5AW4B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw4B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw4B02
2P67A 3A3YB 1OXZA 3LIDA 1GTWA 1NWQA 5APVA 2R32A 5APWA 1G2CB 4AYCA 1MV8A 1T2KD 5AVUB 1HUCA 3WGUB 1JUNA 4LC1A 3L35A 2P7JA 5APYA 2YO2A 2N9BA 4C7NA 1DH3A 3VN0A 4XE5B 5AW7B 4GT1A 2WPQA 1OWAA 2R3CA 1NAFA 3SWFA 3M9BA 3M0DA 5AW1B 1GU4A 4JYCA 2C9NY 1A02F 1X8YA 3TK1A 5AVRB 4RESB 1H89A 2Q5UA 5APXA 5AVZB 3KDPB 3HE5B 2R5DA 5AW4B 3MD0A 3L36A 2Z5IA 3NTNA 5APSA 3M0AA 3NXSA 3VMYA 3A7OA 3NFQA 3P7KA 1T2KC 2Z5HA 3MGNA 1CSBA 1YYCA 5AW0B 4KHXA 1J2JB 1SLQA 2W27A 1SP4A 2H7HA 5AVWB 5AW5B 3VMXA 3V5BA 3I5CA 3T97A 4GKGA 5AVTB 2ZFCA 2W6AA 4AQRD 2QM7A 1GZLA 2QM8A 5AW6B 2XU6A 3VMZA 1FAVA 2WT7B 1H88A 3IR9A 2E42A 3P32A 1FOSE 1MFZA 3HE5A 3A5TA 1CI6B 3HE4A 2Q7CA 5APQA 4EOTA 2YO3A 5AVXB 1CZQA 3TNUB 5AW2B 1A02J 5AVSB 1HBWA 2JJLA 1GU5A 1MUUA 2WWWA 5AW9B 3L37A 5AW3B 2BASA 1FOSF 4C46A 3VYIA 3TYYA 5AVQB 4DZOA 2R5BA 3A2AA 3M91A 5APUA 4HYTB 4I6MC 4AUWA 3P8MC 2IPPA 3WGVB 3LIEA 3M06A 3M9HA 1JNMA 1HWTC 2XV5A 1H8AA 1GK4A 2VRSA 3B8EB 2WT7A 2ZXEB 3V4WA 1IO4A 1CI6A 3HE4B 2WTYA 4B86A 5AVYB 3V4QA 3UIAA 2C9LY 5CMZA 1GK6A 5AVVB 4M3LA 2XZRA 2WPSA 3HTKA 5APTA 5AW8B 1S9KD 2KP8A 4C7NB 1HJBA 3NMDA 3OAKA 4I2LC 1GD2E 4JYBA 2Q3IA 2E43A 4RETB 1KQLA 3VTPC 3KQGA 3TNUA 2P2UA 2YNYA 1S9KE 2WPRA 3O8ZA
chains in the Genus database with same CATH superfamily
4R26H 4NWTL 3L08A 3FTGB 4ZUVA 2JMRA 3T8MA 4Y7MA 2O5XH 5LLIC 1FFPB 5JZ7D 1MNUL 2C4XA 1QL2A 4DN3H 4YFEA 3QPXH 5BVJB 2IALA 4F7PA 4XOBA 5EFIB 2XQBH 1G7IB 3KPSB 2CO3A 2JKSA 2WQVA 5AOMA 3IVKA 2FX9L 1RJLA 1T0MA 4HGWA 2GUOA 3NTCL 4LLWB 3CMOL 3RU8H 2EDEA 3KPRA 1PG7H 2I27N 4CKVX 5ESQB 3LXAA 4FQIL 1GGCH 2F54B 1F41A 5ABAA 5LCVL 3NOIA 1S78D 3AEEC 1EK3A 4JR9L 2DLHA 4L1SA 1R3KA 4J27A 2DMCA 1TQTA 1C5CH 1WAPA 3MRRA 5L8KB 1J2JB 1L3WA 4W4NA 5IIEB 4MDJA 4CU7A 1O0VA 3I9GL 4WIQA 5F3BA 4K9JA 3FH7A 4PUBL 3DGGB 3SE4A 3MJ8B 1C12A 5CZXC 5HDBB 1MHCA 1U95B 1NIFA 3BH9A 3W11C 1K8AQ 1G7QA 3KJ6L 4WWKC 1CZ8H 2AK4E 2X7LA 2F61A 3GBMH 3I56P 1CLOH 1NC2D 4XN7A 5GGSY 1AMYA 2I07B 3VFGL 1CFQB 2C3HA 2DBLH 3P11L 2R44A 1NKNA 4XTRC 3RIAF 1AD9B 2H0JA 3H1LD 3RA7H 3FTUA 2YAPA 5F97E 4FNRA 4KKAD 4LPXA 3M17A 4AV4A 2BWDA 5CLTA 1XVSA 3UJJL 1BG9A 4U1SB 1BOYA 4LGRB 2YD1A 4JFEE 2Y0EA 3KZIE 4XX1G 1EZVX 3UDWA 1HJCA 5PCYA 1D5IH 4M8UA 3V6BR 3KPRD 5EF0A 4OR1A 5D1QE 3QRGH 5DJYB 4ZO9A 1G7LA 2W95A 1B0GB 4HWBH 1E5CA 2HN7B 5FA4B 5TDOB 5FDWA 2GEEA 4GP5B 4OCWH 3UTZB 5I1IL 1YPZB 4UIMA 1YYML 4XRCA 5L88H 2VLKD 1JGLH 4U1IB 5IVXA 1ZHKB 1LL1A 2AVGA 4X99A 5C0BA 4LCYA 3QJXA 1A6UL 1P4IH 4S2SB 5C09A 4F24A 1JG9A 5EU3B 1JM0A 1Z0NA 3LNHA 4PJ8D 1AR1B 4JG0L 3NH7L 4ODVH 4RBPK 4N0UA 2UYLA 1AFVL 5F3HA 1QLED 1VAHA 1P5UB 1I31A 5ALCL 3N43B 2QR0B 4ZQKA 5B8CC 2H1XA 3CK0L 4U49A 2VLRB 2FYUE 4I2LC 1X4XA 4F7MA 2WD0A 3FU0A 1FCCA 5K1VA 1QAWA 3PGCB 3KXFD 2Z31C 3KXDA 1WGVA 4FLHA 5CP7B 3CL3D 2KZ1B 2OMNA 2WQAA 4UAHA 5F8QC 1K85A 2Y1AA 5C08B 1TQBB 4L8CB 3X11B 4NQQA 4UT6A 4OGQB 4I4WB 2H3KA 3VRJB 3DBSA 5SWZB 4OBRA 4F80A 4OZHF 1ZW0A 1FN4B 3I9AA 4E36A 3HZKB 3SQRA 2YGNA 4Y4FC 25C8H 3KH4A 3L5HA 3EG9A 3PRJA 3EH4B 4UTBA 1VRSA 3C12A 1FNEB 1QBAA 4CW1B 5HHQA 1IFPA 2VISB 2WZ7A 3FN9A 3IRZA 3EQ2A 3PUUA 4M9PA 1SY6A 1UB6A 3V0FA 1SBSL 2ZG1A 2ROXA 4U1NA 3HI6L 1ZV9A 4OI8A 3OQRA 5EU6A 1CFSB 3P4OA 1U21A 1J5IA 3DVNB 4PJ8A 3FRPG 3KYOA 4WHYH 4WI9A 1P7QD 1F4WL 1QVGO 1E5UI 2Z92B 3KW8A 5KKZB 3IU3B 1N7ML 1ND0B 1UM4L 3ALWA 3GC3A 3L5WB 4HJJL 2KSEA 1AY1H 3DX9A 1XL6A 1U8JB 4AGOA 4DOHB 1JGEA 4GKGA 4C56E 1T04B 4YZFE 4Q2ZA 3PAZA 4C54A 5D2LF 1IBYA 3DNKA 4PJAA 4XPHH 1L4AB 1NU1E 1FO0A 2I1KA 1DX7A 4U3XA 3TNNB 1D5BB 5DMIL 3KPSD 3RVTC 1F3JB 4LEEA 4XPGH 1MFZA 1OHZA 5B1CA 4KI5D 3D39E 4MRCA 1ZLEA 1QRNA 5FLVA 2HJFA 1JV5B 2BVUA 1E43A 1SXZA 1SQVE 4JKKA 4RVBA 2FH8A 3L2LA 4G7YL 4AL8L 2FWOA 2YKLH 1S7WB 2Z8WC 4GI6A 1BQHB 3MLRH 1F6FB 1QD0A 1TF4A 1ZCRA 3U9WA 3WBDA 1JFQH 3B8YA 3ZDXE 4LLDB 1KYOK 3G7TA 3MN8A 5D5ME 4Z76A 4L1HA 2GJ6A 3UIYA 3B5NC 3JWNC 3MA7B 4PPTA 1RMFH 1KIRB 2Y23A 4ZMLA 5I5IA 3QARA 1MCLA 5HHME 3U6RB 4HJ0C 5G4NA 5A16B 1QHOA 1OD7A 3IGKA 5DZ9A 5EOQH 3UABA 1WEJL 4GIFA 3L7FA 4H8QA 4FL4B 1NC2A 1MXGA 2XPGB 4JFOA 2XTJB 1VQKP 3PWPB 4EBQL 5IT2H 3LIUA 1FSKC 5K9KB 1FZCC 3GPSA 3I85A 2YAEA 4HKJB 1IT9L 3IGLA 1YEHH 3WKML 2CM5A 4G71B 1CICB 4HK3N 2DJSA 3ROLA 3CBRA 3D85A 5AB0A 1WA2X 4UMSA 4NYLB 3FUDA 2BFGA 1DL7H 2X0UA 4BXLA 1S46A 3MQIA 2NY2C 5KSAB 2Q9OA 3H1JJ 1RXLA 4Y9EA 4OUUA 3NVQA 1CL7L 5DMKB 3ZE2B 5EUKA 2W0LA 3CH1B 3L3GA 5I2IB 4WU5A 2N1TE 4CBPA 2WOYA 5GRVK 3KYMA 4FHKA 4DKFL 2C0XA 5EDXA 2D7NA 4NQDA 2D9QB 2G5BB 3L70D 2ED6A 1RK1B 4WHDA 1QSFB 4BCZA 2J5WA 1CT8B 8FABA 5LGJA 1FE8H 8FABB 3RUGB 4N8VA 4ZYKB 3BCCJ 5IMMB 5I1JH 1N7SB 1RQVA 2P8PB 3BH8B 3B5ND 1E9PA 4PJBA 4W81A 1R5VB 2VLJE 1MQKL 3CWBG 3EADA 2EDMA 4P9HC 2KQNA 5DFVD 5F9OH 4HQQL 5I66B 4M00A 4NM8H 1J48A 1JY2N 1SJHA 1QPPA 3GTNA 2ZCKL 1GR7A 1CE6A 1TZGL 4LSUL 2BY3A 1BZ8A 5AOJA 4N5ED 3MBWA 3G4SP 3HJ0A 1K8DA 2BXZA 4M7LT 3CFBB 5HDBE 3RQ3A 3GEWB 2X6CA 1MW0A 1CICA 2POHA 1WFIA 4H5SB 4KHTH 1AIFA 1NC4B 4O58L 5I1KH 5EUKB 2EDLA 1KILE 3H42L 5D72L 4UDUA 3LEXA 3BLKA 2ZT9D 2NRDA 4CVZA 4ZNCA 1JP5A 1R34A 3H1LJ 5DJAA 1JVKA 3U9UB 5BW7A 3DX8A 3WJMA 3DX6A 4CBZA 3S3PA 1QP1A 3OXRA 1L2PA 4I7ZC 2QADB 3HPJB 1SDAB 1QWUA 2X3CA 3B1UA 3HUJB 4KGJA 4WDIA 2EE0A 3WIFA 1BGYE 2VMFA 1YEEL 3ZT6A 4PJIB 4C4KT 4JO5A 3VXNA 2XPGA 4JFOB 2N1TD 2HKAA 1BZ9A 4ALAL 2AITA 1BQHA 3B4NA 3LIEA 3U0TA 1Q1JL 2MTPA 3GIVA 4R97B 5J11C 5CCHA 1A7PH 2X38A 3QORB 4YDJB 5DRXB 3V4WA 4BJLA 2K7QA 3IS1X 4BV1A 3HFMH 1S7TB 4P9ML 4PD4K 4RMBA 2V9RA 4TLSA 1Q2NA 2Q7YA 4H4NA 2A06E 3SSGA 1XCXA 5FO7A 4JE4B 4Z76B 1SXCA 4ADJA 1EDKA 1PG7W 5E2VL 3FO9B 3L1GA 3AE9C 4PJAB 1C16B 3DTUB 1VENA 2V7HB 5HGAA 4DKTA 1IEBA 2QELA 3K4DA 3QNZB 5IJKC 4K7PY 3RKPA 2G3ZA 1CURA 4OD2A 2Y36L 3KHQA 5TDNB 2JCCA 1Z9OA 2VDKH 1WZAA 2WVRA 2NPSB 1R5WB 1RIUL 2HRGA 2NW2B 4HFWB 3CSPA 5AL0A 1EEUA 1CF8L 2FE0A 1T1YA 4J3OF 1L0PA 2V2WA 2Z34A 2YXQB 4NZFA 5DVLA 5F96H 1JTOA 1U3HD 3TO4C 1DANT 1CFSA 3P4OB 2EH8H 1L0NJ 4GPVA 3EOYG 4HIHA 3CUPB 4KQ3H 4M6NH 4WGVB 4JRXD 2P8LA 4KQ4L 4XP9H 3CXHE 5IEKB 3BASA 4JYCA 5C07B 1TNNA 4XNUL 2RMNA 4BE5A 3B3IA 3D25B 3UPRA 1XF5A 4XNZC 5IV2B 3NTNA 5DYOA 3SGJC 1NFDA 2HFEA 2QVMA 3CWBE 5DJXB 2KBGA 1CSBA 2EYTB 4PV1D 4NQTA 1UZ6F 5FFOA 1UTDA 3APMA 1KCKA 4KO9A 2C9XA 5GS1B 3WN5C 2MPVA 4XZUB 5BRZA 4A7QA 1JEKA 1SHXA 2FX9H 4IDJH 5J89A 2ICWJ 5C08A 4LASL 2QFRA 2YPLD 5F7DB 1JF1B 5FF6B 2Q8BH 3V5BA 1MH5B 2UY6A 4JFWA 3ZL4L 4K7FA 5B3JF 1UFGA 1CL7H 2DWSA 2F54E 4GRWH 3FXDA 3CMOH 4XCEB 5EIVA 1PPJG 5FM4A 2YPKB 5F0PB 1H6TA 4M6NL 4PSPA 1KN4H 3GLAA 4JFFE 2WKOA 4PAZA 1OM3L 2QR0A 4ZQKB 3KWWA 5KAFE 1U8OA 1OLZA 1WVZA 3V7AG 4UTAH 2VN6A 4MAYA 1I4FA 1A0QL 1ZV8A 2DEWX 3Q2WA 5HHOA 4M1DL 4OFDA 5IROA 2YO3A 4K7PH 3DX7A 5A2JH 1OAYH 3T3PB 2XFXA 1T2QL 3VXRD 3PWNB 4N4YB 3VE0A 2WTRB 2ZG3A 4F7MB 3HCVA 1FLRL 1OSZA 1TMCB 4H26A 1G1CA 1TLKA 4XRCB 1RZJL 3SCMD 3TYYA 1AGEA 1U6AH 2X4QB 3ARVA 3BT0A 3VQLA 3WMSA 4GAYA 1DFBH 3RWFA 3QCVH 3H1LE 3RB5A 3BW9B 4HQQH 4NZRL 4IOIB 4PRIE 5M1BA 2NTFB 1LWHA 1ACYL 4WY4C 1T80A 4PB9H 4WI3A 1ZHKA 2IWFA 4X99B 5DUML 3TH3T 5CEXB 1AG6A 3S3SA 4KKRA 4YK4C 2QKIC 4BIKA 3WNIA 4Z7VF 4UIMB 4DHLA 3ILPB 5E9DB 1AHMA 1NTZD 1NEZA 5E8PB 2WY3B 4YS4A 2EIJB 1CFQA 2K3HA 1KJ2H 1NANH 4D9RD 4BRJA 3P2BA 3SQOH 3QHFL 2NR6C 3D69A 4OCNC 4CVXB 4EIJA 2DQUH 4RNRA 2YLKA 2V2TB 2EVJA 2YUXA 3DGGA 4X4XA 2OQQA 4X4MA 1RZ8B 1HYSC 4KDTA 3ARUA 1ZHBA 3BC9A 2OCFD 3ASNB 4KK6C 1UXSA 2BJML 4MXQD 3U2IA 3K6FA 1QFWM 2R1XB 2YRBA 4DPRA 1MHCB 1U95A 2EXWC 1A7QL 2EEAA 2EDHA 4RAUB 3ZLQC 2IANE 2P24B 4KMQA 4Z7OF 1S4IA 3NCYP 4RFEA 2ZX9A 3BAYA 2ZUQC 2ZVNB 4HK3J 4NC1C 3IJEB 4PD4J 4N2KA 5DK3A 4WZ9A 3CX5D 1UC6A 2FTAA 1RERA 4BH8B 1AGDB 4Q6KA 2FYVA 4U6VH 5K59E 4JHZA 1LHZA 3CSYB 1YQVH 1UIXA 3CFDB 3GLDA 3EJQA 1DJYA 1V3LA 3VVVA 2OR9H 5F9OL 1YJDL 3DYPA 3MRBA 3ARZA 4P2YA 4Z0BL 3RWIA 3FAXA 4XCYA 4OQTA 3RHWK 1N8OE 3L95A 1EEQA 3RB7A 2BSEA 1G6RB 5C0IB 3NSDA 1XFPA 2GSIA 4F7PB 3GG2A 2FFDB 3CQQA 5CCGC 4YEEA 3FF7A 1BE3D 1HOCA 1LTXA 1W6LA 1ZANL 2G9HA 4JDEA 5GS1C 5DMJB 2CK0H 1W8NA 3MRCB 4H8HA 1RU9H 5KTEH 4NC1E 3NJGA 4M03A 4XNYH 4MMZB 4AIEA 1R0AH 1J1DB 1S7SB 2V9UA 3LS5H 5C9JA 4DTGH 2Z0UA 1IGCL 4JR9H 3D4YA 4IL6H 4M7ZC 1PAMA 4LLMA 1YBKA 3LQMA 1MZZA 4P57A 4BELD 4GAJL 1QA9B 1NCBH 2C1OA 4KRMB 4UWQB 5CZVH 4MS8D 4ZI8A 3F6LA 4XVTH 3T3ME 5HP5A 3P0VL 3RPKA 1ETJA 2MOGA 1IAII 1U8QA 2V3FA 5EN3A 2R0WL 1GW6A 2APFA 2ENQA 4LLUB 2C4FT 3IRPX 3QIWD 4I9WE 4K5PA 3UTTE 5D7IF 5DGQA 4PJDF 3WIHL 4QY8A 4LEXH 2QA4P 1CXLA 5JW3L 1XF1A 2AS5M 1OLLA 1EANA 3NN8B 3MU3A 5CHNB 3SE3A 3V2NA 4NN6B 3VI4E 4GFXA 1KB9D 2Y1VA 4WKZB 1ZRUA 2A73B 2ZX6A 3AXLB 3FOLA 5AW8B 3HZYB 4M8QA 3BPOC 3P73B 2CPBA 3TYGH 2E6JA 4LVOC 3PFQA 2DL9A 4XHJC 3Q44A 3RVWD 3DJSA 3MRLA 3QCTL 2OMZB 4IMLB 4CU8A 4EO5A 3HC3H 2CMRH 3LCYA 3PS6A 5HHNB 4S1RH 1K3IA 3D18B 3U9PH 5CILL 3B6SA 2D03L 1IEAB 1N59A 3S35X 1HQ4A 3O6FD 1X3DA 2GC7C 1FC2D 2N56A 4IBZA 2X9XA 1FZKA 2WLZA 1UKQA 2VC2H 5AVUB 4L8BB 4NJ9H 5I19L 1WFJA 4LASH 2ZZUT 5IQOA 5A2KH 3RVUD 1ADQA 5C9JB 5TPWL 1U8IB 1J11A 3COOA 3OLEA 2BCCG 1TVBA 2PP7A 2WKLA 4PGDB 2CIIB 2KYIA 2WM0A 3GMRA 4X5QA 1AXSB 1AI1H 3L74D 1CJYA 3VWJD 4U7KA 4YE4H 4YDKH 1FGNL 1X0TA 1G6RA 3JV0A 1RE4A 3NXSA 4LSVL 5HHOE 4MXQC 5EOCH 5CJOL 4QTIL 2NPSD 4LDOB 4CPGA 3BYYA 1H6UA 4JFDA 1PNCA 4HDIA 1MCFA 1YDPA 1GS6X 4JY6A 1S8DB 5E7BA 1DJXA 2K70A 1S9WA 2PPEA 1U4EA 3B7TA 4WSKA 1TT6A 3D8MA 2LHAA 2W0FA 1O6TA 4NLHA 3N50A 3DK0A 1R5SA 3SYPA 3CC5B 2CR6A 1KXTB 4M1CC 3FQXA 1VQPP 2FR4B 3RWEB 4Q6YA 4AM0B 4JHAH 2F53A 1XF3B 2P24A 3RBGA 4FRWA 5CUSL 4M3HA 3PGDA 1IIKA 2ZTBA 4DF9A 3MBEC 1NAMB 1SQXG 1V8HA 3WEMA 3WUWA 1WD8A 3CCSP 3EJCA 2Y7LA 5C6TL 4YE0A 3ZUCA 4WSGA 1FU1A 4ZW3A 4O5LL 4P9MH 4WWOA 3L3JB 5T3XE 2LAAA 5FPIA 2ZUVA 1MFNA 1RQ5A 2WITA 1TVHB 4X4XB 5DD1L 2A9AA 4LPYA 2R4SL 1CI5A 4MN4C 4G59C 2XRAH 5KWYC 3VFVB 3UEZA 1KC5H 2SODB 3CU1A 1FJKA 5EEWA 2GJJA 3NH7H 3QUML 2JCCE 3BAEH 1ZA3B 5E9DA 2DLTA 2OP4H 4QYAA 3QXAB 1QVOA 2WBJB 5CN2A 3B8SA 1LM8V 2FYUJ 3VFOA 4PW9A 4PJCE 2WPSA 4HHGA 1SF3A 5F7WC 4ELKB 3AUWB 4JLRB 4MJJA 2E46A 3QRBA 1K2DB 4AJYV 3B7RL 4QHLB 2GUSA 2WYTA 3TCTA 3RDTA 1JNNL 3C87A 1G7MB 5A7BA 1K4CB 3GEFA 3S4SB 4IQHA 4NC0B 4OZGE 4D2NA 3SYAA 3I2CH 3A0BH 4H25A 4PV8B 1SQQG 4IIZA 3Q48A 1RL1A 2PCYA 3HCVB 2CUMA 4KZCA 5A6IA 1H9VA 3IAGC 4MRBA 3IDUA 5EEYA 2H32A 1DBMH 3WIAA 4R4LA 1T6BX 1XD1A 3EOAA 1MELA 4EUPH 3D87B 4OGAC 4WFHE 1T1WA 1I4FB 5D9SB 3BMVA 2HX9A 1IK9A 5CGBA 3FJTA 3TV3L 3LKNB 1QVOB 1DANU 3GMMB 2YN5A 2IAMA 1NH4A 3KR3H 5FCUH 3JV4A 5K5GB 4F7CB 1ZA3A 1RF1A 2HKFH 4FNLL 4PJBF 1JXJA 1AVAA 5EWIL 4LP4A 4FG0A 4M6AA 2VDKB 1KUMA 3HOGA 4NRZA 3PXJA 5AEAA 3ATFA 3QFGA 4JY4B 3WXWL 2ATKB 4NNPH 3TBVB 3HBQA 2XQYK 4N9GB 5F7LB 1LE9A 4OD3L 2APVA 3QIUD 4UUJB 3OKOB 5INCB 3K72A 1BHGA 2K9YA 1AGBA 3FRUB 4LOEA 4NZTH 3MZTA 2ZT9B 3UC2A 1XR8A 2QHRL 4AQEB 5HI5C 4XN8A 4XPHL 2YPVA 3WIHA 3EFFB 5D7JB 4AQRD 2J8UB 1FFOB 3ME0A 4OB5L 3QI9A 3TIEA 5T1KD 4ODUA 4WY7L 1NAMA 4RGNB 5EULV 3Q43A 2JB6A 1ZT4B 1YNKH 4HCRH 5A2IH 3QIBA 1KJVB 3CUPA 4M93B 5IB5B 2XTLA 4LHJB 1T5KA 4CILA 4JN2A 1E8XA 4YX2L 1M1XB 3KGUA 1JTPA 3VYPA 5CM1A 3LPFA 2NPSA 1R5WA 5CGMA 4AG4L 4GRWB 3Q13A 3NJNA 5CIPA 3S3DB 1GMEA 1XT5A 1FPTH 1GIGH 1L4AC 1X4ZA 4GODA 2V7HA 2L04A 4N20A 4OLZH 1B6UA 1J9SA 3KBEA 1FNGA 1IBDA 1M2VB 4YXKL 25C8L 3QFJB 3TVMC 1I1AB 2G2NA 1MVYA 2A9NH 4HPYL 5I5RA 1LYQA 4X5PA 4ZFQA 3SY0B 3V4VL 5EH1A 2E75D 3W3BA 2F7IA 2XHNA 3I75A 4KPHL 1G7JB 4FLSA 5DD5H 5EBMB 5HPMA 1PGQA 4F5CE 4I48A 1T5WA 4WF7A 1BFVH 1SQXD 4FS0A 1UD3A 2GTZB 2PP8A 4TSAL 5K9OA 3T9WA 2K9UA 2BP8B 4OIIH 3GSNA 1GH7A 4G11A 4PRBB 1CDJA 1NBVH 1H6FA 5EBLB 4G8AC 1KQLA 1NAMH 3P69A 5JORB 4IRSB 5SWQB 3S96B 4NZUH 2A1WH 2F0CA 5FXCH 4HSQA 3IFOA 4QRRD 4PTTA 1OW0C 1FDMA 3VO0A 2HFTA 4GEIA 4C56B 3BDBA 3PP4H 4TN9A 3WFEL 3OXRB 2VC2B 1KULA 5EPMA 1IAOA 4KOBA 2XETA 2WK2A 4CVZB 4NIYE 4KK9C 2R2EA 3H0TB 3QIWB 4QLWA 3L74J 1QUNA 1KC5L 1AFOA 5AB2A 2J8UF 1IBHA 1F2XK 3MCKB 1N8ZB 2AEOA 1WAAE 1SUHA 1IB5A 3NN8A 3CHOA 3S1KA 5CBAA 3O0LA 1AQDB 2BVOA 3D50A 4GG6B 5F9WC 5E6ID 3QXDA 1OAKH 4JL2A 3INUL 4FNLH 4L4VA 3RL0g 3DIFA 4MZ2A 2G3AA 4MA1B 4CN4A 1M9SA 1FG2B 3M1BA 3ULVD 3S3JA 1INQA 1GL4B 5T33L 5E95B 2B2XL 3EO0A 4WI0A 5FO9A 3M9QA 4G1EA 2QDWA 1RJYA 2WPGA 4NUGL 3NFSL 1LEIA 4HUWA 3V5HB 3FFCD 3GQFA 4QAWA 3GSNH 3MV7B 3ILDA 4L3ED 5E8NB 4FAAB 1OPOA 3I2CL 3G6JF 4LE8A 4Q8BA 3RILA 3VFUA 4K35A 2L7EA 4X7DC 3RUGA 2QM8A 5BZZA 3WV0A 3KPNB 3KYQA 3CC2P 4PJ7E 1FOSE 1CFTA 5EC1A 3TT1H 4MAUH 4WY4A 1KPVB 2CJTA 3C5XA 5FOBB 1LNUA 3ZQ9A 4Y9FA 3SJVA 2H2SD 4NQDB 4XXCC 4L18A 2LABA 2CRMA 4W9DC 5DEGA 1CDCA 2VLMD 5E9DE 5C0IA 3CPLB 1NTDA 1IC4L 4MZIA 4YXHH 3EJTA 4FQIH 4EDWH 12E8L 4WWID 1RVFH 2YQBA 4OAWA 5DUPL 5HI3D 4OUUB 2HT2C 1YO4A 1JB0J 3T0AA 3LB6C 5J3HD 4QT5A 2ZYAA 2FJSA 1HIML 2C8NA 1MFVA 1LTJC 3RX7A 2RJMA 1VACB 5TPWH 4AUWA 5I1IH 1SLXA 5FYKH 3RURA 3ILEA 4G1MA 2DIJA 1G7PA 2VAJA 3WJJC 2EVGA 4A67A 1TQWA 4X7EC 1XGQB 4E41E 5JW5A 1MEXH 1T6WA 3OAZH 2X3BA 3MLXL 1HJBC 4J3VA 4PRAA 3VWKA 1TPXC 4HVBA 4B7IA 1I8MB 3LX9A 2R1XA 3MRPA 3OL2A 3ECQA 4GAAA 2N7BA 5MENA 5CINH 2EC8A 5LNGA 4UM9D 5F7MC 5T5FA 4QF1A 2AXHA 1MFDL 2CG9X 3PPEA 2JIXD 3VFTA 1VF5D 4PB0L 1ZHBB 3ULVE 3HZVB 3TFKD 3ULUH 4N0FB 2GJ6B 1YEJL 5KLVK 2EDNA 4G8FA 5AZEL 1JS4A 3VH8A 4LOVA 4AG4H 4HCIA 1SMAA 3WGUB 2YJQA 1E4JA 3FQRB 1G1OA 3C6EA 5FCSH 5FYKL 5IUSA 4B3VA 3PHQA 1EVTC 4JFDE 4UDTA 4JK0D 2OULB 4Y8DC 1TITA 4RMSA 1O6SA 1PY9A 2Y1YA 3TNNA 2DQHL 1ZSDA 3L5JA 4LMQE 3TPKA 5C0CE 1MG3C 4UU9A 1VA9A 5KLVE 1ZPLA 1IC7H 2KK7A 4PJDE 5TE7H 3LRMA 3L74E 1TEGA 3AG1B 3QSKB 1D5ZB 3QZLA 4JGJA 1D5ZA 1NGPH 3KCPB 1KMGA 1BZ7A 3S9OA 3B71A 5TF0A 1ZXGA 3ARPA 5FR3A 2DI8A 2JTDA 4OD3H 1T6AA 1DDHB 4KUZH 3HMWH 1G9MC 1FRGH 4Y1SA 1JK9B 1X9UA 3HJEA 4F15B 3CGTA 1E0OB 3PWNA 4YFDB 3HUJF 3BQUB 5IW1B 4UDTB 1S9XB 2IDSA 5KVGL 5JHDB 5KAQF 4G6KH 1EXUB 5DRNA 2DQCH 3GB7A 3LKSA 3KEDA 2A9NL 4OFIA 4ZOBA 3X1FA 5IVNA 1AO7D 1J0IA 1XGYH 1EPFA 1NCCH 2AK1H 2VN4A 4FMKA 4MCYB 3I9PA 4KXCA 4F2FA 1A9BB 1JRHL 4PP1D 3L71G 4QMAA 2QV4A 3MR9A 1JPEA 4N8CL 3GRWL 2BVPA 4N0FA 2E76C 1ZVSA 4PJ5E 4GMTL 1WGOA 4HJ0D 3OQ3B 4NOBA 1A1OA 1OQOA 2I85A 4NHCL 4WFGD 4AVKA 1MUUA 5J1TC 2R39A 4KXBA 4L8CA 3H3PH 1N12A 4UZUA 3D6YA 4XPBH 3C75A 4XWGL 2VDPH 2HWZL 3CX5K 3WFHA 1NPNA 4XNBA 1OCZB 2CE6A 2DWTA 2HFEB 4YQXL 5AALA 3B2DC 3V4UH 5IFHL 3B1TA 3B3IB 4NRYB 5GRJL 4UIKH 3BVUA 3FCTA 3MODH 3FMGL 1IV8A 5I1LA 1PTZA 2IVFC 5IJCC 3IPEA 5C07A 1WD9A 2R29L 4EN2A 4PSRA 1XSKA 5K9QI 4FXGB 5B5EE 1X6LA 4NDMA 2W07B 4Q0XH 1RHFA 3OR6B 3FAWA 4XO8A 1HJBA 5A2LH 2APWA 1KCSL 2ZSVB 4LRIA 5TH2A 4GO9A 4QXUH 1YPZA 2FXPA 2W80C 1E4WL 2MKVA 2NY6C 1U58B 4ZX5A 5DHVH 4WY4B 2YKQA 1KPVA 2C1PB 1CFTB 2FY8A 4P2OD 5LGHH 3SGKA 2R32A 3PQYE 4PV1C 2B59A 1KFGA 1ZGLM 5L2KA 4F8TA 1C16A 3IDYC 1PJ9A 1JRHI 4XXWA 5KVDE 1OSYA 2DWYA 3OKYA 2IAMC 5DJZA 1MFUA 1YCSA 2H2PD 1EEZA 3K3QA 1QO3B 2OMVA 4IMKC 4WNQB 5H37A 4AMXA 4KGLA 3KLLA 1JRHH 4YSQA 4UNIA 3HS9A 2VDOH 3VU2A 1YEGH 2JELL 3P77A 5E03A 2X4PB 5DRZA 4RWYH 1N6QL 1FL3A 2Q6WB 2BW5A 3FNKA 4GMSL 4QOKA 4X80L 4DIXA 1G7QB 1RUML 4X4YB 5KVGH 2K37A 3T04D 3U0TB 3MJ8A 1NDGB 4ASVA 2YN3A 5KBPA 4RFNC 4XCCL 3V2QA 5IBUB 5JHLH 5G2NA 5F88A 4F57L 1UXWB 3BUPA 3L3IB 4ZDHB 1QSED 5T1MB 3HPJA 3CJJA 3SE9H 3OZ9L 4PYGA 1AXTL 3QFDB 3BQVA 1SBBA 2CDGA 4BGLA 4OY9A 3O3EB 1Q72L 5M95B 2F1EA 2GCYA 3LPPA 4TLTA 4GW1B 4X4ME 4OI7A 3VGAC 4PLOB 4NQVB 4CMMA 4BFBD 5I16B 1BVKA 1CFVH 4MX7A 4A7UA 1WTGT 4Y4FB 1MCSA 3ZE0B 4KVNH 4TVUA 2YA0A 4ODWA 1N73A 3BVWA 4H5SA 4X9GA 4NP4H 1R3HB 3VXME 1E4KC 3NZ8A 3Q3GA 4Y2DC 2KI7B 4C8XA 4JKNA 3BQUC 4YSEA 2PTVA 4YDVA 6PCYA 4Y9CA 1U2HA 5IKCA 4FXKA 5IQ7L 5HJ3A 4NKMB 2W91A 1OPGL 4A2HA 3V0DA 5F6IC 1HAUA 4DPBX 4RMRA 1UWXK 2N4IA 2EDWA 3RP1A 1JY3P 1TQCB 3MROA 4Z95L 3BP5B 3RZWA 3TCLB 1OGSA 1PCSA 3ZBMA 2OMXB 2D31A 2AVFA 3QFJA 3PL6C 3MJ6A 2X12A 5L4IA 4D3CL 3CZLA 1L9QA 1SHMA 1IO4A 1BZEA 5G5DA 4AGLA 2CHWA 43C9A 1BMGA 1QACA 3HR5A 2BZCA 1OGTB 3E8UL 3TYFA 3RJDA 4DKEL 1EDHA 1MFBH 3U2SB 1D9KB 4ZZFA 1PPIA 2E47A 5D1XE 5HXMA 5JHBA 2AEQL 3S8FB 1HILA 1A6TB 4ZSOA 2B1AL 3AQZA 5AL8A 5BZWB 4QD2E 5GJSH 4A7VA 1FGNH 5GTHH 1XD0A 1A7BA 2Q7AA 1S7UA 3QIBB 4G80B 3UZQA 3FCUB 4M29A 1GSMA 4NPKA 3JVFC 3ORJA 4Y9BA 2BSSA 1SVCP 4YMPA 5I6XC 1OT2A 4UZGA 5IBTH 1RURL 2F58L 1FFOA 3ME0B 4K5LA 5E4EB 3PXHA 3ROLB 5IB3B 1M7IB 2TRYA 4XCFL 3T4AC 1MJ8H 4F33B 4I3SL 4OFVA 1M7DB 3UZVA 3I6SA 3VFWB 2N1KA 4YHOL 2J44A 1J8RA 1HNFA 5INCA 5C0EA 2FRGP 1I75A 4RESB 2UX7A 1LEGA 3KL3A 5KN5A 3T77B 1JY2O 1FYTD 3NSYA 5DUBB 4JY4A 4JG9A 2KT6A 3V4PH 1CIDA 1OOAA 1A7NH 4KTYA 3U6RA 5IW6B 4A2MA 1HSAB 3MA7A 4AXWB 2ZYGA 2MH4A 3LPGA 4CSTA 2DH2A 3OKDB 2DIAA 1KGCE 4UM8A 1L0LK 3DOIA 1L7TL 1PAZA 3ZYJA 3TFKC 5EC2B 1QLFA 2ZWNA 1I53A 3ECBA 1L0NK 3RVXC 5CD3B 3U4BL 3EJYD 4Q58C 2IYPA 4BQCA 3F7YA 4A7TA 1CBJA 3UJIH 3N40F 4R7DA 2QMKA 2XT1B 5D7LA 3GSWB 5GGTL 3F5HA 3VMZA 3P4NA 2JWYA 2QJDA 1KFMA 1GZPB 2ESVB 1H19A 3UADA 2KS0A 4PV8A 1XH2A 3CFEA 4IU2A 5AWNL 3P8CD 3MUDC 4JCLA 4KKQA 2F8OA 2NYYD 3RDTB 1KCRL 4B95C 2C0WA 1KY7A 3UBXA 5GZNC 4XXDA 4J3OC 2W6JH 1OW7A 5C3IA 2VQ1A 1I8LC 3HE7B 3OJDB 3KPQA 1CFNB 2BNQB 4FYRA 2D3VA 1WBZA 2UZYB 1S78C 3M8OH 1HEHC 3T6QC 1YJWP 4ZFOA 1XR9B 4QYOA 5FO2A 5IBTL 2P45B 4ZFOL 2Y9ZA 1A9EB 2XIIA 4HUXB 5DJ2A 3WY1A 5DJ0B 3BN9D 1KGUA 1ASPA 2LLGA 3BQUD 3GHGC 2Q9IA 1NL0H 5KYUA 3RDTD 3FO1A 4A6YH 4B60A 3OKKA 3TEXA 2P5EB 4S1QL 1FLTX 2NXZB 5CCKL 1A4CA 3FTSA 1MWOA 2OMTB 4Y4FD 1BV8A 4K3AA 3SDXA 2M5AA 1KBWA 1YEDA 3D52A 1DSFL 2GI0A 5DD0L 4Y2OA 1BFOA 2R4RH 4WO0A 5CUSH 4N2GA 2WQUA 5FWRA 4QJ3B 4RRPG 2E27L 4Y16C 2WWKT 1UACL 4NCDA 4Y2DA 3K4AA 4ISVB 1YEHL 3DOHA 1LO4L 3PDDA 3FN0L 1A2YB 3QDME 1SFCD 3WTSA 2DV6A 3D4GA 3KPQB 4BK5A 2VDNB 2AJXH 2XXFA 3R06A 5AAMA 4OJAA 3LOWA 5CD5C 1P6AB 1I7TB 3T0EB 1F8TL 5JO5A 4EE2A 3HA0A 3OKLA 1NM9A 2QVIA 4FQHB 4P2QD 2JB5L 4UOQA 5AD0A 1HSBA 2NY7H 3VFRB 2H41A 4AITA 2CPSA 2O3JA 1X9LA 1YLBB 2QEJA 5B38B 5L8LB 1D5XA 2RD0A 3GKWL 5JW4M 1G2CA 1Z2KA 1ZGLA 2ZXQA 1H3VA 2EUZA 3IKCA 2MNJB 4M48H 3M86A 4GG8B 3VXMD 2XN1A 3NQIA 1KYDA 2AJUH 4GRMA 4IKNA 4BHUI 5I6PA 4DETA 5BCAA 1W91A 4R5TA 1M1KQ 1B6DA 2J1WA 4LCCA 3RX5A 1KG0A 5DHXB 3QP3A 2X2HA 3CVHL 4FJYA 1AVOA 3B3BA 4K9EH 2IBZI 1UCBH 1OAXL 2R1YA 2BFVH 4AT6B 5JDSB 2HG5D 3ZTJH 2Q3EA 1C8QA 1YNLH 4WO4B 3EW3B 5DU7A 2CKBA 4OZ4B 4TOYH 4CGTA 5KLVD 3GJFB 4KZDL 4RGMB 1YN6B 5CR8A 2VR4A 2CNZA 2FD6H 5HJBA 1OAJA 3MACL 5DMGC 3OKMA 2O5ZH 4Y4KC 5GTIE 1T7VA 1FVEA 3CTTA 3GMQA 4Y1AB 4NCC1 2WO4A 3CMGA 3L3DB 2PNDA 4JCMA 3BKJL 4NEHB 3SD2A 2IYOA 3UZVB 2R83A 5DJ6A 2Y07L 4FQPA 4ZNEA 4DUVA 4X0KB 5FYJE 3N55A 5E2JA 5I76B 3T6ZA 4G8EA 5T1LB 3FBKA 4LRNH 2BIPA 4PJHA 1I9EA 4J6IA 2OPCA 2WXRA 3QUYA 4Z3GA 2WWWA 1DBAL 4P3WA 2A73A 4M4RB 5I1GL 2EILB 1KIQB 5AVQB 4PRID 1YEKL 1TOXA 5IQ9B 4ZS6C 4AE0A 3CDGA 1GAFL 4I3GA 4UQBA 3HRZB 3IMTA 4YN3A 4YHZH 5IK3A 4FTVE 1VIWA 3A4AA 3B4SA 2X2IA 3CFIC 3BVTA 1CGSL 2I69A 1UOWA 5F71A 3L72D 1LTBC 3HNTL 1JNMA 4FI7A 5D5MA 4K3JH 3K4ZA 4PN6A 4M93C 1FFQA 4P23A 1R33A 4OB5H 2KLVA 5E5MA 4G6MH 5AYTA 2BNRE 5DEZA 4EIUA 1TZHA 1RJLB 4DP9X 3STLB 4GQRA 4CNIB 3JWNG 4PGCB 3BPNB 2CKBH 4XC1H 2KSJA 5CCGD 1H3TA 5APTA 2C1OB 3OJ2C 3W11D 2KP8A 3RY5A 1GOFA 2UUDK 2EIMB 2AP2A 2ADJA 2XN9E 2ZF9A 5BVJA 4PW3A 4YXDC 5EO9B 4LLMB 2H7WA 4OD1L 4NNPL 1P53A 2VJ8A 2K6ZA 1JCVA 2WBKA 1RKRA 4XR8C 4IEFB 4JREB 2VIRB 4IEFA 2XG5B 3SWKA 1GYVA 4KI1A 3KS0H 3PTZA 4UIKL 4HS8L 2EXTA 5TE4L 5KYYA 1YEWA 5EO9A 5GZOC 2WQSA 2IBGA 4ODXB 3EO1A 1SZNA 1TJHH 4AW4A 2VSCA 4Z7IA 3T0DA 1BVOA 1CL7I 3J8F7 3NZ8B 3Q3GB 4WUUD 4ELME 1YYMH 5EORH 4PGCA 1E9QA 4XCNA 4OM1L 3STLA 3HZMB 1QSFD 3W9EB 1BVKB 2EQDA 3EBIA 4MJ5B 4MX7B 1X8YA 5EU6E 3H1IG 1Q1PA 3HG2A 6TAAA 4HD9A 5GS3A 2EXWD 3MV7D 4L3EB 3VYOA 3ZPDA 1SQBD 1IBGL 4KHXL 5DFAA 3W5NA 4JANA 4OQTL 2ARJB 5CSBA 3V4PB 4P59H 3EFFK 5E9DD 5JW4Q 2HTLD 1E4XL 4OCSH 4FG4A 2KH2B 4TLFA 3H1HE 3MNVB 3Q2YA 3U82B 2BVTA 2PYEB 3ZO0A 4LKCA 3S98A 3QZPA 5L6YH 4ZX3A 2X1WL 1F5WA 4HKZB 4GO8A 2VWEC 5DTFA 5DLLA 1QFHA 1EFXA 2J72A 3AE8C 1FIEA 2YBRB 4WW2C 4IKKA 3L73E 5GISL 4JO2H 4NFCA 1NUNB 5IOKA 3SDCA 3U36B 4CDGC 3C5ZC 3EYOA 4GQQA 4JBSA 5IBLD 2AQNA 3AEGC 2VZSA 2IG2H 3CPWO 5D93B 5BMFL 4WFHD 4OZHB 2ENPA 1DJGA 3N40P 1J12A 1IFHL 4EUPA 3S3BB 4RNRB 1FYTB 3BKML 1IBBA 2QVFB 1CE1L 3NRFA 4U1HB 1MUJB 5D93C 5C0CB 3DV6A 5FW8A 2BNRD 4JPWH 3RPIB 1RQUA 2R51A 3N6YA 3DX1A 4MLSA 1NEZB 1E8WA 3BH4A 1CF1A 1GC1C 3GXIA 4HYTB 4P23C 2UXFA 1JPFB 5ID1A 2HRLA 2NY1C 3RIAK 3WXVH 4OTXH 3LVTA 3OR6A 1YJ9P 2OL3L 2JIXA 1NAKL 3EDKA 4YDIL 1XGPB 2J1KA 3KYNA 3OB0H 4GUPA 1P84J 3VTAA 4JFEA 2OJZH 4LPUA 2CBMA 3PV7A 4ODSH 3U9PL 4W4OA 3THML 3AREA 3VFRA 4HK0A 5LGYA 3TO4D 4YFLF 3RL2B 4D3CH 3MLTB 3OKLB 3F6JA 4NI3A 3VM7A 2DM3A 1E3FA 1LO2H 4UTAL 2BNQD 2WV3A 3A67H 5J1SC 1GL2D 3WFHB 3KQGA 4NOFA 3ZDYE 3L6FB 1I3RB 2LE9A 2XA8L 4WJKB 3FQNA 4FQQA 2WB7A 4HUUB 1V55B 1HEJC 2VDNL 5GTIH 1Q38A 2AJZB 1HHKA 1AYRA 3M1CA 4AZ8B 3CLWA 3MLRL 4Y2DB 4WK4B 4NWUH 3VXOB 1AAJA 3VUAA 4WV1B 2FUTA 3AXHA 4R5XA 3RNQB 3KHUA 3GLMA 4YHOH 1AANA 4FN0A 1YNLL 2MFNA 1S1CX 3HEIB 2HJKB 4KJYB 3W39B 4GBXD 4LLQA 2FJGA 4GO6B 4YHLH 5DK2A 1GYCA 5IESL 4A2EA 4R2GD 4MZRA 4LCCC 3ASWA 3WUTA 5C08D 2B0SL 1S9YB 3PWJB 3GB7B 2XKSA 3IE9A 5LN4A 4JO2L 5BRZB 3P4LA 4IBVA 3FO1B 3TDKA 1MLCB 1PYWB 4O2EA 3TOPA 4ATTA 1S9XA 4QTFA 3IDNB 4RFNB 4P3CH 3ZTDC 1PP9E 3H55A 1BPLB 3B34A 1VFUA 4GQ9L 5IV2A 4UQAA 4AEHH 3QEQB 5I24A 2E3VA 3GI8H 1WBZB 2UZYA 1JWUB 4PWFA 1MDAA 4HOXA 3I3BA 4XPFL 1VJSA 1TYEB 4ASWA 4RIRA 3IFNL 2CR3A 4N0CD 4Z18A 3LD8B 3QH3A 5IHUH 1F1AA 5GRVL 3U46A 5L6YL 2W0KA 4OKDA 2NRGA 4QRRA 4QHNA 4ETYA 3RK3C 1M1JB 1A6VH 3A22A 4W9FC 9CGTA 2NW2A 4CL7A 5KSVA 4N0YL 4WUUB 5ERWA 1RI8A 1PZCA 3FWLA 1YQVL 4NNXA 2DD8H 2Q1KA 3I02A 5E70A 2O1AA 2CBTA 3BN9C 3AEFC 3GBEA 4J23A 5IEHB 5D8JL 2BJMH 5D96C 3UTSD 2VDRH 1RUKL 4X6BA 5ANMA 1OAUH 1Y1DA 4H1LB 2A6DA 1ZAGA 3HW7A 2CGRH 1HXYB 4U3FD 3G5VA 1NL0L 3GHEH 3MKKA 4M5SA 5LGKA 2CLZA 1I9IL 4H1LG 1MIML 4XZ4A 3L3HA 3BWAB 4H0LC 3MRPB 1O9VA 2IBBA 2J8HA 1AVYA 3O2DH 1QRKA 5DUBA 2GIYA 3N3EA 4WCYL 3SDCD 3T77A 3X14B 4YLCA 4ZT1A 2OMBA 1EXGA 3ZTJG 1JV2A 2GTWB 4ONGH 1IGFH 1G4MA 3QG6B 3US1A 1NIDA 2DQJL 4D7BA 3RVVC 1QTPA 3Q6FA 1Q90D 5CF3A 2LTQB 5GZOA 1BM3L 1JN6B 1EO5A 2FIRT 4M3KB 2NPLX 1BGXL 4ZTOL 3TEZA 4JZNB 1WO2A 3GJFK 2ED9A 3MLWL 3QO1A 4XMZA 5B38G 1S7UB 4QT5B 3NZSA 4J6RH 1QFWL 3SBQA 4LCWA 4LAJH 5K9JL 1D5IL 5APVA 2NY5C 1S5HB 4ZJ9A 5F7BA 1O5PA 2WB1A 2CLVA 2ZCKH 3ARDA 5F3FA 4F58H 2Y5TA 1QUPA 5CCJA 3D2UB 5E9AA 4TTDC 3REVB 3QEQE 1NAFA 2CO2A 2R7EB 1KB5B 4JDZA 1CLOL 2IH3A 4DKDC 5D1QC 2J6WA 4NBZB 4R7XA 5APXA 4FHBD 5C0RL 1IEHA 1KYUA 4E9LA 5E6SB 5MI0B 3BP5A 3TCLA 1NTZE 4G3YL 4L8SC 3VSTA 1JDCA 4MNQE 4AEIL 2FEEI 3CSTA 4F37K 1XCQA 1JZ7A 3QFJD 1F0LA 3FULA 2ZXBA 5F0LB 2YWYA 1INQB 1L0XA 3FUFA 4FXKB 1EH9A 1I1AC 3MBXL 2AJUL 2R69A 1RK1A 3FU3A 4I89A 1EJ8A 2KZJA 2H2SC 3ZKQD 4YAQA 3ESUF 3HB3D 1KDJA 1BCCD 3B5NB 4NNYA 2ZYIA 5BUPA 3BSZL 4K9EL 3FMGH 4X2UA 3BVDB 3NCJH 1E28B 2YD5A 1QLEB 3PV6A 1KBKA 3BEWB 2X89D 1UVQA 4JAMB 1OANA 3E1RA 4UTAA 5HDLA 4W70A 5JXEC 1HZHL 5E8OB 1QGKB 3BZEB 1I1RA 5JR1L 2CDGB 1IAOB 2J6EA 2GJZA 3L9EA 1WV7T 4PR5A 2J8OA 4MDRA 1NMBL 4MLIA 5FUZH 2E7HA 4F2MA 4Z7VA 4AC2A 4Z7VB 3H9HA 4F2MB 2XZQL 4Z3EA 1QFOA 3RG1C 5SWQA 3ZDWA 1BDDA 4P4RB 1NCDL 4ELMB 3PL6A 1CF8H 1WWCA 4GKOA 4OCXL 3N1GC 4LZKA 4UTCA 2F1AA 2QPFA 1OM3H 2CXGA 2XV5A 5E9NA 2ZX7A 4BWNA 4NQCE 2OBGA 5J11B 3LPOA 2X4PA 1SQ2N 3I75B 5LWYH 5I75C 1UG9A 1DD3A 2GM4A 3LZQA 2F8XC 4MJIB 1QO3A 1EGJL 2EZ0D 2OMVB 3BISA 3I84A 4UB0H 3OA7A 4OZFH 3IS0X 2AJYH 3TH4T 1UWGL 1MCOH 7FABH 3S5LG 1FH2A 1QSEE 3V4VA 1FNGB 4JQVA 5LBSA 1G9NH 2AK4D 2OFQA 2XWJA 4U1JA 2B59B 3BAJA 2NY0D 5D1ZB 1JV5A 3QUZB 4JM2B 1P7KA 3WDIA 5TDPA 2BNRB 3QPQC 5BRQA 2RMZA 2JKLA 3FQYA 3O11A 3GUTA 2XKMA 4PJ9B 4XVOA 2X6MA 4BZ1A 4GUQA 3EGXB 3CXHD 3CZGA 2BVYA 1EMTH 1VZIA 2DYPD 1WA1X 5CZKA 4JFDD 4MNQB 1G0DA 1HF9A 1I8IA 1KBVA 3BP6A 3C6LA 5ACZA 1KV4A 3WY3A 4OVVA 3IU3A 3LRKA 4OCSL 1WSST 3JWDL 3BSHA 4FZ8H 4XOEA 5J0BA 4Y19A 1XAKA 5AVZB 1LTGC 5T1JA 3VXSD 1VESA 2EJ1A 1IU1A 2R27A 3N1QC 1VZGA 1Q90A 4X98A 4E42B 1U9KA 4YZFF 1QHPA 1VEOA 3QO0B 2N59A 2UUDH 4MJ4A 3S88L 2OAAA 3H42H 3K72B 4JZNA 2R2CA 1PGJA 3L75E 4XMLH 3GMPA 5FW6A 5KVDH 2VLJB 3TA3D 1WT6A 5IFAH 1ZV2A 3IT8D 2YK1L 2AXGA 1EWHA 5J06A 5CCKH 5GGQL 1TZGH 4LSUH 4NB7A 1TTUA 1S9KC 1ZVSB 5GSVA 3QW9A 3FUKA 3HZKA 2BEQD 3O8XA 1R24A 1FA4A 2VJ0A 1FO0H 1FAVA 3D2UD 1XGZA 2IAND 2AGJL 3JV4B 4HJUA 3JWOC 3STZA 3X14A 1WH0A 2BHYA 3GMMA 4Y4KD 3X11A 1AJ7L 1W2EA 1JMXA 3OF6A 3ZW3A 4MMXC 1CDUA 1ZPUA 1BGYD 3LKSB 3BWAA 4QI3A 5B5EH 1KTJA 4KJQC 2H32B 1VERA 1INEH 4QRPE 4N2CA 4X5WA 3WHXB 1DVFD 4BFFA 3D07A 3HC2A 2OJEA 2J1XA 1PZ5A 3MXWL 2E74D 4OCLC 5BOZG 4POZD 4MA8L 1I7ZA 3V8CA 4X6BB 4HV8A 1P5UA 3I74A 1EZVD 2HT2D 3GLZA 3S4SA 4N6JA 3KW7A 4RZCB 4U3HA 4ZXBA 3NJVA 4EMZA 4O02A 3CFTA 2FXMA 2DDQH 1D7MA 2CIKA 4LPWA 4S2SA 3U7YL 3HUJE 5IM7A 3L74G 4ELKA 1XIWD 5J6GB 1BFVL 5A3IC 1CDBA 5D2NA 5BUGA 2BSTB 1M1JA 4JFHD 4ZKUA 5D2NB 3QXAA 3IEAA 3UJJH 1B0GA 3FFDB 2NNAB 4JGMA 3L45A 3D6ZA 4M3JA 3FU7B 4JCWA 4XMKL 4N3TA 4I9XA 2B15A 3SBWA 3MOBH 3H7LA 1L7IL 1TYJA 3Q5TA 2V0AA 3SY6A 2ESVE 2IBZE 1E65A 3IFLH 4HV8B 1DLHA 3ATDA 5EO0B 4MSWB 1AD9A 1W15A 5HHXL 3V52L 5BV7H 4XH2A 3LIDA 5IJBC 4J2XA 5IHZB 1DQLL 5K9JH 3X13A 1WHOA 3FQUB 1BAFL 2RQEA 3CXDH 2R0ZH 1GJIA 3F7LA 4GLRH 1FE8L 3R8BB 5E2TL 1HUCA 1MLCA 1XSIA 3HKFA 4QCIA 1O7SA 2EZ0C 4QGTA 3VXMB 1SQPJ 3RFZA 2Y07H 1UCBL 4FNUA 1JHKH 3PGDB 1JJUA 4Z7OB 4QXGH 2BZDA 4XNQA 2OTUB 5T1DH 4Z8FL 1X79B 3O6QA 1DEEG 2ZAGA 1XXDC 3QIWC 3MRNB 1FJPA 3O0RL 3SDAB 5A6MA 1KPUA 4G1MB 1IC7L 3F6IA 3Q5SA 3NJMA 4RMWA 1MRDL 1Y18A 5F1NA 4B96A 2E5YA 2O61B 4KVNL 3BPLB 1X7QA 3M7FB 4OIAA 3TBCA 3UAJA 2JJTC 4JFFD 3FT2A 4WWKA 1SQVK 3WS6C 5ESQA 1YDPB 2AW2A 2ZCLL 3QZWB 1ZANH 3CWGA 1UEMA 4L4JA 1T0MB 3O3AB 1Z32X 4PS4L 1VQ9P 2CCWA 3WHE0 3ECWA 4AYBA 5DEGB 3AY4C 3QZMA 1RUKH 2YC1A 5GGVL 2GITA 1ZHLA 1XGTB 1U3NA 4UV4H 4EIZC 1K5WA 3L75J 3DXAE 2CIIA 3JSVC 1NGXA 2IGLA 1HH9B 2N7AA 4ZBJA 1F4WH 1KELH 3D0VB 2RB8A 3KPNA 5FM8A 5CR1A 3CMEP 1CICD 2R3SA 3FTGA 3QORD 4HJ1A 3FPXA 1JE6A 2WCGA 1IE5A 4P06A 3FSOA 3MOQA 4FQ1L 1UH3A 5EZPA 2WP3O 1SBSH 2OM5A 3IXTB 1IGMH 3QDMB 1QFWH 1IJDB 5IHUL 4KNQA 2A0LD 3K0YA 4ZMVA 2AABH 1LO4H 1NVOA 3H1KD 4JKWA 1JWSB 1HEZA 1DBKL 1FL5A 3KPTA 5JMRA 5HYJB 1H8LA 2A9CA 3RNKA 1PZBA 2KPNA 4PJEF 2Y7QA 2YRPA 2G4EA 1EZVY 3MRLB 5GQBA 2GIXA 3WGVB 2Z7WA 1EHKB 2VLRE 1IGFL 1KT2B 1CD1A 2PP6A 1BSHA 1HIMH 3L17A 5EHFA 1CR9L 3H56A 2X53A 3OKNB 4IS6A 1M3JA 1R4XA 2Z91B 4UBDD 3UIAA 4RGNC 2WCPA 5CMZA 4L5FE 4YXHL 3PGFH 3SBWC 1EHNA 3TEUA 3NRPA 1ANUA 1R47A 4P4RA 4FG6C 5DVMA 5DJTB 3ABKB 4XPAH 1Q7YQ 2Z9TA 2WSFJ 4LARL 2IBZG 1ZLUK 2IOIA 3P9LA 4MBOA 4N2DA 4DK6A 1LO5A 2EH7H 3CXHI 3O45B 5KAQG 1M7LA 2NX5A 5CN3A 1JWMA 1GL2C 4QGYA 4ZXBD 2FXOA 1NCHA 5KJ7D 2ZE0A 4HGKC 4JANB 4P57B 1N9PA 1TCMA 4LLAA 5IY5B 2XQYG 3C9NA 4ZTEA 2APSA 1QL1A 2QFPA 2Z0BA 2ZXGA 4MMZA 1UZ8B 3HAEA 2IZ0A 3T3MF 2Q3ZA 4D8PB 1FE6A 1TZ8A 5ACMA 2XCMC 3P3TA 5CBNA 3H85A 2Q10A 2FZ3A 4K8RL 1ORQA 4E9TA 3KJ6H 3RVUC 4LRNL 5KYYB 4ZO7A 4PD4I 4JW3A 4R6UA 1NGQH 2XG5A 3AU1B 2E5TA 5ABZA 1BDCA 1SQXE 4PJ9D 1N6VA 2ITCB 1ASOA 2DMBA 4JKLA 2HB0A 1AQ8A 3QJQB 3IYLW 2XBTA 3RWJA 4PJAF 5AW5B 1MI5A 3EF7A 2AJ3A 3K81A 2A9DA 2ADGA 4KNSA 5FV1L 1AGDA 2H1PL 3UG3A 1GOGA 2Y0DA 1TO4A 2FT8A 4G9FD 4N8VG 3TO4A 3BE1H 3WENA 4GG6E 3DARA 4JO3L 3D51A 1IL1A 1KWKA 4D9LL 3BT2H 2JFCA 3MFFA 3FUEA 1JGLL 1D7FA 5KANI 5CLWA 2YAQA 4MFHA 4UT9L 32C2A 1EDLA 3G5XA 4W9JC 4WFFE 3WOVA 2CHXA 4YH6A 5AVXB 4F8OA 4URKA 4DKEH 4AKOA 1CG9A 2VLJD 1ZV5A 2OSLA 2YFNA 1OB1A 1KIQA 4KRPD 3IXAA 4J1UA 5JIMA 2LOEA 4Y5VB 1FHNA 3QO1B 4HHAB 3ZSSA 4Z3FA 1ZT1A 2K8MA 1FVCB 3MYJB 3A67L 4N9GA 1AS7A 2EKSB 2YMXL 1JMMA 1H8NA 3MSPA 3QCTH 4B9CA 4FERA 4YBLB 1QSVA 5JA8B 3GTTA 4P8QA 1UEYA 4KK8D 3BCCD 5CEZH 3VXUA 5JXAH 1WRGA 2AJXL 5G4OA 3VXTA 3HE6B 4ODSL 2VRSA 1UWEH 4G6KL 3B5TA 4XBGA 3E80A 1FVEB 4F27A 2OCJA 3CXHJ 3T08A 5ICYA 1FZJA 5EEZA 2DH3A 3HN3A 3MRQB 4HXAL 5JQIB 4Q89A 2CKBB 3ZT5A 3QC5X 2JH2A 2XXMB 3FB5B 5GZOD 1HK6A 2G3MA 3SKJL 3HE6C 1FAIH 5HY9B 3MCLH 2OYHA 1FGVL 3K71A 5L0QC 3L73D 1HZLA 4IL6X 1E30A 5JHDE 3GHGA 4KH9A 4E41B 1T2JA 2W90A 5LDSA 3BRVB 2HLFD 2XKNB 1E4WH 3VH8G 3UEQA 3NFPA 1D5XB 5AUMB 2QRXA 2K4WA 4Y4HA 5BUAA 4HHWA 4G8IA 3M8OL 5HYFA 4YSCA 2ZOKB 1Y0LB 1KEML 4LSRH 3VXQB 4HSAC 2O30A 1BECA 4DP6X 3GNMH 1JZGA 2VDLH 4FQHA 4AI7A 1FVDA 2YIUC 5FYKD 4QRRB 4BZ2A 1VSCA 2R29H 5CJ0A 2AQPA 1I7TA 3MUDA 2H6OA 4I0PB 3T0EA 3RGVB 3V79C 1UJTA 4TUJB 5BRPA 5JHAA 3VW3H 2ZUXA 3VXSE 3LH9A 3MRIA 3GGWA 5AKSA 1NMCC 2VLRD 5DR5H 1OW6A 2AHIA 2X6UA 2VYRE 3FHAA 5CCGE 2O1KA 4ISVA 3KPSE 5KSBA 2CSPA 4MJ6A 3ARFA 5CU9A 1LGHB 4KI5E 1AXIB 1DUYA 1YY8A 2BIMA 3IDNA 4PY7B 5GRUL 4KUCF 3VRLF 2C3VB 4Y99C 4XTRD 5I1AB 2EABA 2Y3NA 5IQNA 4EVNB 4XP6H 4L1TA 5D2LE 2CO6A 3WNPA 2VXVH 1P4LA 5E4EC 3DV4B 4PRDA 1XF3A 2PCFA 3SBPA 5D70H 1BM3H 5HPOA 3ARXA 3SOBL 4HEPG 3GMLA 1OKEA 1G1KA 4JPQA 1SFCB 2V3EA 3GSOA 5F9JB 1OAKL 3SPJA 3VQMA 2Q76B 3V0VA 2BO0A 2G3XA 5DFTA 1NOFA 5DD6A 1CFNA 2JCCB 3QYMA 4G8IB 3OJDA 5L2JA 1T3FA 1N2RB 2FYYA 4B53A 3MRKB 1J5OH 1C5BL 2BCKA 3TZVA 1CYGA 4NZUL 3VB8A 3QUGA 1CQYA 4J3OD 2MCG1 4L1LA 2ZCZA 3HMXL 3LZOA 3FO9A 1EA9C 3SHSA 3L3OA 4KBPA 4LOUC 2Z65C 3MXVL 2JCWA 4KKBD 1AXSA 2YUWA 1KIUB 2X4OB 4MTMA 4TSAH 1UYWL 3EJZC 3BRFA 1GZPA 4K0OA 5CLZA 2KERA 4N2FA 2YGOA 2XG4B 4JFEB 2Q7YB 4A37A 1ZWIA 4PJ0E 4B86A 3IBOA 5I6OA 1F4XL 3NPSC 2DQIL 3NJHA 1FZAA 4U6YB 5L2KD 2Q2EB 2E4TA 5HHPA 5ICYB 1VADA 4X6CE 4F3FB 1C1EL 3ECBB 4K71C 3QDJB 3JV6A 2OKMA 1JOIA 4J12A 1OP4A 1FFNA 1UZ6E 1HHIB 2I7SA 2ZAIA 4ZFZA 4MNQD 4UM8B 3VXTB 4BKLB 3ULVL 3O3DB 2NZ2A 1IEAA 1HGVA 1N59B 3QUXA 1OIOA 3RI5F 5GRUH 4IGBB 1UD2A 4NRXA 3A6BL 3BZ4B 5C0AE 3HE7D 1NDMA 1QFPA 1QKZL 4GQZA 2IADA 4AQ8C 2MQ3A 3ISRA 1XDTT 5KUMA 4J1UB 2O93L 1OB1B 3Q8EA 4XP5L 2BS9A 2ZOOA 4EKJA 4XODA 4KKNA 1GU4A 4FFZH 4PHXA 5CGYD 1N64L 4FZEL 3WTVA 1B0WA 2UV3A 2D0FA 2LTQC 1EFXB 1PIFA 1ZJAA 1KTMA 5GGVH 1TQUA 3AS1A 5CJQH 2Y7SA 3TC9A 1BSNA 2X4UB 3GJFH 8CGTA 1QBMH 1X5ZA 3RTQB 4P99A 4U3CA 2UY7A 3S35H 4AQ1B 2O5NA 1IL1B 4J3OG 1BX2B 3ULAB 3MNVA 2B14A 3QDGA 3BFQG 3PWUA 2YGVA 1SJHB 1AO7A 4OT1L 5HVHB 2JXMB 1VFBB 4XPTH 1U8LB 2FX8H 4JFQA 5AW0B 4KHXA 4EQ3A 4LKXA 2ZXCA 1EBAA 4XNAA 3PXLA 2QSQA 1MI5B 3NA9L 1YA5A 1I7RB 2YJLA 3WXWH 4RFOH 1ZLVK 3CVIL 1NYHA 3DHJA 4PJBB 2CO7A 2XNXA 3D05A 1QABA 5GRZA 4I2XB 3NESA 3Q8BA 2R0ZL 1DQVA 5IOPA 1Q94A 4GINA 1Z9NA 5G5DB 3UBGA 3K2MC 3N85L 4BWWA 1J9QA 1CT8A 5BS0E 1LWRA 2IX7C 1HL5A 2DLFL 1JZ8A 2CWRA 3BGMB 2E75C 2D31B 3HE5A 2FIKB 5H2BA 1WBYB 1HOCB 3MROB 1DFBL 4ODXA 3PL6D 1DVFA 1R75A 1MWAH 2Q7CA 4L05A 4S1SL 3LQZA 1EC5A 2GSIB 4OLYL 3W0WE 3LH2H 5EOTA 4XBEL 5CEYA 5J13C 4Y89A 2YMTA 4MNGB 1JZHA 1A6AB 2VIRA 3GI9H 3ARGD 4GRLD 3THMH 1MIEH 3W1ZA 1RHHA 3MRMA 1Z9SA 4NUJB 4PB0H 3MVSA 5KSAA 3MRBB 3KD4A 4K15A 5FYKE 3LTVA 5IWLA 1SRDA 4U1GB 3QJZA 4RRPA 5HDRA 4IHOA 1TZAA 2QMJA 2P10A 5EBWB 1R9FA 1ZT7A 4PD4H 5EF1A 3I3DA 1ONQA 3EYFA 1BE3E 1YJNP 5EMYA 4APXA 2VO8A 5ESVB 1QI3A 3H1HJ 1YVLA 4M1GL 2K8QA 2YWZA 3V8OA 2GCYB 3PLYA 2QVKA 1BMWA 2MJZA 3R0MA 4RAUA 2EH7L 1KTBA 3UBHA 1INEL 3DUSA 4J5VA 2VGLM 2V9TA 3II2A 2P5WA 1MFEL 3HG3A 5F9WB 3RKDD 1NU1J 1E50A 2DYRB 1NKOA 2W81C 3JYBA 4YBHA 5FKAA 4ZDHA 3UPAA 4U1MB 4NZJA 4YR6B 1RZ8A 1GVIA 5GRJH 4WNJA 2X1QA 2WWKO 5IMOA 1T22B 2HKFL 2AXJA 2FWOB 1L4IA 4PJGE 1SQVJ 3T0XA 4L0YA 2K1AA 3TIDB 3HRNA 2PYEE 5FHBL 1C7TA 3L35A 4ELMF 3BVXA 4H13D 3TGUE 3C09C 3GXDA 4JDTL 4XWGH 5HGDA 4ES9A 3CSBA 3BZ5A 4ANWA 5IFAL 2B87A 5EUOF 5SWSA 1DZBA 1FZMA 3ABVC 1OWAA 4GOSA 1YJDH 4BQ8A 1C9SA 4AKQA 2VR7A 3V0AC 5KBDA 2W9EH 2FAUA 5BQ7B 1LO0H 1JYVA 4G8GE 4ODTH 3K6OA 5ACLA 3MGOB 4O2FA 2V2XA 3C60A 4KPHH 3P40A 4O2CB 1G6RH 3AG2B 3EBHA 3A0HE 4GMTH 4Q2ZB 2BSRA 4WO4A 5J12C 5C0ND 4EN3D 1HH9A 4N2IA 1KTLB 5F89A 3UAJD 5I15H 4H8WC 5D7HA 2HLFC 3IDJA 1EJ6A 4XMLL 2IMNA 1U58A 3L5WA 4MS8C 1XF2B 2QTVA 3H32A 5BS0D 4PJXA 1MHHA 4DO4A 3AE5C 4JS7A 4KVCH 2FYZA 2V7QJ 2JKRM 3Q5RA 4JQIH 3PYCA 2PPFA 3GSRB 3DOSA 5DQJA 5LDUA 1LE5B 4NDMB 4Z1MH 3CXHK 4DN4L 3DX7B 4U1NB 4YL9A 5GTHE 4MAYB 4J3SA 2XJKA 1U8OB 5EU4B 3H1JE 5AD0B 4NQEE 1GRWA 2G60L 2K6WA 4MNHA 3BAIA 1EMTL 3DJRA 1QSEB 2D7QA 3FQTA 4EI5C 1JNLL 3SDAA 5HYSG 1KACB 3FFCA 2DW5A 2VZTA 5FGBA 3VD1A 3G6JA 2IGTA 4R0LB 4Z7UB 4M1GH 1MH5A 2UY6B 2VC2L 2WZ0A 1NBYA 2HVJA 4YSPA 3VD2A 3QHTC 3VSUA 3H9ZA 1OCCB 2FEDD 4DJGA 1EJOH 3CFUA 4JDVA 1ES0B 3BIKA 3OG4B 1XTGB 1RY7B 3F7VB 5LXGH 4L29A 1RZ7H 2EDJA 3VRIA 3X13B 4F57H 2Q86A 2WBWB 5C0GB 3DMMA 3EDDA 2GJRA 3SDXB 4HF5H 3QCVL 5E51A 3MJ9A 4PJFA 3GSQB 1SEQH 4MNHB 3T4YB 2BMKB 2R0KH 4KJWD 4YSRA 5TFSL 1J86A 4LPVA 4N0UB 1DQKA 5C2UB 1B0IA 4PLKD 4HS3A 2P8LB 4ODHL 1CW5A 5EA0L 5C09B 1RUPL 1A9EA 5DJ2B 3RBZA 4U1IA 5IVXB 4PLJD 1BBDH 1H6EA 2OTJP 2VERA 2Q3IA 4HEME 1ETA1 2YNYA 1TQCC 1G87A 1MHHB 2QKIB 4M56A 5IMKA 1NA8A 3ATAA 2X3AA 3MKGA 2NY5L 1DJSA 3N0AA 5DHVA 5TD4A 4OD2B 5ITBL 1HT6A 3KCPA 4LHUB 4Z7QE 3ZZ1A 5T3ZE 1YG9A 2P5EE 1JHTA 3NCBB 2VCOA 4PWJA 3D3VA 1X4YA 3MLWH 4JFTA 3RZCD 2AEJA 1S7RB 4GI8A 4U0QB 4IU2B 4MYWB 4HAGA 1GA2A 3R19A 2ATPA 2ZCLH 3CX5J 5H37H 2W83C 4GEJA 5B8CA 1WFMA 3PF2A 1WFTA 4R8WH 2APXA 3IDXL 1CFVL 4JRYD 1HVXA 2PR4L 1FNLA 4RGNE 4EDXA 1Y6MR 2UXTA 4L2YA 3PFUA 5T8IA 3GSWA 3LEYH 2BY0A 1AR2A 1BWWA 1RLWA 1YAIA 4FULA 4I8DA 5CS7A 3SGJA 1M9WA 4ZG1A 1IVTA 4BUGA 4DGVH 4F1SA 3MGNA 2D2OA 4P2RA 5GSRA 4HJGH 4U31A 4NPFX 3OMZA 4Q6IC 4ZS7H 5D70L 5LAPA 1HYSD 2HG5A 1QNIA 1T1ZB 2VWEE 3BMWA 4QKXB 1MZ9A 4QNPE 2R4SH 5EEXA 1U3HB 1FNSL 3U4EA 1KFAH 5MENB 3AB0B 4YHNB 5JOPE 4KJQD 4PMEA 2WZPD 3DX8B 1E9OB 3VWKB 5EWIH 4QEGA 4ES8A 3A0BE 1B2YA 1NFIB 4FABL 3CN2A 3H9SB 3KPRB 3LEXB 1NICA 3AFLA 4C7RA 1X7SA 5DZNA 2F74B 2HX8A 4LCIL 4X98B 4E42A 4M4PA 4TNFA 3QDJE 2FGWH 4Y5XB 4NO3B 1ZT7B 5DQDL 4LESA 2E27H 4UZSA 1OSPL 1NCCL 3KPSA 1MWAB 3F8UB 4IHOB 3OHXA 2YUVA 4QMEA 4Q56A 1AYOA 4ACPA 2BHUA 2Y1ZA 5DWUL 1U93B 2IH1B 5ILTL 4G80A 1J0KA 3ZDMA 3RTQD 3ZZSA 1TETH 1P69B 3HG1E 3QNYA 2GHZA 5IZ7A 1PD6A 3L37A 5JIPA 1A6AA 4U0RB 2G5RA 2FWSA 1S9VB 2F8IA 1XEDA 2X9WA 2KZIA 1TO5A 4ZAKD 2F9BT 2WSEH 3G71P 2D7MA 5CCHC 3FQWB 3LQZB 3U2SA 4IK7A 4M6ML 5H8DA 4A39A 1RP9A 5K1NA 1UUSA 5M7QA 4N1EA 3B9KC 3DI3B 2VDRB 3MUZ1 3UTQB 3JQOB 4BK8A 4ZYKA 3M46A 4MD5A 3ML8A 1M7XA 4MWFB 2H5UA 3ZIYA 2EIDA 2QPSA 5T3ZD 4MXVF 5GGRA 5IFHH 5KVEL 2YSSA 3SO5A 2G5BA 1TPXB 3MV7A 5DUMH 5E8NA 1BVNP 5FHAL 3DVGA 4X5LA 2X41A 4JF7A 1XZWA 2J56A 3KBPA 3NCEB 3IMRA 4PI2A 1DEBA 1PQZB 2VM9A 3N43F 3F84A 1A6WH 4D9QE 5BZDB 1XAUA 2H8PA 4PY8I 3VDAA 3ZKMC 5KLVG 2A3TA 3WFCL 5DMKA 1PZQA 1ID5I 1GW3A 1T2XA 4OSUL 4KDTC 3CCEP 1S7XB 4AQ1A 1IGML 2WLYA 4ZMNA 2F7QA 5DQ9B 3L71E 4L4VB 4S0TD 4X7TA 4NQSB 4EEEA 1ZVNA 1LTJB 4UB6E 3S4RA 1A8ZA 1VB9A 1MWAA 2JI3A 1WT5C 2OW6A 4YXLL 5KVDL 5E4AA 3CDFA 2VUKA 4IW4C 2IPTL 5CEZD 1MVFA 1NCDH 4JO1L 4N26A 4E0RA 2GJZB 1RZJC 1KEGL 1QUNB 2DBLL 3P11H 2QJPB 1XIWC 2CHDA 3BGFC 4JRXA 4JY5H 2BRRH 2J12B 3O3EA 1E9OA 3LW5H 3FWNA 3PNWB 1J8HA 4JAMA 1CYWA 4GKNB 4F7KA 2BVEA 2PLTA 1NMCB 5IP4A 5A16A 1ZLUH 3HNSH 4DW2L 1Q0XL 1U3HA 1UJ3A 1CBVL 2B0SH 4OGQC 2V4HA 2Z7YA 5DEFB 1SF5A 3K6SB 3F65A 3L3IA 3L4WA 3W57A 5AAWA 2HRPL 4KAQL 5KS9A 4I18A 1HWGB 4H13B 2F5AL 2OXGA 3AACA 3ZE0E 5HHVH 4PRBA 1B0RB 1WBXB 3M88A 4YLQT 4MA8H 2VMJA 2IAAC 1T5WB 5DJCB 3MNWA 1IE4A 1UM6L 4K94L 4KZEH 1XCQB 2W60B 5DRZB 5TQ2L 4B7LA 4DQOL 1MI5E 4KX8A 1H88A 3II1A 4G5AA 3QWNA 2CKNA 3NJXA 4YHKL 2COQA 1R0AL 1RPUA 1JDDA 3IDGA 1YHQP 1ZR4A 4NKIH 3X17A 1PIXA 1HHHB 4B9KC 1W72L 1A7OH 1ETZB 4HIPA 3WDHA 1JGEB 3AWGA 1SEBA 2GBTA 3TPUA 4NP9A 1QOKA 3P3SA 4FMVA 1T3FB 3O6MH 2XTJD 4NQUA 5CILH 4JRYE 2Y5TB 5DK0B 4DPCX 4IBUA 2HFGL 4PRPA 4TULH 2J20A 2ZSVA 1O7VA 1SUJA 3WN5A 2F7OA 1S5HA 3IU4L 2P48B 4MAYD 2VQ4A 2XNAB 3TX4A 4F92B 3DVNA 2YAHA 5IB5A 4FQ2H 1IAIM 2IPTH 4HETA 4JUTA 3BPCA 1MHEB 1BQKA 4DP0X 3KLHC 3EXJA 1ZT4A 3P0VH 2DQGL 3H4FA 1IBGH 4KHXH 4NBYB 2GYSA 3VG0H 4N3UA 3C8VA 4ETQA 1PZUB 1E42A 1II4E 3QXWA 4YSDA 3RVTD 5IBLC 4HIXL 3CHPA 4N78E 1F4YH 1RULL 4PRNB 3LVEA 3INOA 2WJ7A 5C0GA 1INDL 4PGZA 2Y6SD 5T5FH 3FT0A 1A7QH 2NNFA 2H26B 1AGBB 1NSNL 1UA6L 3JCUH 4YO0B 2VXQA 3BIKB 3WTUA 4XVJH 1MJ7H 3SPHA 1ML0A 1E5BA 1TIUA 2J88H 1H3UA 4EDWL 2G3NA 5CP7A 1UZGA 2B4CH 1YTZT 1N5AA 4AYCA 3G6JB 4M5TA 4R0LA 2BC4A 4RJTA 5JLZA 3Q06A 1VDFA 3R0NA 3MLZH 4PRHB 5B7EA 3CFQA 2A06G 2VLRA 5TE6H 5BMFH 2XRAL 3LRSA 4KAQH 1NGWA 2UYLB 4KJWC 4X50A 1NKZB 1NU1D 4X7CC 5MEPB 2P9RA 2RTTA 3H2PA 2AAAA 4NNXB 2J21A 4LNRB 3FTXA 1R19A 3HKZA 5F7UA 3QDGD 2QJYC 4P46B 1M42A 2OSWA 3N2JA 3ZN6A 1G0YR 1MW2A 1HE8A 1ZTXL 2QSCL 1AHWA 4AQAA 4OV5B 4MASA 5TQ0L 2VW7A 1G7MA 3LRGA 5JOFA 1XIWB 4HLZH 4PS8A 2QSTA 5A7EA 2JJSA 3AE4C 4ONFH 3H9SE 4HC1L 5KYXB 1DEEA 4XAKD 2BOBB 1CFBA 4YHIA 3RKDC 3RX8A 2VXQH 4WLCA 3MBED 3LIZH 4JO4L 3ES6A 5LB1A 4HS8H 4AY0A 1T2QH 4P46D 5FFGA 5FEBA 4U1LB 1I82A 2NY3D 2PCPB 2Z6FA 1CQKA 5EORL 1GL2A 2B87B 4KKPA 3N7NA 5DHEA 1P84D 2O01N 3PRZA 1MQKH 2IDCA 2RN0A 4HAKA 1SVBA 1WICA 1T03L 3VXPA 1N6UA 4GRWF 1BOGB 5DC9B 1SMDA 2XWZA 4HAFA 4M62H 3ZE2E 1HXMA 3JWNH 7PAZA 5HGHA 2Y7OA 5F3BB 3LHAA 4HHAA 1FV1A 1UASA 2EO7A 3POHA 4JFED 4V33A 2IQ9H 2BDNH 3I3EA 3KVQA 3L3JA 5EUOE 4HC1A 3S48A 4DGIH 1JPSL 3RNQA 4GRLC 1J1EC 4YHLL 4AZ8A 1NSNH 1UA6H 5I28A 1UKTA 5MEND 1KJ2L 2YXRB 3FSAA 4ZOAA 4MJIE 1TR7A 5E00B 1DBKH 3L71D 5F44A 1YECL 5DLMH 3OVUB 4KNUA 3RL0D 1U8HB 1MCPL 4C4KO 4LBEA 3CZNA 2VTFA 4LRIC 3D48R 2UZPA 5LAXA 3W0WB 2CALA 2XWBB 1JZ5A 3MLTA 4BBWA 1KQGB 2ADGB 3AEAC 2P1YA 4NZRH 3BPNC 2ZXWB 1IQWL 3LN9A 4LQFL 1DEDA 3NMDA 4CMHC 1KELL 1L7IH 3ARDC 2WXJA 3VOPA 4P49A 1HCFX 2WIMA 2ITCA 4NUJA 1MCWM 1RUPH 2EEXA 3DIDA 2DI9A 2BWIA 3CLEL 1AHWC 1QNZH 5E99L 2J73A 5CEYB 4LEXL 2DY2A 4UQCA 4MNGE 1FZGA 3GS4A 3UPCA 3UYRH 2JKTM 5HD8D 5IVXF 4KJMA 2BIQA 1JHLH 3QRFM 3FB7B 4FOMA 3EGDB 1JBJA 4OCYH 3SE4C 1H3WM 2WXFA 3WXVL 2IGFH 4BQ6A 4ZS7L 3E0GA 2E9IA 4FTDA 4JRFA 3W9DA 2C9VA 3ZGIA 3MIWA 4HOWA 3KHOA 3EFGA 1TJGH 1B90A 1YC8A 3ZDZF 2D4FA 5IB1B 3O0RH 4OZHA 4P5KA 1KZUB 4MS6A 1I8UA 1TEYA 4GQPH 4QRPA 3GF8A 1IFHH 3UERA 1G7HB 1DVXA 2HVBA 3B6SB 4ALAH 4OJYA 2VLLA 2JXMA 3ARGA 1MIMH 5GRYA 4UQDA 2ZG2A 3CV5A 5J9PB 2LT9A 4N86A 2F19L 2Z64C 4JJHA 1VQ8P 2NQ3A 2ICCA 4U6HB 1L0NG 1EXJA 3FCSA 5DHYB 3CHRA 3D0LA 1EVUA 2QLVB 3BAKA 3O2VH 4Z7WA 3TVMB 2PYEA 4X8XA 2B08A 4LVOB 4BQBA 2GG1A 2BVOB 4XNUH 2L91A 3RJQB 1Y8AA 4EI6B 1HHGA 2ZYHA 3MCKA 1CDGA 4L1DA 4OF3A 4HMEA 4WBAA 3GO1L 4TUKH 5I0DA 2EH8L 4P5MB 2Q7NA 3V0JA 4MCMA 3D4ZA 4QRUB 3TVMA 4A7GF 1WZMA 3V9EA 1CVRA 1H15B 4LLHA 4OJFH 1NH6A 2OCCB 5E2VH 4HBCH 4MHHI 4H44B 3MLXH 3HLAB 1M8OB 3WUZA 5KYNA 1X5MA 3WTXA 2YKLL 1IC1A 3VQ2C 1P84I 1R5LA 3VYIA 1CVSC 1UACH 3HFML 5MP6L 1P4BL 3FU8A 1A21A 5ITFB 2R59A 3AITA 5D2NC 3DDGA 4XPFH 3M91A 3QG7L 4NFBA 2BP8A 4YTPC 4AE1A 3IJ8A 4JPKL 3PHAA 2OMUA 1IM9A 5GGRY 2O5YL 5EOCL 3SOTA 3MLZL 2Y06L 3W9DB 1OTUD 3O2DA 2OL3A 1NGXB 4Y5XC 4OLVL 3JWOL 2G9HB 5I30L 3L9BA 4WEEA 3BI9X 2JLLA 1BCCE 3O6FB 1ZP0C 2DS4A 2P52A 4ONOA 5CFAA 1KXQE 2ZX5A 3VFMB 3BPOB 1FF5A 1UWXH 4Y19D 3EH5B 3L95B 3W0WA 3WMPA 3VWKC 1X5JA 4LPTA 4G42A 4N5EC 2HRPH 3PP3H 4M6MH 4LBEB 3VTPC 1U91A 3Q1SL 4XWOC 3EF4A 1N2RA 2IV9A 2VDOB 5E00A 5JDJA 5J4MA 1EO8L 3UAEA 4DN4H 1NZRA 5AENA 4IGBD 2NQCA 1NUGA 3TGUJ 4DVRH 1OO2A 3EAKA 2QGDA 3EJUA 4QRAA 5LAXB 1EJFA 2Y5QA 2GJPA 4J7RA 4AYDC 1E90A 3FL7A 4KROD 1RAMA 5D1XD 5ABDE 4CJ1A 4GT1A 3NJLA 3TZVD 4NX0A 3MOAL 2FQEA 1XCTB 1PV3A 5HBBA 2KS1A 2CO6B 1AO7E 3ZKND 1YEKH 4DEWA 1JZDC 1UOKA 2FECI 4UQ2A 3CLFL 4H0LD 1X5LA 2W0PA 1NMBH 1IC2A 3INUH 5DJ6B 4LP5A 2FHCA 1T3UA 1W80A 2DZEA 1OXYA 3ARFB 5HGHB 4G6AD 3ES6B 2O6FA 3TTSA 4XOCA 1LK3L 1BOGA 4JM4H 3D69B 1VFMA 2ZUYA 3OAZK 4CVXA 1O7DC 5ETUB 4FFWC 1PKQB 5I74C 1SNRA 3IPBA 3DVFA 2WXNA 1FZFA 3BKMH 3EHBC 4I9WD 3UTTD 1DO5A 5JYLA 2QM7A 2W94A 4CKQA 2PCPA 4MBRA 2IAMB 3S8WA 3ULUE 3WO3B 4JHUA 3OGCA 3S36X 3VXQA 1MJ8L 1SXNA 3KWXA 4HT1H 3WSQL 5IM7B 2XFGB 1A7RH 1E27A 3N42B 3E7JA 4LSPL 4A04A 4AEIH 2ZWSA 1MFBL 5IJVB 1M4KA 1UHVA 1NGWB 3B9EA 3FU9A 4R7NB 4AW7A 5ICZB 1AGEB 1WJ3A 2BOCA 1DL7L 1ZMEC 1HL4A 1BIHA 1IC5L 1KCBA 3L5XH 5ISZE 2BK8A 2FDBP 3AAZA 3R06B 5D5MF 3AS3A 1K2DA 1Z56A 5DJUB 1NCTA 2H88C 1UOVA 1WTLA 3L4CA 4QHKJ 4U2ZA 4Z3HA 1VFOA 4X8JA 2ERJC 2HFGH 4A6YA 4P59L 3QUMA 2WBJA 3HUSC 2JSFA 4BKSC 1D9KC 3VP9A 3L72J 4NUPA 4R2GC 3I55P 2VLKA 3S37X 1YUHA 4P4KD 3LQAL 1ZLVH 2Y0CA 1M90Q 4JG1H 1ED3A 2J2ZB 3ETTA 5CO1A 1KJMA 1CLCA 1RPQA 5JLZB 5E94A 1EO7A 4IL6E 2E56A 3I9GH 1U36A 5KJ4A 3ERXA 3ELQA 2JK5A 4BZYA 3WMM0 2FEJA 2VXTH 4IRZL 1L0LD 2DQDL 5E2UH 4ANVA 4ZOEA 1LMIA 1VPCA 3M7OA 1FQ9C 2ED7A 2QV2A 4KNTA 4LU5H 3OKKB 3LKPB 3CX5E 2JWDA 2ICEC 1JXDA 3PJLA 5KYUB 4FFTA 2GA1A 4X6DF 1NCBL 3LXCA 3QIUC 3ZYOA 4LMQI 2F7PA 1R1CA 4I77L 3IAOA 2G4GA 3RVVD 1IM3D 1U8NA 4ZK8A 3UP6A 1SDYA 1PX8A 5J6SA