Q3EA 4WIQA 1MLBA 4CA4A 2YKPA 3VTMA 1GH7A 5BXFB 5KSBB 3BP4A 3K72B 2M83A 2M5AB 3EFDH 1M1XB 3HW7A 4U49A 1G1OA 5DSCA 3MUDC 4ZZFA 3PWPE 4WKZA 2IGLA 1G5GA 3FN0H 1J9RA 1U91B 4W70A 2YMTA 2EIEA 3CPLA 4LT7A 3DK0A 4PRPA 2EVHA 2EXWD 2EDEA 2WZAA 1FC2C 4EF3A 3G08A 2PCPB 4Q9CA 4YSCA 3VU1A 3HE5A 3LN4B 4D2NA 1T6VN 2CO1A 4YXLH 4FXGA 3NJMA 5EN2B 4PJ8B 4NT6B 4ANKA 2D2CB 3DX1A 1IC4L 5TPWL 2K37A 3WFEL 5DWPA 4CADB 3CPWO 2MNWA 1VACB 3QUYD 5JPNC 4OI7A 1QSED 1MFZA 4O4YH 4P3DA 2XIDA 2OMXB 1JXGA 1OWWA 4U2ZA 4XB3A 1BA9A 1SQPK 4HJEA 4XHJC 2WQWA 1KJ2A 3OAYK 2E75D 4JN2A 3GD1C 2ICEA 3QDGE 4J3TA 2W6JH 2QA4P 1T2XA 1YNTA 1ZJAA 1I75A 2QQKH 4P5TB 4R4FH 2X05A 4PVBA 2Q0ZX 3D69A 4J27A 3TA3A 2N01B 3ZDYF 3X1FA 2EXWC 2AQSA 3V2PA 5E6IA 4KDTC 2I26N 3QIWA 4YQXH 3H3PH 5ESQB 1PMYA 3FQUA 4XPHH 1OVZA 4U4IA 2E3VA 1XF1A 1UHVA 3T0EB 3QCVH 1Z0NA 3ALPA 4R7XA 3WFBL 3DJ9A 3WTTA 4LLMB 2VDPH 4HUVA 3CCJP 1JZ7A 2KH2B 3IMUA 4XNYH 5FHAH 3QDJD 2X40A 1E43A 5EB9A 3G6JA 4MD5A 2VW4A 3HI1B 1HK6A 3LHPL 1CFTB 2EDYA 2CA3A 3QG7H 4NPYB 5J5EA 2R2HB 1AZUA 4Q0XL 3CSYB 5J6HA 5EEUA 5IVXA 4M3LA 3QHTC 1OT1A 3CZNA 3IAOA 1NTKJ 5CCHA 3WFDL 1P7HL 2A4CA 1LO2H 5E9DE 3FQTB 1J1EC 1VQ4P 3FO0H 3ZUCA 3RNQB 3PP5A 2JCCE 1AXTL 1MI5A 3HZKA 4A39A 4JM2C 4QHNB 3L75J 1I1AD 3EFFK 2E42A 2DQTH 4G80B 3H1JJ 3VE0B 2F2HA 1MQKH 3D6ZA 5F8RC 4CAGA 2B15A 2K7QA 2O5ZH 4HEMA 1YEEL 1UOLA 2JCCA 5C0FB 4GO9A 2E9IA 2EYRB 4O2FA 5F1NB 1KUMA 1ONQB 4XWGH 2EYSA 3O9WD 3DHJA 3QUZB 2Z93B 3GMLB 4OZIE 2NX5B 3FTGA 3KS0J 4TUOA 2VE6A 3ZSSA 4F15B 1MVUB 1YEIL 2Z8WC 1KCRL 4BQCA 2APSA 5I6KA 3S3JA 3QUMH 3FB5B 2FZ3B 3OHMB 2OAAA 4YDKH 3H1LJ 2ATKA 3UZEA 4RRPM 1K8DB 4P59L 3L5HA 3V5KB 1OWRM 1BCCE 3HB3B 3ZTJH 4Q6IC 4UB8E 3BCFA 3CFEB 3OLDA 5IROC 3O45B 4JFEA 4XBPB 1JERA 5E4IA 2K3TA 4JANB 1HSAB 2A1WH 5ESAA 4HUXB 3FOMB 3RL2B 5JR1L 3GIZH 2XXGA 4Y19E 4N2BA 4I77L 5F93C 1LK3H 4UTBL 2Z35A 4DGIH 1XH3B 4KROD 4UT6L 4X6CA 4KHXH 2CH8A 5C0GA 1G1JA 1KTBA 1R0AH 4FQIH 4KROB 4X8JA 1XCTA 2YPKB 4R84A 3D51A 4BFOA 2GBUA 2XN0A 4PBXA 4YK4C 3HS9A 1C1EH 1UQSA 3U46B 4Z7VF 3AE7C 3BPOC 3CVIL 3JVGC 4NUJB 1RD6A 1LE9A 3MRFA 3QIBA 1RIUL 4N6JA 4NN6C 2AXHA 3SJVD 4P8QA 1TZGH 5CGBA 3K4ZA 1RF0C 3QXDA 3SQOH 1MWAL 2ITCA 3NCWA 3UTTD 5IJVB 2HVJA 4LPXA 5C0FA 3BVXA 5D2NC 1CDHA 1XHHA 1VQNP 2VN4A 2PR9A 3QQ4B 3SCMA 2R9HD 1C12B 3NJNA 1FGNL 3I56P 4L4VA 3NPSB 4U3CA 5FC9A 5C97A 2UVEA 3I9GH 2B39A 3O3EA 5DJAB 4AGPA 1KIQA 3LEYH 4UNVA 2E7LA 2K9FB 3N55A 4F33A 5D7IE 1N19A 3NIGE 1FDIA 1DBKL 4OVUA 2ZFCA 5EV7A 4Y99C 2A06G 1D9KA 1KJVA 3HE7C 3ABZA 3PV7A 3OA7A 3IS0X 4S1RH 2AQ3A 5FUCC 5E5UB 4F80A 3QEGH 4PLJC 4H40A 4WWOA 5D7LD 1M7XA 3HNVH 4ZW6A 4BZ1L 2XZAH 1HAWA 5B39B 2YXQB 4JANA 1ZVNA 3OZLA 4OIIL 3MROA 2FHBA 3NSDA 3QXVA 4W9IC 2YSSB 4ZYKB 2MCG1 1RERA 5DHVA 4WI8A 5D8JH 2VXSH 3BGAA 1A1NA 3DBXB 2KLSA 4ZT1A 1JGLL 4APQB 4GXVH 3T2LA 1W8EA 1WV7T 2L7UA 3BCCD 1GGBL 2N59A 4L9LB 4F7MB 1MQKL 1Z0MA 5TD4A 4JO1H 1OF2B 2O5ZL 3NJLA 2XTSA 2IDUA 5ISZD 4C56A 2Y1YA 3CZEA 4WHCA 5F9JA 4XN2A 1L9PA 5HHNB 4I18C 3BPCB 1BQLL 2Q8BH 5IBTH 1OE3A 1SP4A 3BRVB 2VL4A 1HS6A 1LO0H 4GAGH 3EGXA 1OCZB 1J5HA 3Q7JA 2B2XH 1KENL 2R4RL 3NCYP 3OF6D 3JWNH 4ZXBC 3FU6A 3EXLA 1JWUA 3V4QA 5IWLA 3CMOL 1IGML 4OJFH 1Q8MA 1IBDA 3CFBA 2WIIA 5IVZA 1AS6A 3FFCA 2FSDA 4G8IA 3UBXI 4B9YA 3ARFD 1J87A 4XBEH 4NRXB 4QAWA 1BOGA 1NOFA 3S8GB 3N3EA 1W0VB 1QLEL 4ZTPH 3NCFB 5DO8A 3D8MA 3T5WA 3IT8D 4I77H 1IKFL 2GFBB 4UT9H 1LWRA 1CXHA 3HUJF 3T2NL 1IBGH 3PQYB 5LLIC 1QNZL 4IGBC 2D3VA 5DVNA 4O02B 1RVFH 5C7ZA 5FB8B 2DBLL 2QMJA 1CLCA 4FI8A 1RIUH 4WFHD 1F3DH 4UB6H 5DMYA 2XNXA 2LV4A 4S0HA 2BRQA 3JTTA 4JN2B 4OZFH 3S34L 2XIBA 2EO1A 3M6DA 2YO2A 1OLLA 4YXHH 1AIFA 5FM5O 1U3HB 1EFQA 5D6DC 4O2CB 5D71L 3IDJB 3JSSA 2P7JA 1NTDA 5JA8B 2V7NB 1CI3M 1SQVG 4GRWE 3VXRD 4PWJA 5IQOA 4WWPA 1DZ0A 1JGUH 1LDSA 3OHXC 5DCCA 5FUCE 1HJBC 4UV7L 1U42A 3GXFA 1KV7A 3QRGH 2EH7H 2WLKA 2XN2A 1SLXA 3BVNA 3RA7H 3PU7A 1NAML 2HFEA 1X0TA 1HHGB 4BSWA 4O9HL 4NHCL 4M56A 1EGJH 3PREA 3T77B 1DJYA 3V7MA 4RO0A 4HIIB 2BIMA 4R4BA 4LCVA 5JHDB 5L8RJ 1W2EA 3PF2A 1X9QA 2FAUA 2VERN 4Q4EA 3KLSA 3WS6A 5K5GB 3OGCB 3NN8A 3FB7B 3M1BA 2VSDA 3JWNG 4MCZB 2P7TB 4WUUA 3HNVL 2VLRE 2X2UA 2X4SA 3OB0H 4KAQL 4OM0H 3ZN6A 1U8MA 3APFA 3L3DB 2E6JA 2P52A 1TUPA 1UJTA 3R06B 4ZMXA 1UXSB 4L37B 1R47A 1Q7YQ 2AK4A 1OTTC 2WBJA 3RDTA 2W6AA 5ETUA 4RVBA 1CSBA 3VXPB 3LH2L 1IAKB 2IPKB 4ERSL 1NJ9B 1X9VA 3LX9A 1DVXA 1LP9E 4QXTA 1NBVH 4LKCA 4A37A 1EZSA 4I4WB 3EO9H 1MDAA 3M17B 3C2SA 2WXOA 3GTTA 4Y1AA 5DYFA 2W6BA 4RWYH 1UEYA 1HQ4A 1AIFB 2Y06L 3MJ7A 3QZBA 3B4SA 3ZDXB 4CC1A 1QVOB 5I15H 3BZ5A 4PLKC 4AIOA 1GRWA 4ENEC 4X9BA 3X3FL 5CEYA 4NO3B 4JFSA 3MRKA 4R2GB 2VXTL 4KXZH 3E6HB 5MERA 4BELD 2DICA 1T4KB 2XPGA 3HMXH 1XV8A 1M2VA 3SJVB 2EADA 4M1DH 3MV9D 4IBTA 5D2NE 5B66E 1ZT1B 4EDWL 1ZOXA 1X7QA 3GZOA 1U8IA 1E8XA 1BQKA 3BAJA 3HFFA 3IFLH 5AVYB 3B2VH 4P46B 4R4BB 4XAWL 1JNLL 2V6HA 4G6ML 4YGVB 4GUQA 4QF1B 4JFHD 4L1SA 4M7LH 2DMKA 1WO2A 2YXVA 2ADFH 3SGEI 4NQVB 15C8L 3PNRB 1ZTXE 2WN2A 3VUAA 2VLMD 2I25N 3L3DA 4LRIA 4JKPH 1OAYL 4AM0B 3IMSA 2Q7YB 5KAQF 2IAND 3Q5TA 1QAWA 2EQDA 1F13A 4M6OL 1P7QB 4F3FB 5C08E 2YSTA 2TSAA 1KN4H 3IE9A 5FYKD 4YHPA 3VYOA 4K94H 3GMMB 1I8LC 3BRDA 2IPUK 2NZ1A 5IREA 5HI3C 1BGYE 2FBJL 4YHOL 1DR9A 4HG4K 3AQYA 2AVFA 3C87A 5KVEH 3HN5A 4MBOA 1ZWIA 2X9ZA 3RGVC 1U8NB 4W9ZA 4PRIE 1N73B 2EH7L 4E36A 5C71A 1FWXA 3ABLB 3DPDA 2ZUQC 5J89A 4OV5B 3P40A 1FOSE 4O9HH 4AXWB 3VFVB 1IT9H 1T22B 2OMUA 1A3RH 3IJ9A 1CFQB 2GEEA 3MRQB 3U4EA 5F7FA 1Z1WA 1CLOL 4GRLA 3BFQG 3A4EA 5DJTB 3BOVA 3JBG7 4PJ6A 1N59A 1OP3H 1OCRB 2A77L 1D5BB 2BHYA 3MLZH 4WCYH 1WPCA 4E0RA 4RISH 1PSKL 1TTRA 4XOEA 1RHZB 2D3LA 3ZT6A 4Z7IA 1LT9B 4JFDA 3WL9A 2NY4C 1S7RA 3H1LG 3JWDL 4YHLL 4MB5A 5L8JB 3LKOA 3OV6A 5KZCB 2ZKYA 1DQLH 3GZPA 3QISA 4WJG3 1WAAE 3G5XA 3HUJA 2IBZX 2QQQA 1J9SA 3C5XA 2UXTA 2Z65C 1YC7A 4MQ7A 5FHBH 5IKCA 4OKDA 1F11B 4MKTA 2G30A 1CLZH 3OM3B 4MB4A 1MCRA 3FKUS 1CLVA 3WEOA 3L4VA 3G6DH 4YSOA 2EYTB 4U1GB 2GSIA 4GG6F 5T1LD 1PD0A 3SOBH 3F64A 4FG6D 3SBQA 3DGGA 4JFPA 5JMOC 3HHSA 3IE4A 5HVFB 3OQ3B 1NUDA 4J3OC 5DD5L 2G75A 5GIRA 4ZMDA 4B5EA 3EGXB 3CH8A 2ZXWB 3IDXH 4KC3B 3E80A 3BPOB 3FQNB 1RE4A 3MJGX 1QTSA 2DKUA 4LOFA 3ZL4L 5I1EL 5IHWA 4FI6A 4UZUA 1T1XA 4GW1A 1P84D 3OKMB 4IBZA 5F1IB 1FZAA 1NU1J 2NNCA 4F57L 2MQ3A 4TSCH 4NWTH 2PP7A 1DQML 4W9EC 1RE3C 4XN8A 4OV5A 1N6VA 1LDPH 2AJYH 2WSDA 4XE0A 1HL4A 4PV1D 1CD9B 1CPUA 4PV8A 3UFIA 3JT0A 2NQDA 3PWJB 4G43A 1AQ8A 1MZ9A 4L48A 1CT8B 2QQNL 1CTMA 3K8KA 3B5NA 1S7XB 2PCXA 3HNTL 5EDXA 5HGHB 1MI5D 5KLVE 1EBPA 2F19L 4DSYA 2IYPA 4QI3A 1S72P 3BKYH 3S4RA 2MPAL 2YD2A 3AU0A 2CD0A 3KGSA 2BRRL 4WI6A 5LBSL 2IO5A 1A7NH 4MCMA 4N3UA 5TQ0L 1CGXA 4CRPA 5A6LA 1FI8C 2Y6SC 3KBHE 4N25A 5GGTA 5AB1A 3KEHA 3CZLA 1R9FA 4H5SA 1YYLL 2PP9A 3HBQA 3WMSA 5HGAA 3GHGA 1AZNA 2J8HA 5LXVA 3NCJH 1CVRA 2EDNA 5I75B 4PJEF 3L71E 3H9YA 3RL0g 3REWB 1IVTA 2ZKMX 3VH8B 4PJFA 1HFUA 2H32H 4XVSL 4FG4A 4G2AA 1EAQA 3WUVA 4LPVA 4FL4B 1M90Q 2HLFD 3VXUB 4U1LA 5K9KB 3K7UA 5JW4M 1PAZA 1BFOA 3JWOC 5A2LH 5HBBA 4NSKA 4XB8A 5FYJD 1S78D 4WFED 1V7ML 2XBDA 2N0MA 3GF8A 2ZE0A 3LD8B 5IF0B 4CBZA 2FYUG 1FV1B 2XNDH 3F5HA 2WUBH 4NI6A 3TX4A 3F05A 4A2MA 3VRJB 4F9PC 1AHMA 2BLFA 2COQA 2AJSH 1UH3A 1A3RL 4LAQL 2XOTA 4QHNA 1PY0A 4PGEB 2B5IC 1DJGA 4XP1L 4EI5B 1VZGA 1F18A 4ZTOH 4J3BA 4LCCB 4QY8B 4KQ3L 4MQTB 4PJAA 2ATPB 1N7SA 3C8KA 5EC1B 5CJ0A 4LHUA 3LZFH 1FVDB 1PD6A 3QZMA 5KLIC 4WY7L 3VFPA 1UZGA 4HIXL 2AEPH 4JPKL 4Z3EA 2PO6A 2NLJB 5KN5A 4GNKB 2W8ZA 3ZDXF 2BINA 3EFGA 4YMPA 2DTMH 1I7ZB 5AVXB 1QNIA 3QXTA 1W0YT 4E41B 3V0HA 2VZVA 3TN0A 5GSRB 3RL1A 2P42B 4WI0B 4GRLC 4PJDA 4DETA 2ZP9A 2WBKA 4K15A 2YAQA 3CD6P 4PP2A 3GSNH 1XD1A 3WN5C 1MF2L 5C7XL 2QTVA 3K2KA 1CLZL 4DP0X 4HUVB 2ITDA 4PD4I 1EUTA 3HJEA 3B9KB 1H6EA 1NAKL 3IGFA 4L3EB 1IFGA 3GMQB 4IHBA 3M9QA 1HQ4B 4G71B 1I7TA 3NZUA 2Z34A 3B83A 3MI6A 3RNKA 3ZO0A 3SGJC 1G9MH 1SHXA 2WUCL 4TL5A 5DS1A 3ZL4H 5I1EH 1KCWA 5EU7E 1EDYA 1Q9OB 3L73D 5B8CC 3B2PA 3VFWA 4ZX4A 4U3FJ 5TFSL 2CRYA 3MUGB 4YSTA 1XGRB 5D1ZA 2BO0A 2FIKB 5A2JH 4GUCA 4ZK8A 4JY4B 3HG3A 3CVDA 3PAYA 5E4AA 1T80A 4JY5H 2DRUA 1LDPL 3NZHL 3STZA 3ZR5A 1WTLA 1SFDA 3QH9A 1KGIA 3MXVL 3KPOA 4XVJH 5CJ5A 2YWYA 4JPVL 4EQ2A 2O5YL 3MGOB 3PJNA 2OYPA 3WDHA 3EUUA 4XPFL 4X8XA 2QQNH 3D9AH 1VL2A 1D5MA 2JWYA 4OF5A 3TO4A 5DUBB 2WT7B 1PJWA 2W9DH 3SDAA 1P5UC 1MW3A 3MREA 1YITP 1R3JB 3QC6X 4M62L 3C9NA 1QHPA 1CDIA 2NXZC 4GLRI 2NPSD 4U3HA 4HS8H 1YDPB 4ODVL 3DECA 4QKTA 2NY6C 5JNYB 1RU9L 1HCFX 3RFZC 1DANU 2A6JA 3P11L 2IH9A 1AC0A 1W0WA 2F7QA 1FFPB 3FONB 3QAQA 4FNUA 4C7NB 1U92A 3GNMH 4OUUA 5EC2A 1UTDA 4MRBA 3CHSA 5I0ZA 4DZBA 3RZCC 3B2DC 3DI2B 5J13B 3OXSB 3VA2C 1FZOB 1TKWA 4HJJL 4JKMA 3MLYL 5D6DA 3N7NA 3KPEA 2Y5TA 1Z9SB 4NLAA 1NUNB 3HE6B 1K5WA 1W72B 1WD9A 2IXQA 3UOAB 4BSVA 4H13C 5F88A 2KZKA 4NUMA 1ECYA 2AITA 1IC5L 4H2AA 3BQUA 3MVSA 4XZUB 2VITA 4RLDA 4S1QL 1FUNA 1LD9A 1R46A 3BDXA 3HOGA 5CJOH 3BCCE 4NQCB 2ZVNB 3AAZA 4JG5A 4NBXB 3UTZA 2IBBA 3FS9A 1JEKA 3LQMA 1WK0A 1VCBC 4E41E 5IB3B 1KTDB 3FRPB 2HAZA 4FXKA 4C56E 1GMIA 2O6EA 4QCIB 4YUEL 2QM8A 2R69H 3H6AA 4Q6YA 5EF1A 2OYKA 1FDLL 1JN6A 3OX8A 2JEEA 2J21A 2JKRM 2Z31B 3TH3T 1BIIB 3BZEB 1NLDL 3VNZA 4HS3A 3KXFD 3W5NA 2ADGA 4WY7H 5D1XD 7PCYA 4LC1A 5LHDA 2RQ8A 5KBDA 1ZE3C 4TNWF 1MCLA 2F5BL 2RAMA 4UQDA 4ATWA 1JF1A 2EXSA 4HLJA 5DFVD 7TAAA 4APXA 5I8KH 5CN1A 3PJLA 1EHXA 3LRGA 2Q1EA 1QFHA 3TDKA 1SVZA 1T5WA 2J8OA 3RRQA 3FU8A 3SYPA 4AQ8C 5C70A 4WKZB 3BHBA 2X89A 5D96C 1TJGH 2I32A 4LLVB 1D9KB 4LVNB 4CVZB 1LO3H 2PGDA 1VRSA 1A21A 5A40E 3QCVL 1LEIB 4FQHA 5F89A 4DZ8A 5DJCB 3WEBA 3JVGA 1IKNA 3V0WL 4BK5A 2FATL 3TVMD 3WFHA 1PP9J 1ETZA 5TF1H 1U8KA 2Y1VA 2I9TB 3NGBB 4RDBA 4FERA 5TFSH 5FA3A 4KK5D 2ITAA 2HA1A 2W0FA 4KDTA 3P73B 4EDFA 1Z5HA 3CH1B 3PWJA 2V37A 4DKEH 5KJ7C 1AKJA 4DPBX 2GUOB 5AW3B 3A5TA 1X5MA 1AXTH 3ARGD 1GL2A 5HGBB 3L95B 5IESH 2DV6A 1QSEA 3AJ7A 1M9WA 2FH8A 1B88A 4X99A 4ZMPA 5DZOA 2OCJA 2V2WA 3BVVA 5DZNA 1K6QL 3NSXA 4ODVH 2ED9A 1MCPL 4U1KA 1HIML 1UA6H 4IGBD 4FLQA 4TPRL 5CCHE 4K9EH 3L75E 3RDJA 5T5FA 2YKKA 5FOBB 2BCKA 3O4LA 3W1ZA 1JDCA 4PM1A 1NIEA 4ONFH 2YEQA 4RMVA 2VC2B 4TM9A 1QLRA 3DUHA 3PHQB 5LBSA 1L9SA 3CDGA 1I7RB 4K3DL 4TXVB 1BVOA 1IC5H 2ARWA 4PVLA 3MJ9H 2W80C 4PJXF 2ENSA 1XTCC 2BJML 2KDGA 2QRXA 1GOGA 2J25A 3EJYC 3L74G 1E30A 1DVTA 1SQPD 3SBRA 1P7KB 2QJPC 3C08L 1WD8A 1S8DA 3ZHKA 1B2WH 2VXVL 3ABMB 3T6ZA 2KNCB 1S9VA 1TTCA 3QH3B 3ARYA 1NPJA 5I0DA 2R69L 1J0JA 3O2WH 1I4FB 3BASA 2IIJA 4UBDD 5HYSG 3MV7B 3ES6B 4YHKL 2BK8A 3DX0A 3ARBA 1NTZE 4H0LB 3D69B 4L3CA 2Q76A 5IT2L 4PGBB 1V27A 2V4LA 1MHCB 1F8TH 2I7OA 2Y4SA 1S78C 2HP4A 1AE6L 2EEDA 1BWWA 5F72S 3JV0A 3MV9E 5ESQA 2NY4B 1DFBH 4OGQC 4HCGA 5AYTA 1K8DA 4WFGE 3OBAA 2NZ9C 5I74C 3WXWH 3CWGA 3X1EA 5A3IC 4K5PA 3EOAA 4U6VL 3T1FA 4CN1A 4Y19A 2AXFA 2DLHA 2IBZD 1DL7L 4ELKA 5JLZA 5F6IC 2PO6D 5MEOA 1OE2A 1XR8B 1F4YL 2V5SA 2J6EA 1S7TB 2ICEC 3QQ3A 1HWWA 1T04A 3PL6C 1XIWB 2W81C 5DO2C 3RVTC 3WHXB 3D08A 2MJZA 4DVBB 3LRLA 1KMIZ 2AQTA 4ILDA 1AD0B 1H15B 2B16A 2CJ3A 2HG5A 2UZXB 3P54A 5EU4A 4PD4E 3HC3L 4HX1B 2R1XB 2FJHA 3D25B 3V0WH 4DP9X 3PS6A 5ICZB 2IALA 1BMZA 3HI5H 3O0RL 3AXIA 5JW4N 2ZYIA 2WXKA 1FFNA 5ICUA 2A0LD 3SDAC 1OPOA 3EOTL 5BPPA 4JRFA 3PG2A 4L37A 2WO2B 2QFPA 1MI5B 3HZKB 3R19A 5K33A 3SE3C 1VAHA 4RGMB 5IQ7L 4AM0A 4QLWA 1YNLL 2BPBA 3T2PA 2R7EA 2ZSVB 3WIHA 4QGTA 4OFDA 4ZFFA 3WUTA 5TJHA 1JGVL 2DBJA 4G6KH 3DPBA 4H1LB 3WNOA 4L3ED 2C1OA 1T8ZA 1XZ0A 4BCYA 3BYYA 3LPWA 1ZKAA 1AFOA 3UC0L 4GBXD 1L9RA 5D1ZC 3KXFA 3PV6A 3K2MC 4FOMA 3MRLA 4G9FD 1F42A 3QIBC 3B43A 2FBOJ 4KY2A 5KW9H 3MRKB 2ZUSA 2B5IB 1AD9A 5H2FE 3CLFH 4EI5C 5I6MA 1MCPH 1OARH 4L8DB 3KYMA 4NUQA 4JFYB 3HRZC 3SYAA 4U2YA 4DEPC 4Y19B 3OPUA 1AHKA 2E47A 2VXQL 2A7BA 4Y4HA 3H25A 4N78E 2CLZB 5DD0H 5F7YC 3S97C 2OULB 5D7JD 3WDJA 4DGUA 3ESUF 3TN0C 1Y0LA 2LAGB 3V52H 3K1DA 4X7DC 2GJZA 1QQDB 4N2OA 3TH4T 3ZYIA 3ETSA 1XCQB 4QO1A 4RFOH 3BZFA 2KIKA 1NQBA 3NRFA 4XNBA 1LD9B 4Y4KD 4DJMA 5LB1A 5E24E 4NIKB 4PJ0H 1KB5A 3I3DA 4P57B 2FYVA 1UWEL 5TE7H 1NTZK 4DF9A 4GKNB 4I0PD 1HOCB 1NH4A 3ZDYB 5E95B 43C9B 2XZQH 5EORH 3D3VD 4HU8A 4OZHB 1KYOE 3AQDA 2DJSA 2VZ1A 4H8UA 4RZCB 3UPAA 1FORL 1HSBA 3PJSB 1YJ9P 1XGYH 1QWHA 1HHKB 3GMPB 1FOSF 5FLVA 2CJUH 4ZD3L 2VOTA 3HG1D 4CC4C 1IJ9A 1U91A 4C7RA 5DS2A 1P2CA 3FUKA 3DGGB 2WXRA 1TO4A 5KSBA 4PG2C 4WY4B 1DHKA 4LKXB 1AJYA 3DLQR 3LRSB 4ALAL 4B27A 4YDJA 1NC2D 1HDMA 4HXBL 3C8HA 1NGXA 2GBAA 2PW2B 5E9DB 2X12A 2R29A 1NM9A 4LLWB 5KOMC 4WK0B 1IARB 2H6UA 4HEPA 2CO6A 4MQXC 3G6JF 4YZWA 2DYRB 4QEGA 3VFTB 4TQIA 1CE6A 2EUWA 2OJZH 4X80L 3VDBA 5I1IL 4X4ZA 2ZCKH 1I7UB 4QWWC 4PJEE 1P5UB 1A1NB 1JFQL 2YFNA 3DBXA 2XTJB 4MJIB 3GMNA 2BVQB 1CGVA 4OQTA 2VZ3A 4B6ZA 3WIIL 4NHCH 4OQ1A 5E5MA 5AAWA 5E7BA 2BZDA 4HJSA 5ILTL 4R8WH 3KW7A 1LLAA 5FYJU 2J6EL 1E4JA 2Z8RA 3ARTA 1NA8A 2B9BA 3FB6A 2BVOB 2EUXA 1CFSA 2VISB 2PTTA 2W0FB 1X9UA 2OTWB 1J9QA 2WZ5A 4QMEA 5D93C 3RZCB 4QXVA 5J13C 4HGWA 1USQA 5DMIL 2VDLH 3F7VA 3LKNA 1W72L 3VFOA 4PV9A 4XH2B 4QRRA 3I6LE 3L3OC 3U0WH 1SQBE 1JI1A 2UX7A 5A7BA 3KJ4B 4IIQC 1J2JB 2JK5B 4TN9A 3ZTEA 3CCMP 1K04A 1ZR4A 2QSTA 3LZOA 2CR0A 1KGUA 3QGVA 3RURA 4J1UA 1C5CL 3C1LA 2E7DA 3BPCA 1X5HA 1KYAA 1LEGA 3NG5A 1NBVL 3CN0A 5SWZB 3I75B 3L6FB 3LSOA 2CMRL 3CSBA 5KZCD 1MN4A 5J4MA 1BYNA 3FWNA 5KW9L 3QZNA 4LOUD 2JI2A 3VFNA 1A6UH 4PJ5E 4LDEB 2Q7NA 4APQD 1A0QH 2X2HA 2D7PA 4DW2H 2DLTA 2IDCA 4L4TA 1CFNB 2CM6A 4NN5B 2XBZA 4J23A 3K6DA 1OZUA 4JM0A 2ZWYA 3D85A 3GZQA 1KILC 3T65B 2BEQD 3H1HE 4AQZA 3DHMA 1Q0XL 1SJHB 5DC9B 4DKAA 5LGKA 1RPUA 3N85L 1BVKB 3HMXL 4UQAA 1YN6A 2PYFA 5DF0A 3K3QA 2M8XA 3RNQA 1D7DA 1R5IA 1FIGH 2NPLX 1L5GA 3U4BH 3EJYD 4ANWA 4P5RA 4RDQF 5DUPH 4ZMLA 1UWEH 4H8HA 3DUUB 4Y1AE 2EXYD 4KKBD 1U8JA 4G7YL 5FB8A 3GXPA 4K2UL 5EPMB 2Y2WA 3BGFC 2PTTB 4AQRD 1K72A 1S3KH 4P2AA 4H44D 1EFXA 4K7PY 4FNLL 3QFDB 1AZVA 1PEZA 3MR9B 3E1IA 3J27A 3ATDA 3O6FC 1PPJG 5AD0B 1VGEL 1UXWB 4JKPL 1IV8A 2HFTA 3A6BL 3L4UA 4CU8A 3VD2A 1KSRA 1U33A 4HQQH 3LQZA 2CDEA 3WO4C 1HU8A 3P1VA 2YNYA 1WBYA 5D7SH 3KM1A 4UILL 5ADPL 3IJ8A 3GHEH 3D06A 2OK0H 1U8PB 2XQYG 4WTZA 3QNYB 4GW5B 3CC1A 3CQQA 4DTGH 4LVOB 5FO7A 3CBJB 3H42L 1T7ZA 3SDAD 1P84J 4UZGA 2VERA 4PS7A 1WH0A 3KHUA 5GS2H 3GSUA 3H55A 3ARWA 4FJ6A 3R18A 3WG7B 3KPOB 3PPSA 2NXYB 2A06E 3MUJA 1UWYA 4Z95L 3GMAA 3U46A 4R5TA 1L6ZA 3FSAA 2WPQA 3LW5H 3LS5L 2KUTA 4PHZA 1XGUB 2HPCA 4C4UA 1F58H 1WAAF 1L5GB 3NGBC 2ALAA 1IK7A 3LZRA 1MJ8H 4DEWA 4R5XA 4I9WE 1DBAH 4MZ2A 5HDBE 5AOZA 4B7IA 5IFAL 1KGJA 2ICWI 4YDNA 2HYNA 4ACTA 2KS1B 4KRLB 1O0VA 4YS4A 5ES4B 1QI4A 4M6AA 3B7SA 4P5TC 4WO0A 3AS1A 2OSWA 4A7SA 1N0LA 4XI5D 4K9EC 2XPYA 2K1AA 1PDKB 3ZHNA 5DA4A 3LDBB 4ZXBD 2WLLA 5DLML 3BD3A 1OB1B 1R3HA 2DDQH 1X7TA 2ZOLA 1DN2A 1Z9MA 2VDKB 1JDDA 1SJVA 1KC8Q 2D7OA 3VWKC 1N5YH 2EO7A 3BQUB 4HIPA 4RGNE 4HLEA 2FEJA 2R1WA 4BV1A 5F44A 2B1AL 5IJKA 3KYMB 1AC6A 4BUGA 3IFMA 1JHTB 2A6DA 4YIQB 4Z7NF 2PPCA 1AGDA 5ITFB 2GEQA 4M43H 3FU0A 5FKAB 2FX8L 3BKMH 4G8AC 4LSRL 3NTCL 2FFDB 5DRNA 3UX9B 4L3FA 2CKNA 5IMMA 3ESOA 2GBVA 2K7PA 3PWVA 4Y8DC 1R33A 2Y9ZA 4ETQA 2AQNA 4NO5A 5EU6D 1ZT4A 5EBLB 2GAZB 3WY2A 4QRSA 2I8DA 1MJ7H 1T7YA 5I74B 2AW2A 2FL5B 4HIJB 1RAMA 1ES0A 5KSVA 1OW0A 4NENB 4AM0Q 1YEFH 4A7UA 4BM7A 3L9EA 1L0LE 4ELDA 1VDFA 4KT0J 3JVFC 3LN5B 4JFDE 5DUBA 5APXA 3SQBA 1RE4C 4RMRA 4Y2NA 1SHSA 1HNFA 1HSBB 3V6ZB 1UIXA 1L9NA 2BSTA 1M56B 1YDPA 3OKOA 5CBNA 2L8AA 3BP5B 3KPLB 4ZX6A 2WMPA 2MPAH 2Q20A 1VCAA 4LZKA 5LBSH 2P44B 4M3HA 4CN6A 3A7OA 1IZKA 2V3EA 3CHQA 4DKDC 3DSNA 1YN7B 4LRIC 4HQQL 1ED3B 4UM8B 2HT2C 1IJDB 1BM7A 3NFSL 4OR1A 1FNSH 3NCXA 2BCMA 1L9QA 2Y24A 4GO8A 2BCCD 2XFXA 3TU6A 1QSVA 4NP4L 2GITB 3TWCL 3GBNH 3TV3L 3Q1MA 1A4KA 2J8UA 2X2IA 3IGLA 1WCBA 2A9MH 3QDGA 1U95A 4PWEA 1I9RH 3OKLB 2OX5B 2OR8A 3B9DA 1C08B 3O6FD 5K5YA 2ICEB 1DBBL 4JM2F 2Z7WA 4MNGE 1TQTA 2EE9A 1T0NB 2L3BA 3SPIA 2G2NA 1P4IL 3DO4A 3ISRA 4WI3A 1QLFB 1TQWA 4LAQH 1Z9LA 3MAWA 5CP7A 5C6PB 3VFGL 1IGCL 5HHXH 3ZDXE 1UWGH 3EYSH 4M3KB 3MNWB 4QIRA 5CR1A 5DRXB 2FJFB 1ET8A 4P23B 1OF0A 3CZSA 4FULA 1DBAL 2OYHA 3AM8A 2IBGA 3CFUA 1DQTA 5JIDA 4EYYQ 3HAEG 4HPOH 4JFWA 1JCDA 4X98A 2I1KA 4LQFL 5DZPA 1P4UA 1HWTC 2OSLB 1KJ2H 1CW5A 2HLEB 3VFSA 4ZOEA 5J6HB 3NA4A 4N0CD 3SY6A 2O61A 1K73Q 2G2PA 3ZDMA 1AP2B 3W82A 25C8H 3LTVA 3A0HH 5FOJA 3TCTA 3BCDA 1URQD 2JJWA 2GI0A 4ZFGL 3SDDC 4PJCF 1ROCA 2ENPA 4UM8A 5HYJA 5KTEL 4QHMB 3ZIMA 2CHZA 1IQDB 5H2BB 1FRGL 1UOVA 2HT4C 4XNXH 3O2VH 1GW6A 1DX7A 1J1XL 2WXFA 5KSUB 4MTMA 3FSOA 1NU1E 4Q14A 2P10A 2DKMA 4HEPG 4MMXB 3PQYA 3B5NB 4XMKL 2VH5L 2KHAA 5D4QA 1RULH 2WK2A 4RFEA 5D6CA 3MA9L 1NGPL 4CMMB 5KJRL 5E8NA 1WCBB 4FZ8L 4FMKA 2AJZA 4JAMA 1NCTA 2VIRA 3QWRA 4QTIL 1F4WH 4PRDA 1A4BA 5EC1A 1NVOA 1FZCA 2YD1A 2CG9X 4WY4C 1FH2A 1M1JC 1L0NK 4HWEL 3T2QA 1ZEAL 1H0DB 1DLFL 1YEHH 1MZZA 4OLWL 4HEME 3CFIC 4MA3B 1A5FL 5HHVH 4JY5L 3AXLA 1SQQJ 1PY9A 2PYED 1IGFH 2ZX8A 1XTGB 4PGJA 3PGDA 5KVGH 3SKMB 5DD3L 2NPSC 3AUWB 2E6QA 4KTEL 1KJ3H 3EOAB 5CMAA 5D1QA 4NC1E 1BQ5A 4JMXA 2UZYB 3OC5A 4FKKA 3G71P 2O5XH 2OKMA 1JOIA 3TC9A 3GUTB 1I1CA 3BW9A 5TDNB 3LQAH 3QEHA 1NTKD 1LHZA 3U6XA 1ADQA 4XNAA 4I18B 3ALXA 4IGBA 3N40F 4Y5XB 2X4TB 5JUEL 3ATFA 4EVNA 4RBPK 1OSYA 2RJMA 1MIEL 1M4KA 4J2XA 3B37A 1BOYA 2AK4D 3GNML 3RDTD 4TS6A 4XODA 4KU1A 3GBNL 4WK2B 1SQXD 4GI8A 5G5DA 4ZO9A 1GTNA 1VEMA 2DIAA 1KPRB 2BMKA 4HS6A 2WKOF 3I50L 4X7EC 1Y47A 2Z92A 1H9VA 3F85A 4XMZA 2DI8A 1MG3C 3FZUC 4RQQB 4Q8BA 1QSZA 3CC2P 4NGHH 5H37H 5DR5H 4Z18A 3HB3D 4EZMA 4ZDHA 3VDAA 4OF3A 2XTJC 1J0ZA 1RPKA 1LE5A 2WVVA 2NRDA 2ZYRA 4Y7MA 2C8NA 3NH7H 4HCFA 5EU3B 1GGUA 1IAIM 3HPLA 3PGFL 4N8UA 3GHBH 3WKNA 3WUWA 3CWBD 3OD3A 1LTSC 5CJ8A 4UTBA 1A7BA 1MJUL 5EIQA 3N4XA 1DD3A 1PU0A 3H1KJ 3BCCJ 5I23A 1WFIA 4JO2L 3WU1A 4MAYC 3E6HA 3QJHB 5MERB 3VGAC 1XTMA 2W0KA 1AY1L 1L0YA 1SFHA 1E40A 2H8PA 4FG6C 3PP4L 3OJDA 4XVOA 4CDGC 4R96A 4KQ4L 3KJ4C 1LTIC 4W6YB 2XWTA 2Y72A 1UM5L 3HE6A 1WFNA 4XWOD 2BOBB 3BQVA 4P4KC 5E8PA 4KJWD 1J1PL 5HSFA 4H8WL 3BIAX 3ESPA 2HPOA 4K3AA 4PREA 1IM9A 1SVBA 5BZXA 4ZFGH 4ZYKA 2V3DA 3ROLB 3FO1B 4BCZA 4JPWL 1IRAY 3EO1A 2L5GB 1V54B 4JFHE 5DXWA 2I24N 4BQBA 1KB9H 5DD1H 3MKGA 1VQMP 4OIFA 4E42B 1QSFA 4WQOA 3MACL 4KI1A 1S6NA 2P5EE 4ANXA 2BIQA 2WGNB 3DJTA 4KFMA 5KVMC 3SCMC 4FXKB 1JZ5A 4TQPA 5IP4A 1SQBJ 3UZVA 3MREB 3KZ8A 2WIMA 3SDCC 4K73A 2YOAA 3LNGA 3L4ZA 3N44F 4X2UA 2VJ8A 4M61B 3DMMB 3L72D 1LQBC 4G9DA 5I1GH 2R4SH 5D72H 3JUYA 4X5LA 4FLOA 4XN1A 3H1KD 2A99A 2V8MA 4AQ1B 5LN8A 3UPRA 3T0DA 4L76A 3CQFA 1A7QL 1BJ8A 5IJBC 5C0BA 4WNJA 5FECB 3INOA 2N1TD 1BGYG 3ARGB 3Q3GB 4KTDL 4DKEL 4CNIA 2GY5A 1YG9A 3OKEA 3CNKA 3LNIA 5E2TL 1D6VL 1RF0A 4LSPH 1FL5A 3D4YA 1JIBA 4C7NA 1U92B 3BXNB 3BGMB 4NQEB 3GUFA 1BDDA 5F1KC 3RIKA 5EO9B 1RZQA 2OJEB 4A7QA 4GODA 4MJ2A 1YN7A 4UQ9A 4YBQD 4PJ9D 1V3LA 2YD7A 4DKFL 4HH2A 4LPWA 3I84A 1P5UA 3W39A 2KQNA 1KLGA 1I1YB 4MJIA 5F88B 3C6LA 4OGQD 3CFQA 5F3BB 1OGTB 2YN3A 3CDZA 5ALCL 1KXTA 3CFCH 2HRHA 3KLDA 1WIUA 3O6ML 1BD2B 3DX7A 4GDOA 1KB9E 2JJVA 2MCPH 4LASH 4QRRE 3VGFA 3TNUB 2ADGB 3BEWB 1E27B 3CUPB 5DMGD 4WDIB 2NXYD 2BY2A 1E6OH 1R3LA 3HVDA 2YPLE 4AEIH 1JPEA 1FBMA 4R83A 4PYGA 1LTJB 1SM3H 3MJ9L 4OZHF 1RJLA 3EH2A 2HG5D 3BVTA 4J3OD 5GRUH 2HT3C 2ZPKL 3E0GA 4KKAC 1MFDH 3N1QC 2FJUB 2KZWA 5B4MC 4QYAA 4IIZA 3AQXA 4KMQA 1JXDA 4HYTB 4DQAA 4JREC 2V9QA 3FCBA 4X5WA 2G3NA 2HTLC 4MLSA 1ZLWH 4PJ5D 3W5MA 1EJOL 4N0UA 1XIWD 4Y0GA 3CXDL 3G08B 2MPVA 1CD8A 1FNHA 3AQZA 3GRBA 2NY1C 3MNVB 1OLZA 3TBSB 5CGTA 1BDCA 3ZKMD 1QR1A 3PXLA 4ZFOB 5IBLD 1J0IA 1IGTB 1X5FA 1P84E 2AI0L 4WI5A 1JE6A 1VACA 2G3ZA 1RZIA 1XB8A 4N4YB 3N42F 5GS0D 3WXWL 5AKTA 3FQTA 4MJJA 3BAXA 4XN9A 2QR0A 4WU7A 1JY2P 4PR5B 4H8WH 3M9BA 4YWGH 2OYHC 4OD1H 4U7KA 3II3A 5F3BA 4N2AA 4NQCE 2EDFA 4KTYA 2FWOA 3H0TB 1JWMB 3D0VA 1IAKA 2IPKA 4PIRF 1A3LH 3FCSB 2FO4B 1MI5E 3BJLA 3O0LA 4BZ2A 1GYWA 3O3DB 3OG4B 1E4WL 1E2WA 2C0XA 4PRNA 3M06A 4JCLA 4YO0A 3Q9QA 3UTSA 3UYPB 1ULVA 1FAVA 3ARDD 4NZDA 4LLMA 3D87B 1A25A 5D4JA 2PWGA 3DOIA 1GR7A 5F7EH 1TZIB 1URZA 4U7JA 3NFPB 5KAIE 2V7NA 1JK8A 1OAZL 4HSQA 5HI3D 4CJ1A 4NO3A 1MIML 2JO1A 4R9HA 1HEHC 1KXQE 2KXPB 3W2DL 5GHWL 4DUVA 5GGQH 4N2FA 3SD2A 3MJ9A 5IEHA 3F58L 3KWXA 3ZK0A 1MCCA 4WFEE 2OZ4A 2H0PA 4LCUA 3BISA 4PS4H 4AL8H 4MN4C 3HD7B 3K6SB 1F2QA 1RP9A 5CFHA 3BESR 1FCCA 4L4TB 4P9ML 1J8RA 2FYUK 4OZGB 3FC8A 2R1XA 2QKIC 2JCWA 4WO4D 5J1AA 5JXAH 5AZUA 3TCLB 3EXJA 4PJAB 1XSKA 5IFHL 5JHLA 1NFDA 3MRBB 4RRPG 2QIWA 1TXKA 3WMPA 2EDBA 1PIGA 1SDYA 3RUGA 3VG0H 3ULVD 1Q9KB 2CM5A 3BKJL 5AOKA 2PO6B 3DVIA 3ES6A 5DJYB 2RIKA 3KWWA 4QHLB 4JHWH 3GSQA 3IPEA 4RBPH 1GC1H 5DC2A 5HHPB 4DFIA 4GAJH 5C6WH 2KDYA 4LMQI 2M0BA 4Y2DD 1QW8A 3DYOA 2IMMA 5IIEA 1YMME 4O5LH 4JDVB 2DQJH 4JN1L 3MV7A 4H0LD 4LSRH 4DUXA 1IFHH 1SQVE 2XZQL 5EORL 5C0DA 3KLHD 1BPVA 1SF3A 3ARDB 2GTWB 1DBJH 1I7TB 1IC7L 4LPCA 2AANA 3M7OA 2DF3A 4ZMTA 3B5NC 1M3JA 2OL3A 2WZPA 2C26A 2YZ1A 1L0ND 4I0KA 4FKHA 3VRIB 1I31A 3MLUL 3OC8A 4HIQA 2FWUA 3KYKL 4HGMA 3OWRA 1TR7A 4NRYA 4NQDD 4IMKA 3EYQC 4QPEA 3KPPB 4BFFA 1NTZG 2AJ3A 3JWNC 1JK9A 5FW8A 2O1KA 1BGYJ 3AT0A 1LNQA 2ZCLH 3GKZA 4ZOBA 1CF8H 3WFZA 3QIUD 3WAJA 5J3HD 1ZT7B 4IBQA 4DH2A 3BP6A 3GIVB 4W9GC 3TTSA 1R5VA 3TVMA 1OANA 1MREL 1E5YA 5I1LA 1ZSDA 4NAMA 1S7RB 4F8NA 5K1NA 2FL5A 4HIJA 3VQ2C 1GW0A 2C7FA 1T7WA 4JZOB 4NQQA 1SDDA 2VLRD 4HJ1A 4UM9B 4F2MA 1EZVY 2Q7YA 2OZNA 3OR6B 1P4BL 4L5FL 1MRCH 5CLWA 1QZ1A 3T6XA 2IDFA 4JG1H 4EUPA 5IBUG 2NNFA 2BVPA 1A4AA 3O8XB 4OI9A 1FZGA 4R8WL 4JFZH 3W3BA 3VWKA 4QOKE 4ZW3A 4N6RA 2UWEF 2GSIB 3HNSL 3SDYH 2WLIA 1O5DT 4HMDA 2WSFH 4OT1H 4BRYB 3TV8A 5DMIH 2V9UA 7PAZA 3CWBG 3IB4A 3BUPA 3U0WL 3IJYB 3H1IG 1IM3A 3GDBA 5FM5M 2PMZA 5FDYA 4OLUH 1O5PA 3UIZA 1OMIA 2KZJA 4WUUD 4YL4A 3D07A 4XZUA 1PYWA 1MVFA 3CX5J 4JO5A 4N8CL 2XWJB 2W9EH 4QRPE 3MRQA 5AUMA 1KN7A 1KCSH 4Z7UF 4O4YL 3KPRD 2CLZA 2Y7MA 1U93A 3VXOB 4E5XG 1GGTA 5EZOL 3X14B 1EXUA 5FYJL 3KW8A 1EO5A 1XAUA 1YUHA 3U6RA 2X6MA 1YNTB 3L48A 2FEEI 4LRNL 1XMEB 4E0RB 2X9WA 3BN3B 3IS1X 2Z7ZA 4NWUH 3CK0H 3MBEB 4YPJA 1FJ1B 1GL2B 3EJZC 1CFSB 5HGBA 3CX5E 3BKJH 4MBRA 3NCBB 1NTKK 2GIMA 4NRZB 2QPUA 1Q0XH 5LDUA 1BD2E 3BDBA 4PG2A 3KPNB 3WMM0 2OMVA 4U1NB 3FN3A 3V0AC 5HYJD 1PP9D 1ZTMA 1YNKH 2QE7H 4M7LT 2ISDA 4EUPB 3QPQC 4GUPA 2IFGA 1UJ3C 2P8LA 2P8PA 2GIXA 5C08D 3AACA 1QL2A 1CN4A 3MBWA 4JJ5A 4Q0XH 4D7BA 2HRPL 3VU2A 1RP8A 1YI2P 5LXGL 3DO3A 1J18A 2PCPA 3IPFA 2C3VB 5AB0A 2BWQA 3KYOA 1VQKP 3N04A 1BGYD 5FYLH 4U3FE 3ILDA 2NXZB 1C5BL 4LKXA 1PZUB 5IF0A 4B95C 1GS7A 1KT2B 2YUWA 1SXCA 4Y89A 5JMRA 3R7QA 4K35A 5I30H 5DRZA 3U1SL 1U8CB 5I8OL 2Z7YA 2F68X 4QRUA 2GITA 1OFCX 3LNEA 3ASNB 4JR9H 4TNVK 3SE8H 5EBMA 4JCMA 1JMBA 5KYUB 1JTHB 2BFVL 1G5AA 1T1WA 3RY4A 1PVHA 5H37A 4LCYB 5I9QC 4WSGA 3T4YB 3GHEL 3QC5X 4PY8I 3T6VA 4ATTA 4Z7UB 4DPCX 5IB4A 2ZX5A 5EU7C 2WBJB 1U8QB 3U25A 1FH5L 3BAYA 4YLQT 3PIQA 2VDKL 2VDMH 3RX7A 3MLVL 2ZCHH 3S4SA 4HLZG 3H0TA 2BNRA 1PG7W 1PP9G 3HMWL 2C0WA 1GS6X 5C0RH 5KG9B 5T3ZL 4FMFA 1P4BH 2B3RA 5IQNA 4DVRL 5I0YA 4XP9L 2QKIA 3SDXE 5CHNA 1P53A 2Y0DA 2ZXDA 3SGDH 4P23A 1LWJA 1X5GA 1ZGLA 1SNRA 3D50A 4IBSA 5CD3A 4GG8B 3GM0A 3ULAB 5CEXB 4KK9D 3S9OA 3E6FA 4OI8A 1FVCB 1H3XA 4JM4H 2WJ7A 1X3DA 3NOIA 4LSVH 4WI9A 3OHXA 1ZS8B 3H7BA 5ANHA 1VSCA 2GJPA 3V8CA 1VADB 5I5IA 4NNXA 5L2KE 4PWHA 5BV7H 3FO2A 2P7TA 1V5JA 2P47B 1FNEA 1XCTB 2YPKA 1X5JA 3CDGB 4KHXL 5IEHB 3BH8B 4HUCA 2EIMB 1U36A 4FQIL 2DQHL 2VDNL 2AHIA 1O9ZA 2HH0H 2VAAA 4YGVA 4M5ZL 1K85A 2CPSA 4ZX3A 1R5WB 3RY6C 1FFTB 4PRHA 4NHUA 5ITBH 4MJHA 3PDOB 1N5YL 2DLFL 1QWNA 4NQVA 2XN1A 1UEMA 1A9BA 3KPQB 5TGBB 4YE0A 2B1AH 4JFOA 3HAEH 1B4RA 2P3YA 2WWKO 4PJ8C 2F54D 3W0WB 2IF7A 1RZGB 1FZCB 3GSWB 1WWAX 4ZFOL 1MLCA 3BKML 3RU8H 2VYRE 3UJTL 2N3JA 4LSSL 2X4UA 2G2RB 5HJ3A 1OSEA 3IXAB 5J7CC 5GSVB 2L04A 2HVKA 5HI5C 3WI9A 3TA3B 3DTUB 5BUGA 1JPGA 2FLRT 5GSRA 3RL1B 1F4XH 5KLVD 4WI0A 4DP2X 4KRPD 3NABH 3CX2A 5AL8A 2OMWB 5E9AA 4U31A 4HD9A 2AGJL 4B53A 4ZMYA 2IBZE 1DO5A 3PV6B 5KVFL 3ZUNC 1S7TA 2A73B 5MENA 5F7DA 5BMFH 5TH2A 2E74C 1CO1A 1AD9B 1N0XH 1QZNA 1U8LB 1RUKH 4Y2DA 2L0DA 4TULH 5I73C 5KSBF 3GLDA 2CUMA 2Z4QA 3QP3A 3DV4A 4G9FA 3EYFA 5F0JB 3DK2A 4AJ0A 2F53D 1RHHB 4TTDC 1N2RA 3EO0B 2E7LC 1EC5A 4PRAA 4ABVA 2E46A 3NFSH 1OGAA 3KDPB 1K4CA 3SWFA 3GT6A 3SDXB 2Y6TE 4Y5YC 4JO1L 3ME0B 5DK2A 4RIRA 4ZFFB 1JV5B 1SXZA 1MKMA 3JSVC 4P57A 1YUKB 3BDYH 3WIAA 1I9IL 4Q7DA 4W4OC 5IVOA 5E51A 2B1HL 3S3SA 2G9HA 1UOWA 2L7EA 4OTXH 4RRPA 3CCEP 3U7WL 2D03L 5I19L 3FAXA 1CFMA 5C0RL 5HGGS 1BW8A 3O6LL 4G6FB 4PJIA 3UBFA 4D9LL 3CCUP 2WIIB 2HLAB 1E9QA 2BASA 1Q82Q 3LIZL 5I6NA 1IE5A 1L4AA 3LPFA 4LLYA 4C58B 2ZG2A 3SB3A 3ROOB 1R3KB 2D2OA 3MRPB 4TLKA 4L8DA 3FQYA 1IGCH 5HHXL 3B7TA 4IQHA 2H8PB 2ZNXA 4G8GA 4GSQA 2ESVD 1SBSL 1MH5A 3BVUA 1AQ5A 4HOXA 5IMKB 3WSQL 4CSZA 4E9WA 1O75A 1TFHA 4JQVC 5IW1B 2XLLA 5EO1A 4JFEB 3GSNB 1XQ4A 1DEDA 4ZQKA 5H35B 3C6LB 1EDJA 4OGQB 4NOBA 4UT9L 4BZ2H 3BT2L 3CCLP 1E50A 1USEA 2A9NL 5CKGA 3UTOA 3VB9A 5IB5A 3GRWA 3Q05A 3TPUA 3EH3B 2Q8AL 2B4CL 4FA7B 1HJCA 3PWPD 4OD2A 3L73E 2LAAA 2R15A 1EXHA 1LO5B 1DQJA 1S5IH 4FKEA 3QI9C 2LABA 3MYJB 4JG9A 5JPMA 3S5LA 2FX7H 4YLBA 3CQPA 3HD7C 1REIA 1NTZJ 4QRPB 2GB2A 2WMMA 1HAUA 5FKPA 1KF9B 3UIYA 4AENA 1RJLB 5FO8B 1T20A 2Z31A 4LP5A 2P5PA 3C2AH 4QRSB 1JWSB 1JV5A 1KTLB 1JGUL 4X9IA 3RU8L 1OQXA 3UJTH 1JJUA 3FHQA 2HVJB 1JF5A 4YDMA 2EIZA 2VQTA 4RETB 3IFNL 1EH9A 2J20A 5HDBB 4RMTA 2A83A 5E1IA 4OFYA 1T0OA 4HWEH 4FRWA 5C0IB 4UDTA 4W80A 2C9VA 1XDTT 1OOWA 1I8KA 1F3JB 4HCRL 2Z5HA 2BCKB 2K3HA 5BRZD 1S7VB 2QVMA 4OD3H 3CC7P 1IAOA 1HXYA 4DPRA 5LDSA 2F1AA 4IBUA 3B9KD 4DCKA 2VT0A 5EU6B 4MJ5A 1R19A 3HTKB 5KVGL 2OTKE 1R8EA 4QNPF 2R3CA 2BERA 3V4UH 4JKLA 2E8YA 1BVKA 1PGOA 5LGHH