1KQGB

Formate dehydrogenase n from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
total genus 89
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqgB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB02
1BWEA 1BQXA 3IR7B 3MM6B 3PNIA 2XSJB 2C3MA 2WB1D 4AYBD 2PDAA 5E7OB 1C4CA 1GAOA 2VPYB 1PC5A 3MM9A 3IR6B 3IR5B 2WAQD 3MM8A 2FD2A 1F5BA 7FDRA 5BYQA 1RGVA 1FRIA 2PA8D 3MM9B 2PMZD 3EXYA 3MMAB 5L8RC 1GTHA 3MM7B 1A6LA 1FDBA 6FDRA 4RKUC 1G6BA 3MM5A 4XK8C 2FGOA 2V4JB 1Y5IB 2FJBB 1H7WA 3MM5B 3MM6A 1FDNA 1B0TA 1FRJA 1FCAA 1CLFA 1JNZB 1FTCA 1F2GA 1IQZA 1FRKA 5BYRA 1FDDA 1XERA 2O01C 2WSEC 1BLUA 3LW5C 1FF2A 4DHVA 4L6V3 1SJ1A 2FJAB 3MMBB 2C3PA 1FXDA 2FJDB 2FJEB 1Q16B 1K0TA 3HKZD 2WSFC 1GT8A 3C8YA 5CHCB 1AXQA 3MMCA 1D3WA 1HFEL 2C3OA 2VPXB 3MM7A 1FDAA 4XDDA 1F5CA 1H98A 1JNRB 1H0HB 1FRXA 3MMBA 2V4JA 1VJWA 1WTFA 3MMCB 1FERA 1FRMA 5FD1A 2GMHA 4YDDB 3OR2A 2VPZB 1FRLA 3OR1A 1KEKA 4ID8A 1FEHA 1SIWB 5BYSA 4OV1A 1BC6A 5CH7B 1PC4A 2FDNA 1R27B 1ROFA 1SIZA 1DURA 4XDCA 1KQFB 1B0PA 2IVFB 1Y4ZB 2C3YA 2V2KA 6FD1A 4CI0B 7FD1A 1Y5LB 2VKRA 3GYXB 3EUNA 1C4AA 1DAXA 1JB0C 2WSCC 4OMFG 1H7XA 2ZVSA 2C42A 3EGWB 4Y28C 2VPWB 1G3OA 3MMAA 1Y5NB 1BD6A 1GTEA 2GMJA 4KT0C 1FRHA 2Y0SD 2Z8QA 1KQGB 1IR0A 3OR1B 1DFDA 3OR2B 2UZAA 2XSJA 1B0VA 2C3UA 3MM8B 1FD2A 1FXRA
chains in the Genus database with same CATH superfamily
5LJ3Y 3UPFA 5CCGA 2NYIA 5E5NA 2KOGA 1DBDA 3K17A 4ECTA 2VFVA 1VQKP 3ITHA 1NMEB 1BQNB 2GGPA 1JJ2R 2ZDOA 5ETPA 5T7LA 3D6MB 1BE3J 2NYHA 3SV4A 4S0MA 4DSJA 5KFZA 1F2GA 1F3FA 2RJZA 5G0RB 1JCDA 2A45H 3MMBB 1IBKJ 4C8YA 3H20A 4I6MC 3DLLQ 1VPCA 2VQFJ 2CDQA 1HFEL 3V5RA 1H0HB 1S4XA 2R7SA 4URSA 2NXEA 4IL6X 3D54A 4ALZA 2W9CB 4DV0J 2UUAJ 4HEA9 3J81j 1N34F 2R32A 2FDNA 1K47A 4Q8EA 3L75J 2V4QA 2YO3A 4ED0A 2VDIA 2ADCA 1SH2A 2F5GA 4B9NA 3FJ2A 1EIYB 1L0LK 1HBMB 4ZIWA 4DG1A 2FLOA 2ZHBA 2Z56B 5KFEA 2RD5C 1RAFB 3MOZA 2PI5A 4ZKAA 4AQYF 4H13B 2PO4A 3MXHP 3JSMB 3R6GB 4P2MA 4BLGA 4CTAB 1ZAXA 2C22A 1VRUA 2QLXA 2XZWA 4ZLLA 5DDRC 1RGVA 3AB4B 2Y0BB 3VVUA 1RCXB 2RKLA 5F9LA 3L73D 4ZVEA 2A6OA 3CMES 2B3TB 1FK9B 3T1HF 3KLEB 3AE6C 3L70D 1Q82Q 1S6UA 2OARA 1L4AC 2RHSB 3H2LA 2VOOA 3I82A 3QZ8A 2YX1A 3VQSA 1RXOB 2NZCA 4JI4F 3GR1A 2EW9A 3LPYA 3UE2A 1ZZFA 1LTGC 1BY9A 4KFBB 2BRKA 3KUGA 1JY3N 3TNUA 3HD7D 4WE1A 4DV2F 3V4WA 3CCVP 1RT5B 5F8IA 3NNAA 2MKKA 4YR0A 1R8HA 3KFWX 1RE3A 4P71A 1RTJB 2JWNA 3GPAA 2GMLA 4Q8FA 3H1HG 2QIWA 3KPEA 2JFDA 2UZAA 3OTEA 2IJRA 3VP8A 3E8OA 1GU4A 3EGNA 2FD2A 2IC3A 2V63A 1N52B 2MJNA 3NNCA 3PJSK 2VFUA 1V5IB 2FJWA 4JI0F 2D2CC 1A6LA 4LVOP 2NPSA 4Z37A 2HGNA 3ZC4A 5CCHA 3BCCG 3P45B 3CC7P 3CWBE 1V3SA 1GZLA 1YRUA 3WMM0 3B78A 4RWWA 5ETOA 4YB7A 4FP9A 2E74C 2HQIA 1V5VA 1AV1A 2PP6A 2RDDA 5KJ7D 1LFWA 1TAUA 1CJUB 2EKYA 3JAMY 1RAIB 1PGZA 1VFJA 3RB0A 4PXDA 5DM6Q 1WTBA 4B3MJ 2BBEA 1VK8A 2CXEA 2R7XA 2VZ9A 4DZ6A 1Y10A 1K1QA 4XAKA 1U09A 1OVRA 5IM0A 1JK9B 1SFCC 3PFEA 3RTVA 4IFVA 3GSDA 5DM7Q 3V6JA 2C2DA 1VRTA 3DFEA 1OVUA 4PXCA 4JI2J 1FZCB 4HI1A 4WE1B 2HFUA 3ENVA 3BO2A 2XSFA 2V94A 2OYHA 1FZCC 5KAFH 2DR8A 1KB9D 4MFBB 4PAAA 3VAGA 3GYNA 4LF2A 2F4VF 3B4SA 1RHMB 4F2SA 2PMZD 2HRUA 5BVZA 2E7WA 4CNYA 4NA2A 5CYMB 3ISZA 3FBFA 1HW8A 4F02A 2AIRB 5HVFA 1VIOA 3M8QA 3BQ2A 3HTKA 2DITA 3QO9A 3F5HA 1NU1J 1BUXA 2C3OA 3MEGB 5L46A 2R5BA 4EYYQ 3MMBA 2BUNA 4FBTA 4KJMA 2QMWA 4RW7B 3FCHA 4FXWA 5KAFE 3UD4P 1YRTA 3GQCA 4MIWA 1WEZA 2XNXA 2DR7A 3MAAA 1TAQA 3IWNC 2RKIB 1YI2S 5CJ4A 2HBQB 2VKRA 4I2QB 2WSCC 2ZOFA 3FSXA 1HBOB 4A46A 1D8YA 2XLKA 3FK4A 4OI6A 3H90A 4W4MA 2A10A 4I2PA 3CMAS 3A8KA 1EZVE 2VIHA 5DQGA 2MKJA 3IR7B 5J2PB 4LRCA 4TKTA 5CCHC 2EG1A 1SL1A 5D77A 1NPPA 3J7Z5 3H1IE 4I69A 1EQ7A 3DI6A 2EK1A 2KNCB 2ZFHA 1YQ4C 1RT7A 4N5SA 2XWXA 3SDEB 2JHEA 2N9YB 3GG1A 3DCAA 1KTQA 1U6ZA 2VG5B 1X4CA 1BLUA 1BCCE 2VUGA 2CJAA 1CC7A 3H1LE 1DD4A 3FRYA 2JEFA 3M8SA 2Y0CA 2DO0A 3J81Y 4LSZB 2W24A 4P7TA 5DGBA 3OTBA 2FLLA 2VKZG 2FTRA 4WKYA 4PWWA 4IOAQ 2KJWA 2ASLA 1AFOA 4DR4F 2CQ2A 1FFSB 5EN1A 4WY4B 1U8WA 5A0YB 1M5VC 3BPDA 3LIEA 2CKWA 3CEDA 1PKUA 5D3GA 2XMUA 2K7JA 1OWAA 1YK9A 2E29A 3IO1A 4KHRA 3PLNA 3CCJP 2Z2LA 3A8EA 4A8YA 1N5VA 2B7BB 2Y8WA 3HUSA 1MSWD 2VG5A 4IRCA 3LPEA 3SCLE 1KFDA 3GYGA 2Y1IA 3QQCD 3AFGA 4C8MA 4IOIH 1FDOA 2AJQA 2R7QA 1KYOD 1AVOA 3GHGC 3MM9B 2M0GB 4U3FE 1J5EJ 3MM5A 3RAXA 1NO8A 4FF2A 5KFTA 4ASWA 1LKZA 3C66A 1RWNB 1U48A 3K8VA 1YVFA 1JJCB 1NUEA 2P2CB 2PRRA 4I2PB 4EYHB 5AVQB 1SQVD 4FXVA 5AE2A 2O01H 2P9CA 3G71S 4IRDA 5AE1A 1JTHB 5KJ7C 4JOUA 5CAAA 2CPSA 1H2VZ 1RK8A 3NCPA 3IF4A 3BDEA 3W66A 1AT1B 5DJTB 2UUWA 1MROB 3CTRA 2XGPA 2H3EB 1TZ0A 1GTWA 4C97A 1SC1B 2HFSA 2H1YA 4WK1A 1UETA 6AT1B 3EICA 2A45G 4BC9A 2GCFA 4MK7A 2VG7A 4NCBA 2VFTA 2BKOA 3MFIA 4UUXA 5DGAA 2C0XA 4FPIA 4P52A 4USJC 2POHA 4ZJOA 1HBMA 4RZRA 6FDRA 2BVZA 3E01A 5TISE 2OAUA 1RTZA 2XBPA 2WPRA 4B3TJ 1REVB 1FRJA 4Y3CA 2KU7A 3H7HB 3QNWB 4LSNA 1FHTA 4CLUA 3NS7B 1T94A 2HQGA 4IDKB 1IWGA 2VFRA 2FHMA 3CJKA 1RWVB 2F1FA 3QSIA 5CCLA 2A2CA 2W9AA 4OV6A 1SQXG 1HVVA 1VQ9P 2V2VA 2F7VA 3L75G 1FJGF 1V3ZA 4OYXA 1LV5A 4P2SA 4PUOB 5EWGA 3PW4A 1CI6B 2IM3A 1J27A 2FC8A 3M8WA 4P72A 5C2CA 3KLHA 4EEYA 1VQNS 3N6LA 1QE1A 3CC4S 1REGX 3I32A 4A4JA 4U3FG 3NRBA 1PPJG 3GHGB 5A2QY 2AJ1A 2DNGA 3AJ1A 3KHRA 4N41A 1IFIA 3W68A 3W2WA 3KG0A 1U6FA 3DC2A 5D4PA 4MYUA 4NMXA 4QPTA 1S77D 1IXKA 3I0SA 1S9KE 5KKZB 1Y5IB 1BE3D 3MP7B 4YHHJ 3HE5A 2D1CA 3R7SB 2P9EA 4LF8F 1CJKB 2DD8S 3CCSS 1OXZA 3K57A 1SP4A 1ZA2B 2QA2A 2RF2A 5A8KA 2HHHJ 2ASJA 2FJEB 5E79E 3W2VA 3MAHA 2B9YA 3OSPA 5M2UA 4NRTA 3ETMA 4AD6A 5JXSA 2FQQB 5C25B 2IAJB 3TNUB 3THTA 3LW5J 2KXHA 1KEKA 1URQA 1KONA 3BPSP 3MD3A 1YJ9S 1J2JB 4WP3A 4UOGA 1T95A 1KHWA 3QGIA 1KYOI 1VDHA 2XY5A 4OHVA 4G1QB 5H9FJ 1S49A 2DNPA 2BE2A 3AEBC 2KZJA 4JI5J 3MI7X 1K8AQ 1TL5A 1VQ8S 1T3UA 4X62J 3RR8A 4F67A 1SFCB 4MYTA 4TN2A 2J7WA 3C6TA 2ZC4A 3OUYA 1KTVA 4NLOA 3VGUA 2D41A 3OXFA 3GV5B 4CP5A 3F73A 2C0WA 1HF9A 4OZ0A 1W25A 3UD3P 2AJFE 4N8NA 3D5MA 1X9MA 3M30A 4X64F 1S1WA 3H5YA 4HHHA 3MAAB 4OIXA 4H44B 5IV4A 2Y9ZA 2WVBA 1MMLA 1S1WB 4OFZA 3KHUA 1T6AA 3RK2D 1S3JA 2PIIA 2IDLA 5K5MA 3ADAC 3DOMB 2KRBA 3CD6S 3JXOA 1YJ7A 2OH2A 4DV0F 2KXFA 4BBYA 2KFNA 4RNMA 3CO9A 4TY8A 3ZTRA 1UW4A 2DRAA 1HGZA 3IN5A 2YMKA 2DNYA 3TX0A 1YQ3C 3GSIA 3G9CA 3WDOA 4U95A 4LRDA 2ERRA 4DWIA 2OTJS 2ZHOA 2DGWA 1FJ7A 1RWKB 2VJVA 1HNXJ 2M5AA 1VLYA 2IJFA 1XBWA 3A0HE 3G6ES 1G7CB 3MUMP 2VG6B 2IPOB 4K59A 1ZM3A 3OHBA 4AL5A 4C0OC 2C2KB 2M3BA 4RUAA 1SCJB 3AE8C 4DUYJ 2NXNA 3GJRB 2OPPB 3HHLD 1IN0A 1QL2A 3CPWO 1DQAA 2AYBA 3M30B 1UEVA 1NSPA 1RAJA 2FY8A 4HT7A 2H48B 2WSCJ 5L1KA 1KLNA 2CZ4A 4F3MA 2HHQA 1FEEA 1NYHA 2B8QA 4NYPA 3EZ5A 2FPHX 4CIOA 3IN6A 2Y0EA 3ZZPA 4RNHA 4R25A 1ICEB 1AQ5A 1I5OB 2OPSB 1R5SA 4F4XA 2KYZA 2RUGA 2V34A 2Z5HA 3G9RA 1RHRB 2BXJA 3MEEB 3NGDA 4DR7F 1YKWA 3V6KA 1IK7A 1XTCC 2UUBF 1UWAA 4M5DB 3R8YA 1MZ9A 5D8HB 1X9SA 2QJKB 1SQXJ 3QFHA 2KG0A 1RKIA 1V9OA 2ZH5A 1NH4A 1BGYD 1Y4ZB 1P1TA 3R1HA 3FNNA 2YX4A 3NFQA 4B3RJ 3AT1B 1NZAA 3BKFA 1NK5A 1S5LH 4F3OA 1Y5NB 1I3OB 2DB1A 4KT0C 2A45I 2P7JA 3HLUA 3ILLA 5DLGA 2CPIA 4GOEA 1RA7A 3I0RB 3H42A 2FUG9 2HZVA 4R5PB 3H1KG 1MWQA 4K4XA 2IRXA 2QL7B 3ULHA 2L9NA 5D4LA 3MUVP 5J2MA 5IV3A 3ZDMA 3TJAA 3V81A 3BEGB 1SQQK 5TISH 4JF7A 4LBPA 4DEZA 4RWXA 1VQMS 1DD3A 3L72D 1IQTA 3EDQB 4PG4A 2V4JA 3MMCB 4OYBA 1VF5D 2XNDH 1H2UX 3B5ND 4JV2A 2RUSA 3IXQA 4C0BA 2YH1A 3N6MA 3UDCA 4B86A 4JP8A 4W98A 2XLIA 1M56D 2HNZA 3D0GE 2DR6A 3A2AA 3BKUA 2HNYA 2OYIA 3BH7B 1H38A 1S59A 3D6TB 1DH3A 5BR8F 4ZCKA 3OW2O 3QJJA 2YNHB 1BWVA 5K8MA 4QJVA 4Q2LA 3PR5B 2KO1A 3CXCR 2LR2A 3QT8A 2DYAA 1NDCA 1ZM9A 4WIQA 2VPYB 4B3MF 2GC8A 5D0HA 1A0OB 5KFMA 3JSYA 2DW3A 1HBWA 1F9FA 4CLYA 4L75A 4ZVGA 3RGUA 1TL7A 4RUHA 3G8SA 5J2MB 4GDOA 2DY9A 3S6EA 1N5QA 4C3LA 2KK7A 2BRLA 5AJ3J 3SWKA 3TK1A 4X4PA 3JCUE 4BCAA 1CZQA 1ZPWX 2O3DA 1NU1E 3L4BC 4J5OA 4LF9J 3ISND 2W2QP 3JB9k 2GHVC 4NXMJ 5KFOA 2FJDB 3EVWA 3OVSA 1UW9A 2MSTA 2RN0A 1CVJA 1PL5A 4U67Q 4RW8B 2W7OA 3GR0A 5DZ6A 4OJ3A 2VPZB 3P6YC 4PXBA 1WG1A 1S4FA 4I6WA 2GGPB 1SIZA 2JJLA 3L35A 4OI0A 5K5GB 3F44A 2YKOA 1YJRA 4NLXA 4LBIA 4YMEA 2O66A 4Z7YA 3NXSA 3BR9A 2AWZA 4FYXB 2CYYA 4JYAF 4Z7CA 3MIWA 2NRGA 1ZP0C 3GF7A 3BN7A 2ZITA 3M05A 2Z4EA 3OTDA 1C4CA 2HGMA 2YWWA 5IT9Y 5C24B 2JEIA 5LXYA 4CDIA 4U7UD 2ZEJA 4TXSA 1T03B 1AQTA 2VICA 2ZVNB 1T3NA 1L5UA 2R2TA 1SQBD 5GAEI 1SVFA 2PT0A 4HYKA 3MMAB 3CCUS 1VQ5P 2JH3A 3TGUG 1WC3A 1HL6A 5BU8B 1LP1B 4RW8A 4MAKA 4DR6F 5K14A 3K5NA 1QAIA 2K37A 1Y47A 5L8RJ 1TMMA 2DK2A 3H1JD 1J1DC 4I4BA 4Q2MA 2XU6A 3KJNB 3A0BH 4EYIB 3SQGA 1IJFB 4DZDA 1RT5A 3I4PA 2XNRA 2CNOB 3IS9B 5HLFB 1EP4B 1HMVA 2DH7A 1FRXA 1AROP 2QFJA 3OQ2A 1T2KC 3TAPA 4K0KF 3WX4A 4Y2IA 3VOPA 3H1LD 2Y8YA 3C16A 1GK8A 1S72P 5ETSA 1WF2A 3GG0A 5KAIE 1YQHA 1NK7A 5RUBA 5KFKA 4J9OA 1NDPA 2H54B 5M2PA 1AB8A 3S4RA 1SL2A 3JS9A 1K73T 3CXHE 1SJ4P 1HYSA 1M1JA 1RE4A 4X65F 1JMTA 1S5LE 1SKUB 2QEXS 1N5SA 1VBKA 4CLSA 2JEJA 3NGRA 2XG8A 3L37A 4ECZA 1FJEB 3BO4A 5ETQA 3TP2A 3CF5Q 4WFNQ 2M9KA 1M8OB 5F8MA 4K4TA 5AVWB 1M57D 4WU3A 4QCLA 1VQ7S 3P8BB 3IR6B 1UCNA 3CCES 3VAFA 3MM8A 2K3RA 1Y0HA 2CVIA 3QO9B 2HWHA 2H43A 2IBZI 5A8RA 4CCHA 2P67A 1VQ4P 3J7ZT 3EXYA 3E1IA 3AE4C 3MUDA 3PACA 2W2MP 2VQFF 5APUA 1EHWA 3N5FA 3ILJA 4UOFA 3VYIA 1SQVE 1WDDA 1USDA 2OMOA 9RUBA 4NPEA 4H0LC 1FTCA 2WSEC 1M1HA 2OGUA 3CD5A 1JXVA 1KKHA 3UFCX 2CNLB 2WSFJ 4IH6A 2QMUB 2VBYA 4DFMA 4DV4F 2LEBA 1DTTB 4IH7A 3NWRA 5C5JA 2RKIA 3DOKA 4U8VA 3NL0A 2DGUA 3LGNA 1T9UA 2G2OA 3H1JJ 1S0NA 2XMAA 3V4IB 2HHWA 5KFFA 3QAEA 4OJ1A 2YNGA 4UOCA 2HHHF 1FZFA 3FBEA 3IBCB 2RNEA 1DLOB 1S1TA 2XMKA 3AOBA 5KT5A 2HVEA 3I0RA 5L1IA 3M2RA 2A1BA 4HR2A 2D3O1 4Y2CA 5IT9U 3W60A 5ETNA 4LFCF 1NB2A 1UFKA 3MPUB 1B7FA 2I8DA 4WB4A 4ZVUB 1JY2O 3MPWA 1QSLA 4J9SA 1PIEA 2HHVA 2RMLA 4RKUJ 1K0VA 4WZQA 3T3FA 3QT6A 4RBTA 5CXTA 1ZN5A 1UVNA 2HFED 2CRLA 2FZKB 2FYUD 2DXDA 3HPOA 4JI3F 2J8SA 1JLEA 1RQ0A 1APSA 3PO4A 2RT3A 2Q7CA 4ITSA 4M5DA 1CG2A 3FZBA 2GAHC 2BE9B 1T05B 4WVZA 3VN0A 3H59A 3L74D 1N4LA 5LM7E 2YBVA 2JLEA 1LFPA 1WT6A 2QE7H 2YTCA 1OFCX 5DJUB 1X7VA 2MZQA 4DJBA 3BJYA 2DIUA 4DBQA 2L48A 4ELVA 1NU1G 4R4LA 4Y99C 2VC1A 4IO9Q 3CSKA 1JNRB 5HQMA 2AX0A 4CNZA 4ZN3A 2B4UA 3QJPA 1Q82T 2K2PA 1G1JA 1E6VA 4NLYA 2N1TD 1BC6A 1HJ0A 4O3QA 1N6QA 1M5OC 1IBLF 3CX5H 1GL2B 2LQ8A 4M5JA 2N82B 2FVPA 3D1QA 1WJ9A 3M8PA 3CXHD 5I42A 1HWIA 1SPBP 1KQSR 4RUBA 1VQOS 3EFGA 3DOLA 1JY2P 1U2RA 2EBEA 2JFKA 5A2QU 1ZZNA 3SFUA 1KOOA 2FYUE 3BZQA 1WF1A 3HCXA 2QJYB 2J9DA 2VODA 5JMNA 4ZPWR 5E79H 2DIVA 3D6ZA 1RYRA 4NCAA 3VGVA 1MN9A 2FFDC 4ZS6A 3C15A 2LDYA 3ETOA 4F04B 1LXJA 4OHWA 1GX5A 3KK1A 3UO0A 5KFJA 4DHVA 1LWUB 1VC0A 4ID5B 4NLVA 2OTKE 3M0DC 1VRUB 2IY5B 2X3DA 2E5TA 4TU7A 4DCKA 2NSCA 1D3WA 3H8YA 2XULA 4OZJA 5A8RB 2FYNC 1KYOH 3RBXA 3RW6A 3OVAA 3POTB 1PP9G 5KOXA 3KMSA 4GT1A 1T02A 1RHUB 1OJ4A 3QRPA 3SIPB 2OKQA 3H1IG 3NLCA 6FD1A 2YNGB 3DGPB 2BYCA 2ZH6A 4Q43A 4WY4C 1OIPA 2L9DA 2H5EA 4TVAB 1YJNP 4LBHA 2HAFA 4O0IA 4OZ3A 4DF8A 2R7VA 3VGTA 1W2IA 4IKAA 2Z2YB 1HHQA 2CPBA 3M0AA 1HNWF 2BCCJ 4B17A 4AL6A 4FF4A 2DCLA 2H4YB 3ZTQA 5A76A 4U96A 1VCTA 4OX8A 2XO7A 4CLKA 2EFGA 1FS0E 1WRGA 4PQUA 2JRSA 4X66F 2R7TA 4EOTA 4NCGB 1ZOYC 3EGZA 3ENAA 2ALYB 3HF5A 4ANDA 1FDBA 4W7ZA 3VCDA 2R7UA 3M9HA 4D3GA 3ZZRA 2OPQA 2W1BA 4M3LA 4CLTA 2Q6BA 8RUCA 2O01C 4CLWA 1L0LE 3PDNA 3AEFC 5AW1B 5ADZA 3HO1A 2BX6A 4DSLA 2WSEH 3CDEA 5B7WA 1X4DA 1GMJA 1OX3A 1FRMA 2E1RA 2UXBF 5KFWA 1RSCA 2J59M 2A6MA 3FUYA 1T3JA 3MCOA 4KSEB 2Y1JA 3BSNA 3CC2S 1PC4A 1SQPJ 4LIRA 1PCAA 5B5EH 2XEXA 2ZBPA 3A4TA 3MECB 1XMQF 1T9XA 4GVBB 3D67A 2ZBIA 4ZP6A 3K8WA 1KSPA 1R5LA 3II6A 5APYA 4NOHA 3VALA 1K04A 4ECSA 1LWEA 1X4BA 3WC2A 4ES1A 3HSZA 1T8ZA 4CM2A 4PV1C 5HL7Q 3DLEB 2CG4A 1GAOA 2DXFA 3MM9A 2J9DE 4BHQA 2B4PA 2MQ8A 3W8GA 3H1LG 2X3GA 2F65A 3WX8A 3KHHA 2DNQA 1NDKA 1RWUA 4K2JA 4KV8B 3TARA 5HAOA 3RR7A 1VC6A 2CWXA 4RNOA 4FNHA 4JBCA 4OX9J 3OVBA 5F8JA 2AEJA 3M9QA 4PV1B 4Y00A 2FJAB 1JX4A 2CQCA 3MD0A 2HS4A 3MFHA 2KN4A 2E75C 7AT1B 1HGVA 1FI4A 2R3CA 4KGVB 1QVGR 1R7IA 3BSAA 3NOGA 2JVRA 2BOPA 2VBZA 1AA0A 1N7SD 2M52A 3TX8A 2YIUC 4RR5A 1KFSA 2WQYC 2EKNA 1DIPA 4O0NA 4ZJLA 1YHQS 2HQ3A 2UWJE 2RDJA 3QGHA 4U9RA 4ILLA 1DAXA 3Q8PB 1R8EA 4WFXA 1OWXA 4X4RA 4H13C 4OLPA 4OVNF 2G0JA 2N3LA 1RHJB 1OYDA 2MZTA 3BGFA 3VZHA 2CJ9A 4USKA 1N33J 2E76C 3M8QB 1VQLS 1IJEB 3DI6B 1KDNA 3HT0A 2QZ8A 2W7PA 2E42A 3R5GA 1UL3A 2APOA 4I0WA 4LT6A 2FYZA 3HVAA 4QR0A 3OFFA 1VQPP 4TYAA 1GXUA 3KG1A 3HE4B 3ZO7A 4KE5A 4PWDB 2G2ZA 3C6UB 1REVA 4DR1F 1UPPA 5KTQA 4F0HA 2DGVA 2D2CB 1HQUA 3ICLA 3KYQA 5DDQC 5BYRA 2WK4A 1WHVA 1B3TA 2MJUA 4I67A 2DH9A 5CBNA 2C9NY 1QM9A 1Z4UA 1D09B 2W4PA 3R4YA 2FFDA 2HKEA 2WT7B 2HPCB 3W5ZA 3BATA 2Z4PA 3ZTPA 2R4FA 1PP9J 3QRQA 3SSQA 3AJDA 4DF4A 4PKDB 2BQUA 4N78E 5LSLA 4MH8A 3Q8VA 2FHJD 2LA4A 4LJMA 4N77A 1WI6A 4Q0BA 3BGLA 2ZH2A 3V5BA 1U1KA 5B0FA 1HNXF 4ED2A 3GG2A 3MMAA 3OLBA 4ASVA 1RTHA 3RK3E 2H5IB 5KG2A 3TQ1A 2OYOA 2UXCJ 1GU5A 2GJ2A 3PNIA 1QGKB 3PG9A 3WU2H 1K9MT 4P75A 1L4AB 3IR5B 1AW0A 3A3NB 1S2EA 3VAHA 4H4KC 2BCCE 5EGYA 2Q6QA 3D28A 1R43A 4R0JA 3KNAA 1CQMA 4ZMMA 2W2OP 3IAS9 3GIRA 3OFHA 4LF5F 5U47A 1FOSE 3I5BA 1TV6A 4HVZA 2JKVA 5AW8B 3VAMA 1UA1A 2E43A 4J91A 2QG9B 1RP5A 2EPIA 2HW3A 4JPZB 2ITAA 2E7VA 1GT8A 3LP2A 2KXNB 1OSCA 1SJ3P 4H4OB 1YBKA 2OTLP 4X4OA 1BDCA 3SDEA 1HLWA 3LTOA 1OS5A 1EETA 2C2MB 4B3OB 1X5SA 3EWGA 3M32A 1R8CA 1HR0J 2YXQB 2JX2A 3SSSA 3DRSA 4KC5A 2WSSH 1SQPG 5E3AA 3UR3C 2C3YA 1C1CA 1SB6A 4NCGA 3U1CA 1Q78A 1GL2D 4H44C 1TL3A 1JLAB 4DR6J 3PCOB 4DPUA 1HR0F 4LGDE 5ETRA 3TVZA 3LIDA 2UU9J 1FKOA 1U25A 4PRFA 5KFCA 4DL2A 1TU0B 3KK2A 1T9TA 3PJ9A 4A8KA 1IC2A 3D6FB 2ZH8A 4NPOA 1XIQA 1C1BA 1UJ5A 2K3IA 5HN0A 3QGGA 5E0OA 2QRXA 2LXIA 1C0UA 3LGMA 2MGZB 2MSSA 2HVZA 4KIAA 2I1JA 1HNVB 2EFQA 2VC0A 4QYZK 4CTAA 2KIKA 4RLEA 3PX6A 4OGQC 2KZIA 4ZKUA 2H8PD 3MMCA 2QJPC 1EC5A 2E75D 2GIFA 3EE3A 4YR2A 1RT6A 3N4WA 1BE4A 2DNRA 2V7QH 3HDSA 2WSFH 2VASA 3C2PA 4ID8A 2DKOB 3R2CJ 4A8XA 2HAIA 4GKKF 2CQHA 4GMKA 5CD4H 1IVZA 4Y34A 1FJGJ 2HZAA 4AQRD 2AXTE 3C14B 1VHFA 2M2BA 5KKZC 4MIAA 2CPDA 3TDKA 5AVRB 3QATA 4XPCA 4JI1J 3FMBA 2BE2B 5LMNJ 5L9XA 4DOJA 2BJDA 2BCCG 2BJ1A 1XR6A 2Z30B 1WELA 1RAAB 3MWBA 3HMJG 3O8ZA 2PGDA 4DDFA 3B4MA 1K1SA 5G0RA 1KP6A 3PHLA 4DN9A 2I1KA 5EHHA 1LQ9A 2KFYA 4UB8E 2QC3A 2QYCA 3I55P 1BGYG 2D2CD 4DCOB 4CRJA 1PGPA 3DU5A 4PZVA 3DRYA 5KG3A 5A8KB 1XMBA 4RL1A 3CCLP 3FX0A 3R7BB 1WWHA 2GS8A 4JV1A 1XERA 4PPDA 4RW9A 4DLEA 2WPVB 1JY3O 2KJVA 4L6V3 1X4AA 1SUQA 4UT4A 1A02F 3PM9A 3PZPA 1MLAA 4D3HA 3V6HA 3MEEA 5KFNA 1X4GA 2IA6A 3AJ2A 3FBBA 5DETA 4LRAA 2AGPA 1NCLA 4U8YA 1FRLA 3MHVA 1VHIA 1JMMA 3AQOA 2OPSA 1RTIB 1H72C 4QIEA 3H1KE 2PMHA 4C9DA 2U1AA 1HHTP 4FS2A 3H1IJ 2LXUA 2AT1B 2HLTA 3LP2B 1VMBA 1WSVA 1OSDA 2CPEA 5HBMA 2IAJA 1QDUB 1NTKJ 3KK3B 1JKHB 4OZLA 4E0DA 4CH7A 4F8RA 1H3DA 3DGVA 1KV4A 1LNQA 3LA0A 5E7OB 2B6AB 3H1LJ 4Z1MH 3OT9A 5EX0A 2WAQD 2QJPB 1UVKA 2J0XA 3IAOA 5A6PA 2RQ4A 3RJMB 3M8ZA 1IO4A 2PC6A 2WVDA 2F8EX 3W3SA 1S48A 5KLIB 4DUZF 3QT7A 3HZGA 4LF4F 4KQZA 3HHNB 1SLQA 1SQFA 2QV6A 1RTIA 4QIGA 4AE5A 4J9RA 4O23A 4XPEA 2GHPA 3TUZC 2G0IA 3H1HE 1FE4A 1TUWA 2FJVA 4DR5F 3CCMS 4U7CA 1OMSA 4NZ0A 1NTZJ 3CX5D 1T9YA 2CJYB 1SJ1A 2RE1A 4NZ6A 4BC7A 4K50A 1SQXK 3UN2A 4KGZB 3UQSA 1SBRA 2IVYA 4IYQA 1KILE 4IFFA 1A7GE 1TKZA 1TKXB 1S1VB 3V2NA 4WCEQ 4LFBF 1FK9A 4NE9C 4O3NA 2PA3A 3TO8A 3M06A 2ZAEB 1VRQC 1L0NE 2DGOA 2P6SA 2OD4A 4XA4A 2I6WA 5IC4B 1XNRF 4BWMA 5FDLB 3OXGA 2B8PA 4H4MA 1RI7A 3IP0A 1ULRA 4JQ0D 1YBTA 4F0MA 3T1YJ 3KZIH 2BM0A 2B4OA 4F26A 1KRPA 1RLDA 4PQUB 2RIJA 3TA2A 1BXNA 4CLLA 2XZRA 1HQUB 4ZCLA 5KFVA 2BJ8A 4ZPCA 2C2NA 1QLED 3IWXA 1IFJA 4G1IA 2RB7A 3PRVA 3BYRA 2ACMA 2JDIH 1IR2A 3CJRA 2A0FB 3IFMA 5LSRA 1N86A 1X8YA 3EPIA 2FJBB 2W4CA 4UF4A 4NLGA 2OO4A 3PX0A 1S9EB 1S10A 1S5LX 3GF3A 1NAFA 4X4VA 4Q7AA 4A8FA 5IWAJ 2WONB 4C48A 3EPGA 1M90T 4LFBJ 2H88C 1N36J 3AE3C 3FSIA 3D7SB 4JI0J 3MAQA 1L3SA 1GK4A 1YIJP 1UIXA 3PHTA 2DEJA 3B4DA 4WTYA 3L3CA 2UP1A 3UN3A 3GB0A 2BM1A 2ILZA 1HNVA 4Z2XA 3PKYA 1SQVK 4YDXA 2BEZF 4FKXA 2JDJA 1C0TB 2JNJA 3RG6A 1MU2A 2H51B 2BKNA 4A8MP 3GFHA 5C7PA 3SSRA 3HE5B 3PTZA 4CLZA 3HZEA 4HDHA 3C19A 1ZRTD 2IDBA 1YWXA 1CS4A 1QLNA 4UB8H 5AXKA 2W7AA 3JTNA 2OLWA 3R1LA 1HWKA 4EU0A 3UCZP 3AD7C 4ECRA 2H4WB 3K59A 1U57A 4KV8A 5J1EA 1VF5B 1F5BA 3HK2A 2PA8D 4L3NA 3KJFB 1EDLA 1NJIT 4EZ9A 2QLWA 5C25A 1SJQA 4OI2A 2NUUG 4X62F 3V6IA 4I7ZB 2G13A 3M32B 1FDNA 2I5JA 4JI5F 4LQ9A 4O9BA 4O3PA 2NQPA 3UD5A 1HPZB 4IFYA 1KZUB 3EDRB 2NXJA 2XYPB 1TK5A 2XB2D 4Y2AA 1Q2NA 1V3RA 4DQIA 2MZ1A 2DT9A 4DSKA 2CZVC 3P8CE 2V9KA 1BGXT 1YI2P 3TJ9A 2W6JH 2VU5A 2MY7A 3B5NB 5AW0B 2ZZTA 4LSNB 1LW2A 1YYCA 1UFWA 2ROPA 4WYLA 2CJXB 3P49B 2IVFB 2B0GA 3DRRB 1BCCG 3TAQA 1IBLJ 3FEZA 3J81U 3KKFA 5IXUA 3UR0A 4DL3A 1T05A 1EXJA 3OJSA 3L73E 3I9V9 4ZVHA 4JUZA 4I2LC 1UZHA 4LVNP 1FD2A 4HHUA 4USUA 3PRBA 2C9LY 2C3MA 1LT1A 2V4HA 2UUAF 1NTKE 4NLUA 4LF7F 4KH0B 2V50A 5E33A 1PAUB 3MZIA 2ZM6F 1MFZA 1LOUA 3KDNA 2FHOB 3HFZB 4DR2F 1QEXA 1R8BA 3ONQA 3CJ3A 3H0PA 3RZAA 4M5KA 3KLIB 3M2RB 4P73A 3US5A 3ENWA 4IG3B 4YR3A 2EWHA 4EBCA 3MM6A 4K4SA 3SQOP 2WITA 2FB0A 1T9WA 3IBWA 4I6YA 4K5RA 1IKXB 4AUKA 1HNZJ 4JI3J 1UWBA 3DM2A 3GJSB 3NS5A 3E01B 3HHLB 1S1UA 1U0HB 1RHZB 3S7RA 4XE5B 3K0JA 3ET6B 1MU2B 3KJQB 3RRGA 4IL6H 2FLNA 1BQMB 5ETKA 5KLIC 4WXWA 5HJXA 2D7SA 2A3JA 4F4KA 3CCJS 3CI9A 3SMZA 2XY7A 3SXLA 5CCGC 1ZPVA 4GC6A 4DR3F 4PD4E 2A18A 2Q79A 1N54B 2ZE2B 2HQFA 1BD6A 2GAGC 2GUSA 1Q8LA 3KDOA 4CT8A 3KLFB 4RJTA 2RSQA 3MM8B 5D78A 1SQBG 2RMZA 3M7VA 4JI7F 2W2NP 3C15B 3TSIA 1IKYA 1LT9A 3D3CJ 4LFAJ 2BDPA 1X0FA 2NPSC 4ZPBA 2ZH3A 1XMOJ 3M9MB 2KHCA 3EJMA 2KG1A 3RGIA 2MDAA 4GC7A 1SV5A 2HIQA 2DHXA 4QR2A 5K9FA 1OW7A 2ZH9A 2OIHA 3B5NC 3U59A 2GO8A 1HYSB 4IFDK 2UVWA 2AV5A 3MR2A 3M9BA 3DOLB 1S1CX 3QFWA 5HI7A 2KM8B 5GAEU 1CLFA 1UFLA 1FCAA 4UB6H 3I9ZA 2DY1A 2HMIB 1RISA 1OQ3A 3KLGA 3M8PB 3N7NA 2J0WA 2CQPA 1P9QC 4J7CA 2M3EA 2NPSB 4NEZA 3L09A 1VS3A 2DO4A 2IVMA 5APWA 3FWNA 4O4RA 4NPFX 1JKHA 2CQ4A 4P6QA 1RT2A 5CH7B 1SC4B 1SI9A 4GOFA 4LF5J 1GW3A 3T6BA 3FEYB 3G82A 4MK9A 3GTYX 3CJSA 3KMQA 3MGNA 5HP1A 2CJQA 2P9GA 4K0KJ 5AW6B 2GVDB 3AQPA 1PG5B 3GLJA 4A47A 1PP9D 2R2UA 4KGMA 2QM8A 2HRTA 2HNDB 1SL0A 2HK2A 2IBZE 5HMWA 1J1DB 4L3KA 1V6HA 4UW2A 1W2EA 1HQEB 4Y2KA 1JM0A 1RT4B 3EMTA 4XIUA 4A48A 5BJRA 1UTAA 1LT9C 3Q2SC 5KFHA 3V4QA 1JLCA 2XI2A 3VQTA 3G4SS 2N1TA 3QMQA 2E5LJ 3K5OA 1NAYA 4M5MA 2IFXA 4P74A 4D6TJ 4OI4A 3BCCE 3SFGA 3HVRA 1ZOTA 1BDDA 3Q8UA 4TU9A 1U1RA 3MTUE 2Y9YA 4F4ZA 3JSMA 2J7UA 1B4SA 1X5PA 3CW2C 4OYWA 2YKQA 3PO5A 2BV3A 3TEHB 2J76E 1Q86Q 4LR8A 2Q3EA 2GVZB 4KT0J 4YPCA 2KS1B 1EZVD 1HTLC 4CLFA 1RDRA 4HTIA 2HR3A 1G1IA 2FYUG 2HMIA 2OMLA 1F60B 2N3OA 4DSFA 3CULA 2HHSA 3SYZA 2AQ4A 4BDPA 3UN5A 1NTKG 1SQEA 2ZXEB 4KGXB 3CJ5A 3FEXB 1FA0A 3ZZUA 2WB1D 2FVCA 4DQPA 4J9QA 5J1NA 3CCQS 2I0XA 2P2UA 1VQSA 9ATCB 2ZT9B 4MT1A 4WK3A 3MR7A 1WKLA 2DBBA 1R0BG 4QWDA 1TK8A 2WW8A 4PR6A 3TR5A 3QSYB 1I1GA 4DR5J 4DCPB 1NHLA 2VDHA 2RQMA 1SKRA 3FQKA 1UVLA 4AYCA 3R5CA 4PQAA 5APXA 3USSA 1NTZG 2DNNA 1LTJC 2M8HA 1S0MA 4WP9A 4DCJB 1M1JB 1MMNA 2HIYA 1VJWA 4ANCA 3EVOA 2YQ0A 4GIFA 1MMDA 1OYEA 4C4WA 2O01N 1E5WA 3DRRA 3DLKA 2HVHA 3NMRA 1FJPA 2BE7D 5AW9B 3Q24A 1RAOA 7FD1A 3VAKA 1IFMA 1OVVA 2W90A 2QL9B 3DRSB 3NGSA 5L1LA 3PEJA 4NYOA 2QJ3A 2BJ7A 1AFJA 1RY3A 1SQBJ 1IR0A 1Q0NA 4H0LD 3H1HJ 4WWSA 3KLVA 1UIIA 4NLTA 1YTZI 5IM0B 4Q45A 1UZDA 2WW4A 3QGPA 4G3IA 4O44A 1YGYA 5T14A 5CA5A 4UUWA 1MUUA 1U2FA 3CDAA 5IC6B 2MY8A 1CJUA 1NGMB 1TV6B 3DYAB 3IG1A 5AVZB 3ISNC 1RJJA 5B0AA 3T41A 1FKOB 3CCEP 4HHJA 3PJXA 3A3OB 1L3TA 1FXLA 1HBUB 1NXIA 4DQSA 4HDGA 3VTPC 1K8AT 3BRTB 2UUTA 3CJKB 2HURA 1KYOE 1U8SA 2V68A 1JY3P 4Q5VA 2OTJP 3LF0A 4U3FD 3IAM9 1C1CB 4FYDA 5APVA 1FAVA 1FERA 2HEKA 3UIAA 2Z2MA 1WF0A 4M1KA 3R97A 5HP1B 3O6QB 4RW4A 1H89A 1YBAA 2WSCH 3EX7B 1M1KT 1FWPA 1NKZB 2BANB 5D4NA 1B0PA 4CI0B 1Y5LB 3M91A 4ZIVA 3GV7B 4RBVA 3AEAC 3CD7A 4NRUA 2ABYA 2NUHA 1S6QA 2FIUA 2YNFA 2XTJP 2Q1LA 4CWBA 1U1OA 2ZYDA 2UUBJ 2ZE2A 1N5YB 5APQA 3GE9A 1X5OA 3CGIA 4LQ3A 1ZBTA 2QFIA 2V8VA 1HBNA 3R2DJ 4JV5J 2QLBB 4AXJA 3QPIA 2X1FA 1YG0A 4DPTA 5B0GA 2KB7P 1FTRA 2MQLA 2VQEF 1NTZE 1YX2A 1DLOA 1S1TB 4B08A 1S1UB 1NU1K 1U7JA 3CX5E 5L1JA 4PV1D 2HYNA 2DJWA 3HVTB 1GEHA 3D2WA 1I51B 1EQMA 2ZOGA 4H4KA 1JXEA 3QZ7A 4DV5F 3TW0A 4U7JA 2X7IA 1Y3JA 1TKTA 3UVJB 2K9JA 5DDOC 3AD8C 2HNYB 4KHXA 3DLGA 2GX8A 3KYLA 4TY8B 4MJKA 2AX1A 4KPYA 1H73A 3W61A 3W8PA 2C2ZB 3DMJA 3LAKA 3OL9A 2YWEA 1Y11A 3M1VB 1OY8A 2L41A 1WOPA 2GHWA 1N2DC 2FVSA 2XKMA 5F9NA 4FYYB 3BGOP 2P5VA 3OAKA 3HJFA 4DL6A 2HHXA 3GYXB 2LEAA 2Q66A 3UDVA 3CNQP 3T1HJ 3A3YB 1OZHA 1ZRTE 1VQKS 1ELOA 1TKZB 2MTLA 2WZ1A 4C7NB 2O1KA 3B82A 3EXCX 5TJHA 3FGAD 5GTIE 1XEZA 1HWLA 4V19J 7FDRA 3TVKA 5HVHA 3KUHA 4I7ZC 1WOOA 2MYFA 3QLHB 2IZ1A 1SQPD 4Y6IA 3MM7B 1NK6A 2B88A 2FHJA 4FKYA 4ZLJA 5EWEA 3NGUA 2J9EA 5D4OA 2BA9A 4K4VA 3KLIA 4WFZA 4YS2A 3LAMA 2KVQE 1NWQA 1Q7YQ 1URQB 2MQOA 3C1LA 3L7PA 3L74J 2COLA 2VPXB 3TGUE 3PY8A 2XLJA 4DSEA 1RAEB 3DLEA 2Q9IA 2WWWA 1G4CA 3CVKA 2L3MA 3ELHA 3MTJA 4OHXA 2V6AA 3VP9A 4C8KA 2Z58B 3L71D 1QTMA 4OI1A 1U24A 1RT7B 8ATCB 4EO6A 1KLMB 2RILA 4N47A 1N32J 2LQBA 2E5LF 2IRYA 4JBZA 2WMMA 5L38A 2H89C 1IK9A 3N0VA 4V19X 2MQMA 4DV6F 2XC9A 1NJZA 1UP1A 2ZHAA 1LTBC 4LC1A 4K2XA 4WY4A 5A0YA 4R4MA 2B4VA 2QJYC 4P7VA 2ROEA 4BWJA 4L73A 3PR4A 4RW9B 1PJ6A 5CYQA 3OFEA 3CJ4A 1S7IA 1CEZA 1WHYA 1Y9BA 3L36A 2DNZA 2QN6B 2E9RX 4NZ7A 4F4YA 2OPPA 3MGJA 2ATLA 4WKRA 2LVWA 1P1LA 5KLVD 4ETXA 4KHMA 3DLBA 1N73A 2NXCA 2HBRB 1S6PB 2DNLA 3MEGA 4LF6F 1TK0A 1DTQB 3SFDC 1TUVA 3N5BA 4D6TG 1UPMB 4ZN1A 3D0IE 1TFYA 1OQ6A 2KHDA 5JVHQ 4JV5F 4E2FB 3AB2B 3CMAP 5LSOA 3H5SA 4TLQA 3MTKA 2QSFA 4DPXA 1U2CA 3AD9C 2WPSA 5B0EA 1GD2E 2C2RA 1QUVA 3DGPA 3THPA 3BKTA 3DN9A 1RCOB 4Y99B 2FYUJ 1FNXH 3MOJB 2O5DA 2E76B 2MLXA 3WIUA 5HVGA 4PEOA 4ED1A 3DOMA 3MCSA 2ZM6J 5L39A 4QU6A 1RT6B 2HS0A 4EBEA 4AXIA 4V1Ak 1FD8A 4MKBA 3R6LB 2IFNA 2VBWA 2GVZA 2OI2A 3OA7A 3CC7S 2KSJA 4B3SF 2V2QA 5KLVG 2YNHA 4ED7A 2E66A 2AJ4A 3DRPB 3KQGA 3CIMA 2V5HG 1NTME 2P10A 4H44D 1MV8A 2F9DA 2XS2A 3K5BA 2YIUB 2OEKA 2AJ0A 3G6YA 1VBZA 4B3TF 4ZVFA 2WBRA 2E5HA 2K1RA 2LDIA 1JLCB 4KY3A 1J5OB 2D74B 3UCUP 2IA0A 5B5EE 4DL0C 2C3PA 4DR3J 5ETLA 2E7XA 1EB0A 3J80U 3AECC 3PRJA 2IYOA 3C8VA 4EIJA 4KR0B 3BF4A 4PWUA 2GQCA 2JWAA 3VAJA 5GADU 1Z1ZA 4FPRA 2RQKA 2QEXP 1RF1A 2FLPA 1KB9I 2W9BA 4WY4D 4HL9A 4N76A 3QIPB 4P2FA 1HNZF 4H4MB 3A3PB 1Q86T 1PGOA 3P5BP 4OWFA 2IBZG 4DV7F 1LK5A 4ID5A 3L71G 2VA3A 1LWUA 2GUVA 1KQGB 2ZBRA 3QRRA 2YNFB 5KFDA 2HVDA 1CJKA 2OQQA 1NTMD 2PDAA 2V0NA 1GMWD 1KORA 2K9YA 1AUSL 1KS2A 2H9ZA 1E6YA 3CJTA 4I64A 3HUSB 1FZEA 2YKMA 5KG0A 1AA1B 1S9GB 4F4AA 4JYAJ 1Q7YT 3OSNA 4M5NA 1RT4A 4WJBA 1NOHA 1CSJA 2EFOA 2BJ9A 2HFZA 2RS8A 3N01A 4R8UA 4QWEA 1GTHA 4LF6J 2PGCA 1NEEA 1BE3G 3BCCJ 2IPPA 4XO0A 1RYSA 2FZGB 4X84A 2EC2A 2OTLS 2HHTA 1RTDA 2IHR1 2WRMA 4GODA 2VV5A 2I2YA 3I5CA 3BBFA 3CIZA 1FDIA 2CQIA 2G0CA 1FE0A 1RAHB 2E1AA 3A13A 1DJ0A 1G2CA 3Q83A 3AOAA 5CHCB 1QUPA 4I7FA 2B6AA 1Q7LB 2F40A 4NMLA 1JLGA 4I56A 3RL0D 3M2VA 4PABA 1KB9H 3PW2A 1J1EB 4HI2A 1N7LA 2UVRA 2QX0A 1FVSA 2GW8A 3L72E 4Q0BB 2LFVA 2ZD1A 1BCCD 4UB6E 4KB7A 3O1LA 1KWMA 4B9MA 3HKWA 1OPZA 3AAWB 2EFNA 1TFWA 1N32F 2D9PA 1WC6A 2YKPA 1ZTTA 4RUCA 2E74B 5HQLA 2L9WA 1JJHA 2J6TA 4NI2B 4B9UA 2W9BB 3WC0A 1PGJA 4KKOA 5J2NB 5H9EK 4JYBA 2KKHA 1FZBA 1L3UA 2GFFA 4JI6F 1B7YB 3TAMA 2M5AB 4ED3A 3DLHA 1JLFA 1DY3A 1S57A 5GTHE 4C3MA 3Q8RB 2VONA 5H2FH 1Q81T 4D6TE 2B9XA 2MZJA 2AYMA 1NU4A 2XY6A 3UDEA 4PG5A 1AUDA 2ZUGA 3BH6B 4DX8H 1L0NK 2VH7A 2EG2A 1UJ4A 1DX7A 3CCWA 4N6JA 4ZHRB 2C28A 2D3UA 3H2UB 4DX7A 1S99A 3RK3C 3KXDA 3IC1A 5E3CA 1LTSC 2GIRA 4NPDA 2HPCA 2WT7A 3MF5A 3NKYA 1SIWB 2IFMA 1CW5A 1R0CB 2CQ1A 1MW7A 2JJ4D 2GJFA 3T5HA 1IFNA 4FBUA 2RU3A 3F89A 2B5JB 1MN7A 2QM7A 4LRBA 4YTPC 2AKWB 2JSXA 5CYQB 4J9KA 4LIWA 2E1CA 1RB0A 1H0TA 3TAMB 3D71A 2LA6A 1PFIA 2GMJA 5HATA 1Y8AA 4GO5X 3MR3A 1P84I 1FFGB 2NSBA 4X64J 3N9UC 1Q79A 5IQQA 1NBEB 5J2NA 2LQJA 4M5HA 3D0HE 4IG0A 4M5GA 1IKWA 2BACA 1T0TV 2HYIB 4OGQD 3LH2S 1IKXA 1LWXA 1T3OA 4RX6A 4B9LA 3SQGB 4WIIA 2Y1LB 4CO1A 2HFOA 3HXMA 3OL8A 2ZUAA 5DRKA 1X4HA 4IOCQ 3CCRS 2IM2A 3TUIC 2N4CA 1L3KA 4XK8C 5EWFA 3GLMA 1HI0P 3JSVC 1KILD 4FF3A 4NEYA 3KHGA 3L7OA 4B02A 2PSZA 1EZVI 4H54A 1QD1A 3R3TA 1JLBB 2M8RA 3V2PA 2NXUA 3JQJA 1G2CB 1X8DA 4LR7A 2ZT9C 2AMCB 1X31C 1N33F 4DU7A 1NKBA 1ZAVA 3MDFA 1DARA 1RHQB 1KD1Q 5KFYA 5AXMA 2WSEJ 1NDLA 3MD1A 3Q8YA 3LW5H 1X9VA 2IIHA 3CB4A 1HMVB 3HHLC 1C4AA 3SI8A 5HLFA 3IS9A 5CCMA 1F5AA 5LMUF 2ZNYA 2J5UA 3S1KA 3BQ0A 4JI8J 2CG8A 4QZVB 3W63A 3TZZA 5F41A 2R9LA 1Q95G 1FKPB 2BJ3A 2WBMA 1FXRA 1O51A 4DUYF 2W4DA 4KO0B 5GVQA 4DUZJ 3AE2C 3CD6P 1KQLA 2UVVA 2NPFA 1RADB 2R8GA 5B0CA 3G3ZA 3NGKA 2KDOA 4ZLPA 4NLDA 3HD7B 1WC1A 3BYPA 4USMA 4WXOA 1O8BA 5KFIA 1M5KC 3DDIA 4OX9F 1IKWB 2DEIA 3OXLA 1NM2A 4YUDA 4TLFA 1S72S 4EO8A 1RF1B 1TVRA 4NYZA 3FKBA 4DV7J 5E2QA 2FXOA 1ZAWA 2HBZB 5D15A 3JYTA 3AEEC 3C8YA 1XR5A 2Q43A 2SPZA 4C46A 4I2QA 2IYGA 3CCLS 4LF7J 5KAIH 2VHGA 5ETTA 1CC8A 2MQNA 1MWYA 1VQNP 3S9OA 1U1QA 5SUHA 3G86A 4XTTA 5EX3A 3Q8SB 3EZUA 5KT4A 2Y9HA 1FJKA 1L4AD 1X22A 2BEQD 1WEYA 2ZBQA 2IRUA 2CA9A 4CPGA 2E9TA 4ILMA 3OFGA 1A02J 2L08A 1KOHA 1Q4RA 4URGA 1XMQJ 1N7SC 3PIPQ 2XYGB 1R0AB 1LJ2A 5IS2A 4HACB 3GJTB 2IZ0A 4J9NA 4JI6J 1L3VA 1HBNB 3UNGC 1UA0A 4N8OA 4EGLA 4QWAA 4TLRA 4LR9A 3CCSP 4A8WA 2XNQA 1SKSA 3DMJB 2HQCA 3I96A 4ZLNA 5AVTB 2PMWA 5GAHU 2EXUA 3FC9A 3TGUJ 1H8AA 2RRBA 1HA1A 5F8LA 4B3SJ 4G65A 2D3OR 1TKTB 4QYZJ 2XI3A 2AW0A 1XWLA 1HQ2A 4X2BA 3RBDA 1GMUA 2X1BA 4YN3B 1F2HA 3E51A 1FRKA 1NTZD 3PH0A 2AYGA 2DCUB 2LECA 3ILOA 3QWPA 3DHXA 4ED5A 5KG4A 2C1EB 2M0BA 3BCCD 3HSJA 3P8MC 1OMIA 1RWXB 5E3RA 3GFYA 2ZKUA 3AHPA 2J0QD 3Q2YA 1IJDB 1EDIA 1YHQP 1VQ8P 1HBUA 2LMIA 2UVUA 3A0BE 4J9MA 3M6WA 2XM3A 1CJVB 1K44A 3FRZA 4C8OA 1SC6A 2H5JB 2Y3YA 1UMJA 2B43A 3NEKA 3RAMA 3LP0B 3FQLA 3Q0AA 2FY1A 3NAHA 1FT8A 4NL5A 2LXCB 3M9OB 4FNIA 2R8KA 4E8UA 3Q3DA 3JSRA 4NASA 4ILRA 2ZBCA 3WUTA 2AZ1A 3M2UB 2UXDJ 1WMKA 3CO0P 2BANA 2FVRA 4YFUA 2IMWP 1VQPS 1RKJA 5D6GA 3OBIA 3H1KJ 3A7OA 4ELUA 3EFFK 5K20B 2HVIA 3RBZA 5HO4A 3TGUD 5K8OA 3A12A 3EYZA 1N56A 1IZNB 4LF9F 1R6VA 4ZMDA 1VK3A 3SBMA 3U02A 4DL7A 2ATCB 3U7JA 3GONA 4DS4A 5DQIA 3EQ2A 3DDNA 3V6DA 4WZMA 1YDLA 2I5JB 1RT1A 3D70A 2HG4A 4DR4J 1YJUA 4K4YA 4C11B 2JR8A 4ELTA 4J9VA 3OR2A 4DMZA 4IOBA 5KFLA 2V8DA 1PV3A 2G9OA 1CSBA 1LK7A 1RF0A 3BDPA 2YQ1A 1D9FA 1VQOP 1IFPA 1R27B 5KG7A 2BEFA 5C42A 2JEGA 4B9SA 3EWKA 2WOMB 1YIJS 4L76A 2GA7A 1HW9A 4NX9A 2OEJA 4OMFG 1KR4A 3CL3D 2E9ZA 2JLGA 4N78D 3EGWB 4IR9A 3SWFA 1M5PC 2LKZA 4NLWA 3G87A 1RBLA 4EK2A 2DNKA 1DTTA 2FBWC 2JOQA 1NNDA 3IGNA 2FJXA 1NSKL 4F50A 2CNKB 5AVSB 3MEDA 3O44A 2VA2A 3VR1A 3P32A 1NO4A 1RWPB 2N4DA 2G1DA 3HFVA 4NXNF 3D1HA 4USHA 4XFJA 1KQKA 2OYIC 1NJXA 1I94F 5CCHD 3VAIA 4K4WA 1JY2N 2CQGA 1QTNB 2UXCF 1QVFR 1HARA 1W2BR 2ALZA 4DV1J 4BRYA 5DO2A 3RK2B 1OY6A 4UZBA 3B8EB 2K1AA 4LF4J 3H1HD 4DG1B 3H32A 3KK1B 4IH5A 5F0WA 2HWIA 2GO9A 3F56A 3HSGA 3HUSC 3QH9A 3W62A 4NA1A 3MEDB 2W2PP 1P84D 1YTZT 1PGQA 2V4RA 4KRWA 3NCQA 3A8IA 2R5DA 4YDDB 3L71E 1C1BB 5EFWB 1PILA 2Y1RI 2B89A 2R3SA 1WNEA 1SFCA 4G1PA 3KK2B 4FZVA 5KT7A 1NSAA 3QYYA 1ROFA 1NPKA 3NWGA 2YO2A 1XN9A 4QW8A 2XO6A 1JOCA 3HVTA 1Q53A 2XMVA 1NSQA 4FVMA 5CD4A 2C42A 4JI8F 1KILC 3BV8A 5LMUJ 1O6XA 2Y0SD 1KTMA 1ZR4A 4C8ZA 1PP9E 4ZCMA 2ZDPA 4WF9Q 2NR0A 1BQXA 2RH3A 1AZSA 2CQ0A 3PYDA 3R7NB 3OLAA 3W65A 1FOSF 5FDLA 3X3UA 2AD9A 1HKAA 1UKUA 2AHOB 2DNOA 5BYQA 2XGQA 2JWDA 3EZOA 2NZ2A 3LP1A 1UVJA 4ZVSB 2AZ3A 1N8RQ 4YY3F 2QIFA 3CDUA 1RT2B 4WFYA 1NJIQ 3I0SB 1SQQE 1JNZB 2MLYA 3LALA 2LP4A 4RW4B 3PIOQ 1M1GA 3RL0C 3GMGA 4N7TA 3VTIA 4C6AA 1LWFA 2P58A 4WBFA 4HKQA 4J9LA 2ZOMA 2MJZA 1SQXE 2O67A 2MPUA 4G6VB 3VZIA 2X51A 5KFGA 1JLAA 4EMDA 4ZCIA 3OTOJ 1RTDB 3R5DA 3C16B 3WIVA 2RAQA 1YITP 1M1KQ 3MMJA 3L70E 3VVTA 4MMOA 4PUOA 1SJFA 2CQDA 2M8DB 1FC2C 3SFEC 1JLQA 1A9NB 5E3QA 1GH8A 2G2YA 4WFAQ 1TU3F 4I68A 2J9CA 1EZZB 4F4WA 3SWYA 1VQ9S 5AXNA 4PCQA 4U3FJ 2JL9A 3MUTP 1HNIA 1NKEA 4EDFA 2MLZA 5I3UA 4BS2A 2HG5D 1P6TA 5CMZA 2JZ5A 4RKUC 1OW6A 3FSYA 5GMDA 3OL7A 3GIKA 1RHKB 2PD1A 5L9NA 2R8JA 1S4EA 4YXWH 3KDPB 1SQQD 4FDFA 3I56S 4YQWA 2DXEA 2Q1KA 4EWTA 3L9ZA 3T19A 1N48A 1EXIA 2R42A 3NBPB 4KPCA 3Q23A 4KH1B 2F3JA 3VHQA 4JI4J 2W6BA 3AE1C 2PFFB 2UXBJ 1FWLA 3FBCA 3IM9A 2OYIB 3TF5A 2WB4A 3NY0A 1BHNA 2R7WA 1RAGB 3BSOA 3BN4A 1RABB 2QGFB 1W26A 3TUJC 4ECWA 3WQPA 3ZTOA 3C9IA 2VOPA 3I4HX 2W27A 2QJKC 3CT9A 1GQEA 2Z8QA 5CYMA 5KFXA 4OZ5A 4HH0A 3CCZA 2UUCJ 2A2DA 2B87A 5LJ5Y 5FLXY 1YJWP 3IMQJ 4AYBD 2KZMA 4A8OA 2F9JA 4Y2MA 4FXDA 2ROGA 3CMQA 2Z57B 3CCMP 4AQYJ 4Y65A 1EDJA 3ENQA 4IQXA 3RK3D 1FBMA 2LU1A 2J0SD 1X9WA 4DXLA 3KZIE 4C2MA 4W80A 2Z5IA 3FXDA 2OPRA 1AYEA 4QIFA 1U02A 3BB5A 1D9AA 2ZT9D 1HD1A 1S79A 4DSIA 1WC0A 2CZ9A 4IFMA 1P8GA 1JWWA 1LXNA 4CM0A 3LGHA 1FKPA 3BBBA 2FXPA 3G4SP 4RW6B 2MXYA 1KNZA 3RK3B 4BWNA 1EKSA 2F63A 2XCAA 3PW0A 1IBKF 2NCKL 3LOUA 4OLOA 5D3GB 4ZVTB 1DURA 2B56A 2XZTB 3CDBA 3ITHB 1WACA 4DPOA 1VQ7P 5JUMA 1ZLLA 4ANEA 4M8LA 3G6VA 1GTEA 3HHDA 1XR7A 2ZH4A 2IDEA 4FS1A 1XNRJ 5KFAA 3B8HA 2NPSD 1N5TA 2N1TC 3D4JA 1L4AA 2P1JA 3V2UC 3MZWB 1DQ9A 3L95X 2VL1A 2H7HA 1SS1A 2QLFB 5F0UA 3PXGa 3IA0A 1KILA 4ICLB 5CYJA 1NH7A 1S7HA 4R0EA 1E6YB 2CADA 3O3LA 3M8RA 3I5AA 3H25A 1SXLA 1DZ5A 3PP5A 1N0VC 3R2PA 3GCXP 3GILA 1SQBK 4PG8A 5ITHA 2B51A 3AE7C 3CDWA 1Z2ZA 2N9BA 3CCQP 3LP1B 2I9SA 3M6UA 5AW2B 2YQ3A 3AOCA 1CBKA 1J2VA 1IM4A 4I1LA 1SVDA 2YXLA 1EAYC 2EVZA 2E5GA 2Q3IA 4KFBA 5F3TA 1YSJA 2HS3A 4UTGA 1R31A 3TYYA 2V67A 3Q8QB 1XQIA 4K4UA 3DLKB 1ZW0A 5IT4A 2VF3A 3OJUA 3AH6A 2XZDB 3FZ2A 2R7OA 3KLGB 4XDCA 1DHMA 3N4XA 4ENOA 3TJ8A 3KNGA 1NJYA 2RHQB 1JEKA 1PBUA 2YPZA 2QA4S 2ZVSA 3OTCA 4PWDA 2YWFA 3KLEA 4AT1B 2XHWA 2GM4A 3BGRA 3JCUH 2LXFA 3THVA 3T5LA 2WVRA 1F1BB 2YWKA 1U26A 2BQRA 2WPQA 5CABA 3M6XA 2WVEA 3HP6A 4OHYA 5KFSA 1F9EB 1HJBA 2YX7A 4Y28J 3W1YC 1WD6A 4DPYA 2CFXA 5GADI 1JMBA 2OPQB 3HHEA 1XMOF 2HPUA 2KSEA 3NTNA 1CQNA 1R8AA 3VF0B 5ETVA 4M5LA 4F2RA 1O5JA 1VF5C 3ABVC 1B0TA 3H98A 2DHSA 2QMXA 2M3DA 4DFPA 1BQMA 2AXTH 5GTHH 2XMJA 3Q86A 1WHXA 5DG7A 3FGVA 1X0PA 3OUYB 3HHLA 5I3PA 1F5CA 1H98A 5I3QA 3BRVB 1P9YA 4ECQA 1M7LA 1RLCL 1PO6A 2D69A 5IQ6A 2OSRA 1RF0C 2YVSA 4FF1A 4DUTA 1IBMJ 3C46A 3GFXA 2HGLA 2J6SA 2XCPA 1QJHA 1PPJE 5IZHA 1PAEX 2YKNB 3BASA 2P8IA 4FYVB 2Z2ZA 2CVEA 2HNZB 2G1HA 4LMZA 3GFZA 1GL2A 2K3KA 3I55S 5KTBA 4GRSA 5KT6A 5T7LB 1UAWA 5KFBA 4O3OA 3JQKA 1IM6A 1RH5B 4HH2A 1WORA 3OHAA 2R7RA 3LO3A 1EKRA 2YNYA 1D8ZA 1KBRA 1YZ6A 3KOAA 2UXDF 1VQ6P 4TNOA 4QOTA 4DFKA 4EZ6A 5KT2A 3V81B 5SZTA 3C6TB 3FCWA 2W8ZA 2GVDA 4ZP8A 2LXBA 2OYHC 2MEWA 3TYTA 5HQ8A 2KT3A 2ZVIA 2V8PA 3AEGC 4PD4H 5THWA 1FO1A 4J90A 1O0PA 3B71A 3IFEA 3W67A 3CCRP 1VRTB 5KG1A 4CO2A 4G1QA 2YKMB 2WSFC 2GV1A 2G4BA 2DR9A 2MKYA 5AE3A 1AJYA 3W5XA 4IL6E 3VMXA 2AYEA 4IQMA 5AW7B 4N56A 1L0LG 1N7SB 2QT7A 1NTZK 2DTJA 3HD7C 3DYAA 2EFPA 3DNCA 4AUWA 4ATNA 1GMWA 1L0NG 3RU0A 1JB0C 4GO7X 4NWBA 4UY8T 1PYTA 2CPZA 3CCUP 4OYZA 1FKAF 1VQ5S 2WHOA 2YPYA 4RNNA 1AVYA 3HFKA 4C8LA 1BE3E 5J1EB 2KLUA 3PV8A 2LQ5A 4WTOB 4YB1P 1OY9A 4HB1A 2CJKA 5BU5A 1SQGA 5B0BA 3WUUA 5B0DA 3CUNA 5DG9A 2HFVA 4R8UB 1IBCB 3C14A 5HMXA 2VBXA 1CS4B 2HHUA 2KVIA 1K9MQ 2IC3B 1J5OA 1NZ8A 5BXIA 4F36A 3AA8A 2V7QJ 3M2UA 1NRKA 5H1SV 2ZC3A 1LT9B 2M88A 1KC8T 1IKYB 4OI3A 1H7WA 3MPYA 4CQ1A 4YHHF 2ZH7A 2MZRA 3OPKA 4L74A 4ES3A 2V9WA 3LP0A 1OIAA 1KN7A 2WZ7A 2F4VJ 1RTJA 1TL4A 4LRFA 3QIPA 2X1AA 2W83C 2R2RA 1PSDA 1HWTC 4QIVA 2CDRB 5FLXU 1R3NA 5LXRA 1S9EA 2YKNA 3ET6A 1C0UB 2VG6A 4GKGA 1N36F 3H4DA 3HI9A 3TANA 3H2VE 4K35A 5IOLA 2O1PA 3DM2B 1URQC 3ILIA 2LYVA 2FZCB 2UV8A 4DR2J 2ASYA 2X1GA 3S1TA 3TRGA 3HX9A 3G8QA 3VMZA 1XJWB 3MM6B 3AXKA 4RJVA 4TQRA 4HJGH 1C2PA 4USWA 5E41A 3CCTA 3KJVB 1H74A 1WC5A 2D3ZA 1ZETA 4K3AA 4CLPA 4F3QA 2BABA 3K2YA 3TI0A 2QE5A 1WDTA 3HD7A 1XTZA 2L5GB 1X4EA 3BGUA 4PYAA 1R0AA 3IRWP 4X4UA 2E5YA 1MKMA 3J7YU 3ZZYA 3MCNA 3T97A 5D0GA 3OV7A 1L0LJ 2CQ3A 3O6QA 3BGRB 3H1JG 1T03A 3CJ8A 4ICLA 3BREA 2M7SA 4DX5A 3CWBJ 4DQQA 4U7UK 2W9CA 2IM0A 3CWBG 1VLOA 3RK2C 3JYTB 1Q8BA 3GHGA 4LFCJ 1LWCB 2ZWOA 1TL3B 5C42B 3TEGA 1CJTA 1SQPE 3M0DA 2JO1A 2J8AA 1SFCD 4A8QA 4CO3A 1HPZA 3AA9A 4CZCA 1N73B 1DFDA 3OR2B 1USEA 3IG1B 1U1PA 1CI6A 1R6YA 4ECYA 4KBIA 3QWUA 3NS6A 4ECXA 4PG6A 3L72G 1S0OA 1TKDA 2AEMA 1JB0J 5GAGI 2W6AA 1FE6A 1VR6A 2FYNB 1PBAA 3PYFA 2YNIA 1KD1T 5CZXA 2KTQA 1X0TA 2PFXA 3LQVA 2EK6A 4O4GA 4YB5A 4W92B 1Q81Q 4IDKA 2YWHA 4M94A 2O01J 2J58A 5C24A 2VB6A 4TYBA 3FFIB 3NNHA 3J7AN 3E3XA 3MHYA 4RU9A 2IBKA 4EUVA 1AXQA 1I94J 1RQVA 4XDDA 2A06G 3Q89A 1WTFA 4OGQB 1QAYA 1XNQJ 2KFZA 5M1BA 3A1YG 3GMAA 4ZPVR 1HIYA 1Q1KA 2B5JA 2R2SA 2GNKA 4QR1A 1KVJA 4DR7J 3JSBA 1JLBA 1FX4A 1URRA 4TQSA 2CJBA 1Q5VA 1SV5B 4RU2A 1P27B 1WI8A 2KXPB 4U6PA 1R89A 5GAHI 2PN6A 2DGQA 4QWCA 5KG5A 3TZXA 3FWLA 1PJ5A 2K8GA 2H65B 1N34J 4EBDA 4O3RA 3OTOF 1GL2C 2F4FA 3GIJA 5KG6A 5FIIA 2QL5B 2YH0A 4WWIA 3L7UA 3ZNJ1 1ZTWA 1VIXA 1FNOA 2DRDA 1Y7PA 4QPXA 1FFWB 1U7MA 3QBCA 4P9SA 3R5BA 3TQEA 3D6YA 2F8HA 1FZAA 4F0KA 3VMAA 4YEAA 4WYWA 4W7YA 1RF1C 3WBZA 2E5IA 3T1YF 1G6BA 3FDSA 1DEBA 1IFDA 4ZPAA 3NXZA 1EZVG 4DT0A 2AXCA 3RW7A 3CMEP 3MEKA 1FF2A 1TP7A 2OYHB 4USVA 2E76D 3BSCA 2WVCA 4OZ1A 4MKAA 4MIBA 3TVYA 3KWMA 5KLVK 4URQU 1QAXA 1L2PA 3M4XA 4LSLA 3PYGA 5DJBA 1E79H 2JEEA 4ZHRA 1HNWJ 1NK0A 3ZNUA 4LF8J 2V69A 3RB6A 3W9IA 5KFUA 1NTMG 1PYSB 3NMDA 5B66E 4QIWD 2MKVA 1NTMJ 4CO5A 1TKXA 4LUBA 2BZ2A 3SEOA 2CPXA 2CPFA 2ILYA 3UCGA 1OO0B 4UQTA 2Y0DA 2O1JA 3NBPA 2OP5A 1T11A 2F8MA 2DRBA 2C2OB 1NJWA 5B09A 3RBEA 2AGOA 1JTHA 3KUEA 4LF1A 1GX6A 1CJTB 4KJIA 1VJQA 2KH9A 4KKOB 3PVXA 3H4BA 1HD0A 5KFRA 5L8RC 4OJGA 4ZA1A 2I8EA 1NTKK 1KFNA 1SQBE 1S1XB 3P7KA 2UU9F 3MM5B 1MNEA 1IR1A 5I3UB 3AODA 2ZKTA 1HNIB 3QT5A 2E5JA 3J80Y 4RW6A 4JB8B 1P84H 1FXDA 3K5PA 1VBXA 1Q90D 1XC9A 3G96A 2AP6A 4P2XA 2NLWA 4H4OA 2KNCA 4HTJA 3PX4A 4QU7A 4N3YB 3WU2E 1JLGB 2OPRB 1U49A 4PG7A 2DGTA 1Y00A 4I6AA 1LW0A 1X4FA 2DPIA 3PKMA 2LCWA 2OEMA 3D66A 4JI2F 1WKJA 3BR8A 4IO1A 1GXTA 2W01A 1KQFB 3HD1A 3WHIA 4PJ0H 1S1XA 1WOSA 5JJBA 2O3JA 2Z0GA 1Y9OA 4MN4C 3EGVA 2CIMA 1X79B 4J9UE 4GVBA 1SUQB 4ZVQB 1H0TB 2MHNA 1HBOA 3GJQB 4OYIA 1LWFB 2KT2A 2DH8A 2LEPA 3ZTSA 3IRXA 3T5KA 5D0EA 4B9TA 3CC2P 3UDLA 4A8SA 1D0EA 5J1PA 5F3ZA 3BO3A 3PHEA 3A8JA 1GDTA 1IWAA 4OJHA 1SH0A 3BBCA 1YBUA 5AT1B 2MHEA 4JI1F 1NTMK 4DN0A 1ITPA 3W9HA 3NGTA 3NMAA 5LL6d 3D1OA 2W25A 1RT3A 2CNNB 3PRDA 4GKKJ 2GA1A 2E1MC 2D9OA 1Q8IA 3Q5PA 2ZJQQ 3F0NA 2OSQA 4OYMA 3H5XA 5A8WB 2QVAA 1U1LA 2CPJA 4IG0B 3A5TA 3VMYA 2GMHA 2W8LA 5IT0A 2P6TA 1KVIA 4H13D 3I56P 4F25A 3RRKA 4ZP9A 4QW9A 2MQQA 4MFBA 3VGSA 2GZOA 1S5ZA 3DXSX 4RESB 4DJGA 2OFGX 5F8HA 1YRXA 1JXLA 2CPHA 1VL2A 1Z56A 2HLOA 1U1MA 4IFVB 3DRXA 3G8TA 1S6PA 4WFBQ 3V2RA 3P3DA 2QA4G 2ZD1B 2ZFCA 3HTKB 2CQBA 1RU2A 3HSDA 1LTTC 2FXMA 3QJLA 2HBYB 2KT5A 3GP9A 2JLFA 3JTOA 1BGYJ 2V4JB 4ZK7M 3EVMA 2EBGA 2RF2B 4HYTB 5A6WA 3OW2R 2DNHA 1FX2A 2QSIA 3RRHA 2R44A 5GAGU 2MQPA 5DLFA 2HNDA 5KLVE 1B70B 1Q16B 3DDKA 1M90Q 1K73Q 1FDAA 2XMMA 3B6BA 2HODA 2KM8C 1YJTA 4M95A 4JV0A 4R5PA 2OJ3A 5KFPA 2WOMA 1GMVA 4X4TA 4OYPA 1EETB 1PYOB 5AVXB 3M9NB 3X1LB 3L73G 3M8YA 4O4GB 3NOCA 3ZZ0A 1ZYQA 1U1NA 4ECVA 4ER8A 5APTA 3U1AA 4YXDC 2YNIB 2ZYGA 4C11A 2WTYA 3MPVA 4DL4A 2XSJA 3N6NA 1HI1A 1ZA1B 3RYLA 1XNQF 1RT1B 3W2VB 2CPYA 3J7YI 2XSJB 1VISA 1J5EF 3PW7A 3J7A1 1YLXA 1AZSB 2IBZD 2SXLA 5KFQA 1RQUA 1VQYA 2Q6CA 3IR9A 4KGKA 2FGCA 4HH1A 3U1MA 2XMTA 3RB4A 4CO0A 1EQ0A 3ZFVA 1VI7A 1F6TA 3QLHA 1PJ7A 2I38A 2XS7A 4FVCA 2PI4A 4MTPA 1S9KD 1TMJA 3CJ0A 2QTWA 3R27A 4HKZH 3L70G 1HI8A 1JO5A 1KLMA 4ERDA 4OL8A 4C7RA 4IR1A 1ZXGA 1J1EC 2YWGA 3GZ7A 1TQLA 2FVQA 1WKKA 2Q3PA 1S97A 2K1RB 3ZZTA 2L91A 4OZ2A 3MURP 3GU0A 5G4DA 3GW6A 3DHWC 4M63A 1D7MA 4RBUA 3UI3A 3CC4P 4DV5J 1L0NJ 4OYAA 3GIMA 3W64A 3T5JA 2FFDB 4DR1J 1UVIA 1TELA 2GQ2A 3DLGB 2ZZNA 1NTKD 4OQJA 3OJAB 2K9JB 4DLGA 2E74D 1SH3A 4X4QA 3G6XA 3NCRA 3SSUA 4J37A 1BMQB 1KFMA 2JVOA 1M5HA 2KZZA 1OW8A 1WEXA 2BMBA 5HROA 5HMZA 3AE9C 1YJNS 3RAQA 2YXRB 4KTQA 1IKVB 3CPWR 1LTIC 2HK3A 2NS1B 3H1JE 2KI7B 1ZM2A 4IUFA 1IQZA 1RE1B 2DGSA 3U1NA 3K5LA 4ZJQA 2EC0A 1UVMA 3AY0A 3N79A 3R9LA 2MKCA 4BRYB 2RRNA 3SCIE 2VJUA 4DV3F 4MKVA 4K5SA 3CCVS 2XDJA 2QSWA 4USIA 3H40A 3AXMA 5FD1A 1NVOA 3QIDA 2BASA 1HWUA 3ZZOA 4B9VA 1TTHB 1NB7A 2LKMA 4DI6A 3WZ0A 5F8NA 2K88A 1LP1A 2PFDA 1SQQG 3P96A 2ZH1A 1G1XA 2CAJA 5JVGQ 4DV1F 1WG5A 3O8WA 2KL8A 3HM9A 3HD2A 2HSEB 3RL0B 2ZVOB 3CLQA 4AFFA 4NXNJ 3RUBL 3Q2TC 4H0LB 2MKSA 4O3SA 2GJIA 1DEEG 1S9FA 1NHUA 2IYIA 2CUYA 2RH0A 1KN6A 3V2QA 3O5TB 4UY85 2NREA 1N5YA 3AEDC 4DV2J 5HK4A 1W2BO 1QVFO 5APSA 3H5UA 3H6PA 4PPZA 4B3OA 4OX6A 3V6DB 2WTFA 1E6VB 1ZS6A 1CJVA 5K14B 4YB6A 1NLKL 1UJ6A 3S8SA 3HVWA 3S01A 2HQDA 3MECA 1YITS 3W5YA 3OD2A 1LWCA 1L0LD 1WUUA 2J5AA 3N28A 4Q44A 4MK8A 4X4NA 2DVIA 2MKIA 5C39A 2HODB 3CJQA 3W2WB 2MZSA 4ED8A 2OELA 1RUSA 2HRYA 5HJYA 2RQCA 1JQGA 2FYXA 5LMNF 1S0VA 3T97B 1TL7B 1YJ9P 4B3RF 2VPWB 1G3OA 3T1AA 4ZDNA 1VOMA 1FU1A 3OR1B 3TWZA 3KLHB 4KHPF 2DHHA 5DS7A 1JLEB 2C3UA 5AVYB 5MAOA 3L75D 4WP8A 3L72J 3L4FA 4ZPTR 1H6KX 5M2RA 2KI2A 2KYVA 2VG7B 3LANA 2J7KA 5CJ0A 2XYHB 2WONA 3LWMA 2UV8G 1SJRA 1MWZA 2E75B 1RBAA 2IX7C 2V8GA 2EFVA 3NG8A 3ITKA 2V8HA 1DQ8A 4CYUB 2XQCA 2KP8A 5J2QB 3LWLA 3Q1MA 1VQLP 4PD4I 4FN5A 3D68A 3MR6A 1URNA 2ZNZA 4ES2A 5B08A 4LSLB 1YTYA 4DL5A 3A0HH 5D0RA 5J2PA 3KHLA 1RACB 4QWBA 2ZJSE 5AW4B 1EARA 1RE3C 3IWLA 3UW1A 1RZMA 3P8CD 5K8PA 4P10A 1P84E 5HMYA 3E7KA 2BKPA 2QRRA 3T9NA 4OV1A 4DX6A 2KS1A 3W9JA 1VYAA 3U27A 2FHKA 2LLZA 5K8NA 3HE4A 4DV4J 4FYWB 5GMEA 4DV6J 1FZGA 2POKA 4ZITA 3VV2B 3CD0A 4RW7A 1IBMF 4LREA 4W90B 4I1TA 1KC8Q 3FCVA 3SV3A 3G6EP 4Y0FA 1XK8A 5ETMA 1B0VA 1SQVG 3IGVA 4C0HA 4L72B 2YMYA 1NK9A 1RA6A 1S1VA 4K4ZA 3P4UB 3UVJA 5FJ4A 5HSPA 3HRNA 2QO3A 3L75E 1ZV8A 1Y3KA 5HANA 1G2EA 3QAUA 3JQMA 2AU0A 3DU6A 2BR0A 2IM1A 1RWMB 3MR5A 1FRIA 1JIHA 3CE8A 2N7CA 3TNVA 1T9VA 1NU1D 2RVJA 1VQMP 4CH0S 2R8HA 4RNFA 3LW5C 1SKWA 2BW2A 4TT3H 4TU8A 1TVRB 2JC0A 1LTJB 3TUPA 3K7RA 1BSNA 3MCMA 3FFIA 3DLJA 5C2GA 2QLJB 2E1PA 3I6PA 4QYRA 1W5CE 2AJ2A 1JCCA 3KK3A 3CWBD 1T2KD 1SQQJ 5CHXA 1NAQA 4UQGA 1VGYA 1GNKA 3IBFB 3T6JA 4DU8A 4KO0A 5KJ7A 1NH8A 4NA3A 3EUNA 2V2ZA 5LOQA 4C7QA 3QWOC 4ZVPB 3B54A 4UOHA 2ZYAA 3P5TL 1JLQB 3G2XA 3C3LA 1HQEA 1D1UA 4I7FB 1AFIA 4ED4A 1M1JC 1RE4C 4USTA 1LTJA 1NPRA 2BCCD 3U1LA 1LWEB 2E44A 2LU2A 2RRAA 1MFTA 2BQ3A 4LFAF 2HFNA 1XTGB 4BXLA 4JI7J 1H88A 4UZCA 2AF6A 4DV3J 1Q8KA 3CJ2A 4NLRA 1M5SA 3NP5A 2XHCA 1H2TZ 1SQPK 5H2FE 1YJVA 3BM7A 2FGOA 2KYXA 4RO0A 3G71P 2W8KA 1B64A 4CH1A 4QMAA 1TUGB 3I31A 3M6VA 1S9GA 3L70J 1W7WA 2HLUA 4O44B 3CXHH 3G82B 5HBMB 4QQBA 2YY3A 4ZOSA 3HKZD 5AW5B 1OPIA 3PJWA 2KLVA 3H32B 1CULB 5LT5A 3RB3A 4F7VA 2CWKA 4C3KA 3FVYA 1SQXD 1FEHA 3TA0A 1GK6A 4WU2A 3UNYA 1EJ7L 3F41A 4ZP7A 1X5TA 1JLFB 1JUNA 4NLPA 4NXMF 2DHGA 1UEKA 2HHPA 4YP3A 2IYPA 1U0HA 1BGYE 1FRHA 1I6JA 2BOAA 1SQVJ 1LEOA 3KJVA 4ZKPA 1HHSA 4C98A 2FYUK 4PD4D 2VD3A 1UWBB 2DNMA 5AJ3F 1KB9E 2AGQA 1N0UA 2RS2A 3JC22 1YZ7A 1PC5A 2GIQA 4PXEA 1NHVA 1PPJD 4NI2A 1D9DA 5KLVJ 1QY7A 2WVFA 5KT3A 1F3VA 5EUHA 1RBOB 4LLHA 2VRSA 5CBOA 1QL1A 1CULA 3GV8B 4D6TD 4X65J 4A7PA 3JTPA 1CPZA 3O2IA 4OZNA 3SZ2A 3T9ZA 4YOEA 8AT1B 3IM8A 5AVUB 5BR8J 3TZWA 1K0TA 2ASDA 3M2VB 2ZWPA 5KOWA 2RDIA 2K7KA 1QVGO 1ZM4A 3WUVA 5MLCV 2IJNA 2UUCF 1PIXA 1ZMEC 5IFMA 1FWKA 4X4SA 3PTWA 4HT5A 2K06A 3MUDC 1FJCA 3DXBA 1RWWB 5CQGA 4GKJJ 2NZ4A 4GVLA 3D3BJ 2V2KA 1NKCA 1LW2B 5A8WA 1EP4A 3PYEA 2IMOA 5DQHA 3H1KD 2ADBA 2DPJA 3K5MA 1IUJA 3FMWA 2LQ9A 3PEHA 1FZCA 2NPIA 4KAIA 1HWJA 3D6HB 1WSRA 3ZZZA 1U4BA 1RT3B 4CYUA 3W7BA 1VQ6S 1QX8A 2ZJRQ 2MGZA 1X60A 1NKNA 2B9WA 2QA4P 1ZH5A 2N1TB 3GCWP 1LTAC 2U2FA 4NLSA 4DPWA 3R5AA 1KQSO 2R3VA 3E1RA 1KILB 3R5JB 3Q5SA 4AL7A 4GKJF 5H9FK 4ZVRB 1WHWA 3TA1A 2HZCA 1U7LA 3HJVA 3IRXB 2YKAA 2VQEJ 1FDDA 1PZQA 1S6OA 2MMYA 3K89A 1Q5YA 2JP3A 3FXEA 1T7PA 2B9EA 3PFOA 4HLBA 3LUYA 3MM7A 2N7YA 3L74G 3HULA 4ZPDA 1TL1B 4KYZA 3TOQA 5AW3B 1HH0A 3HT3A 3B5NA 4X66J 2ZJPQ 1QAJA 1LW0B 2MB0B 1RTHB 3Q22A 2QYGA 1KHVA 5IWAF 4WBAA 4K7QA 1HUCA 4KHPJ 3L73J 1BSHA 2M5YA 1BCCJ 5I4MA 1F0XA 1JNMA 2BW7A 2PAJA 4DFJA 4EI2A 1T8EA 1QE1B 5T41A 4RPFA 1H7XA 2B9BA 2AEFA 2CK3H 1K05A 1JJ4A 4ECUA 3KLFA 5AVVB 2XS5A 1WG4A 3DRPA 1BWEA 1R8PA 2C2EA 2FC9A 2GQQA 3SCKE 5CCGD 3CWJA 3M1VA 5DG8A 5E3PA 4DQRA 2ACYA 5KAKA 1RU1A 2VFSA 1EDKA 2Q5UA 3AE5C 1S76D 2M4MA 2M70A 3V4MA 5DZ7A 4OH8B 4E98A 4ETZA 5HROB 2B87B 2ZXXA 4YY3J 3V4IA 2EI5A 3C6UA 1U6BA 2KRRA 1VQ4S 3GWCA 4ZNCA 2I1RA 4DZOA 3GIIA 4CO4A 5F8GA 4QBUA 4JYCA 4IRKA 4OX7A 2J6UA 3DOKB 2RU9A 2DISA 4EFAC 2OHDA 4C7NA 2BJEA 1FNMA 2OUGA 4IG3A 4OYOA 1C0TA 4CT9A 3POTA 3PW5A 3BS9A 2OD6A 1NHKL 2DGXA 1VC5A 2OFHX 5H9EJ 1ACMB 2QA1A 1VDFA 1F9HA 4MKYA 2PEHA 2XV5A 2ZZMA 3CXHI 4ED6A 4HACA 2A06D 1MG7A 3SCJE 3Q5RA 1M0SA 1FVQA 1U45A 4NLQA 3I87A 1NK8A 1N88A 3K58A 2R8IA 2DHAA 3L71J 3EM1A 1LGHB 1N73C 1IKVA 3NAIA 1QSSA 2KUBA 1MROA 3H1ID 5CZVA 3TZYA