1KQGB

Formate dehydrogenase n from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
total genus 89
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqgB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB02
1FF2A 4OV1A 2C3PA 1Y5IB 4L6V3 3MM8B 2FJDB 1FD2A 2VKRA 1C4CA 1Y5LB 1SJ1A 2WSCC 1B0VA 4OMFG 1KEKA 1FCAA 2FJBB 1FDNA 1H7WA 1FDAA 5CHCB 4XDCA 5BYQA 2V4JB 1F2GA 3HKZD 1BC6A 1FXDA 3IR7B 2FJEB 1Y4ZB 1JB0C 2FD2A 1FRIA 1B0PA 2VPXB 2Y0SD 2PA8D 6FDRA 1DFDA 3MMCA 1BD6A 1BWEA 2VPYB 1FEHA 4XK8C 3MM7B 3LW5C 3MMBB 1FRHA 3MM9B 2UZAA 1R27B 5CH7B 1FXRA 4KT0C 1SIWB 1IR0A 1BLUA 5L8RC 1G6BA 3EUNA 5BYRA 1FRMA 1GTHA 2GMHA 3MM9A 1KQFB 3PNIA 1F5CA 2C3UA 7FDRA 1JNZB 1PC4A 3MM6A 1AXQA 1VJWA 2VPZB 1FDBA 4ID8A 4DHVA 1Q16B 3GYXB 1A6LA 7FD1A 1XERA 2FGOA 1BQXA 1FTCA 2PDAA 1H7XA 2WSEC 3C8YA 2FJAB 1DURA 5E7OB 2O01C 1ROFA 1FERA 1FRLA 6FD1A 1GTEA 1Y5NB 4CI0B 1B0TA 2XSJA 2C3YA 1FRKA 1H0HB 1GT8A 3MMCB 3MMAA 4YDDB 3OR1B 1WTFA 2FDNA 3MMBA 1G3OA 3MM7A 4XDDA 3OR2A 1HFEL 1CLFA 2Z8QA 4AYBD 2GMJA 2ZVSA 1F5BA 3MM5B 1PC5A 5FD1A 1IQZA 1C4AA 3EGWB 2XSJB 4Y28C 1SIZA 1FRJA 3IR6B 1FDDA 2PMZD 2V2KA 1JNRB 3EXYA 1FRXA 2V4JA 3MMAB 1RGVA 1H98A 2C42A 2WB1D 1KQGB 3IR5B 2WSFC 2C3MA 2WAQD 2VPWB 2C3OA 2IVFB 3MM5A 3OR1A 1D3WA 3MM8A 5BYSA 1GAOA 1K0TA 1DAXA 3MM6B 4RKUC 3OR2B
chains in the Genus database with same CATH superfamily
4DV7J 1NTMG 3VAMA 1UETA 4G1PA 1OW8A 1I5OB 4OYWA 1FJGF 5F3TA 3PIPQ 5AW3B 1N5YA 5FDLB 3L74J 1RWVB 1FE6A 1VMBA 4KT0J 1YI2S 3FSIA 2IA0A 4DLEA 1VQKP 4V1Ak 6FDRA 1SQPJ 2QJKB 3V4QA 3KZIE 3KJVB 3PJ9A 2IVMA 4H0LB 5GMEA 4MN4C 1OJ4A 1CJVA 1S6PB 3HD2A 1MWQA 1N32F 1OY8A 5LMUF 2NLWA 4JYBA 4OI1A 4BBYA 3JTPA 4KGMA 3M7VA 3CD6S 2CA9A 4ZPBA 2HZAA 2LXIA 1F3FA 3G9CA 1L3KA 1DURA 5DETA 3OTOF 1OWXA 2ZYGA 2N4CA 3H98A 4JOUA 1HH0A 4GKKF 3IN6A 1RY3A 3KOAA 2XMWA 4QIGA 3AE5C 3Q23A 4L72B 1NPRA 5FD1A 3PCOB 1ICEB 2EFPA 4RUCA 5E3CA 4L74A 1NSAA 2IBZG 1IO4A 1AQ5A 3CWBG 1KYOE 2GJ2A 2Q6QA 1HBNB 4UW2A 4AL6A 4MIBA 3DCAA 1SQPG 4OI6A 2FJDB 1RU2A 3BQ0A 4KJMA 2KM8B 2RIJA 4IO1A 3RRKA 5EFWB 4L3KA 2YNFB 1M7LA 4ZN3A 2V2VA 2Z4EA 1HD1A 5KFLA 3FEXB 3H7HB 3QRRA 2J6TA 1MMDA 3CJRA 4USVA 2AXCA 3DDKA 4H4MA 3O6QA 2E76C 3GONA 1CJKB 2O5DA 3PRVA 2IVYA 1L3TA 5KAFE 2DR5A 4IOCQ 2DY1A 1UP1A 4PQUB 2FXOA 1O6XA 2YKMB 1T03A 1RWKB 3ETOA 1MN9A 1KN6A 4RW8A 1VLOA 4MFBB 3M0DC 3K5LA 3I4PA 1NGMB 3O1LA 1NPPA 3THTA 3K5BA 1T8EA 1P84H 3PRJA 2RQ4A 4DUZF 4Q0BB 2FXMA 4ZCIA 1NO4A 1HBMB 2RKIA 4JQ0D 2M3BA 1PJ7A 2KUBA 2E43A 4ITSA 1RE4A 2FBWC 4DQSA 4X66F 3NNHA 1RT1A 4YB7A 1EZVG 2FYXA 2N1TB 4KGVB 4OZ3A 4UZCA 5U47A 4W90B 4MKYA 3V4IB 2BQRA 3C8VA 1R89A 1XR7A 3K2YA 4M5LA 4ZKPA 2YO3A 2HNZB 1S4FA 2VBYA 4I56A 1P1LA 3MUDA 4RESB 4Z7CA 2ZOGA 5ETTA 3R7NB 1BY9A 2AV5A 4GRSA 3U59A 2D1CA 1B0PA 2E1AA 2FPHX 2CPYA 2B3TB 3OL8A 5EDWA 1JLCA 2HRYA 1GTHA 4FXWA 2HG5D 3KLGB 3CC7S 2HRTA 5CYMB 1VQLP 1UWBA 2WVEA 4NXMJ 2J7KA 2JFKA 3M8QB 5D0GA 2MJUA 3L70D 3R4YA 4GKGA 1RTJB 3M9MB 3U7JA 1FKPB 2QO3A 3D28A 4QU6A 4KV8B 1VDFA 5MLCV 1WKJA 1NTZE 2OYIA 4U3FD 3MMJA 2BABA 4LT6A 5B0CA 5JXSA 3IR9A 4UY85 1WNEA 2J6UA 2HK2A 1R6YA 3Q8RB 4G3IA 3CMQA 3IFMA 1RHZB 1HBNA 2IM0A 1LW2A 2ZBRA 4JYAJ 2HFOA 2CYYA 4RNHA 4RU9A 1HUCA 2G13A 5TISE 2XEXA 3MAQA 4MAKA 2YX1A 3CGIA 3D6HB 3SFUA 4PJ0H 3A8IA 4KR0B 1UPPA 4XPCA 3TAMB 4EZ9A 1FXDA 3O44A 2HNDB 2E1RA 2N1TC 3OTOJ 2CZ4A 2DNRA 1MWZA 2ATCB 2I2YA 3C46A 1UA1A 4OL8A 1S1VA 1I51B 2PGCA 1FX4A 3VV2B 4PQUA 1RAJA 5D4NA 4R0JA 2Q79A 2XCPA 2KK7A 3AJ2A 4EO6A 3CCTA 5L1JA 2KFNA 2YKQA 2IM2A 4P72A 4DN9A 2ZHAA 2PP6A 1HW8A 1WC5A 1GMWA 1K73T 3RB0A 1RU1A 1S10A 1D09B 3TQEA 4ZVPB 2Y1IA 2BASA 4C8ZA 2R7RA 3VOPA 1FRKA 2OI2A 1SQBG 1YIJS 2CQDA 2XGPA 1T7PA 2G2YA 3LGMA 2BVZA 4O3NA 5DJUB 4TKTA 1QE1B 4YFUA 3QAUA 1FNOA 1TU0B 1GFWB 1Q4RA 2C28A 4OZ2A 4K4YA 2E5IA 4KAIA 1VR6A 3PDNA 2Z56B 3W8PA 2W2QP 3OJAB 1HI8A 5KFMA 5GAHI 1GK4A 4JI3F 2ZVOB 3OHAA 2R32A 1WI6A 4MTPA 2PD1A 2C2RA 2BR0A 2VF3A 2E75B 4X4PA 3OV7A 1S9EA 2KRBA 1WF0A 3SCLE 2ZH6A 1UJ4A 1TL4A 2NSBA 5JUMA 2QA4G 2MZQA 4YB6A 1RISA 1FKAF 3M4XA 1HWUA 3CCES 5APXA 3LW5C 4F50A 1YYCA 1YJWS 1V3ZA 1JOCA 1Q95G 5KJ7D 1S4EA 2FYUJ 3Q8PB 1NKCA 1RAHB 4LF4F 2DTJA 2M4MA 2W01A 2IZ0A 2F7VA 2MTLA 4J9SA 1N5VA 1J2JB 4EU0A 1A6LA 1PKUA 3GZ7A 3MOZA 4I7ZC 2IBKA 3H1JD 1N7SC 2W2PP 2K1RA 3H40A 1WHVA 3H2VE 1N0VC 4OH8B 1B4SA 3KK1B 1HMVB 4PD4I 4HYTB 1BGYE 5KAIE 4I6WA 3QSYB 3Q22A 1MROB 1N8RT 1KMIZ 5K14B 1YBTA 5KKZC 2GFFA 3QIDA 3TJ8A 2B5JA 1GMJA 3JSBA 1X9SA 5IV4A 3L72E 1PPJD 3SQGA 3PR4A 4MT1A 1JXEA 2MPUA 5FLXU 5HQLA 4JI8J 1R5LA 2LQ9A 1V6HA 1RT2B 4ZVHA 4IL6X 3D1OA 1WC0A 2OTLP 3WHIA 5G0RB 4NLQA 3HFKA 2UV8A 2W2NP 2FYUG 2ZYAA 1KONA 3VGSA 2AZ3A 4WVZA 3PJSK 4TQRA 2AJ4A 2MZSA 2RF2B 2OGUA 4DL0C 4X4UA 4JI1J 2UP1A 3A2AA 1KDNA 4K4VA 5GVQA 4OVNF 5CH7B 2KZMA 4Q2MA 1K05A 3C14B 3L70J 5BYRA 1CULB 1DTTA 2IAJB 3JTNA 1X9MA 3H32B 1FEEA 1EETA 4TY8B 2I9SA 2L48A 3KG0A 4QU7A 4KQZA 3TNUB 2LXFA 2QE5A 4DPUA 3Q8QB 3OW2O 2VDIA 3VWSA 5KJ7C 3UPFA 2FYNC 1JLAA 2ZH9A 1S1UA 3OL9A 3TI0A 3GG1A 2F8MA 3A8JA 4NL5A 1G1XA 3QFWA 2BCCG 3BM7A 1VC6A 4NYPA 3BV8A 1MLAA 1JJ4A 1DQ9A 1WSRA 4RW8B 5C42B 2C1EB 3O8ZA 4IUFA 1WWHA 2BEQD 4DFPA 2DITA 1LK5A 1U7JA 2FVPA 3KNGA 1SJRA 3B5ND 1CJTB 2XWYA 2RHSB 1VS3A 1N8RQ 1SKUB 1Q5YA 4X4RA 5D4PA 2UXBF 2GC8A 2X1AA 2NXUA 3AQOA 3VAIA 2XC9A 2Z2LA 1SFCA 4QBUA 1H3DA 3J7Z5 1VPCA 3AE2C 3P8CD 2KI7B 3CJQA 4OI3A 3P3DA 3T1YJ 2W8ZA 4XFJA 5AXMA 1TP7A 4CM2A 1CULA 3HE5B 1YJVA 3L72G 2Q7CA 1V3RA 1CJUB 4FXVA 3HJFA 1RHQB 2MEWA 5CZVA 3EFFK 4DPWA 4ID8A 1RQVA 1LWFA 5KFZA 4FYXB 2YPZA 1NLKL 1VQMS 2P5VA 3J7ZT 1R31A 1VBZA 1Q5VA 1S1UB 3IMQJ 2FDNA 4QYRA 1W2BO 2MYFA 2MQPA 2K3KA 2Q6BA 5C42A 1PZQA 3DLKA 2YNIB 2AWZA 4DR5F 3A13A 3DU6A 4MK7A 3DHXA 2BZ2A 2M0GB 1OVVA 4CLWA 5HP1A 2FC9A 3FEYB 2A18A 1X4AA 1WOOA 4OZJA 1S57A 2AGPA 4RX6A 4OHZA 3V5BA 1LOUA 1KILD 3RUBL 4O3RA 1KTQA 2AEJA 2FLOA 4MFBA 5GAEI 4YXWH 2XKMA 4ECTA 2K9JB 1FU1A 4EYHB 1NKBA 2ZZTA 4LREA 1C1BA 2E75D 3RK2C 2EBEA 2L9NA 1WACA 3MR6A 1KBRA 4NASA 2B6AB 4LLHA 4CH0S 4OHXA 3TYTA 2BJ9A 3LTOA 4HYKA 2L41A 1TVRB 1DH3A 2AP6A 4FKYA 4WY4B 1A9NB 3MTUE 3CX5E 1WC3A 2VG7A 1M0SA 4DFKA 1FZAA 2YKOA 1FWLA 3W7BA 4K35A 5F8HA 3BDEA 1XWLA 4CTAB 4K4UA 1IZNB 3G8TA 2M88A 1JKHA 5F8GA 2WSFJ 1HNWJ 1KN7A 4UB8H 5LM7E 4C0BA 3K89A 1G2CA 1G3OA 4K4SA 4OJGA 2Y8YA 3FC9A 3BBFA 3BBCA 3C3LA 3CCJP 2KYZA 2LLZA 2F9JA 1FO1A 4KGZB 3VGVA 2RU9A 1VHIA 4A47A 3HLUA 1PP9J 5HN0A 4WWSA 1AFIA 3JSMA 3ISND 1LTTC 4OYZA 4ZCKA 3GSDA 4C3LA 3FCVA 4B3SJ 3B6BA 2BEZF 4B3RJ 2H5IB 2DD8S 1YG0A 1NHKL 3L71D 3KJFB 3IWXA 4U8YA 2HPCB 3OD2A 1DZ5A 2RQKA 1N5YB 1Z2ZA 3AE6C 3ZTPA 1IM6A 3KK2A 2V9WA 2ACYA 3AAWB 2FLLA 1P27B 2LQJA 2AJ2A 2ZWOA 3FQLA 2X51A 2EFOA 1QJHA 2MMYA 3M6XA 2BUNA 1TVRA 3RBZA 1D9AA 2RDIA 2QJPC 2VG7B 4NLWA 5KFXA 4IR9A 3U1MA 1KD1T 1N33J 4DZ6A 2W9BB 4CO5A 2QL7B 2AGQA 2OYOA 2AXTE 3RL0B 1Y3KA 3L71G 1GK8A 1SQVJ 3EJMA 4ZNCA 5DQHA 4LF7J 1HI0P 1FERA 3HT3A 3LGNA 1EZZB 1B0TA 1VL2A 5CCGD 2FFDC 1REVB 5HANA 4B3TJ 5KLVK 2WRMA 1O8BA 2DNHA 1RE3C 3GLMA 3ZZYA 4UUWA 3HD7C 1Q8IA 1SJ4P 2VG5B 1HNIA 4GMKA 2WB1D 4R5PB 4C4WA 5HATA 2HQ3A 1SC1B 3M32A 1F3VA 1L0LK 4NXNJ 3P6YC 2VBZA 4RNMA 3V6DB 2DNPA 1K0TA 4EWTA 3N6NA 1UCNA 1XN9A 4WFZA 4I7FA 4K0KJ 3FKBA 1TKDA 3CLQA 4JV5J 4NLXA 2PN6A 4TQSA 4Y2KA 5KFGA 5APQA 4USUA 1N0UA 2L9WA 2RS8A 2R9LA 4CTAA 3VR1A 1NO8A 4NI2A 1IM4A 3L71E 4JI0F 3D7SB 1LTSC 2X1GA 3UO0A 4WP9A 2XHCA 1YJNP 1GW3A 4F25A 5KFOA 4DV4F 3VTIA 2O3JA 2MSSA 4I6MC 2BKPA 5M1BA 2RQMA 2JLEA 2PE8A 1Q53A 1X79B 2EI5A 3LWLA 1HNZF 2DIUA 4TLFA 4C0OC 2F65A 1RZMA 2CVEA 1ZM3A 2FYZA 3TF5A 2KHDA 3MM7A 1VQ8S 5B5EE 1HQUA 5B5EH 1BQMA 2BW7A 4ZLLA 2OAUA 3RL0C 2CPXA 3K58A 1VQOP 2KTQA 5AVTB 5K5MA 3LWMA 2IFXA 1SQGA 3JQMA 2O01H 2CFXA 1AW0A 3GB0A 2ZJPQ 1SQBK 1UPMB 5KFIA 3KLEA 3ONQA 3CO9A 1HNXJ 1U1RA 2DHSA 1NJXA 4LIRA 2R3CA 2JWAA 3H20A 2Q3IA 3D0HE 3SFDC 3VAFA 3AJDA 1LEOA 2CG8A 3UVJA 4OHWA 3QNWB 3RBXA 2VPXB 2Z30B 4OYPA 3J81Y 4LSNA 1X5SA 5F3ZA 3G6XA 2HHVA 3N9UC 2VV5A 3NCQA 4USKA 4XPEA 1BE3D 4WP3A 1E6VB 2EPIA 4LF1A 1F5CA 2C3UA 3PW4A 2MQOA 1G1JA 2CQ2A 3CJKB 2V7QH 4Y2MA 1BWVA 3CEDA 1WSVA 1ZRTE 2PMHA 4OYBA 1CS4B 1EDJA 5JMNA 2HODB 3DGVA 1RCOB 2GHVC 2KG0A 3H1JG 1HQ2A 2V5HG 3FWLA 5DS7A 4B3RF 3HE5A 2EFGA 3E3XA 4ZOSA 4CO2A 4U67Q 1NHVA 1WG5A 2ZZMA 1IKYA 2K9JA 2QLJB 3KMQA 5EWEA 3GF3A 1VC0A 1J5OA 2OELA 5DDRC 2QJYB 2CNOB 1U1KA 3MEGB 1S9GB 3C6UB 3GIKA 3HTKA 3T5KA 3CI9A 3R9LA 4X4TA 2IJRA 5AE2A 3AD8C 3U27A 1RTIA 1U6FA 1ZZNA 4GT1A 2YXLA 1RKIA 2FY8A 4GVBB 2E5LF 3PO5A 3W9JA 1FFWB 3HI9A 3M30A 3IAS9 3TEGA 3CXCR 1QVGO 1JLEB 4X4QA 2RMZA 2P67A 1FRHA 4JI4J 3TJ9A 2GMHA 2QTWA 3Q5SA 2BMBA 3MR3A 4ZP7A 1L0ND 2KYVA 4O44A 3I9ZA 4J9UE 4IRKA 1TL5A 2P6TA 2JVOA 3PKMA 4OWFA 3OT9A 2J58A 2B6AA 1YTYA 1NK4A 2DNKA 2RD5C 2OHDA 2QSFA 4QPXA 3I4HX 1T11A 1H2VZ 1FJPA 2HHXA 1ZETA 1UJ6A 1KRPA 4F67A 1U02A 1KZUB 3MCOA 2KO1A 4NE9C 4X65F 3QAEA 2UUBF 4E8UA 2IRYA 4PV1C 1TZ0A 4CRJA 2FYNB 3UW1A 3BKFA 2HNYB 1SQXG 3E8OA 4OYAA 1N6QB 3VCDA 3GLJA 1FWKA 1FBMA 1OZHA 4B86A 1NZ8A 3SWKA 2O66A 4RW7A 3CDWA 3R5JB 4H13D 4DSLA 4ALZA 3TR5A 4K2JA 5KT7A 5GAGI 1EX8A 4CQ1A 3BRTB 3I5CA 4ANDA 2GIFA 1YKWA 2GS8A 1NTZJ 1CG2A 2WVBA 3RBDA 4IRDA 3TNUA 1LWUA 1YQ4C 4M94A 3CCUP 1Q16B 1Q8BA 4TNOA 4EBEA 1LTGC 4PEOA 2D3O1 1OY6A 1SJFA 2O01C 3F56A 5HMZA 2BE2A 4UY8T 2QYGA 1XBWA 2ZOFA 2HFED 4F0MA 4F36A 2R8GA 2XNRA 3RGUA 2GCFA 1YLXA 5ETNA 4J90A 4ZPWR 1HFEL 1I3OB 3PTZA 3ZTRA 5BXIA 2VOOA 4PPDA 4YR3A 2I1RA 4YXDC 4HKZH 2B4PA 5A0YA 3BJYA 1OVUA 1FZCC 1CS4A 1KQGB 2ZXXA 5KLVG 1SQBD 1CJUA 3KYLA 4FYVB 1KFDA 1FD2A 2W83C 2LEBA 1PBAA 2YMYA 3MWBA 1JK9B 2QFJA 1YZ6A 5F9LA 2XS5A 4DOZA 3S1TA 4DR1F 5D3GB 1BGXT 2FY1A 1EZVD 3L74D 1E6YA 3TW0A 1NU4A 1YX2A 4IR1A 1QM9A 2CDQA 4RUBA 5JJBA 4KHPJ 3AD7C 2JL9A 1FJKA 2XZTB 1IK9A 2DHXA 5DGAA 4ZVEA 2PC6A 3ABVC 2DEIA 3NS6A 2FVSA 1KB9E 2D9PA 1EIYB 3OL6A 3H1KE 1WRGA 1PP9D 4OZNA 3LIEA 6FD1A 2WSFH 1Z4UA 3Q8VA 4CIOA 3EFGA 4ZS6A 1YRXA 1NOHA 2JO1A 4WY4C 4GKJF 2K7KA 3FMBA 4LF4J 3GIIA 1LP1A 5I42B 3IR6B 1XIQA 2B4OA 4HVZA 2IDLA 4OYOA 2J0WA 2OARA 4C7RA 2C2ZB 5HI7A 1C2PA 2DO4A 2C3PA 3IRXA 3KJQB 3KNAA 3P96A 2DBBA 3ZNJ1 2VC0A 2WVRA 4HL9A 4LR7A 2KN4A 2RB7A 4AXIA 2ZVNB 5GMDA 1KQSO 2RH0A 3NS7B 4EBCA 3M9OB 1U45A 3EWGA 3BCCG 1VK8A 2W6AA 1K9MQ 4ENOA 4DU8A 5L8RC 3OUYA 1KR4A 1DX7A 3UDEA 1VRUA 2QRRA 3Q8SB 4NPDA 1S6UA 2KXHA 2WT7A 2ZM6F 4DR2J 3PFOA 4IYQA 4IG0A 4Z37A 4X65J 3UR3C 3CCLS 2V7QJ 4Y34A 1VQNS 4E98A 5A8RB 2RJZA 1NU1J 2MKYA 1VQ6P 3OXFA 5HL7Q 1QVGR 2XSJA 4RBTA 3I87A 1VQPS 5J2NB 4BLGA 3OR1B 1N73A 3P49B 3BEGB 5AVUB 1U2CA 2XNDH 2QGFB 3RB4A 2Q1LA 3PTWA 2CZVC 2CRLA 2ZVSA 2VQEJ 3R1HA 1IQZA 2MKSA 2HW3A 2HVEA 2OLWA 2IHR1 4M8LA 4HH2A 1PAEX 1S1TB 4ZK7M 1WELA 3DN9A 3CJ0A 3QGGA 2R2UA 1WDTA 1BXNA 1SFCC 2UUCJ 2E9TA 2NPSA 3TGUJ 3HD1A 1T6AA 2E44A 2FZGB 2SXLA 3A8KA 4BWMA 2Z2MA 5M2PA 3KZIH 1NKNA 2F3JA 1VQMP 4ILMA 2BE7D 5J1PA 3D54A 2KJWA 2X3DA 1FRIA 2CNLB 1L4AA 1Z2LA 1GMWD 2E1MC 2MQMA 4KY3A 2IM3A 5G0RA 4KRWA 3QQCD 4ECUA 3K5MA 1NB7A 1UVIA 4AFFA 2PT0A 2JDIH 4HJGH 3TX0A 2ZDOA 2KVQE 5EN1A 2WT7B 4TU9A 4ZPDA 2FHOB 1M1GA 3BPSP 3DFEA 1BQXA 2NYHA 4DR6F 5E7OB 1RWMB 4TLRA 1D0EA 1GTEA 5CHXA 2JC1A 1KFSA 1BSNA 4C8KA 1QD1A 1HWKA 3GJRB 2O01N 1N6QA 3TUPA 1GTWA 1WC6A 2A1BA 3W5ZA 4OHVA 1KB9H 2KT3A 3HK2A 4LRAA 1RK8A 4IOBA 5I42A 4RNFA 1TKXA 1S5LX 3AD9C 4MKVA 4DR1J 4G6VB 3AE1C 4MH8A 1HTLC 2KOGA 1JEKA 4HHHA 4KE5A 3MM5A 2A45I 4KHPF 2WVDA 2RUSA 3RB6A 2GM4A 3G6EP 1S5LH 1U1PA 2CUYA 1WMKA 5HSPA 1RT6A 3VQSA 2V4JB 3HKZD 2AW0A 4DL3A 4DR3J 2J7WA 1KB9D 1URQC 4DR5J 5KFJA 2JLFA 5LT5A 3IC1A 2VPYB 2D7SA 4WFYA 1FD8A 1EDLA 4PG4A 4ILLA 3OW2R 4DV3J 5L1KA 2WSCH 3MI7X 3CCZA 4AXJA 4QR2A 4FS2A 4FBUA 1SS1A 3PACA 4DV6J 1MNEA 1R5SA 3S1KA 2Q3PA 1OIPA 2DVIA 1ZH5A 2RRNA 2Q9IA 1OY9A 2ZD1B 4IH7A 1Y5NB 5E79E 2E1CA 2CDRB 2DYAA 3TAMA 2PI4A 3Q86A 1LT9C 3CX5H 4N6JA 4IQXA 2P8IA 3MEDB 4HTJA 3J81U 2OEKA 2F4VF 3A4TA 1YBKA 5CD4A 1EQMA 2I0XA 4ZJOA 4KTQA 1U47A 1AVYA 4YY3F 5AVQB 3GYNA 4N5SA 1IBKF 4IG3A 3AA8A 3V6DA 1TR0A 3X3UA 2DISA 4ANEA 3C16B 1R0AB 4ED5A 2OTJP 4AL7A 1R0CB 1IKYB 4EBDA 2E42A 1KLMA 1YBAA 3EYZA 2IY5B 5LJ3Y 1MU2B 3HUSA 2FC8A 4BS2A 3CTRA 4DT0A 1XMOJ 2M5AA 4RW9B 3Q1MA 1SUQB 2JJ4D 1RAFB 3QPIA 3ZC4A 3HSJA 1GDTA 4F4YA 4NRTA 3R7SB 4C7NB 3CJ8A 3KHRA 3N5FA 4B3MJ 1ZZFA 4KO0B 2EXUA 1AROP 1S6PA 4N56A 3RJMB 2VU5A 2QL5B 4NEZA 3OFGA 4DQRA 1HYSB 2WPQA 3MEDA 2XZWA 1NTZK 2OYHC 4QYZK 2GMJA 5I4MA 5HLFA 3F89A 3W66A 2F4FA 4IL6H 1N7LA 2MZTA 2UU9F 3D6ZA 3UDLA 1MN7A 2KFYA 3KFWX 3NP5A 3B4DA 1Y5IB 3DXSX 1VF5C 4Z2XA 2WSCC 4GO5X 2VFTA 1N32J 5IQ6A 4M5IA 3EXCX 3W61A 1AVOA 1UVKA 3RU0A 4X4SA 3OFEA 3EDRB 5AVRB 2DHHA 2J0SD 2ASYA 3HP6A 1HL6A 2J5AA 2QLFB 3T97B 4X84A 3NL0A 4W4MA 3PV8A 1T9TA 1BHNA 4LFAF 4C7NA 4I2QA 2HAIA 2V69A 5K20B 5C39A 2JC0A 4K0KF 1RTDB 2CPBA 2JDJA 4Y6IA 2KXFA 1LKZA 3TA1A 1BGYD 2AMCB 3ENAA 5C2GA 4WZMA 1FZGA 2XNQA 2R4FA 1Q86T 4U9RA 1R7IA 2VFRA 1QVFO 3CMAS 2RS2A 2H48B 3DYAA 2NXJA 5HVHA 1X5TA 3VP8A 4U3FJ 5KFSA 4IFYB 4Y2CA 2UVUA 1SV5A 1ZXGA 3R3TA 1ZV8A 2B8QA 2DIVA 2VQFJ 3EXYA 5K8OA 3RK3B 4O9BA 2W4PA 3IR5B 4ED0A 3CC4P 3PIOQ 4JBCA 1NSPA 3H32A 1SQBJ 3WC0A 2DXFA 1LQ9A 1TMJA 2WK4A 4EZ6A 3DOKB 4WF9Q 5KFTA 1OW6A 3KXDA 1IKXA 1HPZA 1KILE 4ECRA 1BDDA 2N7CA 3J7AN 1S4XA 1ELOA 1RF1C 3I5AA 3ELHA 3R7BB 4K4WA 2NCKL 3M6UA 5LJ5Y 4XO0A 1X0PA 3T1HJ 1VF5D 2HPCA 1RT4A 2NUHA 3CXHE 2IFNA 2W25A 1VBKA 1L3UA 4CH1A 3OTBA 5KG3A 1LTJC 1SKSA 2AT1B 3V2RA 3UIAA 1AFOA 1KV4A 1XERA 4U3FG 1NBEB 4ZHRB 3CC2P 1CJTA 3PHEA 3ZZRA 3W9IA 2JEIA 3QATA 2HLUA 2YH0A 4NZ0A 2FZKB 3HHNB 1TK8A 5DZ7A 4DV1F 2M52A 4PUOA 3JAMY 5KTBA 4FZVA 1DIPA 1VFJA 3G96A 3ZZ0A 4ED4A 1L0NG 3RRHA 4Y2AA 4IFYA 3MD1A 1N2DC 1R3NA 3HFZB 1YSJA 5B09A 1GXUA 2VKZG 2XLJA 4FBTA 3MTKA 1WEYA 4HHJA 1T3OA 3C6UA 4WFNQ 1WD6A 4P52A 2XWXA 1GX6A 1R0BG 3S01A 2IYOA 3V6KA 1NTKK 4JI2J 4C46A 4B3MF 1C4CA 2DRDA 4R5PA 2XM3A 1M8OB 2LQ5A 4IL6E 3HD7D 2B43A 4ER8A 1HBWA 2MKVA 3EZUA 3L73J 4WJBA 4ECYA 3MMCA 2MY8A 3B8EB 2CQCA 4URQU 2QN6B 2R8IA 5IZHA 2FXPA 3M2RA 2BX6A 4KT0C 1HNXF 3HSZA 4IFVB 4K2XA 2ASLA 5AVZB 1EAYC 3BO2A 2HKEA 2WW8A 1K1SA 1A02J 1RF1B 1RF0C 1JLEA 2MKIA 3RK2B 3ZZTA 3UD5A 1K44A 4YB1P 1T9YA 3KHGA 2R2SA 4A8OA 1XC9A 3DMJA 3GQCA 3CW2C 4QWEA 4YDDB 1T3JA 5DJTB 2QZ8A 3E01A 3OR2A 1I6JA 4A8QA 1C0TA 5E3RA 3SEOA 1F5BA 1PC5A 1GD2E 3WUUA 2EFQA 2AHOB 1U25A 3H1KJ 3LH2S 1LWEA 2Q1KA 1RAAB 1MFZA 1FRXA 1JLAB 1T05A 4AUKA 4LF8F 2OPRA 2D2CC 3FSXA 2I1KA 2BOPA 3T41A 2AX1A 4LF2A 3M8QA 2DNYA 4U3FE 3RR7A 2ZHOA 1M5KC 4WCEQ 2CNNB 1VLYA 3AEBC 4J5OA 1M1JC 2CZ9A 2MDAA 4JUZA 2V67A 4FVMA 2CQBA 3CCSP 5TISH 2K9YA 2ZT9D 3BZQA 3SCJE 3P8MC 3RTVA 4DG1B 4ZVUB 4I1LA 1N88A 1PIEA 1SQPD 1O0PA 3ET6B 1NNDA 3CD6P 1LT1A 1RYSA 1XK8A 2MZ1A 4DCKA 4LSLA 2MKHA 2KVIA 2C2KB 5A8KB 1WT6A 2CJYB 2O1JA 4WZQA 4EDFA 3MUVP 3A5TA 2R7XA 2W27A 2HGNA 4QIWD 1S1TA 2KNCB 1N34F 2JEJA 1RF0A 2OFGX 2Z5HA 3G87A 4FF1A 3BSOA 4H54A 2H3EB 5D6GA 4P7TA 1YRUA 1S1XA 3NXZA 5HAOA 4H13B 1LWCB 1K8AQ 3C6TA 4PXCA 3V81B 4G1QA 3TVYA 1K0VA 4EO8A 4P71A 2DY9A 4GC7A 2CPDA 2ZC4A 3DI6A 4Y28C 4F04B 3BYRA 1FDDA 1NSQA 4HI2A 4C11B 2J59M 1JLBA 2ASDA 5TJHA 2MQLA 3V4WA 3MM6B 2EVZA 2WONA 1KKHA 2JEFA 5FJ4A 3H8YA 1KQKA 4NCBA 3AJ1A 2ZJSE 1TL1B 3EMTA 2HQGA 4F3MA 1RBOB 1NTMD 2H43A 5F0UA 2HYNA 1W2EA 4BWJA 5LL6d 1MZ9A 1REVA 1U1NA 3P5TL 1L0LG 3PYDA 2ZH1A 1HJBA 4J91A 2GJFA 4DV7F 3CXHD 3FWNA 3VYIA 4PKDB 3TUZC 1EP4A 1PP9E 4FYYB 5F8JA 1HR0F 2KZJA 2YWGA 3UN2A 3FQKA 3FJ2A 3CJ4A 1OMSA 5HQMA 4TY9A 3N79A 2QMWA 2CJ9A 5A2QY 3I32A 1B7YB 1KLMB 5CJ0A 3GE9A 1UZHA 2GA1A 5DQGA 3SYZA 3WIVA 1QAYA 3JCUH 1QAIA 4JYCA 2ADCA 1MWYA 3CX5I 3L7PA 2B9YA 3TUIC 3VZIA 1H88A 1RKJA 3L73E 3AB2B 4OZ0A 1T0TV 3D6FB 1RF1A 2OSQA 3I9V9 5KT4A 1W7WA 2R42A 4WIIA 3T5JA 3LAKA 3OR1A 1ZP0C 1FXLA 2IPPA 3I56P 2WONB 1SQQG 1KS2A 2YQ1A 2ZT9C 5LSRA 1HGVA 3MM8B 1SI9A 4I6YA 5K8NA 1NK9A 5KG5A 1CEZA 1U09A 1QSSA 1A02F 3H25A 3VMZA 2ZJQQ 3ZTOA 4B9SA 4ZCLA 2XGQA 1RWPB 5AW4B 1U1QA 1B7FA 1IVZA 2VJUA 1JB0J 3CT9A 4RZRA 4DCJB 4PV1D 4DL6A 1OQ3A 2Z2YB 1VQ5S 4F0HA 2LQ8A 2IA6A 3T5LA 4C2MA 3G2XA 2LXBA 1YQHA 4F3QA 2CQGA 5LMNF 4CM0A 1VJWA 1RE3A 2GUVA 2KU7A 3WUTA 5K9FA 3PHLA 3VAHA 1E79H 1C0UB 2CKWA 4DR4F 2O1KA 2WBRA 3FRYA 4A8XA 1YZ7A 2DGSA 4GVBA 2B0GA 1VRTA 2KM8C 3VGUA 3B4MA 3QFHA 4HR2A 4IOAQ 4N7TA 2DO0A 3CCJS 3N6LA 2W4DA 1J1EB 3HHLA 3BCCD 2EW9A 2C42A 4I2PA 3UNYA 1L0NK 1VISA 2U2FA 1SL2A 1RI7A 3GFYA 3MD0A 3C16A 2DXEA 3Q5PA 3M06A 2YWKA 5IQQA 1KHVA 2XMKA 1NSKL 1WKLA 5CBOA 1FCAA 2ZWPA 1RTZA 3UI3A 3K59A 1R6VA 5DDOC 1KB9I 4LBPA 3A0BH 2XULA 2QJYC 4DPXA 1QAJA 1S3JA 4RJVA 3W68A 2ALYB 3R5GA 2VODA 3HXMA 2ZT9B 2UUCF 1Q81T 3H1IJ 4BWNA 2WPVB 3CWJA 1N4LA 5K8PA 2OEMA 3AE9C 2R3SA 3WUVA 4KC5A 2ATLA 2BKOA 5E41A 3RR8A 3QYYA 1S9GA 4UOFA 2NXNA 2UXCF 3K5PA 2C9LY 2OD6A 2IYPA 3UDCA 1UZDA 4DX7A 1N5TA 5ETPA 3OSNA 3DRXA 3L7UA 1JJ2R 3MMBA 3ILIA 5H2FH 1PBUA 3SMZA 2FJVA 5M2UA 2XB2D 4H4KA 3L72D 2DR6A 3THPA 3PW5A 3FEZA 3JS9A 1RCXB 2K7JA 5CCHD 3W64A 2VOPA 2RRAA 3RK3E 2VASA 4PG7A 4A8KA 2KB7P 1FFSB 4ID5B 1Q81Q 3V4MA 5DLFA 4NMLA 3VP9A 4CO3A 4J9RA 1KEKA 3JSMB 2QVAA 1NJYA 2A6OA 4HH0A 3ETMA 2DGOA 1GU5A 1EXIA 1TELA 5ETKA 3L73D 4EMDA 2RN0A 1FKOA 4Q8FA 3QGHA 1LXJA 1Q2NA 1LT9A 4DFMA 1SIWB 4NX9A 4NPOA 5G4DA 2DNMA 1HNWF 5H9FJ 1FOSF 1V5VA 3L75D 2BCCD 2R7VA 1U0HB 1RLCL 7FDRA 2E5JA 2DNGA 1X22A 3L4BC 2GQCA 2W1BA 3OAKA 1S6QA 2FLNA 2O01J 3NWGA 4K4XA 2IMOA 1QTMA 2GIRA 1X9VA 3L75E 3NGSA 4ZLPA 4JB8B 2I8DA 1NEEA 1EC5A 4A8MP 2IYIA 2YX4A 3GFZA 2ZBIA 3CCLP 3C15A 5KFYA 1FNMA 2WVCA 3W5XA 4I67A 3HT0A 1QAXA 4Q0BA 1X31C 2ZNZA 2DB1A 5IXUA 2RE1A 2BV3A 4DL4A 1GW4A 3H1LJ 2PMZD 1EZVI 2YNGA 2MHEA 4WE1B 3GTYX 1SC3B 3RK3D 3KLHB 1R8AA 3SWFA 1AQTA 4OZLA 3MCMA 2PFDA 3N4XA 2NPSD 3AE3C 1R8BA 1PL5A 3M8PA 1JJHA 3DLHA 3QT5A 2RRBA 1FKOB 3E51A 1SQXD 3D6MB 2QM7A 4C7QA 1PCAA 1GU4A 1PPJG 1XTCC 4Q45A 1U7MA 4HI1A 3LGHA 2RDJA 1ZMEC 3M91A 4LVOP 2H89C 1U24A 4KO0A 4K5SA 2D3UA 3A0HE 1SH3A 3GV8B 1KQSR 4DEZA 5AW0B 4B3TF 3C14A 1VQ7P 4ZHRA 5HMYA 4YHHJ 3W2WA 1OO0B 3ZTQA 4D6TJ 5GADI 3L4FA 3CC2S 5FDLA 4TXSA 1WUUA 1JLGA 3D6YA 2ZZNA 2X3GA 4DPOA 3M1VA 3DDIA 1IN0A 5D15A 5IT4A 1K04A 3EGWB 1O51A 4LUBA 2W24A 2O1PA 3BGLA 3ZDMA 1RHRB 3P5BP 3TA2A 2M9KA 1BGYJ 1HWLA 3WIUA 2UVRA 1NCLA 3D2WA 2LU1A 4IFVA 2Z4PA 2J9EA 1TFYA 3K8WA 4JI0J 2Q3EA 2PI5A 3HFVA 2DPIA 2OP5A 2F4VJ 4N77A 2EC2A 2I5JB 4PXEA 1PIXA 2FLPA 3GIRA 1AA0A 1S79A 1FDNA 2WOMB 2UUAJ 3MZWB 2ROPA 3K5OA 3D1HA 3CE8A 5EUHA 2HBZB 3ILJA 2XHWA 1PJ5A 2PEHA 2MZRA 3TVZA 1KNZA 4K50A 4UTGA 3F0NA 2R7SA 2VHGA 5KFHA 2KT2A 3H1HE 1LTIC 1R27B 4LF9J 5J2QA 3H1JJ 1BLUA 3NRBA 1V5IB 1TU3F 3V2PA 3CL3D 4OLPA 1M1JB 2C2NA 1K1QA 3T1AA 4Z1MH 2V8DA 1NTZD 2KLVA 1I94F 4EIJA 1VQKS 4FNHA 3SIPB 5E3PA 4JI5F 1SBRA 3IFEA 2GGPA 1P84E 3C8YA 5HBMB 1S1WB 4DQQA 4X4NA 1JO5A 3D3CJ 4USHA 4DZDA 1XEZA 3EVMA 4NPFX 1ZRTD 4IQMA 2ADBA 5GTHE 4DF4A 2E74D 1SQQE 2H1YA 5KLVD 3M8YA 4CZCA 1CLFA 2G1HA 3CMES 3POTA 2YWEA 1VYAA 1F5AA 4QQBA 4UB6H 4NCAA 1JLQB 2B87A 4UB8E 3ZZPA 2IBZI 3VMXA 3AH6A 4CLTA 3BGUA 1GK6A 3PXGa 1GMUA 4FYWB 3DOMB 4CPGA 2XZRA 4FPRA 1F0XA 4NLSA 1GZLA 3POTB 3L75J 2ZEJA 4K4ZA 3T9NA 3MUMP 4PYAA 4W80A 2IAJA 2KIKA 3BGRB 1NTKG 1Y4ZB 2QL9B 4P73A 2BYCA 3DYAB 4JV0A 2ALZA 4P2SA 1HNVB 1Y11A 2A06D 5I3QA 4ZJQA 4RKUJ 2PO4A 2WTYA 5CAAA 1S6OA 4FDFA 4X64J 3R8YA 2BANB 4D3HA 3N5BA 1XTZA 5DQIA 3N0VA 2DNLA 5KFFA 2OMOA 3QIPA 1VDHA 1YJ9P 3RRGA 1RAGB 3B78A 3PLNA 1KTMA 4P75A 1NM2A 1SQEA 1JLGB 2MLZA 4XTTA 1L3VA 5HLFB 2YX7A 1IWAA 1RWNB 1S2EA 2IDEA 4ERDA 2G2OA 2OPPA 3DI6B 2HHTA 4Y65A 1FS0E 1N54B 1G1IA 3J7YI 4QMAA 3BO3A 4I2PB 1Q86Q 4ZIWA 2W6BA 3AEFC 5CYMA 1X60A 2B9XA 3AOCA 1NTKJ 3P7KA 1D3WA 1SH2A 3SCKE 3BYPA 1LP1B 3QZ8A 3H1IE 5AE3A 2B8PA 2XTJP 1BSHA 5KAIH 2LVWA 4QW8A 3OFFA 3G3ZA 2QMXA 1NTZG 3PW0A 1VQ4S 3M2RB 2H8PD 2POKA 2DPJA 2Y0EA 3C15B 3HUSB 2FVCA 3ZXWA 2Q5UA 2FB0A 2CQIA 2P10A 4M1KA 5A6PA 2B7BB 3R1LA 1JLCB 1M1HA 4HACA 4DF8A 3ZZZA 1VQ4P 1P9YA 1NYHA 1BE3J 3QH9A 2OPSA 3AQPA 1NHLA 2P6SA 3VN0A 1TL1A 3H0PA 4CI0B 2W2OP 4ELVA 2VIHA 2OPPB 3CCWA 4G65A 1M90T 3C6TB 3V81A 2G9OA 2DK2A 2WPSA 3B4SA 3HSDA 4ED7A 1PO6A 5E2QA 1AZSA 2Y0CA 1EKSA 5E33A 4N8OA 4FS1A 4QWBA 2R7WA 4WU3A 1YJUA 4EK2A 4HKQA 1Q8LA 2C3OA 1HNIB 1RACB 3TEHB 1LTAC 5F41A 4CO0A 4KBIA 3OJUA 2HS0A 5A0YB 4QR1A 1W26A 2VKRA 4FYDA 1NK5A 1HQEA 3PYEA 2DNOA 1H7WA 1BDCA 2U1AA 1DTQB 4NCGA 1UEVA 2PA8D 4Y00A 3FFIA 4TVAB 4LF8J 1XMQJ 1FEHA 2VG6B 3CWBD 3R2PA 1VRQC 5BVZA 4NLGA 1RT2A 5KG4A 1RT7B 1MMNA 2YWHA 4A8SA 2OYHA 2LKMA 4LQ9A 1U2FA 3IBCB 1RHMB 4OYMA 1SVFA 3HZGA 1T9XA 1MV8A 2AF6A 1T9WA 2L08A 3FUYA 4BC7A 3FBFA 1J1DC 4H0LC 5ITHA 4DUTA 3M9QA 2XMAA 3MMAA 3BQ1A 2J7UA 3DM2B 2C2OB 3HZEA 3CX5D 3W5YA 3JB9k 3BVHA 2D74B 1RA7A 1GXTA 3G82A 1RB0A 3OLAA 3DLKB 3DRYA 3RAMA 5J1EA 3R5DA 5J2NA 4ES1A 3AB4B 3FDSA 1R8PA 1GXLA 2D41A 3M6VA 3A12A 4HB1A 4U96A 2ZFCA 1OPIA 1DEBA 1I1GA 3SI8A 1AB8A 4EUVA 5CXTA 1DD4A 3HHDA 5AVVB 3ENQA 1FZCB 3MP7B 1FZBA 2BCCE 2KP8A 4UF4A 4CT9A 3D4JA 2Z5IA 1IKWB 4DI6A 1HJ0A 1SQFA 2QLXA 3L36A 3R97A 1T2KC 3J7YU 2QE7H 2ZC3A 1IKVB 2CQ4A 1JMBA 5KT6A 1IXKA 2RH3A 2RNEA 4MYUA 1HWJA 3HD7B 3I82A 1OPZA 4DSEA 2DGTA 4AUWA 3FBCA 1B99A 4CLZA 3DRSB 4DSIA 4ES2A 4JI6F 1HPZB 2V63A 1G2CB 2I6WA 2HK3A 2OH2A 4ICLA 2KSJA 3D0IE 5KG7A 3JSVC 1HNZJ 3L37A 1S7HA 1REGX 2QG4A 3ISZA 2AD9A 2VBWA 4NA1A 2CADA 5AVYB 4KFBA 1Y7PA 4ID5A 4OJ3A 3AXMA 4A4JA 5H1SV 3QJPA 1QL2A 4CP5A 2QX0A 4U7CA 2OPRB 2GVZA 2YKNB 5IV3A 3ITHA 4NXMF 1YRTA 1DEEG 2WQYC 3VMAA 2MLXA 1Q8KA 3O6QB 4ZPAA 4WTYA 3HDSA 3UQSA 2APOA 2F63A 4QW9A 4WFAQ 3GF7A 2IRUA 3ET6A 4B08A 1RDRA 4WP8A 1D7MA 2FQQB 2A06E 4QZVB 3US5A 4MMOA 4F26A 4M5JA 1DY3A 1TKZA 4F4KA 5GMKa 3ILLA 5IC6B 2LQBA 1ZOYC 2BJ1A 1VC5A 1NUEA 2OFHX 2QC3A 1RAEB 1JJCB 4YMEA 1AZSB 2K88A 2E74B 1XNQF 3K0JA 1X4DA 3DHWC 2XSJB 4QJVA 3TA0A 2XI3A 3T6BA 3WC2A 3TQ1A 2HHPA 2Q43A 1IK7A 3G71P 3NG8A 4QPTA 4MKBA 3L74G 3USSA 4OV1A 2HFSA 4YDXA 2A10A 1JXLA 1SXLA 2V34A 3HHLB 5K5GB 2RSQA 3NBPA 3GCXP 1B64A 3HVRA 1IBLF 1YK9A 3QJLA 3AEDC 2R7UA 3HD7A 3QWUA 2BJ3A 2NPSC 2ILYA 3L9ZA 1SCJB 4Z7YA 5CMZA 2ZBCA 2MKJA 3Q5RA 4DX8H 2CWKA 1CSJA 1IFPA 1MG7A 1D8ZA 3IF4A 4JPZB 1X5OA 1EQ0A 2QEXS 3M9BA 2NPIA 3F5HA 1S59A 2DR9A 3EM1A 4ZVTB 1E6VA 3UD3P 2VPZB 2E5TA 5KFPA 4CCHA 2K06A 2FGOA 4ZVSB 1HBOB 2M8DB 3CWBJ 1Y00A 1D9FA 3Q83A 5B66E 3LP2A 2FYUK 4X4OA 5A8WA 3QMQA 4XA4A 3PVXA 1RHKB 2RKLA 4RR5A 4OV6A 3OTCA 4LF6J 4LR9A 2V8HA 3G86A 4HHUA 2M8HA 2V2KA 1JNRB 2W2MP 4ZKAA 2QEXP 2FHKA 3O2IA 3IXQA 1F6TA 4DR3F 2A06G 1H73A 5FIIA 4KFBB 1UVLA 2ITAA 5KOXA 3ADAC 3W9HA 2NYIA 5KT5A 1JKHB 4DUYJ 2KG1A 3U02A 2ROGA 2AXTH 3AEGC 1NJWA 3W2WB 3CD5A 1KD1Q 2ZH5A 4OIXA 4DV3F 2RAQA 3V6IA 2V8GA 1VQOS 1SQVK 3B54A 1PJ6A 4DV1J 2LFVA 4ED3A 4DBQA 1YVFA 3HHEA 4ECQA 1KP6A 3E7KA 4JI6J 1NAFA 3AEEC 1GL2D 2WCXA 4WXWA 3A3YB 5MAOA 4PCQA 3THVA 1TV6A 4PWDB 1HBUA 4WY4A 1CQNA 3DKDA 1DTQA 4O44B 2B9BA 2BA9A 1HNVA 2DNQA 1NK6A 1Y47A 2B5JB 2FYUE 2OD4A 4PV1B 3KJVA 1J5OB 2W7PA 3VMYA 3K57A 2GQ2A 5LMUJ 1H0HB 1KYOH 2L5GB 2CNKB 1YGYA 3T97A 1ZA1B 1NH8A 2X1FA 2YPYA 2B4UA 3AODA 2E7VA 2E1PA 3NFQA 4ELTA 3BO4A 2LR2A 2J5UA 4FF2A 4P2XA 1S77D 2IVFB 1UL3A 2BQ3A 4J9OA 1MUUA 5LXRA 4JI1F 3QGPA 3N6MA 4DR7J 1HLWA 3PJXA 2VUGA 4DDFA 2AU0A 1VBYA 1Q0NA 1B0VA 4DX5A 3TARA 2B56A 4I68A 3G82B 2VRSA 2ZXEB 2ZKUA 1GL2B 2XV5A 4WKRA 4PUOB 2EC0A 1X5PA 1RTDA 1BQMB 3H5UA 3MD3A 4ILRA 2N7YA 2B9WA 2AYEA 3NAIA 1FHTA 2GAGC 4N76A 4AT1B 1EARA 4YR0A 1VQ9S 1SUQA 2G0IA 1TV6B 1VQPP 3MOJB 1YITP 2RDDA 1NKZB 1AUDA 3L73G 1CW5A 1VQ6S 4ETZA 2R8HA 3V6JA 1RT4B 5L39A 2EBGA 2UU9J 3GWCA 3I56S 1Q82T 2C3YA 1RA6A 2CVIA 5KFNA 4YP3A 3BGOP 1ZN5A 2ZAEB 3TOQA 2FJWA 1H2UX 2GJIA 1EDKA 2N82B 3MM5B 3H5XA 1VQ9P 2AJ1A 1PG5B 3FXEA 1S1WA 5KFRA 2IBZD 5C24B 2QIFA 4RL1A 2Y3YA 4Y99C 1J27A 3M0AA 3MEGA 2ABYA 2KDOA 1CJVB 3Q89A 1U1MA 2O3DA 4L6V3 2HWTA 2MXYA 3GIJA 3K5NA 5EWFA 2KRRA 1RYRA 1Y10A 3H1KG 3S6EA 2YNGB 3CWBE 4X66J 4C6AA 3QIPB 2XY5A 4HT5A 3BS9A 1RUSA 3WQPA 1QUPA 2D3OR 9ATCB 1DQ8A 4C8OA 4DL5A 4KH1B 4P6QA 1KC8T 1WEXA 3BGFA 2HHHF 3Q2SC 4DL2A 3T3FA 4B3OA 1IR0A 3X1LB 2A6MA 3LP1B 4I69A 4PAAA 3TX8A 4AQYF 3I6PA 4YQWA 2DJWA 4DQPA 2W6JH 1PC4A 1AXQA 4TY8A 1BQNA 2BW2A 4OJHA 2V9KA 4NZ6A 4LR8A 2BBEA 3I5BA 4KYZA 2HQDA 3DRRA 4NOHA 5LOQA 3M32B 2Z57B 1IC2A 4NRUA 3FK4A 2BRKA 1MFTA 4DUYF 3I55S 2V68A 4W92B 4DR2F 1SVDA 2POHA 1Q1KA 3UD4P 3IRXB 2YH1A 5CABA 1X4FA 4ZLJA 1F60B 3TSIA 1YBUA 1RT6B 2KLUA 1M1JA 5B0EA 3KLFA 2XYGB 1D8YA 4WYWA 4Q5VA 3J7A1 5DDPC 4OGQC 2GGPB 3A3NB 2CIMA 1LFWA 3CNQP 3MFIA 2K8GA 2HFUA 3AFGA 4N47A 3RW6A 4OX7A 2VL1A 5F9NA 2MKKA 4D3GA 1UEKA 4IH6A 3FXDA 4Y2IA 1L2PA 5L1IA 2NREA 5BR8F 3CO0P 4CO1A 3UVJB 2F8HA 1TAUA 2PSZA 2W4CA 3MMBB 1KYOD 2WZ1A 4D6TD 1DLOB 2JP3A 1WEZA 2HS3A 3MECB 4DWIA 2CK3H 2N4DA 3BH6B 1UW4A 4L76A 4BCAA 3QRQA 3D9BA 4PG6A 3S9OA 5CYQB 5ETRA 1QTNB 1L0LJ 1QSYA 7FD1A 3AEAC 1Y9BA 4WXOA 4OI0A 5A8KA 1H8AA 4AD6A 3CCQS 5KFQA 4WB4A 2JVRA 3KYQA 1J5EF 3GPAA 3DGPB 2LDIA 1I94J 3BASA 4X64F 2E7XA 3JQKA 3T19A 4H4OA 4Y28J 3LA0A 1FDOA 3WMM0 3PX4A 1VIXA 2HEKA 2WSFC 4GVLA 3TZYA 1NB2A 1JY3O 3MURP 3EVWA 3RAQA 8AT1B 3HX9A 4M3LA 1H6KX 2PFXA 1PILA 4K5RA 2MJNA 3H1LD 4DV0J 3L70G 1U49A 1S49A 3A3OB 3QT7A 3QT8A 1KFNA 4PWDA 5IFMA 1N33F 3KUGA 4V19X 2VZ9A 3J80Y 4L73A 1RT3A 1S5ZA 1YHQP 3NGRA 4YEAA 1MMLA 4DQIA 1WTBA 1IJFB 4YR2A 3NXSA 1ZAXA 1RWUA 3PYGA 3KG4A 1U26A 2OYIB 1IUJA 4FKXA 3M8RA 4FPIA 1EB0A 1TUGB 2YKAA 5AVXB 3TGUD 3ISNC 3QO9B 3IP0A 4CLKA 4NYZA 4ZVRB 3GYXB 2BCCJ 4RUHA 2IBOA 5BJRA 1Y9OA 4O3PA 2JNJA 1SQPK 5ETSA 5HP1B 2E7WA 4RWWA 2QJPB 1PSDA 3CUNA 5KFBA 2ZH8A 3M05A 4H0LD 2N9YB 3SXLA 4JV5F 3P4UB 2W8KA 2N1TA 1JY3N 1HHSA 3CSKA 2DGUA 1NU1D 2GO8A 3NOCA 9RUBA 2XO6A 5CD4H 1X9WA 3DOLB 3K8VA 1RSCA 2KZIA 4U7UD 4LRFA 7AT1B 2ASJA 1YHQS 3M9HA 1SQBE 3B5NC 3MECA 3KDNA 5IWAF 3KK3B 1FK9A 2R7TA 3DLEB 1LW0A 5D8HB 4N78D 3L72J 4FF4A 2RT3A 3GP9A 1FWPA 1PP9G 4TT3H 3P32A 1UFWA 4M5DB 3E1RA 3PG9A 1K73Q 3D1QA 2W8LA 1DFDA 1BD6A 2PAJA 2R8JA 2AJ0A 1H72C 3K7RA 4DSFA 1KLNA 1WC4A 2FHJA 2GHWA 3VALA 1WJ9A 5ETMA 4TU7A 1W2IA 2QLBB 2DW3A 3EGVA 4DSJA 4C0HA 4A8WA 1SQPE 2RF2A 2Y9HA 2QSIA 3BPDA 2PDAA 2MSTA 3GCWP 2FJAB 3H1IG 3L70E 1HVVA 1PYOB 3SV4A 4F2RA 2YBVA 4UT4A 3EZ5A 4ED2A 1WTFA 5BU5A 5I3UA 1PPJE 1SQQJ 3H59A 2JOQA 1LWXA 1AYEA 3EICA 2FKWB 1SQVG 3CC4S 4YPCA 4XAKA 1TKTA 1U8WA 5KG1A 1KQLA 5FLXY 5BR8J 5CCHC 2LDYA 2AQ4A 1T3UA 4V19J 1QLED 1NK7A 2VPWB 3MUDC 2GUSA 1L0LD 2PGDA 1ACMB 4RNOA 4WPAA 4ECSA 2JSXA 3M8ZA 1IFNA 3MXHP 1TL3B 4J9MA 3IS9A 3GJSB 3H1JE 1W2BR 3D68A 1PV3A 2CPHA 2FJBB 3LANA 1WHXA 5IM0A 2NQPA 1P8GA 1USEA 3D5MA 4MK8A 5D4LA 1H2TZ 3GR0A 1QLNA 4NLDA 5EHHA 1U48A 2Y9YA 5A8RA 3V6HA 1WKKA 2UXBJ 2XY7A 1X8YA 2HFVA 3CJ5A 1IWGA 2OUGA 4NYOA 2LP4A 3W2VA 1V9OA 3GMGA 3MM6A 4RBUA 2B7CB 3H4BA 1X0FA 3CULA 1U6BA 5H9EJ 3I96A 3OXGA 3ZNUA 1SL0A 1F1BB 1IFJA 4KSEB 3F44A 2KZZA 2RUGA 3NCRA 1N86A 1NK8A 2J9DE 1YJNS 3R2DJ 1DBDA 1HYSA 2YO2A 5BU8B 1HQUB 1USDA 2PMWA 1N56A 1JMMA 5AJ3J 1AA1B 2E5LJ 2CWXA 5CCGC 1M5PC 3SFGA 4F4WA 2UUTA 3NOGA 2DGXA 4RBVA 1WHYA 3Q8YA 2CJAA 2MLYA 3MEEA 4O4RA 2H9ZA 4A46A 5K8MA 3JC22 1LTJB 2VQFF 5AW1B 4LC1A 3IR7B 1EZVE 4RUAA 1FKPA 1NZAA 3UNGC 3DRPA 5J2PB 2MQNA 5APYA 1CVJA 2BM1A 1JX4A 1RT7A 5RUBA 3IRWP 1WG4A 3QWPA 3ITHB 2XO7A 1T02A 4CYUA 3SQOP 3NBPB 2PFFB 4LRBA 5D0RA 4IOIH 3TO8A 5ETLA 3TK1A 2QA4S 1TFWA 1KC8Q 3HPOA 5B0DA 3IWLA 2VH7A 3VZHA 2FHMA 2DNNA 4A7PA 4ZPVR 3R27A 2OTJS 1M56D 5KFCA 2JRSA 3I0SB 4B9MA 4OX8A 1JLBB 3WX8A 3S8SA 3CB4A 3KLHA 3FCHA 1N7SD 4LGDE 4OX9J 1YJWP 3FBEA 2DHAA 3KUEA 2W9CA 2H54B 2PEBA 5HQ8A 4I6AA 2LMIA 2IJNA 5AW2B 4K8RA 1G2EA 1NWQA 3PO4A 4C48A 2ACMA 3K17A 5CJ4A 3IG1A 4OHYA 1XNQJ 5BYQA 3GR1A 2RQCA 1W25A 2JR8A 3C66A 3CJTA 2XS2A 2Y0SD 3HVWA 3EQ2A 1ZR4A 2V2QA 4RNNA 3OBIA 5E3QA 4BRYA 2YKNA 3EZOA 1JQGA 4JI8F 2EEYA 2WBMA 3M2UB 3PRBA 2FFDB 1E5WA 1FRMA 1TL3A 2BQUA 2Q6CA 5LSOA 4CWBA 2HGMA 4F3OA 1NAQA 1LXNA 2QJ3A 1LNQA 3H1LG 2QJKC 1QEXA 4NLVA 4S0MA 3MIWA 1ZM4A 4PXDA 1PYSB 1KORA 2E5GA 4B02A 1WC1A 4P2FA 3H42A 2FVRA 4ZPTR 4ZKUA 4C11A 3G6ES 1EDIA 1S5LE 3RL0D 3FGVA 2WSEH 1NTMK 4YUDA 3RYLA 2HIYA 3HMJG 3N7NA 1L4AC 4X62J 1SLQA 1JUNA 3NMDA 3E2EA 1OMIA 1P9QC 2XS7A 3KPEA 2K1RB 1R8EA 4CLUA 2PRRA 4J9NA 3VF0B 1IQTA 2DH8A 1X4BA 4LFBJ 2F5GA 3FX0A 1L0NE 2IYGA 3CDUA 1VQ8P 1OYEA 5SZTA 4WK1A 2H4WB 2B87B 2KT5A 1N5QA 3PP5A 2YY3A 3H1KD 3PY8A 2C2MB 4LF6F 1HGZA 1OYDA 3LQVA 4BC9A 2BJEA 4NXNF 1KHWA 1SH0A 2X1BA 3H2LA 3BKTA 3ICLA 3IWNC 3NNCA 1KSPA 3HJVA 3MDFA 3II6A 2WB4A 4ECZA 2B89A 4D6TG 1WOPA 4P74A 4TYBA 2OIHA 1OSCA 5D0EA 3DLEA 4WBFA 1ZAVA 4RPFA 2UXDJ 2NZCA 4M5GA 4URGA 3BATA 3CMEP 1RTJA 3JAMU 1UJ5A 4JV1A 4R4MA 4GO7X 1TKXB 5AJ3F 1KVJA 4NMXA 5B66H 2W9CB 1TQLA 2XMJA 4ZVOB 4WKYA 1Z56A 4CH7A 1TAQA 3BR8A 3B8HA 1FVSA 4C98A 1U2RA 1N73B 3FVYA 2A0FB 5THWA 1EKRA 1FJ7A 3C9IA 4N41A 3OTDA 3IGVA 1JY2P 1RHJB 2BM0A 2OMLA 5GTIE 5D78A 1FA0A 3PX0A 4GODA 2WAQD 4DV5F 3DGPA 5HMXA 1S9FA 1IKVA 1VGYA 3MPUB 3BSCA 5AE1A 3TNVA 1SKWA 3KMSA 3CJ2A 1OVRA 2B88A 5T7LA 4MJKA 2JH3A 1XNRF 1TTHB 4MK9A 5KTQA 2HNDA 2PIIA 1QX8A 2JFDA 1SL1A 5KLVJ 2GO9A 2D9OA 3TZWA 4IO9Q 2ERRA 2HVZA 1SQQK 4O4GB 4YHHF 2NXCA 4Q43A 2VD3A 2UZAA 4H4KC 2LA4A 1IBMF 4DR7F 1Q78A 5HROB 3PH0A 4FP9A 1S0OA 3PNIA 2BJ7A 1UIIA 3SCIE 3DOKA 4NA3A 3TYYA 1M90Q 4USIA 2CQ3A 3PM9A 5DG9A 3MPDA 4PRFA 3JSYA 4IG3B 2WW4A 1OSDA 3FSYA 2GW8A 3PW2A 2GHPA 1H0TA 1URRA 2CJXB 2HBQB 3EDQB 2IC3B 2Z8QA 3PW7A 4DN0A 1NKEA 4CLLA 1URQD 4KV8A 3PZPA 5JVHQ 2ILZA 5KG2A 5A8WB 1HMVA 1XMQF 4M63A 3EWKA 4U7JA 1BCCE 4LFAJ 1MKMA 2YKMA 1FF2A 2ZNYA 3CCRP 4RO0A 4O0IA 2VICA 4LF9F 4QIVA 3MUTP 1FOSE 2XG8A 2BXJA 5C24A 4AL5A 4JV2A 3QSIA 2R8KA 3KUHA 1EQ7A 1OWAA 5CCHA 2XLKA 2BKNA 1S7IA 2CJQA 3WDOA 1OIAA 2YNFA 4OI4A 2FUG9 3KK3A 3CIMA 3CCMP 2BJ8A 4B9VA 2E75C 2YXQB 3BGRA 3CJKA 1AJYA 4EOTA 3R5BA 3HSGA 2XMMA 1IFMA 1JXVA 1M57D 2ZOMA 1U0SA 3FFIB 5HJXA 1YJTA 3H6PA 4GDOA 4ZMMA 3WZ0A 1L0LE 2CG4A 4EYYQ 4ZP9A 1J1EC 3OA7A 5KT2A 4B3OB 4IFDK 1GMVA 1ZM2A 2V50A 4O0NA 4P10A 3MMCB 2R44A 1FDIA 1RQUA 3DLLQ 2M7SA 3N01A 1RXOB 1F2HA 2CAJA 1X7VA 4LFCJ 2K2PA 2CJBA 2C0WA 5AXLA 3OLBA 3LALA 1FRJA 2ZH3A 4H44B 1S1CX 2B9EA 1GL2C 4I7ZB 1S72S 5DDQC 4WY4D 3LPEA 2V4JA 1RGVA 4WIQA 2YQ0A 5AW6B 1SV5B 8ATCB 4J9VA 4CNYA 1T05B 2QA2A 3DDNA 3FMWA 1UA0A 3D70A 4C8NA 4IDKA 4OZ5A 1X0TA 2CXEA 3W2VB 1R8CA 3NGUA 1SKRA 2Z2ZA 2W9BA 3PEHA 1S76D 2UXDF 2E74C 5KKZB 2HHWA 2MKCA 3CJ3A 3R5CA 6AT1B 1TKTB 4KGXB 3J80U 5IT9U 4U95A 4I4BA 3DC2A 3CCUS 1BE3E 1UIXA 2IJFA 2NS1B 1TK0A 1QVFR 1H74A 4MYTA 1NK0A 3TP2A 1CZQA 2EG2A 2LKZA 4DPYA 4DS4A 3CJSA 4M95A 2OQQA 2WSEC 5DRKA 3RG6A 2XLIA 1NJZA 1IBCB 2HNZA 4RJTA 3SSSA 2QG9B 5KG0A 5DZ6A 2QRXA 1VI7A 2OTKE 2DCUB 1DD3A 2J8AA 2ZBPA 1C1BB 5B0FA 1GQEA 3D71A 1VQ7S 2DRAA 2R7QA 4A8FA 2UXCJ 5AT1B 3KK1A 2QSWA 3BF4A 1LWUC 2JEEA 3WU2E 3SDEA 2NUUG 3D3BJ 3PEJA 1N7SB 2OJ3A 3ENWA 4AQRD 1XMBA 1XMOF 2E76B 2CQ1A 2IIHA 2IC3A 1IBMJ 4ICLB 2X7IA 1HA1A 4WFBQ 3A1YG 1UWBB 5GTHH 5CQGA 5EWGA 2DGWA 4XDCA 1C1CA 1BC6A 3L35A 4NA2A 4AYCA 4B9UA 3DM2A 2NR0A 3CCVS 4A8YA 4J37A 3GILA 1HF9A 4A48A 2KYXA 2JHEA 1NAYA 3NNAA 3MM7B 2IMWP 1EJ7L 3GG2A 3PRDA 2K1AA 3R2CJ 2GX8A 2ZH4A 4MKAA 3OVAA 3U1LA 3V5RA 1IKXB 2GZOA 4F4ZA 3L74E 3TZXA 1UFLA 1TL7B 3AOBA 3IAOA 4NLOA 1QDUB 5IT9Y 3VHQA 3VVTA 1F9EB 4FNIA 5T41A 2NPFA 4DV2J 4RU2A 5LSLA 3PFEA 2P9CA 5HVGA 3DRRB 1J2VA 5CA5A 3NGDA 4RLEA 1XJWB 1VQ5P 3MMAB 1WORA 3CD0A 3CIZA 1RWXB 4PXBA 3I0RA 3W67A 1RWWB 4I7FB 2P9EA 3MR2A 4JI7F 1LWFB 4Q2LA 2V4QA 3AE7C 5L8RJ 3MHVA 3GV7B 4QYZJ 3SQGB 3WBZA 1LWUB 1U7LA 2HVDA 4Q8EA 3KDPB 2DT9A 4LF5J 1NU1K 4ECVA 3PHTA 4OYXA 1APSA 4EGLA 4BXLA 4LMZA 4OGQD 3M6WA 1N36F 2ZHBA 2DRBA 3H1HD 2QMUB 1OX3A 4F4AA 5B0AA 4PWUA 1S9KD 2MY7A 1IJEB 4WE1A 4G1IA 3GHGA 1M5HA 1X4GA 3F41A 1JMTA 1NTKD 4MIWA 1S6QB 4F02A 4URSA 2UWJE 3MEEB 1IFDA 2GVZB 4IFFA 1U1OA 4XE5B 3G6VA 1FC2C 4F8RA 1GT8A 4HH1A 1UWAA 5EX0A 2QIWA 3M2VB 2XQCA 1DARA 4ZN1A 4PZVA 2ZKTA 3GFHA 3BQ2A 2BDPA 5AVSB 1ZA2B 3P8BB 1J1DB 4LSZB 3MR5A 4RKUC 3F73A 1FZFA 3RBEA 1PGZA 3G8SA 1ZTTA 3BN7A 3T1HF 1NRKA 2MHNA 2GNKA 3RB3A 3MGNA 1YJ7A 5J1NA 2HWIA 1FDAA 3B71A 3J81j 2XMTA 2KHCA 3R5AA 2P9GA 4AE5A 2XY6A 3U1NA 4PWWA 4RW4B 5IS2A 2V94A 1ZYQA 5A76A 5F8IA 1UVMA 5IWAJ 2JLGA 4PR6A 1KVKA 1JLFA 3QLHA 2QYCA 5D4OA 1FVQA 4R4LA 4C3MA 2CQ0A 3H5SA 1RBLA 1SJ3P 1VQYA 3Q2TC 4QWCA 4J9PA 2L91A 4UQTA 4ZJLA 2B4VA 2HG4A 2KB2A 2BANA 1NDPA 2ZE2A 2UUWA 5AVWB 4IFMA 3UE2A 3IS9B 2D69A 4O3SA 4NCGB 3NEKA 5KFWA 2N3OA 2NZ2A 3FGAD 2YKPA 2M8RA 3BSAA 1KVIA 1HIYA 5IC4B 2HHQA 2JEGA 5KFDA 1Q7YQ 2DR7A 3KHUA 1S72P 1A0OB 3MPYA 2LEAA 2J0XA 3HO1A 4E2FB 1LTBC 3IBWA 1YI2P 1EHWA 1RABB 3OVBA 1JM0A 2J9CA 4QWAA 1UVJA 5KFEA 5L9NA 5C5JA 3A8EA 1RLDA 5H2FE 3AECC 2GA7A 4GKKJ 2ZVIA 1NDLA 4G1QB 1TK5A 3H2UB 1ZOTA 4UOGA 2F8EX 2QA4P 3EPIA 2BE2B 4RW4A 1VQSA 4JI3J 4QIEA 2HRUA 2M3EA 2WSEJ 2H5EA 4KHRA 3TDKA 3DMJB 4P7VA 3HHKA 4DV2F 5LXYA 2W9AA 2G3AA 1OQ6A 1GL2A 1LT9B 5CCMA 2R2TA 3QBCA 2DH9A 1K8AT 4BDPA 4NLPA 4DHVA 3KLFB 3MCSA 1T94A 3IBFB 3T6JA 3HTKB 4CLPA 2EKNA 2HNYA 1W5CE 5K14A 2I1JA 1S0MA 3SV3A 2FFDA 3BR9A 3FRZA 3V2NA 4PQAA 2WZ7A 4DMZA 4KKOA 3BB5A 5APWA 1LW2B 4USMA 2FVQA 1FI4A 1H89A 4W98A 4PG8A 4B9LA 3W65A 1JWWA 4ZITA 5J2MA 1N48A 3A0HH 5E0OA 4WU2A 2ROEA 2E9RX 4H44D 3VVUA 1HQEB 1IBLJ 1KILC 1T9VA 2XCAA 4ES3A 4PPZA 4C9DA 1N36J 2OPQA 2DXDA 2WITA 5H9FK 1ITPA 3NMRA 2J76E 2IX7C 5APUA 3QO9A 1N52B 3UN5A 4GKJJ 4X4VA 2KNCA 2UVWA 1ZM9A 3VQTA 3M1VB 1IBKJ 4QR0A 2KS1B 2BJDA 1SC4B 1SFCD 3M30B 2BOAA 3GIMA 3BH7B 2VDHA 5ETQA 1WI8A 4QWDA 5GAGU 1B70B 1NU1E 1CC8A 2IBZE 2R5BA 2HMIA 1FT8A 1FTRA 1VHFA 3HHLC 5GAHU 3UWTA 2D2CD 2A3JA 2YMKA 3SZ2A 3W63A 4B9TA 1LV5A 1S1VB 1QSLA 3NWRA 1DJ0A 1JY2N 2Y1RI 3GW6A 1S9KE 3M2UA 1QE1A 4ED6A 1XR5A 2WSCJ 4GOEA 1HHTP 2HYIB 1P84D 5B0GA 1HI1A 2VFUA 3C1LA 3NAHA 2M70A 4H4OB 2WSSH 2V4RA 2EK1A 2F40A 1CPZA 5J2MB 4AYBD 1IR2A 2LXCB 4X2BA 2VG5A 1G7CB 1KYOI 3BBBA 1PFIA 3OSPA 1P6TA 2DR8A 4EI2A 4YB5A 3HVAA 2CPSA 5ETVA 1VBXA 1UW9A 1S1XB 1PGJA 2AKWB 4JF7A 3RW7A 4H13C 3NMAA 3HUSC 1TMMA 1HBOA 2MZJA 5F0WA 1FDMA 3KG1A 1RT1B 1EP4B 2QLWA 2MQ8A 4J9KA 2IFMA 2G4BA 1K47A 1CC7A 3N28A 1ZS6A 3ZTSA 2FJEB 4ZVQB 3D6TB 4USTA 1RT5A 2WWWA 4NLYA 2Q66A 1MROA 3NCPA 3RAXA 1S12A 4WK3A 1FESA 3B5NB 2Z58B 2R5DA 4K7QA 2E5HA 2CPZA 3MFHA 4C3KA 1L0NJ 1RQ0A 3O8WA 3KQGA 1WDDA 1LK7A 1MW7A 2IM1A 2M0BA 3T1YF 1H7XA 4LRCA 2CJKA 2XMVA 5DLGA 3RK3C 4PD4E 5KFVA 2JZ5A 3UR0A 2FIUA 2HHUA 5KAFH 2K3IA 2DCLA 5IT0A 3WU2H 1QGKB 1CI6A 5A6WA 2CPFA 3OTEA 4DV0F 2I5JA 5C25B 4NI2B 1YQ3C 1GEHA 3AA9A 1NVOA 2QA1A 3EE3A 2BEFA 4QIFA 4KHMA 3ULHA 3QJJA 1UEUA 4IDKB 1URQA 1NDCA 3I55P 5A2QU 4ED1A 1FJEB 4DJGA 2MGZB 1JY2O 3BKUA 5AW7B 4KKOB 5C7PA 2C9NY 1WOSA 3T9ZA 3GSIA 1SJ1A 4X62F 2LXUA 4KH0B 4KGKA 2GAHC 5LMNJ 3LP1A 2HHSA 4C8MA 4LFBF 5D0HA 2P7JA 5HO4A 3Q24A 4Y0FA 1SQVE 2KXPB 2LYVA 5HJYA 1SC6A 2HAFA 2MJZA 4XIUA 3OHBA 2F1FA 2A45G 1H38A 4DR4J 4DOJA 1G6BA 1JCDA 3ITKA 4M5HA 3D67A 4QCLA 3MM9A 4IKAA 3MAHA 4FVCA 2WMMA 3VAGA 2BRLA 5I3PA 1G4CA 4WFXA 1N7SA 4B9NA 4WYLA 4BRYB 2IZ1A 3O3LA 2SPZA 3CDEA 3N4WA 1ROFA 1HBMA 2RKIB 2KJVA 3JYTB 1VOMA 3L95X 2HMIB 3AXKA 5KLVE 3DOMA 1D1UA 1C0TB 5KJ7A 4ZVFA 1HD0A 2YWFA 1RH5B 1HWTC 2YNYA 1LJ2A 1P1TA 1U6ZA 2UUAF 5ADZA 4D6TE 2B51A 1NMEB 1AT1B 2QT7A 4YTPC 1X4EA 3MTJA 1AV1A 3JQJA 5B08A 4LQ3A 2GIQA 1KTVA 5BYSA 4PD4H 4I2QB 2FHJD 4UB6E 1F9FA 3TRGA 3DU5A 2GMLA 1CJKA 2ZUAA 1NXIA 3CCQP 1T95A 1PYTA 5AW8B 3KDOA 3MPVA 2GVDB 2L3MA 2RHQB 1H0TB 1QUVA 1Y0HA 1JCCA 5CYJA 3C19A 4Y99B 4O3QA 5L46A 4F4XA 2AEFA 4OZ1A 2DGVA 4TLQA 5L1LA 4JI2F 4J9LA 3UCZP 4C97A 2W90A 3GJTB 5DM7Q 3PYFA 1N73C 1U1LA 4R8UA 4NWBA 4C8YA 1U57A 4ECWA 4TN2A 1RP5A 3HE4A 3JCUE 5AW9B 1JTHB 2N1TD 2H88C 2QV6A 3HULA 4DFJA 3CMAP 5F8NA 2D2CB 4ECXA 1OS5A 3OUYB 4PYDA 4O23A 3TZZA 3KLEB 2JX2A 1X8DA 3IO1A 2OSRA 1R43A 2ZUGA 1SQXK 2VONA 1HKAA 3KLVA 3BSNA 3HKWA 2LU2A 1RAIB 3ZZOA 5DGBA 3GU0A 1ZLLA 1BUXA 1S48A 2ZYDA 3MAAB 1FK9B 2MQQA 4HACB 4DCOB 1UAWA 3SSQA 3GFXA 2E66A 2LCWA 3RGIA 1RBAA 3OR2B 3NGTA 4RWXA 3A3PB 1HARA 1BCCD 2KI2A 2VA3A 1YJRA 1TUVA 4LBHA 4OMFG 4LFCF 2EFNA 3ZO7A 4DZOA 4EEYA 2KH9A 4R25A 2G1DA 4NPEA 1Q7LB 3KHHA 3DLGB 3HCXA 2H7HA 3KJNB 1UTAA 3LP0A 5CCGA 1X4CA 1R0AA 4WBAA 1L4AD 2E29A 1SQVD 1FXRA 1BMQB 2XMUA 3Q8UA 4OLOA 1R8HA 2DGQA 1RT3B 4IG0B 3AOAA 3I0RB 2W7OA 4KB7A 1ZW0A 2YIUB 2HBYB 3JTOA 1FZEA 1DQAA 5B0BA 2OEJA 3VAKA 4ASWA 2ZH7A 3TAQA 2GQQA 2IRXA 1K9MT 3G8QA 4HDGA 5T7LB 2IDBA 3OPKA 3ZFVA 5F8MA 5KFAA 4ZP8A 5GADU 1XQIA 5EGYA 4DV4J 4LJMA 4ANCA 2N9BA 3LW5J 3LW5H 2YQ3A 3L71J 4KPYA 5KFKA 1LW0B 2DH7A 2GVDA 1LTJA 2NPSB 4OX6A 1FFGB 1GAOA 4OYIA 2QM8A 3TJAA 2YNIA 4USWA 3H1LE 4PD4D 3CCSS 3DRSA 3HM9A 2ZE2B 3H5YA 5CHCB 5D77A 2N3LA 1VQLS 1L4AB 3FZ2A 3H90A 5E5NA 3CPWR 1SQQD 2G8YA 3OL7A 1OW7A 1RE4C 4CO4A 4HEA9 3IAM9 1FZCA 2ZFHA 1L3SA 1PGPA 4CLFA 3CC7P 2VBXA 4DUZJ 4ED8A 3W62A 3KK2B 2P2UA 2EG1A 4R0EA 4R8UB 2XU6A 4OX9F 3TANA 4K4TA 2XDJA 4H44C 3FZBA 1LGHB 1JY3P 3O5TB 1NDKA 4QOTA 3QT6A 4CYUB 4OFZA 2OYIC 1VQNP 2HR3A 5APVA 4DU7A 2CQPA 3IA0A 4XDDA 4HDHA 2YXRB 3IM9A 3SSRA 3DRPB 3AE8C 2AZ1A 3W8GA 5D3GA 3HVTB 3MEKA 3KTQA 3AY0A 2YNHB 2HPUA 2YIUC 3AE4C 3GMAA 5DG8A 3HE4B 3CF5Q 3Q3DA 4ZCMA 5APTA 3QZ7A 2C0XA 5DG7A 3CCVP 1AUSL 3P45B 2P58A 3DLBA 3OJSA 1TKZB 1NJIT 3IGNA 4LVNP 1YJ9S 1S99A 2KL8A 1SPBP 4F7VA 5EX3A 2P1JA 4ATNA 3MF5A 2NXEA 3M8PB 2XYHB 2XBPA 4RW9A 3B5NA 2EWHA 4DXLA 4L3NA 1BWEA 4ZMDA 2VJVA 4FF3A 3FBBA 3AHPA 2H4YB 3CDAA 3JSRA 2CPIA 2W7AA 4NEYA 1Q90D 1RTHB 2OKQA 2V8PA 4B3SF 3UFCX 5HK4A 2HVHA 4W7ZA 3EUNA 2ZBQA 2PA3A 2VG6A 3GHGB 2V4HA 4UOHA 3CPWO 1PGQA 5M2RA 1FDBA 2FJXA 2ZJRQ 2E5YA 2NRGA 2A2DA 4JYAF 4WWIA 3OVSA 4NLRA 3I0SA 1RHUB 1XR6A 1FRLA 1UKUA 4LF5F 2Y1LB 3IG1B 5DM6Q 4CLYA 1JIHA 1FE4A 1Y3JA 4P2MA 4K3AA 5APSA 3CVKA 5KT3A 3HVTA 2Y1JA 3VTPC 3M0DA 1OFCX 3MAAA 1QL1A 1IR1A 1T3NA 2HZVA 2ZD1A 2BE9B 1RWOB 3WX4A 4CLSA 5AW5B 4YS2A 3SFEC 2RMLA 3MM8A 4M5KA 3GG0A 2V6AA 3AT1B 1LWCA 2G2ZA 4P9SA 1WF1A 1O5JA 3R6GB 3S4RA 3VGTA 4Q44A 3GJQB 4KJIA 4UUXA 5KLIB 2UUBJ 4DPTA 1BGYG 2ZH2A 2LECA 2C22A 3SSUA 3SBMA 5DJBA 3D66A 4CNZA 1CI6B 4YOEA 1SP4A 4XK8C 4JI7J 1JNMA 3MR7A 5IM0B 3CDBA 2E76D 3DLJA 3IN5A 1M1KT 2RILA 2LEPA 5ETOA 1T2KD 4UOCA 2XI2A 1TL7A 3L3CA 5J2PA 1SB6A 2I8EA 2IPOB 4U8VA 1URQB 4JBZA 1HBUB 5KFUA 1HW9A 1FTCA 2HHHJ 4PG5A 4YY3J 1ZBTA 4DV5J 2CQHA 2WVFA 4AQYJ 1VRTB 1NH7A 1UFKA 2J8SA 4J7CA 1ZAWA 3KHLA 3OFHA 3DXBA 2BACA 1C4AA 2D3ZA 3G71S 4LBIA 3CCMS 4DS5A 2O67A 2J6SA 4GIFA 2AYMA 2WOMA 1VK3A 1T03B 3BDPA 1UMJA 2C3MA 1NJIQ 4M5MA 2OPQB 1YTZT 1D9DA 1WHWA 2HSEB 4C8LA 2VFSA 1E6YB 3H4DA 3CCRS 1RT5B 3MCNA 2KKHA 2RVJA 1SQXJ 4DSKA 2EFVA 1SQXE 3ZZUA 3A0BE 1A7GE 4DL7A 1GNKA 3W1YC 4DJBA 2HODA 3V2UC 3LP2B 4J9QA 1VF5B 2JWDA 4Q7AA 4ZIVA 4HTIA 5KLIC 2CPEA 1B3TA 4F2SA 2FYUD 3MPWA 5L9XA 2DNZA 5C2CA 3V2QA 2OTLS 1YDLA 3UCGA 2XNXA 1DRZA 1Z1ZA 3QRPA 2MGZA 5CZXA 3UCUP 3JXOA 3HRNA 1P84I 5KOWA 3Q2YA 2XSFA 3T5HA 4OGQB 4IH5A 3LAMA 2NSCA 4ASVA 1HR0J 3S7RA 2M3DA 2KSEA 3CXHI 1ZPVA 1GX5A 2VC1A 1H98A 3NTNA 1J5EJ 3RZAA 3QGIA 2OO4A 4KHXA 3GYGA 3M2VA 1EXJA 1VCTA 2H65B 2NZ4A 2Y0BB 4FXDA 1Q7YT 1CQMA 5HMWA 2KXNB 2K3RA 2Y0DA 3TWZA 3ENVA 5AXNA 3G9RA 1L5UA 4ZLNA 2FD2A 1YITS 1JLFB 3QLHB 5CBNA 8RUCA 5GTIH 4OQJA 2HIQA 4M5DA 4ELUA 4LSLB 2DEJA 1GH8A 4JP8A 3CCEP 4PJ0E 3RL0g 3ILOA 4ETXA 1DHMA 2HFZA 2AJFE 4BHQA 2YWWA 2M5AB 4Y3CA 1M5VC 5KAKA 4U7UK 5IOLA 4O4GA 1EETB 2HVIA 5B7WA 2KFZA 1NHUA 2M5YA 1S9EB 2DKOB 2AIRB 1CSBA 3NS5A 3G4SS 3KWMA 2YVSA 2WHOA 2M2BA 1SFCB 1XTGB 1S0NA 1M1KQ 1FX2A 4LSNB 1RJJA 4JI4F 4DG1A 2K37A 2UV8G 5C25A 3PJWA 3W3SA 1BE3G 2HBRB 4K59A 3L75G 4NLTA 3BRVB 2R2RA 5J1EB 1YIJP 2H5JB 1VJQA 1QY7A 4N78E 3TUJC 1FJCA 2AGOA 3LO3A 4DCPB 4NLUA 3I31A 1URNA 2YTCA 3EGNA 5KG6A 2VQEF 1PAUB 4RW6B 1LFPA 1Y5LB 3H1HJ 1LWEB 5H9EK 1M5SA 2JKVA 3H1ID 5CCLA 4LRDA 2AX0A 1Q79A 1JB0C 5JVGQ 3KLIB 4O3OA 3TVKA 4YN3B 1PGOA 2AJQA 1ULRA 1KILA 2A45H 2V2ZA 2EKYA 1JNZB 4WTOB 5CYQA 1FJGJ 2FTRA 3PKYA 1BQNB 3TGUE 2HLOA 2RU3A 3LOUA 1SJQA 1U8SA 3BCCJ 2CPJA 1YTZI 4H4MB 3BCCE 5F8LA 2DHGA 1KILB 2AYGA 1KFMA 2AYBA 3OXLA 1BCCG 3LIDA 4ZVGA 3IM8A 2YNHA 3NGKA 2AEMA 4I2LC 2FZCB 2VB6A 3U1AA 3KKFA 4U6PA 1JLQA 1SIZA 4TU8A 1T9UA 4JI5J 1HHQA 4UZBA 1XNRJ 4DR6J 3H1HG 3LPYA 1NU1G 3MZIA 2OPSB 4ZPCA 1IJDB 2HS4A 4B17A 3PX6A 2HURA 2C2DA 2UVVA 2P2CB 3MGJA 2JWNA 1DAXA 1AFJA 1ZR2A 4EFAC 4OJ1A 3G4SP 1JTHA 2HWHA 1WF2A 2XYPB 4PABA 3A7OA 2A2CA 2HQIA 3M8WA 1FAVA 1S0VA 3KLIA 3D0GE 1CBKA 4ZP6A 3EX7B 1RAOA 4LIWA 1Y8AA 3W60A 1RADB 3FNNA 4CT8A 5L38A 3TGUG 4DLGA 2Z0GA 3R6LB 5J2QB 2XZDB 4RW7B 2JJLA 1U0HA 3MM9B 1IKWA 3LUYA 4HLBA 1V3SA 1KWMA 3OQ2A 1KQFB 1HWIA 5T14A 1KOOA 3C2PA 1BCCJ 1DTTB 2FGCA 3CXHH 3MHYA 5GAEU 2HLTA 2J9DA 3BN4A 2ZITA 1WG1A 2WPRA 3L09A 5HROA 1YWXA 4CDIA 3EPGA 2VA2A 4FN5A 3M8SA 2WTFA 4GC6A 1OXZA 3M9NB 3SDEB 1MU2A 5AXKA 4IRCA 2V8VA 2R7OA 4OI2A 5E79H 5E3AA 3NY0A 1N5SA 2MB0B 4DV6F 2R3VA 1M5OC 3U1CA 1KOHA 4N8NA 4USJC 2G0JA 3LF0A 2J0QD 1IFIA 3HHLD 1RTIB 3B82A 2QFIA 3RK2D 4MIAA 2Y9ZA 4KPCA 4W7YA 2G0CA 3L7OA 1DLOA 3FCWA 3CD7A 4ZA1A 2VFVA 4I64A 2C2EA 4NZ7A 3VAJA 2HGLA 3P8CE