2NRGA

Solution structure of pufx from rhodobacter sphaeroides (minimised average)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALETGIELIKHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intrinsic membrane protein pufX
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Photosynthesis,membrane protein
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2nrgA01
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH superfamily
2ZT9C 1JM0A 3JCUE 2M5AA 2AXTE 1KB9H 3F5HA 2FXMA 2FYUE 1LTTC 1R5SA 1P84I 2B89A 2BEQD 2OYHB 2E76B 1NGMB 1GK4A 4IL6H 2ZYAA 1SFCB 4GIFA 1LT9A 1NWQA 3B71A 1OW8A 2M5AB 3E1IA 4W7ZA 4EDFA 2QJPC 3MHVA 4JQ0D 3VN0A 2ZXEB 1SQXE 3BVHA 2H7HA 1U7JA 3BATA 1L0LK 2H89C 5APXA 1S5LX 3WUTA 4GOEA 1EQ7A 3B5ND 2R3CA 3OW2O 3FXDA 3B5NA 1R8EA 1VF5B 1RE4A 3CLQA 2QE7H 3TF5A 2YIUC 3W67A 1BGYD 1FJPA 2W6AA 3GHGC 1BGYG 1KQFB 3RGUA 3M9HA 1SQVD 3L72J 1SQVG 2Q3EA 1N73C 1LTIC 3T97B 5APVA 1J1EC 2OYOA 1VQPP 5E79E 1JMMA 2JWDA 3RL0C 4GODA 1T6AA 5APUA 1BSHA 1G1JA 5GTIE 1YJWP 3AECC 3A0BH 4WY4D 3Q2YA 2FYUD 2RH0A 4WY4A 2FYUG 1VL2A 1IK7A 4DOJA 4NPFX 3CWBE 1RF0C 2E74D 3D71A 1BDDA 1KYOH 4HB1A 5KLVK 1X22A 1OW6A 2OYIA 1AA0A 1EXIA 3TNUA 3R2PA 3M0DC 2XDJA 5APWA 3H1IJ 2Y0DA 1A02F 1EZVE 2FYNB 5KAFE 1YTZT 1L0LE 2P1JA 1SQXD 3EFFK 4WY4B 3H1LJ 1GK6A 1SQXG 2LR2A 3L71J 5AW6B 2OYHC 2E76C 4H13D 3CX5E 5AW9B 3V2NA 1NTMK 1RH5B 2E74B 1HBWA 1SFCC 3AE2C 5CCHC 2OYIB 4GOFA 2A45H 2O1KA 3TNUB 1P84E 3G9RA 4QMAA 3ABVC 2LXBA 1MZ9A 3BRTB 3P7KA 3KDPB 2J59M 1KILE 3GLMA 1IFNA 2VRSA 4JYBA 1X79B 3VMAA 4H13B 3CCMP 2BCCJ 2JDIH 3WMM0 1VF5C 2WMMA 4PD4I 1Q86Q 1FZCA 1VDFA 1G2CA 1FZAA 3P32A 5KLVE 3CWBD 1VQ9P 2ZXXA 1AQ5A 1LP1B 3CWBG 1FDMA 3CCSP 3LIDA 1ZOYC 1XTGB 2IX7C 1N7SD 1EZVD 1N7SA 1KN7A 2OARA 4Y28J 1L0LD 1N8RQ 1EZVG 1NTME 1L0LG 2IYOA 3K5BA 5AVSB 2JO1A 1G2CB 4UB8E 3CX5D 2IYPA 3WUUA 2WITA 1YQ3C 3HUSA 1KD1Q 3VMYA 1CW5A 3S9OA 4YXDC 1JUNA 3CXHI 4C7NA 1R5LA 1W2BO 2H8PD 1N7SB 3LW5J 1GD2E 1NU1K 1J2JB 1X0TA 2FYNC 1HJ0A 1KILD 4WY4C 1KILA 1OXZA 1BCCE 4JYCA 3HUSB 1L2PA 2E74C 1OFCX 1PGQA 3HRNA 2O01J 2OYIC 2I8DA 4JPZB 4UB6E 1IFJA 5KLVD 1Y47A 1J1DB 5KLVG 2W27A 2IBZI 2C0WA 2JR8A 5APTA 3VTPC 1KILB 4JBZA 2H43A 3A0HE 1BDCA 1JTHA 3C8VA 2FXPA 1VQ7P 4H13C 5AW3B 5B66E 2YXRB 2HPCA 1LTBC 1NTMD 1PP9J 3L74J 1NTMG 1PV3A 1N86A 2RMZA 3AE8C 1TU3F 1FS0E 3BASA 3E1RA 4ASWA 5DJUB 2K9JA 2W8ZA 2IDBA 4I6MC 2P7JA 1PL5A 1S2EA 4ZMDA 2LKMA 3V5BA 1OW7A 2WSEJ 4K35A 1VQ4P 2I1JA 5B5EH 1HF9A 1BCCD 4U3FJ 3PTZA 1BCCG 4BRYB 1URQB 2N9BA 2K9YA 1VQMP 3H6PA 1PIXA 3KZIE 3TGUJ 4IOIH 1AJYA 3PRJA 2E43A 3L75E 3S1KA 3O6QA 2YKOA 1NTZJ 1N7SC 1MUUA 1N2DC 1Y9BA 1Y8AA 1SQPE 3GG2A 3MTUE 2FYZA 3CXHE 2POHA 3VOPA 2KIKA 1RQUA 3VYIA 3L35A 2WPVB 1U57A 3U59A 3HUSC 1L0NK 3R4YA 2Y9ZA 2KK7A 3WUVA 2WWWA 2ITAA 5CJ0A 1RE3A 1M8OB 2E75D 1YJ9P 3U1CA 3L36A 1ZN5A 3O6QB 1PP9E 1NTKJ 1SQQJ 1J1DC 2WSCH 1JEKA 1LJ2A 1KILC 2WSSH 3WU2E 1EDLA 3SFEC 2Q6QA 3I55P 2IBZE 3H1KJ 2WT7B 2ZYDA 1JY3O 1JMBA 3S4RA 4XA4A 3KHUA 5KLIB 4HYTB 1SQXK 1M1JA 1QEXA 2E75B 2M3BA 1W2EA 1EDKA 1DX7A 4MN4C 1JY3N 1S5LH 3TSIA 3CPWO 1YQ4C 3LIEA 5CMZA 4XFJA 1ZRTE 3RL0g 2P58A 3AE3C 3A3YB 2ZYGA 4PJ0H 3L75D 1LWUA 3L75G 4ZKPA 1SQBJ 3RK3B 1SQPD 3CXHD 1SQPG 2R5BA 3CX5I 4M3LA 1L0NE 3H1JJ 2V4HA 1DEBA 1KTMA 4PV1D 2HODA 1L4AD 1URQC 4W7YA 1L4AA 2WSEH 2L91A 4IFFA 3BCCE 1QL1A 1S3JA 4H44D 1PP9D 1RF1B 4CPGA 1KV4A 1GZLA 1Z56A 4BXLA 3PLNA 3FXEA 1YHQP 3OA7A 2P2UA 3G4SP 2N1TD 4PV1B 2N1TA 1GU5A 1L4AB 2IBZD 1LTJA 1NKZB 2IBZG 1NYHA 4OGQD 3V2QA 3FWNA 4D6TJ 2R44A 3IR9A 1BE3J 3V6IA 5KAIE 1T2KC 3L70J 1LT9B 3M9BA 2AXTH 2AXCA 1ZRTD 2FKWB 2XNDH 4RESB 1DEEG 1OIPA 2N1TB 2Z4EA 2OGUA 1SLQA 1LTJB 5AW0B 1U7MA 1YJNP 4WBAA 4Z1MH 3C9IA 3L73E 1RE3C 4OGQB 3SFDC 3CI9A 3IN6A 1L0ND 3EFGA 2QM7A 5KLIC 2E75C 2KLVA 2PP6A 1L0NG 3B5NB 3CCJP 5AW2B 1FU1A 1LNQA 2YO2A 3BCCD 3BCCG 1ZXGA 3TK1A 1ZR4A 2M3EA 2J58A 1N7LA 1S9KE 1IFIA 1VQ8P 3RK3C 2KZJA 2OQQA 3N4XA 5KJ7D 5CJ4A 5KJ7A 2Z5IA 4R4MA 1QVFO 3MZWB 3JC22 3H1HJ 3MGNA 3A5TA 5APYA 1NOHA 3VMZA 5CBOA 2J5UA 3CMAP 1RF1C 3AE4C 5E79H 5TISH 1KQSO 5GTIH 3VP8A 2P10A 2WPSA 1PGOA 1X8YA 4PV1C 3AEGC 3M06A 4L74A 2HYNA 5AVUB 3RK2D 3L73D 5AVWB 2Q1KA 3L73G 2O3JA 1PGPA 4IFMA 3L72E 1NHLA 4B86A 2O01N 2HR3A 2GUVA 1LT9C 4LLHA 3GW6A 2CPSA 3U1AA 3RBXA 2QEXP 5KTBA 1FOSF 3MUDA 1SS1A 2N1TC 1LTJC 1MKMA 1CSBA 1S9KD 2YMKA 3Q3DA 4W80A 3CCVP 3RK2B 2B87A 4OGQC 1KQGB 2OTLP 4OWFA 1FDOA 1P84H 3B5NC 1PPJE 1M57D 2BEZF 1RE4C 4R4LA 3H1IE 2JJLA 1FZCB 2K3RA 4N6JA 1VQ6P 2WZ7A 1D7MA 3V2RA 4EOTA 2YKQA 3AEFC 3H1LE 3L71E 3USSA 2DW3A 5M1BA 2PAJA 3KQGA 4RKUJ 4RO0A 4TT3H 2XKMA 2B87B 3W68A 1SP4A 2YXQB 1IFDA 1JOCA 3CC7P 1JCCA 1ZV8A 2K88A 1NU1J 2WQYC 2WPRA 2IZ0A 1DD4A 2V7QJ 1YIJP 3L72D 2ZJSE 3NTNA 3L72G 3HD7D 4WB4A 4C7NB 2BCCE 3HD7A 3HE4A 2WSCJ 3HE5A 1X9VA 2ZAEB 5KJ7C 3IAOA 1QL2A 2KOGA 3AE9C 2QJKB 1IJDB 1KB9I 1W5CE 1CI6A 3GMAA 3CD6P 3P8CE 1SQPK 3AE5C 3SWYA 2KB7P 4ZKUA 1PPJD 3H1ID 3HD7B 5APQA 1PPJG 3HE4B 1MFTA 1NKNA 3H1IG 1KZUB 4NPDA 3H1LD 3L71D 4EIJA 1HH0A 1T3JA 2KXPB 3H1LG 3L71G 1CI6B 1HGZA 1JTHB 3RK2C 2G3AA 2MKVA 2JP3A 2W6BA 2D2CD 5C39A 4UB6H 2HPCB 1FJKA 1FZGA 1FZCC 2Q5UA 1NVOA 1HWTC 1IO4A 1QGKB 1GL2D 1NO4A 3A0HH 2XU6A 1GL2A 2K9JB 2MJZA 1YTZI 2BCCD 5B66H 5GTHE 1FBMA 2K37A 2BCCG 1EXJA 2QM8A 4GKGA 1ZLLA 5TJHA 1USDA 2D2CB 1T8ZA 3C1LA 1BGYJ 1EC5A 5AVVB 2GM4A 5AVTB 2Q9IA 2KLUA 1H88A 3NMDA 3P8CD 1E79H 1SQVJ 5APSA 3CCRP 1GL2B 4PD4H 1QLED 1RHZB 2UWJE 3CCQP 5AVRB 3FX0A 1KYOI 3SWKA 2V7QH 2QA4P 1HUCA 2KS1A 1GW3A 2FYUJ 3V4WA 4IFDK 2IPPA 3GHGA 3I5CA 2HFED 3L74E 5AW8B 1G1IA 3H32A 2Q7CA 5AW1B 2YMYA 2ZVNB 4PJ0E 2R5DA 2WTYA 2ZVOB 2QJKC 1N73A 2KSJA 3RL0D 5AW4B 2KZIA 4YTPC 1K73Q 3KZIH 5AVQB 1SQQK 1FZEA 5BU8B 3OJAB 2AEJA 3HD7C 1KB9E 4L75A 1SQXJ 4C46A 2QVAA 2A45I 2AEMA 1VQ5P 3CXHH 1OVUA 1WMKA 1AVYA 1XTCC 2QSIA 4IL6E 4U3FE 1H0TA 5AW5B 3TDKA 4XE5B 1GTWA 3KPEA 1WRGA 2Y0CA 1KC8Q 2CK3H 3TGUE 1LTSC 1IZNB 1VQKP 3QH9A 1NTZE 1M1JB 3G3ZA 2NRGA 1USEA 1SFCD 2GA1A 3V4QA 2FY8A 3WU2H 1SFCA 4EYYQ 1H0TB 1SQBK 1NAYA 4LGDE 3O8ZA 2N9YB 1UIIA 5AVYB 3D70A 1K05A 1LWUB 1YITP 1SVFA 3L74D 4TLFA 1HVVA 1PP9G 1K9MQ 3L74G 2D2CC 5KKZB 3CWBJ 5H2FH 2WVRA 3FGAD 1NTKE 1SQQE 1KMIZ 3BRVB 3AE7C 1PGJA 3MD0A 1HJBA 2NPSD 2HODB 2P67A 1JO5A 2NPSA 3MP7B 4HKZH 1GL2C 1VF5D 1OZHA 1T3UA 3CC2P 4N78E 3SWFA 1KB9D 3V2PA 4H44B 1AFOA 3H1KE 1L0LJ 2KI7B 4A7PA 3A0BE 3JCUH 2CPBA 1EDJA 3IF4A 1LGHB 2C0XA 4DZOA 4U3FD 4U3FG 2E5TA 1KYOE 1FZFA 5EFWB 3CCEP 3N7NA 2HG5D 3T97A 1VQOP 2NPSB 2Y0EA 3TGUD 3TGUG 2E5YA 2Q3IA 1FOSE 5CCGD 4N3YB 5CCGA 5CHXA 1NTZD 1LTAC 3CC4P 3SSUA 1OMIA 4I7ZB 1NTZG 1SQBE 2QRXA 1HGVA 3ZDMA 1OVVA 1RY3A 1JNMA 4H0LD 1H89A 3M9QA 3H1JE 1ZR2A 4EI2A 2IFNA 3L4FA 2FXOA 4U7JA 1ZW0A 1CZQA 1YYCA 5TISE 1KORA 1GU4A 4GT1A 2K1AA 3MIWA 2XNXA 1YI2P 4KT0J 5KLVJ 4IL6X 5KAIH 1NTKD 1SQQD 2C9NY 2YO3A 3GF7A 1NTKG 1SQQG 1M1JC 1NAFA 1QX8A 2NZ2A 2PFXA 3PHLA 1KFNA 3F89A 4H0LB 4AQRD 4N78D 1DIPA 3H1KD 2B88A 1FZBA 3H1KG 1NTMJ 1LWUC 2A06E 4D6TE 2KNCA 2QJYB 1BE3E 5KKZC 3L70E 3M91A 1KYOD 4C7RA 2GUSA 1L4AC 3RBZA 2E42A 4ZNCA 4YXWH 4HH2A 2I1KA 2FFDA 1VQNP 4H44C 1SQBD 5CBNA 2IZ1A 4WWIA 2KSEA 1SQBG 2KNCB 1LP1A 1BCCJ 3H1JD 5DJTB 1Q90D 2YNYA 3Q1MA 3H1JG 5KAFH 4GDOA 1JY2P 2NPSC 3G71P 1PZQA 2A45G 3E7KA 3CX5H 3KYQA 2M8RA 2L5GB 1HTLC 1GW4A 1YBKA 1FDIA 2FFDB 1H8AA 1FAVA 3A7OA 3Q5SA 3QWOC 1RQVA 4L76A 1OX3A 4I7ZC 4AYCA 2SPZA 3VP9A 3B4SA 1MV8A 2LXCB 2WSFJ 1LTGC 3NFQA 3HTKA 3AE1C 1MFZA 1UIXA 4I1LA 3PH0A 3AEEC 1DH3A 4JF7A 1KFMA 1LT1A 2A06D 4D6TD 3H1HE 3AE6C 2A06G 2KP8A 4DJGA 4D6TG 1NJIQ 1BE3D 3AEBC 5CCGC 2Z5HA 3L70D 1BE3G 1GDTA 1AV1A 3L70G 1ZP0C 2WPQA 3II6A 3CCLP 4KJMA 4OVNF 3B8EB 4YPCA 2ZFCA 1VPCA 1Q81Q 1GMJA 4H0LC 3VMXA 1P84D 3HTKB 2AEFA 2YKPA 1JB0J 1IK9A 3L37A 3G6EP 3Q5RA 1PFIA 1EDIA 2QJYC 1IFPA 5BVZA 4DT0A 3AEDC 3AEAC 2M0BA 4UB8H 3JSVC 1K04A 1IC2A 3L75J 3CMEP 2HLOA 2KUBA 1OVRA 2W6JH 1JCDA 4RJTA 4DCKA 1M7LA 1SQPJ 1FC2C 1S72P 5B5EE 2R3SA 3KXDA 3IFMA 1JY2O 3HE5B 1Q2NA 3A2AA 4BWNA 1WT6A 3I56P 4Y99B 3EQ2A 3P8MC 4NPEA 3H1HD 1S4XA 1JY2N 2ZT9D 2G8YA 3H1HG 2FBWC 1M1KQ 1JY3P 2FFDC 3ITKA 1URQD 4BRYA 1URQA 1AQTA 4O9BA 3CL3D 4PD4E 1NU1E 3MUDC 3CCUP 1Q7YQ 3TYYA 3NXSA 2QG4A 2WSFH 3RK3E 2ZT9B 2W90A 3EWKA 3D6ZA 2RKLA 2XV5A 1OWAA 4LC1A 2BASA 2R32A 4I2LC 2W83C 1KQLA 1ZMEC 2RN0A 1T2KD 2JEEA 2C9LY 1NTZK 2PGDA 1L0NJ 4ASVA 1S5LE 2OTKE 2KYVA 1SQVK 1A02J 2QJPB 3PP5A 3LW5H 3BCCJ 1AVOA 1BSNA 2WT7A 2Y9YA 5AVXB 4WVZA 1VQLP 3D6YA 1K8AQ 2FYUK 2OTJP 5BU5A 1NTKK 3M0AA 5GTHH 1M56D 4L73A 2O01H 3GF3A 5K5GB 1QVGO 2YIUB 2KS1B 4PD4D 5L8RJ 1NU1D 2IFMA 3GHGB 1NU1G 1RF0A 2H88C 3FWLA 3H32B 1NH4A 4Y99C 2B9BA 3RK3D 1IFMA 1N73B 2JWAA 1Q82Q 1J1EB 3M0DA 3RL0B 1DD3A 2PRRA 3UIAA 2QIWA 1E5WA 5H2FE 4AUWA 4KHXA 4HJGH 1M90Q 2E76D 4OH8B 2OYHA 4K3AA 1BGYE 3PJSK 2O1JA 3H25A 5CCHD 5AVZB 2XZRA 3L73J 1EZVI 2JKVA 5CCHA 1RF1A 1S1CX 3OAKA 3Q5PA 5AW7B 1FE6A 1SQVE
chains in the Genus database with same CATH topology
2NRGA 2DW3A 2ITAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRG A;  2DW3 A;  2ITA A; 
#chains in the Genus database with same CATH topology
 2ZT9 C;  1JM0 A;  3JCU E;  2M5A A;  2AXT E;  1KB9 H;  3F5H A;  2FXM A;  2FYU E;  1LTT C;  1R5S A;  1P84 I;  2B89 A;  2BEQ D;  2OYH B;  2E76 B;  1NGM B;  1GK4 A;  4IL6 H;  2ZYA A;  1SFC B;  4GIF A;  1LT9 A;  1NWQ A;  3B71 A;  1OW8 A;  2M5A B;  3E1I A;  4W7Z A;  4EDF A;  2QJP C;  3MHV A;  4JQ0 D;  3VN0 A;  2ZXE B;  1SQX E;  3BVH A;  2H7H A;  1U7J A;  3BAT A;  1L0L K;  2H89 C;  5APX A;  1S5L X;  3WUT A;  4GOE A;  1EQ7 A;  3B5N D;  2R3C A;  3OW2 O;  3FXD A;  3B5N A;  1R8E A;  1VF5 B;  1RE4 A;  3CLQ A;  2QE7 H;  3TF5 A;  2YIU C;  3W67 A;  1BGY D;  1FJP A;  2W6A A;  3GHG C;  1BGY G;  1KQF B;  3RGU A;  3M9H A;  1SQV D;  3L72 J;  1SQV G;  2Q3E A;  1N73 C;  1LTI C;  3T97 B;  5APV A;  1J1E C;  2OYO A;  1VQP P;  5E79 E;  1JMM A;  2JWD A;  3RL0 C;  4GOD A;  1T6A A;  5APU A;  1BSH A;  1G1J A;  5GTI E;  1YJW P;  3AEC C;  3A0B H;  4WY4 D;  3Q2Y A;  2FYU D;  2RH0 A;  4WY4 A;  2FYU G;  1VL2 A;  1IK7 A;  4DOJ A;  4NPF X;  3CWB E;  1RF0 C;  2E74 D;  3D71 A;  1BDD A;  1KYO H;  4HB1 A;  5KLV K;  1X22 A;  1OW6 A;  2OYI A;  1AA0 A;  1EXI A;  3TNU A;  3R2P A;  3M0D C;  2XDJ A;  5APW A;  3H1I J;  2Y0D A;  1A02 F;  1EZV E;  2FYN B;  5KAF E;  1YTZ T;  1L0L E;  2P1J A;  1SQX D;  3EFF K;  4WY4 B;  3H1L J;  1GK6 A;  1SQX G;  2LR2 A;  3L71 J;  5AW6 B;  2OYH C;  2E76 C;  4H13 D;  3CX5 E;  5AW9 B;  3V2N A;  1NTM K;  1RH5 B;  2E74 B;  1HBW A;  1SFC C;  3AE2 C;  5CCH C;  2OYI B;  4GOF A;  2A45 H;  2O1K A;  3TNU B;  1P84 E;  3G9R A;  4QMA A;  3ABV C;  2LXB A;  1MZ9 A;  3BRT B;  3P7K A;  3KDP B;  2J59 M;  1KIL E;  3GLM A;  1IFN A;  2VRS A;  4JYB A;  1X79 B;  3VMA A;  4H13 B;  3CCM P;  2BCC J;  2JDI H;  3WMM 0;  1VF5 C;  2WMM A;  4PD4 I;  1Q86 Q;  1FZC A;  1VDF A;  1G2C A;  1FZA A;  3P32 A;  5KLV E;  3CWB D;  1VQ9 P;  2ZXX A;  1AQ5 A;  1LP1 B;  3CWB G;  1FDM A;  3CCS P;  3LID A;  1ZOY C;  1XTG B;  2IX7 C;  1N7S D;  1EZV D;  1N7S A;  1KN7 A;  2OAR A;  4Y28 J;  1L0L D;  1N8R Q;  1EZV G;  1NTM E;  1L0L G;  2IYO A;  3K5B A;  5AVS B;  2JO1 A;  1G2C B;  4UB8 E;  3CX5 D;  2IYP A;  3WUU A;  2WIT A;  1YQ3 C;  3HUS A;  1KD1 Q;  3VMY A;  1CW5 A;  3S9O A;  4YXD C;  1JUN A;  3CXH I;  4C7N A;  1R5L A;  1W2B O;  2H8P D;  1N7S B;  3LW5 J;  1GD2 E;  1NU1 K;  1J2J B;  1X0T A;  2FYN C;  1HJ0 A;  1KIL D;  4WY4 C;  1KIL A;  1OXZ A;  1BCC E;  4JYC A;  3HUS B;  1L2P A;  2E74 C;  1OFC X;  1PGQ A;  3HRN A;  2O01 J;  2OYI C;  2I8D A;  4JPZ B;  4UB6 E;  1IFJ A;  5KLV D;  1Y47 A;  1J1D B;  5KLV G;  2W27 A;  2IBZ I;  2C0W A;  2JR8 A;  5APT A;  3VTP C;  1KIL B;  4JBZ A;  2H43 A;  3A0H E;  1BDC A;  1JTH A;  3C8V A;  2FXP A;  1VQ7 P;  4H13 C;  5AW3 B;  5B66 E;  2YXR B;  2HPC A;  1LTB C;  1NTM D;  1PP9 J;  3L74 J;  1NTM G;  1PV3 A;  1N86 A;  2RMZ A;  3AE8 C;  1TU3 F;  1FS0 E;  3BAS A;  3E1R A;  4ASW A;  5DJU B;  2K9J A;  2W8Z A;  2IDB A;  4I6M C;  2P7J A;  1PL5 A;  1S2E A;  4ZMD A;  2LKM A;  3V5B A;  1OW7 A;  2WSE J;  4K35 A;  1VQ4 P;  2I1J A;  5B5E H;  1HF9 A;  1BCC D;  4U3F J;  3PTZ A;  1BCC G;  4BRY B;  1URQ B;  2N9B A;  2K9Y A;  1VQM P;  3H6P A;  1PIX A;  3KZI E;  3TGU J;  4IOI H;  1AJY A;  3PRJ A;  2E43 A;  3L75 E;  3S1K A;  3O6Q A;  2YKO A;  1NTZ J;  1N7S C;  1MUU A;  1N2D C;  1Y9B A;  1Y8A A;  1SQP E;  3GG2 A;  3MTU E;  2FYZ A;  3CXH E;  2POH A;  3VOP A;  2KIK A;  1RQU A;  3VYI A;  3L35 A;  2WPV B;  1U57 A;  3U59 A;  3HUS C;  1L0N K;  3R4Y A;  2Y9Z A;  2KK7 A;  3WUV A;  2WWW A;  2ITA A;  5CJ0 A;  1RE3 A;  1M8O B;  2E75 D;  1YJ9 P;  3U1C A;  3L36 A;  1ZN5 A;  3O6Q B;  1PP9 E;  1NTK J;  1SQQ J;  1J1D C;  2WSC H;  1JEK A;  1LJ2 A;  1KIL C;  2WSS H;  3WU2 E;  1EDL A;  3SFE C;  2Q6Q A;  3I55 P;  2IBZ E;  3H1K J;  2WT7 B;  2ZYD A;  1JY3 O;  1JMB A;  3S4R A;  4XA4 A;  3KHU A;  5KLI B;  4HYT B;  1SQX K;  1M1J A;  1QEX A;  2E75 B;  2M3B A;  1W2E A;  1EDK A;  1DX7 A;  4MN4 C;  1JY3 N;  1S5L H;  3TSI A;  3CPW O;  1YQ4 C;  3LIE A;  5CMZ A;  4XFJ A;  1ZRT E;  3RL0 g;  2P58 A;  3AE3 C;  3A3Y B;  2ZYG A;  4PJ0 H;  3L75 D;  1LWU A;  3L75 G;  4ZKP A;  1SQB J;  3RK3 B;  1SQP D;  3CXH D;  1SQP G;  2R5B A;  3CX5 I;  4M3L A;  1L0N E;  3H1J J;  2V4H A;  1DEB A;  1KTM A;  4PV1 D;  2HOD A;  1L4A D;  1URQ C;  4W7Y A;  1L4A A;  2WSE H;  2L91 A;  4IFF A;  3BCC E;  1QL1 A;  1S3J A;  4H44 D;  1PP9 D;  1RF1 B;  4CPG A;  1KV4 A;  1GZL A;  1Z56 A;  4BXL A;  3PLN A;  3FXE A;  1YHQ P;  3OA7 A;  2P2U A;  3G4S P;  2N1T D;  4PV1 B;  2N1T A;  1GU5 A;  1L4A B;  2IBZ D;  1LTJ A;  1NKZ B;  2IBZ G;  1NYH A;  4OGQ D;  3V2Q A;  3FWN A;  4D6T J;  2R44 A;  3IR9 A;  1BE3 J;  3V6I A;  5KAI E;  1T2K C;  3L70 J;  1LT9 B;  3M9B A;  2AXT H;  2AXC A;  1ZRT D;  2FKW B;  2XND H;  4RES B;  1DEE G;  1OIP A;  2N1T B;  2Z4E A;  2OGU A;  1SLQ A;  1LTJ B;  5AW0 B;  1U7M A;  1YJN P;  4WBA A;  4Z1M H;  3C9I A;  3L73 E;  1RE3 C;  4OGQ B;  3SFD C;  3CI9 A;  3IN6 A;  1L0N D;  3EFG A;  2QM7 A;  5KLI C;  2E75 C;  2KLV A;  2PP6 A;  1L0N G;  3B5N B;  3CCJ P;  5AW2 B;  1FU1 A;  1LNQ A;  2YO2 A;  3BCC D;  3BCC G;  1ZXG A;  3TK1 A;  1ZR4 A;  2M3E A;  2J58 A;  1N7L A;  1S9K E;  1IFI A;  1VQ8 P;  3RK3 C;  2KZJ A;  2OQQ A;  3N4X A;  5KJ7 D;  5CJ4 A;  5KJ7 A;  2Z5I A;  4R4M A;  1QVF O;  3MZW B;  3JC2 2;  3H1H J;  3MGN A;  3A5T A;  5APY A;  1NOH A;  3VMZ A;  5CBO A;  2J5U A;  3CMA P;  1RF1 C;  3AE4 C;  5E79 H;  5TIS H;  1KQS O;  5GTI H;  3VP8 A;  2P10 A;  2WPS A;  1PGO A;  1X8Y A;  4PV1 C;  3AEG C;  3M06 A;  4L74 A;  2HYN A;  5AVU B;  3RK2 D;  3L73 D;  5AVW B;  2Q1K A;  3L73 G;  2O3J A;  1PGP A;  4IFM A;  3L72 E;  1NHL A;  4B86 A;  2O01 N;  2HR3 A;  2GUV A;  1LT9 C;  4LLH A;  3GW6 A;  2CPS A;  3U1A A;  3RBX A;  2QEX P;  5KTB A;  1FOS F;  3MUD A;  1SS1 A;  2N1T C;  1LTJ C;  1MKM A;  1CSB A;  1S9K D;  2YMK A;  3Q3D A;  4W80 A;  3CCV P;  3RK2 B;  2B87 A;  4OGQ C;  1KQG B;  2OTL P;  4OWF A;  1FDO A;  1P84 H;  3B5N C;  1PPJ E;  1M57 D;  2BEZ F;  1RE4 C;  4R4L A;  3H1I E;  2JJL A;  1FZC B;  2K3R A;  4N6J A;  1VQ6 P;  2WZ7 A;  1D7M A;  3V2R A;  4EOT A;  2YKQ A;  3AEF C;  3H1L E;  3L71 E;  3USS A;  2DW3 A;  5M1B A;  2PAJ A;  3KQG A;  4RKU J;  4RO0 A;  4TT3 H;  2XKM A;  2B87 B;  3W68 A;  1SP4 A;  2YXQ B;  1IFD A;  1JOC A;  3CC7 P;  1JCC A;  1ZV8 A;  2K88 A;  1NU1 J;  2WQY C;  2WPR A;  2IZ0 A;  1DD4 A;  2V7Q J;  1YIJ P;  3L72 D;  2ZJS E;  3NTN A;  3L72 G;  3HD7 D;  4WB4 A;  4C7N B;  2BCC E;  3HD7 A;  3HE4 A;  2WSC J;  3HE5 A;  1X9V A;  2ZAE B;  5KJ7 C;  3IAO A;  1QL2 A;  2KOG A;  3AE9 C;  2QJK B;  1IJD B;  1KB9 I;  1W5C E;  1CI6 A;  3GMA A;  3CD6 P;  3P8C E;  1SQP K;  3AE5 C;  3SWY A;  2KB7 P;  4ZKU A;  1PPJ D;  3H1I D;  3HD7 B;  5APQ A;  1PPJ G;  3HE4 B;  1MFT A;  1NKN A;  3H1I G;  1KZU B;  4NPD A;  3H1L D;  3L71 D;  4EIJ A;  1HH0 A;  1T3J A;  2KXP B;  3H1L G;  3L71 G;  1CI6 B;  1HGZ A;  1JTH B;  3RK2 C;  2G3A A;  2MKV A;  2JP3 A;  2W6B A;  2D2C D;  5C39 A;  4UB6 H;  2HPC B;  1FJK A;  1FZG A;  1FZC C;  2Q5U A;  1NVO A;  1HWT C;  1IO4 A;  1QGK B;  1GL2 D;  1NO4 A;  3A0H H;  2XU6 A;  1GL2 A;  2K9J B;  2MJZ A;  1YTZ I;  2BCC D;  5B66 H;  5GTH E;  1FBM A;  2K37 A;  2BCC G;  1EXJ A;  2QM8 A;  4GKG A;  1ZLL A;  5TJH A;  1USD A;  2D2C B;  1T8Z A;  3C1L A;  1BGY J;  1EC5 A;  5AVV B;  2GM4 A;  5AVT B;  2Q9I A;  2KLU A;  1H88 A;  3NMD A;  3P8C D;  1E79 H;  1SQV J;  5APS A;  3CCR P;  1GL2 B;  4PD4 H;  1QLE D;  1RHZ B;  2UWJ E;  3CCQ P;  5AVR B;  3FX0 A;  1KYO I;  3SWK A;  2V7Q H;  2QA4 P;  1HUC A;  2KS1 A;  1GW3 A;  2FYU J;  3V4W A;  4IFD K;  2IPP A;  3GHG A;  3I5C A;  2HFE D;  3L74 E;  5AW8 B;  1G1I A;  3H32 A;  2Q7C A;  5AW1 B;  2YMY A;  2ZVN B;  4PJ0 E;  2R5D A;  2WTY A;  2ZVO B;  2QJK C;  1N73 A;  2KSJ A;  3RL0 D;  5AW4 B;  2KZI A;  4YTP C;  1K73 Q;  3KZI H;  5AVQ B;  1SQQ K;  1FZE A;  5BU8 B;  3OJA B;  2AEJ A;  3HD7 C;  1KB9 E;  4L75 A;  1SQX J;  4C46 A;  2QVA A;  2A45 I;  2AEM A;  1VQ5 P;  3CXH H;  1OVU A;  1WMK A;  1AVY A;  1XTC C;  2QSI A;  4IL6 E;  4U3F E;  1H0T A;  5AW5 B;  3TDK A;  4XE5 B;  1GTW A;  3KPE A;  1WRG A;  2Y0C A;  1KC8 Q;  2CK3 H;  3TGU E;  1LTS C;  1IZN B;  1VQK P;  3QH9 A;  1NTZ E;  1M1J B;  3G3Z A;  2NRG A;  1USE A;  1SFC D;  2GA1 A;  3V4Q A;  2FY8 A;  3WU2 H;  1SFC A;  4EYY Q;  1H0T B;  1SQB K;  1NAY A;  4LGD E;  3O8Z A;  2N9Y B;  1UII A;  5AVY B;  3D70 A;  1K05 A;  1LWU B;  1YIT P;  1SVF A;  3L74 D;  4TLF A;  1HVV A;  1PP9 G;  1K9M Q;  3L74 G;  2D2C C;  5KKZ B;  3CWB J;  5H2F H;  2WVR A;  3FGA D;  1NTK E;  1SQQ E;  1KMI Z;  3BRV B;  3AE7 C;  1PGJ A;  3MD0 A;  1HJB A;  2NPS D;  2HOD B;  2P67 A;  1JO5 A;  2NPS A;  3MP7 B;  4HKZ H;  1GL2 C;  1VF5 D;  1OZH A;  1T3U A;  3CC2 P;  4N78 E;  3SWF A;  1KB9 D;  3V2P A;  4H44 B;  1AFO A;  3H1K E;  1L0L J;  2KI7 B;  4A7P A;  3A0B E;  3JCU H;  2CPB A;  1EDJ A;  3IF4 A;  1LGH B;  2C0X A;  4DZO A;  4U3F D;  4U3F G;  2E5T A;  1KYO E;  1FZF A;  5EFW B;  3CCE P;  3N7N A;  2HG5 D;  3T97 A;  1VQO P;  2NPS B;  2Y0E A;  3TGU D;  3TGU G;  2E5Y A;  2Q3I A;  1FOS E;  5CCG D;  4N3Y B;  5CCG A;  5CHX A;  1NTZ D;  1LTA C;  3CC4 P;  3SSU A;  1OMI A;  4I7Z B;  1NTZ G;  1SQB E;  2QRX A;  1HGV A;  3ZDM A;  1OVV A;  1RY3 A;  1JNM A;  4H0L D;  1H89 A;  3M9Q A;  3H1J E;  1ZR2 A;  4EI2 A;  2IFN A;  3L4F A;  2FXO A;  4U7J A;  1ZW0 A;  1CZQ A;  1YYC A;  5TIS E;  1KOR A;  1GU4 A;  4GT1 A;  2K1A A;  3MIW A;  2XNX A;  1YI2 P;  4KT0 J;  5KLV J;  4IL6 X;  5KAI H;  1NTK D;  1SQQ D;  2C9N Y;  2YO3 A;  3GF7 A;  1NTK G;  1SQQ G;  1M1J C;  1NAF A;  1QX8 A;  2NZ2 A;  2PFX A;  3PHL A;  1KFN A;  3F89 A;  4H0L B;  4AQR D;  4N78 D;  1DIP A;  3H1K D;  2B88 A;  1FZB A;  3H1K G;  1NTM J;  1LWU C;  2A06 E;  4D6T E;  2KNC A;  2QJY B;  1BE3 E;  5KKZ C;  3L70 E;  3M91 A;  1KYO D;  4C7R A;  2GUS A;  1L4A C;  3RBZ A;  2E42 A;  4ZNC A;  4YXW H;  4HH2 A;  2I1K A;  2FFD A;  1VQN P;  4H44 C;  1SQB D;  5CBN A;  2IZ1 A;  4WWI A;  2KSE A;  1SQB G;  2KNC B;  1LP1 A;  1BCC J;  3H1J D;  5DJT B;  1Q90 D;  2YNY A;  3Q1M A;  3H1J G;  5KAF H;  4GDO A;  1JY2 P;  2NPS C;  3G71 P;  1PZQ A;  2A45 G;  3E7K A;  3CX5 H;  3KYQ A;  2M8R A;  2L5G B;  1HTL C;  1GW4 A;  1YBK A;  1FDI A;  2FFD B;  1H8A A;  1FAV A;  3A7O A;  3Q5S A;  3QWO C;  1RQV A;  4L76 A;  1OX3 A;  4I7Z C;  4AYC A;  2SPZ A;  3VP9 A;  3B4S A;  1MV8 A;  2LXC B;  2WSF J;  1LTG C;  3NFQ A;  3HTK A;  3AE1 C;  1MFZ A;  1UIX A;  4I1L A;  3PH0 A;  3AEE C;  1DH3 A;  4JF7 A;  1KFM A;  1LT1 A;  2A06 D;  4D6T D;  3H1H E;  3AE6 C;  2A06 G;  2KP8 A;  4DJG A;  4D6T G;  1NJI Q;  1BE3 D;  3AEB C;  5CCG C;  2Z5H A;  3L70 D;  1BE3 G;  1GDT A;  1AV1 A;  3L70 G;  1ZP0 C;  2WPQ A;  3II6 A;  3CCL P;  4KJM A;  4OVN F;  3B8E B;  4YPC A;  2ZFC A;  1VPC A;  1Q81 Q;  1GMJ A;  4H0L C;  3VMX A;  1P84 D;  3HTK B;  2AEF A;  2YKP A;  1JB0 J;  1IK9 A;  3L37 A;  3G6E P;  3Q5R A;  1PFI A;  1EDI A;  2QJY C;  1IFP A;  5BVZ A;  4DT0 A;  3AED C;  3AEA C;  2M0B A;  4UB8 H;  3JSV C;  1K04 A;  1IC2 A;  3L75 J;  3CME P;  2HLO A;  2KUB A;  1OVR A;  2W6J H;  1JCD A;  4RJT A;  4DCK A;  1M7L A;  1SQP J;  1FC2 C;  1S72 P;  5B5E E;  2R3S A;  3KXD A;  3IFM A;  1JY2 O;  3HE5 B;  1Q2N A;  3A2A A;  4BWN A;  1WT6 A;  3I56 P;  4Y99 B;  3EQ2 A;  3P8M C;  4NPE A;  3H1H D;  1S4X A;  1JY2 N;  2ZT9 D;  2G8Y A;  3H1H G;  2FBW C;  1M1K Q;  1JY3 P;  2FFD C;  3ITK A;  1URQ D;  4BRY A;  1URQ A;  1AQT A;  4O9B A;  3CL3 D;  4PD4 E;  1NU1 E;  3MUD C;  3CCU P;  1Q7Y Q;  3TYY A;  3NXS A;  2QG4 A;  2WSF H;  3RK3 E;  2ZT9 B;  2W90 A;  3EWK A;  3D6Z A;  2RKL A;  2XV5 A;  1OWA A;  4LC1 A;  2BAS A;  2R32 A;  4I2L C;  2W83 C;  1KQL A;  1ZME C;  2RN0 A;  1T2K D;  2JEE A;  2C9L Y;  1NTZ K;  2PGD A;  1L0N J;  4ASV A;  1S5L E;  2OTK E;  2KYV A;  1SQV K;  1A02 J;  2QJP B;  3PP5 A;  3LW5 H;  3BCC J;  1AVO A;  1BSN A;  2WT7 A;  2Y9Y A;  5AVX B;  4WVZ A;  1VQL P;  3D6Y A;  1K8A Q;  2FYU K;  2OTJ P;  5BU5 A;  1NTK K;  3M0A A;  5GTH H;  1M56 D;  4L73 A;  2O01 H;  3GF3 A;  5K5G B;  1QVG O;  2YIU B;  2KS1 B;  4PD4 D;  5L8R J;  1NU1 D;  2IFM A;  3GHG B;  1NU1 G;  1RF0 A;  2H88 C;  3FWL A;  3H32 B;  1NH4 A;  4Y99 C;  2B9B A;  3RK3 D;  1IFM A;  1N73 B;  2JWA A;  1Q82 Q;  1J1E B;  3M0D A;  3RL0 B;  1DD3 A;  2PRR A;  3UIA A;  2QIW A;  1E5W A;  5H2F E;  4AUW A;  4KHX A;  4HJG H;  1M90 Q;  2E76 D;  4OH8 B;  2OYH A;  4K3A A;  1BGY E;  3PJS K;  2O1J A;  3H25 A;  5CCH D;  5AVZ B;  2XZR A;  3L73 J;  1EZV I;  2JKV A;  5CCH A;  1RF1 A;  1S1C X;  3OAK A;  3Q5P A;  5AW7 B;  1FE6 A;  1SQV E; 
#chains in the Genus database with same CATH homology
 2NRG A;  2DW3 A;  2ITA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...