5AW4B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw4B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw4B02
5APTA 3WGVB 2R5BA 1HUCA 3TK1A 2YO3A 3P7KA 3VMZA 1DH3A 5AW8B 1GD2E 2R32A 4DZOA 2XV5A 5AW4B 1CZQA 2W6AA 1G2CB 3IR9A 5AVUB 3M9HA 4AQRD 1H8AA 2ZXEB 4JYCA 3NFQA 2E43A 1A02F 5AW3B 2H7HA 1HWTC 3HE5B 2Q7CA 3V4WA 2Q5UA 5APQA 4LC1A 2VRSA 3O8ZA 2IPPA 3P32A 2P7JA 4XE5B 2C9NY 3VMXA 1J2JB 4GKGA 2XZRA 3P8MC 3L36A 2WT7B 1FOSF 3TYYA 3A7OA 3KDPB 1SLQA 1MUUA 1FAVA 5AVRB 3A5TA 1S9KE 5AW6B 1HJBA 5APYA 2E42A 3M0AA 3OAKA 3T97A 1SP4A 3M0DA 1CSBA 1HBWA 2Z5IA 3M9BA 3NXSA 3TNUB 4C7NB 1GTWA 2P67A 2ZFCA 3V4QA 1JNMA 1T2KC 1YYCA 5CMZA 3L37A 4HYTB 3HE4B 4KHXA 4AYCA 4B86A 5AW7B 5APVA 1GZLA 3HE5A 2XU6A 4M3LA 3VMYA 2QM7A 3LIEA 4GT1A 5APUA 4C46A 1GK4A 4RESB 1CI6B 1NAFA 1KQLA 5AVXB 3MD0A 4I6MC 3VYIA 2P2UA 3SWFA 3A3YB 3B8EB 3MGNA 3L35A 1H89A 1CI6A 5AVWB 3UIAA 1IO4A 2WT7A 1MV8A 3V5BA 5AVSB 1GK6A 3LIDA 3VTPC 2WWWA 5AVVB 2JJLA 5APXA 2C9LY 1GU5A 1H88A 3M91A 1S9KD 1OWAA 3KQGA 2WTYA 3I5CA 3VN0A 1GU4A 1OXZA 5AW5B 5AW1B 3TNUA 5AVTB 5APWA 4C7NA 5AW0B 2YNYA 3NTNA 4I2LC 1A02J 3M06A 5AVQB 3HE4A 2KP8A 3A2AA 5AVYB 3WGUB 5AW2B 4RETB 5AW9B 3NMDA 4AUWA 1MFZA 1X8YA 2BASA 2R5DA 2Z5HA 2N9BA 4JYBA 2Q3IA 5AVZB 2WPQA 1JUNA 2QM8A 3HTKA 5APSA 2YO2A 1T2KD 1FOSE 2WPRA 2W27A 2R3CA 4EOTA 2WPSA 1NWQA
chains in the Genus database with same CATH superfamily
4BK8A 2D7OA 3F5WB 3VFRA 1E8YA 2IH9A 1KB9H 1KENL 4GRWE 4JHWL 5IMKB 3QI9B 3QZWG 2JR8A 3IU4H 3NFPA 1KV4A 2QMKA 5CAYB 4OCSL 3A0HH 3QWRA 1P84E 2GI0A 1AGFB 2APBA 3HCVB 4UNVA 4XBEH 2OI9C 4XVOA 5KAQG 2GC4C 3CBJB 3MUHL 5K39A 3B2UD 4G6AC 2DLGA 3MRCB 1ZR4A 1MDTA 2GCYB 4XNUL 2BP0A 2JO1A 1N5YH 2G5BA 1XGQB 2X4PB 5CU5A 1DD3A 3DRQB 5DYOB 3VJ6A 4BWTA 3V2RA 1AGBA 5DHVA 4AEHL 5TQ2H 1FC1A 3AXLA 1CFSB 1NTZE 1PY0A 1G4RA 1P4IH 2PYED 3TFBA 5MEND 2X4TB 4PRDA 2M26A 5GJSL 3T8XA 3P32A 2FBJL 2GTZA 2Z9TA 3ZDWA 2YARA 3EAKA 1HSBA 1AXIB 1E9QA 1ZIBA 2FHCA 5FA3A 1MAKA 4XVJH 4YDLC 1F4YH 3KLQA 2E9WA 5E5MB 4X6FA 3CXDH 4MXVF 4PPTA 5DJ0B 4CADB 4YSQA 1HJBA 5E2UL 1AS8A 1DZBA 3GBNH 4V2CB 1ML0A 1Z56A 1S8DB 1XF4A 5E8PB 4PD4J 2EXTA 2IGFL 4NQEE 1NL0H 1WICA 3NFSH 3PDGA 3T2OA 1UXSB 1A9BB 3P0VL 3IF1A 3K6SB 2DQEL 1T0NB 2WXFA 2HKAA 1EAPB 1PDKB 3EDKA 4ZTOL 2VUOA 4O9BA 2WVSA 1MFEH 3NK4A 5HVHB 4X6BB 1QFWM 1N7SD 4ZMLA 3ARFA 2P8LB 4UYPA 1PFIA 1K05A 1JY2O 1MJJB 2IBZY 5DFAA 5EBMA 3FB6B 1JF5A 1DJZA 1CXFA 3MREB 4XMPL 5E4EC 4L4VA 4P9HH 5FYLH 1DQMH 1HILB 3RLSA 4TVSa 3BPLC 1S5IH 3U59A 2HFFB 4EO5A 5AVSB 3KGSA 5ABAA 4HEPG 2DYPA 3MRBB 4Z7UB 3T6XA 3JT2A 4JFOB 4KPHH 5CZRA 4NJ9H 5DHDA 2Y6SC 4DCQA 2ICWI 2F58L 5IHUL 5I1LA 1TTRA 4BRVA 1ET7A 2WSEH 3QUMH 5F1IA 4L1DA 5IBTH 1BJMA 1CDJA 4NYLB 1CMOA 2NY4B 1NGWA 2XV2A 3BX7C 2Y2YA 1N7SC 3IU4L 4PJ7A 3VOPA 4HSCX 4TXVB 2Z35B 4XBEL 3LKOB 3Q3GA 3SEPA 5I1IH 3HW7A 4CNIA 1EMTH 1WFUA 1NCUA 1CE1H 2Z6FA 1WQVT 4PBWD 4KQ3L 4X6CB 4AM0A 4WSJA 2HMID 4P3CH 2GUSA 1N5YL 1KTLA 1A1NA 1N86A 1X5XA 1OAXL 1OM3H 2VL5B 5DR5H 1S7TB 1SOSA 3ZQ9A 4FQXC 1DVSA 1MH5B 3BP7B 3QNXB 3T9WA 5TQ2L 1JY2P 2V2WB 2VLKD 4NQDE 1D9KB 3WN5B 1P4IL 1ZLEA 5F7YC 1KWGA 2VABB 1QFWH 1J8HA 5I74C 1JY3N 5HYIA 1KJMB 5AVUB 1HVXA 3KW8A 4Z77B 1F56A 4GRWF 5TTRA 3RBGA 5LG6A 1I1AA 5IBLD 3WTXA 2J5LB 4NHUA 1QEWB 3VP9A 4XVJL 3TU6A 1F4YL 1RZJC 1SQBE 5KKZB 4B41A 2V2TB 5BW7A 3CXDL 2VDNB 4PJ7E 3GBNL 4KI5E 2EC9U 2GPZA 2J3SA 4B9GA 3VI4B 1X9VA 2HN7A 3LPWA 3QDHA 5AD0B 3IRCA 5TDPB 1NL0L 3US0A 4JFEB 4OFPA 3NFSL 5DS2A 1HWWA 3L95A 2VXQL 3LPOA 2N4IA 5IR1B 4TNVK 2CKNA 2D9CA 3MBEA 1HH6A 4BH8B 1TVBA 3UBFA 5CZVH 5APYA 1YQ4C 3IE9A 1MFEL 4PWKA 3PJSB 4OFYD 3EYFB 3P54A 2A45H 5IBLC 4YL4A 3HZYB 2YXWA 4JFDB 1PX4A 4NXSA 2OXGA 4GQQA 2EH7H 4OGQC 5FYLL 4P9HL 1DQML 2FGWH 3DV4A 2X2UA 3SQRA 5IUSA 4MLSA 1S5IL 3BCFA 1XIWC 1DQQB 1Q9OA 4AW4A 4W9JC 3FHQA 3NQIA 2BCCG 2M8XA 4KPHL 4NJ9L 4N0FA 4WNJA 6PAZA 2V2XB 2XWJB 1JNHB 1OB1A 4J3WA 2Y0CA 1I1FB 3MZTA 4DFIA 1MLBB 3QUML 4DN4H 5IBTL 2WT7A 3S4SA 4XN2A 1GS8A 5IHLB 4WKZA 2K3RA 2H88C 3L6FA 1UB6A 3MYJA 3M8OL 3DVGA 4ERSL 2JK5A 4F24A 3FPYA 2OMWA 2P9RA 3F65A 1KN2H 3JZ7A 1DJIA 5BXFA 4WI0A 1GAFH 5KANI 1EMTL 4ZOBA 1CE1L 1KPUA 2K9JB 1CI5A 3HR5B 4P3CL 2H0PA 3S5YA 5I75C 3RZCD 4WV1A 1DUYA 1RHHB 1OM3L 4P5SA 3D85D 2QJDA 5DR5L 4ABVA 1J1EC 4GO6B 4TUJA 4QTIH 3X1NA 4S11A 5GGRY 2ICWB 1H8OA 5CZXC 5AVZB 2WPQA 1OEZW 1FZOB 3CDZB 4H44C 2ZAIA 3HLAB 1LDPH 1FL3B 1HL4A 3PGDA 2XKMA 3CFJB 1WIUA 1JRHI 2CBTA 3KWXA 4ISVB 5F7DB 1R3LA 5ACLA 3FYEB 4V1DE 2R56H 1U8JB 1DE4B 3CX5K 1SEQH 1TTAA 4KO5A 3S48A 5GRZA 1SQPK 4U1HA 1KLUA 4POUB 5CN3A 3Q48A 2YEZB 3G5VA 3SGKA 4BV1A 2DS4A 2IBGA 3NZUA 3VJ6B 5C97A 2IBZE 1HNYA 4YSUA 2FBRA 1AGBB 1WS7A 1ZHKA 2NYYC 5DHVB 4CJ1A 5IT2H 2W83C 4ZNCA 1TQUA 2YPVA 2H9GB 2HX9A 3MHVA 3KPEA 4QRAA 1PD0A 3L9RB 3H3KA 1WYJA 3HFFA 1NAKH 4ZAKD 1FGNH 4XVSH 3BGMA 2H7HA 4AZUA 1FPTH 4BE6A 3MJ7A 1PSKH 3HUJB 5EO0A 5JORA 3F58H 2LABA 4QYOB 4MAYD 3AE3C 5CZVL 2IBZX 4Z1PA 2G4EA 1HSBB 4HSAC 1E9QB 4X4KA 3PJNA 3FBQA 4KMLB 2WN3A 4K94C 5BVPL 1OF0A 4P2OA 4JRWA 2K4AA 1HE8A 1FZMB 1A4KB 3HRNA 2NNCA 1XF4B 2EH7L 4HWUA 4XPBH 3VGAB 4ZD3H 1UJ3C 2SODB 5GRYA 2FGWL 3D69A 4OM1H 1KILD 4KI5F 1KXTB 1VQPP 3IF1B 4NKMA 3TIEA 1RF0A 5DSCA 1IFDA 2DQJH 1WT5C 3ZW3A 4GI6A 4LSUH 4BFFA 4U1JA 3SN6N 1M1XA 4BJLA 4ZMAT 3TN0A 3BVDB 3IDJB 3UPAA 4DN4L 5I66A 2DQCH 1L0LD 1RVFH 1AI1H 2BNQD 3QH3A 5EBWA 5F9OH 5CEZE 2ZVNB 2OTKE 3CU1A 4P23D 5KUMA 3TT3H 1WWWX 5EBMB 1GOHA 1SQVG 3SE4C 1KN2L 2Y69B 4UDTB 2H2SD 1YTZT 2BNRD 1GAFL 5CEXB 2Z7WA 1UB5B 3EFOA 4DO4A 1WRGA 2YZ8A 5EO1A 5E8NA 1FDMA 1N0LA 2KC0A 4PS7A 3V4PH 1NH6A 4RNRA 3ARGC 4DCQB 2WP3O 2R1YA 4ODXB 4MDIB 3PWJA 3FTXA 1E4HA 5IW6A 1ZN5A 4QTIL 5CCGC 3N41B 1T7VA 4OZIA 1S9KD 5F1IB 1NGXA 4XMWA 1W8OA 4W6YB 2GJ6A 3HBPA 2B20A 4UT7H 5GIRA 3T0VA 3RHWF 2DEYX 5D6DC 5MENE 1X79B 1LDPL 3FQXB 3PS6A 5IQ7H 2VOTA 2R56L 3VD2A 2AF2A 1T3FA 4Y9CA 1SEQL 4CNIB 5KBPA 4WENB 1UC6A 4AM0B 4ALAC 2EACA 1EA9C 1G7IA 1H6EA 3H55A 3ZSSA 5SWZB 1F86A 5T1LD 1KTLB 4FXLA 1A1NB 1UFGA 4NN7C 4F5CE 2P45B 5IT2L 3S3JA 2GSIA 1X7QB 3VI3A 1VKXA 2ZIDA 2GJRA 2FYNC 3QJXA 4PRBA 3AE8C 2GUVA 2DF3A 1NAKL 4JPVH 2PTUA 2KZIA 1FGNL 1JY2N 3L72E 2EEAA 4XVSL 1FPTL 3WE6A 5EEZA 1PSKL 5E1AB 1Z2KA 3F58L 2JLLA 1MNNA 1ZP0C 3LRSA 1T6AA 4B27A 4XAKE 5CN2A 4PCKA 5JW4N 3N5AA 4ZMPA 4U3FJ 4L8BA 4NHUB 5BJTA 1WFJA 3NYKA 2FB4H 3T1WA 3FQWB 4LK4A 4O51B 4Y1AD 4DEUA 2BVPB 5EF1A 3H9SE 3QBTB 3FZUC 4F1SA 2DD8H 3I6KA 3O9WA 2NPSC 5D2NA 3VXSD 4ABUA 4HISA 3L75G 2BSSB 2HN7B 4NIYE 4Q89A 4XPBL 4ZD3L 3QJHA 3G04B 4OM1L 3U83A 1X5FA 2VLJB 5EEUA 4HU2A 2FJUB 2C9NY 1E5ZA 1FHNA 2DQJL 5HHQA 3PWNB 4HIHA 4LSUL 4Z95H 4K8RC 1SQMA 2IFGA 1HH6B 1ET8A 1UKTA 3VI3E 3E3QC 4ECNA 2DQCL 1LL1A 1M56D 1RVFL 3WEOA 1AI1L 3VXTA 5GS3A 5BV7H 1UYWH 5F9OL 4FHKA 1R75A 2OXGB 2R23A 3A4AA 4LKXB 3TT3L 3QZLA 4OF3A 5C0IA 1MW0A 2QQQA 5GRJH 5CJXA 5MEQB 3DV4B 4TVPH 3RL0D 2BM3A 3JBG7 1Q9OB 4HXAH 4N5ED 2IWKA 4Y5XA 3IM1A 1F1AA 4QKXB 3N85H 3V4PL 3N40F 4DHLA 2A9NH 4FG2A 2ED8A 5HHMB 4PAZA 2CU9A 5B4MC 1UH2A 4LCCA 1XGPA 5EU3B 4PI2A 4QHLA 3ELQA 4GP4B 1YI2P 2EZ0D 5D1XC 3SBWA 5H35A 1TPXC 2D0FA 1KNOA 4UT7L 3CFTA 3HG1B 3PXHA 4XB7A 3TA4D 2V7QH 3MGNA 2WLLB 4WKZB 3L6FB 3DJSA 3FRPA 3MYJB 3TONA 1NUFA 2DMHA 1W72H 2JK5B 3D0LA 3SDCD 2LU7A 3SKNA 2OMWB 4PJ9C 3OA7A 3B2XA 3HMWH 3F7YA 1RURH 4L3EE 1ZAGA 1KTCA 5EEWA 1JZHA 2XICA 4JFXA 4AQAB 3W57A 3WXWH 3K74B 2OMYA 1DN2A 4ZMTA 1XDTT 2F8XC 1J7VR 2E76B 1S5LH 1DUYB 1EANA 1SXSA 3C5ZD 5DZPA 3HD7D 1BXAA 3VFSA 1KGYE 4GRLC 4I0CC 4WNSA 4NC0B 4KKNA 2YUWA 3EH2A 2P52A 1JYNA 4JPVL 1DQJA 4ZPVA 3RPBA 3PGDB 2P8MA 2GEEA 2WXMA 2VMEA 1HHJA 1VA9A 4H5SB 2HRGA 3AADB 2P24B 4G9FE 1CU4H 4L23A 2WPRA 5HGGS 1O7DC 4LSPH 2V5TA 2FB4L 3CGTA 4U1HB 1F1GA 3BP5B 3IXTA 3ZE1E 3ARTA 3G5VB 2GTWA 1UJTA 2DD8L 3CH1A 1BZEA 4APQC 3G3LA 2D7NA 3BZFA 3OM3B 1ZHKB 3T3PE 5AENA 5LXGH 4C8XA 3RFZC 1CXHA 3P4NA 5L8RJ 2P1JA 2FJGB 4GYBA 4XNBA 1CGTA 4EPSA 3RUGA 4JG1H 4F27A 4IOFC 3HNVH 1QVOB 1X5AA 3NK3A 4BWWA 3ORJA 5AWNH 4D9RE 4F57H 2HLOA 3MJ7B 1F4AA 3MLYL 3N44F 4Z95L 3ZE2E 4LBEA 3DYOA 4R96A 1N10A 1RZ7H 3B83A 1F6AA 3G6EP 4IKKA 3NMEA 3UMTA 1YJDH 1IC0A 1SQ2N 3B4NA 2FEDD 4PWJA 5BV7L 3Q8EA 1UYWL 5ID0A 2H3KA 3NCJH 4KK9D 4MVBC 4W93A 1WZMA 1UZGA 4GXVH 5GRJL 3C6LD 3D69B 4NOFA 4TVPL 3QUMA 4ODWB 1BPVA 4NKMB 3TIEB 1P2CB 3FQUA 2ZZUT 2WLKA 3N85L 3QUHA 4WW2B 3BGFB 1R34A 1ZTXH 2A9NL 2ZCKH 3VG9B 4OJDH 4KRLB 3K0WA 1UATA 2PETA 2KZKA 3WTTA 3DX9B 4AGQA 4JM2D 2AEPH 5I66B 3GTTA 1DR9A 3MA9H 4ZUTA 2DB8A 4FE9A 2VDOH 1CD1A 2X88A 3QH3B 3FXIC 4HETA 4UAOB 3ES6A 5EBWB 1FCGA 1EFXB 3QORA 4JZJC 4C4KO 1MCNA 1W72L 1FZCB 3AM8C 1KIPA 4QXGH 3O8XC 1NDTA 3VMAA 3HMWL 1RURL 2EADA 2F8IA 2QPDB 5IQLA 3QUZA 1A6VH 3HE7C 1T7WA 3MV9D 4ZXBB 3SE9H 1KG0A 1ZS2A 3F2LA 3WXWL 4RNRB 5I8OH 4G42B 2R1YB 4D6TD 1LJMA 5IW6B 1IIKA 2LVCA 4OZIB 4N24A 3DVFA 5FGBA 2GJ6B 1NU1E 1FVCA 1NFAA 4P46D 2GSGB 5INCB 4M8RA 4KK5D 1FL6B 4CMHC 4PJ5E 1A1MA 1VQOP 4MDJB 3QQ9C 3MGAA 1M57B 1MF2H 4C7NA 3KLAA 3TO4D 1CU4L 3L4XA 4OZFB 2QJYB 5FIEA 4LSPL 1KDJA 2FCBA 1CVSC 2X6CA 4ZO8A 4CC4C 1V27A 3EHBB 3KYKH 4X5LA 4PHZA 4PGBB 4HVBA 5E51A 4Y9EA 3FHEA 5LXGL 3WTSA 2XPYA 1YN7B 4P99A 3RX9A 1PPJG 1KIQB 43CAA 5F3BB 5E7BA 4M61A 3TCTA 1TJMA 4JG1L 4PRBB 4QUOA 3HNVL 1U9KA 3EZ8A 4Y16D 3WE6B 1G9EA 5AWNL 4F57L 4QMEA 1IGIH 5APTA 1LLAA 3LRSB 4HCIA 5IZ7A 1DLFH 2WYHA 4JJOA 2A73A 4KFZC 5C08D 5KSBA 1CB4A 3K1KC 4L8BB 3GXNA 3QPQD 2KSJA 1RZ7L 2EIKB 1I8IA 1JGEB 4A7QA 1YJDL 4LBAA 1P7HL 1JHTA 3EYOB 4H13B 1GZPB 3O9WB 3ZE1F 1DQTA 3NCJL 5A16B 4GXVL 1KGCD 3QJHB 1H8AA 2DTMH 3OXSB 3HC0B 1FYTE 4J2QA 2PR4H 3T3PF 3QUXB 1MIEH 4KVCH 4KRPB 1L6XA 5DTFA 1ZTXL 2ZCKL 3FO1A 4HIHB 4J3UA 2IX7C 4ABWA 5HYSG 4Y16C 1J87A 4HHGA 4FTVD 4QWWD 4M5TA 4UNUA 4X8GA 4DETA 5EOTA 2AEPL 4M7JH 4E9TA 2ESVB 1UA6H 3MA9L 2VDOL 3VXTB 4CN6A 1RLBA 2R23B 3CX5I 1UTDA 1J0JA 4MNQE 1SBSH 2YKQA 1J9SA 4QXGL 5KSBE 1O6SB 1TQVA 4JCWA 4PGEA 4GMTH 1QFWI 2IDBA 1QBLH 1A8ZA 1A6VL 1NCNA 2ADJA 5TFSH 5I6XB 2WO2B 3SE9L 3N1PC 5I8OL 1OHZA 4BSWB 2H89C 4LCCB 4QHLB 2NW3B 5T3XH 4B6ZA 2VC2H 4XRCB 4E5XA 4XHJC 5H35B 1QABA 5HJ3A 2FR4B 4LOFA 4JGNA 4UYQA 2HVKB 1KMIZ 1A6ZA 3ZT6A 5I0WA 4YXLH 1QG3A 2W6JH 3FN9A 3D0LB 3QWOA 5HJBA 4NPJA 5LBSH 2XY2A 2HPOA 3H6PA 3SKNB 1SVZA 2KERA 3AECC 5B8CC 3GSNH 1MF2L 3F7YB 5EOCH 3U30B 1H89A 2RR3A 5CCHC 5J6HA 4XNYH 4AWJC 3T0AA 4JFXB 5I26A 1F1DA 3GGWA 1P4LB 2OMYB 3DI3B 1JXKA 3KYKL 4DP5X 1A1OA 4KZ0A 5IV2A 1FZAA 2LXCB 3AU1A 4TYUA 3VFSB 5K69A 3RBSA 4M7LH 5F1KC 3VDAA 3I5CA 5E2JA 4NKDB 1N2RA 3BQVA 2ZXBA 3CIAA 4FQHA 2ENPA 4LLDB 1DJYA 4Y8AA 4ZPVB 1MHPH 1IGIL 1R0AH 1HHJB 3W11C 1GSKA 1DLFL 3QJSB 5L4FA 2JSFA 1E4XH 1NM9A 2NTFA 5DMIH 4ZX5A 3ZRSA 4YHZH 4QOKE 3BW9A 3CH1B 3IMBA 1PEWA 4ZPTA 2CDEB 1UWXK 3BZFB 2O01N 4PGDB 1HEHC 2X44D 1IL1A 1INDH 5BRZA 2DTML 4GBXC 3L45A 3D8MA 5DK2A 4EI5A 4GJTB 3VRLE 3RUGB 2PR4L 3WLWC 4EN3A 1N6UA 2JQZA 1PZ5B 3OBAA 2OSLA 5H2BA 3UZEA 1URIA 1PV3A 1OCCB 3AS0A 1NCTA 4HUMB 2FUTA 3IKCA 4HH8A 3WUWA 4LBEB 4M7JL 1F6AB 1UA6L 2P5WE 4PJBB 4X5WB 1BGXH 4TRPH 2NY2B 1RFDH 5L4IA 5LHDA 3E6FA 3KLKA 4FL4C 5ID0B 1BSHA 5IVZB 1SBSL 1I53A 4G8AC 3RY6C 3RJDA 3FT2A 2RHEA 4GMTL 5D96B 3WYRA 4F8PA 2WINA 3LYRA 1EEQA 3MNMA 1QBLL 4KUCD 3U6RB 5TFSL 1U8QA 5FB8B 3ZT5A 4HWZA 4PWGA 3MRMA 4HIPA 4IHOA 5EU7E 1QAWA 3QJOA 4AK2A 5T3XL 5IFAH 2VC2L 3WJLA 3EGSB 3ZHKA 5IEKA 4OCYL 5CLYA 4ZUTB 3T0ED 5TK2A 1CD1B 3QFJB 4FERA 3KNBB 1PP9G 1VFUA 4NFDA 3TZVC 4JB9H 4MRCA 5J13B 5KSAA 2IVFC 4YXLL 5KWYC 3QORB 3CZSA 3U0PA 3CVIH 5DJAA 1UXWB 5LBSL 2P67A 1KIPB 4GH7B 3VD7A 3GSNL 1DUZA 1DN0B 1GY1A 2YUXA 5EOCL 2FO1A 4XNYL 3HE4B 3QUZB 1QSZA 1IK9A 1JOCA 1JWSA 4QXTA 2WPGA 2F19H 5J12B 4JBSA 1M3IA 3TJPA 2AXWA 2WAQA 3RWCA 3C5SA 1OGSA 2PW2B 4M7LL 3VRIA 1PD1A 3AE5C 2VR8A 2Z31D 3N06B 3BWZA 4OD2B 2XXGA 3NABL 5HJDA 4ZFZA 4RBPH 1MHPL 5B1BB 1NEZG 3VXNA 5IFHH 4WFHD 1R0AL 3FQ1A 3SYCA 1HYRC 5F7MC 3CG8A 2X4OB 1QLED 5EF3A 3GS4A 3J7HA 3KLAB 1E4XL 4IDJH 1R4XA 1JMMA 4NT6A 4OLEA 5DMIL 3BASA 1JYWA 2VMCA 2XQYK 5GGSY 1KZQA 2YIUC 3VUAA 2WQUA 4YHZL 4N2OA 3SDAA 1EVUA 4TSCH 3X1GA 3CMGA 4LLHA 1R6VA 3LD8B 2J25A 1VZIA 4MB1A 1INDL 43CAB 1KGXA 4M61B 3D18A 2FX8H 3K2UH 2OAAA 1G7JA 1D5RA 3MO1A 3NSCA 5DZLA 3G6AB 3IDMB 5TD4A 1NEUA 2VITB 4EIJA 4JRYD 4JN1H 4GO9A 2A73B 3N1QC 5I6LA 1RP9A 1OGAE 5T5NG 4P48A 1NBYA 2XZCH 1I8IB 4WWNA 4ZFQA 3LB6C 1EZSA 1BGXL 4TRPL 4JHZA 2WSSH 1RFDL 3QQXA 4N0UE 3FO0H 3UTSD 4P5TA 4LCUB 2EO1A 4LPCA 3P4MA 2XV5A 5AW4B 1K8IA 4U3XA 4MCYB 3H1IJ 5A2LH 3FN0H 4Q56A 2KH2B 1OZTG 4JQVA 5E9DD 5IROD 3Q2VA 2FL5A 1RUPH 4YK4B 5DTFB 2D2CB 2BCCD 1TMCB 1JPTH 1W72A 4F2ME 2WBKA 3Q9QA 4OJFH 5IFAL 2AQ3A 4DVBA 4MTMA 3QNZA 4PJXA 5EOTB 1AQDA 4NUQA 4ETQA 3SWKA 3PWPD 3TNNB 2DJMA 3KL0A 4U3SA 1FIEA 4JB9L 3VFPA 1NGQH 1N64H 3ZHFA 1T2QH 3CVIL 1URLA 4XPFH 4WDIA 3K1DA 3GPEA 4ZMOA 1VF5C 5A7BA 4PGEB 1KYOH 4TVPE 5I0XA 2FT8A 2RACA 3AS1A 4JAMA 2QVTA 1RZJH 3RRQA 5DJZB 1Q9KB 3C8KB 3ASOB 2F19L 3ZKQD 3H4FA 3N6YA 3PUCA 2KLRA 1OW8A 3V6OA 3I6LE 3V9EA 3K71A 1MCCA 4UOQA 2I9LB 1BD2D 1GPOH 5IF0A 3KPRE 1DQIA 1NM4A 3FO2A 4MA8H 4N2NA 3TGUD 3GUTA 1YPZB 2AEFA 5C71A 4YNYB 4X4ZA 1HXKA 5IFHL 3QWOB 1QPPA 5FPIA 5APVA 1QRKA 2DYRB 5ISZD 3B6SA 3EW3B 1D2PA 1G1KA 4IDJL 3EYQD 4PJXE 5J6HB 1H9VA 4L74A 4Y5VC 4TNGA 2TSBA 4LEEA 1BQRA 1B2YA 1WBZB 3IMUA 4TSCL 4ZFOL 2ZE0A 4AQ1C 1A1OB 1ZA6A 3EDFA 5IV2B 1QEXA 4LSRL 1S5LE 2P5EA 1BQLH 3VGFA 3MCKB 4C47A 4LL1A 2BMKA 2C4FU 2FX8L 3K2UL 1BREA 1QLRB 1RJZA 4FQHB 1M8OB 1ZTMA 4P2AA 3G6DH 4XBPB 1BJ1J 4DO6A 1OF2A 1VB9A 1SQQE 5LN4A 5F0JB 4JN1L 2A0LD 2LR4A 2FECL 3P73A 1A4AA 1WD8A 4L4JA 3L9EA 4I18A 2XZCL 3CFCH 4Q6IB 4D0BA 3BW9B 4LL4A 2Z7YA 3FSOA 2X0VA 3FO0L 4BH7A 2YN3A 1ZJBA 4OZ4A 3KPSE 4XC3H 4HS6B 1IL1B 1ASPA 5BRZB 5DK2B 3ULVD 2XWCA 5IMMA 2YZ1A 3FN0L 1IRAY 2ED6A 3K91A 2FE0A 4N2FA 2JCWA 3JT0A 1RUPL 3QCTH 3DXAE 3I6GB 1JPTL 2QSIA 1AD9A 1AG0A 3FSZA 3IDXH 1HN1A 2VT0A 4OJFL 3EO1A 3GXTA 2N7BA 5IW1B 2XKNA 1P84J 1D6VH 4P05A 5EU6E 3MV7B 1LTSC 4QYAA 3JYBA 2BY0A 2EH8H 3I6SA 1NGQL 3L54A 2F53E 1JPSH 1N64L 1NGYB 2VTFA 1T2QL 2ATPA 4XPFL 1ZA3A 3SCMD 4UTAH 1BFSA 1OW7A 1FFTB 1SQVD 3BVXA 1HJCA 3O11A 1AO7A 4GI9A 5E5RB 4ZMQA 3KEHA 3MMEA 5CJ8A 2A9ML 3D71A 4PMEA 4D9LH 1VGEH 1RZJL 2QLYA 4XN5A 1NTZJ 5E7FA 1ZTXE 3MRMB 5CGMA 4IHOB 4UILH 1WIPA 5DS8A 2IDUA 5IEKB 3FO9A 5B7MA 1J18A 2ZVOB 1GPOL 1A3LH 3PV6A 5J4MA 4PU2A 4MA8L 2O3JA 3QXVA 5KSAB 2AXGA 4F37F 3F7KA 5IOKA 4JVWA 5KSVA 1UT1A 2P3YA 4NXKA 5TF1H 4FG6C 2RJMA 4B5EA 4FG4A 1SPDA 1EWHA 4Y7MA 1AKPA 3SE3A 2KZBA 1UG9A 1H0TB 2PW1A 3F7VA 3QJQB 4LHUG 1JWSB 3NZSA 2DM4A 3Q44A 4K94H 1JNMA 3M86A 1CUOA 3RWCB 1P6AB 1HXYA 1C5CH 1BQLL 3SY6A 1FAKT 4HA1A 1CD8A 1JZDC 4X9GA 1AGEA 3E6HA 2XN2A 5LNEA 4ZFZB 3P9WB 1S7WB 4ZKUA 2P80D 2HVJB 1U8HA 3OKLB 3GLDA 4MZIA 5AVWB 4PRHD 1ACCA 3V5BA 3CFCL 3RILA 3BMVA 4HIEA 3SDAB 4KV5E 5HYQB 2Y36H 3EO9H 3WFHB 4UQEA 2FEEI 1C16A 1EGJH 2ZOWA 4GT0A 4PD4D 4XC3L 3FU0A 2C26A 3LH8A 2IH1A 2VXVH 3BPCA 3N42B 2DWEA 1SFCD 1G7JB 3O6MH 1KOAA 2YXRB 1O6TA 2XHNA 4TVUA 3QCTL 3QXAB 3SE6A 2GHZA 5DRZA 2EILB 3IDXL 3Q2CA 2XBZA 4NQXB 4UAHA 1NBYB 3V0FA 3K81A 2C9VA 1D6VL 4POZD 3ROLB 1FOSE 3QRLA 2EH8L 4NO0A 4BQ6A 2H1PH 1JPSL 5CO1A 1E2ZA 1MCKA 1I1YA 5EC1A 1LGHB 3Q5RA 4UTAL 3P4MB 5IQMA 4A6YL 1VEOA 1K8IB 2BWQA 2QFPA 4PY8I 4MZ2A 5HHNB 1CTOA 5T5FH 1JEKA 2Y0DA 4U0RB 4D9LL 1VGEL 4ALAH 5L8JB 2H43A 3MOQA 2L7QA 5DWPA 3QIUA 2XG5A 4MNGA 2C9UA 2HRPH 1F5WA 5LBSA 1BOGA 4DVBB 2D7PA 1O75A 2ZX8A 3GHGC 1AQDB 4ETQB 3DOSA 4D0DA 1AGCA 1JZ2A 3O3AB 1V05A 4TS6A 1WH0A 1S1CX 3PP3K 3HZKA 4NC1E 1LT9B 4U3SB 4QF1B 1MFAH 3FOLA 1BGYE 1J0YA 3QEHB 3AQDA 2ZT9D 2CR3A 1D5MA 3FUEA 5TF1L 1SQBJ 4X7DC 4RFOH 4F3FA 4ORZC 4UINH 3KYAA 3KPLA 1R5IA 2H8PD 4HFWB 3FF7A 1XBRA 3NSJA 4P2CG 1PJ9A 1NDGA 1GH7A 5GZND 1G7LA 3BDXA 2Q20A 4K94L 3MR9A 3WS6C 1A8JH 3BWUC 2XN9D 1FAVA 2N1TB 5IFJA 1C5CL 3K71B 1RF1C 3GZKA 4IGBD 4UB8H 3FFCB 4NQCD 5F89A 5GSRA 4ASWA 3VYPA 5T3XE 4KXZH 4F91B 5IF0B 2DQFA 3O3UN 3LZQA 5HJGA 2ZYIA 3HUSA 2D3NA 3ZYIA 1E7VA 1FFPB 2G5RA 3LEXA 5DFWH 4X5XA 3B6SB 1JPEA 2XIBA 2GY7B 5D2LB 3RL1B 2X7LB 5ALBL 4ODBD 3UTQB 1OAKH 5I1JL 3CC5B 4HLZH 1JVKA 3STBA 5E4AA 2J6WA 2KS0A 4LSQH 3VMPA 4I0PD 1I8UA 4BINA 3W1ZA 4YBQD 2Y36L 5DJTB 1U8KB 1ZA6B 3EO9L 1IVLA 3P3RA 4RO0A 3CFMA 1EGJL 3D9AH 1NGZB 3OPZH 4MASA 3D39A 2VXVL 4HKJB 4IBTA 4PTUB 3VX0A 3O6ML 3RQ3A 1DANU 2PAJA 1SLUA 2NX5A 3P2TA 4S0HA 5BVJB 1UD5A 4MHHG 3G5ZB 3OKDB 5HY9B 3OKMA 1Y6NR 2VLRD 2OMTA 1P7QA 4NI3A 3VFNA 4I18B 4N2BA 4NUJA 3TYGH 2K3TA 4B60A 3D2UD 3AS3A 4KROB 4RAHA 4D0BB 3LH9A 1OP4A 2C7UA 1BHGA 2P47B 2H1PL 2FIRT 1SFDA 2EDKA 3RI5K 2PABA 3EOBB 3VH8B 4OZ4B 4KV5F 3WDHA 1XGTA 2OQQA 3H1IG 5HVGB 3SPGA 3RVTC 2BZDA 4PB9H 5IMMB 2DPKA 3PABB 5T5FL 4KTYA 5CNHA 2X1XR 1V3LA 2AJXH 4HOZA 3QCUH 2Q7NA 4ALAL 4NZFA 5ICZA 3D52A 3ARBB 5JHDA 2FWLB 4DP4X 5DQJA 2HRPL 5FO7A 4PB0H 3RPKA 4CBZA 3OAWA 4FNUA 3P9LA 5DJCA 1JZ6A 3E2HC 3QHTC 4TLKA 1MCRA 2CCWA 5HD8C 2WKOA 1MCIA 1OV8A 3HB3B 4DP7X 1MAMH 1MFAL 1D7CA 3UPCA 4GUCA 1I75A 4MAUH 3PP5A 4RFOL 5DXWA 3ETTA 4JDVB 1SRDA 4UINL 5AOLA 3D7PA 2E7LA 2WSPA 3ZBMA 2ZAHA 5TDNA 3DSFH 5TJWK 3VP8A 2JP3A 1AHKA 3UOAB 1EHXA 2AEIT 5E0FA 3CFEB 5IJBC 3UZQB 2PYEA 4LVNB 5MENA 3CCJP 4M93C 1AZCA 4LIQE 5DS8B 3VI4E 2AK4D 4E41B 3PV6B 3WNJA 2GUOA 3LXCA 4NBZB 1Y1DA 2AXGB 2NXYB 1WD9A 4OKVA 5JHDE 4MBOA 4ZFOA 5M7QA 2K6WA 4WI9A 3RGVB 5ETUB 4K8RL 1RK0A 5CLXA 1OAKL 4J8QA 4Z5RB 3QEQA 2PW1B 3GSVA 3HJEA 5CSZA 2GK2A 5E6SB 3TC9A 4LSQL 3RK3B 1GMIA 3EO0A 3MA7B 1EJ8A 5F0PB 3QWQB 3D9AL 3ARED 2XRAH 3OPZL 5F9JA 1I31A 4WFEE 1AGEB 1IJDB 1TJGH 2JTDA 1HHHA 3E6HB 1P6WA 1E43A 3AB0B 3EJCA 4KO7A 4YBLB 1WFMA 3N9GH 5HGAA 4PJFA 2QEXP 4ELKA 2ZWKA 2NDGA 4TUUA 1N7SA 2W9EH 4HB1A 2O6DA 3AE6C 3MGOA 5E00A 4A7SA 3TYGL 3CPWO 4HIEB 4YDVB 3EUDA 1RE4A 1NLBH 3EH5B 1YDPA 2CJSA 2UVEA 2NNAB 3P3UA 3IYLW 5K33A 4HUUB 2PR9A 3JWDC 2OCCB 3C8DA 4FQXA 4PB9L 2IH1B 1Y0LB 3QEQE 2DWEB 2NR6C 4RAUA 5FYJH 3DA0A 2AJXL 2P43B 1YMMB 3QCUL 2QPSA 6TAAA 1XEDA 3E1F1 4Z7UF 4PB0L 1MVUB 2UY6B 4HH9A 4PCTA 4KO9A 5L2KA 2HG5D 2P44B 1EH9A 1LT1A 5C7XH 3L1GA 1NUNB 1U92B 3ABGA 2CUHA 1AMYA 5K9JH 4PI0A 4NO0B 1MAML 3KWWB 2NZ1A 2QGEA 3FSVA 4MAUL 1MG2C 4WUUD 3DROA 3HI5H 2H26A 2VC2B 2QGCA 1UVQA 4EXKA 3DSFL 1H8NA 2CR6A 1GZQA 1CLOL 4Y2OB 4G3YH 2CRIA 1XH3B 3HAEB 4P4KB 4YJZL 1X5GA 3QIUB 2VLKA 3CCUP 1NBCA 4X6CF 3LVTA 1BOGB 3L72J 2A77H 3TVMB 2HUEA 4DZOA 2AZUA 1CS6A 5FGCB 1H5BA 3NIGE 5FDYA 1CZQA 1AGCB 3FUHA 5GRUH 1G2CB 3H1KE 3L3JA 4C54A 2XNDH 4GB9A 2XETA 1VFAB 1MWOA 5E4OA 5IG7A 1D5MB 2V7NB 3NCYP 4MMXC 3KPMA 4RMSA 4Z7WA 1P1ZB 1EXJA 3REWA 5J1TC 2PO6C 1B6DA 2LV4A 2X9ZA 5I0DA 3FS9A 5C92A 1KYOE 3H1HG 5E95B 3ILQD 2VIRA 4J3XA 2IPPA 1HL8A 3B2MA 2WQXA 4PN6A 1V55B 1ZEAH 2CMRH 2UYLB 2WIIB 4LVEA 4DKDC 2XRAL 2EDYA 1B88A 4Z3GA 3DI2B 5KYUB 1TJGL 1ZT4B 4E68A 2FO4A 3VI4F 2IALB 2VW4A 3NIDE 1YQ2A 3B3IA 3C1LA 3LEXB 3N9GL 5DJ8A 4B9JA 4Y4KD 3VWJC 1F3JA 4Q14A 3SB3A 1ID5I 1QSFD 2W9EL 1X5MA 1INEH 4OV5A 5DK0B 4U3FD 4WI2A 2VM3A 2WLJA 5KLIB 2ADGA 1F3DJ 3PU7A 3C5JA 1I7ZB 4IK6A 4FFTA 1KBGH 4AC4A 1NLBL 4G6FB 1S7RB 1SN5A 2VYRE 5JPNC 2E8ZA 2F8OA 3UBXI 3MJGX 4MB3A 2OM5A 4K7PH 5B3JE 1M2VB 3D39B 1RZGA 5J6GA 4FRWA 2AQRA 4I48A 2Y5TB 5FYJL 5GGVY 3FFOA 5HDRA 4LT7A 1JTPA 5C0CE 1VQ8P 1MZ9A 3RYMA 1LGVA 2LHAA 1IGMH 3VX1A 2OMTB 1P7QB 3OL2A 3B7SA 3RJOA 3VFNB 5C7XL 2WV3A 4EYYQ 4NUJB 4XBGA 2HT2C 1BZ8A 2A6KB 3C9IA 2K3HA 3D07A 5K9JL 2C7UB 2Q87A 3PRJA 4OT1H 2WGNB 4WWKC 2BOBA 3BIBX 1SHSA 3HI5L 3WXVH 4J23A 1GCYA 5JOFB 4YSEA 2C9RA 2ZONA 1EQ7A 2A6IA 3SJVD 3RZCA 5I82A 3N1FC 4BZ2H 2OZ4H 3DGCR 3D85A 4G3YL 4PJGA 1S3JA 2PXYC 2P58A 1F45A 2D3VA 1OVVA 4JKLA 2YGVA 3EJYD 4J27A 3BQUD 3LH2H 4P57B 5FO7B 3QFDA 1ND0A 2A77L 3D09A 4Y19D 4XA4A 1KB9J 4ETYA 1NAMA 4J4PC 5K93A 2L3BA 5DMGD 5GRUL 1NMCC 4HUXB 5L7XH 4PJ8C 4OI7A 5D7JC 2XA8H 1SQBG 1BZDA 1GC1C 3BN9D 1AHWA 4AYSA 1AQHA 4AZ8A 1A3QA 3BP6A 3Q6FA 2KIKA 3T0WA 3W37A 1L9QA 2J1WA 4PJCA 4X99B 5KYXA 5DZAA 1YEGH 2FYUE 3ZR5A 5K9KA 3QDGA 2K1MA 5DJ2A 2P8PB 4JRXA 1YNTF 1WT5A 1ZEAL 2CMRL 4H0IA 4ZDHA 2PYEB 1I8LC 4AQRD 3QEUB 5MENB 2E7BA 3Q5YA 4ELMA 3EJYC 3UCRA 2RCSH 4ONGH 2GUOB 2WYIA 1D3CA 2VLJE 4N0CC 3NIGF 2R15A 1S4XA 2J2ZA 3NJXA 3CN2A 4OKVB 5I8EB 1I7RA 4XCNA 2I7SA 4NNXA 4Q4EA 2UZPA 1EGJA 5HYJB 5KYWB 2JIXD 2ICCA 1MCOH 1INEL 1L0NE 3EBHA 3HUJF 3LHAA 3PQYE 4XXDB 3WJMB 5CSZB 3BPLB 4WI8A 1R5WB 2OL3H 4KOCA 2X10A 1KBGL 4BK4A 2LE9A 2JQAA 1BP3B 1M71B 3T71A 1KILA 4HHWA 3BZDA 2YXVA 3ARGA 5IMOA 4NZUH 4I87A 2XOTA 4K7PL 5F9JB 3W5MA 2HB0A 1TYRA 1NTKE 3LTVA 3V79C 4CSTA 1PKQA 2BY3A 4PJFB 4ELKB 4NCDA 4B9CA 3QDGE 5D6DA 4JRXE 3NIDF 1N7SB 1IGML 4PS4H 2CKBA 2XBDA 4J3VA 2YRBA 3MJ8A 3MGOB 5E00B 3RAJH 3TIDA 3V0VA 5A1AA 2IIJA 4RLDA 1HHIA 2W8CA 2XG4A 4R4BB 1P5UB 1BIHA 3WY3A 4F7KA 2BNRA 1K5NA 2YMKA 4OT1L 3VFOA 4F20A 5EORH 1CF8H 2KNCB 3WXVL 3OMIB 3PFUA 5K1NA 1BEYH 1RUMH 1YMHA 2BVYA 1OLLA 2GT9B 2QADD 3UBXB 4MQ7A 3U6XA 2OZ4L 1M7DB 3P77B 2ZKMX 4RAUB 4BZ2L 5B3JF 5DMKB 5SX4I 3KJ4C 4YDKH 2JCCA 2JV6A 2WSEJ 3SKOB 1NU1J 4OIBA 2DMBA 2ODIA 3LH2L 1U8LA 3B5NC 4HH9B 2WTYA 1H19A 4NDMA 3PFQA 4AQOA 3MXWH 3TNUA 3IPFA 1QWNA 5HI5D 3RDTD 4HUVB 3DX8A 4OGAD 25C8H 1LO5A 1ULVA 4HULB 5CCGE 2YD9A 4XMZA 3S4SG 5L7XL 3V0HA 2XA8L 1IFGA 4A7GA 2R2BA 4UQ9A 1H3TA 2Z5HA 2H26B 4XN1A 1W0VA 4GLRI 3J2PA 3QNYA 5I1DA 1UVQB 3S35X 3LMJH 4WHDA 2YO2A 1AACA 3SSGA 1FVDA 1YEGL 32C2B 1O5DT 3OLGA 2BSRB 2VLKB 5GGQH 3BP4B 4XCEA 5EWIH 1H5BB 4JPIB 4N87A 2RCSL 3C87A 4XZUB 5AAWC 1ZHBA 2V4LA 1ORSA 3N0AA 3NDZE 4ONGL 1QA9B 1LO4H 4NO2B 2EABA 1NCCH 2GUYA 3RVVD 2L91A 3C09C 5A2FA 3KPMB 3D2TA 3JQOB 2KYVA 2CXKA 1HJ0A 1TYEB 3S2AA 1MCOL 2J7LA 4RISH 3VXSA 3ZDXE 4G7VL 3MUDC 2VIRB 4KGLA 2OL3L 3VSVA 4BRJA 5CGYD 4F2FA 5EMYA 3HE6D 1FFRA 4JMNA 1F41A 1AD0A 4XCFH 2AZAA 2LW3A 4I5BB 4NZUL 3UP1A 5CHXA 4DERA 3FL7A 4DN3H 4UB8E 1Y9BA 2FO4B 1KCUH 2JELL 1T3UA 3OGOE 2A6DB 1LILA 5DJ8B 1OD9A 2FD6H 3O45A 3ALXA 2SPZA 1C9SA 4IBSA 3C60C 5J1SC 3I02A 4R2GC 4PS4L 1RLWA 5MEPB 3RAJL 2CGZA 3PH0A 3AE2C 2NY5C 5DLLA 3DUSA 4QRSB 5CJ4A 3DTDA 3BO8A 3T2PA 5KVEE 1CF8L 1BXVA 4LNRA 4JPKL 5EIIA 1AKJA 3HE6C 1HKLH 4KDTA 3FHAA 4OTXH 1BEYL 1RUML 3POHA 1EZUA 1RZGB 4NSKA 2KDYA 4PRPD 4XH2A 4GRLA 3U2SA 4PGJA 4I48B 2A06E 2IDSA 1EEZA 1AFOA 4KJYB 1G4MA 3TH3T 4DJMA 4YDKL 2FWOA 2ZOOA 4O2EA 1KGIA 2JF1A 1U8OB 4NHCH 1LK2A 3UABA 4XNXH 3MXWL 3B2DC 1QNIA 2RGSA 25C8L 1LD9B 5D1XE 4AXWA 1Q8MA 4ELMF 4BYHA 1UT9A 4LPTA 1NOLA 4TNWK 2OQJB 1GYWA 4BFRA 1WP6A 1YSOA 2BOBB 3ECUA 4MRBA 5I1AB 4OQTH 2BCMA 1OOAA 4FJYA 4APQA 5B1JA 1C1EH 1SLXA 2FWUA 3RZCB 1M1JC 3LMJL 2H41A 3RFZA 5C2BH 1M6UA 2YN5A 3D85B 1U93A 4PJGB 4XZ4A 3SIKA 3NP3A 3R0MA 3FCGA 3RKDD 2DL2A 5GGQL 1GRWA 2MTAA 3QFDB 1ND0B 3L3OA 2APFA 2BCKA 2XPZA 1RQVA 5IGXL 2IPUG 5EWIL 3NMDA 1NAMB 1OZHA 2EDJA 2MWCA 1QQDA 4JFYA 3V4VL 4KJPC 2CK2A 2NRGA 1NPJA 2B4CC 4KDVA 1LO4L 2FZ3A 3R8QA 3KD4A 4KK6D 3SODB 4PR5A 1NCCL 3KHQA 4DGIH 1JBJA 1AHWB 1M7IA 3ZTCC 1CGXA 4AZ8B 1MRDH 3Q6FB 4K7PY 2HTKC 3VSUA 5FF6A 3L16A 5F88A 2A2QT 5I24A 4XO3A 3PAUA 1U3YA 4RISL 3LNEA 5JIDA 2XWBA 4PJCB 4ICWA 5FGRA 4O02B 1O7DE 3GSXA 4LHUD 5K9KB 5BUGA 1W8NA 2UWEA 4IM8A 1OZUA 5DJ2B 2AJVH 2HTLD 2EUWA 4F7TB 3RNQA 4XCFL 3LZRA 3RKDC 4ZAKB 2CRYA 3BC9A 4AITA 4DN3L 4N78E 4TN9A 1WF5A 4MAYB 1KCUL 4HFUH 3VD5A 3L3IA 5F7FA 2W5PA 3T1FA 3HHSA 3F6IA 1TQCB 5C0BB 3MRGA 4NNXB 1B0RB 1E6JH 4TPRH 2X1OA 3AM8A 2NNXA 1OY3B 3O8XA 5IJVB 3IJ9A 2ESVE 5DVMA 3LX9A 2WQVA 3C6LA 2OULB 4L3CA 4TUKH 1KILB 1CTMA 4HLJA 4E9VA 4LFHD 4OFQA 2P42B 1OL0A 3QR2A 3MACH 1HKLL 4LE8A 4OTXL 5BZWA 1PF3A 5F97E 2D73A 1JSYA 3K6OA 5HDOA 1G87A 1PKQB 1OW6A 3SSUA 2Z93B 4X98A 2O1AA 4WY4D 3FQTB 5C2UB 1N19A 3QEGH 2BNQB 4DSYA 4NHCL 2CKBB 3PWLB 4WW2F 3V0VB 3MJ8B 4XNXL 4QJ5B 1DEEB 1HE7A 4P23B 4ZYKA 2X1QA 4K3DH 1R24A 2BNRB 5FX3A 1K5NB 1L7TH 1E4WH 2ZXCA 1MWAH 4OQTL 3DECA 3N4XA 1NANI 4LQ1A 2Y7LA 5GTHH 4YHNA 3MV9A 5JQIB 1C1EL 3TBWB 1YMHB 3Q6GH 3ZQXA 4NN5B 3CQFA 5C2BL 3A3YB 4NFCA 4U7SA 1XHHA 2VO8A 1IJ9A 3LV3A 4YHLH 1WCQA 3KPQB 3IETA 2UXGA 3RTQC 4WY4C 3DX8B 3ROOA 5MHSD 1LO5B 1Z9LA 3L3DB 2BP8A 2V5MA 3R1GH 2BY1A 4N3YB 5I16A 1NWPA 2ICEC 2HT4D 3DARA 2H4EA 3TO4A 1VQ7P 2V9RA 4DGIL 1ZIAA 2R2BB 3QDJE 2YMYA 4H1LH 1PVHA 3FRPG 1MRDL 3EQ2A 3QNFA 1W0VB 2NYZA 2RH0A 2N0KA 2Q1KA 5T1LB 5AKRA 5T1JA 5C6PB 2BRQA 1FVDB 4N25A 4F8TA 4L8SC 3TF5A 2KXPB 4Q97A 5IJKC 2AJVL 2BDNL 4XPGH 4PV1D 4KFMA 4GEJA 4Y16A 2MMXA 3DIDA 4OF5A 1ORSB 2OK0H 3HI1B 4ELDA 4HFUL 3UL4A 1P5VB 5D7HA 4GAAA 5C08A 3GMOA 1IKNC 3GM8A 4JO8A 2MQ0A 1BQKA 1E6JL 4TPRL 4Y1AB 3ULSA 1X3DA 3AT9A 3IMWA 1G1OA 2HPCA 4JCMA 1ZLLA 6FABH 3VXSB 3VYOA 3VYNA 3L74E 1YEWA 5E03A 1ZXKA 3GLMA 2CUAA 3QPKA 5D7LD 1VGKB 4R7NA 3S0PA 4TUKL 4IOIH 3R06A 4JJ5A 1AD0B 3MACL 5DF0A 4Z0BH 1HXMA 1JI1A 1IC7H 1F0LA 1L7IH 3M45A 4IQHA 2HKHH 3E1IA 4NQQA 3IMRA 4K3JH 2ZF9A 3TBTB 3TEZA 3Q5SA 2Y9YA 3CWBE 1WPCA 3O45B 5DRNA 3L3GA 3O6FC 1M56B 2NNRA 3QEGL 4R7VA 4G8IA 1CXKA 1W8EA 4NQVA 5EV7A 3T65A 5JW4Q 1JZ7A 2VISA 3HZ3A 1X9UA 4KKRA 1X9RA 1UUSA 3RVUD 2OZ4A 5CCHA 1UGKA 1WC7A 4GT7A 2AKRB 4BZ2A 3ISRA 1HYSD 4K3DL 3TCLA 1YEFH 4JQXC 1L7TL 3RL0B 1PIFA 3MOBH 2X2HA 1E4WL 3QIWD 4P2QD 4KTGA 1MWAL 3X12A 3NCFB 1MI5A 5I0VA 3RL2B 3CX5E 1GGBL 3WUTA 3H1ID 3Q6GL 4NSKB 5I6MA 1DVYA 5E9NA 1PIXA 1SQPE 1MUJA 1BIIA 4YHLL 1DVFC 2AXFA 3L7EA 2JKRM 3PHSA 1LK2B 1YBKA 3L73G 3C8VA 2IZ0A 4UWQB 1PCXA 4KRNA 3T4AA 3SDCB 1GK4A 3R1GL 1KBWA 4HJ1A 3L5HA 4AXWB 4WHTB 5E08H 1SQVK 3DX4A 1NCHA 3QUYD 4Y9BA 3TGXA 3U1SH 3RVUC 1GDTA 4JFFA 5HPMA 4GFXA 1L6ZA 2MJWA 1NC4D 3HS0C 3H56A 4J8RB 4F15B 1BWMA 3PWUA 3VXRD 4AL8C 5C8JA 4PUBH 4U1KA 3C5ZB 4GBXA 3HD7B 1PS3A 4YHIA 1Y1UA 4YMPA 4Y99B 4C55A 2C9PA 1R3KA 1I4FA 3L3OB 4XPGL 3G5YA 1GZHC 4RX4A 1JTTA 2F54D 5JZ7C 3RVWC 1SQQJ 1DBBL 1MI5E 3I84A 3D0VA 2BNUA 5FDWA 4E9YA 2OK0L 3CZFB 4JFYB 4XOBA 3RG1C 2E75D 5AVYB 2KLUA 1WZLA 5HGBB 4PR5B 1X4XA 4U1SA 1M9SA 2BASA 1M6OB 1M7IB 3BVHA 3JYCA 2GIYA 4OI9A 4WI6A 3V0IA 3KLDA 3VXMD 4TNVF 2OSXA 5F88B 3KXFD 5F8RC 4AH2A 4NO3A 5C07E 6FABL 1OQOA 2W27A 5F7WC 2J73A 3RY6A 1DJHA 5A3IC 4D8PA 4JKNA 4ZSOB 2R0WH 3QCVH 4LLMA 3DIFA 5D4HA 4JFFE 4NO5A 3FUJA 5B1CA 4MJ6A 2IV8A 4Y9GA 4Z0BL 3P3YA 1IC7L 3PY9A 1L7IL 2XUWA 2HKHL 3LPPA 4K3JL 3MXVH 1KULA 4DZ8A 4JL1A 3TZVA 3L3IB 4W68A 3T1FB 1CE6A 2E75C 3HHSB 1A4JA 5GZOC 1AZVA 1HCZA 1MW3A 1RV6X 5T3ZH 1T1XA 1JNNH 4QRRE 3NA9H 3EFGA 2BFVH 2A9CA 3KEDA 4LU5H 1PCSA 3BUQA 4PD4K 3I55P 3C6LB 5APQA 4L3CB 4OIIH 4YGVA 1YEFL 4GOEA 4JG5A 3MOBL 4PJBF 3X1FA 3Q2YA 1CFVH 2RMZA 5G2NA 5CS7A 4NRYB 4U1LA 1RKRA 1PYWB 5BZWB 3OGCB 2WB7A 2K8QA 2X4NB 4GI8A 4X83A 4EI0A 4RSVA 1IGYB 4X98B 4JM2B 5SWQA 4PJIA 1U42A 3C9NA 3UYRH 3T0EA 2VMFA 2E42A 3MNVA 1Z0NA 5D55A 4AYBA 2DI9A 4GW4A 4RFNC 5DURD 4C57C 1P84D 4UM9D 1JB0J 3T6ZA 4ZYKB 1FP5A 4JPSA 4R4ND 5JQ6H 1R24B 5E08L 3U1SL 1U58A 3FQNA 3U7WH 5F1OB 3QG7H 1F2QA 1B2WH 2YMXH 3MV9B 3B3BA 2G2PA 5LGJA 5JW5B 4LLQA 3EWKA 1TEYA 1J0ZA 3T6QC 1FNGA 4PUBL 5JHAA 1R3JA 2C5DC 2NCEA 4XTRD 3QUKA 4X9HA 4R3SB 1JWMA 3LV3B 4ZW3A 2OMZA 5HDWA 4Z23A 3B1TA 2X5PA 4P46B 3IETB 3ZKNC 3BVNA 3MYZA 1JCKA 4IIQB 1GR7A 1U3HC 5J8OA 3UIAA 4E5XG 2DWDB 1V54B 4L76A 5EEVA 4OCWH 2I07B 3TO4B 4W1TA 1UM4H 1UURA 4K5LA 2WWKT 3TO2B 1AYOA 5KW9H 4M1CD 3RB7A 2K78A 1WHOA 5IMLA 2FH8A 4L4TE 4Z6AT 4G7YH 4GPVA 1GJIA 4HIIA 4JZNA 4NQED 2WM0A 3H1HD 4L1HA 1NBZA 2K9FB 2R0WL 3QCVL 3A2AA 3NH7H 4ZMXA 3E7JA 3GSWA 2MJZA 4PW4A 4GKLA 2N9BA 4QT5B 1HI6A 1UWGH 3JWDH 1D5BA 3OJAB 1J9RA 1OTSC 2BSBA 5BQ7A 5BO1H 4JRYA 3MXVL 2VDKB 5C08B 3ARYA 1XEUA 3LNDA 4CMMA 2FQFA 3AMLA 4XXCA 3ZSTA 1GKEA 5BMFH 5T3ZL 5IB5B 4GKSA 2WUCH 3CCMP 4LGPB 1Q0XH 1JNNL 2O6PA 4BGDA 3NA9L 2BFVL 2OYPA 3UTSA 2BS71 2RD0A 3II3A 3MV7E 4LU5L 4NERA 4R7NB 3CHRA 4RMQA 5FOBA 4OIIL 3K8LA 1TJXA 1XH2A 4JJ5B 4H8HA 2IZ1A 2EYTA 2V6HA 1CFVL 3IE4A 1BVZA 1SY6A 2BP5M 1XCTA 2JE8A 3AT0A 4FNLH 2QZQA 3NCMA 3QQNA 5E9DA 1HXMB 4YX2H 4A2EA 1A66A 1J05B 2C9AA 4F7EA 3TH2T 5AG8A 3OAYK 4MCZA 4FTVB 1SQXG 4QKTA 1DQDH 3L3GB 3UYRL 4G8IB 4OQTA 1BGYJ 3L4TA 2O72A 3P30H 3HVDA 2XDHA 3WUWG 1XH1A 3TBSA 1NJ9A 3RJQB 3LQZA 3E8VA 3DYPA 5JQ6L 1U7MA 3L5WB 2BHFA 1EK3A 3NIFE 3U7WL 2CZNA 3ARFD 1BAGA 2VKWA 3QG7L 1Z5HA 2DL9A 1B2WL 4YN3A 2YMXL 3X12B 4AQ1A 4H25A 3VNZA 5DHYB 4GMSH 3FPXA 3QZNA 4L4VD 2R83A 2FBWC 1BIIB 1DSYA 4NQDD 2VDRB 3QJTB 5F9WB 4HWEH 3FUFA 4NS0A 4X9BA 1VRSA 2DYPD 3UG4A 3V4QA 1QRNE 3TJHD 4ZMZA 1WA1X 2KQMA 3OWEA 1T7ZA 3T4AB 4ADIA 4OIFA 3IMSA 1MLCA 4GG6A 2JXMA 4GS7C 1NIAA 1VFBA 1CK0H 4OCWL 4MD0A 4NUPA 1T66D 2XU6A 3BRVB 1FBIH 5K5YA 1E9PA 1UM4L 3ASWA 5TE4H 1SQBD 1YPZF 3W81A 1GYVA 2W59A 5KW9L 3PWUB 2NXZC 4JFZH 4A39A 2D4DA 5TH2A 4AEIH 2OTPA 4KXBA 4APXB 1UENA 4X80L 5K9OA 4G7YL 4FI8A 4H2AA 1R1CA 3OX8A 4LP4A 5CGBA 3GKWH 3REVA 3NH7L 3V5HB 3P02A 1I4FB 2OX5B 3WKMH 2JJLA 5GTIH 1TCMA 5E79H 4DOHE 2FX9H 3QW9A 1UWGL 3D0VB 2BNUB 3JWDL 5FDWB 3EJPA 5DYFA 1EJ6A 4IW4C 3P1VA 1RI8A 3L9BA 5BO1L 1FE8H 4UI2A 4PJAA 4U1SB 4JANA 4M8UA 4WU5A 2IFMA 1T66C 3U79A 3M06A 3VTAA 5BMFL 2O5YH 4NO3B 1YVLA 2WUCL 4ZFGH 1Q0XL 2BVOB 3EYUH 1D6EA 4JDEA 1NSNH 2NOYA 1XO8A 1I1AD 4N2GA 4P2RE 2EVHA 4KI5C 4D8PB 3AG2B 3IJSA 1CI3M 5IUCA 1MCJA 3A4EA 1T2KD 1SHMA 1LWUB 1U6AH 4FNLL 1FSKB 4WEBH 4MJ6B 2KLTA 1IEBA 4YX2L 3OHXB 2QTVA 1KT2A 2A4ZA 1OVZA 4ABQA 2DLTA 4DZ8B 1DQDL 4IRJC 4FXKC 3B56A 4ZO9A 1WBYA 3TEYA 4S10A 2UZXB 2ZXAA 1MWAA 3CUPB 2Z4EA 3WIHH 3P30L 2Q6QA 2VR3A 1T1XB 3HZVB 2JKNA 3MBED 1YEJH 1OHQA 2YUZA 3QO1A 2V33A 2OTWA 1CF1A 4EIUA 2QKIB 1UCTA 4YGVB 2K88A 4PJAE 4Z3HA 5JIMA 3B8SA 4G9DB 5F70A 1GC1H 2AERT 2HP4A 2B87B 2Q7CA 2RA1A 1OIOA 3QJFA 1EAJA 3HIZA 3FB8B 3O41A 4U1LB 2PTTB 4GMSL 4IMKC 3NAAL 1MKFA 2NZ9C 2WXRA 3AQZA 3CHOA 4K71B 4HWEL 2VXSH 3I75B 4Q0XL 5CR8A 3C6SA 4JF7A 4PJIB 3H1LE 3C9NB 2X1WL 4H1LA 3T0EB 1DJSA 2GBTA 1EIBA 4DP6X 4FNRA 3VE0A 1CK0L 1NMBH 5IQ9B 2EO7A 1IAIM 1FBIL 1O7SA 4MQTB 1IIIA 4PLJD 5TE4L 2ZUWA 3P8CE 3U1AA 4YPGB 1GTWA 3NIFF 4JFZL 1ZVYA 4KJWD 4LLQB 1V8HA 2YC1A 3ITKA 1NIBA 2ZX5A 5KLVK 1MVYA 4X4XB 3QULB 4GP8B 1G7MB 5IB4B 1Q9WA 1FLRH 1T0MA 3GKWL 4X2UA 3K6IA 4MMZA 3ZKMC 2Z31B 4CVXA 2H5UA 2QLVB 3WKML 1CBJA 4GEIA 2FX9L 3WEBA 2P80A 1TKWB 1HX0A 1H3WM 1QLEB 1FE8L 3GIVB 3H1ZA 4PRHA 5B3SB 1UUNA 2HAZA 4IOIA 2FYVA 2A9BA 4YFDB 2IGLA 3GF8A 2O5YL 4B50A 4ZFGL 3O81A 1M53A 5FKPB 2KKQA 3EYUL 4JZNB 1NSNL 3FN3A 3PP3H 1CFQA 1PZAA 3UTPE 4PJHA 1BSIA 3WUVA 1OPGH 3PL6C 1J0HA 1RHFA 1BM7A 3RWEB 1U6AL 4HW6A 4I2LC 4WEBL 3M7OA 4Q4IA 5HTSA 5BQ7B 1EEYB 5JR1H 4GO8A 4CILA 4CVWA 5F1NB 3PIQB 3GHGA 4JRYB 2CRMA 4OLWH 3G6JA 4ZNCD 4G8FA 4MQXD 4OZGE 2CPUA 1EZVG 3OB0H 1IAIH 1SF3A 2C1OA 2Y7NA 4HCFA 4HS8H 4CMMB 5CEZD 1FA4A 3WIHL 2MKVA 4GKSB 3I3DA 2J20A 1E5WA 1YEJL 4ES9A 3UTSB 1EUUA 3TSIA 4KXCA 4LVHC 2LGNA 3UTOA 2EIEA 2KBGA 2G2NA 1KC5H 1NKZB 1MHEB 3GJFK 4WHYH 4U1IA 2EYTB 1GC1L 3L3KB 4P2OD 1J1DB 3WS6A 1QFPA 1D5ZA 1KCVH 1OSZA 1TJIH 2CIKA 3ATAA 1D7FA 2EIDA 3CDFA 5E9DB 1BQ5A 5ACZA 4ZFFB 3RNKB 4G8GE 1TLKA 4MCZB 3S2CA 1KLGA 4FA6A 5F21B 3WD5H 3R4YA 4KC3B 1UZ8B 4ATTA 3CMAP 2Y7MA 5KYNA 5BU8B 3H1KJ 2VXSL 3PWPB 1AAJA 2J8UA 4IBVA 1MOEA 2ZUTA 2D4FA 4XN8A 4H0LD 1QUNA 3BEVA 2WWMC 3OKOA 4CAGA 1SVBA 3DURB 2UX7A 1WUZA 2UZIH 4FQ1H 3TN0D 4Q9CA 5GS1B 1NMBL 3HN5A 2XACC 5EUOA 1KYOJ 2Z91B 2NNFA 2NLJA 4IRSC 4BXVA 4PJAF 4DUWA 3GB7A 4MJIA 3LKQA 5CMAA 2XN9A 3FB7B 1JK9A 1ZLVK 3U0TB 4IGBA 2YAHA 2O93L 4NQCA 2F74A 1BD2B 1FLRL 3KPTA 1Z9SB 5FYJU 3ZTNH 4FABH 1G5AA 5AALA 2PCFB 1KLFA 1RPKA 1JTHB 1MLCB 4EDXB 5ISZB 2JXMB 3S37X 1VFBB 3WNIA 4LF3A 3QB7C 3DO7B 2VSMB 2XI9A 2E7DA 4X0KB 3S36H 2B1AH 3NZ8A 3B9KD 4YC2C 5TE7H 2ARJQ 2IBBA 2IMMA 2Y0SA 4I0PA 1Z32X 5TH2B 2ZD0A 4PD4I 1FVEA 4XXWA 5D2LF 1RD6A 3BJLA 1USQA 3K4DA 1X5LA 1B4TA 2NY5H 2XVLA 4UUJB 2FIKA 1G84A 3NCCB 1OPGL 3REVB 3U46A 4HCGA 4QTFA 3LCYA 3ALWA 4OQ1A 1LTJC 5JR1L 3H9YA 5F2FA 3ZMNA 3LN5B 3LNIA 2KSEA 2HT3D 2VLRA 4OLWL 5GS0C 1MCSA 1YMME 1Z6JT 1HL9A 1ZMYA 2EO9A 4IFFA 3ARWA 1IAIL 4HK0B 1ICTA 4I0KA 4QD2E 4EZLA 3D2UA 3MCG1 5DZOA 4JHVA 5EO9A 2ZYRA 4F8NA 3FYIB 4YSDA 1SVCP 3IAOA 1OSEA 1T1YA 1D6EB 1A02J 5D93B 3INOA 1K85A 3AE7C 3NPSC 1W0WB 1KC5L 1G94A 3RK2C 2N3JA 3D3VA 3KPNB 4ORGB 1NUDA 1KCVL 1TJIL 4H0HB 4FC3E 3VGBA 2WYTA 4OZHA 5CSBA 1TZIB 1KT2B 3FULA 1WS8A 3IVKA 1QTSA 2X6BA 1S9YA 5DEGA 3WD5L 5DEJA 5E6ID 5E6YA 4A2LA 1RIVH 1WBYB 2IAAC 3WI9A 3QWNA 1L4AC 2CBPA 3BCCE 4OZGF 4PBXA 5T3ZE 1X0TA 2QIWA 2UZIL 1YY8B 4FQ1L 5I19H 2TSAA 3SCMB 4L3ED 3CCQP 2B4CH 3BH4A 3PREA 4H26B 4OD1H 2E74C 5AB9A 2H0FA 2FYUJ 1X6LA 4Z7OE 4KXAA 1UT2A 4PRNA 4KAQH 3O41B 2P48B 3S9DB 4AIOA 1RZPA 4HS3A 3GRBA 4R7LA 2Y2WA 2CE6A 4LCIH 3C6SB 2OYMA 2J4WH 4QRQB 5E6IC 3ZTNL 1KB9D 1MFNA 4FABL 4XP5H 1WLHA 3U2IA 5DZVA 1G0YR 3QR0A 2XN1A 4U6XA 3IDIA 4G9FD 1L0NJ 5JA9A 4PW9A 3S36L 2B1AL 5KS9A 1ORQB 4E36A 5TE7L 2VAAA 1CL7H 2PWEA 4NP9A 3KLLA 2V9TA 4MA1B 2YC1B 3FXEA 4MD4B 4OAWB 2F08A 4FYSA 1M9WA 2HJLA 2K4WA 2AEJA 2FHFA 2NY5L 4GFTB 2NR6A 4UDUA 4HPHA 1T0MB 4LRNH 4MMZB 4G5ZH 4D9RD 3K7UA 1BFOA 3L08A 4JY4B 1LTIC 3ZQWA 2EDQA 5IVOA 4M3LA 3HHMA 3BIKA 2RQ8A 4DKTA 2C3XA 1JMZA 3GTNA 4PRHB 2TAAA 3AW5A 1ITCA 2W6BA 1QFUH 1NICA 1A9VA 1MHHB 3IFLH 4FFZH 1CI6A 2XVBA 5B7FA 1QACA 4PJHB 3VTPC 2IQAA 2WW8A 2QQNH 5KS9E 5I17A 1SFCB 1WV7T 5JO5B 3IDGA 3PP4H 3K2IA 3ZL4H 3IFPB 1VADB 2EKJA 3QUGA 1L3WA 1U36A 5KG9A 2O5ZL 4OIAA 2CPBA 4Y2LA 1FNAA 3FSAA 2OMNA 2PWFA 4GNKB 5T33H 3H8NA 3JV4B 4KVPA 4OW6A 2JB5H 3ZDYB 1BZ9A 1RIVL 1USZA 2C1OB 4X6DA 2OCFD 1DZ0A 1N8RQ 1K8AQ 1OARH 3G4SP 4MMXA 1KD1Q 3PNWB 2PO6A 1I7UB 5I19L 1KBKA 2A9AA 4WUUA 5FYLD 3FFDB 3LZNA 4JQIH 2LR2A 3P4LA 2B4CL 4RFEA 1KBPA 1ZRTE 2OSYA 4OD1L 1NHLA 3WEXB 1EXIA 2WVUA 4WI7A 1QHPA 2C3HA 2CIKB 3V6ZA 4FA8A 4KAQL 3U7AA 5ACZB 1AQTA 1IGCH 1XF3A 2EVFA 2M5AA 1KLGB 4FMVA 3WUUA 3GRWH 3O4OC 4FFVC 4LCIL 2CA4A 1RH8A 1NU1D 1YZZA 2CWRA 2J4WL 4AMWA 3H1JE 3OKOB 5D7EA 5ICUA 3EJQA 4XP5L 5DU7A 3HEIB 2ZT9B 4OVNF 1PZQA 1RJCA 2DKMA 4YZFE 3V6FA 3NFQA 2XWXA 2H8PB 5H4ZA 3EOYG 4I3RH 5EUOB 3CC4P 2DLIA 3QSKB 3MFFA 3MV8E 4X6DE 3D4ZA 1CL7L 4RMWA 5HYJE 1G7QB 2L0DA 2UVFA 4NAJA 3GB7B 2DMCA 1KTBA 3LKQB 2HVBA 4IU3A 5CMAB 2XN9B 1MJ8H 4Z7OF 2MNWA 4IGBB 2F74B 1Q38A 5ANME 4LRNL 4HJGA 4GSUA 1H6TA 2AS5M 1LMKA 4LSVH 3N0PB 4G5ZL 1TTFA 1E9OA 2WVVB 1HC1A 4RGMB 2X6MA 2NY0D 1CQYA 1M1SA 1L2PA 5ICXA 3VFWA 4LF3B 1ILUA 2QSQA 1ODAA 3SDDD 1BVLA 1MDAA 3NFNA 3PHQA 1DEDA 3M9BA 5EULV 3SPHA 4DP1X 5B5EE 1FFNA 2D03H 2VJ0A 2VDMH 1S7XA 1GA2A 1QFUL 5DQ9A 4WWKA 4I0PB 1R3HB 1VCAA 3IFLL 4FFZL 2R27A 1FVEB 4H8WC 3U1PA 1AZBA 2RAMA 1WZKA 3TF4A 1XGUA 1IM9A 2ZTBA 2ZXWB 2E4FA 3F01A 3VSTA 2QSVA 4FFWD 3U46B 1BG9A 1WWBX 2QQNL 4Y4FD 4P4RA 2VZ1A 4W9EC 3WIHA 3PP4L 5E79E 4N20A 4TL5A 3ZL4L 2PTVA 4XMKH 2B59A 3ZKXB 3PGCA 5B66E 2VLRB 2AQTA 2QEJA 2NY0C 1J1XH 1Q81Q 4ZUUA 4PYGA 4Y2DC 3TT1H 3ZL2A 5T33L 5JPMC 2JB5L 1RZ8B 3SPCA 5D7JA 2CR0A 1LQSR 1KPRA 2XIDA 3D2UB 5EO9B 1OARL 1PNDA 1XL6A 3QZBA 2HH0H 5D1ZC 4NPYA 1TNMA 2B88A 1T1YB 4MNQD 5EBLA 5C1MB 2XXMB 2WWKO 4IS6A 5CLTA 3WSQH 1AR1C 3O3EA 4JQIL 3JUZA 5AL8A 4KX8A 5CINH 3SOBH 3FCTB 1X22A 3SJVA 2W88A 5BOJA 4AYFB 4PLKD 4KK8D 1I8LA 4OZHB 1URQD 4AL8H 1IGCL 3FQYA 3M46A 3KCPB 1S9YB 3BQUA 4IBZA 3WMQA 1R8EA 2B5IC 2FUQA 3GRWL 4Y19A 2ROXA 1W5CE 2NTSP 4LEBA 2KDGA 1QI3A 2ZSVA 2ZOKA 4EUPH 4WGVB 3ZE0E 3RVXD 4PRIE 2X4RB 1ZVHA 3V55A 4TMPA 4X42A 2FNBA 2UZYA 3OZKA 1ZRUA 4FQQA 2LU4A 3CVHH 3OJ2C 4Q7DA 4U1MA 4I3RL 4EVNB 2PYFA 2GJZA 4J3OF 2R32A 1YY9D 2NY3D 4LLUA 5C0JB 3LXUX 1K3ZA 4JFPA 2XPGB 3PRZA 2FLBT 1CICD 3W2DH 1MJ8L 4EXPX 1PGPA 4ADJA 1NDMA 2AK4B 4HC1A 1C5DA 2FDBP 3QRGH 4LSVL 2NSXA 4TLSA 2GYSA 2F7OA 4UOW1 1II4E 1NCOA 3DX1A 5F7NC 1KY6A 1TITA 3UDWC 4HMEA 2EVJA 4U6XB 1NEZA 3D50A 2JIXA 4FJ6A 4HHAA 3ESMA 3NSYA 1C12A 2D03L 2Y2TA 2VDML 4QOKD 1UOLA 2EIZA 2FQDA 4YZFF 4XNZB 4EJ1C 4DUXA 2EP6A 5I1CL 2GAZA 2CHNA 3BUTA 3IFNH 2NY3C 1YY9C 1M7LA 3D12B 3IXAB 1TF4A 1BVKA 2E5TA 4UDUB 3RWDB 3OKNB 4NQTA 2XYBA 1A7NH 3AREB 1P4BH 1XF5B 4L29A 3CXHK 2DOCA 4OY9A 3EGDB 3B5NA 7FABH 2R59A 4L9LB 1J9QA 5CP7B 4NNYA 4XMKL 3VFUB 1JMXA 1QFOA 3X13A 3I9PA 1UH3A 3L1FA 2V5SA 2XTJC 3ARDC 1WA2X 1J1XL 1Y07A 4PVLA 5C7ZA 2P5WD 4XP6H 5DC9B 3TT1L 4G1MA 1FZEA 1FE6A 1ACZA 5AZ2H 4RWYH 1BJ1H 2HH0L 1CI6B 2VAJA 2J12B 3ZO9A 2I7OA 3WSQL 2YXMA 2A6JA 2IQAB 1E2WA 2MHAA 4YLQT 2WQYC 5CINL 2QR0B 2YJLA 3W9DA 1CDYA 3FU9A 4WFFD 2EDXA 3CC7P 4QHPA 3IDGB 5KBLA 1OTTD 1X4ZA 4AL8L 2I9TA 4BCXA 1L9PA 2O01H 3NEXA 2EEFA 4OU3A 4EI5D 1X9QA 2R2HA 2HG5B 1T8ZA 2G3AA 2Q9OA 3RDTA 3B4SA 4EN3D 1SHXA 3B43A 4Y4HC 5MEOA 4WNQA 2Z0BA 1J88A 4CC0A 1Q9LB 4BDVB 1EHLH 3GC3A 3V0DA 3CVHL 4WUUB 4LXFA 3KAAA 1P84H 2FYUG 4MYPA 1XGYH 1AIFB 2BOCB 2FJFA 4R5XA 3TNMA 1XF3B 3GINA 2FXOA 4ADGA 1GGIL 3W2DL 1ZWIB 5EU7C 2G2RB 43C9A 5GPRA 5JIQA 2JWAA 4RMBA 5IK3A 5G5DB 1HZLA 2J71A 3DVNB 2GEQA 5IVXA 5E1GA 1SXCA 5ES4B 2G4GA 3C60A 2JVUA 2ZKHH 1CURA 3LRKA 3MTXA 1KYAA 1L0NG 1U95A 3H53A 2QJPB 3W0WA 1EDIA 1IC5H 4JMXA 1PL3A 4U1GC 5HI4C 1TQWA 3L74J 3LVEA 3Q1EA 1U91B 5C0BE 4FXGC 4R83A 4O2CA 1G5GA 4Q74A 2PPEA 3IFNL 2F15A 3FT1A 1VACA 3HE6A 3EH1A 3DMMB 4BSVA 2H0JA 2Q5UA 3WL9B 4EZKA 1A7NL 1IAOA 1F6FB 1P4BL 5DQDH 3OD3A 4HJGB 2CO2A 2W65A 4AMKH 5IB3A 1V3KA 3MGTA 3MRIA 2A38A 3KG5A 4LLWB 1CYGA 2NY6C 3CWBJ 3SKJH 3VXUA 1T20B 1XGRA 2HSIA 4Y4KB 4DVRH 7FABL 1DP0A 5ICXB 3RWIA 2QQKH 2OYHB 1NGPH 1QSFB 4JO1H 5FUOH 1OGAD 5DUPH 2KPWA 1TT6A 5MI0B 3NFNB 4WGWB 4XP6L 1FFNB 1TZHA 1S7XB 4GAYA 3JUYA 1KQFB 2BNQE 2RTTA 4OCLC 5DQ9B 3T3MB 2CQVA 5AZ2L 4EOWH 4RWYL 5I5IA 1YG9A 4E9RA 1XR8B 2A4CA 3OW2O 3KYOA 1HIMH 1IZJA 2ZFCA 3CQPA 5IOPA 1M1JA 1ZSHA 4HEMA 4O5LH 4OCRH 5EF2A 2HPTA 4PRPA 1SQPJ 4YFEA 5FUZH 1K5WA 1J11A 2ORBH 2X3BA 4RZCB 3NACH 1F11A 3QIBC 1FFOA 1OSPH 3OC8A 4R0LC 3V5DB 2B59B 3V7AG 4KKAC 2PNDA 3TASA 4X8JA 2VL4A 3OF6A 2R1WA 4QHUB 3DX7A 4YXHH 1OP5H 3WUZA 4BZ1H 5AOKA 4PS3A 5FM5O 1NTMG 1ZV5A 1KEGH 1L0LG 4GUPB 5GGUA 2BZCA 5TQ0H 5C0EB 1EHLL 2FXMA 5EBLB 3WLBB 4Z7VA 1F18A 5CIPH 4FHBD 4S2SA 4TVPD 4XI5C 4PHXA 4U0QB 1G6RH 3SJVB 3CFBA 3KW7A 3ZKSD 1XGYL 3NPZB 2XWRA 5F0LB 2NSMA 3GSOB 3KWVA 2KI7B 1Z9OA 3LRLA 4YEFA 4P5TD 3G9VA 2A83A 3I6LD 4WSKA 3BQUB 1WFIA 4UTCA 4HEME 4Y19B 4O4YH 5BS0A 3M9QA 2R2EB 3KPRD 3TBYB 4YQXH 2I60H 3MRKB 4GOFA 1SN0A 1LTGC 4Y9FA 3ZRFC 5BRPA 4J39A 3ETSA 3NESA 2ZKHL 2UZYB 4D3CH 4MGXA 3J8F7 1YYMH 4N2LA 4DFHA 4AKOA 1BF8A 1KTDA 2G30A 4TQEH 3PUUA 1IC5L 1KACB 3KE0A 4RGNC 1D2OA 4WSGA 1E28A 2PYFB 1HEJC 2GJZB 2WOBA 3UTTA 4N9GB 3MODH 1V10A 1OLZA 4MXQD 4UQCA 1OAQH 3DV6A 4Y1AE 1KORA 4LHUA 2RFXA 4HG4K 2NY1C 1BCCE 1BPLB 2J1XA 1HHGA 2Y4SA 4XP4H 1U2CA 3V4LA 1QP1A 4J2XA 1KCSH 5DQDL 4AMKL 5BPPA 2R4SH 2YD6A 3BIAX 4G7QB 3OR6A 1J0KA 2EDDA 3M9HA 1EJFA 3ML8A 4E9WA 3SKJL 3F6LA 1M05B 2I25N 1SQQD 5E56A 1FORH 4QPEA 3SYPA 2QQKL 4DGYH 1NEZB 1CGSH 1NGPL 4JO1L 5FUOL 5DUPL 4K35A 5BS0E 4HHAB 2WK2A 4F9PC 3FT3A 1C12B 3ULUC 3BUIA 1L5GA 1PGQA 3LRGA 4Y5YC 3TDKA 2EIZB 1S9VB 1CYXA 5LGYA 1B90A 1ROWA 4EOWL 4UOZA 2J8HA 2IF7A 2BK8A 3KPSD 4ZRGA 2BO0A 4AJYV 4Z76B 1BVKB 1HIML 4E9LA 4O5LL 5LN8A 4I9XA 4OCRL 4GUOA 1IT9H 2FYZA 2Q1EA 1YO4A 1WAAA 4JFUA 1FC2C 1XTLA 5FUZL 4GDOA 2ORBL 3W67A 2EXYD 2FYYA 2IQ9H 2V17L 3BVVA 3NACL 1OSPL 4KO6A 5EN3A 3DXAD 1YIJP 1T6BX 3L5XH 3RI5F 3RTQA 3X13B 1UWFA 2P5ED 3A5VA 4WY4A 5HGHA 2KS1A 2Z5IA 4UIMA 4N3TA 5E94A 1T4WA 4JQIA 4YXHL 5EU6D 2OYKA 4BZ1L 4G1MB 3FQRA 5F3HA 2YPKA 4BFGA 4ANVA 4UIKH 2APWA 1B6UA 1EZVD 1KEGL 1IGJA 4B53A 2F53D 5TQ0L 3LN4B 1Q82Q 1GZLA 4C56A 1YNKH 4R90H 4J28A 5EFIB 3S98A 1IBFA 1P1VA 2YR3A 2A6JB 3GRWA 4Q2ZA 2ED9A 1GS7A 5D1QC 2QADB 1G6RL 4NPFX 1SF5A 1TLMA 2X9XA 2ENQA 2HZHA 2IJ0C 2YQBA 5DMYA 5EIIG 3F05A 2I9TB 3SO3C 4JNXA 2JWDA 4NPDA 4AYMC 2D0GA 2PUQT 4AV0A 4RMVA 2R2HB 3F83A 4O4YL 1LP9A 4LPWA 1THAA 2K7QA 3RDTB 2D8KA 4YQXL 2I60L 1WAAE 3GMQA 3WIAA 4WNQB 1FI8C 5I9QB 5IWLC 5MEOB 1IKNA 5LKNA 4NKOA 2Q86B 3MRQA 3OLDA 5KEZA 4ZX6A 4D3CL 1CDCA 3E1ZA 3CN4A 2WJ5A 1YYML 2IAMC 1ZE3C 4TQEL 4UNTA 4FXTA 5LCVL 1NO4A 2DZEA 4FADA 3MODL 1FUNA 1WCBA 1RXLA 2FJFB 1OAQL 5FKAA 3RDJA 3SKMB 1I8KB 3TNMB 4ZNEA 4B9ZA 1FO0H 2K37A 4XP4L 4C56E 4NRZA 1Z66A 3S3PA 3O3DA 1AO7D 3LW5J 1KBBA 4J3SA 3STLA 2VN6A 1M1KQ 1KCSL 2P46B 4Z7NE 1OE1A 2A74C 2H32B 2R4SL 4U49A 5IVXB 4FS0A 3LDBC 3O6FA 3WS3B 5FR3A 1DLHA 2P7TA 3HG2A 1FORL 4XNAA 1YQVH 4DGYL 1CGSL 1ZXQA 5DJYA 3L7FB 4CGUB 3OQRA 2XNXA 5L8LB 4TUOA 7TAAA 2BEQD 4LARH 3BMWA 4L1SA 4O2CB 4IDLA 2KI6A 3BD3A 1VACB 5KSUA 3CH8A 4BSVB 3IJYB 2CM5A 4JYCA 2FSDA 1BX2B 2QVIA 4KVNH 1IT9L 5IB3B 3MGTB 4FAAB 4FYRA 5ADOH 3SD2A 2YSTA 5L0QC 2IQ9L 1IEAB 5HSFA 3L5XL 3RWIB 4AUJA 3BOVA 4M7ZC 3BPNC 3GSUB 4HJTA 5F9AC 5TK4A 6CGTA 1RH5B 2ALWA 3CFQA 4WFGD 1UFUA 4YPCA 4FF9A 3ZY7A 4HLEA 4UIKL 1WTLA 2YPLA 1WG3A 2HLAB 3HS0A 1CT8A 1IAKA 1DTUA 2B89A 3CN0A 4P2QA 3BWAB 3QIWA 4WAFA 1WGOA 5IOPB 5H2FE 1YNKL 3EJSA 3GMNA 4R90L 5IEHA 2FFDA 2VR5A 2OR9L 3PWVB 4P9MH 2WBXA 5C0DA 5SWSA 4DQOH 4AGNA 1JY3O 4EUPA 4YDMA 2JB6A 4DGUA 1SXAA 3CLWA 2V9UA 5C6WH 1BV8A 1F11B 5K59E 3D06A 2VDLB 1FL5A 1AGDA 1XF2A 3ARRA 5J3HC 4D6TE 2R1WB 4XCYB 3I74A 3DX7B 4NJAH 5LAXB 4K07A 3QXDA 5K1JA 4MX7A 3VMYA 4RH4A 5CWSA 2OMBA 1Q90D 4RESB