2NRGA

Solution structure of pufx from rhodobacter sphaeroides (minimised average)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALETGIELIKHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intrinsic membrane protein pufX
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis,membrane protein
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2nrgA01
2DW3A 2ITAA 2NRGA
chains in the Genus database with same CATH superfamily
4XE5B 1VQ7P 1H89A 2BASA 1BDCA 2MJZA 2WSCJ 1NTMK 1T6AA 1T3JA 2WSFJ 3CWBG 2R3CA 3L74G 1DX7A 1FZFA 2YO2A 2FFDB 3SSUA 1CI6A 1GMJA 1OMIA 1BE3D 2OARA 1H88A 1SQXG 2WSSH 5AVSB 1T2KC 1SFCB 1HWTC 2XDJA 4KHXA 3SWKA 3OA7A 3B5NC 1GL2A 3RBXA 3VMZA 1KILD 2D2CD 3WU2E 2Q7CA 2BCCJ 1JY2N 3H1JD 4IFMA 1P84I 2B87A 3CWBJ 3NTNA 2KSEA 1NTMG 3VMYA 3HUSB 1PP9E 1Q2NA 5KLIB 1URQB 2SPZA 3AE2C 1VQ9P 2Y0DA 1ZR4A 5KLVE 1SQQK 2OYIC 5APYA 1J1EC 2NZ2A 3WU2H 3M0DC 1LWUB 5CCHA 1MV8A 2GM4A 3CC2P 2FYUK 1YQ3C 3L71E 1FZGA 1Y8AA 4OVNF 5AW3B 2WITA 1Y9BA 3AE9C 4H0LB 3AE6C 1YJ9P 1N7SB 2HR3A 2YKQA 1P84H 2P58A 1YBKA 3IN6A 4IOIH 5BVZA 1OW7A 1DH3A 2K88A 3P32A 1T3UA 1SQQG 1N2DC 2LXBA 2ZYAA 1XTCC 3H1ID 1EZVI 1NKZB 2ZVNB 4U3FD 2QJYB 1S9KD 2KS1A 2RMZA 2IZ0A 3TNUB 2R3SA 3B8EB 4RESB 3L73G 4UB6E 1L0NE 1Q7YQ 3GF7A 2M5AB 4ASVA 3WMM0 2QG4A 4C7NA 1L0LD 1GU4A 1KILC 2D2CC 3H1HE 2RH0A 2JO1A 4GDOA 1N7LA 3L35A 5AVVB 1OFCX 4UB6H 2NPSB 2WTYA 1VDFA 1J1DB 2P2UA 3QH9A 1BE3E 3L73J 4LC1A 2HLOA 2H8PD 2KI7B 2JP3A 5KAFE 1Q82Q 2WSEH 3L72J 3PH0A 3GHGC 3D6YA 3MIWA 1GL2D 4PJ0E 3TYYA 2B9BA 1MUUA 1KILE 3H1JE 4RJTA 3CC4P 1GZLA 4PV1D 4BRYB 1NTKJ 3AE8C 1L4AA 2K9JB 1VQ8P 1SQPD 2YKOA 3FWLA 5KAFH 4PD4H 2AEFA 1ZN5A 4PJ0H 4I7ZC 2R32A 3L70J 5KLVK 1GK4A 1EDJA 2QM7A 2YIUB 4WY4B 5CCHD 3HE5B 4HKZH 3EQ2A 2R5BA 5AVTB 4EIJA 3Q1MA 5CMZA 5APQA 1OW8A 2A06E 2CK3H 5AW2B 1JY3N 1SVFA 1Z56A 4N3YB 1ZP0C 1GW4A 2E5YA 3MP7B 5BU8B 5AW7B 2E74D 2VRSA 3G71P 1PP9G 2KIKA 5AW1B 2V4HA 1HGVA 1R5LA 3TDKA 2B89A 2YO3A 3HD7A 3H1IE 2QIWA 2IPPA 3AEFC 5KLVG 4U3FE 2J5UA 1NTZJ 2AEJA 3CXHD 2HODB 5KTBA 3L71G 1BCCD 3RK2B 2ZJSE 1A02F 1L0NK 1K8AQ 1L0LE 1MFZA 1GL2C 1LTJA 2R44A 1GU5A 2XZRA 4GODA 1X8YA 1BGYJ 3RBZA 2Z4EA 3R4YA 4I1LA 2ZFCA 3WUVA 4ZMDA 4H44B 2Z5HA 1FOSF 1YITP 3MUDA 1LTGC 2PRRA 3L71J 3A0HE 1YI2P 3QWOC 3JC22 1R8EA 1RE4C 3HRNA 5DJUB 5AW9B 3RL0B 5CCHC 2OYOA 2ZXEB 4Y28J 1KQSO 2RKLA 1FZAA 3SWFA 1KZUB 3Q5PA 2R5DA 1L4AD 1KORA 3H1HG 3BCCD 1SQPE 1ZR2A 1NYHA 1X79B 3A0HH 1U7MA 1SQVD 3H1LG 2E74C 3H32B 3VP8A 4NPDA 4ZKPA 5AVZB 3RGUA 1ZMEC 1T8ZA 1NVOA 2OYHA 1GW3A 1RF0A 3TK1A 1RE3C 3T97B 2FFDA 1AJYA 4EYYQ 2IBZD 2QJKC 2WSEJ 3H1HJ 1PV3A 2KYVA 3H1JG 1MKMA 3P8CE 3KPEA 2PP6A 2QM8A 1SFCA 5CJ4A 1WT6A 1EDLA 3H1LJ 2Y0EA 1OX3A 3II6A 3KHUA 4K35A 2KOGA 1TU3F 2FYUE 2GUVA 1N73A 3HD7D 4RO0A 1S2EA 4JPZB 1OVRA 5CCGA 1KFNA 2WZ7A 1DEEG 1VQ4P 1SQBJ 1LGHB 3HUSA 4XFJA 3S9OA 4RKUJ 3CXHE 1M56D 1URQA 4WVZA 3V6IA 1J1EB 4YXWH 1GD2E 3VMAA 4Y99C 1BCCE 5CHXA 2MKVA 1LTBC 2A06G 3C9IA 1NU1D 3O8ZA 2N1TB 2Q9IA 1LWUA 1PGPA 1L0LK 1CSBA 3TGUJ 3VMXA 3CD6P 3MGNA 2DW3A 2P1JA 3PTZA 4D6TD 1L4AC 4JYCA 1M1JC 1LP1B 2Y0CA 3H1IG 1N7SA 5KKZC 1X9VA 4U3FG 2JEEA 3M9HA 2FY8A 2CPBA 2OGUA 5CJ0A 2KP8A 5H2FE 3V2RA 3H1KD 1PGOA 4XA4A 3CCRP 2M3EA 2BEZF 4W7ZA 1L0LG 5APSA 3BCCE 3AEBC 4LGDE 2M5AA 2D2CB 1QX8A 1SQPK 5B5EE 3PHLA 5H2FH 3CCSP 4WBAA 2KXPB 3BRVB 3HD7C 2C0WA 1G1IA 2ZT9D 3GF3A 1GDTA 1N86A 2AEMA 1NAYA 3IR9A 2NPSA 1EQ7A 1YJWP 3M91A 3L74J 1YTZT 2IBZE 3FXDA 2LKMA 5B5EH 1SFCD 1U7JA 2KUBA 1SQXJ 3KQGA 3A3YB 1JCDA 3Q5SA 2E5TA 1YJNP 1IFIA 1LTJC 1SQPG 2UWJE 5CCGD 1EC5A 1LNQA 4K3AA 1JY2O 4BRYA 1EXJA 4GKGA 3AE4C 1NTMJ 2Q6QA 1KV4A 1KYOD 3B4SA 4I7ZB 2K9JA 3CX5E 2IFMA 4WWIA 1PL5A 4I6MC 3I55P 5E79E 5EFWB 2IZ1A 4N78D 1AFOA 3EFFK 1NU1E 3L75D 4OH8B 3KZIE 4WY4A 1HF9A 1KC8Q 3KYQA 1RF1C 1VF5D 3FWNA 4ZNCA 1RH5B 1L2PA 2V7QJ 5B66E 3O6QA 2M0BA 3CX5H 1KQGB 3C8VA 4D6TE 1JNMA 2ITAA 4H0LD 1M90Q 2FYUG 2IYOA 5E79H 2HPCB 1N7SD 1NH4A 3KZIH 3NMDA 2E42A 3AE7C 5KAIE 3LW5H 2JWDA 1SQQJ 1QEXA 3TF5A 5B66H 3N7NA 3Q2YA 2ZT9C 2OYHC 1BCCG 1ZRTD 1RF0C 2BCCD 2FYNB 4I2LC 4PD4I 3HTKA 3CWBD 3AECC 2FFDC 2FKWB 1R5SA 2FYUJ 1VL2A 1OXZA 2K3RA 1GL2B 1HVVA 5AVQB 1SFCC 1SP4A 1Q90D 5KAIH 1KQFB 4TLFA 4M3LA 2G8YA 3I5CA 3TSIA 3SFEC 4ASWA 1N73C 3C1LA 1OZHA 4KT0J 3RK3B 1LTSC 1VQLP 4U7JA 2ZYGA 1PFIA 5CCGC 1UIXA 1RQVA 1IFPA 3HUSC 3IFMA 1UIIA 2QRXA 2NPSD 3BATA 2FXOA 2W90A 1GK6A 4N6JA 3NFQA 4GIFA 2FXPA 1H0TB 1IJDB 3A0BE 3GMAA 2PAJA 2ZYDA 1FBMA 1LWUC 1LTAC 3GW6A 1VF5C 2E76B 1VQNP 1IZNB 3W68A 2E75B 1HGZA 4H0LC 1KYOE 4QMAA 1N7SC 3CCVP 5AVXB 3A0BH 3H32A 2PGDA 1ZLLA 1EDKA 4N78E 3L75E 1FZCB 3G3ZA 2IBZG 4WY4D 3F5HA 1KD1Q 2E43A 4KJMA 1NU1K 1NAFA 3FGAD 1FC2C 2XNDH 2QJYC 2HFED 1KYOH 1K9MQ 3OAKA 2Q1KA 2A45H 1S9KE 3T97A 1LT9A 1JTHB 2JKVA 3WUUA 3PLNA 2LXCB 3L73D 1DD4A 5APWA 3JCUE 1EXIA 3CMEP 3L72D 1PP9J 2WSCH 2FXMA 3MHVA 2WSFH 2WPRA 1ZRTE 2BCCE 2KB7P 1QL1A 5KLVJ 1NHLA 4PV1C 1NU1G 3VP9A 1QVFO 4JYBA 1G1JA 3CWBE 5KJ7A 2W83C 4IL6E 1RHZB 2NPSC 2C9NY 1NTKD 2XNXA 1KN7A 1J1DC 1PGJA 3V2NA 3JCUH 4OGQB 2POHA 3RK2D 4JQ0D 4D6TG 2K1AA 4UB8E 3CMAP 2N1TA 5APTA 3K5BA 4WB4A 1CW5A 1FJKA 3CLQA 3CCJP 3L70D 1L0NG 3HE4B 3CL3D 1FOSE 1M1JB 4IL6H 4H13B 5KKZB 3R2PA 4H44D 2YNYA 1LP1A 3VTPC 4EDFA 1PZQA 1KB9D 1VQMP 1E79H 1RY3A 3PRJA 4UB8H 1FDIA 4DJGA 1S72P 1JY2P 3WUTA 2XV5A 2YIUC 4WY4C 1YIJP 1NKNA 2KZIA 1BE3G 1L0NJ 3M9QA 3AE3C 1WMKA 3UIAA 3Q3DA 1WRGA 5K5GB 4IL6X 3M0AA 1IFJA 1NTZD 1VQKP 4AYCA 1M8OB 2WT7B 3B5NB 1K04A 2G3AA 5APUA 1KFMA 2BEQD 3G4SP 2QE7H 4CPGA 1AVYA 2O1KA 5AVUB 3SWYA 2JJLA 1M1KQ 4HJGH 1BE3J 1X0TA 1M7LA 1PPJD 1BGYD 4EI2A 5AW0B 1DEBA 3B71A 3D70A 3EWKA 4BXLA 5TISE 1FDOA 4GT1A 1P84D 3D71A 2OYIB 3ABVC 1OVUA 3V2QA 3RK2C 1S1CX 3V5BA 3H1JJ 3V2PA 2WPVB 3L71D 1LTTC 2A45G 2KLVA 1FAVA 1HJ0A 2O3JA 3EFGA 3L72E 1IK9A 1J2JB 1HBWA 3OJAB 1VQ6P 2OTLP 2W6AA 2Q5UA 5TISH 2P67A 2YMKA 2O01H 3L75G 1QVGO 3CXHH 4DOJA 5KJ7D 4H44C 4Z1MH 2YKPA 1JB0J 4MN4C 1NTKE 4HYTB 1MZ9A 3LIDA 1XTGB 3L37A 3A7OA 2Y9ZA 1ZOYC 1X22A 2WQYC 1RF1B 3F89A 4W7YA 2N1TD 2WVRA 3L70E 3I56P 2HYNA 1JM0A 1NGMB 5AW8B 1LTIC 4EOTA 1EZVD 5DJTB 3A2AA 1PGQA 3TNUA 2HPCA 2QA4P 1KB9E 2JR8A 2XKMA 3H1IJ 3H1HD 2BCCG 1SQVE 3MD0A 1KILB 4U3FJ 2OTKE 2N9BA 2JDIH 2ZT9B 2OYHB 1BSHA 2WWWA 3H1LD 1S5LX 1QL2A 2IBZI 3AEEC 3JSVC 4O9BA 2KLUA 3BVHA 1ZV8A 5C39A 1NTZE 1KB9H 1LT9C 1SQBD 1G2CB 4PD4D 1L0LJ 2K37A 1HJBA 2KNCB 3GHGB 3M06A 1D7MA 1N73B 4YXDC 1IFNA 3A5TA 3H25A 1N8RQ 5APXA 4BWNA 1A02J 3CX5I 1JY3P 2QVAA 3RL0g 1PPJE 1BGYE 4GOEA 2B88A 3Q5RA 3TGUD 1JCCA 2HG5D 5KJ7C 2PFXA 1AV1A 3W67A 1USEA 1P84E 1K73Q 1DD3A 1URQD 1JUNA 2ZVOB 3FX0A 3KXDA 4L76A 2H89C 1RE4A 3ZDMA 3LIEA 3MUDC 1JMMA 2KSJA 1H0TA 1VF5B 4R4MA 5TJHA 2N1TC 2YMYA 2YXRB 2QEXP 3SFDC 2A06D 1Y47A 1SQPJ 2QJPC 5AW4B 3HE5A 3CCEP 4NPFX 1OW6A 3AE1C 1QGKB 4LLHA 5AW6B 3PJSK 2AXCA 1NTKK 2M8RA 2L5GB 1U57A 1FZCA 1RE3A 3S1KA 2W27A 2NRGA 2WPSA 3V4WA 1NWQA 4IFDK 3H1KE 2C0XA 1CI6B 3D6ZA 1W5CE 1EZVE 3E1IA 5GTIE 3H6PA 1VPCA 3L72G 1JTHA 1CZQA 2HODA 1KTMA 3L74D 1JO5A 1FU1A 3IF4A 1ZXGA 5CBNA 1NTKG 1SQXD 3H1LE 1SQVK 5M1BA 2B87B 2O01J 4PV1B 1H8AA 3L4FA 1YYCA 2I1KA 3BASA 1AA0A 3FXEA 5GTIH 1BCCJ 5AW5B 1EDIA 1SQBE 2JWAA 4PD4E 5KLIC 1URQC 3L70G 1NTMD 1S3JA 2FBWC 1NTZK 1HUCA 2ZAEB 4YTPC 1KYOI 3CCMP 2A45I 3RK3D 3BCCG 5AVRB 3HE4A 1AVOA 1M1JA 4NPEA 1SQVG 3S4RA 2Y9YA 3M9BA 3TGUE 2KZJA 2W6JH 4HH2A 3AEAC 2W6BA 2E74B 4AQRD 2RN0A 1LT1A 1Q81Q 3MTUE 3E7KA 1JEKA 1SLQA 1NTZG 3CCUP 1LJ2A 2IDBA 2WMMA 1HTLC 2QSIA 3O6QB 2KS1B 2E76D 3BCCJ 2W8ZA 5AVWB 1SQQD 4L75A 3OW2O 4DT0A 1SQVJ 1BSNA 5L8RJ 2E75D 2QJKB 3P8CD 3MZWB 2K9YA 2WT7A 2O1JA 1JOCA 1JY3O 3B5NA 4C7NB 2AXTE 2FYUD 1PPJG 1BGYG 2IYPA 4JF7A 1VQOP 1YTZI 5AVYB 3HTKB 3CCLP 4ZKUA 3V4QA 4IFFA 1FE6A 1NO4A 4GOFA 2FYNC 4L73A 1NOHA 4R4LA 4Y99B 1FZEA 2AXTH 2OYIA 3ITKA 1YQ4C 2J58A 3L74E 2IX7C 2WPQA 1KMIZ 2J59M 3M0DA 1MFTA 3CI9A 4AUWA 3USSA 1SQXE 2IFNA 5CBOA 2KK7A 4W80A 3RK3C 3P8MC 2L91A 1OVVA 2C9LY 1L4AB 1PIXA 1IFDA 2OTJP 2LR2A 3PP5A 1BDDA 1Q86Q 4A7PA 1NU1J 1NTME 1W2BO 2GUSA 4OGQD 2Z5IA 1SQBK 3H1KG 3LW5J 4HB1A 1RF1A 4TT3H 2CPSA 1EZVG 2YXQB 4D6TJ 3RK3E 1ZW0A 3RL0D 3P7KA 2FYZA 2E76C 1FS0E 4H13D 2O01N 2E75C 3VN0A 1M57D 1IO4A 1VQPP 3GG2A 2M3BA 3AE5C 3VYIA 1E5WA 2P10A 3E1RA 2ZXXA 3CCQP 1KILA 3H1KJ 1VQ5P 3HD7B 3L36A 1USDA 1SQBG 1YHQP 1FZCC 1FJPA 3CXHI 2N9YB 2OQQA 1OWAA 4DZOA 3AEDC 1GTWA 1LT9B 1PP9D 3U1AA 1SQQE 5GTHE 2V7QH 2H88C 4C7RA 1QLED 2Q3EA 4JBZA 3BRTB 1AQTA 1T2KD 5KLVD 1G2CA 2I8DA 2XU6A 2KNCA 3B5ND 3GHGA 1FZBA 1LTJB 3TGUG 3L73E 3IAOA 5APVA 4L74A 1S4XA 3GLMA 5BU5A 1S5LE 5GTHH 2I1JA 2Q3IA 2GA1A 3CX5D 3U59A 1HH0A 1KQLA 2P7JA 3CPWO 4OWFA 1RQUA 4YPCA 3CC7P 1NJIQ 1OIPA 3U1CA 1IFMA 3KDPB 3G6EP 4B86A 3N4XA 4OGQC 4DCKA 1IK7A 1SS1A 3G9RA 1FDMA 2QJPB 1K05A 3NXSA 1S5LH 3AEGC 1IC2A 1KB9I 3RL0C 1W2EA 1JMBA 1SQXK 4C46A 2H43A 4H13C 3VOPA 1L0ND 2H7HA 1AQ5A 3L75J 1DIPA
chains in the Genus database with same CATH topology
2DW3A 2ITAA 2NRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DW3 A;  2ITA A;  2NRG A; 
#chains in the Genus database with same CATH topology
 4XE5 B;  1VQ7 P;  1H89 A;  2BAS A;  1BDC A;  2MJZ A;  2WSC J;  1NTM K;  1T6A A;  1T3J A;  2WSF J;  3CWB G;  2R3C A;  3L74 G;  1DX7 A;  1FZF A;  2YO2 A;  2FFD B;  3SSU A;  1CI6 A;  1GMJ A;  1OMI A;  1BE3 D;  2OAR A;  1H88 A;  1SQX G;  2WSS H;  5AVS B;  1T2K C;  1SFC B;  1HWT C;  2XDJ A;  4KHX A;  3SWK A;  3OA7 A;  3B5N C;  1GL2 A;  3RBX A;  3VMZ A;  1KIL D;  2D2C D;  3WU2 E;  2Q7C A;  2BCC J;  1JY2 N;  3H1J D;  4IFM A;  1P84 I;  2B87 A;  3CWB J;  3NTN A;  2KSE A;  1NTM G;  3VMY A;  3HUS B;  1PP9 E;  1Q2N A;  5KLI B;  1URQ B;  2SPZ A;  3AE2 C;  1VQ9 P;  2Y0D A;  1ZR4 A;  5KLV E;  1SQQ K;  2OYI C;  5APY A;  1J1E C;  2NZ2 A;  3WU2 H;  3M0D C;  1LWU B;  5CCH A;  1MV8 A;  2GM4 A;  3CC2 P;  2FYU K;  1YQ3 C;  3L71 E;  1FZG A;  1Y8A A;  4OVN F;  5AW3 B;  2WIT A;  1Y9B A;  3AE9 C;  4H0L B;  3AE6 C;  1YJ9 P;  1N7S B;  2HR3 A;  2YKQ A;  1P84 H;  2P58 A;  1YBK A;  3IN6 A;  4IOI H;  5BVZ A;  1OW7 A;  1DH3 A;  2K88 A;  3P32 A;  1T3U A;  1SQQ G;  1N2D C;  2LXB A;  2ZYA A;  1XTC C;  3H1I D;  1EZV I;  1NKZ B;  2ZVN B;  4U3F D;  2QJY B;  1S9K D;  2KS1 A;  2RMZ A;  2IZ0 A;  3TNU B;  2R3S A;  3B8E B;  4RES B;  3L73 G;  4UB6 E;  1L0N E;  1Q7Y Q;  3GF7 A;  2M5A B;  4ASV A;  3WMM 0;  2QG4 A;  4C7N A;  1L0L D;  1GU4 A;  1KIL C;  2D2C C;  3H1H E;  2RH0 A;  2JO1 A;  4GDO A;  1N7L A;  3L35 A;  5AVV B;  1OFC X;  4UB6 H;  2NPS B;  2WTY A;  1VDF A;  1J1D B;  2P2U A;  3QH9 A;  1BE3 E;  3L73 J;  4LC1 A;  2HLO A;  2H8P D;  2KI7 B;  2JP3 A;  5KAF E;  1Q82 Q;  2WSE H;  3L72 J;  3PH0 A;  3GHG C;  3D6Y A;  3MIW A;  1GL2 D;  4PJ0 E;  3TYY A;  2B9B A;  1MUU A;  1KIL E;  3H1J E;  4RJT A;  3CC4 P;  1GZL A;  4PV1 D;  4BRY B;  1NTK J;  3AE8 C;  1L4A A;  2K9J B;  1VQ8 P;  1SQP D;  2YKO A;  3FWL A;  5KAF H;  4PD4 H;  2AEF A;  1ZN5 A;  4PJ0 H;  4I7Z C;  2R32 A;  3L70 J;  5KLV K;  1GK4 A;  1EDJ A;  2QM7 A;  2YIU B;  4WY4 B;  5CCH D;  3HE5 B;  4HKZ H;  3EQ2 A;  2R5B A;  5AVT B;  4EIJ A;  3Q1M A;  5CMZ A;  5APQ A;  1OW8 A;  2A06 E;  2CK3 H;  5AW2 B;  1JY3 N;  1SVF A;  1Z56 A;  4N3Y B;  1ZP0 C;  1GW4 A;  2E5Y A;  3MP7 B;  5BU8 B;  5AW7 B;  2E74 D;  2VRS A;  3G71 P;  1PP9 G;  2KIK A;  5AW1 B;  2V4H A;  1HGV A;  1R5L A;  3TDK A;  2B89 A;  2YO3 A;  3HD7 A;  3H1I E;  2QIW A;  2IPP A;  3AEF C;  5KLV G;  4U3F E;  2J5U A;  1NTZ J;  2AEJ A;  3CXH D;  2HOD B;  5KTB A;  3L71 G;  1BCC D;  3RK2 B;  2ZJS E;  1A02 F;  1L0N K;  1K8A Q;  1L0L E;  1MFZ A;  1GL2 C;  1LTJ A;  2R44 A;  1GU5 A;  2XZR A;  4GOD A;  1X8Y A;  1BGY J;  3RBZ A;  2Z4E A;  3R4Y A;  4I1L A;  2ZFC A;  3WUV A;  4ZMD A;  4H44 B;  2Z5H A;  1FOS F;  1YIT P;  3MUD A;  1LTG C;  2PRR A;  3L71 J;  3A0H E;  1YI2 P;  3QWO C;  3JC2 2;  1R8E A;  1RE4 C;  3HRN A;  5DJU B;  5AW9 B;  3RL0 B;  5CCH C;  2OYO A;  2ZXE B;  4Y28 J;  1KQS O;  2RKL A;  1FZA A;  3SWF A;  1KZU B;  3Q5P A;  2R5D A;  1L4A D;  1KOR A;  3H1H G;  3BCC D;  1SQP E;  1ZR2 A;  1NYH A;  1X79 B;  3A0H H;  1U7M A;  1SQV D;  3H1L G;  2E74 C;  3H32 B;  3VP8 A;  4NPD A;  4ZKP A;  5AVZ B;  3RGU A;  1ZME C;  1T8Z A;  1NVO A;  2OYH A;  1GW3 A;  1RF0 A;  3TK1 A;  1RE3 C;  3T97 B;  2FFD A;  1AJY A;  4EYY Q;  2IBZ D;  2QJK C;  2WSE J;  3H1H J;  1PV3 A;  2KYV A;  3H1J G;  1MKM A;  3P8C E;  3KPE A;  2PP6 A;  2QM8 A;  1SFC A;  5CJ4 A;  1WT6 A;  1EDL A;  3H1L J;  2Y0E A;  1OX3 A;  3II6 A;  3KHU A;  4K35 A;  2KOG A;  1TU3 F;  2FYU E;  2GUV A;  1N73 A;  3HD7 D;  4RO0 A;  1S2E A;  4JPZ B;  1OVR A;  5CCG A;  1KFN A;  2WZ7 A;  1DEE G;  1VQ4 P;  1SQB J;  1LGH B;  3HUS A;  4XFJ A;  3S9O A;  4RKU J;  3CXH E;  1M56 D;  1URQ A;  4WVZ A;  3V6I A;  1J1E B;  4YXW H;  1GD2 E;  3VMA A;  4Y99 C;  1BCC E;  5CHX A;  2MKV A;  1LTB C;  2A06 G;  3C9I A;  1NU1 D;  3O8Z A;  2N1T B;  2Q9I A;  1LWU A;  1PGP A;  1L0L K;  1CSB A;  3TGU J;  3VMX A;  3CD6 P;  3MGN A;  2DW3 A;  2P1J A;  3PTZ A;  4D6T D;  1L4A C;  4JYC A;  1M1J C;  1LP1 B;  2Y0C A;  3H1I G;  1N7S A;  5KKZ C;  1X9V A;  4U3F G;  2JEE A;  3M9H A;  2FY8 A;  2CPB A;  2OGU A;  5CJ0 A;  2KP8 A;  5H2F E;  3V2R A;  3H1K D;  1PGO A;  4XA4 A;  3CCR P;  2M3E A;  2BEZ F;  4W7Z A;  1L0L G;  5APS A;  3BCC E;  3AEB C;  4LGD E;  2M5A A;  2D2C B;  1QX8 A;  1SQP K;  5B5E E;  3PHL A;  5H2F H;  3CCS P;  4WBA A;  2KXP B;  3BRV B;  3HD7 C;  2C0W A;  1G1I A;  2ZT9 D;  3GF3 A;  1GDT A;  1N86 A;  2AEM A;  1NAY A;  3IR9 A;  2NPS A;  1EQ7 A;  1YJW P;  3M91 A;  3L74 J;  1YTZ T;  2IBZ E;  3FXD A;  2LKM A;  5B5E H;  1SFC D;  1U7J A;  2KUB A;  1SQX J;  3KQG A;  3A3Y B;  1JCD A;  3Q5S A;  2E5T A;  1YJN P;  1IFI A;  1LTJ C;  1SQP G;  2UWJ E;  5CCG D;  1EC5 A;  1LNQ A;  4K3A A;  1JY2 O;  4BRY A;  1EXJ A;  4GKG A;  3AE4 C;  1NTM J;  2Q6Q A;  1KV4 A;  1KYO D;  3B4S A;  4I7Z B;  2K9J A;  3CX5 E;  2IFM A;  4WWI A;  1PL5 A;  4I6M C;  3I55 P;  5E79 E;  5EFW B;  2IZ1 A;  4N78 D;  1AFO A;  3EFF K;  1NU1 E;  3L75 D;  4OH8 B;  3KZI E;  4WY4 A;  1HF9 A;  1KC8 Q;  3KYQ A;  1RF1 C;  1VF5 D;  3FWN A;  4ZNC A;  1RH5 B;  1L2P A;  2V7Q J;  5B66 E;  3O6Q A;  2M0B A;  3CX5 H;  1KQG B;  3C8V A;  4D6T E;  1JNM A;  2ITA A;  4H0L D;  1M90 Q;  2FYU G;  2IYO A;  5E79 H;  2HPC B;  1N7S D;  1NH4 A;  3KZI H;  3NMD A;  2E42 A;  3AE7 C;  5KAI E;  3LW5 H;  2JWD A;  1SQQ J;  1QEX A;  3TF5 A;  5B66 H;  3N7N A;  3Q2Y A;  2ZT9 C;  2OYH C;  1BCC G;  1ZRT D;  1RF0 C;  2BCC D;  2FYN B;  4I2L C;  4PD4 I;  3HTK A;  3CWB D;  3AEC C;  2FFD C;  2FKW B;  1R5S A;  2FYU J;  1VL2 A;  1OXZ A;  2K3R A;  1GL2 B;  1HVV A;  5AVQ B;  1SFC C;  1SP4 A;  1Q90 D;  5KAI H;  1KQF B;  4TLF A;  4M3L A;  2G8Y A;  3I5C A;  3TSI A;  3SFE C;  4ASW A;  1N73 C;  3C1L A;  1OZH A;  4KT0 J;  3RK3 B;  1LTS C;  1VQL P;  4U7J A;  2ZYG A;  1PFI A;  5CCG C;  1UIX A;  1RQV A;  1IFP A;  3HUS C;  3IFM A;  1UII A;  2QRX A;  2NPS D;  3BAT A;  2FXO A;  2W90 A;  1GK6 A;  4N6J A;  3NFQ A;  4GIF A;  2FXP A;  1H0T B;  1IJD B;  3A0B E;  3GMA A;  2PAJ A;  2ZYD A;  1FBM A;  1LWU C;  1LTA C;  3GW6 A;  1VF5 C;  2E76 B;  1VQN P;  1IZN B;  3W68 A;  2E75 B;  1HGZ A;  4H0L C;  1KYO E;  4QMA A;  1N7S C;  3CCV P;  5AVX B;  3A0B H;  3H32 A;  2PGD A;  1ZLL A;  1EDK A;  4N78 E;  3L75 E;  1FZC B;  3G3Z A;  2IBZ G;  4WY4 D;  3F5H A;  1KD1 Q;  2E43 A;  4KJM A;  1NU1 K;  1NAF A;  3FGA D;  1FC2 C;  2XND H;  2QJY C;  2HFE D;  1KYO H;  1K9M Q;  3OAK A;  2Q1K A;  2A45 H;  1S9K E;  3T97 A;  1LT9 A;  1JTH B;  2JKV A;  3WUU A;  3PLN A;  2LXC B;  3L73 D;  1DD4 A;  5APW A;  3JCU E;  1EXI A;  3CME P;  3L72 D;  1PP9 J;  2WSC H;  2FXM A;  3MHV A;  2WSF H;  2WPR A;  1ZRT E;  2BCC E;  2KB7 P;  1QL1 A;  5KLV J;  1NHL A;  4PV1 C;  1NU1 G;  3VP9 A;  1QVF O;  4JYB A;  1G1J A;  3CWB E;  5KJ7 A;  2W83 C;  4IL6 E;  1RHZ B;  2NPS C;  2C9N Y;  1NTK D;  2XNX A;  1KN7 A;  1J1D C;  1PGJ A;  3V2N A;  3JCU H;  4OGQ B;  2POH A;  3RK2 D;  4JQ0 D;  4D6T G;  2K1A A;  4UB8 E;  3CMA P;  2N1T A;  5APT A;  3K5B A;  4WB4 A;  1CW5 A;  1FJK A;  3CLQ A;  3CCJ P;  3L70 D;  1L0N G;  3HE4 B;  3CL3 D;  1FOS E;  1M1J B;  4IL6 H;  4H13 B;  5KKZ B;  3R2P A;  4H44 D;  2YNY A;  1LP1 A;  3VTP C;  4EDF A;  1PZQ A;  1KB9 D;  1VQM P;  1E79 H;  1RY3 A;  3PRJ A;  4UB8 H;  1FDI A;  4DJG A;  1S72 P;  1JY2 P;  3WUT A;  2XV5 A;  2YIU C;  4WY4 C;  1YIJ P;  1NKN A;  2KZI A;  1BE3 G;  1L0N J;  3M9Q A;  3AE3 C;  1WMK A;  3UIA A;  3Q3D A;  1WRG A;  5K5G B;  4IL6 X;  3M0A A;  1IFJ A;  1NTZ D;  1VQK P;  4AYC A;  1M8O B;  2WT7 B;  3B5N B;  1K04 A;  2G3A A;  5APU A;  1KFM A;  2BEQ D;  3G4S P;  2QE7 H;  4CPG A;  1AVY A;  2O1K A;  5AVU B;  3SWY A;  2JJL A;  1M1K Q;  4HJG H;  1BE3 J;  1X0T A;  1M7L A;  1PPJ D;  1BGY D;  4EI2 A;  5AW0 B;  1DEB A;  3B71 A;  3D70 A;  3EWK A;  4BXL A;  5TIS E;  1FDO A;  4GT1 A;  1P84 D;  3D71 A;  2OYI B;  3ABV C;  1OVU A;  3V2Q A;  3RK2 C;  1S1C X;  3V5B A;  3H1J J;  3V2P A;  2WPV B;  3L71 D;  1LTT C;  2A45 G;  2KLV A;  1FAV A;  1HJ0 A;  2O3J A;  3EFG A;  3L72 E;  1IK9 A;  1J2J B;  1HBW A;  3OJA B;  1VQ6 P;  2OTL P;  2W6A A;  2Q5U A;  5TIS H;  2P67 A;  2YMK A;  2O01 H;  3L75 G;  1QVG O;  3CXH H;  4DOJ A;  5KJ7 D;  4H44 C;  4Z1M H;  2YKP A;  1JB0 J;  4MN4 C;  1NTK E;  4HYT B;  1MZ9 A;  3LID A;  1XTG B;  3L37 A;  3A7O A;  2Y9Z A;  1ZOY C;  1X22 A;  2WQY C;  1RF1 B;  3F89 A;  4W7Y A;  2N1T D;  2WVR A;  3L70 E;  3I56 P;  2HYN A;  1JM0 A;  1NGM B;  5AW8 B;  1LTI C;  4EOT A;  1EZV D;  5DJT B;  3A2A A;  1PGQ A;  3TNU A;  2HPC A;  2QA4 P;  1KB9 E;  2JR8 A;  2XKM A;  3H1I J;  3H1H D;  2BCC G;  1SQV E;  3MD0 A;  1KIL B;  4U3F J;  2OTK E;  2N9B A;  2JDI H;  2ZT9 B;  2OYH B;  1BSH A;  2WWW A;  3H1L D;  1S5L X;  1QL2 A;  2IBZ I;  3AEE C;  3JSV C;  4O9B A;  2KLU A;  3BVH A;  1ZV8 A;  5C39 A;  1NTZ E;  1KB9 H;  1LT9 C;  1SQB D;  1G2C B;  4PD4 D;  1L0L J;  2K37 A;  1HJB A;  2KNC B;  3GHG B;  3M06 A;  1D7M A;  1N73 B;  4YXD C;  1IFN A;  3A5T A;  3H25 A;  1N8R Q;  5APX A;  4BWN A;  1A02 J;  3CX5 I;  1JY3 P;  2QVA A;  3RL0 g;  1PPJ E;  1BGY E;  4GOE A;  2B88 A;  3Q5R A;  3TGU D;  1JCC A;  2HG5 D;  5KJ7 C;  2PFX A;  1AV1 A;  3W67 A;  1USE A;  1P84 E;  1K73 Q;  1DD3 A;  1URQ D;  1JUN A;  2ZVO B;  3FX0 A;  3KXD A;  4L76 A;  2H89 C;  1RE4 A;  3ZDM A;  3LIE A;  3MUD C;  1JMM A;  2KSJ A;  1H0T A;  1VF5 B;  4R4M A;  5TJH A;  2N1T C;  2YMY A;  2YXR B;  2QEX P;  3SFD C;  2A06 D;  1Y47 A;  1SQP J;  2QJP C;  5AW4 B;  3HE5 A;  3CCE P;  4NPF X;  1OW6 A;  3AE1 C;  1QGK B;  4LLH A;  5AW6 B;  3PJS K;  2AXC A;  1NTK K;  2M8R A;  2L5G B;  1U57 A;  1FZC A;  1RE3 A;  3S1K A;  2W27 A;  2NRG A;  2WPS A;  3V4W A;  1NWQ A;  4IFD K;  3H1K E;  2C0X A;  1CI6 B;  3D6Z A;  1W5C E;  1EZV E;  3E1I A;  5GTI E;  3H6P A;  1VPC A;  3L72 G;  1JTH A;  1CZQ A;  2HOD A;  1KTM A;  3L74 D;  1JO5 A;  1FU1 A;  3IF4 A;  1ZXG A;  5CBN A;  1NTK G;  1SQX D;  3H1L E;  1SQV K;  5M1B A;  2B87 B;  2O01 J;  4PV1 B;  1H8A A;  3L4F A;  1YYC A;  2I1K A;  3BAS A;  1AA0 A;  3FXE A;  5GTI H;  1BCC J;  5AW5 B;  1EDI A;  1SQB E;  2JWA A;  4PD4 E;  5KLI C;  1URQ C;  3L70 G;  1NTM D;  1S3J A;  2FBW C;  1NTZ K;  1HUC A;  2ZAE B;  4YTP C;  1KYO I;  3CCM P;  2A45 I;  3RK3 D;  3BCC G;  5AVR B;  3HE4 A;  1AVO A;  1M1J A;  4NPE A;  1SQV G;  3S4R A;  2Y9Y A;  3M9B A;  3TGU E;  2KZJ A;  2W6J H;  4HH2 A;  3AEA C;  2W6B A;  2E74 B;  4AQR D;  2RN0 A;  1LT1 A;  1Q81 Q;  3MTU E;  3E7K A;  1JEK A;  1SLQ A;  1NTZ G;  3CCU P;  1LJ2 A;  2IDB A;  2WMM A;  1HTL C;  2QSI A;  3O6Q B;  2KS1 B;  2E76 D;  3BCC J;  2W8Z A;  5AVW B;  1SQQ D;  4L75 A;  3OW2 O;  4DT0 A;  1SQV J;  1BSN A;  5L8R J;  2E75 D;  2QJK B;  3P8C D;  3MZW B;  2K9Y A;  2WT7 A;  2O1J A;  1JOC A;  1JY3 O;  3B5N A;  4C7N B;  2AXT E;  2FYU D;  1PPJ G;  1BGY G;  2IYP A;  4JF7 A;  1VQO P;  1YTZ I;  5AVY B;  3HTK B;  3CCL P;  4ZKU A;  3V4Q A;  4IFF A;  1FE6 A;  1NO4 A;  4GOF A;  2FYN C;  4L73 A;  1NOH A;  4R4L A;  4Y99 B;  1FZE A;  2AXT H;  2OYI A;  3ITK A;  1YQ4 C;  2J58 A;  3L74 E;  2IX7 C;  2WPQ A;  1KMI Z;  2J59 M;  3M0D A;  1MFT A;  3CI9 A;  4AUW A;  3USS A;  1SQX E;  2IFN A;  5CBO A;  2KK7 A;  4W80 A;  3RK3 C;  3P8M C;  2L91 A;  1OVV A;  2C9L Y;  1L4A B;  1PIX A;  1IFD A;  2OTJ P;  2LR2 A;  3PP5 A;  1BDD A;  1Q86 Q;  4A7P A;  1NU1 J;  1NTM E;  1W2B O;  2GUS A;  4OGQ D;  2Z5I A;  1SQB K;  3H1K G;  3LW5 J;  4HB1 A;  1RF1 A;  4TT3 H;  2CPS A;  1EZV G;  2YXQ B;  4D6T J;  3RK3 E;  1ZW0 A;  3RL0 D;  3P7K A;  2FYZ A;  2E76 C;  1FS0 E;  4H13 D;  2O01 N;  2E75 C;  3VN0 A;  1M57 D;  1IO4 A;  1VQP P;  3GG2 A;  2M3B A;  3AE5 C;  3VYI A;  1E5W A;  2P10 A;  3E1R A;  2ZXX A;  3CCQ P;  1KIL A;  3H1K J;  1VQ5 P;  3HD7 B;  3L36 A;  1USD A;  1SQB G;  1YHQ P;  1FZC C;  1FJP A;  3CXH I;  2N9Y B;  2OQQ A;  1OWA A;  4DZO A;  3AED C;  1GTW A;  1LT9 B;  1PP9 D;  3U1A A;  1SQQ E;  5GTH E;  2V7Q H;  2H88 C;  4C7R A;  1QLE D;  2Q3E A;  4JBZ A;  3BRT B;  1AQT A;  1T2K D;  5KLV D;  1G2C A;  2I8D A;  2XU6 A;  2KNC A;  3B5N D;  3GHG A;  1FZB A;  1LTJ B;  3TGU G;  3L73 E;  3IAO A;  5APV A;  4L74 A;  1S4X A;  3GLM A;  5BU5 A;  1S5L E;  5GTH H;  2I1J A;  2Q3I A;  2GA1 A;  3CX5 D;  3U59 A;  1HH0 A;  1KQL A;  2P7J A;  3CPW O;  4OWF A;  1RQU A;  4YPC A;  3CC7 P;  1NJI Q;  1OIP A;  3U1C A;  1IFM A;  3KDP B;  3G6E P;  4B86 A;  3N4X A;  4OGQ C;  4DCK A;  1IK7 A;  1SS1 A;  3G9R A;  1FDM A;  2QJP B;  1K05 A;  3NXS A;  1S5L H;  3AEG C;  1IC2 A;  1KB9 I;  3RL0 C;  1W2E A;  1JMB A;  1SQX K;  4C46 A;  2H43 A;  4H13 C;  3VOP A;  1L0N D;  2H7H A;  1AQ5 A;  3L75 J;  1DIP A; 
#chains in the Genus database with same CATH homology
 2DW3 A;  2ITA A;  2NRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...