2NRGA

Solution structure of pufx from rhodobacter sphaeroides (minimised average)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
b'MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALETGIELIKHLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intrinsic membrane protein pufX
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis,membrane protein
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2nrgA01
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH superfamily
1JY2N 5APWA 3JCUE 4OWFA 2OTKE 5APTA 1ZP0C 1PZQA 3IR9A 1LT1A 4LLHA 1N73B 1N7LA 1VQ4P 3EFGA 3RL0C 2WT7B 1NTZD 3CCEP 2Z5HA 2QJYC 3L72J 1EDKA 2C0WA 1SQXG 1X22A 2KIKA 3TGUG 3FWNA 2YMYA 2Q5UA 4JQ0D 1L0LJ 1E5WA 1SQQK 2WSFJ 3HD7A 3H1IG 1QVFO 1WMKA 2KUBA 2XU6A 2R5DA 5APYA 4Y28J 2YKQA 1AV1A 3L72G 5KLIC 2HFED 1YQ3C 2QIWA 2R44A 1YTZT 1R5SA 4ZMDA 1SQXD 3LW5J 3TGUD 3HD7D 3E1IA 3NMDA 2WPQA 1NOHA 2FYUE 2OYOA 2R3CA 3VMZA 2J5UA 1FZCB 3AE4C 3A7OA 2B89A 2W6JH 2AXTH 1SQVE 2I1JA 2K9JB 1L0NG 4C7NB 1N7SB 2W83C 3AE8C 1PGPA 5AVWB 2Q3EA 1S9KD 2E43A 2XNDH 1QX8A 3NTNA 1LWUA 1BGYJ 1FOSF 2W27A 4DJGA 2AXTE 1Y8AA 3AE6C 4WBAA 1PV3A 3CCJP 1LTJB 1BE3E 3M0AA 1OVUA 2MJZA 2ZJSE 3HD7C 1NAYA 3IF4A 1EDLA 1PPJE 3D70A 1QEXA 4R4MA 1IFNA 2A45H 1RQVA 1AVYA 3L36A 2BCCJ 1NVOA 2K88A 3LIEA 3RK2B 1N8RQ 3KZIH 2KP8A 4XFJA 3VMYA 1CI6B 3L70J 3OW2O 5KKZB 1HVVA 3V2NA 3SFEC 4W7ZA 1PP9J 1J2JB 2CPBA 1VQNP 4EYYQ 1HH0A 1DH3A 1OW7A 2BCCG 1ZXGA 2M5AA 3PH0A 3P32A 1IFDA 3S4RA 1LWUC 1YIJP 1KV4A 1FS0E 1L4AB 4U3FG 3M06A 1PGOA 3NFQA 2JDIH 1SFCA 3PTZA 3G4SP 1KFNA 1PGJA 1NTZE 1NYHA 2XV5A 1OMIA 2AEMA 3H1KJ 2PRRA 2W6AA 3RBXA 1P84D 1YJWP 4I7ZB 1KYOD 1SFCD 2GM4A 1KC8Q 2B9BA 1JMBA 4U3FD 3TSIA 1NJIQ 3WU2H 2ZYDA 2HPCB 2KB7P 1FDIA 4RO0A 4PV1D 2QJPC 2WQYC 3U59A 1GU5A 4N6JA 2R32A 3C9IA 1SQXE 3M9HA 3TGUE 5AW9B 3CXHH 4KJMA 3M0DA 4NPDA 4JPZB 3K5BA 2JJLA 5AVQB 1LTAC 3H1IE 5APQA 1KB9D 3L74G 4RESB 1E79H 1SFCC 1DX7A 3L72E 5GTIH 2QVAA 2HODA 5B66E 3L73J 3HUSA 2FXPA 2QJKB 2FYNC 3O6QA 1J1DB 4H0LD 2GUSA 3RL0g 1NO4A 3H6PA 1DEBA 1UIIA 1ZMEC 1K73Q 4XA4A 1MKMA 2FYZA 4PV1C 3FX0A 4GOEA 1S4XA 1NWQA 3CPWO 1HF9A 5GTIE 1L0NE 3L74D 3SSUA 3L73G 3BRVB 3HE4B 1T2KD 1JOCA 3KQGA 1YYCA 1PFIA 3L35A 2P2UA 1FDMA 2RH0A 3H1JD 5KJ7A 1HBWA 2L91A 5H2FH 4EI2A 4H0LC 3M0DC 1ZOYC 4GIFA 4EDFA 1JNMA 5KAIH 1SQQJ 3PRJA 4HKZH 2O01H 1D7MA 5KJ7D 3L75G 5KAFH 2E42A 1KMIZ 1U57A 3HUSC 1URQB 5EFWB 3CLQA 1P84H 3CWBG 1MFZA 1GW3A 1KYOH 4H13D 1T2KC 5KAIE 2PAJA 3GW6A 3VTPC 5KAFE 2P10A 2UWJE 3L75D 5C39A 5AVYB 1T3UA 1P84E 5BU5A 4TT3H 2BCCE 2JEEA 2FFDA 1GD2E 1KYOI 1KYOE 1XTCC 1KORA 3CWBD 2GA1A 3AECC 3HTKA 4U3FE 3F89A 5KJ7C 1NTKK 4BRYA 3NXSA 2IDBA 1GDTA 2K3RA 2HR3A 1RQUA 4WY4B 1VQ6P 1SQPJ 4EIJA 3QWOC 2ZT9B 1USDA 4H13C 1KB9H 4O9BA 4GKGA 1S72P 5K5GB 1SQVD 3HE5B 1S2EA 1YTZI 4GDOA 3V6IA 1AVOA 1MZ9A 1NU1G 3S9OA 3ZDMA 4EOTA 2O1JA 2WSEJ 2KSEA 1SQPG 3R2PA 1KB9I 1KB9E 1IO4A 4WWIA 3H1LJ 2E76D 1RY3A 3CCUP 2IPPA 3JSVC 5APXA 4OH8B 4UB8H 3AE9C 1M56D 1OW8A 1OVRA 2N9YB 2FFDC 1OVVA 1PPJD 4OGQD 2W8ZA 2IFMA 1N73A 2ZXXA 2WT7A 1ZRTE 4Y99C 3L74E 1EDJA 2H88C 2YNYA 3TYYA 4IL6H 1JCDA 1NTMK 1IK9A 3B5NB 4ZKPA 1BSHA 1LTBC 3CI9A 2E76C 3KXDA 5AW6B 3GHGB 3O8ZA 4ZNCA 4NPEA 1SQBJ 4IL6E 1BCCJ 2KK7A 4JBZA 3L73E 5KLVG 3V4WA 3MP7B 4OGQC 3MD0A 5CCHA 2RKLA 1HJ0A 4PJ0E 1FZCA 5CBOA 2Z4EA 1GL2B 1HTLC 1LNQA 2K9JA 3MUDA 2K1AA 1FOSE 1JTHB 3H25A 2YKPA 1FU1A 1SQBG 3CCRP 4ZKUA 1N73C 4C7NA 1N7SA 2R5BA 2KZJA 1L2PA 1RHZB 3A3YB 5KLVD 1KQSO 3SFDC 3L75E 2IYPA 1AA0A 2OGUA 1N7SD 1U7JA 3CWBE 1LTJA 2P67A 1H8AA 1EQ7A 3CCLP 3RK3B 5KLIB 4AYCA 2KI7B 2ZFCA 3P8MC 3KPEA 2OTLP 1L0LG 1W5CE 2FYUK 1FZGA 4GOFA 1M1JB 1FZEA 3WMM0 3B8EB 1SQVK 3H1ID 1IZNB 3H1HJ 5DJUB 4NPFX 2FKWB 1CI6A 3L72D 1M57D 5AVRB 3GLMA 2KNCB 4CPGA 3EFFK 1IFIA 3MUDC 1L0LD 3A2AA 1T8ZA 2N1TB 1N7SC 3RK2D 2B88A 2E5TA 1H0TB 3GMAA 1L0ND 1NU1E 1L4AA 3CC7P 3BCCJ 5TISE 2N9BA 1JCCA 4N78D 3M9BA 1KD1Q 1LTJC 2WVRA 3L37A 1SQPE 1BGYG 1PIXA 2QEXP 4WVZA 3V4QA 2H43A 1OW6A 3CMAP 2OYIB 3MIWA 1L4AD 3AEEC 2BASA 1JY2P 3VN0A 4PD4I 4PD4E 1USEA 1JO5A 3FXEA 3BCCG 5CBNA 1Z56A 3IN6A 3C1LA 3KHUA 3RK2C 2P7JA 2HPCA 2BEZF 1U7MA 5KKZC 1BGYD 1T3JA 1LJ2A 3BASA 1NTKJ 1ZW0A 2NPSB 2V7QJ 3L70G 3L71J 3Q3DA 2Q6QA 3LIDA 1PP9G 1Q90D 2XKMA 3KYQA 4XE5B 2WSCJ 1NTZK 2M0BA 4D6TJ 2V4HA 1Y9BA 1BDCA 1S1CX 1L4AC 2ITAA 1LTIC 2PP6A 4TLFA 2JWDA 2BCCD 3EQ2A 1GMJA 3AEGC 1VQ7P 1IFPA 2IFNA 5KLVE 3V2RA 1Q86Q 4HYTB 4C46A 5AW4B 1S3JA 4Z1MH 2XDJA 1OXZA 3CCQP 2M3BA 3H1KG 3AEBC 2ZYAA 1S5LX 3VMXA 2JKVA 3IFMA 1SQBE 4RKUJ 4MN4C 1SQXK 3G6EP 1KN7A 3HE4A 5B66H 2CK3H 2R3SA 3AE2C 2C0XA 2KOGA 2E75B 2ZXEB 3GF7A 3AEFC 2OQQA 4DOJA 2YIUB 1FZBA 2WSFH 1X9VA 5E79E 1RH5B 1BSNA 1NTMJ 2Q9IA 2KSJA 1VQ5P 2WPVB 3H1JJ 1JY3N 2QRXA 5GTHH 2KYVA 1L0LE 1HGZA 3M91A 3FGAD 1VQMP 3LW5H 5CCGA 5M1BA 2W90A 1NHLA 1URQA 2QJKC 1J1DC 2A06G 1DEEG 3VYIA 1KQLA 1L0NK 2AEFA 1ZRTD 2E5YA 4N3YB 2AEJA 3PHLA 5GTHE 2RMZA 2IBZG 2M3EA 4N78E 1ZV8A 5CCGD 1M1KQ 3TF5A 1DD3A 1URQD 1S5LE 1ZR4A 2HYNA 1Q2NA 3USSA 1FZFA 1VF5B 5AVXB 5BVZA 2A06D 4H44B 3L4FA 1J1EB 2L5GB 2KLVA 1KILB 3WUVA 3L73D 2IX7C 4BWNA 3FXDA 2XNXA 1OIPA 4WY4A 5DJTB 1BGYE 3AEDC 2H7HA 1RF0A 2KLUA 3CD6P 3CL3D 1SP4A 1JM0A 3HE5A 4L74A 5CCGC 2FYUJ 2H8PD 2O1KA 3AE3C 1SQQG 1FE6A 1URQC 3BCCE 2AXCA 1N86A 2NZ2A 5CJ4A 3U1CA 3CX5E 3CX5I 2ZT9D 4YTPC 4JF7A 2C9NY 5APUA 4IFMA 5AW3B 1OZHA 2Z5IA 3L70E 1MFTA 1X79B 1T6AA 1PP9E 3P8CE 1BE3J 3H32B 3CCMP 2H89C 3RBZA 1YBKA 1LTSC 1H88A 3W67A 2ZT9C 1FJKA 1RF0C 2YMKA 3B5NA 1TU3F 4UB6H 1OX3A 2E74D 1NGMB 4D6TE 1FAVA 3OAKA 4YXWH 3GHGA 3H1KE 1JEKA 4DT0A 4JYCA 1IFMA 2QM8A 4GT1A 3B5ND 1LTGC 4K35A 1EXIA 1G1JA 1R5LA 1NU1D 4UB6E 1K8AQ 1CSBA 1OFCX 3I56P 4W7YA 1LT9B 2J58A 1BDDA 1SS1A 2WSSH 2G8YA 1SQPD 3ITKA 1GL2A 3H1LG 1VQ8P 2D2CB 2CPSA 1JTHA 2RN0A 2OYHB 2A45G 1NAFA 2YXQB 5APSA 1IJDB 1NTZJ 2C9LY 4PD4D 3TK1A 3Q5RA 3T97B 2E74C 2IZ0A 3AE1C 1FDOA 1FJPA 1RF1B 2I8DA 1GL2D 1M8OB 2GUVA 4L76A 3TNUB 2A06E 3OJAB 4PJ0H 5B5EH 5L8RJ 2LKMA 3B5NC 3H1LD 1UIXA 2B87B 2IBZE 2IBZI 5AW7B 2JWAA 1EDIA 3GHGC 3JC22 1W2BO 2WITA 1M90Q 4OGQB 2QE7H 2KS1B 1LP1B 1M1JA 5B5EE 2PFXA 3MGNA 3RL0B 1SQXJ 3RK3D 3TGUJ 1JUNA 1SLQA 4IFFA 2QJYB 1BCCG 3V2QA 1CW5A 5CCHD 3H1IJ 1GL2C 2KNCA 1Q82Q 2N1TA 1XTGB 3SWYA 5CMZA 3N7NA 2Q1KA 1H0TA 3Q5SA 2G3AA 4BXLA 2K37A 4OVNF 1SQBD 1BCCD 1SQQE 2N1TD 2POHA 3C8VA 3RK3C 1L0NJ 1WT6A 5CCHC 3BVHA 2OYIA 2WMMA 3MHVA 2IYOA 1IFJA 1LGHB 1M1JC 1RE4A 1FZCC 3KDPB 3CCVP 1JMMA 5TISH 1AJYA 4ASWA 4YPCA 3QH9A 3D6YA 3H1HG 3P7KA 2NPSA 3CXHD 3A0BH 4L75A 3ABVC 1NU1K 2N1TC 3F5HA 1QL1A 3HD7B 4PD4H 2I1KA 2HLOA 5AW5B 1KZUB 1ZN5A 4LC1A 3VP9A 1SQPK 3RGUA 1JY2O 2WSEH 2NPSD 3BRTB 2O01J 2Q7CA 1NKNA 2Y0CA 1RE3A 1QVGO 2KZIA 4R4LA 3A0BE 4JYBA 3H1HD 1A02J 1QLED 1YITP 4HH2A 2O01N 1M7LA 2OYIC 1VPCA 3WUTA 3TDKA 4KT0J 1RE4C 2WZ7A 3H1LE 2P1JA 4U3FJ 1HUCA 5KTBA 2ZYGA 1GK4A 2A45I 1X8YA 5AVZB 2JO1A 3HRNA 1LWUB 3D6ZA 1PGQA 3U1AA 3V2PA 2M8RA 2O3JA 3BCCD 3FWLA 3KZIE 2NPSC 3B71A 3CX5D 1HJBA 4IOIH 3PLNA 3RK3E 4A7PA 1NTKG 1GK6A 1YJNP 3GG2A 1FC2C 1VQKP 5KLVK 3A5TA 3OA7A 2E75D 3L71G 1W2EA 1WRGA 3L70D 1NKZB 1RE3C 2FXMA 1PP9D 2YO2A 2PGDA 2VRSA 4I7ZC 4I6MC 4D6TG 3P8CD 4HJGH 2DW3A 2LXCB 3G9RA 5AVSB 4U7JA 5E79H 1SQBK 3VMAA 2NRGA 1BCCE 2Q3IA 1YHQP 1NTKD 2QJPB 1KQGB 3AE7C 1DD4A 3Q1MA 1K04A 3L71D 1EZVG 1KFMA 3E7KA 2M5AB 3L74J 3UIAA 1QL2A 4C7RA 1VQLP 3SWKA 4D6TD 2Y0EA 5AVTB 5AW8B 1Q7YQ 3H1KD 2E75C 3WU2E 1SFCB 3D71A 1EC5A 1YQ4C 2Y9YA 1KILA 2YIUC 2FYNB 2ZAEB 1L0LK 1NH4A 3CMEP 4DCKA 3M9QA 3WUUA 1VF5D 1PL5A 1EZVD 3CCSP 2YXRB 3B4SA 4K3AA 1S5LH 4PV1B 4ASVA 4H44D 2P58A 1R8EA 1S9KE 2Y0DA 3CXHE 3CXHI 2FY8A 1NTMG 3CC2P 3W68A 2WTYA 1KILD 3IAOA 2IZ1A 3H1JG 4AUWA 2LXBA 4M3LA 3GF3A 2WPSA 2ZVOB 3VOPA 5AW1B 3H1HE 3AEAC 5AW2B 3N4XA 2QA4P 4H0LB 1NTMD 3L75J 3V5BA 2YO3A 4AQRD 2IBZD 4WB4A 1VF5C 3A0HH 1GZLA 3CWBJ 3CX5H 4H44C 1J1EC 3H32A 2HODB 1KILC 3HUSB 1JB0J 3O6QB 4KHXA 2WPRA 5BU8B 2LR2A 4I1LA 3II6A 3A0HE 4YXDC 2JP3A 4WY4D 2KXPB 1N2DC 3EWKA 5H2FE 4L73A 1SQVJ 1SVFA 1FBMA 3SWFA 2SPZA 5APVA 3S1KA 2MKVA 2FXOA 3I5CA 1IK7A 2W6BA 2FYUG 1ZR2A 1OWAA 2YKOA 3AE5C 1VQ9P 1AFOA 2V7QH 1P84I 1SQQD 3E1RA 1LT9A 1SQVG 3G3ZA 1VQPP 2WSCH 4QMAA 3CC4P 1NU1J 1CZQA 2QM7A 4H13B 2QSIA 1JY3O 1NTKE 2OYHA 4WY4C 1VQOP 1GTWA 1YJ9P 1Y47A 2XZRA 3L71E 3PP5A 2FYUD 1JY3P 2WWWA 2QG4A 2ZVNB 3T97A 1KTMA 2Y9ZA 1RF1A 1BE3G 4GODA 1YI2P 1H89A 3R4YA 2D2CD 3TNUA 1HWTC 3Q2YA 4W80A 5AW0B 4HB1A 3MZWB 2HG5D 1GW4A 1PPJG 4IL6X 4I2LC 1AQTA 4B86A 4RJTA 2B87A 2JR8A 1KQFB 5AVUB 1GU4A 1G2CA 3Q5PA 3BATA 4LGDE 4DZOA 5AVVB 1EZVE 1EZVI 2FFDB 2KS1A 1LP1A 5CJ0A 3MTUE 3PJSK 3I55P 1BE3D 3HTKB 1HGVA 1ZLLA 1KILE 5TJHA 2BEQD 1A02F 4BRYB 1LT9C 4Y99B 1FZAA 1EXJA 2OTJP 1VL2A 5CHXA 1AQ5A 1MUUA 2D2CC 2K9YA 2E74B 2J59M 1MV8A 3RL0D 2OYHC 1IC2A 2OARA 1Q81Q 3JCUH 4UB8E 2E76B 2FBWC 5KLVJ 1NTME 3VP8A 4IFDK 1G1IA 1RF1C 1VDFA 3H1JE 1LTTC 1X0TA 1G2CB 1NTZG 1QGKB 1K05A 3G71P 1K9MQ 1DIPA
chains in the Genus database with same CATH topology
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRG A;  2DW3 A;  2ITA A; 
#chains in the Genus database with same CATH topology
 1JY2 N;  5APW A;  3JCU E;  4OWF A;  2OTK E;  5APT A;  1ZP0 C;  1PZQ A;  3IR9 A;  1LT1 A;  4LLH A;  1N73 B;  1N7L A;  1VQ4 P;  3EFG A;  3RL0 C;  2WT7 B;  1NTZ D;  3CCE P;  2Z5H A;  2QJY C;  3L72 J;  1EDK A;  2C0W A;  1SQX G;  1X22 A;  2KIK A;  3TGU G;  3FWN A;  2YMY A;  2Q5U A;  4JQ0 D;  1L0L J;  1E5W A;  1SQQ K;  2WSF J;  3HD7 A;  3H1I G;  1QVF O;  1WMK A;  2KUB A;  2XU6 A;  2R5D A;  5APY A;  4Y28 J;  2YKQ A;  1AV1 A;  3L72 G;  5KLI C;  2HFE D;  1YQ3 C;  2QIW A;  2R44 A;  1YTZ T;  1R5S A;  4ZMD A;  1SQX D;  3LW5 J;  3TGU D;  3HD7 D;  3E1I A;  3NMD A;  2WPQ A;  1NOH A;  2FYU E;  2OYO A;  2R3C A;  3VMZ A;  2J5U A;  1FZC B;  3AE4 C;  3A7O A;  2B89 A;  2W6J H;  2AXT H;  1SQV E;  2I1J A;  2K9J B;  1L0N G;  4C7N B;  1N7S B;  2W83 C;  3AE8 C;  1PGP A;  5AVW B;  2Q3E A;  1S9K D;  2E43 A;  2XND H;  1QX8 A;  3NTN A;  1LWU A;  1BGY J;  1FOS F;  2W27 A;  4DJG A;  2AXT E;  1Y8A A;  3AE6 C;  4WBA A;  1PV3 A;  3CCJ P;  1LTJ B;  1BE3 E;  3M0A A;  1OVU A;  2MJZ A;  2ZJS E;  3HD7 C;  1NAY A;  3IF4 A;  1EDL A;  1PPJ E;  3D70 A;  1QEX A;  4R4M A;  1IFN A;  2A45 H;  1RQV A;  1AVY A;  3L36 A;  2BCC J;  1NVO A;  2K88 A;  3LIE A;  3RK2 B;  1N8R Q;  3KZI H;  2KP8 A;  4XFJ A;  3VMY A;  1CI6 B;  3L70 J;  3OW2 O;  5KKZ B;  1HVV A;  3V2N A;  3SFE C;  4W7Z A;  1PP9 J;  1J2J B;  2CPB A;  1VQN P;  4EYY Q;  1HH0 A;  1DH3 A;  1OW7 A;  2BCC G;  1ZXG A;  2M5A A;  3PH0 A;  3P32 A;  1IFD A;  3S4R A;  1LWU C;  1YIJ P;  1KV4 A;  1FS0 E;  1L4A B;  4U3F G;  3M06 A;  1PGO A;  3NFQ A;  2JDI H;  1SFC A;  3PTZ A;  3G4S P;  1KFN A;  1PGJ A;  1NTZ E;  1NYH A;  2XV5 A;  1OMI A;  2AEM A;  3H1K J;  2PRR A;  2W6A A;  3RBX A;  1P84 D;  1YJW P;  4I7Z B;  1KYO D;  1SFC D;  2GM4 A;  1KC8 Q;  2B9B A;  1JMB A;  4U3F D;  3TSI A;  1NJI Q;  3WU2 H;  2ZYD A;  2HPC B;  2KB7 P;  1FDI A;  4RO0 A;  4PV1 D;  2QJP C;  2WQY C;  3U59 A;  1GU5 A;  4N6J A;  2R32 A;  3C9I A;  1SQX E;  3M9H A;  3TGU E;  5AW9 B;  3CXH H;  4KJM A;  3M0D A;  4NPD A;  4JPZ B;  3K5B A;  2JJL A;  5AVQ B;  1LTA C;  3H1I E;  5APQ A;  1KB9 D;  3L74 G;  4RES B;  1E79 H;  1SFC C;  1DX7 A;  3L72 E;  5GTI H;  2QVA A;  2HOD A;  5B66 E;  3L73 J;  3HUS A;  2FXP A;  2QJK B;  2FYN C;  3O6Q A;  1J1D B;  4H0L D;  2GUS A;  3RL0 g;  1NO4 A;  3H6P A;  1DEB A;  1UII A;  1ZME C;  1K73 Q;  4XA4 A;  1MKM A;  2FYZ A;  4PV1 C;  3FX0 A;  4GOE A;  1S4X A;  1NWQ A;  3CPW O;  1HF9 A;  5GTI E;  1L0N E;  3L74 D;  3SSU A;  3L73 G;  3BRV B;  3HE4 B;  1T2K D;  1JOC A;  3KQG A;  1YYC A;  1PFI A;  3L35 A;  2P2U A;  1FDM A;  2RH0 A;  3H1J D;  5KJ7 A;  1HBW A;  2L91 A;  5H2F H;  4EI2 A;  4H0L C;  3M0D C;  1ZOY C;  4GIF A;  4EDF A;  1JNM A;  5KAI H;  1SQQ J;  3PRJ A;  4HKZ H;  2O01 H;  1D7M A;  5KJ7 D;  3L75 G;  5KAF H;  2E42 A;  1KMI Z;  1U57 A;  3HUS C;  1URQ B;  5EFW B;  3CLQ A;  1P84 H;  3CWB G;  1MFZ A;  1GW3 A;  1KYO H;  4H13 D;  1T2K C;  5KAI E;  2PAJ A;  3GW6 A;  3VTP C;  5KAF E;  2P10 A;  2UWJ E;  3L75 D;  5C39 A;  5AVY B;  1T3U A;  1P84 E;  5BU5 A;  4TT3 H;  2BCC E;  2JEE A;  2FFD A;  1GD2 E;  1KYO I;  1KYO E;  1XTC C;  1KOR A;  3CWB D;  2GA1 A;  3AEC C;  3HTK A;  4U3F E;  3F89 A;  5KJ7 C;  1NTK K;  4BRY A;  3NXS A;  2IDB A;  1GDT A;  2K3R A;  2HR3 A;  1RQU A;  4WY4 B;  1VQ6 P;  1SQP J;  4EIJ A;  3QWO C;  2ZT9 B;  1USD A;  4H13 C;  1KB9 H;  4O9B A;  4GKG A;  1S72 P;  5K5G B;  1SQV D;  3HE5 B;  1S2E A;  1YTZ I;  4GDO A;  3V6I A;  1AVO A;  1MZ9 A;  1NU1 G;  3S9O A;  3ZDM A;  4EOT A;  2O1J A;  2WSE J;  2KSE A;  1SQP G;  3R2P A;  1KB9 I;  1KB9 E;  1IO4 A;  4WWI A;  3H1L J;  2E76 D;  1RY3 A;  3CCU P;  2IPP A;  3JSV C;  5APX A;  4OH8 B;  4UB8 H;  3AE9 C;  1M56 D;  1OW8 A;  1OVR A;  2N9Y B;  2FFD C;  1OVV A;  1PPJ D;  4OGQ D;  2W8Z A;  2IFM A;  1N73 A;  2ZXX A;  2WT7 A;  1ZRT E;  4Y99 C;  3L74 E;  1EDJ A;  2H88 C;  2YNY A;  3TYY A;  4IL6 H;  1JCD A;  1NTM K;  1IK9 A;  3B5N B;  4ZKP A;  1BSH A;  1LTB C;  3CI9 A;  2E76 C;  3KXD A;  5AW6 B;  3GHG B;  3O8Z A;  4ZNC A;  4NPE A;  1SQB J;  4IL6 E;  1BCC J;  2KK7 A;  4JBZ A;  3L73 E;  5KLV G;  3V4W A;  3MP7 B;  4OGQ C;  3MD0 A;  5CCH A;  2RKL A;  1HJ0 A;  4PJ0 E;  1FZC A;  5CBO A;  2Z4E A;  1GL2 B;  1HTL C;  1LNQ A;  2K9J A;  3MUD A;  2K1A A;  1FOS E;  1JTH B;  3H25 A;  2YKP A;  1FU1 A;  1SQB G;  3CCR P;  4ZKU A;  1N73 C;  4C7N A;  1N7S A;  2R5B A;  2KZJ A;  1L2P A;  1RHZ B;  3A3Y B;  5KLV D;  1KQS O;  3SFD C;  3L75 E;  2IYP A;  1AA0 A;  2OGU A;  1N7S D;  1U7J A;  3CWB E;  1LTJ A;  2P67 A;  1H8A A;  1EQ7 A;  3CCL P;  3RK3 B;  5KLI B;  4AYC A;  2KI7 B;  2ZFC A;  3P8M C;  3KPE A;  2OTL P;  1L0L G;  1W5C E;  2FYU K;  1FZG A;  4GOF A;  1M1J B;  1FZE A;  3WMM 0;  3B8E B;  1SQV K;  3H1I D;  1IZN B;  3H1H J;  5DJU B;  4NPF X;  2FKW B;  1CI6 A;  3L72 D;  1M57 D;  5AVR B;  3GLM A;  2KNC B;  4CPG A;  3EFF K;  1IFI A;  3MUD C;  1L0L D;  3A2A A;  1T8Z A;  2N1T B;  1N7S C;  3RK2 D;  2B88 A;  2E5T A;  1H0T B;  3GMA A;  1L0N D;  1NU1 E;  1L4A A;  3CC7 P;  3BCC J;  5TIS E;  2N9B A;  1JCC A;  4N78 D;  3M9B A;  1KD1 Q;  1LTJ C;  2WVR A;  3L37 A;  1SQP E;  1BGY G;  1PIX A;  2QEX P;  4WVZ A;  3V4Q A;  2H43 A;  1OW6 A;  3CMA P;  2OYI B;  3MIW A;  1L4A D;  3AEE C;  2BAS A;  1JY2 P;  3VN0 A;  4PD4 I;  4PD4 E;  1USE A;  1JO5 A;  3FXE A;  3BCC G;  5CBN A;  1Z56 A;  3IN6 A;  3C1L A;  3KHU A;  3RK2 C;  2P7J A;  2HPC A;  2BEZ F;  1U7M A;  5KKZ C;  1BGY D;  1T3J A;  1LJ2 A;  3BAS A;  1NTK J;  1ZW0 A;  2NPS B;  2V7Q J;  3L70 G;  3L71 J;  3Q3D A;  2Q6Q A;  3LID A;  1PP9 G;  1Q90 D;  2XKM A;  3KYQ A;  4XE5 B;  2WSC J;  1NTZ K;  2M0B A;  4D6T J;  2V4H A;  1Y9B A;  1BDC A;  1S1C X;  1L4A C;  2ITA A;  1LTI C;  2PP6 A;  4TLF A;  2JWD A;  2BCC D;  3EQ2 A;  1GMJ A;  3AEG C;  1VQ7 P;  1IFP A;  2IFN A;  5KLV E;  3V2R A;  1Q86 Q;  4HYT B;  4C46 A;  5AW4 B;  1S3J A;  4Z1M H;  2XDJ A;  1OXZ A;  3CCQ P;  2M3B A;  3H1K G;  3AEB C;  2ZYA A;  1S5L X;  3VMX A;  2JKV A;  3IFM A;  1SQB E;  4RKU J;  4MN4 C;  1SQX K;  3G6E P;  1KN7 A;  3HE4 A;  5B66 H;  2CK3 H;  2R3S A;  3AE2 C;  2C0X A;  2KOG A;  2E75 B;  2ZXE B;  3GF7 A;  3AEF C;  2OQQ A;  4DOJ A;  2YIU B;  1FZB A;  2WSF H;  1X9V A;  5E79 E;  1RH5 B;  1BSN A;  1NTM J;  2Q9I A;  2KSJ A;  1VQ5 P;  2WPV B;  3H1J J;  1JY3 N;  2QRX A;  5GTH H;  2KYV A;  1L0L E;  1HGZ A;  3M91 A;  3FGA D;  1VQM P;  3LW5 H;  5CCG A;  5M1B A;  2W90 A;  1NHL A;  1URQ A;  2QJK C;  1J1D C;  2A06 G;  1DEE G;  3VYI A;  1KQL A;  1L0N K;  2AEF A;  1ZRT D;  2E5Y A;  4N3Y B;  2AEJ A;  3PHL A;  5GTH E;  2RMZ A;  2IBZ G;  2M3E A;  4N78 E;  1ZV8 A;  5CCG D;  1M1K Q;  3TF5 A;  1DD3 A;  1URQ D;  1S5L E;  1ZR4 A;  2HYN A;  1Q2N A;  3USS A;  1FZF A;  1VF5 B;  5AVX B;  5BVZ A;  2A06 D;  4H44 B;  3L4F A;  1J1E B;  2L5G B;  2KLV A;  1KIL B;  3WUV A;  3L73 D;  2IX7 C;  4BWN A;  3FXD A;  2XNX A;  1OIP A;  4WY4 A;  5DJT B;  1BGY E;  3AED C;  2H7H A;  1RF0 A;  2KLU A;  3CD6 P;  3CL3 D;  1SP4 A;  1JM0 A;  3HE5 A;  4L74 A;  5CCG C;  2FYU J;  2H8P D;  2O1K A;  3AE3 C;  1SQQ G;  1FE6 A;  1URQ C;  3BCC E;  2AXC A;  1N86 A;  2NZ2 A;  5CJ4 A;  3U1C A;  3CX5 E;  3CX5 I;  2ZT9 D;  4YTP C;  4JF7 A;  2C9N Y;  5APU A;  4IFM A;  5AW3 B;  1OZH A;  2Z5I A;  3L70 E;  1MFT A;  1X79 B;  1T6A A;  1PP9 E;  3P8C E;  1BE3 J;  3H32 B;  3CCM P;  2H89 C;  3RBZ A;  1YBK A;  1LTS C;  1H88 A;  3W67 A;  2ZT9 C;  1FJK A;  1RF0 C;  2YMK A;  3B5N A;  1TU3 F;  4UB6 H;  1OX3 A;  2E74 D;  1NGM B;  4D6T E;  1FAV A;  3OAK A;  4YXW H;  3GHG A;  3H1K E;  1JEK A;  4DT0 A;  4JYC A;  1IFM A;  2QM8 A;  4GT1 A;  3B5N D;  1LTG C;  4K35 A;  1EXI A;  1G1J A;  1R5L A;  1NU1 D;  4UB6 E;  1K8A Q;  1CSB A;  1OFC X;  3I56 P;  4W7Y A;  1LT9 B;  2J58 A;  1BDD A;  1SS1 A;  2WSS H;  2G8Y A;  1SQP D;  3ITK A;  1GL2 A;  3H1L G;  1VQ8 P;  2D2C B;  2CPS A;  1JTH A;  2RN0 A;  2OYH B;  2A45 G;  1NAF A;  2YXQ B;  5APS A;  1IJD B;  1NTZ J;  2C9L Y;  4PD4 D;  3TK1 A;  3Q5R A;  3T97 B;  2E74 C;  2IZ0 A;  3AE1 C;  1FDO A;  1FJP A;  1RF1 B;  2I8D A;  1GL2 D;  1M8O B;  2GUV A;  4L76 A;  3TNU B;  2A06 E;  3OJA B;  4PJ0 H;  5B5E H;  5L8R J;  2LKM A;  3B5N C;  3H1L D;  1UIX A;  2B87 B;  2IBZ E;  2IBZ I;  5AW7 B;  2JWA A;  1EDI A;  3GHG C;  3JC2 2;  1W2B O;  2WIT A;  1M90 Q;  4OGQ B;  2QE7 H;  2KS1 B;  1LP1 B;  1M1J A;  5B5E E;  2PFX A;  3MGN A;  3RL0 B;  1SQX J;  3RK3 D;  3TGU J;  1JUN A;  1SLQ A;  4IFF A;  2QJY B;  1BCC G;  3V2Q A;  1CW5 A;  5CCH D;  3H1I J;  1GL2 C;  2KNC A;  1Q82 Q;  2N1T A;  1XTG B;  3SWY A;  5CMZ A;  3N7N A;  2Q1K A;  1H0T A;  3Q5S A;  2G3A A;  4BXL A;  2K37 A;  4OVN F;  1SQB D;  1BCC D;  1SQQ E;  2N1T D;  2POH A;  3C8V A;  3RK3 C;  1L0N J;  1WT6 A;  5CCH C;  3BVH A;  2OYI A;  2WMM A;  3MHV A;  2IYO A;  1IFJ A;  1LGH B;  1M1J C;  1RE4 A;  1FZC C;  3KDP B;  3CCV P;  1JMM A;  5TIS H;  1AJY A;  4ASW A;  4YPC A;  3QH9 A;  3D6Y A;  3H1H G;  3P7K A;  2NPS A;  3CXH D;  3A0B H;  4L75 A;  3ABV C;  1NU1 K;  2N1T C;  3F5H A;  1QL1 A;  3HD7 B;  4PD4 H;  2I1K A;  2HLO A;  5AW5 B;  1KZU B;  1ZN5 A;  4LC1 A;  3VP9 A;  1SQP K;  3RGU A;  1JY2 O;  2WSE H;  2NPS D;  3BRT B;  2O01 J;  2Q7C A;  1NKN A;  2Y0C A;  1RE3 A;  1QVG O;  2KZI A;  4R4L A;  3A0B E;  4JYB A;  3H1H D;  1A02 J;  1QLE D;  1YIT P;  4HH2 A;  2O01 N;  1M7L A;  2OYI C;  1VPC A;  3WUT A;  3TDK A;  4KT0 J;  1RE4 C;  2WZ7 A;  3H1L E;  2P1J A;  4U3F J;  1HUC A;  5KTB A;  2ZYG A;  1GK4 A;  2A45 I;  1X8Y A;  5AVZ B;  2JO1 A;  3HRN A;  1LWU B;  3D6Z A;  1PGQ A;  3U1A A;  3V2P A;  2M8R A;  2O3J A;  3BCC D;  3FWL A;  3KZI E;  2NPS C;  3B71 A;  3CX5 D;  1HJB A;  4IOI H;  3PLN A;  3RK3 E;  4A7P A;  1NTK G;  1GK6 A;  1YJN P;  3GG2 A;  1FC2 C;  1VQK P;  5KLV K;  3A5T A;  3OA7 A;  2E75 D;  3L71 G;  1W2E A;  1WRG A;  3L70 D;  1NKZ B;  1RE3 C;  2FXM A;  1PP9 D;  2YO2 A;  2PGD A;  2VRS A;  4I7Z C;  4I6M C;  4D6T G;  3P8C D;  4HJG H;  2DW3 A;  2LXC B;  3G9R A;  5AVS B;  4U7J A;  5E79 H;  1SQB K;  3VMA A;  2NRG A;  1BCC E;  2Q3I A;  1YHQ P;  1NTK D;  2QJP B;  1KQG B;  3AE7 C;  1DD4 A;  3Q1M A;  1K04 A;  3L71 D;  1EZV G;  1KFM A;  3E7K A;  2M5A B;  3L74 J;  3UIA A;  1QL2 A;  4C7R A;  1VQL P;  3SWK A;  4D6T D;  2Y0E A;  5AVT B;  5AW8 B;  1Q7Y Q;  3H1K D;  2E75 C;  3WU2 E;  1SFC B;  3D71 A;  1EC5 A;  1YQ4 C;  2Y9Y A;  1KIL A;  2YIU C;  2FYN B;  2ZAE B;  1L0L K;  1NH4 A;  3CME P;  4DCK A;  3M9Q A;  3WUU A;  1VF5 D;  1PL5 A;  1EZV D;  3CCS P;  2YXR B;  3B4S A;  4K3A A;  1S5L H;  4PV1 B;  4ASV A;  4H44 D;  2P58 A;  1R8E A;  1S9K E;  2Y0D A;  3CXH E;  3CXH I;  2FY8 A;  1NTM G;  3CC2 P;  3W68 A;  2WTY A;  1KIL D;  3IAO A;  2IZ1 A;  3H1J G;  4AUW A;  2LXB A;  4M3L A;  3GF3 A;  2WPS A;  2ZVO B;  3VOP A;  5AW1 B;  3H1H E;  3AEA C;  5AW2 B;  3N4X A;  2QA4 P;  4H0L B;  1NTM D;  3L75 J;  3V5B A;  2YO3 A;  4AQR D;  2IBZ D;  4WB4 A;  1VF5 C;  3A0H H;  1GZL A;  3CWB J;  3CX5 H;  4H44 C;  1J1E C;  3H32 A;  2HOD B;  1KIL C;  3HUS B;  1JB0 J;  3O6Q B;  4KHX A;  2WPR A;  5BU8 B;  2LR2 A;  4I1L A;  3II6 A;  3A0H E;  4YXD C;  2JP3 A;  4WY4 D;  2KXP B;  1N2D C;  3EWK A;  5H2F E;  4L73 A;  1SQV J;  1SVF A;  1FBM A;  3SWF A;  2SPZ A;  5APV A;  3S1K A;  2MKV A;  2FXO A;  3I5C A;  1IK7 A;  2W6B A;  2FYU G;  1ZR2 A;  1OWA A;  2YKO A;  3AE5 C;  1VQ9 P;  1AFO A;  2V7Q H;  1P84 I;  1SQQ D;  3E1R A;  1LT9 A;  1SQV G;  3G3Z A;  1VQP P;  2WSC H;  4QMA A;  3CC4 P;  1NU1 J;  1CZQ A;  2QM7 A;  4H13 B;  2QSI A;  1JY3 O;  1NTK E;  2OYH A;  4WY4 C;  1VQO P;  1GTW A;  1YJ9 P;  1Y47 A;  2XZR A;  3L71 E;  3PP5 A;  2FYU D;  1JY3 P;  2WWW A;  2QG4 A;  2ZVN B;  3T97 A;  1KTM A;  2Y9Z A;  1RF1 A;  1BE3 G;  4GOD A;  1YI2 P;  1H89 A;  3R4Y A;  2D2C D;  3TNU A;  1HWT C;  3Q2Y A;  4W80 A;  5AW0 B;  4HB1 A;  3MZW B;  2HG5 D;  1GW4 A;  1PPJ G;  4IL6 X;  4I2L C;  1AQT A;  4B86 A;  4RJT A;  2B87 A;  2JR8 A;  1KQF B;  5AVU B;  1GU4 A;  1G2C A;  3Q5P A;  3BAT A;  4LGD E;  4DZO A;  5AVV B;  1EZV E;  1EZV I;  2FFD B;  2KS1 A;  1LP1 A;  5CJ0 A;  3MTU E;  3PJS K;  3I55 P;  1BE3 D;  3HTK B;  1HGV A;  1ZLL A;  1KIL E;  5TJH A;  2BEQ D;  1A02 F;  4BRY B;  1LT9 C;  4Y99 B;  1FZA A;  1EXJ A;  2OTJ P;  1VL2 A;  5CHX A;  1AQ5 A;  1MUU A;  2D2C C;  2K9Y A;  2E74 B;  2J59 M;  1MV8 A;  3RL0 D;  2OYH C;  1IC2 A;  2OAR A;  1Q81 Q;  3JCU H;  4UB8 E;  2E76 B;  2FBW C;  5KLV J;  1NTM E;  3VP8 A;  4IFD K;  1G1I A;  1RF1 C;  1VDF A;  3H1J E;  1LTT C;  1X0T A;  1G2C B;  1NTZ G;  1QGK B;  1K05 A;  3G71 P;  1K9M Q;  1DIP A; 
#chains in the Genus database with same CATH homology
 2NRG A;  2DW3 A;  2ITA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...