5AW4B

Kinetics by x-ray crystallography: rb+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw4B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw4B02
1GU4A 3VN0A 2WPQA 4JYBA 1HWTC 2XU6A 5AVQB 1S9KE 1A02F 3VMZA 3L35A 5AW8B 5AVYB 4AYCA 5AVUB 3NMDA 3VYIA 1CI6B 5AVWB 2Q5UA 1KQLA 3OAKA 5CMZA 5AW6B 3LIDA 2YNYA 2WT7B 1T2KC 1DH3A 3NXSA 1H89A 1GTWA 2W27A 2YO2A 5AW4B 5APXA 3NFQA 4B86A 5AW2B 1CZQA 5APQA 3WGUB 1J2JB 3UIAA 2ZFCA 1JUNA 4GT1A 2Q3IA 3V5BA 2WTYA 2Q7CA 4I6MC 3V4WA 3P32A 1H88A 1HJBA 1GU5A 1A02J 1FOSF 2JJLA 3M0DA 3KQGA 3TNUB 1GK6A 3HE4B 4AUWA 2VRSA 3IR9A 5AVZB 5AW5B 1G2CB 1SLQA 2IPPA 4XE5B 5AVXB 2R5BA 3TYYA 2QM8A 2N9BA 3I5CA 3M06A 5AVRB 5AW0B 4C46A 2WPSA 3VMYA 3HE5B 5APSA 4C7NA 5APUA 1GK4A 2QM7A 5AW9B 4LC1A 2ZXEB 1MV8A 4M3LA 4DZOA 1NAFA 5AVVB 4RESB 3M9HA 2P2UA 2WWWA 2R32A 1CI6A 1GZLA 2E43A 3M9BA 2E42A 3P8MC 1CSBA 5AVSB 3TK1A 4RETB 2XV5A 3L37A 1H8AA 1S9KD 1SP4A 2WT7A 4I2LC 5APVA 5AW3B 5AW7B 3A2AA 3V4QA 2Z5IA 1JNMA 1FOSE 4JYCA 2C9NY 5APWA 3LIEA 3MGNA 3NTNA 5AW1B 2R5DA 3HTKA 1OXZA 3B8EB 3MD0A 5APYA 4GKGA 1HBWA 1NWQA 2BASA 1HUCA 2R3CA 3VMXA 2P7JA 1YYCA 5APTA 1IO4A 3M0AA 1MFZA 1MUUA 2C9LY 4KHXA 2W6AA 1X8YA 3O8ZA 2H7HA 2P67A 3TNUA 3SWFA 3HE4A 3M91A 3L36A 3VTPC 4HYTB 3A5TA 2Z5HA 3A3YB 3A7OA 4AQRD 2WPRA 1GD2E 5AVTB 3KDPB 1T2KD 1FAVA 3HE5A 3T97A 2YO3A 3P7KA 4C7NB 3WGVB 2KP8A 4EOTA 2XZRA 1OWAA
chains in the Genus database with same CATH superfamily
4NKIH 1I8IB 2AXHA 5ELIA 2CNZA 1P2CA 3MLRL 4K35A 1IB5A 3LN9A 1IGJB 3S35H 4QRQA 1VPOL 3FFDB 1AS7A 3R1GH 2YRZA 3HZKA 3RU8L 2HJFA 4H0HB 4FEMA 2Q6WA 1R5SA 2MTAA 5HI4D 4OZGE 1IZKA 3TN0D 1J0HA 2BVPA 2XZCH 3EYFB 3HG1A 4LKCB 3KWUA 1NTDA 3SE9L 3RURA 3WJMA 3ECBB 4BZ2H 4PD4E 4ZTOH 3AMLA 2JI3A 4GS7B 5LAXA 3S98A 1NGXA 2DIEA 3W0WE 3MR9B 4QR7A 5IQLA 2Y1VA 4MN4C 1YAZA 3WY2A 5JHDB 1JCCA 2DEYX 4NQCA 4X8CA 1EC5A 4TQPA 1L7TL 3TYGL 4WTZG 1L6ZA 4PN6A 4LVOC 5FYLL 5GZOC 2A9NH 3WUWA 5E5RB 3MQIA 2EYRB 1NTKJ 4Y99C 1J5OH 1SN5A 2CXKA 5LCVL 4XN8A 2AEMA 2JELH 5I6PA 1LEIB 1KJ3L 3RJQB 1JRHI 4I9WD 5CZVL 2WAQA 3MACL 4UQIM 2H88C 4XHJC 5I17B 3CX5H 3IFMA 3N2JA 4RZCB 4WW2C 2B1OA 3DGDA 4CNIB 5DD0H 5E8NB 3D51A 2B9BA 3ARWA 4WVRA 2K3RA 4M1GH 5I9QC 3D39E 1JPGA 1R24A 1PNDA 3PL6C 1T66D 2J21A 4NYLB 5EEYA 3VXOA 2O5XL 4JFXB 1M9SA 4OD1H 2X3CA 1A3LL 4DZOA 3ZYOA 1CFVL 3CIAA 4X99A 1CVSC 4OJFH 3RX8A 5JW4R 2OSLA 2APSA 4ZFGH 2ZYHA 4ZRGA 2CIIB 1KFNA 3ZRSA 2YQBA 5FO9A 1OCRB 5E1IA 3EYOB 3K5RA 5KVFH 1T5KA 2YPVL 5SWSD 4PP2A 3JUYA 4Z7UF 5F8QC 5GGRB 1JHLL 5TDPA 2WUBH 1UT1A 2F53D 5EN2A 5FYLE 3Q3DA 3MNZB 4HKJB 1UM5L 4ODTL 2O1JA 1MWOA 1NCWH 5C97A 1OAKL 1JVLA 2OJEA 4OBSA 3B8EB 1GKOA 3N6YA 3MUY1 3LVEA 4RRPA 5I5IA 2P10A 2W9EH 3H7LA 1FSKC 4N6RA 3M0AA 4GIOA 1MCCA 1MFZA 4NO0D 4UT9A 4B9FA 1YN6B 5L4FA 5CKAA 4NUGL 4CW1A 1W80A 2DI7A 3HE4A 2E0PA 1K4DA 5L8KB 2UV3A 2GHZA 4MAZA 3GNML 3QE5A 2FECL 3RWCB 5LQBL 4ZNCD 5LGJB 3HRPA 5ID0A 2WXIA 2OTPA 3OHMB 2FH8A 3CFKB 1FG2B 2JKNA 4P2QE 4ZAKB 2PRRA 5FHAL 5J12C 1BPVA 4K5PA 2XA8H 4AVHA 1LEGA 1P6AB 3L6FB 1K85A 3GIZL 1A6TB 1GL4B 4BK8A 4OI9A 5C0AA 5DRXA 1QSZA 1E4JA 5HDLA 5J13C 5ITBH 3RYMA 3CVHH 5KN5B 4ZJ9A 1RZJC 2C5DC 4U3FD 2VR6A 3S5LG 2C4XA 3MLZL 2WP3O 3FYEB 3ARPA 3RL1A 4ES8A 5D2LB 4NP9A 1IKFH 1PZBA 4LLQB 3BWZA 1NCDL 3G71P 2RBLA 3BDXA 3EH5B 2WZPA 1CLYL 2WBXA 3KM2A 4OZFB 4YPCA 3Q6FA 2P43B 2Q1EA 3NN8B 1TEGA 1VACA 1KCKA 1KWGA 1A1OB 3QJQB 3UTZB 5EU4B 3KJ6L 1NANI 2WXJA 3ZXAC 2R1YB 1BA9A 1FNLA 3EJRA 1PDKA 2BSEA 1Z9PA 3LDBC 4K2UH 3OF6D 4EDXB 3IFLH 1JTHA 5EG6C 4PS3A 2EDXA 1QFUL 2AMUA 5HHNA 4PJ5D 1I9EA 4JCLA 5T3XD 3UJJH 5AB1A 2IH9A 5FO2A 1V7ML 2NX5E 5DT1H 3GS0A 5CHNA 1MAMH 1UYWH 5C3TA 3UABA 5KSUB 3QVAA 3IB4A 2ESVE 4W9LC 4OIIL 3MJ9A 2LR2A 2IWGA 2E76B 4XP9L 4N0FA 2WPGA 3QXVA 2DWDA 5ESQB 2NY7H 1Q9LB 2NTFB 3CWBD 2GITA 4KK6D 3ULVH 1FPTL 4MNQE 5JQIB 2X7LA 3IDMB 3K0WA 4PRPD 3U7YL 1F13A 1E3ZA 1RHHA 4TTGA 3NSYA 5TE7H 3K71A 2MCPL 1OCOB 2DL2A 2AK4A 1XGZA 1QTYT 3KYAA 1G5AA 5A2JH 1HHJA 2W6JH 5KAQF 5I18H 4QRTA 4R97C 3WTTA 1Y6KR 3NJKA 3HAEH 2OPCA 4GB9A 2WCGA 1Y1UA 1YCSA 3KWWA 4LSTH 4JQVC 3N1QC 4OZGA 2Y3NA 4LIQL 4ODSH 2I8DA 5D93C 5L2KE 3P9LB 3WHE0 2WQ8A 4WFFE 1AQDA 2X70A 4JRXB 1MRCL 4Z0BL 1X22A 3CI9A 5G55A 3W0WA 4R84A 3S88H 2W1NA 4MSWB 1PY4A 1ZLUK 4AEIL 4YXHH 3B6SB 4ELME 1KULA 3GZOA 3BAJA 1OAYH 1ZRTD 2DQCH 3GIVB 4YSSA 1BXVA 1BZQK 1DSWA 3S4RA 1FC1A 4PGBB 2AFNA 1XTCC 4HPHA 5JW4M 2JR8A 1N2DC 4HGWA 1BYNA 1BIHA 2NY0C 1TTGA 5KLVK 3EO1B 3LS4L 4U31A 4YXKL 5B21A 2Z7YA 1MNNA 3FQNA 3HN8A 2AJVL 4X7FC 5DWPA 3VMAA 4M1DL 1M71A 1WV7T 1SQQD 2HT3D 4UF7C 2TSAA 4AXWA 1EFXD 3D39A 1DX7A 3OXSA 5T1MB 3G5YB 4NFBA 2BXZA 4TL5A 3P4LA 4NHCH 2CLRA 3NDYE 2EO7A 3MGTA 2E3VA 3RB5A 3Q0HA 1RJZA 3PV7A 4LIQE 4HXBL 2X1XR 1GSMA 5KYUB 3H1JE 3P4MA 1N9PA 3HNTL 4NWTL 2DKSA 1HOCB 3JWDC 3V6FB 3VXUD 4KK8D 3PL6D 3CN3A 4OFYD 3FQ1A 1AQHA 1JUFB 3H1KJ 3GF8A 1LO2L 2O6DA 5IROC 2HYNA 5DRWA 2N0KA 3ARBB 5ALCL 4S1RL 3NCWA 4U1IB 4QRUA 4A63A 5DJXB 3MLWL 2QPEB 2XQYA 5EFWB 1NFDE 1VSCA 3IMUA 1URQC 1PYWA 1EGJL 4YPGB 2BJML 4H0LC 1KBVA 2VABB 4PRHB 4BKLB 5T33H 2PO6B 2XV6B 4POZD 1J1PL 2CHZA 2CUIA 3CFEB 4MWFA 4G6FD 2IPPA 4OQ1A 3SJVE 5AWNH 5AW0B 4ZS7L 4X7EC 1R3IH 2FYUK 2WP3T 2DJSA 4N6QA 2DQEH 4XAWH 3VTAA 2WSPA 3QWRA 2E7CA 2KERA 5IVOA 2YKPA 4RESB 4Q0XH 1MJJB 3FQTB 5T1KB 3DYMA 3EJZC 3D12B 2C9XA 1TJGH 4KI1A 4GLRH 3VI3B 2C9UA 3IDGA 2DM3A 2WO4A 4LVNB 4G72B 2EAEA 3ZYZA 2XWXA 4P2QA 2FEJA 3FONA 4JL1A 4NJ9L 3QFJE 4Y16C 1S9KD 1FF5A 3FUIA 4IBZA 3S35X 4AL8L 5C9JA 4NPJA 2YPVA 5F21B 3DX4A 5FFLA 4NQQA 4NS0A 4I0PA 5HHQB 2H6PB 3TWCL 1FJ1A 1H0TA 2CR3A 2K6ZA 2OR7A 4CADA 1DJZA 4Y4KD 2A4ZA 3I6GA 1T1WB 1I9RL 2MPVA 4F58L 3LH2H 2JIXA 2CCWA 3B8SA 1XSIA 3QI9C 2IOIA 5FM4A 1IT9H 2DQDL 5DQDL 3O2WH 2OMWB 2QVKA 1XCTA 3AEFC 2K6YA 3MODH 3PWLB 3QEHA 1VFBB 1YEIH 1CTMA 3B56A 1BAGA 2QSCL 2YZ1A 1Z5YD 4JJHA 3IFNH 4DUXA 2VSDA 2YFNA 4Z7AA 2ZXXA 1NICA 1E42A 4ATWA 5CEXA 1XSJA 1T2XA 2Z91B 1TDQA 3OL2A 2HUHA 1RF1B 2O26U 4DJGA 2VB5A 4XRCA 7PCYA 3SDDA 4ETYA 5JPNA 3V79C 1JCKA 4Q14A 5HGBA 3LQAL 2ICWA 4DKTA 4J1UA 3CX5K 1TTFA 3ABLB 4JFOA 5I19L 2NUPB 2PWGA 5BZZA 2Y36H 2DQJL 2ESVA 3IMRA 1UWXK 3OKMB 5JXAH 2X4RA 4J23A 3MGAA 4F8LA 2XWRA 4TUUA 4PJFE 3L9RB 3PYCA 4RWYL 1HXMB 5D7LE 4DP7X 2WYTA 1C5CH 5DEJA 3BKCL 4MNQA 2BVTA 1NQBA 3LKOB 2ZOTA 1MIMH 1T2QH 2W91A 4K5MA 5MI0B 1REIA 1FE8L 2FT6A 3OGCB 5CNHA 2IH1A 3V55A 1WFJA 4OD2A 3SIKA 1YEKL 1UXLA 5C0DB 1NGWB 3KDMB 4NZRH 5F96L 2CIKA 2XNAB 4RVBA 4Z0XB 1I3GL 4APXB 4KXZH 1QVOB 2PTTB 5DMKB 3MUDC 1U58B 2NY3C 3EYOA 1KENL 4Y1AB 3BDYH 5AOKA 2K8QA 4PS4H 2VQTA 3IETB 5FCSH 1IBBA 1RURH 2CO7A 4N0UE 1GYCA 1KLUA 2N1KA 1D3CA 3LNGA 5L2KA 4H44B 3QWQB 3RJDA 1K9TA 2B3IA 5F6IB 4F7TA 2OQQA 2KK7A 5DJYA 5EZJB 4YZWA 1A6WL 3JVGA 2LU4A 5GSVB 2FO4B 4I5BB 3V2RA 3DIDA 3H56A 3VMNA 3HZYB 3ZE2E 5KLVJ 4X0KB 1F8TL 3TPUA 3RFRA 4ELMA 2HG5B 4JANB 3TH2T 5CLYA 4M6NH 4ODHH 4OF6A 4O02L 2O5ZH 1DE4A 2EDYA 4JZJA 3H1IE 3BEWA 4F91B 4XP5H 3DUHA 3RWHA 2ZSWB 5BXFB 2XIDA 2QQKH 4PWIA 3SQOL 4IFDK 2XLLA 2UZYB 2VAAA 2YMTA 3CFKA 2X05A 3ILDA 4OZHE 3MRQB 4NXSA 1Q1JL 4FFTA 1DLFL 4KITB 1A0QL 1ORSB 1ZSHA 2NY0D 4LLVA 1NWQA 2E7LA 2Y5TB 1SFCA 2APVA 4U6HB 4UTBH 4KDTC 3ZTNL 4BJLA 2QHRL 3JV6A 5GRVL 4ZW3A 3APFA 5KN5A 1NJIQ 3CX5I 2I24N 3AQDA 3RIKA 3MA9H 5C0CB 1P69B 1UWGH 2BSCA 3OZ9L 3JSVC 1SYVA 2EIJB 3FCTA 1IGYB 1S3RA 3HUSC 2R1WA 2XRAH 1S7SB 5DJZA 4TUOB 4EXPX 4GG6F 4X50A 4Z7QF 1MDTA 3QIBA 3QISA 4KJYA 4OZFA 3BN9D 4AK1A 2FX8H 4FQLH 4X80H 2FYUJ 3EOAA 1KTDB 4N2KA 4YVUA 5GJTH 1NFDA 1AKJB 1M05A 3C8KB 1ET7A 4TS6A 4H8HA 4ANKA 1E9PA 3QAZC 1A1MB 1ZTXH 2A6KA 2VM4A 3AAZB 1PLAA 5IROD 5I1AA 1DJYA 2OMTA 3SJVA 1FFOB 1FO0B 1IEAA 1QRNB 1URQD 2APBA 1WEJH 4I48B 3LRSB 1IGTA 5T3XH 4KH2A 2I07A 1A4CA 4Q56A 4OQTL 1IILE 4A38A 1YY9C 2R2CA 2WXHA 5B3JE 4DT2A 3BH9B 2VN5A 3AVEA 3BRTB 2YPKB 1NINA 5ADPH 3HHMA 5KZCD 1XGPB 1NEZB 1L0NK 3QFJA 4PGCA 3Q2YA 1IM3A 2D0GA 1H0DA 3EJZD 1QHPA 3AU1A 1S1CX 2AS5M 2BY2A 1DEEB 3UAEA 1TQWA 3VFVA 5KTEL 1FU1A 3G6JF 4TPRL 4Y5XA 3C6LC 4IGBC 4XO5A 4KI5C 3PH0A 2R27A 1MQKH 3SBWC 2IBBA 3L3HA 1UD3A 1EGJA 1FAKT 1CCZA 5B39B 3M07A 2IFMA 4GIAA 1J8KA 3VCLA 2KT6A 1MJUH 4YDMA 3IJSB 2C1PB 1INEH 3VOPA 3E7JA 1LT9B 1Y6MR 2JKVA 4JO1L 4TSBL 4WK0B 4WY4A 4FQQB 3BD5A 3RGVA 4ZMNA 5IMOB 3TF7C 4K9JA 1XR9B 1NPJA 3E6FA 5TPWH 2HTLC 3HI1B 2A83A 3B2UC 4EO5A 4ISVA 3KPPB 4J3OF 2PGDA 3CX5J 1SHMA 3AE4C 4AJYV 5EU5A 3M1BA 4KUZH 1KXQE 4QRAA 2EDBA 1G7QA 2FRGP 5C2BL 2X4QA 2FEEI 3VB9A 5D96B 1AXSB 4WTXA 1GY1A 4UQCA 1KJ2L 3P73B 3RL0C 1KQGB 1RZ7L 3WFHA 1J1DB 3K81A 3GIVA 4ONFH 3MGOB 4UB8H 1W2BO 2DI9A 1M1XB 3LXUX 4KTEL 4M56A 4W4NA 5HVHC 4L4TE 4EI2A 4HH9A 4J28A 4UINL 2C3HA 5F71A 2A73A 5DJ2A 1KYDA 3CZGA 4PJFA 4PJGE 4C4UA 4CMMB 1LP1B 4EI5A 4NQVB 3LKPA 4FP8H 3NCXA 1HOEA 4N25A 1DSYA 1NCBL 2W6AA 3V6BR 5AQ0A 2IPKA 3P2TA 3HG0A 4CVWA 2WTPA 1OGAE 3W2DL 4GJTB 1QX8A 3TJPA 1Q9KA 1T89C 2VXQL 4RGND 3MRJB 3M8OL 1NIFA 4GO6B 1PCSA 4I0KA 4PB0H 5J4MA 3GDCA 4TLSA 1B0WA 1FIGH 4JMNA 3GB7B 3B9KA 1FDMA 3DPDA 2DM4A 4HS8L 1NO4A 1OAJA 3UZQA 4RFNB 1VFUA 1SEQL 1XZ0B 1R3KA 2E46A 1JD9A 2HVBA 3ARBA 4N0UA 4MNHB 5B1CA 4GKZB 5DJXA 4XNDA 3WNMA 3V6OC 2LT9A 1M9WA 3BW9A 2ITFA 2N59A 1A6AA 2PO6A 4D9LL 4KKAD 1MCNA 4JKWA 3QRFM 1I1YB 1X6NA 3B7SA 2YXRB 2XN2A 3P8CD 4LSSH 3RK2C 3BZFB 3TSIA 2QSIA 4G7YH 4BFFA 2CE6A 5IM7A 2BOBA 4LPXA 3OKNB 3NSFA 1NMAH 1R33A 4NUJB 2FATL 5CKGA 2HLFC 2CJ3A 5EOQH 2FJSA 5D1XE 2XKNB 3AWFA 4HFWA 5FYKU 2CDGB 2XBDA 1BJ8A 5EWIH 3VI3A 1JSYA 4PI2A 4UM9B 4BGLA 2I60L 2VLJB 4OZHA 4W4OC 5BO0D 4Q9BA 4ZUWB 3OR6B 3Q8AA 1UM4H 3TBYB 3CK0H 3UYPB 4RX4D 4HF5L 3FDWA 1GA2A 1G6RL 2EEXA 1OPGL 5C08B 5APUA 1VL2A 4JFEE 2XBZA 4M03A 5ANME 4I2XE 3ETBJ 2CHNA 2YBRA 1YNTF 4JM0A 3HBQA 4JR9L 1EHNA 3CFNA 1OGTA 2MOGA 3AG1B 4AI7A 1FUNA 1OGPA 4D6TE 4W9KC 1G87A 2LAGB 4KTYA 5DJ6B 4BFRA 1UFUA 4O02A 1N3NA 4IJTA 4TVPL 3T0ED 4R6UA 4DERA 1MRDH 2J2ZB 2F61A 4M5ZL 2BFVH 1CUOA 3G5ZA 2C9NY 2IBZE 4HWUA 3O9WC 5B66E 3S2AA 1IO4C 3QDME 3ZKNC 1KBGH 2ZIDA 2D31A 3VRLE 3MNVA 4UIKL 1ZMYA 4AOFA 3H32A 1JPEA 2AZAA 4U1SB 3RZCD 2GT9A 4QLWA 2AI0H 2XZAL 1L0NJ 1BBJB 2ED9A 2ATKB 2WLJA 3T2OA 4JFQB 4XNZC 4XNXH 1E8XA 4Y5YB 1QLEL 3EO9H 5FECA 4AV4A 5T3ZL 5AZ2H 3CCJP 4HC1H 1FFQA 1RJCA 4G2AA 2UX6A 3PWUA 2R23B 2NNCA 4K3JL 4OFPA 1JI1A 4PWGA 5F70A 1YY9D 3HCVA 1A7OH 3U25A 5BCAA 5F3FA 3N85L 1O6TA 3AXHA 2ADIB 4ZMVA 7PAZA 4GLRI 1NCCL 3OGCA 1IFPA 5I75B 1HWGB 1MIEH 1VQLP 1BBDL 1NM4A 2WVSA 2N1TE 3KPNA 1WPCA 1NGWA 1GW6A 2ID5A 3H0TA 4TVPE 3CJJA 5E6IC 1KC8Q 5BVJA 3NEXA 3VWJA 1XCXA 2PTTA 2F18A 3G08B 1NDGA 4G42B 4K7FB 4PJ0E 2H26A 4XMPH 1IGIH 3QUML 4LL4A 4IGBD 4QHUB 5BV7C 4TULH 3DJSA 5KG9A 2EZ0C 1ILUA 2X4SB 1KLGB 1DDTA 4OQTA 4X8JA 3MREB 4LDCA 2OYIC 4POUB 4WWIA 3W67A 1KXQA 3PGDA 5F7AA 2LOEA 1RF0A 4LLDA 5F88A 5T3ZE 4WWNA 3D25A 3UTTD 4WHYG 5C09E 3GPEA 3HJ0A 3B2UD 3WEXA 4B96A 4BCXA 3CDFA 3CSYA 1SDDA 5EUOE 3BO8B 4DEWA 3S35L 4BUGA 1OSPH 1Z5HA 3H3BC 1GYWA 3R1GL 1U2CA 3L13A 2IAMB 4FXLA 4JZNB 2KKQA 4QYOB 1ULVA 1P0SE 1QNIA 5FGCB 4F33A 2LLNA 4L4TA 1GXEA 2XZCL 4C83A 3TA3B 2HFED 2QLYA 3TO2B 4BZ2L 2HKAA 4P4KC 3CCUP 2GM4A 3E0GA 3II6A 5LDSA 5D6CB 4PJGA 3CIQA 2FSDA 4WAFA 2ZWSA 1JL8A 5K1VA 4LC1A 4ZMPA 5G5DA 2OCFD 2APFA 4PJCE 4MXVF 1ZHKA 1DQDH 1OGAA 1NTZE 5CBAB 2O1AA 1HH6B 2A9NL 3H2WA 3DX7B 4JQXC 4QXUH 3M0DC 1CVRA 2FNWA 3RTQA 4DZ8B 5JW4Q 4L48A 3H4FA 3SDAD 1J5OL 4MCYB 4EKJA 4A6YB 5IJVA 3E3QE 2XICA 4N9GB 2JELL 5FYKH 4MZIA 4JG9A 4GNKB 1NBZB 1IGYA 1RXLA 2F0CA 2C0XA 4LLHA 1MFEH 4I0CC 2MRYA 2XX1A 5I1GH 1P4UA 5E94B 1KJ2A 4LPCA 3JWDH 2WXLA 3E1RA 2J6WA 5CP3H 5IB1A 4M1GL 2XKMA 5DRZB 3TIDB 4IDJL 4QXTB 1ADQH 3RX7A 2XTJE 3RKDC 1S9VA 5LUMA 2AV1A 4PYGA 1N68A 2ETWA 4NPYA 1ACYH 5JDJA 2NXYD 5KVDH 1FO0A 2DQFB 1TJMA 4LCYB 4ZFGL 2BIHA 2G3NA 3BSHA 3HBZA 3QNXA 1R5WB 4LMQI 4Y7MA 5IOPB 2RAMA 1WHOA 2W9DH 3ESNA 4QJ3B 1MFVA 2A4EA 5KVFL 5IREA 3WJLA 4MCZA 5D1XA 2H1LM 2VO5A 2Q9IA 2WUBL 3RK2D 1SFDA 1G1OA 2KIKA 3P4OA 4MMYA 4BWUA 3GKWL 1PP9E 1O9WA 3MFGB 5E95B 4QDGA 4XAKE 3QFGA 1ZKAA 2VDRH 2VXQA 4UILH 1AGCB 4EOTA 1NCWL 2HLFD 4H1LG 4DAGH 5F9DC 5FA4B 4U1GC 2PMZA 1MG3C 3LQZA 1AP2B 3WI9A 1TYEB 1OVVA 2W9EL 5AVYB 4RQQA 1RZPA 4K71C 2WD0A 3CDZA 4HZ1A 3JV4A 3ZZSA 4A7GF 4P5KA 4LRIC 4Q6IB 1PL5A 4JFEA 5ANMA 3CAFA 3IN0A 2ZOWA 1FYTB 2X89D 3APNA 2JKWA 2FLMA 4YZFE 4Y5VA 3T3ME 4OJEH 4ERSH 3BX7C 3VSUA 1IFNA 1NGZA 2WSEJ 5ID1A 4K8RD 2MH4A 1AGEB 1XR9A 2XA8L 3SDCA 1WA2X 3ILQD 5AALA 3WAJA 4YAQB 5ISZB 5HVFB 5KVFE 3BGFC 1I8AA 1GZHA 4PYHA 2H8PB 5IHZA 1A7RH 4GYBA 4TXVB 5FWRA 3QJRB 3CVHL 1SQVD 2WAHA 3QNYA 1Q0EA 4XGZA 3WEBA 3QDMA 1IBGH 3SWKA 3QCTH 4OZIB 1CIDA 2Y25A 4UMSA 3L7EA 4Y88A 1IKFL 4U1HB 2E59A 4N2EA 4C46A 3ZDXF 4U3SA 3IBEA 1KYUA 2FEEL 3T97B 1S7WA 3DDGA 1FFNA 2BSTA 4Z8FH 2FWUA 1G6RA 1SLUA 2V9RA 4HS6B 1TTRA 4PJ7F 4GO8A 4Y19B 1EXGA 1ZDSA 5EBWB 1AO7B 3OJAB 3DK2A 3GQFA 1HNYA 1PF3A 2LU5A 5F3HA 1KTRL 1PX4A 5EO9B 5D5ME 5CD5D 1WCBA 3KPSB 3O41A 4IM8A 5AZEH 2G9KA 5DI8B 1D5IH 4K2UL 5HVWA 2L5GB 3IFLL 1H3UA 1RIHH 1CYXA 5I76A 1V55B 3S37H 1F45A 5HYJD 1P1ZA 5ANHA 5AW7B 2N1TA 3UJJL 1OIOA 4HWZB 4HUXA 5H94A 1QI5A 1ZR2A 3KPQB 1MAML 1FN4A 5SWQB 3LIEA 4WGKA 5DU7A 5JIMA 3S8WA 4YEFA 4EZKA 2VT0A 2FZ3A 2KPWA 2WQWA 2ADYA 2C8NA 2NY7L 1PZSA 1YYCA 5E6ID 1E65A 2Y2TA 1GHFH 3ULVL 3QUXB 4LP5A 1JV5B 3BAXA 3N43F 4AQ1A 4V2BA 4YL4A 3T6XA 4Z7UB 1UKTA 5TE7L 2ZOUA 4UNTA 1I1YA 4AQRD 1UZ8B 3GHPA 2ZPKH 5EUOA 3P7KA 3B5ND 5I18L 4C7NB 1L0QA 2VLKD 3CSFA 1U91B 3KCWA 4F2MB 4UB6E 3ESOA 4LOEA 4LSTL 4ODSL 5IHUH 4BCYA 4K0OA 2CDGA 5I73C 3UBXA 4NN5B 2EYSA 2P42B 2GB2A 1JWSB 5FKAA 2HT4D 3UAJA 1D5BA 1XR8A 4FN0A 4PJHB 4FE9A 4HLEA 3S88L 1CGSH 4RO0A 1QEWA 3MJGX 3L74E 5EORH 3X1FA 4YXHL 4F5CE 5CMZA 3F05A 4FFWC 4PJCA 3ZE1F 5SX4H 3UACA 5EIIA 5JMOC 5J06A 1CS6A 3QUMA 4CC4A 1OAYL 4P4KD 5B1BB 2PAJA 4C7RA 2DQCL 2AGJH 3ULVE 4Q9CA 2JSFA 3DJZA 3M46A 1TJHH 1YMHA 4XA4A 2R9HD 1J1EB 3HTKB 2WMPA 3MRFB 3PJSA 1IGFH 3DTXB 4YDIL 3BUYA 2ZAEB 3HLAB 4XNQB 1OY3B 5GGVY 4AJVA 4X7DC 4PJDE 4NPKA 1FZCC 1YRKA 3L95A 3FB6A 1R4XA 3H9HB 3FU5A 1IJNA 3F5HA 3BGAA 3CQPA 3QW9A 2J5LC 1NHLA 2O3JA 4NHCL 4PJ9A 5DSCB 2K7QA 2BHFA 2HVKA 3PDGA 3ZDZE 4L8DB 5KYYB 1GGUA 2XN9D 5T5NF 1DTUA 3VXTB 3RWIA 3FT3A 3LKRA 2DLIA 3PAZA 4BZ2A 3CXHJ 2NRGA 3UO8B 1GL2B 2BEQD 3KLLA 4Y4FC 2Y0CA 3RKDD 1TF4A 4JHUA 1EZVG 4U1SA 2F58H 3KCPB 4UZSA 4YFEA 3AM8C 2APWA 3IDNA 3MBEC 4ZUTA 5IWLC 2WWWA 2OYMA 4XNMB 2NZ1A 4DGUA 1A6ZA 4NAJA 3EGSB 3IT8D 3FUDA 4P5TB 4PMEA 3UIZA 1SQPD 1JNHA 4ETQB 3STLB 1UJ3B 3I74A 3LPPA 3BH8B 2YEZB 1JYXA 4E36A 5T33L 1P5UB 1U92B 1ZCRA 1DQJA 1KZQA 3EDJA 5DLLA 5I23A 3Q01A 1OW7A 2JJSC 2UXVA 4M43L 3CCQP 3CC2P 5AWNL 3UAAA 4G7SB 3CHXA 3I3DA 1N7SA 3BVXA 1R3IL 1DSFH 4AMXA 1ZLLA 4PGDA 2DQEL 3DJRA 4XAWL 1E27A 3ROOB 3Q6GH 1CFNB 2EXYD 3PXJA 4JDZB 3S4SA 3L4TA 2O93L 4JPWH 2H45A 1TQSA 2A6JA 2WXNA 3AS2A 5GGUA 3K2MC 3UCQA 1MJ7H 3ESUF 1CE1H 3O8ZA 3BH4A 4YX2H 4P3DB 3TNUA 4D9RD 2Y24A 1A6UH 2ZCKH 3WEMA 1P84J 1ZK9A 4L3ED 1G2CA 4WW1A 5AKTA 1JY3P 4MJ5A 4ELDA 4BSVA 1VQOP 2BMKB 2D2OA 2NLJA 3LRMA 2CLZA 3ZUCA 3O11A 1L4AD 2RHEA 4QEGA 1SBSH 5ITFB 3N4XA 5J8OA 5JOPD 4L1DA 5GS0C 4W9DC 3BIKB 3KLQA 5LGHH 1EJOH 3LH2L 2OTUB 2VO8A 1F1DA 3JBG7 3DMMB 4FMFA 4JJ5A 3L35A 4R3SA 3WMM0 1IT9L 3BO8A 2KL6A 3EADA 1UOLA 4TUKH 2H32B 4P23C 4WSKA 4GT0A 1N0LB 3O2WL 5DZVA 3GSNB 2FVNA 5IB2A 1YEIL 1UUSA 1NC2D 2WLMA 5IT2H 2GG1A 3G6AB 1BOGB 3IMWA 2E56A 4FA7B 5AW6B 3IFNL 4AGNA 1OF2B 4ONHB 1T3JA 3V9CA 2DAVA 5E8DH 4FQ1H 2IQAB 15C8H 3BGMB 4GRLC 5D5MA 8CGTA 3TESA 4N90E 5JDSA 1Q9WB 4YE0A 4RSVA 1A4JB 1IGMH 3I6SA 1J2JB 1MI5D 5DJ8B 4HUWB 1XB3A 3NMEA 5C0BE 1JYWA 1DBAH 1TPXB 4BE6A 3QJHB 4HJIA 2W0LA 2P44B 2PTUA 4MCYA 4O2FB 4NNPH 2VDLB 1VGKA 3LTVA 3CVHA 5JXAL 4WENB 3QULA 1Q9OA 2WK2A 1I8LA 2V5YA 4K5OA 3VAEA 4QRRA 2DMKA 5JZ7D 5I1KH 5DHMC 1MCOH 1C5CL 4M3LA 4K9EC 4NRXB 4QXTA 4EOWL 1G7JA 1R6VA 1MIML 1T2QL 3DRQB 1U8JA 2APXA 1VZIA 3HVDA 4K3HA 2OZ4L 4F7CB 3H1HJ 1M6UA 3FQXA 3QQ4B 1BF5A 1ZVYA 3U9UA 2BNQB 4ZMXA 5F8RC 1IVTA 1T21B 1L5GB 2JWDA 4NZRL 4S0HA 3NTCH 2IV8A 2I32A 1UB5B 2CPCA 3N44B 2X4PA 4YHPA 2LR4A 3RX9A 5IOPA 5JNYB 2GTQA 1E4XI 2XPYA 1YQ3C 3BDYL 1MLBB 1UATA 3MRLA 1T7VA 4PS4L 5LAPA 3ZTDC 1LQSR 4BA8A 4ZNEE 4NQDB 4AVIA 3OB8A 3VW3H 4I2LC 1RURL 2MKWA 1GGCL 1XF4B 1LMIA 4HULB 4LLWA 3H1LD 3SYPA 5T8IA 2QJDA 3FO9A 1GGBH 1AGCA 3RX5A 3L3GB 4I9WE 1D6EA 5PCYA 4IKJA 5H2BB 3LEVL 1J8HD 4NZJA 3RAJH 5AG8A 1UZGA 1XD0A 4F5CA 3RLSA 3BEVB 4E41B 2YOAA 3O3AA 4PV8B 3BRGC 5I8CB 3QXDB 1DCLA 3T6WA 5C07D 4M6NL 4ODHL 3L3IA 2O1KA 5EU3A 4NKDB 3IF1A 3J27A 5B38B 3M91A 5GGQH 1ES0B 2FWSA 3N41F 3C60B 4GI8A 1J48A 4FFWD 1FYTA 1MW2A 4L9LA 4OTXH 4XP5L 5I1LB 5I8EA 3F7LA 3D18B 2QQKL 3HB3B 5BUPA 4BDVB 5JIDA 3HE5A 2YD3A 3SPGA 5HTSA 2QJYB 3GJFA 5F1OB 4PJDA 1JV2B 4K8RH 4I1RA 4IMLB 3OHXC 4PY8I 2G3XA 3A22A 1K73Q 5F7MC 3FSWA 4HG4J 5SWSE 3MMEA 3HAEA 5CJXA 3SDXB 1BE3G 1HQ4A 5AB0A 4UTBL 5I1JH 4P2OA 3UPRA 2F53E 3PWVB 2B20A 3GWJA 4JKLA 4OFDA 1D5MB 4C57C 4CSPA 4ACTA 5F3BA 4N3YB 4FX5A 3VQ2C 3AE9C 1W15A 4XC3H 4OV5A 3Q5SA 3MA9L 3VYNA 1UWGL 3QUHA 2VR5A 1CZ8L 1JHTB 3BKYL 4TNFA 3TIEA 5B8CB 2WBKA 4MMXB 2XRAL 2VERN 2IDFA 4ANVA 1J05B 3FT0A 3RVTC 4GBXB 4OFVA 4HVBA 1AH1A 2NXZD 4S10A 2FX8L 4Y19A 3P2BA 4FQLL 4X80L 3S37X 3FFCB 4GODA 2JKTM 1SQBD 5GJTL 3KVQA 1R3LA 3ECQA 3KR3H 2ZP0T 5L2JA 1SOKA 3MI6A 3MBED 5EO9A 3RVVC 3T08A 2Z4TA 3EGDB 1W0VA 3KWTA 3GUTB 2MNUA 5DI8A 2BS71 2RGSA 3QSKB 1O5DT 5DK3A 1TIUA 3VG9B 1TFHA 5C0JB 1WEJL 3IGKA 5T3XL 1KORA 2YN3A 4Y4HB 2W0PA 3BMVA 5EMYA 2BCKB 4C58B 5J56B 4MJJA 1MVUA 2WXKA 5IOKA 3GUFA 3INOA 2NQ3A 4U3FE 4JW3A 1KXVA 3MUHL 3TASA 1ETJA 3GMLB 4LPWA 5ADPL 1UZ6F 2XN1A 3GBEA 5JOEA 5LNGA 3VD0A 1N59B 3WLWC 4M8QB 4Z3EA 4WRLA 1HXKA 1NC4B 1EIBA 1CICB 3M7FB 2AJYH 3WN5A 1F6AB 3B71A 3BPOB 3GLEA 2HMIC 2DIAA 1MQKL 5C3LD 4IOIB 1ZDQA 3T6ZA 2BIQA 1UZ8A 1CD1A 3PJLA 5BVZA 1P9MC 1CLOH 5E79H 3SCMA 4YHIB 2DS4A 3AY4C 1MJUL 1I8MB 1INEL 1G7LB 2ZAHA 3EO0B 2K3TA 3IN6A 3QFDB 4IBSA 4XPGH 1MUJB 3J8F7 4FXKA 5GS0D 4OVVA 4QJ4B 4PJ5E 5T3XE 3Q2WA 3L70D 2QT6A 5TPWL 5EZIH 4XCNB 2BO0A 1M1JA 4I77H 3TO4C 4HOWA 12E8H 1XIWB 2NX5B 4X5XA 4KUZL 4JDEA 4AIEA 1B4LA 1LEKB 2GFBB 3OW2O 25C8L 3GXDA 4BK4A 3WFZA 4MAYA 5HHOB 4P2RB 2GUOA 3VFSB 3IJYA 3CWBE 4N3UA 5C0BA 3ATBA 4CDHA 2YC1B 1QSEB 2H2PC 2X4UA 3EFDH 2K0RA 4GRLD 3ZOAA 5L8JB 2LU3A 3HG2A 4L29B 4PRPE 1XGRB 1NCJA 3K6IA 4DKDC 2LW3A 5DTFA 4JO3H 1QO3A 4ACPA 4CSTA 3B5NA 1ZIBA 4ZMQA 1RZ8B 2A6IA 2FJHB 3T0VA 4HKBA 5A6MA 3BAEH 3AABA 2VSMB 32C2A 1EBAA 1KDIA 1DLHA 4FP8L 1M2VB 4L74A 2AQ3A 2QRXA 5C8JB 5L9DH 3H9HA 4IBWA 3X1GA 4ZW5A 4QTFA 5I0VA 2IIJA 1JGVH 2DWEA 4GG6B 2C3VB 3TN0A 3QQ9D 3WIHL 4Z7QB 1H8SA 5JOFB 5JHAA 2KNCA 2BVUA 3MHZA 5F93C 2E7HA 3SQRA 3FN0H 2V9QA 4PB0L 1FIGL 2AV7B 4ZNEA 4GW5A 1ZRTE 3L3JB 1L0LD 1K5NA 1SYSA 3BFQG 2F7IA 5E6YA 4M93B 3PWPD 1ND0B 1UJ3A 2YS4A 1Q90A 3LYRA 4IEFB 1XF5B 5AVZB 5FPIA 1URIA 1ZVHA 2FLBT 4FI7A 2PF6A 1UG9A 4YGVA 4ZW7A 1T22B 4LSSL 4E5XB 1HH9A 3A6CH 1SQQE 4G7YL 4OGZA 4BH7A 1WAAE 4GAGH 1MWAH 1NMAL 1UWYA 2FFDA 5GRWA 1A2YA 5EOQL 3V0HA 1SJHA 2R44A 5DC0A 3L4WA 1GGIH 2OZ4A 3AXLA 2M1KA 2ITEA 1BVLB 5EWIL 2WZ5A 1N2RA 3G6JB 3VXUE 3DHMA 1NGQH 3QR0A 3ZDYF 2E9WA 5E56A 5ES4B 4CN4A 3BCCG 4A37A 1Q0YH 5SWSA 1UM4L 2BMKA 2Z5IA 3L8QA 1HJCA 1G7PB 1WBZB 2CNYA 4WI4A 2F53A 3TBTB 1X5FA 3TGUG 5FM8A 2ZT9C 5IVNA 3AE6C 4FYRA 4YBQC 3HMXH 1SVZA 3OJDA 2FX7H 4UT7H 1G9MC 2P4AB 2KXPB 2ODIA 1MFUA 4TQ8A 1A9EA 3A0HH 5D1ZC 5IQ9A 3RVWC 3CMAP 2UZXA 3MUJA 1LWUB 2Y7SA 1YZZA 4NO0A 1NOLA 3LEYH 3FHEA 1WWAX 4CVZA 4ZFQA 3ZL4H 2RA1A 1BCIA 2AAAA 2CK2A 4OJYA 1IE4A 4XT1C 5H2FH 3AE2C 4EI0A 3KDPB 4L73A 3TVMD 3O3BA 3RUGE 3T5WA 2OTWA 3PHOB 3WY1A 2IPUK 2O6EA 5BQ7B 3B2VH 4ZNCA 2F54E 3OV6A 4KKRA 3L1EA 4LLYB 1KBGL 1WFTA 2FTAA 1AR1C 3MPCA 4EIJA 4HUWA 4PG9B 2LV4A 1S9KE 3H1HE 3JXAA 1RJLB 2ZYGA 1W6LA 2WQRA 4HAFA 4UTBA 2SEBB 1QPPA 4XNXL 3EO9L 3AU0A 1E67A 2J8UF 5AZ2L 1NTMG 4PB9H 1CR9H 4E9WA 4YTPC 1NCOA 5DK0A 5E8PA 3BSZH 3T2QA 3HR5A 3S9OA 2CWRA 2YO2A 1A7OL 5DZOA 3TBSA 3QRGH 5CJ0A 3SPIA 3IYLW 4NO3A 1WBXA 1S46A 4BQCA 2Q8AL 3BP7A 3H9SB 2P1YA 4OUOA 1MIEL 1F02I 4MXWH 4B41A 1CF8H 4G6AC 3MRIB 1WK0A 5BU8B 2J58A 3WLWD 2DB8A 1FNGA 4AM0A 3L72D 1E5ZA 3S96A 2DOCA 2VL5A 3RQ3A 3U59A 4P57A 2OAAA 2H2SC 1HESA 2WOYA 3DVFA 3DYPA 3PV6B 3ITKA 4FHKA 1IGIL 4WJ5A 4XMPL 4YHLH 5GRXG 2HMID 2F8OA 1VADA 3OWEA 4TULL 2E5EA 3MJ8B 3MRNB 4PJ5A 3O3EB 1RULH 1BFSA 1OT1A 2X41A 3G5XB 5TH2A 1MQ8A 1RZQA 4GQ9H 1EFQA 2BZCA 4CMHB 1N67A 2XCMC 1JPST 1Y07A 1E5YA 2XBTA 1IFHL 4XCYB 4X9HA 4LASH 2P8MB 3L75G 1I9JH 1C7TA 1KY6A 3BPNC 4IU2A 3T65B 2YKKA 1I1CA 1PD1A 5AAMC 5KBPA 5KZCB 3X2QB 3M9BA 1LO4H 4QKXB 5AVSB 1CG9A 1OSPL 2F7QA 3SSGA 5B38A 3IDJB 1MY7A 4PRPA 3N1GC 1OTUD 3C60A 3D50A 3LH9A 1NIEA 3P4NB 3EOBB 4XX1G 4YSOA 3G6EP 4XMWA 4KK9C 4S1QH 5A16B 3VFNA 1PIGA 5CD3B 5SWZB 3DPBA 3EFFK 1MAKA 5F7DB 1KWKA 2XKSA 1XGTB 4AQEA 5KSBE 3ARDC 3DSNB 1F4WH 1YNTB 5D7JC 5SX5H 1FZJB 2EH7H 3UTOA 4LNRA 1K2DB 1DQDL 2AJSH 2V2WA 4NSKB 2WQVA 1QLRA 3HRZC 4QXUL 1HILB 5KVEH 1NZRA 2Z34A 4JLRA 5A2KH 1DIPA 2FEDC 3KPMB 1BQHG 1MHHA 4MB4A 2PXYD 2VAJA 1WMKA 1JHTA 3IJ9A 4MHHI 4L1HA 4DQAA 3DUSB 1U3HB 3UC0H 1BFVH 1MFEL 2NR6C 3NCBB 5I1GL 1J05A 3JWDL 3SKJH 4PVNA 5INCA 2D73A 1I85A 4LSUH 4XTRD 1F11B 5CEYB 2G8YA 1ADQL 1NFIB 3Q3GB 3MV9D 4RISH 4WK2B 3N42F 1AD9A 4ENZA 1OMIA 1SMDA 5ETUB 2FUQA 2VDQH 2VDNH 2ZUWA 1YPZF 2Y2YA 5D72H 2YAEA 4G3YH 3TJHC 5KVDL 1D5RA 3V4PB 2ENPA 2HPCB 4URTB 1EFXA 2Q5UA 3GSXB 4JHAH 3RBZA 4WHDA 2W9DL 2CALA 5IKCB 1J9SA 1FNEB 1A7NH 4I18A 4U2YA 4EIBA 1UXMA 1RUAL 3WIHA 5JPMB 5I1EH 1V10A 4F37K 1HT6A 1A65A 3FO2A 4LSDA 2IADB 4FLQA 3VXUA 5HP5A 2E8YA 2VDRL 3PL6A 3QXUA 4TMPA 4UILL 3VWKB 4DAGL 4OFYA 1LK2B 5FYKE 2WLLB 3ULSB 4GT1A 2VXSH 1EVTC 3IKCB 3ZT6A 2CLVB 1N59A 2AQTA 4I6MC 4TSCH 1TXKA 3UL4A 3F2LA 1WE5A 2R2BB 4JUTA 2VJ8A 5CJ4A 5IG7B 5IR1A 3FCSA 4C59B 2Z93A 1NC4A 3SKMB 3G9RA 1NOAA 1F6AA 3B4NA 2EE9A 4IOIA 2L4OA 4QF1A 3SE6A 4KK5C 2W65B 4PCYA 5CZRA 1MFDH 1GMIA 2XOTA 1ZXKA 5DC4B 4ATTA 3CCVP 4DFHA 2Y0EA 1JMXA 2ZXEB 5L4IA 5KVDE 4QRPB 5GIRB 3TFBA 5GS0H 1HHGA 4JDVA 5MP6H 2ZT9D 2IWEA 4DKAA 2CD0A 1UIXA 2DM7A 3HVNA 4I1NB 4A7VA 5BVPH 2CBMA 3RUGA 2GC4C 3USSA 2ZX7A 1A7RL 5D1ZD 4R5TA 3RVWD 3EBIA 3PXLA 2EIZA 4R4MA 1FLRH 1OSZB 4JL2A 3TTSA 3V52H 5JW4N 2EVHA 3P11H 1TMCB 1Z1WA 2WINB 3HZMA 1AGBA 4GP4B 4ORGA 2MQ0A 4R7NA 4BWTA 2JXMB 1DDHA 1IBGL 3QCTL 4L1LA 1U8MA 3GSWB 1MG2C 1INQA 2MKVA 2G4GA 2UYLA 3GEWB 3VXME 4PTTA 5K59E 6CGTA 3FUMA 4L29A 5DDHB 3U6RB 3QORC 1FZEA 3AE5C 2E74C 5I0XA 1IQDA 3U36A 3CC5B 3S8GB 5I15H 1F00I 4Y4KA 3VMXA 2HLEB 1IM9D 2FJHA 2IO5A 3VJ6B 1J9RA 4BHUA 1JK8A 3EHBD 4WO4B 4QTHB 3S9DB 5AZEL 2NDFA 3FHAA 5E5MB 3HPLA 1EANA 2DYPD 3T4YA 1D5IL 2DZEA 4QRSB 1RIHL 2GSMB 3VA6A 1HCFX 1JY2O 2ENSA 4NFDA 4ZUVB 1JMMA 1IKNC 3DV4B 4E42B 5AAPA 5HBBA 4DN3H 1TU2B 3TH3T 2Q6QA 1AHWB 2QPUA 5K9QG 2CUMA 1TQCB 5EOTB 4K9EH 5AOLA 2X0UA 1SQPK 4G8GB 1LTTC 3LPGA 4BRJA 2Z31C 2P49B 4S2SB 1WS8A 4RFEB 4NZUL 3EH4B 4NNYA 2D0HA 3D6YA 4BXSV 2D7QA 1GHFL 1S7VA 5IJCC 4XBPA 5ACZA 1K6QL 4LLMB 5E9DB 3DBXB 4LRNH 4WI7A 1JZ5A 4GDOA 2B59A 3ZUNC 1IC1A 3Q5TA 4Z7NF 2K9JB 1N86A 1BFOB 3WS3B 1YTZT 2Y1AA 5E03A 3IDXL 1BJ1J 4E5XA 1GR7A 1ZPUA 3LKSB 4PR5A 4PWKA 2ZPKL 4X9YA 5D4QA 2G4EA 2ZUQB 4G8EB 3E38A 3DV6B 1CLZH 4MQ7B 4APQB 4RGOH 3QIWB 2A4CA 1RQVA 5IVZA 5EA0L 3QHFH 1PLCA 5KAIH 3WXVH 4RNRB 5IHUL 2MFNA 1IUZA 2EXWC 3OWRA 1L9MA 3FRPA 4N86A 4RGNE 5IJKC 2X9WA 3GHEL 3IU4H 2WOBA 1C7SA 1I75A 3LKNA 4IOSD 4A7SA 5KSBA 4BD4A 2VN7A 3HC4H 1CGSL 2W81C 3BP5B 4OCXH 3AWGA 5EORL 3QUZC 4LOFA 4Z78B 4KK9D 4QCIA 3LXCA 1AG0A 3U79A 4GOFA 1J0YA 2E7MA 1GK4A 1ZA3B 4QOKB 5CSZB 2AGJL 2Z1KA 3U4BH 1I4FB 2WJ7A 4AKQA 2NT0A 5D7JD 4TKWA 1TJHL 2OMXA 3NIGE 4ZPVB 5TD4A 4NRZA 4M61B 1KTCA 4ZKUA 1IGFL 5JQ6H 1GW0A 3S3SA 5FA3A 5TE6H 3P8CE 3FJTA 4Z7OB 5IW3A 5TDNA 1ZA6B 4XVUC 4DEPC 3WE6A 3JTBA 1BM7A 3QJFA 4F3FA 3WU2H 3BKJH 2A6DB 4MX7B 4WWKD 3D0VA 1PCXA 4UAOC 2CCVA 2NR6D 1N73B 2ADJA 4JFUA 3MLYH 4TNVK 1CGWA 4XCFH 5FFOA 4AE1A 2FR4A 1A6VH 1B9KA 4LARH 1GVIA 2R59A 4M48L 4AYFB 2EIBA 4YS4A 1W8OA 1NCIA 4JRYD 3SGKA 3GLMA 2DWTA 4CN6A 5EC1B 3VNZA 3FN9A 5E51A 2D2CC 1SHWA 5JO5B 3S5YA 3NH7H 4MXVE 3IBOA 4JVWA 2H7HA 2BSSB 2NCEA 1A9BA 4ECNA 3JT2A 2XPZA 2D7NA 4JM2B 4HYTB 4L3CA 1G9NC 2PUQT 3ZLQC 1HHHB 1HI6B 3INUH 3ZTJG 4I2XB 4K55A 4R7XA 1GW4A 5DR5H 1A7BA 1K8DB 1OLLA 1KB3A 1PNCA 3VFTA 3QEUB 4G9DB 2VISB 2IGFH 1WZLA 1QASA 3DX3A 5C7XH 1EDIA 3S36H 2EUWA 1DSFL 5EULV 5L6YH 3ZHNA 4IDLA 3I6KB 4M6AA 5CCKH 3Q6GL 1KGWA 3FRUB 4LHUD 3T0EE 1KN4H 2RFXA 1ZMEC 1ADQA 1MZYA 2CRYA 1KY7A 2WLZA 3BWUF 1EQ7A 3CN0A 3QJUB 4JPWL 1ONQB 2AQPA 3ZU8A 2W83C 1NWOA 2XTSA 1O7DE 1MJ7L 4R2GD 1CE1L 4YX2L 4TSAH 4AYID 1A6UL 2R7EB 2ZCKL 1URQA 1I3VA 3SPHA 3IRCA 5F1IB 2MCG1 3KGRA 3RWJA 2ZOLA 4CU6A 3CFJB 5HYQA 2FK9A 4KK5D 4Q58C 3WUWG 3O0LA 3QG6A 3RY4A 3POCA 3WTVA 5AG9A 2P8LB 4EUPB 4RDQG 4KGLA 1DVYA 4IU3B 5BZWB 2I9TB 1SBSL 2BC4B 4YBLB 2R1XA 5E1GA 3T0AA 2D3NA 2YXWA 1T1ZA 3GMNB 2JNZA 1SF3A 3GXMA 3HS8A 1ETZB 4NDMB 4XP1H 1EJOL 5LGHL 1JGIA 3MNDA 4R4BA 3MV11 4LHJB 1NU1G 1XF2B 3BZDA 3FN3A 4TUKL 5C1MB 4MVBD 1WWBX 1N18A 3QH9A 2RB8A 1F4YL 3TEWA 3UXFA 1UA7A 4HV8A 3CZFA 3ZE1B 4F1SA 3VGAC 5SX5K 1PQZA 2EE2A 3APDA 1E5AA 5D4IA 1D5ZB 2NY4C 3FSZA 5E1QA 1S7UB 2M8XA 2WLHA 5E8DL 2QM7A 2R83A 3QQXA 3O0RH 4FQ1L 1MV8A 15C8L 2GVYA 4HFUL 3QORD 2C9RA 5AVVB 2D3JA 5TFSL 2NDGA 1IGML 3C5JB 3LNDA 3MRGA 4TL4A 1A8ZA 5IVXF 2VIRB 1ZHLA 1D7BA 4UQ3A 2UUDH 4OCWH 1DBAL 6TAAA 2KUBA 4EDWL 5FGBC 3TFKC 4GXUN 1AKPA 3FUHA 1MCWM 4KH9A 4XMKH 2E27H 3PHLA 2ROXA 2J20A 4H13B 3MA7B 4NNPL 4XZUA 5HGDA 1NAKH 3N7NA 2G2NA 1LWJA 3UTTE 1E50A 4JHWL 3AACA 4OB5L 4RRPG 5T1LD 4G6KL 4J4PA 3L73D 3NPSC 1IBYA 5C09B 1KCSL 5I1KL 1G4MA 4F93B 1ERNA 4H8QA 3NSJA 4OGQC 1XAUA 2WBJD 4P99A 1L9QA 2QJKC 3MXWL 1NFIA 3MJ6A 4JPKH 5MEOB 2Z31D 2VLLA 1AI1H 1TVHB 5KSAD 5FB8A 3RWDA 2XYCA 3B5HA 1QSFD 3IMVA 4PJ7E 2VC2H 3I9GH 1ZVNA 3L4FA 2C1OB 2JB6B 3NTCL 5C6WH 2NPSC 4GIFA 5JR1L 5DXWA 1HL8A 1S6NA 4D0BB 1MCQA 4YDVB 2IYPA 2COQA 1MHEA 3VW3L 2DWYA 4LVHC 5HYJB 2ODHA 4F7EA 3IDIA 5DEFA 4O2CA 5GS1C 4HWBH 3MBWA 1GGBL 1GAFH 3JSSA 3VWKA 2B87B 3TCLB 4AC4A 4PVBA 4KRPC 3A67H 4JO5A 3O2DL 4PBWD 2UY6A 4EJ1C 5IG7A 4CJ0A 2NW3B 1ZLSH 1MEXH 1PKQB 5ICZB 1IQWH 2K9UA 3LIDA 3QJSB 4M7LT 3QUZD 5IMKA 5JXEC 4OTXL 2IBZY 4FNSA 2ALWA 2WLIB 3DURB 4JHZA 4U1NA 1VF5C 1S9WA 2DQTH 4I89A 3EG9A 4WNSA 3V6OE 2X1PA 3K6NA 4MLSA 3TNMB 4AYBA 4K8RL 1KNOB 3MN8A 3CLQA 3ME0B 3QO1B 1WBYB 1G9MH 3QPKA 3GSVA 5HGAA 3QZWA 4E9TA 3WKYA 5FOBB 5I1JL 3IE4A 2NY1B 3BZEA 1MAJA 4XVUD 1ZXQA 1IFJA 2CG9X 5TE4L 2H0EA 3QQDA 2YD5A 4L8SB 3DO7B 1WRFA 4R7LA 3B9VA 1I1RA 2B1HH 3X12A 2N9BA 2V5RA 3BUDA 2NZ9C 4PJIF 3IPBA 4MJIB 4NQXB 4L23A 1H15A 4RX4A 4UU9B 4AW7A 1KPVB 4RZKA 3TOPA 2OTJP 1IX2A 1MFCH 1NCNA 1M90Q 3BAYA 4PRNB 1NGPH 2JCWA 5EOCJ 2QIWA 1KXTB 4G8FA 5B5EH 4JN2B 3UDWC 1CDJA 1S5LH 3EWKA 1TO4A 3KR3L 1X5IA 2B14A 3VJ6A 4KZDH 3MRBB 2E9JA 4KY1H 3VFPA 3RNQB 4RMRA 4KDTA 5CM1A 4PRAA 4BUHA 2X4NA 4I0PC 5JIIA 1T3UA 1S8DB 3V0EA 1KJVA 3AXIA 5DVKA 1X7SA 4DQOH 1HTLC 1BG9A 1TU2A 2XI9A 3AADB 4XVOA 4XXCA 3T0EA 1BCCD 3FCBA 3HUSA 2P7TB 3PP3K 2BNUA 1WGVA 2GW5A 1SQVE 4KPHL 4J8RA 4G8GA 3MRDA 3MUZ1 3AUWB 2J88L 4JPVH 2VOTA 4GQZA 4X98A 3V4UH 3MNWA 1PEWA 2EDJA 1OWWA 2BCCD 1HEZA 1DBMH 3A6BH 3IWUA 4NZDA 3RZCA 2BS8A 2Z3FA 3RL0g 1F3JB 2V7QJ 4OKDA 1NIDA 4GS7C 1VA9A 2PP9A 4HJGH 4U2ZA 1UCTA 3VH8A 5IHHA 5E6RB 1QQDA 2AJYL 5HDBB 4E9XA 4YFLF 4UQ2B 5JPNC 4WEBH 1P5VB 4GFXA 1BREA 3POHA 3RI5K 3R0MA 1CLOL 3KH4A 5BRZD 1FNSL 4AT6B 4MQ7A 1TVBA 4ELKA 3NA9H 4XPGL 2QADB 5HD8D 3REVA 3JWOC 4YSRA 1ZIAA 5JIKA 4BSWB 4CRPA 2WC7A 3VD5A 4HIPA 1RK0A 2Q86B 4UAHA 5EZIL 1KILB 2V2XB 4NQSB 3HA0A 4I77L 4OCSH 5LXGH 3C8DA 12E8L 3VQMA 3JVFC 3K4AA 3UIYA 1GS8A 4FMKA 3DJTA 4A68A 1L2PA 1RD6A 4KROB 4Z78A 4KKCC 3MYJA 4IGBA 3NXSA 1ZOXA 2NY6C 2NY4D 2M5AA 4FJYA 2WIIB 1JXDA 3SODB 1VEPA 5ESVB 5CN3A 4NKOA 2WYHA 1OB1A 1TQBB 1XH1A 2E75D 2AJZB 4HIJB 2XQYG 4D8PB 3QWOB 4JO3L 4EN3D 4NO2A 3FTGA 4E9SA 3CCHA 2P5WD 2AXFA 2EIEA 3UTTA 4A66A 4DKEH 3BAEL 3O6FD 3TFKD 1CWVA 3RKPA 3E6HA 3TJEL 5DHVB 5E79E 3B9DA 5A2AA 2VLKE 2H1PH 4R7DB 5TF1H 5L9DL 4XN9A 3J2PA 3JVGC 1FL5B 1JGVL 3WEAA 1WS7A 1SN0A 5EO1B 3EOYG 4WHCA 5CZKA 5D7EA 2HFEA 1GGTA 2WKLA 3VFGH 4PJ7A 2DMCA 4NUPA 3P0YL 1NJ9A 3FQ4A 3PFUA 2CUAA 3AG4B 4OGQD 3FN0L 1XV8A 3DSFH 3HFML 4GT7A 1S9XB 4D0CA 5TGBB 4JG5A 5F7HA 5FR3A 5JO5A 5FDWA 3D09A 4PTUB 3S36X 2E42A 3P8MC 1J1XH 2BSSA 2VKWA 3TT1L 3N06B 2P80D 2B08A 4E0RA 2NPSD 1FL6A 1M7IA 3GXNA 3Q2NA 4KNUA 3SDAA 1Q7YQ 4M5SA 1M7DB 4ZAKC 1D6VL 2WZ7A 1KFMA 1T5WA 2JV6A 1JNMA 1P6WA 2HT2D 4HHAB 5DD6B 1E30A 1BE3J 3ESVF 3D5OF 2YAQA 3TF5A 1SFCC 5EDXA 3Q05A 3OR7A 3L1OH 3P30H 1F0LA 3OVUB 1TZHB 4GAGL 1MWAL 5J6GB 5C2UB 5CINL 2EYTB 1O6VA 3GTNA 4MCNA 1XF3A 2JH2A 5EFIA 3ARGB 3FU7B 3M88A 1JGLL 2XN9E 3HE6D 4KQ3H 2EDTA 5D1QD 4QHMA 4X7TB 1LK3H 4P46B 3V0IA 4L3FA 4X4YA 3CXDH 2EH8H 3JUZA 3MJ7A 1NGQL 3ILEA 3V6OA 5JXED 1D7CA 1Q0YL 1T04B 2W0FA 2XFXB 4PJAF 5J3HD 5DGQA 4IIQB 5JORB 1RAMA 1VF5D 1QP1A 4JFPA 1SQPE 5HHMB 2Z92A 1FDLH 3ZN6A 1YEGH 3NJHA 3WMPA 1FFTB 4UV7H 5K9KB 4UZGA 3GRGA 2FX7L 2YGVA 3O8XB 5KJ7D 2PCFA 4HSCX 4IRJD 4W7YA 1XB8A 4UT7L 3ISYA 4Y2OB 4G1EA 5DJDA 3H3PH 5DQ9A 4B9IA 3O2DA 3O4LD 1B9ZA 1PFOA 1SXCA 1XGQB 2QQNH 4HEME 1MW1A 1HK6A 4J3WA 5E00B 3LEYL 4N0CC 1CQKA 3EBAA 3WNJA 2QTEA 3LN4A 3ZL4L 2OX5A 2E76C 5TJHA 4W4OA 1D5ZA 1OTSC 3EDEA 2NSQA 5FWQA 2UUDK 3ZO9A 4YHYC 1U8PA 1RE3A 1B3JA 1NAML 1HWWA 4G9FB 1AZCA 4AYMC 3B2VL 4I4WB 4D9RE 3WHXB 3RILA 3KGTA 8PAZA 35C8H 4L3EE 1NTMK 4GKNA 2QV2A 4RAVB 1KCWA 4RWHA 4Y5XC 1U95B 4JY4B 1ASOA 4Q9QH 2HVJB 4N8VB 2OMZA 1XEDA 2FX9H 3PGFH 4JFFB 4GMTL 1OK0A 5LVEA 2FL5B 2RN0A 2V4HA 1V54B 1ODAA 3VGGA 5B7FA 4HEPA 1BP3B 1IE5A 2CH8A 3IR9A 3N1MC 5BMFL 2V3DA 5JOPE 4DEUA 4PB9L 5EU6D 8FABB 1CR9L 4P5MB 4Y9FA 3RGVC 1KB9D 1Q72H 1OFCX 3NCCB 5C9KA 1CBVH 5LN8A 3BSZL 3SKOB 5I5RA 4P2AA 2V4LA 3T4AB 4Q9RH 4MJ4A 2V3FA 4X5WA 2OMUB 3WMQA 2FT7A 1ED3B 1J0ZA 1JTPA 1ZT1B 3L1FA 2W07A 4OVNF 1TCRA 2OSXA 3LEXA 4X8XA 5F7BA 4D2NA 4MXWL 4LCWB 4AJWA 1HF9A 3DIFA 1CF8L 2BY1A 5H2FE 3MZGB 2G2RA 2KZ1B 5DEGA 4HW6A 3EF4A 2P47B 4AL8C 5JHDD 1CDHA 2L7UA 3R19A 4D0BA 2PW2B 5FW8A 5IQ7H 5BOJA 4DT0A 1MI5E 3D30A 1HEHC 2V0AA 5D7SH 5E4AA 4YHLL 1YEDA 2A9MH 1YEFH 3RWFA 5HYJA 5FYJU 1B0GB 4QWWC 1JVKA 1RULL 3A4DA 3JZYA 4GUPB 3B3IA 3D3VB 4R90L 3H1JG 4GQ9L 4L37B 4EI5C 5EEXA 4TNGA 3APMA 4UOW1 2N0MA 5JW3H 3DX0A 3W38A 4LASL 3A4FA 1AFVH 1I9JL 3V0JA 2H0JA 1G7IA 4MS8D 5E6IA 2BLFA 1YYMH 3ZDYB 3HE7B 3STBA 1G7MA 1KPUB 1LO4L 2UXGA 1DVFB 3FO0H 2IQ9H 2YARA 4FA8A 1UVQA 2IG2H 3VTTA 1X4ZA 1WC7B 3BWAB 3PQYB 3BPCB 4L8CA 2GY7B 2KSEA 3B9KC 4S1QL 3DLQR 5E7BA 5EIVA 4N20A 4UUJA 2QGDA 2DN7A 3ARBC 5EUKB 4NZTL 1F4WL 1IJ9A 3QB7C 4Z3JA 4G6JH 3QO1A 5JTWA 4YVNA 2VLKA 3G5VA 3KLHC 5FAAA 2QGEA 3K6SA 1E6OH 3EH2A 4HA1A 4ANXA 1U8HA 2PO6C 1NLBL 2ZNXA 2AJSL 3BT2L 4ZYKB 4HMCA 3H1LE 7FABH 3CFDA 4NI3A 1RH5B 3CFQA 4U4IA 5KVEL 1KQFB 1WFUA 1S5LX 3HHSB 4AEHH 3QH3A 5DD1H 5I0WA 3MCKA 1DD4A 3EJQA 1J8HE 2BSRB 1G7HA 3IFPB 2G9HB 4R5VA 3LZLA 3UC0L 4MZ2A 1BFVL 3WFDH 4BWWA 1KBBA 4GH7B 2XT1B 3LNIA 3L72J 1XZWA 4P4KA 5C07E 3SKJL 1E2ZA 5E4EB 3TCTA 1RK7A 4YO0A 1RK1B 3UIAA 1XT5A 2ADGA 4LSUL 4LVNC 4EE2A 3NP4A 4OCNC 3BCCJ 3MO1A 1WUNT 3LH8A 3W57A 1HINH 2JB5L 3RNQA 4LCUB 5GQBA 2VDQL 2VDNL 5D72L 3OTTA 1TOXA 3CDCA 2VZ3A 4G3YL 2Q2LA 5JMRA 2J8UB 4D0DB 1VCAA 3M0DA 1J5CA 4PRDB 3US9A 3PWJB 4G5AA 5LBGA 5IF0B 3I3EA 5J7CC 4JHAL 3TGUJ 5AOIA 4ZAKD 5GTHH 1KEMH 4AQ8C 4GQQA 2IFFH 4F37F 2X44D 4KUCD 5DA4A 2XN9A 5EV7A 2BHUA 1ZHNB 3D85B 2YGOA 3U1PA 3IJHB 2G5BB 5KVEE 2YSSB 5FIEA 2AEPL 2E4TA 3V2AR 5IP4A 4G8IA 3EGXB 3V10A 5KANI 1L9NA 1OW0C 1EJFA 2FHBA 3UPAA 3UYRH 2VXSL 1T3FA 2EO1A 4TSCL 2AP2A 1KUMA 2K9YA 1P7KA 2HAZA 2IALB 3BZ4B 4MMZB 4YSCA 2VUYA 4DCKA 3KLSA 4YHNA 1SQBE 3P1VA 2BWDA 3WSQH 5KBLA 4C8XA 1CFSB 2P8PB 5CFHA 2JF1A 2Z0UA 3ZE0B 1XH3A 1MFDL 3ZK0A 1BZOA 2DQIH 2X1QA 5D1ZI 3VTMA 4HEMA 4U1JB 5D6DA 1OXZA 3ML8A 4KX7A 2AXGB 5GS0L 5IEKB 1JF5A 5MP6L 1P7BA 1OOWA 4YDJB 1G5GA 1MWAA 1NTMJ 3FYIB 5LB1A 2FO8A 3RNKB 1EZVD 2CGZA 1OT4A 5BVPL 5KYNA 1J8SA 3KW7A 2VN4A 2BP3A 1U4EA 2GAZB 4U1LB 1FLRL 3G5WA 3V52L 1FA4A 3WNLA 3O3DA 3CD4A 3MJ9H 3P11L 1GOHA 1U2HA 1LWHA 3OKOA 5ICUA 2E76D 4WLCA 3NABH 3ZBMA 1X0TA 4L3EA 4M6MH 1OTSD 5HJGA 2O01J 1XGUA 1U42A 2HODB 2FQFA 4AYSA 5IEHA 3HPJB 3HS0B 1S9YA 5ESVA 1DR9A 4D7BA 3EDDA 4Y2LA 4MQTB 5FYJH 2GSIA 3DVGB 1L4AA 4PJBF 5I15L 1B4JH 1GIGL 2JQAA 2MNWA 3C2SA 1JD7A 3RIFK 3T2LA 1ZWIB 1Y0LA 4HXAL 1LE5A 2EIMB 4H25A 5AEAA 5IB4B 1IK7A 4OKVB 4J3XA 4BA0A 2OV0A 4H2AA 2HLOA 4MDJA 1TITA 2XFGB 4U7SA 1OLZA 5CU9A 3KNBA 4R7DA 2VE6A 1KV4A 3MRPB 4U0RB 5H37G 4TOYH 1NC2A 3NAAH 3ULUF 4G80B 3H1IG 2H0FA 3L75J 3L70E 2XPGA 4DN3L 1AANA 3QQ3B 3QDGE 3RBGA 4HK0B 2PCPB 1KLFB 2D4FA 4K9EL 4XXDA 1WF5A 4JRXD 1W6WA 1NAMA 3N42B 5CBEA 3BYTA 2VQUA 1YPZB 1MI5A 5I66A 2YRLA 3AJ7A 2HP4A 5ACMA 2ISDA 2HRPH 3HI6H 4NQTA 3WFEH 1UD2A 2WXGA 4OBRA 4WUUB 4BRYB 4LRNL 5I24A 4CILA 1JOCA 1H6TA 5AVXB 1KC5H 3I5CA 1IAII 5C0GA 4K5LA 3VFRB 4BUQA 5I1HL 2OMVB 3G9AB 3LY6A 4NRYA 4OLZH 2P24A 1OGSA 4AYEC 3F5WB 1CTNA 2HKFL 4JB9H 4XODA 3BSZA 3RTQC 3GJEA 1CLZL 1CGTA 4KUCF 4ODXB 4RGOL 2VR9A 5A1AA 2XWBB 1EERB 4Z77A 1BVNT 3QHFL 5BZXA 3V0VA 4RKUJ 1Z9SB 4Z23A 1E9QA 3WXVL 1F2XK 1ORQB 2ZKHL 4X7TA 3FTZA 3CPLB 3IU4L 3BVNA 5D2LF 1DFBH 3K8KA 5EO0B 4NENA 5C7ZA 4ZUUA 2HWZL 3MX0B 4MXQD 4OCXL 4N2GA 4XZ4A 1YC8A 2A9BA 2ZKWA 3S5LB 1L0LE 1N5YH 5EEZA 3ARBD 4O4YL 2CRZA 3PWPE 2OMYB 4HIIB 1SF5A 5M94B 5A2LH 1KIQA 5LDUA 4XOEA 3KLHD 4PRHD 2IJ0C 1J8HA 2PO6D 4E2OA 1N6UA 2PWEA 2VRQA 3MACH 3UZEC 5TE6L 1NKNA 3NQKA 4PV9A 3V6ZA 1EO5A 4TNEA 3T6VA 1Y7VA 4KVPA 3V2PA 3K2IA 2YPLB 3RWGA 2VZTA 4GKOA 2I9LB 1KPRA 3BKJL 4OUUA 1FZOB 4LEOA 2BP0B 4XCFL 1RHFA 3MLYL 4OFQA 3F01A 5T1KD 5KAIE 1A6VL 3C5XA 4WW2B 4NP4H 2WTOA 1S5HA 4JFZL 4LARL 5ICXB 4CC0A 1EEYA 3V9EA 3IM1A 4U6XA 1QBLH 1YDPB 1U95A 2HVJA 1FL3B 4TUJA 3D2UB 1MZZA 3K7UA 5GTIH 1JHLH 1R3JB 2PYFA 5IBUG 1HHKA 1PSKH 3VFWB 1BVNP 2VUKA 3DXAB 4HH8A 4Q74A 3CNKA 3QCUH 4IIZA 1KT2B 3INUL 5HGHB 3SDCC 3SKOA 5E6SB 3UMTA 4EXKA 1GZHC 3BAIA 2IGFL 2VWEE 5C7XL 3IGLA 3S36L 3UTPD 1ZT1A 3ARFB 3HUJB 4GQPH 4WV1A 5L6YL 2YMOA 3K4DA 3GSUA 1JF1A 5D96C 5CCKL 2V2TB 3Q8EA 3RGUA 4ZMOA 3WU2E 1KN4L 1NEUA 3AM8A 4D3CL 3CG8A 1EEZB 4B9JA 5IWLA 1XL6A 3LRKA 2Z4QB 2F54B 4TSAL 4X4XB 2WVVA 3TCXA 1LWRA 1PAZA 4HISA 1Q38A 1KIUB 4GUPA 5FFGA 5C0IA 3TS8A 1NU1K 5FO8A 4NO5A 2JJSA 2BP8B 4KU1A 1PKOA 1GSKA 1MF2H 3O6QB 3LMJH 3OMAB 2J57A 4CBZA 3IS1X 3NZHH 3JWOH 3U46A 5MENB 4OGAD 5J9PB 4IJ3B 1O6SA 4WHTB 4X6BB 2LFGA 4B27A 5HYSA 5E4OA 2N1TC 2BIIA 4EVNB 4U6YA 1EEUA 1QA9A 2P45B 4IBUA 3TBVA 2EVJA 1DANT 3PQYA 4FNRA 1YEEH 1T4KB 3OQRA 1J0KA 3C6SA 3EF7A 4BSJA 1UC6A 4FC3E 4N2BA 3KJ6H 3ZKQD 3L72E 4DZBB 1PZ5B 1T6BX 2KS0A 4JBSA 4V2CB 3SOTA 4KKLC 4Q97A 2KS1A 4Y1AD 3WE1A 3UPCA 4AQ1C 4FNUA 3ILPB 4MYPA 4NCDA 4L5FH 5KS9F 3Q13A 2C9LY 1F56A 1QFUH 4OCWL 4I3SH 4LVEA 4H44D 2DLEA 2LXBA 4XMKL 5GS3A 3VXNA 1BXUA 5IW1B 2E27L 3HHSA 3LDBB 2X6UA 3P9MA 1A3ZA 1B4TA 4LPTA 1BSHA 1NAKL 4WWID 4OIIH 3IXAA 5GZNC 4XP9H 3EYVB 2YKQA 2LAAA 3MCYA 1CGXA 2CZNA 3IPEA 2HG5D 2VN6A 2ZWLT 2Y7QB 3F12A 4B53A 4N2OA 4GRLA 1N6VA 2DEWX 1I3UA 3RVUD 4DPCX 2QLVB 1X5LA 1AYRA 4JPKL 3UAJC 4PJEB 1AI1L 4OF5A 1WRGA 3ZMRA 4NPEA 1X9RA 1OAUH 2CM5A 2FWOA 2VC2L 4OH2A 4AIZA 1PAMA 2WXQA 3JTTB 1KD1Q 1AGDA 5J5EA 4D6TG 3LQMA 4RJTA 2L04A 3DX6A 3CZNA 2Q8BH 3FK3A 3IK2A 3E3QC 4L1SA 3UX9B 3IVKB 2H7WA 4QRBA 4IMKC 3WY3A 5IQOA 3V4VB 3TZVB 1QZ1A 3B1UA 4NAMA 2OK0H 2PTVA 1FBIH 4HWBL 5A3ID 1ZV5A 4EBQH 3ES6A 3N5AA 2KZWA 1GAFL 5GSRA 3UGEA 5GXBB 4OLWL 3WL9A 5C0CD 3A67L 2WTRB 1ZEAH 1QR1A 4X6DE 1XD1A 4NCC2 4PJ9C 3E9TA 3DX2A 3ZHKA 2NZIA 2XTJC 2J25A 1A02J 1V8HA 2LXCB 5D93B 1HC1A 4OZFH 2DDQH 1AY1H 4P04A 1MEXL 1ZLSL 5I2IB 2B16A 1CI3M 2A77H 1RERA 3NA4A 3PWPA 5F89B 1IQWL 3KPTA 3MV9E 3QDHA 3DX9A 1AKJD 3FUKA 2VGLM 2XC8A 5KOVC 1HL9A 2AAVA 3QC5X 4AJ0A 1W0WA 2KLVA 3TDKA 1HYSC 4G43B 2OTLP 1PU0A 3RDTB 4U1JA 1VQ9P 4Z7NE 1M7LA 2DQTL 1FZMA 2ZOKB 3GHGA 1QRND 4YDJA 4KWUA 4HD5A 1YUHB 3QJOA 3V0AC 4DP1X 1G9ML 1N5AA 3T3PE 2YD4A 2R32A 1TZ8A 1CI6A 5FK9B 5GRYA 5ECGA 5K9OA 4WTZA 3U0TA 3VFOA 2F74A 4GOEA 1LNQA 2CBOA 3BP4B 1CXHA 3C2AH 5CN2A 3BRDA 3SDYH 2V7NA 3Q8CA 1QR4A 4OM0H 2V3EA 3CLEH 5ENWB 3U4EB 1QUPA 5APVA 3IN2A 2W92A 3JQOB 4OLYH 2B1HL 4JFDB 4JFSA 4IL6H 2MOQA 4X6FA 3HD7B 4I13B 4CVXA 5IW6B 2WLNA 1E9OB 5I16A 2L3BA 4UOJA 1MFCL 5ALCH 5IVXB 4AGQA 4EPSA 1NGPL 5EBLB 3F6LA 5IJDC 4X6EB 1JXJA 1ZWIA 2EKJA 4KY1L 4WY7H 3ABKB 3I02A 1M6OA 4OKVA 4PPTA 1XQ4A 3LV3A 3IU3B 4TV3A 2UVEA 1ZVSB 4AENA 1QW9A 4MD0B 3TL5A 3MRPA 1J9QA 4ZS7H 3QPQC 5DQJB 2MPAH 3SYAA 1RCYA 5T5FL 5GRJH 4IBVA 4H0LB 1H3PL 3VXSB 3PABB 1LD9B 3MFFA 3TVMA 5EEWA 3UBXG 4F7PA 1WO2A 1NU1J 2Y0DA 1KLFA 2E86A 2QPDB 2YN5A 3TYFA 2R29H 3D08A 3KYMA 3M86A 4F7TB 2OQJA 2AERT 1PZ2A 1MKMA 2IAMC 3V4UL 4Z7WF 5C0RH 4NPDA 1FC2C 2PW1A 3Q2LA 5EIIG 2EVGA 3TA3C 3ROLA 1DBML 3A6BL 1MRFH 1NTZG 3OKKA 4NJ9H 4AL8H 1QWHA 2BVOA 1J5HA 5KYXB 2BNRB 1BVKB 3GGWB 4WUUA 4YNYB 2DJMA 3X17A 4DCQB 1BX2A 2SPZA 4FYSA 1S7TB 2JCCB 3RVXC 1HQRA 1BLNA 1LMKA 4QD2E 3RI5F 4KO6A 3VFRA 4WEBL 1LJ2A 5B5EE 3IWVA 1S5LE 1I7ZA 3BYYA 3ZKXB 4Y16B 3F5WA 1QBBA 1IFGA 5CZXC 1JJUA 1HHIA 5SV4A 4MDRA 3NA9L 1GPOH 3NJXA 4TNWK 1T7ZA 4CA4A 2K1MA 1I3RA 1Z32X 1D5XB 4BKSC 5IMMA 5DD5H 2FJUB 3FQUA 4N87A 1I8LC 3QI9B 4U49A 4QT5B 1E8YA 4PJXE 3NJGA 1B0RB 3WKNA 2XQYK 1M1SA 1KGCD 4PUBH 4MKTA 3NIFE 3T1FA 3U0PA 1P7HL 2CBPA 3QRBA 3BVDB 3UZVB 1C5BH 1RFDL 2Z35B 3N9GL 3T77A 3WTXA 3IJ8A 3PLYA 3AY4A 3AEDC 1XBDA 1HE7A 1PP9G 3KS0H 4XI5C 2Q10A 4GG8B 2G5UA 3HC0A 1ZV8A 3RPBA 3WCYA 2B89A 4MBRA 4NNXB 3OKEB 4UDUB 4NIKB 1U3ZA 2ILLA 1DBJL 3KBPA 4Z95H 3FQWB 2J43A 5AL0A 4A2DA 3AY2A 3VGEA 1JN6A 5AUMB 3P3SA 1QKZH 2H1PL 5DS1A 5TF1L 2I9LA 1E28B 1WAPA 2FYYB 3WS6A 1LTJB 4HUVA 4DOHB 5KBDA 5GZND 2BP0A 4H26B 1I1FB 4NBZB 3S4SG 4EYYQ 4I87A 1E2VA 3VFGL 2B39A 2BK8A 1HNGA 3IFOA 3B9AA 3ARSA 1JPSH 3X14B 1U8OB 3B7RL 3FUNA 1I7RA 4UM9D 3DHUA 4ZOAA 4WUKL 1YC7A 2EIDA 2B15A 2VLJD 3QZOA 2YGQA 3DSFL 3GSQA 4PV1B 3L5WA 4MA7H 4ODWA 1T20B 5AD0A 4QO1B 2KOGA 4P3CH 3D2UA 4L9LC 4GAYA 4KOCA 1J1XL 4M29A 2WSCJ 2X2IA 5C08D 4UTCA 5B3SB 2B0SH 1KIPB 1UCBH 3HHRB 2HXAA 2VN3A 4YHKH 4ZT1A 5TQ0H 2NY3B 4DP2X 1A6WH 2PXYA 3GXPA 1SUJA 1JZ6A 3I3BA 1E8ZA 4KXBA 2ZX6A 3NIGB 4X6DA 3KJ4C 3VXRB 3ZSSA 1Q86Q 4P2OC 2JQZA 3L1OL 3P30L 3QA3B 1WCQA 3AT0A 1KB5B 3T0XA 3KEDA 3ARFA 1J9TA 1L0YA 5ECJE 4N78D 3UADA 4AE0A 5HHPA 4O02H 5L0QB 4KVCH 3MV9A 2HN7B 1JGEB 1E6JH 4KQ3L 1IBHA 2MHAA 3W3BA 1LK3L 2G75A 1KYOD 3CXDL 1YMMB 2EH8L 4H8WC 3K3QA 2CPUA 5J1AB 4JRYE 1FNHA 2X9XA 4JZOB 1U8KB 4YSEA 1H6FA 1A0QH 1RZIA 5KLIC 2JKRM 3ZQWA 2BP8A 5ERWA 1F2QA 2H3KA 3D69B 1WT5A 4H4NA 3ZTNH 4AQOA 4FNLH 1EXHA 3TNNA 1FDLL 1QHOA 3HTLX 1NFKA 2PYEB 1YEGL 4HWBA 4WHTA 5DZJA 1NL0H 3L3OB 4UV7L 2CDFB 3JYBA 4KTDH 3OZ9H 2QVTA 4TTDC 2EECA 3DROA 5GGSB 4DO4A 4YR6B 5AKVA 2QQNL 4YSDA 4J3UA 3ZX1A 2ZUTA 4BFIB 2ZSVA 2YUVA 3VFMB 2F2HA 1EHLH 4GUCA 4F8TA 4Z5RB 1JWUB 2L8AA 2CGRL 4IOFC 1L6XA 2WSKA 1TZIA 2ITCA 2P3YA 3U4KA 2YD7A 3EH3B 3QUXC 5DS8B 3ZPDA 3TURA 3WN6A 4HIXH 4QHNB 2W60B 1RHZB 1N0XL 4TLTA 4I7ZC 2H6UA 2Q3EA 35C8L 4NKMB 1BF8A 1IVLA 5K9JH 1ZT7A 4WEMB 2OP4L 4I1LA 1DFXA 3QAZB 3V5DA 3L37A 4HCIA 2FX9L 1LO5B 1U6AH 3PGFL 5I8OH 1IBDA 1AGFA 1FZKB 1K8AQ 5DUJA 2VITA 2IXQB 5C86A 3QPQD 1VKXB 2GCYB 1KMGA 1U93A 4H7VA 3L74G 1VERA 2K78A 4OZ4B 1Q72L 4LCCA 2ATAA 1CBVL 1M7XA 1ZS2A 3TEXA 2QQLH 3KLAB 2IX7C 5IGXH 3CSGA 4GINA 4BELD 4PJIE 1OP3K 2IAMD 5TK4A 4ZFOL 2FECI 1H3GA 1OB0A 2FXOA 3EIFA 4B97A 4WI0B 1IM9A 4P5SA 4TVSa 2ICEB 2OJ1A 3TA3D 3OLDA 3FTVA 3QNZA 1ACXA 5CS7A 2ICWI 4FULA 2ITDA 4YDNA 2AKRB 2DYPA 2NYYD 2ZUYA 2D7PA 4E9RA 4AKPA 3JTSA 5IQ7L 3RVXD 2O72A 3PRZA 3IVKA 1VQ8P 1OE1A 4ASWA 1OP5K 1J1EC 3HAEG 5D7SL 3C6LB 3OD3A 2A9ML 2JK5B 3V4VA 1YEFL 2H9GB 3WBDA 1FHGA 3B5NC 4LPYA 5F1NA 5T5FA 2GPZA 4Z7VE 1FBMA 1YITP 2VR4A 5F97E 4HUCA 7TAAA 4JO2H 1GZPA 1YUKB 4PJXA 1QUNB 3PWNB 1BM3H 5JW3L 2Y72A 2P5EB 1JMZA 3H7BB 4WI9A 1COBA 4MD4A 1AFVL 2CHDA 3L73E 4O51A 2BIOA 2Z1PA 4PCKA 1YYML 4KMTH 1KCVH 4R26L 3FO0L 2Y2WA 1JPFB 2IQ9L 5F89A 4LSRH 2BHZA 1GL2C 2IG2L 1Y9BA 3EJPA 2O6PA 1DH3A 4PJAB 1ZAGA 3PF2A 4ZOCA 1UTDA 1UACH 1JE6A 4KRLB 4HJGA 3LSOA 1IIIA 1GS6X 1QSFE 2IH8A 3HG1E 3BDBA 1OM9A 2W27A 3RL0B 1CB4A 4M7ZB 4Z9KB 4HOMA 1HIML 3Q5RA 1TG8A 2QR0B 1PZUB 1FO0H 3DARA 1HXYB 4LKXA 4P5TC 4AIOA 4Q7DA 3EH1A 4XCCH 4AH2A 4IL6X 1UJ3C 3VACA 1E6OL 3L71D 2FSEA 5IB5B 3OSKA 3VXQB 1ZGLA 3PU7A 1XEUA 1CLVA 4JS7A 4QHLB 1KZUB 7FABL 1W5CE 4CJ1A 5FO7B 1YQVH 3LAFA 2WKGA 5DD1L 4AEHL 2BINA 4IOSA 1T5XB 3PDOA 4GRWF 1RJYB 1C5DA 2NY2B 4WTWA 2GABA 1D9KB 5JYLA 3K72B 1U8NB 1E9OA 5CGMA 4WNQB 1UXWA 2UZPA 3TBWA 5HPMB 4WTQA 4YXLH 5IVXA 2EIKB 4X2UA 5AFAA 3BC9A 4JO4H 5D7JA 4PLNC 2FYNC 5F7YC 2EUZA 4X6EA 2B7DT 1DN0B 1FFPB 1HINL 3NSDA 1FYTD 4FXGB 1OAZH 2XG5B 2ICWJ 4N1CA 1IKOP <