2NRGA

Solution structure of pufx from rhodobacter sphaeroides (minimised average)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALETGIELIKHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis,membrane protein
molecule keywords Intrinsic membrane protein pufX
publication title The solution structure of the PufX polypeptide from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11511 RhodobacterPufX Intrinsic membrane protein PufX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.920 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces rhodobacter sphaeroides pufx membrane protein 2nrgA01
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH superfamily
2LXBA 4B86A 1YQ4C 1LTJC 4H13B 1SQVG 2PGDA 3H1HJ 3L74E 2CPSA 1KB9D 3H1IJ 2IX7C 1EC5A 1HJ0A 1SQXE 3A0HE 1BDDA 3ITKA 1K9MQ 1VDFA 1JTHB 3RL0C 1N7LA 4HJGH 5B66E 3IN6A 3L73G 1RE4C 3BRTB 2M3BA 1N7SD 3CXHI 1JY3N 1NO4A 3EWKA 4LC1A 3SSUA 2Y0CA 2Z4EA 1SQPJ 4IL6X 3P8MC 3MP7B 1WT6A 2M5AA 4I7ZB 2ITAA 1A02F 3KZIH 3CCUP 2HR3A 2V7QH 1HH0A 5H2FE 2AXCA 2P67A 4H0LC 3CCLP 4JQ0D 3EFFK 1GW4A 3CCJP 4GOEA 2E5YA 4AQRD 4D6TJ 4C46A 3AEEC 4NPDA 3O6QB 2BCCJ 2VRSA 3WUVA 1T2KC 1IFJA 4HH2A 2W8ZA 4JPZB 5APYA 2QRXA 1LTIC 3L37A 1L0NE 1IK9A 1VQ7P 1URQC 1L0LJ 2NPSD 3H1HD 3TF5A 3R4YA 2KLUA 3Q1MA 4PV1B 2G3AA 4OVNF 1G1IA 4GOFA 2E74B 1GL2B 1VQOP 1JB0J 2FFDB 1W2EA 3MD0A 1ZR4A 1N8RQ 1QLED 1OXZA 1J1DC 1S72P 1IFMA 4GT1A 3G6EP 1GDTA 3H1LE 1VF5D 4C7NA 3M0DC 3B5ND 3CXHE 5KLIC 2QG4A 3VTPC 4IL6H 1NTKJ 1HGVA 2N1TC 2N9YB 3MIWA 4DCKA 3V5BA 1RE4A 2NRGA 2GM4A 4IFMA 1Y47A 3N4XA 1YHQP 1BE3E 1E5WA 3G4SP 3CMEP 4I6MC 5APSA 1BSNA 1H89A 2P7JA 3U1CA 2B87A 1EDLA 1FZFA 4H44C 2B88A 1TU3F 4NPFX 3KHUA 4MN4C 4D6TD 1Q86Q 4W80A 2K88A 1NJIQ 5APTA 3TNUA 1Q81Q 3WU2E 2WPVB 1NU1K 1VQMP 1FZAA 1L0LD 1HBWA 3H1IG 5KLVJ 1RF0C 5CCHD 4HYTB 3M0AA 1K8AQ 2H7HA 1EXIA 1FZEA 2P10A 1JMMA 3BCCE 4U3FJ 1QVFO 2HPCA 2FYUE 3H1KJ 3LIDA 5CHXA 3N7NA 4N78E 2J5UA 1SQPG 1RF1B 3H25A 2QM8A 5AW5B 2XZRA 1YI2P 1NGMB 3TGUE 2FXOA 1LTGC 1GL2D 3M0DA 1HJBA 2OYOA 3L71D 4I1LA 3CX5H 3RL0D 3CWBJ 4R4MA 1G2CB 1Z56A 2N1TA 2QJYC 1R5LA 3O8ZA 1JM0A 2I8DA 3C9IA 2BCCG 4QMAA 3G3ZA 1PPJE 2KSJA 2YIUC 5KTBA 2ZYDA 2D2CC 1S5LE 2PRRA 1PGJA 3RK2C 4UB6E 5KJ7C 2CK3H 1S1CX 3L74J 4WWIA 3A0BE 2A06G 1Q82Q 2KS1A 3KPEA 1YITP 1XTCC 1AFOA 1SQQJ 2O1JA 3IAOA 1SQVJ 3L70D 1HTLC 5E79E 1S2EA 2A45H 1L4AD 2UWJE 3VP8A 3NXSA 1RF0A 1SFCC 3H1KD 1T2KD 3H32A 1G1JA 5DJUB 1N73C 1SQXK 2WT7A 2KB7P 1PP9D 1CZQA 2H88C 1NTKG 2MJZA 4YXDC 1KFNA 3JCUE 2WSEJ 3L73J 1P84H 2K9YA 3H1JJ 1CI6B 2WTYA 2WWWA 3LIEA 4YXWH 1RE3C 3SFEC 1OVRA 4L73A 3NMDA 2ZT9B 1X79B 3HD7B 3CWBD 5CJ0A 3MZWB 1FZCC 2E76D 1BGYD 3L72E 1DX7A 1KD1Q 2QJKC 2SPZA 1NU1G 2O3JA 3HTKB 3CC7P 1LTBC 1YBKA 3QH9A 3PRJA 1VQ9P 5CCGC 4ASWA 1DD3A 2ZYAA 2A45G 2YNYA 1YQ3C 4R4LA 4RKUJ 3L71E 3R2PA 2OYIC 1MFTA 5KLVG 3F5HA 2KLVA 5APUA 1JY2O 1EDJA 1N7SB 2ZVOB 1OZHA 1BCCD 2GUSA 1H0TA 5B5EE 4YPCA 1NTME 3L75G 3GHGC 1L0NK 1SQVD 1XTGB 2OYHC 4U3FG 5AVSB 1FDOA 3BVHA 4K35A 4DJGA 3AE6C 4XA4A 3AEAC 1SQBE 4N6JA 4H13C 1USEA 3FWNA 1HGZA 2I1KA 2OTJP 4EYYQ 4WY4A 2ZXEB 4XE5B 5AVTB 1EZVI 2Q9IA 1VPCA 3L73D 2V7QJ 3L70E 4I2LC 3HUSC 1SFCA 3V2QA 4ZMDA 1N73A 2FY8A 2QIWA 2W90A 3OAKA 5C39A 1M1JC 2BEQD 2KXPB 3I56P 3BRVB 4JBZA 3AEDC 4HKZH 1VQKP 3HE5A 3ABVC 3TSIA 3V4WA 2WSEH 4GODA 2IBZG 2JO1A 5GTIE 2KOGA 3V2NA 2ZFCA 1NTZE 2XNXA 1MFZA 2L5GB 3VYIA 4I7ZC 1FZCA 3WMM0 2B89A 1H8AA 3KYQA 1NYHA 3P32A 1BGYE 2R3SA 3L74G 3T97A 2AEJA 3HE4B 4OGQD 1GK4A 4JF7A 5CCGA 2YKQA 1VF5B 1SQQG 3B5NB 1SQXG 1WRGA 4N3YB 1DH3A 1Q7YQ 2C9LY 3E7KA 2E75D 1S9KD 2M8RA 1Y9BA 1M7LA 4W7ZA 3D6YA 2KSEA 2LXCB 2M3EA 3BASA 1EDIA 1QX8A 2IYOA 2WQYC 1KORA 2CPBA 1ZR2A 1OVUA 2JJLA 3GHGA 2OYHA 2M5AB 1KB9I 4PV1C 1X8YA 3H1JG 2FYUK 2KZIA 4JYBA 3V2RA 2Y0EA 2MKVA 2E74C 2KK7A 1EZVE 3G71P 3RBZA 4WY4D 1KILD 3TGUJ 1KTMA 5GTHE 1HVVA 2W6JH 1RHZB 1MZ9A 3AE1C 2B9BA 2ZYGA 1YJ9P 3HUSA 1ZV8A 2POHA 3U1AA 3WUUA 1M1JA 1IK7A 1PV3A 2K1AA 2FXMA 1KZUB 2H8PD 2E42A 3QWOC 4ZKPA 1OWAA 2Q1KA 5KAFH 2R32A 1AQTA 4Z1MH 1BSHA 1T8ZA 1Q2NA 3H1ID 3CD6P 5CCGD 5AVUB 3Q3DA 2O1KA 4C7NB 1YJNP 1GU5A 4IFFA 1NAFA 1FS0E 3CLQA 3H1LG 1ZW0A 1LTJA 2IPPA 2IFMA 1MKMA 3RL0B 2JWDA 1DD4A 1JCDA 1A02J 1LP1A 3O6QA 1PGPA 1LT9C 1S9KE 2R44A 1KB9E 2ZJSE 1VQ8P 1ZXGA 1BE3G 3K5BA 2RH0A 1SQPD 3M9HA 1LWUB 1CSBA 2V4HA 3LW5J 3RK3D 2GUVA 5AVWB 2ZAEB 2LKMA 2KZJA 4M3LA 5AW8B 4DOJA 4BXLA 1UIIA 1GW3A 2HYNA 3VMYA 1X9VA 3VOPA 2FYNC 5AW9B 3OW2O 3VMAA 1JEKA 4AYCA 1NU1J 1YJWP 1FC2C 3D70A 1L4AB 1JY3P 3CMAP 3Q2YA 2BCCD 3L36A 2WITA 2HFED 2XDJA 3FGAD 3TK1A 4O9BA 3Q5PA 2QJPB 2G8YA 4Y99B 2HPCB 3PJSK 3BCCG 1KQSO 4RESB 3MGNA 1K04A 2AXTH 2QVAA 2H89C 2A06D 2FYUG 1HWTC 3G9RA 3L75J 1NTMK 1URQA 4UB6H 2J58A 2P1JA 1FJKA 2E76B 3A0BH 3CX5D 3CC4P 4PD4H 1SQBK 3H1HE 3PTZA 2K37A 4L76A 1W2BO 1JMBA 3IR9A 3H1IE 1FOSE 3TGUG 3UIAA 1MUUA 2JEEA 2Y0DA 5KAIE 4IL6E 3A7OA 1NTKD 5BU5A 1VQ5P 1OMIA 1PGOA 1NVOA 3MUDC 2W83C 2WVRA 1LT9A 1IC2A 2IZ0A 2PAJA 5EFWB 1GD2E 1FZGA 1USDA 1K05A 2JDIH 1PPJG 4NPEA 2QM7A 1ZRTD 2HODA 4K3AA 2ZVNB 1SQPE 1GZLA 1NU1D 2RMZA 1M8OB 2KS1B 3I55P 2ZT9C 3LW5H 3RK3E 1CW5A 1VL2A 2KUBA 3FWLA 1NTZK 4HB1A 2QE7H 1KMIZ 4BRYB 2Q3IA 3L4FA 3FX0A 5KLVD 4ZNCA 5APWA 3OA7A 1G2CA 4H0LD 2W27A 1SQXJ 4D6TE 3PH0A 4GKGA 2P58A 2BCCE 3L75D 5AVZB 1P84D 1K73Q 4U3FD 4IFDK 3GG2A 1N7SC 3SWYA 1E79H 4IOIH 5B5EH 1L0LE 5TISH 4DT0A 5KKZC 3H6PA 2KI7B 1URQD 5AW6B 1OX3A 3E1IA 1NAYA 3A2AA 1KYOD 3L72G 2JKVA 2YMYA 1SQVK 1KQLA 2YKPA 4JYCA 5AW2B 5AW7B 1S4XA 3W67A 2WSSH 2K9JA 1IFNA 4OGQB 3VMZA 3V4QA 5L8RJ 2YO3A 2JR8A 1GTWA 2E75B 2C0WA 4RO0A 1LTSC 4L75A 1NTKE 4WBAA 2WPRA 3MUDA 2KNCA 1KYOH 2O01H 2OGUA 2IBZD 2N1TD 2FKWB 3OJAB 2OTLP 1JY2N 2NZ2A 1ZMEC 2YIUB 1NTMG 2NPSC 2PFXA 2D2CB 1L0NJ 1CI6A 3AEGC 5CBOA 3RK2B 1WMKA 2FYZA 1LGHB 3L74D 1SQBG 4H44D 1SQQD 4WY4B 1NKNA 1KILB 1SQXD 2QSIA 3AE4C 1L2PA 3SWKA 3RL0g 4WVZA 1J1EB 4CPGA 5KJ7A 1SFCB 1VF5C 3B5NC 4UB8E 1X22A 3H1LJ 5KLVE 1IFDA 2XV5A 1EXJA 2E5TA 3IF4A 3A0HH 4GIFA 3H1JD 2YXRB 4U3FE 2YO2A 1NKZB 1VQ6P 5B66H 3H1KE 1BE3J 2BASA 2OARA 5AW1B 3NTNA 1NTZG 1PP9E 1FOSF 3FXDA 3M91A 1FJPA 1GK6A 4BWNA 3T97B 3GF7A 2WSFJ 3CPWO 5GTHH 1AV1A 1RE3A 2IDBA 5AVRB 5M1BA 2FXPA 3M06A 3CWBE 5CCHC 3B8EB 5H2FH 3M9BA 1IFIA 1U7MA 1IZNB 4L74A 2OTKE 3D71A 3CCVP 3KXDA 3SFDC 3JSVC 2NPSA 2OYIA 3BCCJ 1R5SA 3RK3B 2QEXP 1PFIA 4EDFA 2E43A 2FYUJ 1OIPA 4PJ0E 2WZ7A 3S9OA 3H1LD 1M90Q 1Y8AA 1JUNA 1EZVG 2D2CD 3GMAA 1BCCE 3AE2C 3RK2D 1JY2P 3CXHD 3PLNA 1YTZT 5KJ7D 1JCCA 1SQQE 2FBWC 1VQPP 1SQVE 3HE4A 1M56D 3HUSB 1ZP0C 1GL2C 3B5NA 2FFDC 3KDPB 1M1JB 1BE3D 2M0BA 2IZ1A 1T3UA 2Y9YA 1SFCD 1OW6A 3GW6A 1KB9H 3CXHH 1JY3O 2XKMA 1GU4A 1SP4A 3PP5A 3L73E 3TYYA 2N9BA 3AECC 1JTHA 1LWUC 2Q6QA 3H1JE 1LNQA 1EQ7A 2WPSA 1PGQA 1ZLLA 1L0NG 3CCQP 3VN0A 4C7RA 2K3RA 1SQPK 1VQLP 1OVVA 1NHLA 1AJYA 4XFJA 3B71A 1LTJB 2QA4P 2WSFH 2HLOA 3L35A 3SWFA 2LR2A 2AEFA 3F89A 1ZOYC 1L4AC 1LP1B 1PZQA 1GMJA 3BCCD 5CCHA 1SLQA 5BU8B 3WU2H 1VQ4P 2FYUD 1AA0A 1U7JA 1S5LX 2QJPC 2Z5HA 3AEFC 4Y99C 2ZXXA 3S4RA 4N78D 1KQGB 1LT1A 5AW4B 3MTUE 1M57D 3USSA 3CL3D 3TDKA 1J2JB 4KT0J 3M9QA 1L0LK 2KP8A 3TGUD 3RGUA 1MV8A 2B87B 1OW8A 2E76C 2R3CA 1JOCA 4TLFA 3L72J 3P7KA 1N86A 4H13D 3VMXA 3KZIE 1RF1C 5KAIH 1GL2A 4EI2A 3TNUB 3AEBC 1AVYA 2FFDA 1HF9A 4KJMA 2RN0A 4H0LB 2R5DA 3CI9A 1PPJD 1UIXA 1RQUA 1KILE 1D7MA 1YYCA 1RH5B 3V6IA 2Z5IA 3CCEP 4OWFA 4EOTA 1ZN5A 3L71J 1NTKK 1FDIA 1EDKA 3P8CD 2C0XA 1FE6A 1IO4A 5KAFE 5CJ4A 1LWUA 3C1LA 1URQB 4PD4D 1NTMJ 1JNMA 1HUCA 2H43A 1BDCA 1FDMA 1OFCX 1SQBJ 3H1HG 1U57A 3CCSP 3AE3C 1IFPA 5APQA 1S5LH 4W7YA 4PD4I 2YXQB 1J1DB 5AVYB 1L4AA 1LT9B 3D6ZA 4ZKUA 1PL5A 3L70J 4Y28J 1DEEG 5E79H 5KLIB 5KLVK 1KV4A 2Q7CA 2N1TB 3BATA 2O01J 1OW7A 4A7PA 2HODB 3CX5I 1KC8Q 3I5CA 3L72D 1PP9J 2WMMA 1R8EA 1FU1A 5AVXB 3JCUH 3B4SA 3EFGA 2O01N 5CMZA 1W5CE 1FZBA 4PV1D 5BVZA 2IYPA 2FYNB 4H44B 1NTZJ 2OQQA 2E74D 2J59M 1H88A 3MHVA 5TJHA 2AEMA 5AVQB 2BEZF 3HD7C 4OGQC 3V2PA 1RF1A 1BGYJ 5CBNA 3WUTA 2Q5UA 2KIKA 2E75C 1S3JA 1VQNP 2GA1A 4D6TG 1NTMD 2WSCJ 3H32B 4YTPC 2AXTE 2WT7B 1NH4A 3Q5RA 5AW3B 2A45I 1SQBD 1L0LG 4TT3H 1LTTC 3C8VA 4OH8B 3P8CE 1QGKB 1T6AA 1QL2A 1QEXA 1BCCJ 1YIJP 3GF3A 4PD4E 3W68A 1RQVA 1NWQA 5APXA 2K9JB 3CCMP 4WY4C 1KILC 2JWAA 2KYVA 1P84I 2A06E 2IFNA 4BRYA 1J1EC 1NOHA 1AQ5A 1KFMA 3IFMA 1SQQK 1DEBA 2I1JA 4UB8H 2KNCB 3KQGA 4AUWA 2YKOA 3CX5E 4ASVA 3Q5SA 1JO5A 2QJYB 1KYOI 1NTZD 2Y9ZA 3AE9C 2Q3EA 3L71G 3AE7C 1H0TB 3ZDMA 3CC2P 1N2DC 1YTZI 4LLHA 2PP6A 2P2UA 5APVA 1M1KQ 5GTIH 2L91A 1IJDB 1RY3A 1ZRTE 2IBZI 3HD7A 1SVFA 1NU1E 2W6AA 4LGDE 2XU6A 1T3JA 2DW3A 3HTKA 2RKLA 3GLMA 5DJTB 3A3YB 2YMKA 3AE8C 4U7JA 3L70G 2JP3A 1N73B 1AVOA 3II6A 5KKZB 5TISE 3NFQA 2WSCH 2W6BA 2C9NY 3JC22 1FBMA 1EZVD 4EIJA 3H1KG 3RK3C 3VP9A 1N7SA 3L75E 5AW0B 1LTAC 3AE5C 1PP9G 1P84E 4PJ0H 3HE5B 1LJ2A 1DIPA 3RBXA 2HG5D 1KQFB 3FXEA 1KILA 4KHXA 5K5GB 1FZCB 1FAVA 2QJKB 3U59A 5AVVB 4GDOA 1QVGO 3CCRP 3CWBG 1KYOE 1BGYG 1X0TA 1KN7A 4DZOA 2NPSB 2OYIB 1SS1A 1L0ND 3HRNA 3PHLA 3EQ2A 1PIXA 1Q90D 2R5BA 3GHGB 3A5TA 2WPQA 3E1RA 2OYHB 1QL1A 2IBZE 4WB4A 4RJTA 1BCCG 2XNDH 2ZT9D 3HD7D 3S1KA
chains in the Genus database with same CATH topology
2ITAA 2NRGA 2DW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITA A;  2NRG A;  2DW3 A; 
#chains in the Genus database with same CATH topology
 2LXB A;  4B86 A;  1YQ4 C;  1LTJ C;  4H13 B;  1SQV G;  2PGD A;  3H1H J;  3L74 E;  2CPS A;  1KB9 D;  3H1I J;  2IX7 C;  1EC5 A;  1HJ0 A;  1SQX E;  3A0H E;  1BDD A;  3ITK A;  1K9M Q;  1VDF A;  1JTH B;  3RL0 C;  1N7L A;  4HJG H;  5B66 E;  3IN6 A;  3L73 G;  1RE4 C;  3BRT B;  2M3B A;  1N7S D;  3CXH I;  1JY3 N;  1NO4 A;  3EWK A;  4LC1 A;  3SSU A;  2Y0C A;  2Z4E A;  1SQP J;  4IL6 X;  3P8M C;  3MP7 B;  1WT6 A;  2M5A A;  4I7Z B;  2ITA A;  1A02 F;  3KZI H;  3CCU P;  2HR3 A;  2V7Q H;  1HH0 A;  5H2F E;  2AXC A;  2P67 A;  4H0L C;  3CCL P;  4JQ0 D;  3EFF K;  1GW4 A;  3CCJ P;  4GOE A;  2E5Y A;  4AQR D;  4D6T J;  4C46 A;  3AEE C;  4NPD A;  3O6Q B;  2BCC J;  2VRS A;  3WUV A;  1T2K C;  1IFJ A;  4HH2 A;  2W8Z A;  4JPZ B;  5APY A;  2QRX A;  1LTI C;  3L37 A;  1L0N E;  1IK9 A;  1VQ7 P;  1URQ C;  1L0L J;  2NPS D;  3H1H D;  3TF5 A;  3R4Y A;  2KLU A;  3Q1M A;  4PV1 B;  2G3A A;  4OVN F;  1G1I A;  4GOF A;  2E74 B;  1GL2 B;  1VQO P;  1JB0 J;  2FFD B;  1W2E A;  3MD0 A;  1ZR4 A;  1N8R Q;  1QLE D;  1OXZ A;  1J1D C;  1S72 P;  1IFM A;  4GT1 A;  3G6E P;  1GDT A;  3H1L E;  1VF5 D;  4C7N A;  3M0D C;  3B5N D;  3CXH E;  5KLI C;  2QG4 A;  3VTP C;  4IL6 H;  1NTK J;  1HGV A;  2N1T C;  2N9Y B;  3MIW A;  4DCK A;  3V5B A;  1RE4 A;  2NRG A;  2GM4 A;  4IFM A;  1Y47 A;  3N4X A;  1YHQ P;  1BE3 E;  1E5W A;  3G4S P;  3CME P;  4I6M C;  5APS A;  1BSN A;  1H89 A;  2P7J A;  3U1C A;  2B87 A;  1EDL A;  1FZF A;  4H44 C;  2B88 A;  1TU3 F;  4NPF X;  3KHU A;  4MN4 C;  4D6T D;  1Q86 Q;  4W80 A;  2K88 A;  1NJI Q;  5APT A;  3TNU A;  1Q81 Q;  3WU2 E;  2WPV B;  1NU1 K;  1VQM P;  1FZA A;  1L0L D;  1HBW A;  3H1I G;  5KLV J;  1RF0 C;  5CCH D;  4HYT B;  3M0A A;  1K8A Q;  2H7H A;  1EXI A;  1FZE A;  2P10 A;  1JMM A;  3BCC E;  4U3F J;  1QVF O;  2HPC A;  2FYU E;  3H1K J;  3LID A;  5CHX A;  3N7N A;  4N78 E;  2J5U A;  1SQP G;  1RF1 B;  3H25 A;  2QM8 A;  5AW5 B;  2XZR A;  1YI2 P;  1NGM B;  3TGU E;  2FXO A;  1LTG C;  1GL2 D;  3M0D A;  1HJB A;  2OYO A;  3L71 D;  4I1L A;  3CX5 H;  3RL0 D;  3CWB J;  4R4M A;  1G2C B;  1Z56 A;  2N1T A;  2QJY C;  1R5L A;  3O8Z A;  1JM0 A;  2I8D A;  3C9I A;  2BCC G;  4QMA A;  3G3Z A;  1PPJ E;  2KSJ A;  2YIU C;  5KTB A;  2ZYD A;  2D2C C;  1S5L E;  2PRR A;  1PGJ A;  3RK2 C;  4UB6 E;  5KJ7 C;  2CK3 H;  1S1C X;  3L74 J;  4WWI A;  3A0B E;  2A06 G;  1Q82 Q;  2KS1 A;  3KPE A;  1YIT P;  1XTC C;  1AFO A;  1SQQ J;  2O1J A;  3IAO A;  1SQV J;  3L70 D;  1HTL C;  5E79 E;  1S2E A;  2A45 H;  1L4A D;  2UWJ E;  3VP8 A;  3NXS A;  1RF0 A;  1SFC C;  3H1K D;  1T2K D;  3H32 A;  1G1J A;  5DJU B;  1N73 C;  1SQX K;  2WT7 A;  2KB7 P;  1PP9 D;  1CZQ A;  2H88 C;  1NTK G;  2MJZ A;  4YXD C;  1KFN A;  3JCU E;  2WSE J;  3L73 J;  1P84 H;  2K9Y A;  3H1J J;  1CI6 B;  2WTY A;  2WWW A;  3LIE A;  4YXW H;  1RE3 C;  3SFE C;  1OVR A;  4L73 A;  3NMD A;  2ZT9 B;  1X79 B;  3HD7 B;  3CWB D;  5CJ0 A;  3MZW B;  1FZC C;  2E76 D;  1BGY D;  3L72 E;  1DX7 A;  1KD1 Q;  2QJK C;  2SPZ A;  1NU1 G;  2O3J A;  3HTK B;  3CC7 P;  1LTB C;  1YBK A;  3QH9 A;  3PRJ A;  1VQ9 P;  5CCG C;  4ASW A;  1DD3 A;  2ZYA A;  2A45 G;  2YNY A;  1YQ3 C;  4R4L A;  4RKU J;  3L71 E;  3R2P A;  2OYI C;  1MFT A;  5KLV G;  3F5H A;  2KLV A;  5APU A;  1JY2 O;  1EDJ A;  1N7S B;  2ZVO B;  1OZH A;  1BCC D;  2GUS A;  1H0T A;  5B5E E;  4YPC A;  1NTM E;  3L75 G;  3GHG C;  1L0N K;  1SQV D;  1XTG B;  2OYH C;  4U3F G;  5AVS B;  1FDO A;  3BVH A;  4K35 A;  4DJG A;  3AE6 C;  4XA4 A;  3AEA C;  1SQB E;  4N6J A;  4H13 C;  1USE A;  3FWN A;  1HGZ A;  2I1K A;  2OTJ P;  4EYY Q;  4WY4 A;  2ZXE B;  4XE5 B;  5AVT B;  1EZV I;  2Q9I A;  1VPC A;  3L73 D;  2V7Q J;  3L70 E;  4I2L C;  3HUS C;  1SFC A;  3V2Q A;  4ZMD A;  1N73 A;  2FY8 A;  2QIW A;  2W90 A;  3OAK A;  5C39 A;  1M1J C;  2BEQ D;  2KXP B;  3I56 P;  3BRV B;  4JBZ A;  3AED C;  4HKZ H;  1VQK P;  3HE5 A;  3ABV C;  3TSI A;  3V4W A;  2WSE H;  4GOD A;  2IBZ G;  2JO1 A;  5GTI E;  2KOG A;  3V2N A;  2ZFC A;  1NTZ E;  2XNX A;  1MFZ A;  2L5G B;  3VYI A;  4I7Z C;  1FZC A;  3WMM 0;  2B89 A;  1H8A A;  3KYQ A;  1NYH A;  3P32 A;  1BGY E;  2R3S A;  3L74 G;  3T97 A;  2AEJ A;  3HE4 B;  4OGQ D;  1GK4 A;  4JF7 A;  5CCG A;  2YKQ A;  1VF5 B;  1SQQ G;  3B5N B;  1SQX G;  1WRG A;  4N3Y B;  1DH3 A;  1Q7Y Q;  2C9L Y;  3E7K A;  2E75 D;  1S9K D;  2M8R A;  1Y9B A;  1M7L A;  4W7Z A;  3D6Y A;  2KSE A;  2LXC B;  2M3E A;  3BAS A;  1EDI A;  1QX8 A;  2IYO A;  2WQY C;  1KOR A;  2CPB A;  1ZR2 A;  1OVU A;  2JJL A;  3GHG A;  2OYH A;  2M5A B;  1KB9 I;  4PV1 C;  1X8Y A;  3H1J G;  2FYU K;  2KZI A;  4JYB A;  3V2R A;  2Y0E A;  2MKV A;  2E74 C;  2KK7 A;  1EZV E;  3G71 P;  3RBZ A;  4WY4 D;  1KIL D;  3TGU J;  1KTM A;  5GTH E;  1HVV A;  2W6J H;  1RHZ B;  1MZ9 A;  3AE1 C;  2B9B A;  2ZYG A;  1YJ9 P;  3HUS A;  1ZV8 A;  2POH A;  3U1A A;  3WUU A;  1M1J A;  1IK7 A;  1PV3 A;  2K1A A;  2FXM A;  1KZU B;  2H8P D;  2E42 A;  3QWO C;  4ZKP A;  1OWA A;  2Q1K A;  5KAF H;  2R32 A;  1AQT A;  4Z1M H;  1BSH A;  1T8Z A;  1Q2N A;  3H1I D;  3CD6 P;  5CCG D;  5AVU B;  3Q3D A;  2O1K A;  4C7N B;  1YJN P;  1GU5 A;  4IFF A;  1NAF A;  1FS0 E;  3CLQ A;  3H1L G;  1ZW0 A;  1LTJ A;  2IPP A;  2IFM A;  1MKM A;  3RL0 B;  2JWD A;  1DD4 A;  1JCD A;  1A02 J;  1LP1 A;  3O6Q A;  1PGP A;  1LT9 C;  1S9K E;  2R44 A;  1KB9 E;  2ZJS E;  1VQ8 P;  1ZXG A;  1BE3 G;  3K5B A;  2RH0 A;  1SQP D;  3M9H A;  1LWU B;  1CSB A;  2V4H A;  3LW5 J;  3RK3 D;  2GUV A;  5AVW B;  2ZAE B;  2LKM A;  2KZJ A;  4M3L A;  5AW8 B;  4DOJ A;  4BXL A;  1UII A;  1GW3 A;  2HYN A;  3VMY A;  1X9V A;  3VOP A;  2FYN C;  5AW9 B;  3OW2 O;  3VMA A;  1JEK A;  4AYC A;  1NU1 J;  1YJW P;  1FC2 C;  3D70 A;  1L4A B;  1JY3 P;  3CMA P;  3Q2Y A;  2BCC D;  3L36 A;  2WIT A;  2HFE D;  2XDJ A;  3FGA D;  3TK1 A;  4O9B A;  3Q5P A;  2QJP B;  2G8Y A;  4Y99 B;  2HPC B;  3PJS K;  3BCC G;  1KQS O;  4RES B;  3MGN A;  1K04 A;  2AXT H;  2QVA A;  2H89 C;  2A06 D;  2FYU G;  1HWT C;  3G9R A;  3L75 J;  1NTM K;  1URQ A;  4UB6 H;  2J58 A;  2P1J A;  1FJK A;  2E76 B;  3A0B H;  3CX5 D;  3CC4 P;  4PD4 H;  1SQB K;  3H1H E;  3PTZ A;  2K37 A;  4L76 A;  1W2B O;  1JMB A;  3IR9 A;  3H1I E;  1FOS E;  3TGU G;  3UIA A;  1MUU A;  2JEE A;  2Y0D A;  5KAI E;  4IL6 E;  3A7O A;  1NTK D;  5BU5 A;  1VQ5 P;  1OMI A;  1PGO A;  1NVO A;  3MUD C;  2W83 C;  2WVR A;  1LT9 A;  1IC2 A;  2IZ0 A;  2PAJ A;  5EFW B;  1GD2 E;  1FZG A;  1USD A;  1K05 A;  2JDI H;  1PPJ G;  4NPE A;  2QM7 A;  1ZRT D;  2HOD A;  4K3A A;  2ZVN B;  1SQP E;  1GZL A;  1NU1 D;  2RMZ A;  1M8O B;  2KS1 B;  3I55 P;  2ZT9 C;  3LW5 H;  3RK3 E;  1CW5 A;  1VL2 A;  2KUB A;  3FWL A;  1NTZ K;  4HB1 A;  2QE7 H;  1KMI Z;  4BRY B;  2Q3I A;  3L4F A;  3FX0 A;  5KLV D;  4ZNC A;  5APW A;  3OA7 A;  1G2C A;  4H0L D;  2W27 A;  1SQX J;  4D6T E;  3PH0 A;  4GKG A;  2P58 A;  2BCC E;  3L75 D;  5AVZ B;  1P84 D;  1K73 Q;  4U3F D;  4IFD K;  3GG2 A;  1N7S C;  3SWY A;  1E79 H;  4IOI H;  5B5E H;  1L0L E;  5TIS H;  4DT0 A;  5KKZ C;  3H6P A;  2KI7 B;  1URQ D;  5AW6 B;  1OX3 A;  3E1I A;  1NAY A;  3A2A A;  1KYO D;  3L72 G;  2JKV A;  2YMY A;  1SQV K;  1KQL A;  2YKP A;  4JYC A;  5AW2 B;  5AW7 B;  1S4X A;  3W67 A;  2WSS H;  2K9J A;  1IFN A;  4OGQ B;  3VMZ A;  3V4Q A;  5L8R J;  2YO3 A;  2JR8 A;  1GTW A;  2E75 B;  2C0W A;  4RO0 A;  1LTS C;  4L75 A;  1NTK E;  4WBA A;  2WPR A;  3MUD A;  2KNC A;  1KYO H;  2O01 H;  2OGU A;  2IBZ D;  2N1T D;  2FKW B;  3OJA B;  2OTL P;  1JY2 N;  2NZ2 A;  1ZME C;  2YIU B;  1NTM G;  2NPS C;  2PFX A;  2D2C B;  1L0N J;  1CI6 A;  3AEG C;  5CBO A;  3RK2 B;  1WMK A;  2FYZ A;  1LGH B;  3L74 D;  1SQB G;  4H44 D;  1SQQ D;  4WY4 B;  1NKN A;  1KIL B;  1SQX D;  2QSI A;  3AE4 C;  1L2P A;  3SWK A;  3RL0 g;  4WVZ A;  1J1E B;  4CPG A;  5KJ7 A;  1SFC B;  1VF5 C;  3B5N C;  4UB8 E;  1X22 A;  3H1L J;  5KLV E;  1IFD A;  2XV5 A;  1EXJ A;  2E5T A;  3IF4 A;  3A0H H;  4GIF A;  3H1J D;  2YXR B;  4U3F E;  2YO2 A;  1NKZ B;  1VQ6 P;  5B66 H;  3H1K E;  1BE3 J;  2BAS A;  2OAR A;  5AW1 B;  3NTN A;  1NTZ G;  1PP9 E;  1FOS F;  3FXD A;  3M91 A;  1FJP A;  1GK6 A;  4BWN A;  3T97 B;  3GF7 A;  2WSF J;  3CPW O;  5GTH H;  1AV1 A;  1RE3 A;  2IDB A;  5AVR B;  5M1B A;  2FXP A;  3M06 A;  3CWB E;  5CCH C;  3B8E B;  5H2F H;  3M9B A;  1IFI A;  1U7M A;  1IZN B;  4L74 A;  2OTK E;  3D71 A;  3CCV P;  3KXD A;  3SFD C;  3JSV C;  2NPS A;  2OYI A;  3BCC J;  1R5S A;  3RK3 B;  2QEX P;  1PFI A;  4EDF A;  2E43 A;  2FYU J;  1OIP A;  4PJ0 E;  2WZ7 A;  3S9O A;  3H1L D;  1M90 Q;  1Y8A A;  1JUN A;  1EZV G;  2D2C D;  3GMA A;  1BCC E;  3AE2 C;  3RK2 D;  1JY2 P;  3CXH D;  3PLN A;  1YTZ T;  5KJ7 D;  1JCC A;  1SQQ E;  2FBW C;  1VQP P;  1SQV E;  3HE4 A;  1M56 D;  3HUS B;  1ZP0 C;  1GL2 C;  3B5N A;  2FFD C;  3KDP B;  1M1J B;  1BE3 D;  2M0B A;  2IZ1 A;  1T3U A;  2Y9Y A;  1SFC D;  1OW6 A;  3GW6 A;  1KB9 H;  3CXH H;  1JY3 O;  2XKM A;  1GU4 A;  1SP4 A;  3PP5 A;  3L73 E;  3TYY A;  2N9B A;  3AEC C;  1JTH A;  1LWU C;  2Q6Q A;  3H1J E;  1LNQ A;  1EQ7 A;  2WPS A;  1PGQ A;  1ZLL A;  1L0N G;  3CCQ P;  3VN0 A;  4C7R A;  2K3R A;  1SQP K;  1VQL P;  1OVV A;  1NHL A;  1AJY A;  4XFJ A;  3B71 A;  1LTJ B;  2QA4 P;  2WSF H;  2HLO A;  3L35 A;  3SWF A;  2LR2 A;  2AEF A;  3F89 A;  1ZOY C;  1L4A C;  1LP1 B;  1PZQ A;  1GMJ A;  3BCC D;  5CCH A;  1SLQ A;  5BU8 B;  3WU2 H;  1VQ4 P;  2FYU D;  1AA0 A;  1U7J A;  1S5L X;  2QJP C;  2Z5H A;  3AEF C;  4Y99 C;  2ZXX A;  3S4R A;  4N78 D;  1KQG B;  1LT1 A;  5AW4 B;  3MTU E;  1M57 D;  3USS A;  3CL3 D;  3TDK A;  1J2J B;  4KT0 J;  3M9Q A;  1L0L K;  2KP8 A;  3TGU D;  3RGU A;  1MV8 A;  2B87 B;  1OW8 A;  2E76 C;  2R3C A;  1JOC A;  4TLF A;  3L72 J;  3P7K A;  1N86 A;  4H13 D;  3VMX A;  3KZI E;  1RF1 C;  5KAI H;  1GL2 A;  4EI2 A;  3TNU B;  3AEB C;  1AVY A;  2FFD A;  1HF9 A;  4KJM A;  2RN0 A;  4H0L B;  2R5D A;  3CI9 A;  1PPJ D;  1UIX A;  1RQU A;  1KIL E;  1D7M A;  1YYC A;  1RH5 B;  3V6I A;  2Z5I A;  3CCE P;  4OWF A;  4EOT A;  1ZN5 A;  3L71 J;  1NTK K;  1FDI A;  1EDK A;  3P8C D;  2C0X A;  1FE6 A;  1IO4 A;  5KAF E;  5CJ4 A;  1LWU A;  3C1L A;  1URQ B;  4PD4 D;  1NTM J;  1JNM A;  1HUC A;  2H43 A;  1BDC A;  1FDM A;  1OFC X;  1SQB J;  3H1H G;  1U57 A;  3CCS P;  3AE3 C;  1IFP A;  5APQ A;  1S5L H;  4W7Y A;  4PD4 I;  2YXQ B;  1J1D B;  5AVY B;  1L4A A;  1LT9 B;  3D6Z A;  4ZKU A;  1PL5 A;  3L70 J;  4Y28 J;  1DEE G;  5E79 H;  5KLI B;  5KLV K;  1KV4 A;  2Q7C A;  2N1T B;  3BAT A;  2O01 J;  1OW7 A;  4A7P A;  2HOD B;  3CX5 I;  1KC8 Q;  3I5C A;  3L72 D;  1PP9 J;  2WMM A;  1R8E A;  1FU1 A;  5AVX B;  3JCU H;  3B4S A;  3EFG A;  2O01 N;  5CMZ A;  1W5C E;  1FZB A;  4PV1 D;  5BVZ A;  2IYP A;  2FYN B;  4H44 B;  1NTZ J;  2OQQ A;  2E74 D;  2J59 M;  1H88 A;  3MHV A;  5TJH A;  2AEM A;  5AVQ B;  2BEZ F;  3HD7 C;  4OGQ C;  3V2P A;  1RF1 A;  1BGY J;  5CBN A;  3WUT A;  2Q5U A;  2KIK A;  2E75 C;  1S3J A;  1VQN P;  2GA1 A;  4D6T G;  1NTM D;  2WSC J;  3H32 B;  4YTP C;  2AXT E;  2WT7 B;  1NH4 A;  3Q5R A;  5AW3 B;  2A45 I;  1SQB D;  1L0L G;  4TT3 H;  1LTT C;  3C8V A;  4OH8 B;  3P8C E;  1QGK B;  1T6A A;  1QL2 A;  1QEX A;  1BCC J;  1YIJ P;  3GF3 A;  4PD4 E;  3W68 A;  1RQV A;  1NWQ A;  5APX A;  2K9J B;  3CCM P;  4WY4 C;  1KIL C;  2JWA A;  2KYV A;  1P84 I;  2A06 E;  2IFN A;  4BRY A;  1J1E C;  1NOH A;  1AQ5 A;  1KFM A;  3IFM A;  1SQQ K;  1DEB A;  2I1J A;  4UB8 H;  2KNC B;  3KQG A;  4AUW A;  2YKO A;  3CX5 E;  4ASV A;  3Q5S A;  1JO5 A;  2QJY B;  1KYO I;  1NTZ D;  2Y9Z A;  3AE9 C;  2Q3E A;  3L71 G;  3AE7 C;  1H0T B;  3ZDM A;  3CC2 P;  1N2D C;  1YTZ I;  4LLH A;  2PP6 A;  2P2U A;  5APV A;  1M1K Q;  5GTI H;  2L91 A;  1IJD B;  1RY3 A;  1ZRT E;  2IBZ I;  3HD7 A;  1SVF A;  1NU1 E;  2W6A A;  4LGD E;  2XU6 A;  1T3J A;  2DW3 A;  3HTK A;  2RKL A;  3GLM A;  5DJT B;  3A3Y B;  2YMK A;  3AE8 C;  4U7J A;  3L70 G;  2JP3 A;  1N73 B;  1AVO A;  3II6 A;  5KKZ B;  5TIS E;  3NFQ A;  2WSC H;  2W6B A;  2C9N Y;  3JC2 2;  1FBM A;  1EZV D;  4EIJ A;  3H1K G;  3RK3 C;  3VP9 A;  1N7S A;  3L75 E;  5AW0 B;  1LTA C;  3AE5 C;  1PP9 G;  1P84 E;  4PJ0 H;  3HE5 B;  1LJ2 A;  1DIP A;  3RBX A;  2HG5 D;  1KQF B;  3FXE A;  1KIL A;  4KHX A;  5K5G B;  1FZC B;  1FAV A;  2QJK B;  3U59 A;  5AVV B;  4GDO A;  1QVG O;  3CCR P;  3CWB G;  1KYO E;  1BGY G;  1X0T A;  1KN7 A;  4DZO A;  2NPS B;  2OYI B;  1SS1 A;  1L0N D;  3HRN A;  3PHL A;  3EQ2 A;  1PIX A;  1Q90 D;  2R5B A;  3GHG B;  3A5T A;  2WPQ A;  3E1R A;  2OYH B;  1QL1 A;  2IBZ E;  4WB4 A;  4RJT A;  1BCC G;  2XND H;  2ZT9 D;  3HD7 D;  3S1K A; 
#chains in the Genus database with same CATH homology
 2ITA A;  2NRG A;  2DW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...