5AW4B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw4B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw4B02
1NAFA 3WGVB 2C9NY 1JUNA 4LC1A 1HUCA 5APUA 5AVUB 5AVWB 3HE5B 3NFQA 5AW4B 1T2KD 1H8AA 2YO3A 2VRSA 2Q7CA 2C9LY 1YYCA 2WTYA 3I5CA 3HE5A 5APWA 1GU4A 1GD2E 3KDPB 2E42A 4JYCA 5APTA 2WT7A 5AW1B 4DZOA 5AW0B 2ZXEB 2IPPA 1OWAA 1CSBA 1DH3A 3VTPC 1IO4A 2ZFCA 2KP8A 5APVA 4B86A 2WPSA 3HTKA 5AW6B 2Q5UA 3A5TA 5AW2B 3MD0A 3NTNA 3NMDA 2H7HA 3HE4B 5AW9B 3MGNA 3VYIA 2WPRA 2YO2A 5AVXB 5AW7B 3M0DA 5AVZB 2YNYA 4RETB 2WT7B 3HE4A 2R3CA 1FOSE 4I6MC 4AUWA 1FOSF 1KQLA 2P67A 3M91A 1GZLA 4M3LA 3VMZA 5APQA 3UIAA 3LIDA 2WWWA 4KHXA 2XU6A 2XV5A 1GU5A 5AVRB 5AW3B 3P8MC 5AW5B 5CMZA 5AVQB 2R5DA 5APSA 3A3YB 1GK6A 3OAKA 2W6AA 1MFZA 3NXSA 1G2CB 5AVYB 3P32A 3L37A 1H89A 4GT1A 1HWTC 5AVSB 4EOTA 5APXA 2P7JA 3KQGA 1S9KD 1A02F 3B8EB 3SWFA 2JJLA 3M9BA 4JYBA 3LIEA 1CI6A 3IR9A 1OXZA 3A7OA 4HYTB 1MUUA 3T97A 3V5BA 1SLQA 2E43A 1X8YA 5AW8B 1SP4A 1J2JB 2N9BA 3TYYA 3V4WA 1T2KC 1NWQA 1H88A 4RESB 3A2AA 3TNUB 1JNMA 3P7KA 1FAVA 1A02J 5AVTB 4AYCA 1GTWA 5APYA 3M06A 2R5BA 4GKGA 3L35A 2Q3IA 3M9HA 3TNUA 4C46A 3O8ZA 2Z5IA 1S9KE 3L36A 1CZQA 4C7NB 3VMYA 2R32A 1CI6B 3V4QA 3VN0A 1HBWA 4AQRD 2QM8A 3TK1A 4I2LC 1HJBA 3M0AA 4C7NA 3WGUB 4XE5B 1GK4A 2QM7A 3VMXA 2Z5HA 2WPQA 2BASA 5AVVB 1MV8A 2P2UA 2XZRA 2W27A
chains in the Genus database with same CATH superfamily
2AXGA 2DJUA 4C47A 1KQSO 4XCNA 2ITDB 1P84H 1V3MA 2GEEA 1QPPA 4PB9H 4FQCL 3LRMA 4N8UA 4C4KT 5E9DB 3UTQA 1G5GA 1FH2A 2VDLH 1PP9D 2O3JA 2VKWA 4QWWD 2OJEA 5DR5H 4IKKA 1BZ7B 4ZFOL 1YNLL 1ORQA 5JNYB 2KZ1B 4LSUL 4LBAA 1I3UA 3SKJH 2C8NA 4KTGA 2IPUK 4FLOA 5DJDA 5DMIL 1BE3D 2A9NH 3ZTDC 4G8GA 1YNKL 4YHLL 1KILD 1N73C 2XTJC 3GNML 4JX0A 4NGHL 2IPPA 3MRLB 3PUCA 1H6FA 2ZP0T 5L8RJ 5FYLD 2WIIB 1QVGO 1P7QD 4XVTH 5ABAA 3MV9B 4TQEH 4U1KA 3QR0A 4F58H 3CFJB 4F92B 1CFVL 1DQJA 4FS0A 5F7HA 3OA7A 2V2WB 2AABH 1IGFH 5IQ7L 1SN0A 3KCPB 2X4QA 4U1NA 3IFNH 5GSRA 1VPCA 3RLSA 2XXCB 5KTBA 4WZ9A 1F6AA 2EVJA 2CCWA 3IFLH 5T1LA 1BYOA 4QF1B 1Z9OA 3MLXH 3H1JJ 4ICWA 5IY5B 1XGUA 4UT6L 3BUBA 1LWHA 1EJ8A 1BSIA 2PUQT 1KIUA 5GGRB 1CDIA 1SDDA 1KPUB 3CXHI 3ARRA 2AK4A 3B3IB 4HWUA 4U3SB 1G9ML 4CILA 3REWA 3IRZA 1HGVA 4FOMA 5EUOF 1QX1A 3OMAB 3APCA 1M57D 4OJFH 1RF0C 5DVPA 3ZVVA 1UJ3A 3AZUA 3LS4H 4MLIA 4HDIB 4JFTA 3SBRA 3BISA 4GAGL 4V1DB 5C3TA 1NDMA 4PAZA 3ZQ9A 1KIPB 3CD6P 3OR6B 1ITBB 2B8OT 4NKIH 1N70A 2RB8A 3MRRB 5F97E 3BFOA 3GLAA 5EZLA 4Z3FA 2IPTH 3AROA 3EJJX 3CX5H 3FQRB 4G9FA 1EZVD 4K5LA 4MSWB 3CXHE 4PJGA 5D96B 3WJLA 1J9QA 1X8YA 5AKSA 1QSEA 4F2EA 5FB8B 4LBEB 5HXMA 1FRGH 3FU0A 1AC6A 1KXHA 4FFZH 4L4JA 1JD9A 1YEEL 4K5MA 5AVTB 2AGJL 3L9EA 4WV1C 5F9WC 3V0DA 1I7RB 3MGOB 1A6PA 3UAJC 3QUYC 4O9HH 1A3ZA 2VRAA 4AV5A 1SQBD 1SDAB 1YJDH 1VQ6P 1S4IA 5KKZC 3DSFL 4P2OC 4OKVB 3SIKA 5EDSA 2FSEB 2MNWA 2R44A 5DJ2A 4EN3B 3M07A 5E79H 3EYSH 4H0LD 3EHBC 3OXRB 1S3KH 2X2IA 3DX6B 5K33A 1QSZA 1DFBH 2AXGB 2EEXA 1OVVA 4XE5B 3O45A 2VDRH 3QJUB 2DH2A 2KZIA 4UTAA 4F7PA 4E36A 1KV3A 1ZLWH 5I76A 2NNCA 2OJEB 2AJSL 1UASA 1NMCB 3V6ZA 1ORQB 1KYOJ 3JTSA 4WFFD 3UJJL 1FZFA 2EDFA 4I18C 3ET9F 3NA9L 5AYUL 5CD3A 3OAZH 3T04D 2B4CL 4YTPC 1KGXA 1P6FA 3DHJA 5DJDB 4G8GB 3WSQL 5LBSH 2BCCG 1MG3C 2Q8AH 3U79A 5T3ZE 1GIGL 5EC1A 1YY8B 1GU4A 3IT8D 1BD2D 2BXZA 2CCVA 4NZUH 5IHUH 3TZVD 5I6NA 3BWUC 3S2CA 1AKJA 1PL3A 3SWYA 3T6VA 3S9DB 1FZMA 4H88H 5EFIA 2G9KA 1P4BH 2GJ6A 1PU0A 3NCWA 1FDMA 4GI8A 4XVSH 4KROD 5EN2A 2AEJA 2AJVH 4MD4B 5DUBA 4YXHH 1UOKA 5L4JA 1N86A 3B9KA 3I3EA 3U1QA 4FP8L 4CSZA 3H1ZA 2WXGA 4PD4J 1EO7A 5A2BA 1F6AB 1EJOL 5T1LB 1R47A 4WGVB 3LQAL 4NJ9H 4H20L 3H0TB 1XGUB 5D1QA 2E9BA 2QKSA 1OP5H 1TNMA 4GAYB 2JQMA 5IHWA 1KIUB 1SDDB 4HIXH 1PZ2A 1H0DA 4XMKL 5D7EA 5ES4B 1MHEB 1UURA 4O4YL 1A9BA 3G5YB 5C08E 3REWB 3VFWB 1MI5D 4X4YB 4WB4A 2J8UF 4UT9L 1BAWA 1C5CL 1E9OA 1U8NA 1NCWH 5BOJA 2X4NA 5JHDE 1A22B 1IBGH 1K8DB 1UJ3B 3SQOH 2UZYA 3BI9X 4ZG1A 3FQYA 5I1HH 5IWLC 2GSIA 1NDMB 4L8SA 2JTDA 3KPSA 3O81A 1RIUH 5KUMA 2QBWA 2XV0A 1MZYA 4QRPA 4QT5B 3G5XA 1ASQA 3CH1B 5E00B 4KJWC 3OM3B 5DDHA 3MYJA 1XH2A 2DQIL 5CU5A 3LNHA 3QCTL 5E99H 1K72A 2WB1A 4JRXB 4J3VA 4PLNC 5DVKA 5JMRA 1G7IA 2NW2A 4LOUD 4P0DA 1NGZB 2ZG2A 2AP2A 3BGFC 1F97A 1HIMH 5DEJA 2NY0D 4XAKE 4AQOA 5MENB 3HN8A 5J11C 4EI5D 1HFUA 2CDFA 4MD5B 5CGMA 2Y7OA 3M06A 2WBWB 3QUZC 3MBEC 5I19H 4LSTH 4XP4H 4TTDD 4C46A 2F53A 2FX9H 4GT7A 3K71B 2KNCA 3PWPE 3SCMD 3O45B 3GI9L 5H35B 4AKQA 3V4QA 2NTFA 4AQRD 1XD0A 3RL0C 3G5WA 4FNLL 3EO9L 4F7PB 1SVZA 5H2FH 1XB8A 4IM8A 1NGXB 5IT2L 3V6ZB 4WNQB 1FO0H 5I2IA 5E1GA 3N43F 1A5FH 5D7IA 1OM3H 4JGMA 5D7SL 3L70E 4HC1A 1WMKA 3HHMA 1TZIA 2VDQH 4NP9A 1F6FB 4MJ4A 1XTLA 4NSKA 1YMMA 1OP3K 4GG6F 3O6FD 3PP3H 1TJHH 4L8DB 4ELMB 2E74D 5FEBA 3GEFA 3EBAA 3LY6A 4N1EA 5SX5H 1FZMB 5KBLA 1RUPH 4ZSOA 2GJ6B 1E4HA 2B77A 2V0AA 3DNKA 4PV1C 2VZUA 3ML9A 4LVHC 4XN9A 3RJQB 4BFOA 4GP4B 5DUBB 3B9KB 1M7UA 1ROWA 2IC2A 1JWUB 5GHWL 2V17H 3ZMRA 1BV8A 1WBYA 3FO9B 3SDDA 3ULVC 5TE7H 1L7TL 4MB3A 3IE4A 1GSKA 1LO2L 3L4VA 5D1QB 2DWXA 2OX5B 2VO8A 4IJ3C 5D1ZB 4KV5F 4WO4C 4ZMZA 3F83A 4FX5A 1H0DB 3Q8FA 2VH5L 5KVGH 2VN7A 2W9DH 3WFEL 1PCXA 4GS7C 4Y19D 1E9OB 3KH4A 1U8NB 2ZPKL 2Z31A 1P7BA 3C60D 3KWXA 43CAA 2UZYB 3BPOB 4NQXA 3GHGC 3VFGH 1ZTXL 4MXQD 4L8SB 2XN0A 4HAKA 1QL1A 5MHSD 3V4PA 4L1SA 1RU9H 4XNDA 1MCRA 2G5BB 3H1HD 1JXDA 4QRPB 4Q4EA 2G9HB 4ACPA 3G5XB 4KY2A 4P46C 5EUKA 4LSSH 4PJHA 4Q9QL 4B9YA 1RAMA 1IGJB 1KBVA 3SOTA 2NW2B 1HXYA 1DVYA 1N0LA 4ZUUA 3EH3B 2AQRA 4N2BA 2HLAA 1RUKH 2I32A 1SY6L 3EGDB 3K72A 2I27N 3KXFD 4W70A 1BQHG 4ZFFA 4MQ7B 1ZLEA 3L3OA 4RO0A 2CDFB 1ERNA 4N6RA 4ZD3L 1XGPA 4PRHE 2VXUL 2CO6A 5TK2A 5HJ3A 2IFFH 2ZOTA 2F53B 1NBQA 4GRLD 1IM3D 2KNCB 4PUBH 5B38A 1BBDH 2NTFB 2BRRH 3A0HH 1M3JA 1N7SD 5IROD 3PWUA 5KS9F 4GIAA 3L3JB 2VR5A 4HFUL 3RRQA 4RDBA 1QTSA 3SYQA 4Z7AA 4URKA 3D3VE 4LCIH 1N7MH 2JE8A 4YDJA 4K7FA 3BD3A 3TK1A 3MGAA 1JTPA 3EOYG 4W9FC 4Y2OB 3APNA 3OAYK 3TIEB 4G7YH 2M1KA 5D7IB 1JO5A 4KUCD 2WTRA 5EEXA 3QBTB 1VF5D 4J3OG 3AS3A 2NX5A 3ELQA 4XBPB 3V5DB 3JVGA 1W72B 3MNMA 3IVKA 1HILA 3GRWA 3QIBB 1MELA 1FYHB 3PV7A 1DBAL 5LBGA 1DLFH 4ZSOB 2DS4A 1SBSL 3Q8BA 4Q6YA 1MCWM 1FNSH 1M7LA 3HB3B 2F8IA 4P23A 5CGTA 4KJMA 1JCVA 4ABVA 5EOTB 1IC2A 1FLTX 1EDKA 1YN7A 2J1WA 3CE1A 4L1TA 2JKLA 4CC1A 1I4FA 3EJRA 4BGLA 1M6UA 2PWDA 2WVVA 4Z77A 4NDMA 3BFWA 3LW5H 1NTMK 4XWGL 3T77B 4KI5E 4W9LC 4QIRA 1MIMH 4B86A 2BERA 3H1LJ 2Q5UA 1E30A 1JI1A 2EXTA 2F9BT 3OKNB 2DEYX 2BZ7A 4X5LA 4ZTPH 1NCDL 5IVXA 4X7DC 4ZYKB 1NLDH 3L73J 4QTIH 2EIDA 5D1XE 5AAMC 5E6ZA 3PRJA 1AGEB 2Z31B 1TPXC 3DVFA 2JEEA 3D8MA 3NEXA 3PPEA 2EDQA 4KX9A 1RE4A 3V9CA 4AVIA 4GUCA 2GJRA 3WKPA 3SEPA 2AXHA 3D39E 3MNVA 4F8LA 4YH6A 5EUKB 1HWWA 5C0RL 1MXGA 4DN4H 1XTGB 5DJTB 1HESA 3COOA 2G75B 2OR9L 1RUML 2WWKO 3NACL 4KFZC 4W7YA 1I3VA 3NJVA 1L7IH 4PWIA 2VJ0A 1CXHA 3DX2A 3U1SH 3A3YB 4J3OH 5E08L 1T0OA 3F7KA 2ZX9A 2COQA 3FSVA 3QUMA 1N0LB 2GKIA 3U7WH 3SJVA 5CJOL 3F7VA 2IOOA 2NR6A 4ZRGA 3QB7C 4JM0A 4AC4A 3DKHA 3G6DL 3MUGA 5DWUH 2Q2EB 4P5RA 4N6RB 4DOJA 4M7ZB 5DUMH 3V4LA 1E4WH 1X9QA 3P73A 2CO6B 4M9OA 1OLZA 1E8XA 3SO3B 4YAQA 1EK3A 2VR4A 4OF7A 4C56E 4FGMA 2N9BA 5B38B 5EF3A 1JHKL 3MV8A 4HWBL 4EUPG 5C70A 4GW1A 4PLJD 2COVD 3RVWC 3PWUB 5B1BB 2B9AA 2ZWNA 5D70H 4A2LA 3M1BA 3BZ5A 4YDJB 2YAHA 1E5AA 4NUJB 1WO2A 3GB7A 2C3WA 3ES6A 5E4IA 4LGPB 2BRQA 1QVOB 2WTRB 5CINL 2HKHH 3HC0B 3RWIA 1I8MB 1HCFX 1FGNH 3GXFA 2UZIL 3MX0A 4FAAB 3TT3L 3FTSA 1L9TA 1NIFA 2WNXA 5LQBL 4CBPA 3IVKB 3CCJP 4MVBC 3SQRA 3TFKC 4QGTA 2W27A 3AB0B 2PCYA 4Y5VB 4EIJA 3SKUD 1KGJA 2L7UA 2VLRE 3I85A 2KK7A 3PLYA 4HGKC 2I07A 5CJ8A 4WCYL 1LNQA 2VTFA 4TN9A 5G5DA 2ORBH 1E3XA 3PREA 1HWHB 4PGEA 1HK6A 3TSIA 1FGVH 3GRGA 4B0MM 1FORH 5F0PB 5HDQH 5AALA 2I9TB 1N5AB 1WG3A 4LLDB 1MQ8A 4JUSA 4NDMB 3WFCH 4ALAH 2VM9A 4DGIH 3QQNA 4Z77B 4M5ZL 1I7ZA 3OF6D 1T2JA 1T3FA 2HX9A 2HX7A 4XB8A 2WYIA 3GGWA 4A2DA 3M8OL 3FB7A 2JH2A 3SHSA 1IBBA 1RK0A 4LRIA 3ZYOA 4RLDA 4JCLA 1UH2A 3LPWA 2H2PC 4XWOC 1DP0A 1U3NA 1HJBC 3DURA 4EUPH 1HH9A 2IF7A 3NDZE 4JO4L 4CN1A 4XXDB 4OGAC 3AT8A 1PJ9A 2R1YA 4GXVL 4HJ0C 1SVBA 1BIIB 3IJSA 4GEIA 5IQLA 5K69A 4FXGA 4R7DA 4FI6A 2I9LA 4TUKH 3P77A 4L1HA 4Z7WF 2KZKA 2VW7A 4Y2NA 5HSFA 4BXSV 2Y7NA 5CEZE 1M4KA 1G1CA 5IJKC 1XAUA 5I1AA 5T1DL 3BWSA 2OL3L 3Q1SL 1GAFL 3RGUA 3ULUD 1QP1A 3EW3B 1B9KA 4MJIE 4NKMA 1P7KB 1EX0A 5HTSA 3VD2A 3MCLH 4AYEC 1B90A 5L2KD 3N40F 3P32A 1L0NG 2YKPA 3P73B 4NLAA 2XWBA 2VQUA 2OV0A 3N1PC 4XPGL 1DJHA 1YJWP 3FCSA 5BRZE 1AO7A 3AE5C 4BQ6A 4KI5C 1PVHA 4ZFZA 2OZ4A 3VJ6A 2X12A 4GW1B 5C0AA 3D85A 4HU2A 2OK0H 2W81C 2A06E 3DRQA 1MWAH 3S35H 3OMIB 3MJWA 2L04A 2EKSB 4F5CA 2ARWA 3M1BB 3GMPA 3RK3C 3AXLA 3QI9C 4WSKA 1NOLA 3GB7B 4ODUB 3Q2VA 4TVPL 5FHBH 1G1IA 2VN3A 2WW8A 1JPFA 1R3IL 1BCCJ 5JUEL 2FT7A 5I8KH 1ZT1A 4HB1A 3MX0B 2MQ0A 4M5TA 4LK4A 3ZUNC 2K1MA 4KOBA 3ZT7A 4P4RA 1S5IH 4FXTA 4DK3A 2Y1ZA 5G5DB 4CN4A 5BS0E 3KLLA 3NIDE 4NOFA 5T3XH 2Y0CA 2DI9A 5DZLA 3U36A 1IQWL 2ODHA 3BP7B 1R5SA 1DD3A 3T71A 4U1IA 2V8LA 1IC5L 2MRYA 3M1OA 4UUJA 2PRRA 2CGRH 2VWEE 3BLBA 4FULA 5DMGD 2J2ZA 2QV4A 3H9SD 5TDNA 3LEYH 4Z7QE 1B6UA 1VIWA 1KENL 2FYYB 1FJKA 1I7ZB 2FRGP 3CFNA 2YPVL 4N90D 4WENB 3GGWB 4LQFH 1AXTH 3FB7B 5AYTA 3K8LA 1G7HA 1EFQA 2VDPL 4LSPH 3FXDA 4I0PD 4BSWB 5KEZA 2WQXA 4A7PA 5I75B 1HDMA 5KSUB 5BO1L 1ZN5A 1N12A 2JKIS 4K2UL 1LEKA 2CAKA 1IM9B 4S11A 5AB1A 4GEJA 3DURB 1X4YA 5C0BE 3AGWA 3BMVA 1B2WL 4XN7A 2GJPA 1MEXH 3IJYA 3P30H 4GAFB 1MFDH 4IMKC 4HUWB 3IJSB 3BE1H 3CN1A 3S3CB 2HFFA 4Z3JA 1EHLL 2I9LB 3UTTD 3ABGA 3P77B 3BPLB 5EBWA 3OAWA 5KSBB 1AQHA 1MKMA 3BIKA 1OAQL 2CGYA 4RDQG 5I1AB 3HG3A 4JO1L 4O02A 4PJXA 4OI8A 2A6KA 3BCCJ 4RMUA 1GZPB 1S9VA 3LNDA 3VGFA 4NKMB 2Z93A 1KGCD 4NRYA 1JD7A 4OCSH 4UTBL 2CH8A 2CO7A 2Y3NA 3EJQA 1PZ3A 4TLFA 5DYFA 3Q6GL 5BZWB 2DL9A 3KZ8A 3BT2L 3JWNG 1V7ML 5CSZB 5T5FL 5FYKE 4QAMB 3BT0A 4XMZA 4AIOA 3FCSB 5SV3A 1KDIA 4DETA 3R0MA 3KVQA 2P43B 4ZFZB 4KZEL 3LRKA 4KO9A 5C0AB 3VFRA 1J87A 3AUWB 1FSKC 4HH8A 1XTMA 2GAZA 3DRQB 3B7YA 1N6UA 1JGUL 4KKBC 3D69A 3V0GA 1RXLA 3I74A 2J5LB 3O41A 3Q5OA 1K8IA 3GUFA 3LCYA 4KUZH 3B71A 1TQVA 5FK9A 1GW4A 1CICD 3N1FC 3FULA 4WUUB 5GZNA 5C0JA 1I9RL 4LF3A 4LNRB 1CN4A 3GMRA 1FAVA 3SDCB 2AANA 1NBYB 4IRSD 4TSCL 5EU4A 3QG7L 1PLGH 2B89A 3GTNA 1P6WA 2QJYC 1H6TA 5FHAL 3UTSD 3QYNA 4DEWA 4OZFA 2BHUA 4BUHA 1J88A 1W2KT 1NFAA 2HTKC 4I18A 3UCRA 3EFFB 3UAFA 2IBZY 1UWXK 4U1IB 4Q9RL 4UUJB 2X6BA 1N73B 4FRWA 2XTJB 3FT2A 5KN5B 1YEJL 2V2XA 2VMFA 2BY1A 3KGRA 1OE3A 3QQ3A 4A37A 4F1SA 1FYTA 4S1SH 5TFSL 2AEFA 4X83A 2ZCLH 4W4OC 4CMHC 3PYCA 1G7HB 3EYFA 1H3UA 2X5PA 3THML 5CCJA 1X7QA 1CXIA 1MFCL 3JWNH 2OR7A 2ROXA 4JR9L 1ADQH 1B2YA 4BQ8A 3F05A 1ZP0C 2R69H 1HDMB 4FFYA 4N0UE 4YJZL 3I56P 3AE6C 3VYNA 4HKBA 1LEKB 2YBGA 4RA3A 5IFHH 1EBAA 3Q2LA 5TQ2H 1JGEA 1QQDA 4DOHE 1JPEA 4HS8L 4BCXA 4NUGH 3H85A 4JK0D 3RYMA 2DM7A 5EUOA 4TULH 2JLPA 2VR9A 3G71P 2PNDA 2XVGA 3H3BC 3Q6FA 2PTVA 1E27B 2EABA 2XBDA 2EE2A 4N9GA 2CKBH 3QDGE 5GXBB 4O02B 4PJXB 3L4TA 4IHOB 1YTZI 4BHUA 1H3PL 1LTGC 3F5WA 3O2VH 4JO2H 5IWLA 3MFFB 2Z93B 2OSLA 1T66C 4NRYB 3VSVA 2APFA 2WP3O 1T3UA 1AZBA 3NABH 4I5BA 1NU1K 3CSPA 5DEGA 1NIAA 5I82A 3HAEB 1NTKJ 1HCZA 2GHWB 3MFGB 2VWEC 3TBSB 1EVTC 3HKZA 3HS0C 5DC0A 3U48A 5EULV 2OS7A 3QQ9C 5IQMA 1T2QL 3OGCA 4UINH 2Z4EA 2IWFA 4HSCX 2E6QA 1A7PL 4JJOA 2IGTA 3DX9A 2N1TA 2TRYA 3STLB 4X98A 1U3JA 5TE6H 3TBTA 3K4DA 4EDFA 1E9PA 1FZJA 4KK6D 4N0FA 1I1CA 3VFRB 2K3HA 2IAND 1JZ6A 4WV1B 1QNZH 5F9WB 1PFIA 5AVYB 3QCUL 4KQ3L 1H89A 2PPFA 2JMRA 3DPDA 3GXPA 3L3KA 2IGFH 4P2OB 1P9MC 5FK9B 5CJXC 2Q1EA 2JB6A 5F71A 1U8LB 1KMIZ 3MUJA 5AOIA 3QUZA 1AI1L 5IF0A 4LF3B 1RZFH 2F2HA 2JKSA 3A21A 4WQOA 2LR2A 2WAHA 3GG2A 2VO5A 5EDXA 3I9GH 5EU4B 2CBOA 5TQ0L 2C4FU 3KYOB 2DICA 3ULVL 1ZIBA 5ITBH 2OSXA 3SE6A 4NYLB 1G7LA 3POHA 1A6UH 1KGWA 4BK4A 4N22A 5DMIH 2VDKH 4OZFB 3O8ZA 1YNKH 4YHLH 4AYDC 4NGHH 3TBVB 4I18B 1NCOA 3E0GA 5IBUG 5EO1B 4DQOL 2MPAH 2WLZA 3NN8B 5KVFL 1T6VN 3FRPA 1CFMA 3NCYP 2DQJH 3FT2B 5CBOA 4GJTB 1T4KA 1CFVH 3H7BA 5IG7A 4HPYL 4MKMA 5IQ7H 2C9VA 4U6TA 3JBG7 4XNBA 2PW1B 1IEAB 2Z65C 5FWRA 4JB9H 2KKQA 1PD1A 1X7QB 2A6IA 4K9EH 4XCFL 1JY2P 3S98A 4YWGL 4ONFL 2X28A 5T3ZL 1QLRB 3F64A 4M6OL 2RA1A 3P9LB 4WHDA 3TGUE 4HKBB 3L8QA 2PGDA 4UT6H 4KPHL 2FYUK 3LZNA 1OK8A 4FMFA 4XN4A 1XH1A 1JGEB 1S7WB 2DQCH 4K5NA 3RDTA 1G9MH 1QAWA 5JIPA 2HKAA 3WJMA 3WU2E 1MCQA 3D70A 1JN6B 1M05A 4HIJA 5JXEA 3KGUA 1DDHA 4JRYA 5EUOB 1ACYL 2J8UA 3CMEP 3W56A 1RHHA 3CCMP 1TKWA 4GAGH 3UBXB 1S7QA 4N9GB 3L72G 4DGUA 5EOQH 4JFXB 3P0GB 2VCOA 3EOAB 4JCWA 2B1AL 4OZGF 4QRBA 4NWTH 2YMYA 4N26A 3GHGA 4NN6C 1J0YA 2OSLB 3EYQD 5KAIE 1BMGA 3P4OB 4A2EA 1CF8L 5GGTH 1EXGA 1XIWD 2Z0UA 3QIWA 1TJXA 3OD3A 5C6PB 1NDGB 5DFVD 1YEEH 2V9UA 3U30C 2AGJH 3CFBA 3GSWA 3RVXD 4NO3A 4NP4L 5BV7L 5D7LA 3DSFH 2YGOA 2X88A 1FZJB 4LLMA 3MUHL 2H9GB 2OQJA 3OJDB 1FJPA 3BGFB 4MQTB 2AV7A 1IL1A 2XACC 5J11B 2JB6B 4ORGB 2Q86A 2UY6A 2NY4D 4C54A 2G0KA 3GJEA 1RK7A 2XHNA 3QUZB 4GFTB 2YOAA 2YZ1A 3MBEB 3AY4A 4J6IA 1XCWA 5IF0B 1R3LA 2Z4QA 1PFOA 1RD6A 1ICTA 5JHLL 4FF9A 4JFDA 3WD5L 3CZEA 3UO1L 2WQSA 3RL0B 4GYBA 3LQMA 2WQ8A 2AJ3A 2FHBA 4R4NC 2B4CH 4GH7B 4PJ9A 4K7PH 3MLUL 1SNRA 4HIPA 3RGVD 1U8OA 2YPKB 4PRDB 3WSQH 1JXFA 1GIGH 3AS1A 5FGCB 1ZRTD 2VXQL 1FC2D 1WWCA 1NTDA 2DQGH 1MCOL 4E5XG 1SRDA 4PJEF 1B0GA 5B21A 1QFUL 1A14L 3H7BB 2UUDH 4JKNA 3KW7A 2FQGA 3JUZA 1KTRL 3IGLA 2C9UA 1H6EA 1FNEA 5B22A 1OW0C 3V0HA 1GC1C 4Q6KA 3MJ8A 1HJCA 1HHKA 4FP8H 2ZAEB 3BRVB 4LVHB 4OCXL 4PV1B 1EJOH 2OXGA 4NQCA 4YK4C 4QRQA 3LQAH 3IDGB 4H20H 4LHUA 2AW2A 2ADIA 1FBMA 3SN6N 1NTME 3VH8G 4XNZC 4KDTA 1LO0L 1E0OB 1TYEB 1ZVSA 4XMKH 4NJAL 2Y5QA 5DJYA 1G7PB 4BCYA 1LP1B 4IJ3B 4HIJB 4LLUA 4WO4B 4UT9H 5E1IA 1A7QL 5FO7A 2WUCL 4I9WD 3RWEA 3QDJA 1YRKA 1JZ4A 3HI1A 3OTTA 3Q0HA 4JQVC 1RHHB 1TKWB 2BLFA 5DTFB 5E1AB 3VFOA 4GS7B 1KB9D 1OALA 2PN5A 3FQTA 1S7QB 2DQDH 4LLVA 3HFML 5DQDL 3GHGB 2ZUWA 2WPSA 3K5RA 1LO5A 2C9PA 1NGMB 5CNHA 2QZQA 2DQIH 4A2MA 3FO2A 1F90L 1KELL 3QCTH 4K3GA 3IDMA 4Y2DC 5G4OA 4P46B 5IESL 3X3GL 5JIDA 2VDMB 3TCTA 4PJ8C 4P2RE 4EPSA 3CFBB 1G2CA 4POYA 1DD4A 3KPMB 4NO3B 3U2SA 2QSCL 2I69A 2AAAA 4UIKH 4LLMB 1YAZA 2QPUA 4OCMC 1PEZA 5F3BA 5FV2A 4X6DE 2OQJB 2UWEE 1QG3A 4JQXA 4BH7A 1TQTA 3KNBA 3BKML 4QRSB 1JUFA 1W2EA 3OKKA 5C09D 5I73C 2ODIA 4FLHA 2UY6B 4HBCL 3GI9H 3BYTA 3OAKA 2YA1A 4MAYA 4U6HB 1HE7A 4FEMA 1R3LB 2DYPB 1AACA 3QZWA 2H7WA 1CGXA 4JL2A 5L8KB 2Z4QB 3H9YA 5BNXD 2DD8L 4WTZG 4GT1A 4NAJA 3ZX1A 4JFDB 1MRFL 5L4FA 4M8VA 3AITA 1U8KA 2I85A 5KS9A 3VQLA 4Y4HA 1MFUA 4KTDL 2AJ3B 3BDXA 2JJLA 1XT5A 2WZPD 3U0PA 5K1VA 4PJ9B 1VDGA 1U8OB 5D2NE 3NSDA 3RGHA 3EFGA 4IOFD 3W67A 3CSBA 3DVNB 1BLNA 3C5ZA 4MA1C 4Z0XA 3SPJA 4HEPG 1G6RA 3II2A 4G7RB 3GJFH 3U46A 1B0GB 4ZO7A 3UG3A 2FLRT 3VRJA 3IFMA 3H1JD 3CXDL 5F6IB 4LSVL 4CW1A 4JFUA 1UC6A 2R0WH 1KGIA 3E1F1 5KLVK 1WVZA 4XODA 3VMYA 3G4SP 3L4UA 5D5ME 5GHWH 4YSOA 3BSZA 2XQYG 3AQXA 4FQ1L 1CE1L 2OXGB 1Q9WA 4NQCB 3WUUA 1PSKH 4E68A 1CFNB 4LHUB 4PGBA 1KFNA 1XF2A 3H6AA 1DHKA 1OB1A 2ADIB 2J88L 3F7RA 4JVUA 5IHHA 2WXIA 3GUTB 4N24A 5I1EL 5K5GB 5SX4I 3TEWA 1UA6L 4J7RA 1SEQL 1ZVSB 3P9MB 4Y4KC 3HE6C 5DJYB 3RVUC 4AYFA 5IGXL 1SN2A 4M48L 5DRWA 5DJ6A 3BAEL 2M2DA 2BFVL 4NKQB 5IQNA 5JO5B 2DQMA 5FO7B 1P5VA 3QDJB 5A6LA 1IKOP 4M61A 1AGDA 3CXHJ 3BO8A 4G2AA 1QHQA 4ZDHA 1IVTA 2JKRM 4ZO6A 3WNNA 1CGUA 3VFOB 3QYMA 1SDYA 5LCVL 3RI5F 2PR9A 2A6JA 2XQ0A 5ID0A 1SEBB 1TPXB 2WLNA 3WS3A 5T3XD 5IR1A 4Z7UF 5D2LE 4OH8B 4PRPD 4MXVF 1LWUC 4Q9QH 1CSBA 3VXME 3FO2B 5FUZH 5LN8A 2YC1A 4FKEA 2PXYA 4E9LA 2XFXB 1CD8A 1JJUA 2R4RL 5KYXA 4MHHI 5DHDA 3UJIL 1AQDB 5K9JH 3PAUA 4IRZL 1SXAA 4E41A 4YDVA 3T4AC 4WTQA 1XTCC 1L0LK 1M7DB 3VXRE 2LOEA 4GUQA 5IJKA 1SY6H 2L5GB 4D6TJ 3KWTA 3U2SB 1P84K 1PMYA 3JWOH 3D51A 2BWQA 3QORD 1SQVG 2X4PA 1J8HA 2FXPA 2J6EL 2ZOUA 3FQXA 1KY6A 1Q1JL 4BH7B 4N8PA 1DVTA 2VXUH 3HE7C 2GVYA 3EJYC 4K5OA 1KYOD 3DECA 1FZOB 4BXVA 1A64A 3ZO9A 5AW3B 3ZKSD 3CC4P 2A4EA 4B9JA 1BYNA 1OGAD 4AH2B 1NUFA 1D7FA 2H88C 3EUDA 1J0JA 1RZKC 4ANXA 2CLRA 1JNJA 1UKSA 3ZPDA 3RFZA 2VRQA 2RBLA 1VESA 2EYTA 2YRZA 4Y4HB 5F21B 4J2XA 3GMMA 3PV6B 1IZNB 3U0PB 5AFAA 5E9DD 1YA5A 1IIIA 1EDQA 5EZOL 1HINH 3K1KC 1A21A 1PNCA 3RBXA 4I88A 3OKOA 3LKSA 2ZSVB 4Z0XB 1Y1UA 3K6FA 1WSST 5CZXD 1WZ1L 2VQ1A 2KLUA 4ZAKC 1DBAH 5DA0B 5EZJB 1IC0A 2IAAC 4P57B 4CW1B 1SBSH 2FX8L 2R29H 5ERWA 5A2FA 3B8SA 3P7KA 5EEVA 2YMOA 3GHPA 1BCIA 1OAKL 5EZIL 1RZ8A 2GUYA 3MV9D 4BWUA 1RPQA 3D05A 2IWEA 2EINB 3S4SA 3ZHNA 3VFTA 1Q9WB 4DP1X 5SWSE 1ZS8A 2ENYA 3MV7A 4NS0A 4PGBB 1XF2B 2AXCA 5HD8C 2QVTA 2NZ9C 4XWGH 3N55A 3G04A 4WU5B 3UGXA 2YD4A 3Q5YA 2WXKA 1IAIL 2OTWA 5DRWB 1NCDH 1QL2A 2Q7AA 1SM3L 1BZQK 5DK2A 3CX5K 5L9DL 4M61B 1AGDB 3CBKB 1AQTA 4ZDHB 4ANUA 2HPCA 2PCXA 2WZAA 2CD0A 2IDCA 4YO0A 5IIEA 3ROOA 1NWPA 4AYSA 5LJYH 2R3SA 4QY8B 2Z35B 1EERB 4C4BA 5ID0B 4BWWA 1KWKA 3D3VB 5IR1B 1BDDA 1WZAA 3DXAE 5DD5L 5C0RH 4F37F 1A4KB 2P5WA 4MCYA 5TH2B 2MIZA 4V1DD 1L5GA 1MAKA 1SQXG 4CA4A 3NACH 2YC1B 1H15B 4IMKA 4Z7WA 2PXYB 3RUGF 4EKJA 4FTVA 4QRRA 5KYXB 1QYGH 4M7LH 2BY3A 2VUYA 4ZW3A 2X1WL 1MJ8L 1UHVA 3HVDA 5CJ0A 1NJ9A 3MRGB 4R4FL 2DMBA 5CJOH 2KLVA 3PWVA 3JUYA 4X4ZA 3MVSA 3G6DH 1BQKA 1YAIA 2BS71 2EE9A 2WWKT 1J8HB 2CLVA 1ZLWK 1MCEA 1MJUL 1NTZG 3L1OL 2WITA 1KJVA 5AL8A 1G94A 4XHJC 1URLA 5CEZL 1FL3A 2A1WH 3OAZK 3RURA 1JHKH 3PXLA 4HWBH 4CKQA 4EN3D 1HQ4A 2F15A 2XICA 3ME0B 4XX1G 5C07E 4EOWH 5F7WC 1VERA 3R19A 1L9NA 3Q2CA 4L9DA 2YPLA 2CLRB 2O6EA 1WT5A 3K6SA 2QR0B 4BBWA 3GMMB 3TEXA 3KPNA 1ZLVH 3M86A 3QPQC 4DK6A 5JPMA 5CINH 1CTNA 1G6VK 3RK3B 3OLIA 1JHLL 2UZIH 3QI9B 1LYQA 3TT3H 4WI0B 4BA8A 4BFBD 5FOBB 3OKOB 5LQBH 2MKLC 3L3IA 1HWGB 3QQXA 2BY0A 4MZ3A 1CGSL 1MVYA 1WAAF 5LGHH 1N67A 1I8IA 3D39B 1JG9A 1NAMA 4DZ8B 1CI6A 5KJ7D 3PWJA 4WCYH 1A0QL 1RJYA 3IDNA 4X80H 1OP5K 1LDSA 2ZUXA 4R3SA 3QFJE 3U4EA 1RZ8B 1SBBA 3FQNB 1WIPA 4GQ9L 5CIPA 5ANHA 1EDLA 2WHVA 1K8AQ 4JQIA 1SJHA 1RY3A 3A2AA 4LCWA 3S4SB 4MBOA 1DVFC 3WEAA 4FHJA 1Z5LA 2VLME 1INQB 5F44A 4FABH 2IBGA 1EZVY 1TG8A 2XY1A 4M5ZH 4RSYA 3ZDZF 3WY1A 2YAQA 3FUMA 3VFPB 3O6QA 3G04B 4KXDA 5A40E 3M8OH 5E1HB 4J3TA 4M6NL 1FVDA 5T1LD 4E42A 3TEYA 2BVPB 4X5XB 1IGIL 1PEWA 4KTEL 2CNYA 2QM8A 4KK8D 4EIUA 4MDIA 3TPUA 3VXNA 4HWNA 5DZ9A 4C56B 5D72L 1T7YA 3WTVA 2ENQA 2HPCB 5DD6B 4MFHA 3H55A 3WKNA 4H8WH 5IIEB 3DC0A 1K4DA 4MQXC 4GXVH 3QXWA 3FWNA 1I1AD 2FBOJ 3NJJA 4DVRH 3DSNA 4GLRH 5B3NA 4MCYB 1MW0A 5E6IC 5CJBA 3OJMB 1XGQA 4FFVD 5KYWA 4FTVB 4QRRB 3QQDA 3VG9C 4JBZA 1ND0A 2X4SA 3EF4A 2YGPA 3IF1A 3KDPB 4N0CD 4AQ1A 5I18H 2OL3H 3Q1SH 1GAFH 4WI5A 3BAIA 1NJ9B 5IJDC 4B9GA 2L8AA 3B2PA 5DJAB 5DEFB 2XX0A 5FKPA 3N0AA 4JRXD 5CJ5A 4H1LA 5HHQB 2PABA 3HKFA 1RMFL 1T1YB 3QEUA 2JKTM 5DRNA 2EIBA 5CEYA 1NU1E 2VLRB 2CLVB 4DPCX 2UZXA 2B5IC 4CSPA 3IBEA 3KPLA 4YE0A 4FA7B 3MO1A 1KJVB 4PW4A 4XPGH 3SGDH 2OSYA 5HYEA 4Z7NF 5MEND 1WC7A 1FL3B 4BZ2L 1U91A 4AGLA 1MHPL 1G9HA 1CXFA 4P2AA 1HQ4B 4TL5A 4L76A 3BAKA 1DEEA 2AXTH 3SFEC 3VP8A 4NZRL 1CURA 4WEEA 2YPLB 3CMOL 2IJ0C 3PP3K 4R0LC 3LYRA 3PGDA 1FSKB 3KXDA 1NKNA 2OARA 4P5MB 4TVPH 2O93L 2FFDC 2YJQA 3MRJA 1N3NA 3FN3A 3GSVB 5SX5K 4DF9A 3CC5A 4HLEA 5JUEH 3N0PB 3S3PA 2XU6A 2DW3A 1GKOA 1P9MA 2VT0A 2WSCH 3V7MA 3H1IG 4UQ2B 3PE9A 5BUPA 4WAFA 5BQDA 3MLYL 1O7DC 1G87A 2MQ3A 4NM8L 4PRIA 4OLYL 2E7LA 4U3CA 4ELKB 1I8IB 3UL4A 4JANA 4BQBA 4PEEA 1NAMB 2NY5C 2O6CA 1JIBA 3NJHA 4K3JL 3I02A 3IDNB 4XBGB 3WFDL 1A02F 3H1LD 1AMYA 4EYYQ 3U4EB 1IQWH 1CLYH 2FB4L 1YO4A 3I9IA 5CIPB 2J5WA 2F58L 1WK0A 3VFVB 1IC5H 3V5BA 1JY3N 2OM5A 3ESVF 4LCWB 1G4MA 1ID5I 1XF5A 2GJ6D 4OLVL 2NY2C 3VCLB 4DZBA 4XB7A 1KENH 3B9KD 1UIXA 2P1JA 4UZSA 3O6QB 4LARL 4B3EA 4DP8X 2QQQA 4KC3B 1OF0A 4R8WL 2P10A 2GSGA 2VDPH 3D48R 4NBXB 5KSAC 2PR4H 2DLFL 3K46A 5LNGA 2K37A 5D1ZD 3L36A 2X4UB 3TPUB 2CPUA 4ZMWA 3VXNB 3P69A 4CMHB 1A25A 2FO8A 2EQDA 4IBUA 4K2UH 2EC8A 2AMGA 4PP1C 3E8UL 4ICXA 1K4DB 2DH3A 2FYUE 1B2WH 1HX0A 1F42A 2PKDA 2V9TA 3PJSA 1U21A 1DANU 3FUIA 3DO7A 1FCGA 3DSNB 4WVRA 3QEQA 3V6FA 1XMWA 35C8L 4GKZA 3QP3A 4ZMYA 3V6OE 5CAYB 5KYWB 2JCCF 1AH1A 1OAQH 3QQDB 4W9JC 1ZLSL 4JO1H 4GG6E 1ND0B 3IF1B 3KEDA 5FPIA 3WLWD 3TCXA 1A7RL 3HFFA 3NSJA 2B15A 3O0RL 4PRBA 1R33A 3RK2C 1I1RA 1XAKA 2N7SA 3FH5A 5B66E 1OT4A 4UTBH 1YC8A 1CK0L 4H1LB 3TWCL 3E9UA 4APQA 3QEUB 4DWHA 3Q6GH 3CZUB 5CEYB 2VN6A 3BT2H 5BS0B 1GW6A 1V7MH 2X1OA 5T5FH 3KPLB 3QJOA 2HFTA 1G5AA 1ZEAL 3QCVL 4N85A 4AL8L 3P2BA 2F7RA 2E47A 3CNKA 5AW2B 3HS0B 3LNFA 3N85L 3BPNC 4Z7QB 1DEEB 1COBA 2Y36L 1JGUH 5INDA 3L95A 2F53D 1FDLH 3TEZA 4Q6IA 1UD8A 4YFEA 5BU5A 5HP5A 2EDWA 2YNYA 2X3CA 3UTPE 1Q0EA 1CPUA 3KZIE 4BKTC 3MODL 1UCBL 1QASA 1VCAA 1N3NB 4PHZA 5D7JC 5J8OA 3CC5B 1I9RH 4QKXB 2KL6A 1A3RH 3KPPB 1N8RQ 2WMMA 1CVRA 3BOVA 4TKWA 1GC1L 5C0IB 4PW9A 1HCYA 1MNUL 4TSCH 2DTMH 2OSWA 5C0BB 4PRIB 5FLUA 1IIKA 3HG2A 2A9BA 5E0FA 5FHAH 2BDNH 2KQNA 2KHAA 4QTFA 1AZUA 1YNTF 1CD9B 4QOKA 4HKZH 2XPGB 5CILH 1MAJA 4KJQC 3LRLA 3I02B 2A45G 2W5PA 1IQDB 3H3PL 2WXRA 3QIBD 2D8KA 5EIIB 3ZYZA 1QRNE 5DZPA 2BH0A 4KROC 3LEVH 2GW5A 1BQUA 3FU8A 1XF5B 3O11B 3HB3D 4O58H 4ENZA 4NT6A 1AJ7L 4I0CC 3TGXA 2Z4TA 5DVNA 1BXAA 5TFSH 1ZV2A 1EWHA 3FTXA 5KG9A 1T2KC 4G9DA 2GSGB 4OD2B 1HVVA 3THMH 4EZLA 4AIXA 3M0DC 1MFCH 2WNKA 3VGDA 4F2ME 4JR9H 4AMKL 5DSCA 1LP9A 1OW0A 1DQTA 3QR2A 3CN4A 5D8JL 1JTTA 1IFNA 3Q3GA 2HVJB 4UTCA 5ESAB 1IX2A 4EDXB 2F5AL 3F7LA 3IKKA 3K6OA 1QGKB 1MF2L 3PJSB 1RKRA 3EJTA 3IJ9A 4HS8H 5CJQH 1HNFA 1YEKH 4L3CA 3PHQA 4ATWA 3S34L 5J12C 4CNIA 3QEQB 4YR6A 4L0ZA 2JK5B 2XQBL 4GKZB 1U8JA 2G5UA 5ETUB 2D7NA 3TO4C 3HMXL 2GFBA 4JQVA 3QG6A 1H3PH 4JFEA 4JVPA 4UANA 4A2HA 5JIQA 4PRBB 3E1RA 3MRHA 2WSFH 4JY4B 5DHXB 4WW1A 4APQB 4NX0A 4R96B 4YFLI 1JZ3A 4NN6B 1OZHA 1S4XA 5JIIA 1NANI 1B3IA 2A45H 3HC4L 1BQRA 1DBJL 1T2QH 5C92A 3CFUA 5JDJA 1A7PH 2FBJL 5KVDE 4NZ8A 4H13C 2B1OA 4L0YA 1ILSA 3VTPC 3B3BA 3U30B 5HGBA 2CLZA 3H2PA 3ZE2F 3H1KG 3QCUH 4HD9A 4HJSA 4KQ3H 5INDB 1K9MQ 3L95B 2AS5M 3HVNA 4IMLA 1IJDB 1C5DA 1S9XA 1OT1A 3CX2A 3DIVA 3HC3L 4W7ZA 1PKQE 2EXWC 4JPIA 3F7YA 1RY7B 1K3ZA 3MXWL 5HI5C 1IFHL 4OW6A 1AI1H 3ZTCC 3V4VA 2RD0A 1TZOA 4N0UB 3HNSH 1J7VR 4GP8B 1FZKA 1IGCL 1FZCC 4LE8A 2MJZA 4PYGA 3Q8CA 3GPEA 3BVUA 4GRWH 5GS0D 3K2UL 1FV1A 2X38A 2FR4B 4KUCF 4DOHB 4ECNA 3V6OC 2G60H 3O6FC 5EA0L 1FVCA 1HL5A 4E9XA 2BZDA 4YBLC 4AQAA 4JG5A 5DJUB 3C8HA 4RRPA 2PYEA 3VXPA 3KLAA 3LPGA 4JHUA 4DQOH 5BCAA 4OGQC 3SBQA 1MVFA 5KVFH 1KULA 4LPTA 3KLKA 3QDGB 1EQWA 4A7VA 4HOWA 1BSHA 4GDOA 1NAKH 4B9KC 3IF4A 4NT6B 1BXUA 1FJ1A 3TVMA 2F7QA 3L5WA 4M3HA 3VM5A 4JN2A 3ULAB 5KLVE 1D2OA 3EJPA 4XCFH 5DSCB 4YWGH 4ONFH 3T2OA 1LP9B 2HRGA 3QUML 5T3ZH 2GBUA 1FNLA 1RVFH 1OTTC 1KCUH 4N5ED 1EVUA 1CBJA 3TIDA 4KPHH 5KWYC 3LIZA 1QBLH 4L2LA 4YK4B 1AFVL 3GINA 5CCHA 3VB8A 3AREA 4JDVA 4P3WA 4F9LC 1ZLUH 2E7MA 4GKGA 4HCGA 4K3HA 4MA8H 4POZD 1UH4A 2KH2B 1I8AA 3PHQB 4ODVL 4CNIB 1ACYH 4Y4KA 5JIHA 3PQYD 3F6LA 3L54A 3DETD 3W68A 1ZT7A 2O6DA 3FZUC 3JSVC 1P84I 3VMXA 1I7TB 3SBWC 1OE1A 2IH1A 2AV1A 3E7KA 3WEOA 5DFAA 1DQLL 1X7SA 4WW1B 2Q20A 1CF8H 1S7VA 5KUKA 2O1KA 3MNWA 1LE9A 4HFWA 1LWUA 1OY3B 2FZ3B 4TNEA 3MRMB 2HG5B 5C0CE 3TEUA 3VXUA 4WWNA 4NP4H 4HK0A 3V7AE 4Y2DB 4X6CF 1L0LE 5BV7H 4FCHA 4TSBL 1TTCA 5APWA 2X2YA 4PJ8B 1P84E 1TENA 4G43A 1S7UB 2CLZB 4KTYA 5HHOE 5HGBB 5TTRA 5I0XA 1P69B 1R8EA 1C5DB 3W5MA 3ZE0E 2ISDA 4ZXBC 2BX5A 1S9WB 4JPIB 4HAGA 3RBZA 1AIZA 3F7YB 1XB6A 2DLGA 1AVAA 1MCWW 3S3SA 1NYHA 2CRYA 1M56B 3V4VB 3HUJF 4F7KA 5I73B 1FZKB 1TQSA 1Q90A 4K07A 5HI3D 5JDSB 2YS4A 3WD5H 3VXQB 4B60A 4PV8A 3I6KA 4W6YB 5GRXG 4L3EA 4RWYH 4Z7VE 3AE3C 2SEBA 3WTSA 3T2LA 4HCRA 1VQMP 3MLUH 4XCCL 2EILB 3QH3A 1CFQB 3ML8A 2E3VA 4AQAB 4PJDE 3MRPB 3VXPB 2VXQH 3GSXA 3F6IA 5G2NA 2XZQL 2CCLA 2V7QJ 5IMKA 1L0NK 1OPOA 1IU1A 1QFUH 1A14H 3FU5A 4MZ2A 4UM9A 1BZOA 2C7FA 1QRKA 1Z3RA 4MA1B 1KXVC 2C9AA 3HZ3A 1QLFB 1BZEA 2MOQA 2V7HA 3D52A 4G71B 4JN2B 3CX5I 4NPFX 1CMOA 3WBDA 2XRAL 3T2PA 4OUUA 4OCXH 4ZQKA 2ICWA 1OGTA 1IGYB 3M9BA 4I2XE 3NIFF 4G80A 3VH8A 4WW2F 3BVNB 5GS3A 1WRFA 2ZSWB 1BJ1H 1GCYA 1U33A 4HEMA 1LO0H 5GTHH 2KDYA 5I8EA 3L3DB 4NENB 2ICCA 4MS8D 2R2CA 1KYUA 2A74C 2D9QB 1A7QH 1IM9D 2NXYB 3ILEA 5C97A 4Y4KB 2ZXCA 1T22A 2XWRA 3HE6B 1UT2A 3DIFA 3CX5E 4XC1L 4PCKA 4R5XA 3B1UA 3WN5C 1NTKD 1CZ8L 3JWDC 1CZQA 2N0MA 3NPZB 3VNZA 5C6WH 1HVXA 3ABMB 3ZDXF 3WY2A 4QTHA 4D9RE 2P47B 4ZTOL 5JMOC 3BKCL 3L3GA 5DQDH 2IH1B 1QLEL 2AV1B 2K9JA 4PJBE 4YSDA 3K8MA 3FRUB 4Z7UA 5IM7A 4OZIF 3B5NA 1F90H 1KELH 4LSDA 2FEEL 1HXMA 1LE9B 3LN4A 3MNWB 5E4EC 5CFAA 2VW6A 2FX7L 3P0VH 3DX7A 5CLWA 2WZ0A 4HFWB 1LWUB 1T1WB 3QC5X 3B2VL 2D73A 5KANG 4QEGA 4Y16A 2OYOA 2OI9C 3CC1A 1JWSA 2HJLB 2ZKWA 2JV6A 1WBZB 3H6PA 2QSCH 3UOAB 3FPXA 1HHGA 3B7SA 1KB5B 4W9GC 3T4AB 5D7HA 2O5YL 3QHZH 1AQKL 2HT3D 3ZKMC 2WCSA 3K4ZA 1LTJC 2WVRA 1GJWA 2BVQA 3HCVB 3J8F7 3ZY7A 1T0NA 3BKMH 3FH8A 3OKMB 4OFDA 4OV5A 1ASOA 4NRXA 5C0AD 4HBCH 5DMYA 3WDHA 4JO5A 4NQUA 2A4ZA 3HE7B 3OJ2C 2EAEA 3FUFA 3S5LG 3CZSA 1GGIL 4ZW8A 4DESA 2Z7UA 4EVNA 3TT1L 4UU9A 2DD8H 1G9NC 1IFGA 3E7JA 5I1DA 1F6LL 1MRFH 2ATAA 2A77L 4MJJA 4UB0L 4PV8B 3I6KB 4WUUD 4PJIE 2NY3B 2E7BA 4LSQL 4KTDH 3SDCD 4RNRA 3EOBA 1HQRB 5C9JB 5M94B 3TASA 4O5LL 4ZKPA 1MJ7L 3JYBA 4CDHA 4LOFA 2ZCKL 3P3SA 5F2FA 3DK0A 1YPZE 4ZOCA 5IMKB 4UOZA 2HXAA 1KFMA 3CWBG 2HODB 1DUZA 3NIGF 2H8PA 3W2DL 4LSVH 3WIHA 3VDAA 4UM9B 5F7BA 5FDWA 2HYMA 3RNQA 1GMEA 4HBQA 2ZAHA 4XMTA 4A67A 2XDJA 5AENA 3S8GB 5AZ2L 4KRPC 4D0BB 2V7HB 1GYVA 4ZAKB 2RACA 2XTJD 2ZKYA 1T03L 1CE1H 4PS8A 2EADA 3VXTA 2MTPA 4ZQKB 3DGCR 4P2RB 3FQUA 4N0YL 1JCDA 2J88H 4G80B 4FNUA 4NO0A 3W11C 4NFCA 4LNVA 2FJGA 4H8HA 1V55B 1UA6H 4IOIA 1SEQH 3GZQA 1KF9B 3OAUH 1KLUA 5IGXH 1A4CA 4A2GA 3NQKA 2UWEB 1NMBL 8FABA 3VI4F 3BAEH 3CVHB 2BFVH 3D08A 3OG6B 2N1KA 3QHFL 4O51B 4U7MA 3I3DA 3PFUA 1FL6A 4LHJB 5E70A 3DIFB 1D6VL 5E9NA 3W0WA 4AG4L 1QMUA 2FJSA 1NUDA 4IFFA 1LDPH 1WD8A 3EFDL 4NRZA 2TSAA 1BAFH 1F4YL 5DURD 4XCEB 2YEQA 1KLGB 1LL1A 3OL2A 5IB4B 1S9KE 2K9JB 3ASWA 2KPNA 3LKRA 3L4YA 3ARFA 1GZHC 1AQMA 3RTLA 4YDMA 2GITA 3LN4B 3WU1A 3UJIH 3DX7B 1GHFH 2PCFA 3RUGA 4R26H 4IRZH 4RAVB 5E6IA 4QJ4B 4Z7OF 1MFBH 2KPWA 2KIKA 2WV3A 3OC5A 5CUSL 4PD4H 3MUDA 3CVCA 3FT3A 1T83A 4KK9C 4XC3H 1Q1JH 1EXUA 2J8OA 2YLHA 2P5EA 1KCSL 1T0NB 2IBZI 3UX9B 1FPTL 2BZCA 4NRXB 2NY5L 2JJSC 5DC9B 4WF7A 4PTUA 2YQ3A 1I1FA 3UAJD 3QUYD 2ZWLT 4WFED 1ULVA 4P2OD 2DQ6A 4D0DA 1Z9NA 2J3SA 4C58B 1LK2B 4L18A 5DLML 1CDUA 1JRHH 3K0YA 1CG9B 4Z3IA 4PSRA 3EHBD 1QFPA 2FGZA 1ZGLM 2E8ZA 4YZFE 3EOBB 4GO6B 4OIAA 1CXLA 4FFYL 1BQ5A 5EZOH 4A6YA 2IBZE 1BOYA 2ALWA 5DI8A 4LGDE 1AS7A 3TN0C 3NP4A 4XO4A 2ZYIA 1WZ1H 4ZX3A 2X40A 2F1EA 2NMSA 1DUZB 1UB5A 4ILDA 1WAAA 1YJDC 2FX8H 1N59A 1XZWA 3IAPA 5D2LB 1KILA 3ZL2A 3BAJA 1OAKH 1XGRB 2HPOA 5EZIH 2O6PA 3O6LH 4PJCF 3DYOA 1P7QA 1CI5A 2FBRA 4FQIL 4R97C 3T3PE 3P40A 1D5XA 1JHTA 2A6DB 3P4NA 3FQUB 4JY6B 5E2JA 1GK6A 3VXRB 1YEGL 2WBJC 5AOJA 4BK5A 2FJGB 2MWCA 2XG5B 1DVFB 2IV8A 1JNHB 4IOIB 4IU3B 2EIKB 4B0MB 4DJMA 3Q06A 1KLUB 3US0A 1Z1WA 2AJUH 2VN4A 1IAIH 1QR4A 1XCQA 8FABB 2WXFA 4BSVB 1QW8A 1RE3C 3O6ML 4R90L 4BFNA 1PD0A 2BP0A 4JFPA 2IXQA 3IN0A 5L9DH 1FL6B 5HHNA 3L9RA 2NXZB 2Z8WC 4K94L 3W0WB 2C34A 5GIRA 3U0WL 2FJUB 1FQ9C 1KN2H 2XT1B 1R3KB 1ES0A 1SYVA 3VMOA 1BVNP 2VRKA 3ATFA 2QDVA 2E7CA 5DD5H 2XVKA 1ZK5A 3DUUB 3LKRB 3PWNA 5JOFA 3ALWA 2C3XA 4IIQA 5C0NC 5HBBA 1XH3A 2PCFB 4IOSD 5AOLA 3VN0A 3K4AA 5E6IB 2VKXA 2XIBA 1GOGA 1MJ8H 4BZ1L 1EEZB 2YGQA 4JBSA 2D3VA 4R4FH 4Z3HA 2VMCA 1OGPA 3VG9B 3ZDWA 3ULUF 1TZAA 2VXTL 1ZGLP 4XCYA 3A0HE 2VE6B 2W8CA 1D5BA 3BVDB 4XPBL 3CPLB 3L1OH 2X4RA 3FB8A 4YHMH 1HXKA 2JI3A 4MA3A 4TQPA 5CEZH 3CU7A 1KCLA 3MUZ1 4Q97A 2B5IB 4UQDA 2C0XA 1I1FB 5DLLA 5SWSB 5TF1L 3AQDA 3N91A 4CU8A 1OQOA 3CCSP 2IH9A 3IGAA 4KXAA 4OLXL 1UKQA 2X53A 3MBED 3QUZD 5AW1B 2QADC 2OTUA 1IMHC 1XGTB 4GAAA 2WN3A 2WTPA 4A6YB 3CFKA 3RY6C 3AWEA 2RN0A 3RL0D 3O3AA 5I1IL 1GGTA 2FFDB 2YD0A 5AG8A 2TRHA 1U3HC 3R4RA 5CKGA 4YSCA 1LGHB 2EDJA 1S9KC 3MLZH 3NTNA 1QWHA 4LEOA 4OZGE 1P53A 3ESMA 4RWHA 1QSFE 3QZLA 4HIHA 1NL0L 3H56A 2YUWA 3DXAB 3WIIH 1A0QH 1YSOA 3NG5A 3WMQA 4HULB 5AKRA 3S36L 4GQ9H 1UTDA 4GPVA 1FOSF 1BD2A 3L74G 2FT8A 1JEKA 1F3RB 4I3GA 4AV0A 3TZVA 4Z7IA 3IN6A 3D4CA 3P4NB 5LBVA 2K1AA 3CXHD 3FU9A 4LPUA 2ATKB 4TRPH 5AW5B 5AVQB 3QFGA 4OLZH 4M6NH 2P8LB 1AGCB 4YIQA 5GGUB 4KTEH 4A2FA 4AZ8B 3LPFA 1AZNA 3QEHB 4X42A 3ZT5A 3MMEA 2BP0B 4JFPB 1LEIA 3ULVD 5KSAB 5D72H 5HHNB 3L9RB 1TO4A 3IGKA 1NCAL 1KCRL 1Y47A 4I0KA 2BVOA 3T2NH 5M95B 5F3HA 4WO4D 4BKSC 5GZOA 2Z91A 3NDYE 4DW2H 5C07B 2Y69B 1NC4B 3LEXA 1MI5A 1IZJA 4FLRA 5FUOL 1ES0B 1SYVB 1F11A 4PRNA 4YX2L 5AW8B 3ZUCA 2F7IA 5SWQA 4RAUA 2PYEE 4TLTA 1OIPA 3V2PA 3WTXA 3HBPA 2JCCA 5T1KB 4HZAA 4UTAH 1UZ6E 3Q5PA 4JREC 1JM0A 4AZUA 4PJEE 3RWCA 2W0KA 3MCG1 4HS3A 3TO4A 1Q9OB 4P46D 1RMFH 2HZHA 4XCYB 1RJLA 5T3ZD 5FKAA 4BSJA 1J0HA 2VXSL 3CCLP 2F7PA 3D12B 3RK2B 1BX2A 1OAXL 3ETSA 3QFJB 1WCBB 4KXBA 1MPAH 4I3SL 2EDDA 2DM2A 2Q76B 1Q0YL 1F1GA 1PYWA 2E7DA 1SF3A 4EI5A 1F8TL 1T89C 3HG4A 1NMAL 1K4CB 4NZRH 4ONGL 1OM9A 3CMOH 4DFIA 1PGOA 2G2NA 1IEHA 3N50A 2XWTB 1TU3F 5JW3L 1MDTA 3GJFK 3TOPA 4KZDH 2DYPD 2NNRA 1NIDA 2ZWZA 1W15A 2GIYA 1GD2E 1NEUA 1PY0A 2XTLA 3MLVL 4LEEA 3O3AB 3W9DB 4OGXL 1PY9A 5D7JB 2APVA 5C08D 5C86A 4OLYH 2ZOOA 4G8FA 5BOZG 3KWWA 3CFQA 3HHSB 5EU7E 2YKLL 2DEWX 2WBKA 4HIHB 3INUL 4JFFE 2D2OA 4NNYA 5JHDD 3L45A 3BKJL 1F1DA 4K3JH 4NM4H 5B3JE 3WFDH 3OWRA 4ETYA 1W0VB 1ZIAA 5FW8A 5KBPA 3N7NA 1JNLL 3O6FA 1BD2B 1MDAA 1MCLA 3WOVA 3MJ9A 1FNGA 3UZEA 1HHJA 4XAWL 4I4WA 4KROB 3L3HB 3M9QA 3U4BL 4R8WH 4NQCD 3PIQA 1GW0A 3L81A 4YIQB 5FXCH 2DLFH 2BHFA 4KI1A 4ZMVA 1NOHA 1TDQA 1XSOA 5T8IA 5HI4D 1J48A 3MMEB 4X6EB 1TR7A 2MQGA 2OQQA 4XAKD 4YL4A 2OA9A 1KXTB 3PP5A 4LSRH 1N9PA 2VSCA 3UEZA 4ASWA 5F3HB 1AC0A 4Z23A 2QGDA 1BDYA 1PZ5A 1QZ1A 1WS7A 2ITFA 3LEXB 2QVKA 4PFEA 1XDTT 5CR1A 4YDIL 3RPIA 32C2A 3PWPD 4PRNB 4Y19A 4WWPA 2IPKA 4YGAB 5IKCA 1E67A 2NY6C 35C8H 3C60A 5SWQB 4RAUB 1E5WA 3DMMC 3BDYL 4UB8E 5DZNA 3W1ZA 5E9AA 2PTTB 3ZL4L 1WFTA 2DF3A 4HMEA 5J12B 1J5HA 5JYLA 4MJ6A 3QT2A 1JK9B 1A7RH 1OSEA 3O0RH 1CLZL 2KYVA 4ASVA 4OSUL 2H3XC 2XQYK 4HS3B 3TO4B 4V2CB 1CK0H 3L70D 3TWCH 3L35A 5I24A 1RJLB 1OPGL 3PP4L 1NIEA 2DEXX 4D8OA 3BUTA 4MZRA 3FFCE 2K7PA 5F89B 1OW7A 1BX2B 4RH4A 5ACMA 4AEFA 2D3JA 3VOPA 4WIQA 1ZEAH 3QCVH 4ONHA 5H8DA 3ISWA 5DU7A 3TA4D 5GRZA 4AL8H 4JFSA 1G6RL 4ZS6C 1PYWB 3BRTB 2FD6H 3N85H 1JZ5A 4GAJL 1VKXA 3MA9H 2VDNB 2HVBA 2Y36H 3IU4L 3S5ZA 1NAFA 1BCCG 3DX3A 1JY2N 3ROLB 2DBLL 4H13B 1L4AC 3OGOE 1ML0A 4FADA 4GRLA 4U1JB 2Y25A 1WHPA 1KXQA 5B38G 2LW3A 5IMMB 2X4TB 2UVFA 4BQ9A 1N7SA 5IROA 5CP7A 1CE6B 4X7FC 1GC1H 1GTNA 1MNUH 4J3OC 3L75G 3TGUG 5EF2A 2CR3A 1JI2A 1J05A 4JPWL 3RVWD 4G6MH 3I5CA 3HE5A 2WBXA 1SQBJ 5FIEA 3S36X 2GIMA 3UTZA 3WEXA 4XHQA 1FZCB 4MXVE 2F74B 4GG8B 4NNYB 4OGZA 4NZDA 2PPAA 2OYKA 4WLCA 2K8QA 2EYSA 1THCA 3RHWK 2QA4P 3KPOA 1E4XH 5ISZE 1URQC 4TM9A 2YRLA 2XLLA 1SQVK 5E24E 3O6FB 4N8VB 4EDWL 2EEAA 5IFJA 1RQUA 2E74B 5F7YC 2KQMA 4YBLB 5E8EA 4MVBD 3V4PH 5DJ0A 3WE1A 1FNGB 1S6NA 1L0NE 1OAUH 4XPFL 3C8KB 3TFKD 1XL6A 1JYWA 1LO3L 1KTMA 4OGQB 5GGSY 2VC2B 3JWDL 4IW4C 4UOJA 1NGYA 4P3DB 3KVPA 3HIZA 2H5UA 12E8L 3PIQB 4KAQH 2YIHA 2GTWA 4AMKH 2CJ3A 3QC6X 4XMUA 5LXGH 3PHAA 4YGVA 1IJNA 1BOGA 4UDTA 1JZ8A 1ZD6A 5D8JH 2WUBL 2GM4A 1UEYA 3TCLB 4S0HA 5I0VA 3ALPA 1KZUB 5APSA 2F5AH 3GHBL 4PJAE 4WWKC 4AX3A 1RUQL 1MF2H 1PZ5B 1QUPA 4H40A 4QRUB 3QNYA 3RPIB 32C2B 4Y19B 3S6CA 5HYJE 3S34H 2IPKB 2OW7A 3FU7A 4AIZA 2XQBH 1B0RA 2H2PD 1C8PA 2M5AA 1XWVA 3H4HA 2A74A 2ZG3A 3D3VD 3HMXH 2LAAA 1FN4A 2AQ3A 5EU7C 4BEIA 4OGAD 2R39A 4ALAC 3WN5A 4HJ0D 2Y24A 1MCSA 2BOLA 5ECGA 1G9NL 3QR1A 2EVFA 1JNNL 1BMWA 4HJJL 1SQQG 3HC4H 3K2MC 3ORJA 2A3TA 1DBJH 3V5HA 5AYQA 5KYYB 1SQPJ 2ITAA 5CHXA 4L5FH 1ZOYC 1M42A 5E2WL 1ILUA 2FBJH 1AS6A 3U6RA 3BW9A 2EDOA 3HZVA 4JFYB 4ZMPA 4DFHA 2EDRA 4L8BB 4X6CA 4HS6A 4BKLB 2YLKA 2CDEB 3US9A 2YGNA 1TCRA 4FTDA 1N6QL 3DJZA 4L3AA 1R5WA 3KMDA 3HC3H 5E51A 5JPNC 4PJ7E 3JSSA 2FQFA 3H6JA 3MXWH 1E5YA 1IFHH 4QLRA 1UWEL 5DMJB 4GOEA 1YUHB 4FYRA 4DK5A 1UVQA 3OHXC 1AE6H 1JFQL 4ZXBB 3IXTA 1P5UA 4KI5D 4RMRA 1M2VB 2W65B 4DVBB 3Q3DA 1SQXK 1IGCH 3HUJA 4HCFA 1MFAL 3HE5B 3OMNB 1H8AA 3SWKA 2XNAB 4KO5A 3K1DA 2DLTA 4PB9L 5D1XD 1JGDB 3QI9D 5GGRY 5EA0H 2BK8A 4OFKA 3BVHA 1LK3L 3WHXA 2HLEB 3T9WA 4EIZC 1KTJA 1X5MA 3ZDMA 3KPOB 3QNXA 4IKNA 1UXMA 4R7NA 2F8OA 4HSQA 4QNPF 4S10A 4UQEA 3W81A 3D39D 3RB7A 5I6OA 1ACCA 5IFJB 2ARJQ 3DRTB 3IU3A 4QHLA 1NTZK 3JWNE 5E8EB 1YJNP 4AEIH 4HG4J 3EJSA 3ZOAA 1LE5A 1LT1A 2OYIA 2BSTA 4Q2ZB 4FA6A 3HG0A 3X1EA 3HI6L 1H8OA 4IFDK 4OZ4A 4OJAA 5TDOB 1D2PA 1NGYB 1AQ8A 1G7MA 1SN5A 1ET7A 3NQIA 4TQEL 1IE4A 4G8EA 2FYUJ 4F58L 1VACB 1J86A 4AVKA 4IBWA 1VQKP 3LRGA 3RVTC 4NZFA 4DCQA 2CUHA 2ZF9A 3QUMH 1I7UB 4YGVB 1BOGB 3WKQA 2IH8A 3GSRA 4PS4H 3OF6A 1KQLA 5E03A 3S8FB 2O01N 1AFVH 4WW2A 3IFLL 2FATH 4BFFA 5T33L 3GIZL 4G6AC 2YZ8A 1HEHC 4C56D 3P9WB 2AAVA 4ODVH 1MLCA 3FU7B 3ZTNL 3AE7C 3GC3A 2OXHA 3HG5A 4JZJA 5CBEA 4YHYC 5IW6A 5IUCA 2IADA 3T2QA 3O9WC 5A2JH 5AWNL 2RKLA 2M5AB 1E2WA 4QYOA 2A74B 3EJCA 4RQQA 5C6TH 3L37A 2NNFA 5DJZB 1E7VA 1NBZA 2WKOF 3V2AR 1FN4B 1GPOH 2W9LA 5G55A 4Z5RB 1WAAE 1RL1A 2QVAA 3WN5B 4X5QA 1VEMA 1DQLH 5DHVA 1AYOA 4QRRD 4ODXA 4U3FG 2JDIH 4QO1A 5FYLE 1QWUA 3LVEA 3B5TA 4GMSL 3L4ZA 2D7MA 4NKIL 4AUUA 1WCQA 1KJ2A 1SMDA 1TTBA 2A73A 3FT4A 3IJ7A 4MMXC 3U6RB 5E4EB 2M3BA 3BW9B 4AT6A 4AVHA 3AFLA 3Q44A 2GSMB 2JJUA 2PYFB 2VLRD 4IRJC 3LS5H 3STBA 4HH2A 2A9AA 4OJEH 4BE5A 2VIRB 3LH2H 4M8QA 5L2KA 3O6KL 2VR7A 4NPKA 4QHMB 1YEFL 1S7TA 1TCRB 2XXGA 2OI9B 3MTXA 1R5WB 3QJFA 5JXAL 1ZWIB 4QJ3B 1JV2A 3NCYS 4LPYA 3EO0A 5ECJE 1F1AA 2D4FA 4N20A 4CVZA 3O3DA 2H32A 2Q2LA 3BWAB 3IXTB 4Z95L 3EYSL 4YBQC 3ZZLA 4GQPH 3WMM0 2P2UA 1QVFO 4XP6H 3A4FA 4OD1H 4FXKA 4ZNEE 4JF7A 4X5WA 4KKBD 2E9JA 3BP5B 4L4VA 1U2HA 4XCCH 1OVRA 1RERA 3Q9PA 4S1QH 5EU6E 2Q7CA 2EDBA 3OX8A 1G7JB 4R7NB 3SKMA 1EFXB 4AJVA 2E42A 4TYUA 4MCZB 4JYCA 4DUVA 4QHLB 4NN5C 5LBSL 2XKNB 1I9JL 3WUVA 4FFZA 5T1JA 3OLGA 3C6SA 4N2NA 1N18A 4RMSA 4OZ4B 2ZFCA 3X17A 5I16A 1BGYJ 3NEEA 3NZSA 4MX7B 4G8EB 1A6AA 1WZLA 4LCWD 5C0GA 2HTKD 1FBIL 1ZJAA 1YI2P 4H88L 3HN3A 4TVSa 5ELIA 4PU2A 2X4OA 4X8GA 1GCFA 1ZHNB 5HYFA 4KRPB 4XNYL 2OMBA 5ILTL 3H9SA 2J1XA 3I84A 5BXFA 4UV7L 4KHTH 5MERA 1DBML 5F0MB 1NBCA 4GSUA 4WW2B 4HKJA 2X05A 3LXBA 5HHOB 2OYHA 4NJ9L 4G1MA 1X5JA 5B1JC 1EO8L 3ZE0B 4N25A 1KTCA 2VDLB 1SXBA 2YAEA 3VI4A 5IW6B 3ATAA 3HBQA 1SLUA 4XC1H 3ISRA 2IADB 2A06D 3BPCA 3HMWH 3LKPA 2ZICA 1MFTA 2JFCA 4RQQB 5G4NA 3FXEA 3CPUA 3KPRE 3BKCH 3ZMNA 1IGML 1NCWL 2OYMA 2ZX7A 3MUY1 1IBGL 1QLEH 4PY7A 2R56H 3PFQA 5I1HL 5AVSB 4P5KA 4Z7VB 3GBNL 2FJHB 5HHME 2DQTL 3MKGA 1IO4C 1RIUL 2YAOA 4H0IA 3SY0A 5CM1A 1GYAA 2HWZL 2FX7H 1Y18B 3QDME 4RISL 3JWNC 3DLQR 4PJDB 3G9AB 2A73B 3FT4B 5FDYA 3VMPA 4M1GL 4OJYA 4AT6B 5FGRA 5MI0C 1DQML 5BS0D 1U8CA 1T66D 4M8QB 5L2KB 3UZQA 2DM4A 3PGCB 1S7TB 1AQKH 2E6PA 4H5SA 1MCDA 1D5MA 2TSBA 3QQ9D 2CIIB 5BQ7A 4HUKB 3EO0B 3UIZA 3EIFA 5F93C 2BVYA 1HBWA 4XOBA 4TNWK 4A1RA 4LSTL 3TT1H 5I19L 3QXDA 1M6OB 2FX9L 2YHGA 2A77H 3MRNA 4X5WB 1DJWA 1YEIH 4LXFA 2BASA 2V2TA 5FW6A 4LSQH 4W9EC 2MCG1 3WFBL 4L4VB 1BPVA 5A6MA 1TEFA 5EIQA 3H42L 3P54A 4JY5L 5C0BD 2X9XA 3VRLE 1F3DJ 4DGYH 4PB0L 2YXWA 2EUWA 1JPSL 4IRSA 4O5LH 4PRID 1FO0L 1MJ7H 4JJHA 1XB3A 2ZCKH 3C1LA 1A5FL 1MCNA 4FG0A 5ANMB 5AEAA 5K5YA 5F8RC 3UTSA 2M8XA 1WYJA 2RALA 3W2DH 5F7AA 4F8NA 1W16A 4Y4FC 2RJMA 1U3HA 3TN0B 3PNRB 4ELMF 2BNRA 2K4AA 5I16B 4DPBX 3ULVE 1UENA 4MRBA 4PJBB 4UDUA 5D71L 5AZ2H 5B39G 2VJXA 3CCVP 1A6AB 5IW1A 1NHLA 4NQEE 5GPRA 4HZLA 3D4GA 4FLSA 1RUPL 1FU1A 2GG1A 4PJCA 2X4OB 5BRQA 3CHXA 5APVA 3SD5A 4N0RA 1WA2X 2AQNA 4LKXB 4AYGA 5A2IH 1YHQP 2ADJB 1C16A 5IHZB 4FLQA 1LJMA 5MERB 3SE9L 4X8JA 3G9RA 4GRMB 2V17L 2XV2A 2VDRB 2EYRA 3EZJB 5TE7L 5FYKD 4JNXA 1X5ZA 2AVFA 1JXKA 3MROA 2W59A 2FIRT 2WBJB 1V05A 3ZK0A 1A1MA 5E8OA 4NQDE 2Q10A 4J6RH 3QHFH 3OB8A 4ACTA 3GF3A 1GS8A 4KMQA 1D6VH 1I1AC 4R9HA 3U4AA 4JDZB 4LT7A 3BPCB 1AGFA 3K8KA 4YE4L 1SMOA 2X89D 3LKPB 4H44C 3RL1A 4XMPL 5JW5B 4X9FA 3EFDH 4YHPA 4OCWL 1F4YH 4X4MA 3QEQD 4PJ5E 1U93A 5AVRB 5CMZA 1OZTG 2QVMA 4PY7B 5F7LB 3OKEA 4ZUVA 4PJIB 5GJTL 4P5KB 3C09C 3IMUA 2VXVL 3UDWA 2A9DA 4BXLA 1CD0A 2X6UA 3PNWA 3DJ9A 4PWGA 1PAZA 4K9EC 5TE4H 5E5MA 3UYOD 2WXQA 1DL7H 4Z7OB 1EGJA 1YN6A 3UC0L 1YPZB 4YSSA 3CC2P 4RAHA 1ZVYA 5CUSH 3UC2A 1YY9C 1H3WM 1X6LA 1OSYA 3UZQB 1QFHA 4CVXA 3M6DA 1G9MC 4N2OA 3TM6A 1EXJA 3OW2O 3CN0A 1JVKA 4H5SB 4HLZG 3P1VA 1FPTH 1D5MB 3PCYA 3HRPA 3JV6A 4EAEA 1X5HA 2KERA 1RURL 1Y0LA 1EUUA 2IMNA 4RMBA 2GUVA 2IANA 1A7OL 3NSCA 3U2JA 1RUAH 2E5YA 5E4AA 1A6ZA 3QXDB 5HVHC 4B50A 5I17B 4PUBL 3MRNB 1BBDL 2C9RA 2VQTA 3VFSA 3IRCA 2X7LB 1EXIA 3B9AA 4P49A 4LP4A 3NA4A 4OKDA 3EADA 3KLHC 1JOIA 3GBDA 1OX3A 1YDPA 2MNJB 3TA3C 4FFYH 8PAZA 4ZNCD 1L0XA 3LZRA 4GODA 5D7KD 5DS8B 1BZ9A 2DWSA 3H1HE 2QADB 5D7IF 4Y5XC 2YARA 4XGZA 4E9SA 3WY4A 4PRAA 4B5ZA 3B5HA 3VFNB 4XA4A 5AVWB 4XNXL 5KAQF 4MJ5A 3TP4A 5E6YA 1U3HB 4R4ND 3PWLA 2BNRB 4TNFA 4IIZA 4UDUB 3RWJB 4JZNA 4QHUA 5IW1B 3QDGD 1YEWA 2VYRE 3OR7B 1ZLUK 1U0QA 3KXFE 1XGYH 5DFWH 3FRPG 2EDXA 5B8CC 3QJSB 3BH8B 1GZQA 1EHXA 1M7XA 5FA4B 1YEGH 2JELL 3DWTA 3NP3A 4Y9EA 5FLVA 3CX5J 4UWQB 1O9ZA 2C3VA 1JF5A 4RVBA 2JTYA 2ZOKB 1DQKA 2EYRB 4CGUB 1NU1G 2PW2A 3MROB 2BOCA 4R90H 4KZCA 4KRLB 2B4CC 1A1MB 4FEIA 4HLZH 3W9EA 3GLDA 5KAFE 5CCGC 3AECC 3PH0A 5GGVY 3ETTA 1FO0B 1A2YA 4FQJL 4K94H 4TMPA 1QW9A 3ULSA 1AGFB 4EZKA 3RL1B 1LQBC 1FFOB 4QCIA 4NUPA 4PG2A 3U0WH 4PLOB 4QD2E 2VDQB 5JOPE 1HSAB 4QLWA 2VDOH 5CF3A 2X6AA 3OKEB 3VU2A 2KBGA 4IS6A 1J9SA 4IGBC 3WAJA 4MCMA 3PNWB 2FDBP 2HH0H 3T0EE 1D6EA 4YC2B 1Z9SB 4DN4L 3F5HA 1B4RA 2W6AA 3LQAC 3VTMA 2NLJA 3MOAL 2Q6WB 5DC2A 1YN6B 5IMLB 1G0XA 1L7IL 1JTHA 4GKOA 4PJFE 4ZZFA 4XPAH 2VXTH 4JREB 4KVNH 5DJCA 1OGSA 2HG5D 1XIWA 4CVXB 3RZCC 3V10A 1PIFA 1UJTA 2DAVA 4XPBH 3WLBB 2YFOA 3TX4A 4Y2DD 2VW4A 5DJXA 4OLUL 1BQHA 1FG2B 4PJ8D 5DWUL 2BHYA 2ESVE 2ICEC 4MDJB 1N5YH 1Y0LB 1J2JB 2ZXWB 3T3PB 1I3RA 4ZI8A 4Y1TA 5TF1H 3RWHA 5LGKA 3AU1A 4A68A 2IANB 3N1GC 2C7UB 2X2JA 3CJJA 5IK3A 1X79B 1H9VA 4AYCA 1E8ZA 2KYIA 1A6ZB 4DO4A 3F6JA 4DKEL 2C3HA 3DX8B 4Y5YA 1R75A 3CDZB 3DK2A 5ESVA 1LMIA 4F7EB 3LRSA 1KBKA 4OLXH 3ATEA 1M56D 1NM9A 3L7EA 1SFCC 2WM0A 3V0JA 1GYWA 3OLEA 1KB9K 3QUGA 4AYBA 1E8YA 4Q74A 1YDPB 4F93B 3L71G 1HYRC 2PAJA 4XX5A 5DK0A 3SKNB 3LZPA 5I1IH 4IJTA 1XFPA 5L8LB 9CGTA 3FO0L 4G6FD 3O4LE 2Q1KA 5FF6A 5ALCH 3CWGA 2E9GA 2HA1A 3GIVB 2VUOA 2XSKA 1CL7H 3FCBA 4UNTA 4PWKA 1ETZA 4YDKL 2WOBA 1NL0H 2OFQA 4Z3EA 4MJ5B 3I50L 4C7RA 1OWWA 2C1OA 1O6SB 2VISB 3ETBJ 2IBZX 3AEDC 2DZEA 4HHAA 4QHUB 4RGNE 4I7ZC 1L2PA 4TUUA 1CVSC 2F6AA 1TETH 4QRTA 1SQVE 2P58A 4U3HA 4GIFA 1KEML 2YO3A 3BQUC 3LPOA 2MCAA 2JIXD 1X9UA 4PIBA 1G7QA 4YFDB 1XR9A 3AVEA 3JV5A 3A23A 1LXMA 1NCGA 4M6ML 5HDQL 1RZIA 2Y72A 3F58H 5A6IA 3R4YA 2BCCJ 3KBEA 3CZLA 3WFCL 2YWZA 4ALAL 5HGAA 1S46A 2Z92A 4DGIL 1AHKA 4R7LA 2CZNA 2DKSA 4YHIA 1M1JC 4WGKA 1KQGB 4KRNA 2O1JA 4LHUG 1MH5A 4XNQB 1MY7A 1NCAH 3A0BE 1BGXL 1KCRH 1PPJG 1E65A 1GH7A 1KIRA 3ULSB 4ES9A 4QCIB 1YMHB 4WEBL 1HT6A 3FS9A 3BZEB 3RVUD 3HE6D 2M3EA 4ZZKA 4PWJA 1WRGA 1A66A 1XO8A 1CC3A 3M46A 3MKKA 3F2LA 4O2FB 5L0QC 4K3DH 4HOZA 1Y9BA 4CU6A 2VM4A 3EDKA 5TF0A 2DIAA 2OPCA 2NY6B 4TUKL 5GS1C 2HYNA 3DMMB 4NIKB 4Y8DC 3EYOB 2E5TA 2NLJB 3VWKC 2BNQA 5D4JA 4ZMQA 1GL2C 1QSFB 2DV6A 1RFDL 3IFOB 4GBXC 1XIWB 3T6WA 5FGBA 1OAXH 5E23A 2GJZA 4L3FA 4EOTA 2MFNA 3KQGA 1BQHB 2V6HA 4I3SH 2H6PB 1H5BC 1KLFA 4MCNA 1LT9C 2A99A 3WNOA 3QUXC 3BVXA 4PJ0E 5FA3A 2GT9B 4LCCC 4UBDC 4M1CC 4AENA 1CJYA 4ONGH 1JY2O 2K78A 2MNUA 4LLWA 5ICYA 2AJYH 2R9HC 5ESVB 3RIAK 3FQWA 5C09A 1S1CX 3HE7D 3EJYD 3HD7C 3L7EB 2OK0L 3NEOA 4RCAA 1ZV5A 5IEKA 4FMKA 1FDIA 1SS1A 1MWAL 4YSEA 4ADIA 3S35L 1L4AB 2YXQB 3T09A 1NTMD 2NZIA 5DK0B 3MLVH 3QZWG 4FG6C 4K15A 2CDGA 2E4FA 1SQXE 1NWOA 5FHBL 2R32A 5FF6B 4AYID 2WINB 5I8KL 2YKLH 1ETZB 2WZPA 4C7NA 2DYRB 1NEZA 1SOQA 3INUH 3JWOC 4OZIE 3BKJH 3T0EC 2C1OB 5KVEL 4F2FA 5HVWA 2E8YA 3FPYA 3KZIH 4GLRI 2R2BA 3KGTA 1TTRA 2C9NY 3V2QA 1JUNA 3IMVA 4ZX5A 2ZUVA 5BOPA 1AMXA 4Y1AE 5CS7A 1UA7A 1NTZE 4W9CC 1G7QB 5DRXB 1URQB 1U8IA 3CLFL 4HH9A 3MAWA 2CR0A 4ZAKD 1MFNA 5AB9A 3D34A 2WYHA 2OJZL 1WF5A 1JERA 1X9RA 2CGRL 1RZIB 1UCTA 3QWQB 3RG1C 2N9YB 3E2HC 3OLDA 4XN2A 3PL6C 4P2RD 4P5TC 3LEYL 2PPCA 2BINA 2Z92B 4XX1E 3MRIB 4LQFL 4YXKL 3SGDI 4XRCB 4N68A 2BIHA 4WNJA 5HD8D 2C9SA 2NZ9D 3SBPA 1E8WA 1PZDA 4ODTL 2Y2YA 3T6ZA 4PI0A 5I0WA 1DUYB 3DUSB 4FJ6A 5F1IA 1KDJA 3O2DA 4YDIH 2BFGA 3RZWA 4A7GA 4JFOA 4N9OB 1PX8A 1QSVA 1R24A 4PD4K 3BDYH 3NTCL 1C9SA 3GMNA 4JG0H 3BE1L 5TD4A 3ZL4H 5F1NB 5KSBF 2Q7NA 5FFLA 3LSOB 1CLZH 2BNQB 4OSUH 4PRPA 3ECBA 2YD9A 4XB3A 1L6ZA 1VQ8P 4MN4C 1HNGA 1S7XB 5GGSA 4XO9A 4RGNC 1OPGH 4JFFB 1RZJH 4GXUN 5DZOA 1D7BA 2M26A 2Y06L 4XI5C 2AXTE 1N10A 2GJZB 2QQKL 3KAAA 4IHBA 3CU1A 1QBML 2E7HA 3NFSL 1H6UA 5CP3H 5AAPA 4N90E 1G6RH 1KLFB 5AQ0A 1PX3A 2DJ4A 3QORA 5AOZA 4GAJH 1N64L