1KQGB

Formate dehydrogenase n from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
total genus 89
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqgB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB02
1H0HB 2FJAB 3OR1A 2PMZD 1HFEL 1H7XA 3IR7B 1WTFA 1BLUA 2FJBB 3HKZD 1F5BA 1H98A 1Q16B 3EXYA 2FGOA 2FJEB 5L8RC 2VPXB 1C4CA 3MM6A 2C3UA 1PC5A 1GTEA 2WSFC 3MM9B 2V4JA 4OV1A 1FRMA 2UZAA 2C3MA 1B0TA 3MM7B 2ZVSA 3MM6B 1FEHA 3MM5B 1IQZA 2VKRA 1BQXA 4ID8A 1FRJA 1GTHA 3LW5C 1F2GA 2GMJA 1FERA 2XSJB 6FD1A 5CHCB 1FRIA 3MM8A 1Y5IB 3OR2B 1C4AA 3MMCA 4YDDB 1F5CA 1FRHA 3IR5B 2FD2A 3C8YA 1KEKA 2PDAA 1PC4A 3MMAA 5BYRA 1H7WA 2WSEC 1GT8A 1Y4ZB 2XSJA 1BC6A 1KQGB 7FD1A 2C42A 1VJWA 2FJDB 4CI0B 3MMBA 1FDBA 2FDNA 1KQFB 2O01C 1B0PA 2C3OA 1B0VA 5BYSA 2WSCC 2VPYB 3MM5A 4OMFG 5E7OB 1JNRB 4XDCA 6FDRA 1FDNA 1CLFA 5FD1A 1DURA 1FRLA 1SIZA 2WAQD 3GYXB 1SJ1A 1FXDA 1DFDA 1FDDA 1SIWB 1G3OA 3OR2A 1BD6A 1G6BA 3MM9A 2V4JB 3EGWB 1XERA 1GAOA 3IR6B 4RKUC 4DHVA 2Z8QA 2IVFB 4XDDA 1IR0A 3MM8B 1DAXA 3MMCB 2C3YA 1ROFA 2WB1D 5BYQA 4AYBD 4Y28C 1BWEA 4KT0C 2Y0SD 2GMHA 2V2KA 1FRKA 7FDRA 1R27B 1D3WA 2VPWB 1FCAA 1A6LA 1FXRA 3MMBB 1Y5NB 2C3PA 3MM7A 1Y5LB 1FTCA 1JNZB 3EUNA 1JB0C 3MMAB 1FRXA 1RGVA 2PA8D 1AXQA 1FDAA 5CH7B 1FD2A 1K0TA 4L6V3 1FF2A 2VPZB 3OR1B 3PNIA 4XK8C
chains in the Genus database with same CATH superfamily
1VQNS 2C9LY 2KG1A 2FJBB 4JI2F 2AJQA 3RRGA 5KKZC 1TUWA 2RRAA 2RKLA 5KLVG 3O8ZA 4OX9J 1UWAA 1IBKJ 2B4UA 3E7KA 4R4MA 1FU1A 1NB2A 1CZQA 4F3MA 4IRKA 4OVNF 1S97A 2EC0A 3JB9k 1AQ5A 1Z2LA 4UF4A 3FC9A 4EWTA 4PWDB 1GEHA 2IVYA 2W4DA 2RNEA 4CLZA 4BS2A 4ASVA 2GVDA 3DI6A 3SQGA 3BRVB 3RBZA 3V6KA 3B4SA 4ZPAA 1XTCC 2GHVC 2DNMA 3CTRA 5H9EK 4EOTA 1S12A 3V5BA 1TL3A 2VFUA 4J9SA 3V2PA 2EFOA 1JY3N 4ZKPA 2VQFF 1URQC 3NMDA 1FOSE 4IDKA 3IBCB 5KLIC 4ANCA 1PP9J 2C3YA 2W9CB 1DIPA 2CPFA 3F44A 1YX2A 1XBWA 4EYHB 2VG6B 2RQCA 2NXUA 4O4GA 3FXEA 1V5IB 3M8YA 1A6LA 4ATNA 4QPTA 1EKSA 2WSCJ 1U1NA 2APOA 4LR9A 3FSIA 2XMMA 3Q22A 1XNRJ 4OX6A 5BVZA 1EQ7A 2YTCA 1PGQA 1SJQA 4KFBA 4OHYA 2PMZD 4OH8B 4HVZA 4JV2A 2AJFE 1NTZK 1IR2A 2WSFC 5RUBA 3KJQB 3CCQP 2CQBA 1HWKA 1M1JC 2KP8A 2IA6A 1YWXA 2B9WA 3FX0A 4A46A 2ZH5A 2HFOA 3CWBE 4MYTA 3OSPA 2D41A 4DG1B 4DFKA 4K4ZA 4CRJA 4O3PA 4OI3A 2B7BB 3CJ3A 4GO7X 4FS1A 2HHHF 1FZEA 3IM8A 4KE5A 2XSJA 3PYDA 2GUVA 4K35A 3NKYA 3UVJA 3P5TL 2M70A 2DEJA 4IQMA 2J9EA 3HE4B 1ZTWA 2H9ZA 2GV1A 2FYUD 2OTKE 2OTLS 1LW2A 3GJRB 1N33J 3RRKA 3M0DA 4B3TJ 2NR0A 2HFUA 3L75E 4CM0A 2FYZA 4C7QA 2QMWA 1YJVA 3W8PA 3L71D 3SV3A 4LR8A 1ZAWA 4W4MA 4U8VA 3L74G 5A8RA 4A47A 1N5SA 1LWFA 1S57A 3GZ7A 3R7NB 4DSJA 2FBWC 1FS0E 2M2BA 1Q90D 2A10A 4IL6H 3FQLA 3H2VE 1OS5A 1NK5A 2HG5D 2O1JA 5D4PA 2AXCA 5IOLA 3IAS9 4PXBA 1NTZJ 3QT5A 1BQXA 3CL3D 2GO8A 1VQLS 2RT3A 2G0JA 2XLIA 3KHUA 3EX7B 1UTAA 3G3ZA 2ACYA 1FERA 8ATCB 1FKOB 1QUVA 1VQ6P 4CIOA 3E01A 1UJ5A 1P9YA 3PZPA 1NKNA 1SQXE 3H1JJ 1ZLLA 1IM4A 1P84E 3DLLQ 1MMLA 3G71S 1MU2B 2VKZG 3T6JA 2D69A 5LOQA 2HNZB 3AD9C 1HW9A 5DJTB 3N7NA 3M9MB 5DZ7A 4LF6F 1NU1G 1Q7YQ 3GG1A 4BWMA 3JXOA 5KTBA 4M5DA 4DCKA 2KXPB 2KIKA 3LGMA 4QIFA 3PR4A 2XC9A 4PPZA 4AUWA 3LQVA 2WVDA 4KHMA 4TU9A 1EHWA 2VDIA 3HMJG 2ALYB 4NPOA 3HTKB 1LT9A 3H1KE 2AWZA 5K14B 3OW2O 2WZ1A 2W9BB 3BBCA 1IO4A 3BB5A 2EG2A 5A2QU 2YWEA 3WZ0A 3UD3P 1DQAA 4QQBA 5AVTB 1OQ3A 3BJYA 3QQCD 2BJ8A 2JLGA 5C25A 2GVZA 3SYZA 2FJWA 1NU4A 4QR2A 1ZR4A 2UV8A 1OQ6A 5B5EE 1M1KT 3KFWX 5KFHA 4C8NA 4FVMA 4ALZA 4B08A 1JLFB 3GIRA 2F1FA 3JQKA 3BH7B 4X84A 1YQ3C 3D4JA 3HVTB 3PJSK 1RT5B 2NREA 2MJZA 1U7LA 3U1NA 2D74B 4NA1A 3TQEA 2LU1A 4F4WA 1XN9A 4C11B 5HMXA 2Q6CA 1K0VA 2D1CA 5B0EA 3IFMA 4NLWA 4KH1B 1SQPJ 4NLUA 2DR8A 4EMDA 5HROA 2KI2A 3ETOA 3BQ1A 3PW7A 3KK3B 3IR6B 3LP1A 4DFJA 4C9DA 3MEDA 2XCPA 3AODA 2BRKA 1RHQB 5E33A 3P49B 3GYNA 4DV2F 4M5JA 3HD7A 2LQ8A 5CH7B 3G6YA 1ZETA 5AE3A 4J7CA 1PCAA 2I5JB 4JPZB 4HHUA 2OJ3A 2I5JA 2RDJA 1FEEA 1O0PA 2QIWA 2HRTA 4QW8A 4JI1J 3DOMA 1TELA 1GW4A 4ZVQB 3KDNA 2ZH1A 2YIUC 1ZPVA 1KSPA 4EIJA 3L72J 3IRWP 1TU0B 2A2CA 4Z2XA 5FDLB 3ZXWA 4L72B 3L70G 1NDLA 2W9CA 2IRXA 4EFAC 2CPDA 2ZWOA 2HR3A 1DY3A 1PP9G 5KAFE 5AW8B 1TAUA 4MYUA 4IL6E 2R7WA 5DG9A 4X4PA 2N1TD 1Q1KA 3GSIA 2QSFA 4G65A 2XG8A 4RNMA 2V67A 4ZOSA 1R8EA 4CLYA 2H43A 4BHQA 3L9ZA 2GAGC 5AJ3J 4KO0B 2NPSA 1N5YB 1RWXB 3NGUA 3KLHA 1NJZA 1T6AA 2G13A 2OUGA 1U49A 1L0LG 4IFVB 4FYWB 2ZHAA 2DJWA 3HE5A 2LLZA 3JS9A 5KG3A 2BOAA 5ETNA 2BMBA 4ZVFA 3PLNA 4ICLB 2KVIA 5CCGD 2I38A 3GHGB 1CJTA 3R27A 1VQMS 4ED5A 2B7CB 3KZIE 2LKZA 1VRQC 4GOFA 3Q3DA 4HACA 4C8YA 3UDVA 2GJ2A 4QMAA 2F5GA 1SH2A 4HACB 3DXSX 3R97A 3GIMA 1S0MA 3CXCR 3HFZB 3ZZRA 5F3ZA 3AFGA 5DQIA 1JOCA 5A8WA 2O1KA 3CLQA 4DR3F 3IM9A 4DU7A 2XMUA 4NCGB 3EWGA 4NI2B 2J6TA 2V4HA 3EZ5A 4PQUB 2RKIA 4CYUA 5B5EH 5E7OB 3GIKA 3TX8A 1U8WA 4PXEA 2O01J 1RT7B 5AW2B 2NPSD 4TT3H 2HQDA 3AQOA 1RT7A 5M1BA 4KY3A 1KVJA 2HHPA 4X4QA 4DZ6A 4LGDE 5IXUA 1DLOA 1NHUA 3KK1B 1N32F 2HPCB 2CWXA 1Q8IA 2HHUA 3SV4A 3UR0A 1XEZA 5LT5A 4IFDK 2Q3EA 2EFQA 3DDNA 1S5ZA 5CD4H 1QAIA 2C2OB 2CZ4A 1LQ9A 2V94A 4LSLB 4MIWA 3W9JA 3FZBA 4KO0A 2XNXA 1NPKA 2YNFA 2WSFJ 1SQBK 1VQ7S 1L0ND 4DV0F 1GW3A 4PD4I 3LP1B 1VQSA 3FGVA 1U4BA 4RJTA 3V5RA 2CPYA 1D8YA 2XMJA 4N8OA 4KSEB 2DNPA 1N48A 1S6OA 3I9ZA 3A3YB 2IX7C 1RHJB 1KMIZ 2WTYA 4AD6A 2E75C 1IN0A 2FFDA 3OFHA 3BR9A 3OXFA 4JB8B 1TVRB 1AYEA 1F1BB 2GMLA 4NLGA 2H65B 2V9WA 1J5OA 3QBCA 3TSIA 4QWCA 4ZMDA 4PABA 1T9VA 4BCAA 2XCAA 2VPYB 4YN3B 2N1TB 8RUCA 5AT1B 3W62A 4FXWA 5CHXA 1TL5A 4NLRA 1WSRA 4NRTA 3L73G 3TGUG 1I3OB 3UDCA 2ZZTA 3ISZA 5KFXA 1G6BA 3TUIC 2E66A 2DPIA 4RW9B 2CFXA 4DL7A 5A2QY 4UB8E 3FEZA 2ABYA 1GTWA 4I2QA 1IBLF 3GTYX 1XNQJ 3CWBG 1S1WA 1HNZJ 5KG5A 4NA3A 3C6TA 2N4DA 3P8CE 1EP4B 5J2MA 3HSZA 1X5TA 2ZT9B 1FDAA 2HHXA 4LSNA 4WB4A 2HVIA 2N4CA 4OI0A 3IN5A 3ADAC 3X1LB 3VZIA 5F8MA 1LJ2A 2IYIA 1SQQE 4JYCA 3HO1A 1NGMB 2MPUA 1KV4A 1M5KC 1FTRA 5IM0A 3D1HA 1KOHA 1RWUA 4USKA 3TA2A 1RT1A 1JLCA 4USJC 2Q3IA 1Q82T 2NZ4A 3AEDC 1FBMA 1LTJC 5TISH 3H2LA 3PIOQ 3SMZA 4A8WA 3F73A 1NH8A 1Y4ZB 4NLSA 2G8YA 4W90B 4UQTA 1UVKA 4F0KA 5GAHI 1YI2P 1WUUA 2XTJP 1VQOS 3O5TB 1URNA 1CLFA 2FGCA 2KDOA 3AOAA 3D66A 2HQFA 2R7QA 1AUDA 1A7GE 3JYTB 4HYTB 4ETXA 3OSNA 1YJ7A 1PP9D 1SCJB 4LBPA 5D0GA 2IAJA 5CQGA 3VP8A 1OFCX 2HFED 1IBCB 1HHSA 3LGNA 4LF8J 3H1JE 3EUNA 3J80U 5IT9U 1U57A 4DV6F 2V8VA 2H88C 3NCQA 3O6QA 3Q8SB 1CG2A 1X9WA 1DRZA 3KUGA 3HLUA 2D3OR 4LBIA 4TNOA 2RF2B 3QAEA 3BPSP 3EXYA 1S5LX 3L7PA 3GYGA 3MF5A 3H40A 1OW6A 3RRHA 3QWOC 5LJ5Y 3FCHA 2KHCA 3SFDC 1Y3KA 2W2PP 4U7UD 1O6XA 1IUJA 4F3OA 3E3XA 3MMCA 2IMOA 1IFPA 4DR2J 4FVCA 2NCKL 4J5OA 2M4MA 1HVVA 2V8HA 2EKYA 1RT1B 3IBFB 4AQYF 3MZIA 2Z4PA 4N6JA 4QYZK 2OQQA 4N8NA 3I55S 4IKAA 1RHMB 2FZCB 5B0AA 2XY7A 3NXZA 3VAJA 3BGUA 2PGCA 4TKTA 1R8PA 1KTMA 4ZCIA 3BN4A 1YBTA 4P52A 2ZH9A 2E5GA 1ZV8A 4KT0C 5CYJA 5H1SV 1RAJA 2I1RA 1FNMA 4RW7A 3RW6A 1N73A 1UEVA 4USTA 2CDQA 1WDDA 2CQCA 5KAIH 3M2VB 1KFSA 2D3O1 1PJ5A 2HBRB 2A6MA 2YWFA 2DK2A 2RN0A 2VBZA 3PY8A 1FE6A 5K8PA 2HNDA 3VGVA 1HW8A 2IRUA 4OYAA 4I2QB 3D6MB 5EX0A 6AT1B 3PP5A 1I1GA 2JP3A 2UZAA 2YKNA 4NMLA 2ASLA 2BEQD 1NBEB 4Q7AA 2Q1KA 1UPMB 1FRJA 1N86A 2KL8A 1X0TA 2KXFA 4NLTA 2B8QA 2LDIA 3HD7D 2CQ3A 2OARA 3FNNA 1KILC 3AB2B 2WSEC 3T19A 3TEHB 1FK9B 1VRTB 1SJRA 2XLKA 2OPRA 1MN9A 1BE3D 3B5ND 3DRYA 2QJYB 2DYAA 2HVHA 4PR6A 2ZE2A 4LF9F 4TVAB 3ZZPA 2G4BA 4LRCA 1G2EA 1RT2A 2J0QD 2B3TB 2A0FB 4JI7F 2NLWA 2MYFA 5EN1A 2V2KA 2EG1A 4RR5A 1RLCL 3CJKB 2K7KA 1HWLA 1TFWA 1GK6A 1TKZB 2X3GA 4P75A 2POKA 2QZ8A 2HG4A 3OXGA 2P1JA 1U24A 4F36A 2MB0B 1USDA 3QLHA 2UV8G 2A45I 1SQPD 1L4AC 3GV7B 1EQMA 1ZYQA 2H89C 2HAIA 4KYZA 4Q2LA 1SQPE 1RXOB 5IV4A 3K57A 1S1CX 2RJZA 1VCTA 1XTGB 4OQJA 2HYIB 2F9JA 1HNXJ 1VQ8S 3I0SA 3MURP 1QSLA 1PGPA 1YLXA 4O0IA 2UXDJ 4B9NA 3FXDA 3CCJS 3AHPA 3CT9A 3M8WA 2P8IA 4EGLA 4IH6A 3MUDC 3PW2A 4KRWA 3RK3E 2EBGA 3DCAA 1QAJA 3ET6B 3PHTA 3CW2C 2BX6A 1S9KE 1AT1B 3UFCX 2IDLA 2CPHA 4RW8A 3CD7A 2K3IA 4ES3A 3OVBA 2DH8A 2MSSA 1IK7A 1BMQB 3R5JB 2XZDB 3HXMA 2R2TA 3QGHA 2RRBA 4ZPCA 1JMMA 2OPQA 3V81A 2M8DB 2MJUA 3E01B 1R6YA 1FD2A 1FA0A 2B9YA 4IOAQ 2N9BA 2QYCA 2PIIA 1L0LE 2CQ2A 3LTOA 1VQ4P 2P67A 2ZDPA 3AQPA 3W2VA 2HVDA 3GILA 4ZLNA 1SL1A 3NNAA 1KD1Q 3PTWA 2ZVSA 1TU3F 4M8LA 1VC0A 1VQYA 1L0NK 5I4MA 3LWLA 3M6WA 2IFNA 3A8JA 3PYGA 3RJMB 4QWAA 3VN0A 1X4CA 2V5HG 3HDSA 3C8YA 3PX6A 1NZAA 1UJ4A 1SVDA 1ZM9A 1NTZD 4DQPA 2F8HA 1VF5C 1PAEX 4EYIB 2ZM6J 5AVSB 3N5FA 2OYIC 2B9XA 1OIAA 1RWWB 3FSYA 1GH8A 1VRUB 2DY9A 2MZRA 4NWBA 5IC6B 3DYAB 4CH7A 1G3OA 4DPTA 1SQQJ 1X4EA 2RKIB 4A8QA 5J2PB 4OI2A 3UI3A 3UO0A 8AT1B 3KDPB 3A1YG 5HVHA 2RILA 1F6TA 3HD2A 3HHEA 1KB9I 1FCAA 2FLOA 3CCSP 5GVQA 1RADB 4NYPA 4PUOB 2XO7A 1LWEA 1P84H 1KQSR 2WSSH 1IKWA 4HB1A 3M8ZA 2VPZB 1ZR2A 5EX3A 3S8SA 2DY1A 4DI6A 3BREA 3HHLC 1M1GA 1LTAC 4QR0A 4AQRD 2J8AA 2Y3YA 1HQUB 3PX4A 2EC2A 1HARA 3CC2P 1CC8A 3H1JG 4PG7A 4HR2A 2CQPA 2J0XA 2IMWP 1NTKD 3S01A 1J1EB 1VQNP 1GTHA 3VAKA 4XPEA 4NRUA 3ENQA 4PWUA 4KGXB 4O3RA 4QCLA 5ETKA 4RBTA 4NXMF 3UDEA 5KT6A 4H44B 1OW7A 4CO2A 4UQGA 1R5LA 3T6BA 1U47A 4IRCA 3OL9A 1H74A 1DJ0A 3KJVA 3DOKA 2A45G 3L09A 4RUAA 2BOPA 1O51A 3L7UA 4RNFA 4LREA 1IBLJ 1WWHA 3D6ZA 1P9QC 4HEA9 1SKSA 5HBMA 2VHGA 1S6QB 4ED2A 1KHWA 2FVPA 2MQMA 4U7JA 3TP2A 1YHQP 3FRZA 4D3HA 4YY3F 2JDIH 1MUUA 5A0YA 3T9NA 1S1UB 4LIRA 3O1LA 1HR0F 3H1IG 5E79H 2ZYDA 4MAKA 4GC7A 2WVFA 3KHLA 5C39A 4OIXA 3MECB 2XDJA 5KFIA 4PG4A 3L37A 4RU9A 3I5BA 2VB6A 3RAXA 2FVSA 2CPIA 2BEZF 3CMES 3SCIE 2IBKA 1OVVA 5D4OA 5KFZA 3QWUA 2Y1RI 3OTCA 5LXRA 2RH0A 3OV7A 4G1PA 1M5PC 4F2SA 4R8UB 3MUTP 2OMLA 2EK6A 5KFNA 2KXNB 1WNEA 2MKCA 2OSQA 5DETA 1GFWB 3HFKA 3L72D 2ZBQA 4ZVPB 2HVEA 5HMYA 1S4FA 1KONA 1CJKA 3TOQA 1NAFA 1KDNA 2Z5HA 1W26A 2WCXA 1G2CB 1Q7YT 4EZ9A 1ROFA 3CJ2A 4ZP6A 3M8PB 4X4OA 5IQQA 3D1OA 2RS8A 3EGZA 1CJUA 3TNVA 2OTLP 3UD5A 2QLWA 2R7UA 3FVYA 4QIEA 3UN5A 4E2FB 4CT8A 5CCHD 2NXNA 1NTMD 1B64A 3R6GB 3V6IA 3LIEA 3L74E 2KB7P 2F8MA 1VFJA 3RB6A 1X31C 1JLBA 3L72G 4FNIA 1RWVB 3CD6P 5AW5B 3U1AA 3AB4B 3V4WA 2ZH4A 2BM0A 1ZM3A 2OPSA 5KT2A 1UIXA 5D15A 1N7SB 4PD4D 1KYOE 2PRRA 1BGYJ 4LRFA 1CVJA 1IKXA 4CQ1A 1PO6A 4JF7A 4CNYA 2BQUA 1IJDB 5B7WA 3L4FA 2BCCE 2M9KA 3DDKA 3HP6A 3Q1MA 3TX0A 3ULHA 3L72E 4M95A 4CO3A 4IQXA 4HH2A 5L1LA 4RX6A 3DOLB 1KB9H 1SQGA 2FVQA 3BPDA 3IF4A 3M2UA 1S7HA 1H0TB 2MLZA 1M1KQ 2UXCJ 2D2CD 1SFCB 3P96A 3M2UB 1HUCA 1PILA 3N79A 4OYBA 2NUHA 3CC7S 4ERDA 3UD4P 4NLPA 1X4BA 4ZPWR 2J58A 3PJ9A 2DXEA 3TAPA 3OUYA 4BWJA 4FPRA 2KKHA 1RKJA 3MHVA 1TL7A 3WHIA 3C2PA 4PWWA 1YJ9S 1NM2A 2B4OA 1MMDA 1SUQB 1M90T 4DR4F 4M5DB 3GSDA 2LXCB 2V4QA 5D77A 2KRRA 1HKAA 3KLIB 2AZ3A 3HD7B 2NQPA 1MN7A 4MIBA 4GKGA 2R7RA 1NTKJ 3D54A 2KB2A 1UFLA 1T9XA 1S1VA 3QWPA 4JV0A 1IFDA 1NJWA 2BQRA 2XZWA 2RDDA 1X4FA 1VPCA 4NCBA 3BVHA 2FY1A 1UVIA 1S1TA 2QO3A 2ZJPQ 1CQNA 2GC8A 3NBPA 3BS9A 3DLKB 2NXCA 3AE2C 4ZS6A 2KZMA 4UOCA 2RQKA 4B86A 3GFZA 1UZHA 4U67Q 1IVZA 4ES2A 3MCMA 1FDBA 4DV4J 2IIHA 3CC7P 1KTQA 1C1BA 4WIIA 5A0YB 3SWFA 1PP9E 2N82B 3G2XA 1VDFA 4NLOA 2UVWA 3ISND 3H20A 1RT5A 3V4QA 3UQSA 2HBZB 2G0IA 4O3QA 5HL7Q 4DX5A 4JI7J 3R4YA 1VQ5P 1WJ9A 1RHZB 4KGVB 1LW0B 3H1KD 4X62J 4Y28C 1TKDA 2GMHA 2FY8A 1W2BO 4BC7A 4A8MP 2PC6A 4C8MA 4KHRA 1M5OC 3C15B 5AVUB 4NYZA 2K9JB 1RT3B 1FZCA 1NYHA 1KN6A 3V81B 3MR2A 1ZRTD 4P72A 1FRXA 1KZUB 3CCMP 4TLQA 5EHHA 2G9OA 1SQEA 2NPIA 4C3MA 2CQ0A 1ICEB 3FJ2A 2FJAB 2HQCA 3ZZZA 1KB9D 1OIPA 3I6PA 2PFXA 3RB4A 1B70B 1MMNA 1KD1T 2NSCA 1FJEB 3A7OA 1MV8A 1QVFR 5HVFA 1VQ9S 4URGA 1ZMEC 3CI9A 1N4LA 5E0OA 1FJ7A 2MQLA 1M7LA 2LR2A 1OZHA 4FXDA 3VVTA 1WACA 1FRIA 2B4PA 4C46A 4ENOA 1U26A 3G6EP 2W2OP 4MK9A 1D9FA 3NGSA 1FWKA 4W80A 2DKOB 3CCLS 2XS7A 3IG1B 1WHYA 2FDNA 4CM2A 2JC0A 5T7LB 3W3SA 2CDRB 2OH2A 3PO5A 1RAIB 3N4XA 4DUZJ 3M8RA 2W7PA 2GCFA 1H8AA 3CCLP 2AYGA 1M1JB 3A8KA 3R5BA 1XQIA 1KNZA 1IFMA 3CDWA 2I6WA 2WB4A 1T3UA 3W64A 3N6LA 3CCTA 2MGZB 3A0BE 2JFDA 4KPYA 1N56A 3POTA 2BABA 3V6JA 2X1BA 2CG8A 3AE8C 5C2GA 2JEJA 1NRKA 1S1XB 2QG9B 4K4VA 2W01A 4JI8J 2E5HA 1JCDA 2QLXA 2L08A 2N7CA 2E1RA 4FF1A 3TAMA 2P7JA 1R8HA 3NP5A 1HNIA 1HNIB 1R5SA 5GAHU 1GTEA 4DV1J 2VZ9A 2F4VF 5KOWA 4DFPA 2Z2LA 1URQB 2WITA 3QAUA 2DR9A 1NHLA 5KFYA 1BCCD 4IOCQ 4YFUA 4X65J 2NS1B 5DDQC 3DLHA 1BY9A 3UPFA 3E8OA 4DV3F 3SCLE 2RH3A 2WVBA 1X0PA 4ZCLA 2WSEJ 3NCPA 1SQBE 3TVZA 1CJTB 3TDKA 1LK7A 3DMJB 2C3OA 2NZ2A 2HGLA 4F7VA 5CBOA 2XYGB 1VIXA 4IFMA 4FPIA 3FFIA 2QL7B 1S59A 2KUBA 1YITP 2MZ1A 1S2EA 1L0LD 3AE3C 3TYTA 2IA0A 2RVJA 4DHVA 5T7LA 1FKPA 4Z37A 4F0MA 2HFZA 3B8EB 3I31A 3LF0A 1OWAA 4FBTA 4WY4A 2A06D 2K8GA 2VASA 4I7FB 1FVQA 2BJDA 1Q7LB 4H4OA 4BXLA 1ZTTA 2UUCJ 1T03B 4OYPA 1VHIA 4P2FA 1EB0A 1RGVA 3ELHA 2R7SA 2BKOA 2V4RA 1CQMA 1Y10A 3Q5PA 2VIHA 4ZVEA 3G8TA 2JWNA 5AVQB 5D0EA 2DTJA 2JLEA 3M8QB 3H1HD 4GODA 2AYBA 2FJEB 3M4XA 4AT1B 4KH0B 2GGPB 4J91A 4UZBA 5DGAA 3I56S 1UMJA 1L3TA 2HQGA 5CYQB 1IBKF 1K04A 3H1LJ 1OXZA 3EDQB 4XPCA 3TW0A 1FAVA 1S9GA 4FYYB 4TQSA 3SDEA 2R2UA 3RGIA 1FNXH 4NMXA 2FD2A 4H4MA 2JJ4D 4F2RA 3VGSA 1SC6A 3KKFA 1RCXB 3K0JA 1F9EB 3UCUP 2E5IA 1H2UX 4OMFG 3IN6A 1JNRB 1VJQA 4RO0A 1L0NG 4JBCA 4TQRA 2LEPA 3G71P 3D6YA 3BQ2A 2P9GA 2CZ9A 1O8BA 4RW4B 2BJ9A 5J2QA 1RTZA 2VQFJ 4ECTA 1S72P 3ITHA 4K4XA 3GONA 1X5SA 1VQKP 2GNKA 4OZJA 2KFYA 2KG0A 3NS6A 1JKHA 1LNQA 3G86A 3MZWB 2CJYB 3H1HG 1L0NE 2L41A 3M9NB 1HGZA 4TLFA 2CG4A 4ECXA 3AE7C 1LKZA 5DM6Q 4YXDC 1TL3B 2QJPB 1PAUB 2ZYAA 2E9RX 1RUSA 5AVZB 2YKPA 4B9MA 2L3MA 1C4CA 3MEGA 2B8PA 2W9AA 2CJXB 1URQD 3AE5C 4RKUJ 3HVWA 1DTQB 4CLSA 3SZ2A 4BRYB 1U0HB 2ADCA 3AXKA 3AD8C 3GCWP 1RT6B 2HPCA 5F8GA 1SJFA 5KFMA 1C4AA 1QGKB 4UT4A 2CRLA 5ETSA 2CNNB 2R5BA 4DL6A 3TWZA 3B4MA 4YB7A 3T5HA 2W7OA 4HT5A 5CYQA 2BM1A 2HHHJ 2GS8A 4EEYA 1WKJA 1X4GA 4L73A 3HZGA 1Q8KA 3MMJA 4CLKA 1N34J 3NGTA 3KHHA 1EDIA 2BW7A 3OTEA 3QJPA 4L3KA 4RNHA 2JJLA 3FEXB 1X4DA 3KTQA 4MMOA 2HNZA 4XDDA 3C6UA 1CC7A 1PIXA 3V4IB 1NK6A 3OL8A 4O23A 4WFBQ 2E1PA 1T05B 2VF3A 1DTTB 1LTGC 2AKWB 3JCUH 1UFWA 3H98A 4A8KA 3QJLA 4NPDA 3RAQA 5KLVE 2V0NA 3HE4A 2LKMA 2ROGA 3QO9B 3A0HE 4PZVA 1X5PA 2IHR1 5DGBA 5I3UA 3FEYB 4DR5J 1VBZA 3MPYA 2MHEA 2DR5A 2VPXB 2BKNA 1RQUA 3G8SA 2UUAF 3AOCA 3A2AA 2W27A 4HKQA 4ZIWA 4PKDB 1R0AB 2M3EA 1BCCJ 5JMNA 4O3SA 1RHKB 1SQVJ 5DJUB 3BCCE 1KEKA 4ZLJA 1T3JA 2BJ1A 5ETOA 3F89A 2HPUA 4ID5A 3HUSC 3OLBA 4N7TA 1VR6A 2QFIA 3Q2SC 4F4AA 1G1XA 1AQTA 1V9OA 1VRTA 3Q89A 1U1OA 3PKYA 4X4RA 1GMVA 4DR1F 4X64J 1ULRA 2Z2MA 1DARA 5A6WA 2JNJA 2ZWPA 3L74D 4CH0S 3CX5I 3IBWA 2BCCG 2DGTA 3KLVA 2ZHOA 2DNQA 4YOEA 1WELA 4Y0FA 4U95A 2ILZA 3D9BA 5CZVA 3TF5A 3J81j 3EZUA 3KLHB 4RZRA 1UCNA 3WU2E 2Q79A 1N5YA 2QJYC 3LUYA 4URQU 3NNCA 2HYNA 1G4CA 2ZEJA 3VMZA 1KBRA 3ZTPA 1FWLA 2QTWA 2U1AA 4H13C 1DD3A 1TUGB 3EMTA 3IR7B 2B0GA 4X2BA 2DCUB 1LFWA 3KG0A 2VG7B 4P9SA 3Q8VA 3MM9B 2FYUK 2HLOA 2P2CB 3KJFB 2WONA 4H4KA 1I94J 1LWUB 2YNIA 1HBWA 5I3UB 4B9SA 4N78E 1T94A 5K5MA 4G1QB 2YNGB 1FDIA 2Y1IA 3D3CJ 3QMQA 3PRJA 2C2RA 1UKUA 2K1RA 2YKMA 3MR6A 4YEAA 2WOMB 2OYIA 3CWBJ 2AW0A 2OTJS 3QZ8A 1M0SA 4RBUA 2QA4S 2HFVA 2CNKB 3AOBA 1D9AA 3MUMP 3LAKA 3CMAP 1FDDA 1X79B 3D7SB 3THVA 1RT6A 3KK1A 3TNUA 4ZP9A 2VA3A 2GIFA 1J2VA 1VYAA 4ECQA 2Q43A 3KHRA 5I42B 2Q6QA 2CPEA 3CCSS 3K5BA 2QFJA 4H54A 2Y9HA 1AA1B 4YR2A 1NKEA 3CGIA 3KUHA 2AT1B 2FZKB 1DZ5A 2DNNA 3P8MC 3CCWA 3PW4A 1YTZT 2XSFA 1UW4A 5BJRA 1QJHA 1ZPWX 1F5BA 2LMIA 4E0DA 4EZ6A 3CC2S 3EM1A 2CQGA 3QT6A 2YPZA 2IBZE 1JIHA 3OBIA 1LWCB 4JI1F 1L0LJ 3J80Y 2OTJP 3VTPC 2CPZA 4Q5VA 3AEFC 1QEXA 1FDOA 2XMTA 3IRXA 4QOTA 3KK2A 1USEA 3RBDA 3EQ2A 2E76B 3ILIA 2C42A 4DUZF 4XFJA 1S48A 2KN4A 3HUSA 1NDPA 2WK4A 1QUPA 2W4PA 1HJ0A 1Q4RA 3BCCD 1Y7PA 3FSXA 1VRUA 3OXLA 2YKOA 2E1MC 5C24A 3Q8UA 3UE2A 2H5EA 3PYFA 1MZ9A 4LR7A 3I0SB 5DQGA 1CSJA 4H44D 4B3MF 1RTHA 3OTDA 1FXLA 1YK9A 1U25A 3B78A 4YXWH 1WG5A 3QSIA 1SKRA 5KG0A 2O67A 4ZLLA 2JKVA 4WFZA 3PHEA 4JI8F 2RF2A 4O4RA 4PV1C 1ZA1B 3CJ4A 4YB5A 2RUSA 3CD5A 5CXTA 4ZPTR 3RR8A 2EVZA 5JVGQ 4DU8A 3C14A 2YXRB 1LV5A 3FBEA 2M7SA 4CLUA 3M06A 1TL1B 1NOHA 1VQ8P 2KM8B 3TGUD 3J7AN 2R5DA 2WPRA 3FCWA 2VBYA 3SBMA 1NTMK 1Z2ZA 3JAMU 5BU5A 4YDDB 3PYEA 2OYOA 1SXLA 1RI7A 2KT5A 2HGNA 1I5OB 3WUVA 3GFHA 4EK2A 1RAFB 4ICLA 4G6VB 4LF5J 3H1HE 3OTOJ 2N7YA 4GKKJ 3F41A 1L2PA 5GMKa 4N47A 2FTRA 4USMA 5I3QA 3SSUA 1GQEA 3MPDA 2QJPC 2BVZA 2AJ0A 3RK2C 3MEEA 1RF0C 4C4WA 4M5MA 2Y1JA 2AJ2A 3GW6A 4C0OC 3M8SA 2RMZA 4WE1A 3MM8B 3L35A 1VL2A 5B08A 2WB1D 1VQOP 4L3NA 2DGOA 1SPBP 3V6HA 2WRMA 3M9OB 5CA5A 1VISA 2CUYA 4EYYQ 2YNGA 3PFEA 4USUA 3A0BH 3DM2A 2HEKA 1FTCA 2HHSA 2IDEA 1HNWJ 1L5UA 2YNHB 2A18A 4KV8A 3E1RA 2PP6A 1BGYG 4K4SA 4DS5A 4WK3A 1T03A 5LSOA 1YIJP 2HFSA 5LSRA 3KLEB 1DTQA 1PC5A 3V2UC 1RISA 2C3MA 3QPIA 3CDUA 3H8YA 3AE4C 1PG5B 3UW1A 1HI8A 1RHUB 2JVRA 4GIFA 2XM3A 1RP5A 1NUEA 3VMAA 2WVCA 2XV5A 4I67A 2AQ4A 1C1CB 3EDRB 2A06G 3P45B 2ZUGA 3LPEA 2Z30B 2E42A 2C1EB 5M2RA 2DNHA 3U1LA 3P4UB 5IM0B 4K0KF 3R7BB 5JXSA 3V2QA 1N8RT 1H38A 2G0CA 4PJ0E 2K06A 4O3OA 3V4MA 3KXDA 4TLRA 4QU6A 3FUYA 3CCZA 5LJ3Y 2Y9ZA 3LW5H 1VI7A 2OELA 4OZNA 1FO1A 3QRPA 3PV8A 3AEAC 4WBAA 2IPOB 2Z4EA 2B51A 4WP3A 2ZC4A 1JX4A 2BACA 1CEZA 1XNQF 2I1JA 4USHA 3CWJA 2QLBB 3OTBA 2VODA 4LFAF 1UVLA 4DV0J 1HNZF 4CO4A 4NEZA 1JY3O 4DF4A 1A02F 2LQ5A 3HRNA 3OHAA 5GTIE 4H0LC 3GPAA 4C3LA 1EDJA 4I1TA 2GHWA 1NKZB 5L9XA 3MFIA 4N3YB 2W6JH 1WRGA 4I56A 4I7ZC 2P2UA 3VYIA 5IWAJ 2V4JA 2E9ZA 3NWRA 3HSDA 3DU6A 3H32B 2BE2A 1HLWA 1TK8A 2FJVA 1S1WB 2BE9B 2VKRA 4ID8A 2FXOA 3L74J 1VQ9P 2HWIA 2KJWA 1RQVA 5F8IA 1IK9A 5ETVA 4FKYA 5KFEA 1VBXA 1KYOD 3CJTA 2J9DA 1P27B 1RWPB 2IVMA 4P2XA 2CJQA 3ZO7A 5GADU 1B4SA 2D9PA 1SC3B 4LSNB 3S1TA 4PPDA 2ZBCA 3BGFA 2KI7B 2PMWA 2HHVA 3TI0A 2Y0BB 2ZE2B 1HQUA 1HGVA 3T5LA 1DFDA 2M52A 3MTJA 3Q2YA 2YQ3A 1Y47A 4TYBA 1FZCB 1C0UB 5D0HA 4PQAA 1DEBA 4OZ2A 1KC8T 2IZ0A 3RL0D 4BDPA 3TZZA 4OHZA 5C42A 1PFIA 3DDIA 4JI3J 3JTOA 2E76D 2QYGA 3FWLA 5C42B 3CJSA 5AJ3F 3JSYA 5ETPA 1J1EC 1XJWB 3OFGA 1H2TZ 5LM7E 2YPYA 3B8HA 4D6TD 4RUCA 1PPJD 4NL5A 4C8OA 3NAIA 2ZBRA 1YVFA 3D28A 3THPA 5KFGA 3IXQA 2QEXS 2LVWA 3DOKB 4U9RA 2ZZMA 3L75G 3OD2A 1AB8A 2XNQA 5J2NB 1TL4A 3BKFA 2E75B 3R2DJ 5J2NA 1IFJA 3I32A 3Q5SA 1SQQG 4U3FJ 2IBZG 3RTVA 4L76A 1VK8A 2YKNB 3PG9A 2XWYA 3M0AA 2KH9A 4HI1A 4USVA 3CCES 1HQEB 2EFPA 5CBNA 5CYMB 4BLGA 1S1UA 3J7YI 1YTZI 1SQVD 4K4WA 4M5LA 3OFFA 2MZSA 1S49A 2HURA 1VIOA 4OHVA 4E98A 1IKYA 4A8XA 1HIYA 1GX5A 1KLMB 4QR1A 2OP5A 2WVEA 3L71E 2CQDA 1AFJA 3A5TA 2HSEB 4C11A 1S9GB 2MQ8A 1MKMA 2C2ZB 2DEIA 2HHQA 5KG1A 2J6UA 1U0SA 1CJVB 2ZVNB 2FYNC 1NDKA 3W2WB 1RT4A 4FN5A 5HROB 1UVJA 5AXMA 4DDFA 3HE5B 5DZ6A 2M3BA 4OHXA 4RNOA 2MMYA 4MKYA 4ES1A 1FZAA 3CCEP 1HWIA 4HDHA 5KFJA 5APVA 4LRAA 5E3CA 3OR2B 3J7Z5 4U96A 3R2CJ 2I1KA 1NPPA 1K47A 3E51A 5KAIE 1J5OB 4PXDA 3D6HB 3W9HA 1UL3A 1R8CA 3HTKA 2IJFA 2VV5A 5K14A 2W9BA 1U45A 1ZA2B 1KQFB 3JTNA 4GVLA 4DL0C 4V19J 4ZPDA 1FJKA 3HVRA 1R89A 4A8SA 1OYEA 4DCJB 2ERRA 1UFKA 2WSFH 3ZTSA 3IA0A 1S9EA 3DRXA 3GR1A 2HZVA 2DO0A 5DDRC 2QE7H 1IXKA 2R7VA 2H8PD 3PHLA 4WU2A 4XE5B 2FUG9 1X8DA 1NO8A 2BJEA 2W8LA 2XQCA 1NMEB 5DG8A 5F9LA 5I42A 4RW8B 2O3DA 2DH9A 2CPBA 5HANA 4OYXA 2LU2A 4WU3A 1PGJA 2LQJA 5APSA 4MN4C 5B66H 3MP7B 2MLXA 1OY9A 2DNGA 4JI5F 4DMZA 2YY3A 4GOEA 1XMOF 2HIQA 5L8RJ 3SDEB 5IT4A 2W7AA 4ZKAA 1NHVA 2FVRA 4EO6A 4IR9A 1C2PA 3W2VB 3HT0A 2P58A 1HNXF 4PD4H 2QN6B 2WSCH 4LRDA 3NOCA 4J37A 4WTOB 1KYOI 3I55P 3T97B 1U2FA 2WBRA 3LP0B 4X66F 1S4EA 2KVQE 1B0PA 2LA6A 3TO8A 2P9CA 3C8VA 1HHQA 2QG4A 1GD2E 4ED7A 3WUUA 1BGYE 1NK9A 1FRLA 3G6ES 5F0WA 4RW4A 3MEEB 3WX4A 2WONB 1B3TA 3VF0B 2J9CA 1IR1A 1LP1A 4B3MJ 3SIPB 4YTPC 1HNVA 3VOPA 1FE0A 2FHJD 3BGRB 4KHPF 3DLKA 3W63A 4F25A 4TU7A 5AVYB 1H2VZ 1GX6A 4RWXA 2M5AB 2AV5A 5J2PA 2R8GA 3MMAB 2M5AA 1GZLA 1XMQF 4N56A 3M1VB 4P6QA 2DXDA 2ZNYA 4LF8F 5K5GB 4CO5A 1WC5A 1U0HA 4KBIA 1IKYB 4PXCA 4DV6J 1SJ3P 1SKUB 2ASJA 2G2ZA 2FYNB 5CAAA 2F7VA 2P5VA 2DIVA 2QJKC 1HTLC 2RE1A 4IH7A 2ZKUA 3OFEA 3TVKA 4YP3A 2CPJA 2L9DA 6FD1A 1NJXA 2PAJA 3UDLA 2K9JA 2ZBIA 3ENAA 4WFXA 5M2PA 1WC6A 5DDPC 2KYVA 5C7PA 4WP8A 3MD0A 5ETTA 2BUNA 5HJYA 3OTOF 4ASWA 3ICLA 4IL6X 2DNZA 1FZBA 3JQJA 2BEFA 2BRLA 4DPXA 2XU6A 2C2NA 1BQMB 2WAQD 4R25A 4B02A 3K8WA 3WDOA 4WP9A 3HHNB 4KB7A 2FHJA 1XC9A 1S0VA 2QLFB 1UPPA 2R7OA 4QYZJ 3W8GA 3RZAA 4UY8T 4Q43A 5KLIB 2UUTA 1N88A 3FCVA 2ZKTA 2KM8C 1MWYA 2NPSC 1KP6A 4J9VA 4D3GA 4ZN3A 2VFTA 4ZPBA 1OSCA 3M7VA 4RLEA 1RDRA 2ZJQQ 3M2RA 4UW2A 1RWNB 3UR3C 3OJSA 1MWZA 4NE9C 2I0XA 2GVZB 5AVWB 3J7YU 1RTIA 1NJIQ 3Q83A 5HP1A 3B82A 2JWAA 1RTHB 3CJQA 3SWKA 2JVOA 5KAKA 1T2KD 1NU1D 3O44A 4XA4A 4H0LB 1JXLA 4NASA 4Y65A 2GMJA 5KG7A 3S6EA 4G3IA 3NS5A 1IKWB 1M90Q 4OJHA 5KFQA 2M88A 1KQGB 3B6BA 4MIAA 5B0CA 3L71J 2K37A 4JUZA 4TXSA 5DLFA 3BEGB 3N6MA 3QFWA 1Q95G 2DGVA 4KGMA 1JWWA 2FHMA 1C0UA 2A06E 3OUYB 1S6UA 1DAXA 3MR7A 3V2NA 2ZFCA 1S9FA 3PO4A 1TKTB 4Y6IA 4AE5A 2RB7A 1NO4A 1G7CB 1J1DC 3OHBA 3IRXB 1GMWA 1LWUC 1K0TA 5HJXA 1LT1A 4I0WA 3KLGB 1P8GA 1G1IA 3PIPQ 1HFEL 1WF1A 3MTUE 5E3QA 1RLDA 1AA0A 1LWXA 5EUHA 1CSBA 3HFVA 3BATA 2DHAA 4LLHA 2HODB 3SCKE 1ZH5A 3WIUA 3FBCA 2B4VA 2AGQA 5A8KA 2DCLA 5GMDA 3I0RB 4W7YA 2W24A 3J81U 1LTIC 4WXWA 2IM0A 1HMVA 2ZAEB 4JOUA 3HHLA 3PXGa 2OPPB 2YIUB 2IFXA 2KHDA 5BR8F 3Q8QB 2YWWA 2IYPA 2AIRB 1DLOB 4O4GB 3R5CA 3GFXA 1VQKS 2L5GB 2GGPA 3BYRA 3RL0C 3L70D 1DH3A 2Q7CA 5T41A 1UZDA 3TJAA 3DOLA 1HPZA 4WBFA 1SQVK 3W61A 2O1PA 3ENWA 1OSDA 1KOOA 2XMWA 2PI4A 4P7TA 5D8HB 2HFNA 2OGUA 3MMBB 2C3PA 3T3FA 3CX5E 3GQCA 2W1BA 2V34A 3ZZ0A 5J1NA 3K5PA 4U8YA 4EO8A 2J5UA 5J1EA 4LQ3A 2MZTA 2VG5A 5KFKA 2OHDA 2ZH3A 4KR0B 3C66A 3MAAB 4AXIA 1FFWB 4MK7A 3TZWA 2LECA 3CCMS 4N41A 4C8ZA 3LPYA 2VG7A 5ETMA 3D70A 5CCGC 3RGUA 4KGKA 2PN6A 2SXLA 3I4PA 1JLAA 1BE3J 2QJ3A 4ZJLA 1HWUA 3VR1A 2ZOMA 1BQNB 1Z4UA 1NWQA 1LT9B 1ZM2A 3ITHB 5KJ7A 4X4UA 4DUYF 5KKZB 2XNRA 1U7JA 2FC8A 4DJGA 1L3VA 3NG8A 5LSLA 1SBRA 2YNHA 4KV8B 2B5JB 4JI0J 1D8ZA 5FD1A 4AL6A 1CPZA 4I4BA 2DGXA 2CK3H 4IG0B 4I7FA 4K3AA 4HH0A 3QT8A 5A6PA 4QZVB 4HYKA 3PJXA 4J9PA 3DNCA 4ID5B 4DX7A 1FRKA 2HWHA 1NSQA 2OLWA 5EWEA 1MLAA 4I68A 2JSXA 4WWSA 2CAJA 1LWEB 2OAUA 1IWGA 1JB0C 4FF4A 2HS3A 3H1LG 1WOOA 1P1TA 1H0TA 3K59A 4B3SF 3PDNA 4DR4J 5F8HA 1H0HB 1X0FA 3FKBA 3JSMB 2R7TA 3KYLA 4R8UA 3OT9A 1E6VB 5LMUJ 1NDCA 3HKWA 2AU0A 2E1CA 3H4DA 1URQA 2KYXA 4C97A 1OO0B 2UXBF 1E5WA 2DNYA 3MEDB 1NLKL 4IO1A 4OX7A 2WHOA 4C2MA 3MD3A 3GHGC 1F5AA 4KGZB 1N73B 3M8PA 2XGPA 3TUPA 1PL5A 1CULB 3AE1C 3JYTA 3DGPB 1AFIA 3Q8YA 4NXMJ 3HJVA 1SJ1A 2ZBPA 2IDBA 2ZXXA 4F02A 3TK1A 2HODA 2E74B 1EZVD 1IZNB 4JYBA 1TQLA 3U1CA 3BGRA 1SFCD 4ZVRB 3R5AA 1KFMA 2KK7A 3KG4A 1L3SA 4F67A 1RACB 3MOJB 3IWXA 1YGYA 2WWWA 2C0XA 4LIWA 1N73C 3CCRS 5ETLA 3D6TB 3GG0A 4BRYA 4CNZA 1YTYA 2YH0A 2DNKA 1TKXA 1EAYC 4YY3J 1KQLA 3BCCG 1BE4A 2GAHC 3UCGA 4GRSA 5AW4B 1FRMA 4J9QA 4DUTA 2CADA 4DX8H 3MM5B 2JO1A 3CSKA 5BXIA 1QM9A 4KFBB 1FT8A 2NXEA 4DN0A 2QIFA 1S4XA 1UWBA 1Y5IB 1KILA 2BQ3A 3M30A 3QIPA 1BDCA 3TZXA 2CA9A 2CVEA 4WKRA 5KFOA 1S5LE 1RZMA 2B43A 3E1IA 5KTQA 2BDPA 3GB0A 2ZNZA 2NPFA 4V1Ak 5ITHA 1OWXA 4F3QA 2O01N 3BO2A 1Q82Q 2HQ3A 4DX6A 1EIYB 1VQ6S 4Q0BA 5B66E 1FDNA 4I6WA 3CE8A 2KNCB 3MM9A 4DR7J 4GO5X 4BBYA 4KHPJ 2IVFB 1JY2O 2W6AA 4LRBA 4ELVA 4DV5J 3KJVB 5IV3A 4J90A 4J9LA 2MQNA 4B9LA 5L46A 1LP1B 2OEKA 3H7HB 2QMXA 2HBYB 1HNVB 2Q6BA 2DNLA 2IAJB 3AECC 2DO4A 3IO1A 5C24B 1ZAVA 3GE9A 4O44B 2QRRA 3U27A 5A8KB 4FXVA 4CYUB 1ZW0A 4WTYA 3RK3C 1KWMA 2CJAA 5C25B 3A12A 2XY6A 2HKEA 1FNOA 1WC3A 5CZXA 4LF4J 4NI2A 2OYHB 2B6AB 1KYOH 4ECWA 2HK3A 1WEXA 3J81Y 1XR6A 3CEDA 4M3LA 4RPFA 4DV1F 3EE3A 1XIQA 2CQ4A 3R5GA 1RE4C 4CWBA 3KHGA 1PKUA 1PYTA 2BV3A 4H44C 2ZD1B 3MTKA 4X65F 2OI2A 3W67A 4DL2A 3DLEB 1KB9E 1QAXA 2YBVA 1GK4A 3S9OA 1T3OA 3IFEA 2YX1A 3PH0A 2DD8S 4DL4A 3UCZP 1DBDA 2R8IA 4KKOB 2MKYA 5AW9B 4F4XA 4Z1MH 1NNDA 3DRRB 1RBAA 4OX8A 3EVOA 1SIZA 3UNYA 3RK3D 2DIUA 1HJBA 1JXEA 1YJNS 3JC22 5IFMA 1Y9BA 3EGWB 1FC2C 4DG1A 3V4IA 2VG5B 3BGLA 2E76C 3NAHA 4OWFA 4CLPA 2J0SD 4PEOA 2FFDC 4I6MC 1T9UA 2N3OA 2IJRA 2LA4A 4AFFA 4FP9A 2R2SA 4U3FD 4J9NA 2GQ2A 4Y2CA 9ATCB 3HD1A 3QATA 2VJVA 3ZZOA 2IBZI 2UUCF 1B7YB 2XNDH 1JLEB 1ZOYC 1PYOB 3R9LA 5L1JA 1TZ0A 1SQBG 3PEJA 2DRAA 1JLEA 1JK9B 4ZPVR 1QTNB 3H1LD 2E7XA 1NTMJ 3T1HJ 2Y0DA 1IJFB 3SQGB 5APQA 4NZ6A 1R3NA 3GV8B 2JLFA 4K5RA 1NAYA 5DO2A 3H1HJ 2HK2A 3H1ID 2OPSB 3GWCA 5CHCB 2ZYGA 3KLFA 4JBZA 5GTHH 3PCOB 2W2MP 3PTZA 3KLFB 3L4BC 2PT0A 3TAQA 2VOPA 4DZOA 1SJ4P 5E5NA 5BYSA 4TN2A 1HH0A 3H42A 2MDAA 3MOZA 1WHWA 3CXHH 4ED6A 2JEIA 4BWNA 3B5NC 3M8QA 2FXPA 1VBYA 1YJRA 4DV4F 2WT7B 1Q86T 1IFNA 2FZGB 4LF7J 5K20B 4PV1B 2NPSB 2GQQA 2ZH6A 1WOSA 3AEBC 1Y5NB 2AJ4A 2N3LA 4OLOA 3KK3A 1PBAA 4URSA 2W90A 2UWJE 2KSJA 1K05A 3F5HA 2KU7A 2EI5A 4ZVHA 1T05A 4YR3A 2J5AA 1H72C 1VQ4S 1BLUA 2HHTA 3K89A 3NGKA 3EJMA 1NSPA 1PIEA 1PJ7A 2ROEA 3TEGA 1B0TA 1L0LK 3ETMA 3HULA 3WUTA 3C19A 4P74A 1F0XA 4GDOA 4ZHRA 3H1IE 4OYIA 4NCAA 2ASYA 4W92B 4ECYA 4RW6B 4R5PA 3OW2R 2VA2A 2F8EX 2CKWA 2MZJA 3M2RB 1BC6A 1HWTC 4RW6A 1R43A 2GHPA 3PFOA 1YQ4C 1YZ6A 3I0RA 2BKPA 2WOMA 4W98A 4DZDA 4ZVGA 3LWMA 2R8KA 2XB2D 5HP1B 1HBMB 3KNGA 1DURA 3LALA 4OJGA 4U7CA 1LWFB 1HBMA 2F9DA 4K4YA 4KIAA 5DDOC 3L75D 5AVRB 3AE9C 2P6TA 2RU3A 1Q8LA 4OLPA 2CVIA 3BYPA 3PACA 2U2FA 5KT5A 2MXYA 1L3UA 1YJ9P 1HPZB 2AEFA 4ZKUA 4ED4A 3NMAA 4OYWA 1OMSA 1JM0A 4ECUA 5GAGU 3OQ2A 3R3TA 3QGIA 3GG2A 2E43A 1NU1E 1M8OB 4PV1D 2XO6A 1NTZG 3BSNA 3MPVA 3T1YJ 3M05A 2KLUA 1WTFA 4LSLA 4FF3A 4FYDA 3WIVA 3QJJA 4MKBA 4IFVA 1SQXG 3RBEA 3MM7B 2KLVA 2FYUJ 4HHHA 4CT9A 4ZDNA 2UUAJ 4Q44A 3W1YC 4CLFA 1HBUA 1I6JA 2O66A 3KK2B 2F4VJ 2RQ4A 1JTHB 3D71A 1RA7A 1EZVG 4JI4F 3CX5H 4B9UA 2L9NA 4H4KC 1N34F 1N0VC 1PGOA 2IBZD 3AE6C 1JXVA 4Q45A 2IPPA 2AYEA 2DGSA 1PJ6A 3CXHI 1LTSC 1U6FA 4LT6A 1SQQK 3EGVA 1U6ZA 3IG1A 2CYYA 1YJWS 3DHWC 4NEYA 4NXNJ 1RK8A 4IG3A 1T7PA 2DHHA 2YXLA 3NBPB 2Y8WA 1JLQA 2IYGA 3C3LA 4Q8EA 4K59A 2L91A 4ZA1A 2VBWA 4F0HA 3TQ1A 1BSHA 1RU1A 4IDKB 5E41A 1HMVB 4DSIA 1KFNA 2J0WA 1JUNA 4N76A 1HWJA 3C9IA 4B3SJ 3PRBA 2QC3A 3PJWA 2DHSA 1NPRA 2Z2YB 3H4BA 3N28A 3QGPA 2MKJA 3ZZTA 5AXLA 2W6BA 1A9NB 5FIIA 4WXOA 3RK3B 1Q16B 1EZVE 1KVKA 1LOUA 4U6PA 3MM6A 4ZP7A 2KS1B 3G6XA 2OSRA 2F65A 1EX8A 3PW5A 2Z58B 1FKOA 3JAMY 1U1MA 1LXJA 1G1JA 3PX0A 3B4DA 1YBUA 1U8SA 3HCXA 3K8VA 4X64F 1SQPG 2CPSA 1EQ0A 1PC4A 2BJ3A 1TKTA 3ZZUA 2PFDA 1JCCA 2WQYC 1NEEA 1NU1K 2EWHA 1LFPA 1BGXT 4YB1P 2ZUAA 1FXDA 4QJVA 2NSBA 3N0VA 2LXUA 2IZ1A 1WF2A 2VDHA 2E5LF 4G1QA 1KILE 4S0MA 2OD6A 5IZHA 1X5OA 4WE1B 1QE1A 4HT7A 3S7RA 5DG7A 1JQGA 1GXLA 2VQEF 1KILD 4K50A 5FJ4A 5KFBA 2I8EA 3DYAA 1R0CB 3KMSA 5THWA 2JR8A 1Q2NA 3O6QB 5HATA 4QBUA 3P7KA 3PM9A 3TA0A 3HX9A 2E44A 1YJTA 1WEYA 1N54B 4QWDA 4I64A 3EZOA 2BCCD 3LGHA 1QX8A 3BBFA 4C7NB 1ELOA 1FEHA 2ZITA 4ZP8A 2RHQB 2YMYA 1OYDA 2NRGA 5E3RA 3G9CA 2J9DE 2IC3A 3L71G 2JDJA 1AUSL 4IOIH 4IFFA 1Q81T 3UWTA 2IYOA 2ZH2A 3KYQA 2FHOB 3AY0A 3H1KJ 1Q81Q 1IBMJ 2LDYA 3VWSA 1F3VA 4ED0A 2E74C 5DRKA 1D7MA 3DKDA 3MAHA 4X4VA 4RWWA 4H4MB 4DPWA 3ZC4A 4DR7F 4CTAA 1P84D 3UN3A 4DV5F 1EDLA 4CTAB 1X7VA 3CULA 1GAOA 2NYIA 2HW3A 1IR0A 3RG6A 3T97A 4KT0J 1SUQA 1HBUB 3BV8A 4N77A 1L0NJ 1NJYA 4PRFA 5IC4B 3CVKA 2DNOA 4I6YA 1RTDB 1HBNA 3K2YA 5KFFA 1OMIA 1RHRB 2LFVA 3RL0B 4HKZH 2M5YA 4AXJA 3GJQB 2E74D 2M8HA 1HBOA 4DN9A 1JKHB 2FB0A 3H0PA 2DH7A 1N7SC 2DHGA 1OJ4A 1W2BR 1FHTA 1SKWA 5D6GA 3LOUA 5L8RC 1JNMA 5AW7B 3ZTRA 1DHMA 3H5SA 4DR5F 2EFVA 2X1AA 1K1SA 4LQ9A 2E1AA 1HA1A 2E5TA 2HBQB 1FJGJ 5LMNJ 5H2FE 2H48B 3VVUA 1FK9A 2F4FA 1WKLA 4C7NA 2KFNA 1BUXA 3GIIA 3V6DA 2LCWA 2EBEA 3EPGA 1U1RA 5EWFA 2D3ZA 3DLEA 1XK8A 2FLPA 4LF5F 3P32A 1RJJA 2QE5A 1TV6B 4NA2A 1ZN5A 2FLLA 2R2RA 4PYDA 2BA9A 1TV6A 3W5YA 4DR1J 1ZRTE 3I96A 3C15A 1XTZA 3HI9A 1FZGA 1KS2A 4IFYA 3MFHA 3WU2H 1KFDA 1RA6A 3L36A 1RT4B 3VAFA 3HSGA 5KFDA 2HMIB 3F0NA 3H6PA 3MGNA 3Q8RB 3CIMA 5B0BA 3M32B 2PD1A 4LFBJ 4J9KA 1RE3A 3Q86A 2GIQA 5T14A 1X9VA 1BE3E 2FQQB 3HK2A 5HLFB 2JRSA 3I4HX 1BE3G 2J7WA 3IWNC 2MKHA 2HHWA 4DWIA 2D2CB 3V2RA 1HI1A 2XEXA 2O5DA 2FC9A 3TA1A 4NLDA 3CCVS 4HLBA 2QM7A 1KORA 1FFSB 3EYZA 1MROA 1H6KX 1X8YA 3RAMA 3OL6A 2UUBF 5KJ7C 3PKMA 5SUHA 2COLA 3I5AA 2WPVB 3HZEA 1I94F 4GKKF 3DLGA 1KTVA 2C2EA 1HQEA 4M5KA 2I9SA 2JEEA 1H88A 3IAOA 3MMAA 4DQIA 2Z5IA 2W2NP 3VGUA 2O01C 3EVMA 1CS4B 4ANEA 4ZJQA 1BDDA 4F26A 2VU5A 2H7HA 4ANDA 5J2MB 1IKXB 1WHVA 1F9FA 1K73Q 1JLFA 4LF7F 3EFFK 1GL2C 3RK2D 3FMWA 2RQMA 1VLOA 4GKJJ 2OPRB 5E3PA 1C1CA 3AEGC 2ZD1A 1HNWF 2QSWA 1Y00A 4R0JA 1S1XA 3NTNA 2AEJA 1KLMA 1TL1A 3CDAA 2J7UA 3RL0g 1S99A 3Q0AA 4Y28J 5APXA 4TY8A 1U7MA 1PBUA 2H1YA 3SFGA 5KJ7D 1HQ2A 3BH6B 1OX3A 3M30B 1AZSB 3I82A 2DGWA 3H59A 2JC1A 2YNFB 1RF1C 1MU2A 5D78A 4Y00A 2GJIA 1V5VA 2XWXA 3MHYA 3RU0A 4OI6A 4I2PA 1Z1ZA 2CXEA 4WKYA 3RB3A 3T5KA 3LIDA 3NCRA 2KXHA 3ILLA 2KT3A 2B88A 4UOHA 2X3DA 1H73A 1T8ZA 4J9RA 2YNIB 4PG5A 2YXQB 3N9UC 3DC2A 2NUUG 3Q24A 5GTHE 4OYZA 1BCCE 2K3KA 2VC1A 2ASDA 4F8RA 4LC1A 2FHKA 3CXHD 1LW2B 3GR0A 4M5NA 4WFNQ 5JJBA 5KOXA 4OHWA 2MY8A 2LXIA 3W5XA 1BCCG 3H32A 2BE2B 4X4TA 2C0WA 4AL5A 1PZQA 2O3JA 4P73A 2V4JB 1AW0A 1SQVG 3AA8A 1I51B 5KFUA 4LFAJ 4K8RA 1M57D 3US5A 5KT7A 3K5OA 2YO2A 1UEUA 1M5SA 2PI5A 1U6BA 4JI6J 3MIWA 1A02J 5SZTA 4WK1A 3DXBA 5H9FJ 3Q2TC 5H2FH 4K4UA 3POTB 4QWBA 2JZ5A 4PUOA 3T1YF 3MEKA 2K3RA 4JI3F 3G4SS 5IWAF 2YWGA 5LL6d 1JB0J 5HMZA 4IUFA 5KFWA 2QA1A 3TAMB 3PRVA 3AA9A 4JV5J 4OYOA 1RU2A 2OPQB 2VC0A 2DRBA 3M9QA 1RQ0A 2C22A 1UVMA 1P6TA 4LFCF 4WVZA 5CMZA 2VL1A 2E7WA 3WQPA 4RUBA 3ONQA 1JLGB 5J1EB 1LK5A 3MI7X 2XMKA 3GU0A 1W7WA 1A0OB 4RUHA 1ACMB 2M3DA 3EVWA 5G0RB 3CJ0A 3MAAA 1S6PB 1UP1A 2H3EB 5HK4A 4IRDA 2D9OA 3N4WA 1G2CA 1FOSF 3KG1A 4I69A 3GV5B 3HVAA 4QIWD 1N33F 5B0GA 1CULA 3BSOA 1U1QA 2EXUA 4H13B 4UB6E 5KG6A 1BQNA 4IOBA 1QY7A 1TAQA 3WBZA 2N1TA 1RYSA 3G82B 1YJNP 1FFGB 2DGUA 3A4TA 4LMZA 1FKPB 4AYBD 4GT1A 1YBKA 2NXJA 4RW9A 1Q5VA 1S6QA 1J1DB 2HRUA 4K5SA 3BASA 3OL7A 1RH5B 1YZ7A 2BJ7A 2GO9A 2DR7A 2XZRA 5KFCA 1VF5D 1EC5A 1B7FA 4OGQB 3OJUA 4X4NA 3PR5B 1JMBA 1T11A 4USWA 1WC0A 4QW9A 2JWDA 3V6DB 2M0GB 3MCOA 1R6VA 3CMEP 3MD1A 3CCVP 1GNKA 5D4NA 2ZT9C 1SV5B 4N5SA 4JI2J 4FKXA 3BO3A 3B5NB 1FJCA 4OX9F 3CD6S 4P10A 2ITAA 4D6TE 2MQQA 5K8OA 4OYMA 2PDAA 1MW7A 5AW1B 4PJ0H 4M1KA 2BR0A 4DF8A 1K9MT 4IFYB 3QIDA 3MMBA 2OO4A 5JVHQ 1YI2S 3N5BA 4P7VA 3G6VA 2AX0A 1ZBTA 3IGVA 3MR5A 4I2LC 3CJ8A 3C6UB 2PEHA 3HHLD 4Q2MA 1SL0A 4K0KJ 5G0RA 5HSPA 2D2CC 2QJKB 2ACMA 3J7ZT 3TYYA 1RY3A 3CNQP 2LQ9A 1WTBA 2BASA 1Y11A 1Q8BA 2Y1LB 5HVGA 4RU2A 1NK0A 3VAGA 4WZMA 2JH3A 1C0TB 3LP2B 3K17A 1YKWA 2ATCB 4K4TA 1C0TA 2RUGA 3ILJA 4L6V3 4NPFX 2RHSB 5DM7Q 4OL8A 4M63A 1FVSA 2FLNA 4DS4A 4GC6A 3QGGA 1JLQB 1VLYA 4OZ3A 3RK2B 1ZP0C 1XNRF 4NPEA 2W4CA 5HO4A 5CYMA 5K8MA 4N78D 3ZTQA 2UP1A 3K5NA 4IG0A 3H5XA 2PMHA 1FX4A 2VD3A 1F2GA 1NTKK 1IBMF 4R4LA 4ZNCA 1SVFA 4UZCA 2ZOGA 4FS2A 2AX1A 4RNNA 1L4AD 2G2OA 4F04B 3OA7A 1D09B 1GMUA 3A3NB 3M9HA 3FRYA 1AROP 4ELUA 1NCLA 1RAGB 5KG4A 4LVOP 3O8WA 2UU9F 2J7KA 3FBBA 2R9LA 4HJGH 1YDLA 2R44A 3SXLA 1FJPA 5DS7A 1RAAB 1NTME 1NJIT 3PW0A 1EZVI 1HYSB 1SC1B 4L74A 4YQWA 3QH9A 1S3JA 5AE1A 3CCRP 2W83C 5APYA 2OFHX 1X4HA 4C8KA 2OYHC 1AVYA 1LTTC 3T1AA 4GVBA 1UETA 4NLXA 3IAM9 4WWIA 1SQXJ 1EKRA 2AD9A 2QGFB 1J2JB 2FPHX 4B3TF 2R7XA 2PA8D 1K8AT 5L1IA 4JI5J 4ILMA 2GZOA 2MKSA 2OEJA 4DQSA 2VFVA 1X9MA 3KUEA 3Q23A 1XMQJ 2YWHA 1RTDA 1H7XA 4DSLA 3A0HH 4Y2IA 4OZ5A 2AF6A 1JY2P 3DRSB 1IC2A 2WPQA 2QL9B 3A13A 2ZDOA 4D6TG 3P8BB 1QSSA 1AFOA 1FJGF 2XY5A 4FBUA 4DCPB 2R32A 4OZ1A 3DLGB 4NLYA 3K5MA 4DFMA 2LYVA 2RAQA 1H7WA 2XI3A 3QFHA 1GT8A 4ZK7M 4HL9A 4DPUA 1EP4A 1ZZNA 2MKVA 3SFUA 4YHHF 2R8HA 3N6NA 3BBBA 1UIIA 2W2QP 5FLXY 1NKBA 2QX0A 3JSBA 2V8GA 1TKXB 1H3DA 3KLEA 3HHLB 3NL0A 5KAFH 4EBEA 1S0OA 4UB8H 5MAOA 2A1BA 1SIWB 1YRXA 2CWKA 4ECVA 2KTQA 1XERA 2IC3B 3ZTOA 2VH7A 3MPUB 4O0NA 1NK8A 2VJUA 3MMCB 5BYQA 4BC9A 3CC4P 4TY9A 4J9UE 9RUBA 4MH8A 2AGPA 4LFBF 4TY8B 3BF4A 1BSNA 5F3TA 5ETQA 3CPWO 4IR1A 1IKVB 3DGVA 3G9RA 3CJKA 5AXNA 1FF2A 2XBPA 2JX2A 4RBVA 2UVVA 5FLXU 1VQ7P 1BGYD 1TUVA 3HKZD 2B9EA 2NZCA 2AJ1A 3KWMA 2BBEA 1YRUA 1FDMA 1NK4A 2PGDA 2IFMA 4LBHA 2AXTE 1SH3A 4TU8A 3W9IA 5GMEA 4ITSA 3IMQJ 3VV2B 1JTHA 2UUBJ 3G87A 2OKQA 2R42A 3CDEA 2H4YB 2AGOA 2BYCA 4AL7A 2WTFA 1QVFO 1RABB 3MM8A 5F8JA 2FKWB 1U48A 3HUSB 1FZCC 3ENVA 2RDIA 3O3LA 2E75D 3L75J 3DM2B 4EU0A 3WMM0 1WDTA 4LF6J 4ZITA 2H5IB 3GLMA 1EDKA 2HLTA 2FVCA 1CBKA 1R0AA 3ISNC 1N32J 4NLQA 4GKJF 2V50A 2YX7A 3VZHA 3ZDMA 1EXIA 3L7OA 4ZMMA 1TTHB 4F50A 2KOGA 2VICA 1SC4B 3D2WA 4JYAJ 1R31A 4WFYA 1NXIA 4WF9Q 4CP5A 3BRTB 3HT3A 2CIMA 1Q0NA 1MNEA 3R2PA 3SI8A 1XR7A 3UNGC 2XMVA 2HWTA 2H4WB 4C0HA 2KSEA 4C8LA 2EW9A 1J5EF 3M9BA 1E6VA 1NVOA 2V8PA 3JSMA 4NX9A 1BXNA 3LW5J 4A4JA 4ZVOB 3VQSA 1SH0A 1IJEB 3CD0A 1N7LA 2XYHB 2IBOA 1ZAXA 1XMOJ 3FGAD 1TVRA 5AVVB 5HLFA 2MHNA 1KQSO 3GF7A 3CCJP 1SQXK 1B0VA 2EPIA 5HAOA 2DITA 2KYZA 3QO9A 3BKUA 5EFWB 2L9WA 4X66J 1XWLA 3G82A 2FYXA 2VONA 4U3FG 3DN9A 4V19X 2GJFA 4MT1A 5HQLA 1RTIB 4DEZA 2YNYA 2Y0SD 3J7A1 7FDRA 3SCJE 3DRPA 2VPWB 4H4OB 2GW8A 1GL2A 2XYPB 3D0HE 3MAQA 5L39A 1FKAF 1EXJA 4M5HA 4P2MA 2QSIA 2CZVC 2OFGX 4MKVA 1S77D 3T41A 4LF1A 2A2DA 4KJIA 2KZJA 2KRBA 3ET6A 3L73D 1EETB 1RAOA 1U02A 1KR4A 3X3UA 3W60A 1KQKA 3U7JA 3MECA 2XZTB 1WOPA 3RB0A 1RF1A 1LTBC 1LW0A 3N01A 1DX7A 5L9NA 5HN0A 4KKOA 3BSCA 4ECSA 5BU8B 2ATLA 2FXMA 4MFBA 3H5UA 4DUYJ 2WSCC 4HTIA 5GTIH 3FBFA 1E79H 4XDCA 4MJKA 2QA4P 3GYXB 3GHGA 3MGJA 4DR3J 3TRGA 1N5VA 4DT0A 1PYSB 4HTJA 3SSRA 4ZVUB 1DEEG 2WW4A 1Z56A 4PG6A 1UJ6A 1X60A 3M2VA 1REGX 2JOQA 3L95X 5KFRA 5J2QB 1NTMG 1E6YB 3CJRA 3LP2A 3VMYA 1VQPS 5EGYA 1E6YA 1VQ5S 2Y0EA 2ROPA 4MTPA 2HNDB 1LGHB 1HL6A 3L73E 4NCGA 4GMKA 1NH4A 3HF5A 3OR1B 3CUNA 3CWBD 3LANA 3U02A 1VQPP 3MEGB 2HLUA 3L70J 1GL2B 3R7SB 1S9EB 2DHXA 4M5IA 1N7SA 2L48A 4Y2MA 2DNRA 1VC5A 3MPWA 1S76D 2RS2A 3FZ2A 2ADBA 4DCOB 2CQHA 3A3OB 2ALZA 5J1PA 4KPCA 2JFKA 1ZM4A 3ILOA 1RTJB 1F5CA 2QA2A 1FRHA 1VGYA 2BANA 4JI0F 2MKKA 2UXBJ 1DQ9A 5KLVD 2MJNA 1RF1B 3C1LA 3M91A 3D67A 5EWGA 3KPEA 1ZZFA 3SFEC 1WEZA 2G3AA 1JY3P 2ZHBA 1V6HA 3FWNA 2LXFA 3DRRA 2B9BA 2HIYA 1RE1B 4CPGA 4NZ0A 4B3RJ 2CQIA 2F40A 5DQHA 2IM1A 3GJSB 3BQ0A 2EFGA 3VGTA 4ILRA 2GM4A 3MWBA 1WMKA 3UVJB 1SLQA 1DTTA 4CO0A 4FF2A 1QD1A 3KLGA 2ZH8A 3BN7A 3FFIB 4F4KA 2PEBA 2VFRA 3AJDA 5K8NA 2MQPA 1EARA 5D0RA 3R6LB 4H0LD 1O5JA 1PSDA 1MSWD 2G1HA 4Z7CA 4AUKA 2QEXP 1N36J 3CCQS 2JEGA 3HHKA 4UUWA 3KNAA 4O44A 2R3CA 1JLBB 4NLVA 1R8AA 1PPJE 4Y99B 5F9NA 3AEEC 1JJCB 4PQUA 4A7PA 2MSTA 1FZFA 3HJFA 3VAIA 1FX2A 3BSAA 3IC1A 4LVNP 3ITKA 2R4FA 2UVRA 2BXJA 2PA3A 4K7QA 3C6TB 2UU9J 3OJAB 4UY85 1RAEB 4ER8A 4QIVA 4KQZA 5H9FK 3HVTA 3GIJA 2QVAA 1JJHA 1W5CE 1FI4A 2VOOA 1F60B 4J9OA 2ZVIA 4DOZA 1SQFA 3RBXA 2Z8QA 2GA1A 5BR8J 1ITPA 1LXNA 2MEWA 3NOGA 1Q78A 1UAWA 1YQHA 3NEKA 2XLJA 2I8DA 1SFCC 1WSVA 1U1KA 3H25A 4DSFA 1KILB 2E29A 2HMIA 1OW8A 1PGZA 5TISE 2FYUG 3H90A 3NNHA 3M6XA 1D0EA 3M6UA 5GADI 4DPOA 3S1KA 3AD7C 2KT2A 3OLAA 1NAQA 2M0BA 1VDHA 3VQTA 2Z2ZA 4NZ7A 4IYQA 1KRPA 2V6AA 1VHFA 3RW7A 1Q53A 4DQQA 3DRSA 3BZQA 2MY7A 2HZCA 1YBAA 1LWUA 2UXDF 2JHEA 4PD4E 1VMBA 3OVAA 4FZVA 4ZIVA 2GX8A 4WYWA 3AJ1A 1SQBJ 4Y99C 4KJMA 2EEYA 1VS3A 3DOMB 4PAAA 4YHHJ 3T9ZA 2HGMA 3R1LA 1TMMA 1ZXGA 3H1LE 3Q5RA 4WJBA 4DOJA 1Q86Q 2IM2A 3BKTA 3C46A 5AE2A 3C16B 5MLCV 1VBKA 2RU9A 1W2IA 1N5TA 2Q5UA 3OVSA 2CJ9A 5GAEI 1T02A 4ZN1A 3CF5Q 4AQYJ 3SWYA 4OFZA 4CH1A 1T8EA 5ADZA 1EETA 2WBMA 1NH7A 2G2YA 2XGQA 4ED8A 1D3WA 5KFLA 1T9YA 2ZT9D 1FXRA 4QWEA 3C14B 3CMQA 1RTJA 1K8AQ 4A8OA 5CJ4A 1JNZB 1VOMA 2E7VA 2DISA 5IQ6A 2XMAA 1WI6A 5EDWA 1M5HA 1K44A 3G4SP 2OEMA 3KJNB 3M6VA 4DR6F 1H98A 5CCMA 4EBCA 1SS1A 2XULA 1XR5A 4OGQD 3JTPA 2DR6A 3M32A 1VF5B 2POHA 3ZZYA 5DJBA 3AH6A 3T1HF 2VBXA 4DSKA 1V3RA 1TK5A 4B3OB 1LEOA 2YQ0A 2KNCA 3SQOP 1SB6A 5E3AA 4DR2F 3W68A 3IS9A 5LMUF 4RESB 1Y9OA 5L1KA 1HI0P 2HZAA 1L4AB 2P9EA 1HBNB 2BZ2A 3W66A 4OZLA 2Q1LA 4C0BA 2DPJA 2YX4A 2W8ZA 1SQPK 1QE1B 4ECRA 4Z7YA 4C6AA 3U59A 4H13D 1BWVA 1T0TV 2GVDB 3DI6B 4UOFA 1OPIA 5A8WB 1HBOB 3DLJA 4J9MA 4LF2A 4JYAF 5D3GB 4DJBA 4I1LA 1BWEA 1P84I 3D6FB 1HF9A 2Z0GA 1U2RA 4LF9J 5M2UA 1URRA 3IGNA 3NWGA 1YHQS 4XTTA 2ZOFA 5KT3A 3EGNA 2D3UA 5A8RB 2RD5C 1KLNA 1F2HA 1KC8Q 2MGZA 4A48A 4HHJA 2OPPA 1OVUA 2KZIA 1J5EJ 3QYYA 4XK8C 2ZJRQ 1KHVA 4DQRA 3IR9A 3EPIA 3NXSA 2QLJB 3R5DA 3MM6B 3D0IE 2B56A 4RJVA 1GL2D 3I87A 1OPZA 1V3SA 3QIPB 2C2DA 4KTQA 1HD0A 2KO1A 3HM9A 2DVIA 1IQTA 2JL9A 5B09A 1GMWD 3VALA 2YVSA 3USSA 1S6PA 5CABA 3CJ5A 4L75A 4B3OA 4K2XA 3CIZA 3EFGA 3KLIA 3G96A 1S10A 1PV3A 3D5MA 4WPAA 2MZQA 3U1MA 4A8YA 3OR2A 1JJ2R 2OMOA 1GK8A 3NMRA 4W7ZA 2KZZA 1JLAB 4UB6H 2DBBA 1CJUB 5AW6B 2K2PA 1QLNA 3GMAA 4AYCA 5APWA 5IS2A 2XHCA 4O9BA 4C3KA 1U1LA 2AYMA 2EFNA 3TGUE 2OYIB 4D6TJ 2K1RB 1S0NA 2FJXA 5HQ8A 5KT4A 3MDFA 4DPYA 2K7JA 5F8NA 3C16A 3D1QA 1JEKA 4DSEA 2W25A 3TUZC 2N9YB 3JSVC 4NOHA 2LP4A 3NRBA 1YG0A 5C5JA 3TVYA 2J76E 5CCHC 1REVA 4OJ3A 2UVUA 4OV1A 1N7SD 2V2VA 1EZZB 4XAKA 3GJTB 3IP0A 1GU4A 1R0BG 3AAWB 4LF4F 1VQLP 3A8EA 4C48A 3WC2A 2UUWA 3P5BP 2WSEH 4DV7J 2HNYA 1QDUB 4LSZB 1SL2A 2Q9IA 3NLCA 2C2MB 4JI4J 3EXCX 4OZ0A 4USIA 2E5YA 2OD4A 1KN7A 1GXUA 5F0UA 3AXMA 3VAMA 3P3DA 5HMWA 1QVGO 1QTMA 1LWCA 1Y0HA 2LQBA 4WCEQ 2X1GA 4I7ZB 4ZVSB 1HHTP 1YRTA 2ZM6F 2V68A 4WY4C 2DB1A 3ABVC 1QAYA 2X7IA 1AJYA 1NTKE 2IM3A 4OI4A 3K5LA 3CC4S 1TFYA 1NTKG 2X1FA 2CJBA 4RW7B 3LAMA 2QRXA 4UUXA 4X4SA 1L4AA 3ZFVA 2PFFB 2IRYA 4YUDA 3CX5D 3JSRA 4ZHRB 3BDEA 1WKKA 2I2YA 3PNIA 1TR0A 2G1DA 1MROB 4IG3B 1QL1A 1S1TB 3WC0A 3SSQA 3BO4A 5CCLA 4TYAA 1FE4A 3K7RA 2B5JA 4JV1A 2BW2A 1GMJA 2PE8A 1V3ZA 1U2CA 3H2UB 2K1AA 2H54B 1S7IA 4WY4D 1DQ8A 1MFZA 1NSKL 1OY8A 1CI6A 2DT9A 3I5CA 3BCCJ 2VG6A 1RBOB 3QRQA 3KDOA 4CLTA 3II6A 2FJDB 1NK7A 1NSAA 5H9EJ 4OGQC 2A45H 2J59M 2DGQA 1X9SA 1WORA 4E8UA 3IWLA 4O3NA 2LEBA 4B3RF 4KHXA 2ILYA 1ZOTA 3R1HA 2H51B 2AXTH 3G8QA 3GP9A 2QMUB 2R8JA 1RT2B 3CDBA 1JLGA 3VHQA 4OV6A 4WYLA 2YQ1A 4I6AA 1YJUA 3MM7A 1SQVE 1T2KC 4ECZA 1SP4A 4I2PB 3RUBL 1RF0A 1RB0A 4CDIA 2FFDB 3OPKA 3EICA 4ZCMA 3PVXA 4EBDA 1N36F 1SQQD 5KFSA 2V2QA 2C3UA 4YR0A 2E5JA 4ETZA 4YMEA 1AV1A 4KAIA 5A76A 1YSJA 3NY0A 5HBMB 4UOGA 3H5YA 2HAFA 3VTIA 1EJ7L 2F63A 2X51A 3O2IA 3GF3A 3DU5A 3B71A 2Q66A 1H89A 2RMLA 3RYLA 2AEMA 1WC4A 1SI9A 3T5JA 2AP6A 3FDSA 3DFEA 1M1JA 1QL2A 2R3VA 2V9KA 3Q8PB 1UA1A 3L70E 1RWOB 2MTLA 1REVB 2SPZA 3FQKA 2VQEJ 5E79E 4ZCKA 1WD6A 2R3SA 5L38A 5HQMA 4ZJOA 3BM7A 2N1TC 1D9DA 1VK3A 2HNYB 2VUGA 2XI2A 5APTA 3W65A 3B5NA 1UWBB 3SEOA 5DLGA 1U09A 3JCUE 1FWPA 4IH5A 3TARA 4ED3A 1N6QB 3KQGA 1M5VC 1JLCB 1MWQA 2ZC3A 3H1JD 2P6SA 1HR0J 4ED1A 2FYUE 3B54A 4MK8A 1N52B 3TANA 5IT0A 2CNOB 5CCGA 2FGOA 1VQMP 4GVBB 3CO0P 4K2JA 1Q5YA 4YDXA 3CCUP 3QLHB 2EK1A 4LUBA 5GAEU 3QZ7A 1K9MQ 2XSJB 1WG4A 4EI2A 1OY6A 1N2DC 1RWKB 4JP8A 3HSJA 4PG8A 5HI7A 7FD1A 2B87A 1UA0A 2HS4A 3OAKA 4M94A 2RRNA 1RE3C 1F3FA 1GXTA 3A8IA 1WG1A 4CO1A 4EDFA 4G1IA 3CMAS 1RSCA 3MR3A 2CPXA 1YITS 1JY2N 4NYOA 4M5GA 1QVGR 3LH2S 2GFFA 3MUDA 5G4DA 3P8CD 2W8KA 2K9YA 2GA7A 4NXNF 1SQXD 1UEKA 1WC1A 1FESA 4Y2KA 1B99A 4CLLA 1OVRA 1F9HA 3NFQA 1YIJS 7AT1B 1U1PA 3R8YA 3GCXP 1TK0A 4DR6J 2E9TA 5D4LA 1M56D 1T3NA 1DD4A 1RYRA 2WT7A 3NS7B 1WHXA 4LJMA 2O01H 4ELTA 4DV3J 4HI2A 4DBQA 2HQIA 3QRRA 2WVRA 4OI1A 2A6OA 1UVNA 3I56P 2AHOB 4P2SA 1CJVA 1IQZA 4MFBB 3CPWR 2C2KB 3KZIH 3LW5C 1RAHB 2F3JA 2H5JB 1TMJA 2AMCB 3AT1B 4OJ1A 3FK4A 1J27A 5KLVJ 4WFAQ 3IR5B 3F56A 2V7QJ 5CJ0A 4YB6A 1RCOB 2Z57B 1TKZA 1TL7B 2EKNA 2JEFA 2ZZNA 3LO3A 3PEHA 1MG7A 2HVZA 2KFZA 1P1LA 3LP0A 4ZVTB 2UXCF 2QA4G 4QU7A 4DLGA 3CB4A 4PCQA 4XO0A 4ZLPA 1Y8AA 5F8LA 3LA0A 1WF0A 4RKUC 4PWDA 2MLYA 3HD7C 3MCNA 1SQBD 3VAHA 3MXHP 4R5PB 2V8DA 2YKMB 3W5ZA 3L73J 2VFSA 2GUSA 1NHKL 3DLBA 2E5LJ 1Y5LB 2C28A 2YMKA 2QV6A 3SSSA 2QM8A 5JUMA 1KKHA 2HRYA 2OYHA 2B6AA 2IJNA 1X4AA 3TJ8A 4QYRA 1CI6B 5TJHA 1NZ8A 4CLWA 5AVXB 2WW8A 4C98A 4P71A 3AJ2A 2DXFA 1C1BB 1FD8A 2NYHA 3BR8A 1GU5A 1RWMB 4ILLA 2QT7A 3MCSA 2YKAA 4DL3A 1T9WA 2ZVOB 3ZNUA 3TUJC 2DRDA 2BCCJ 1NKCA 4DLEA 1LT9C 1T95A 1TP7A 4RL1A 3A3PB 2CNLB 1LTJA 1RT3A 1K1QA 2B89A 1N6QA 1LTJB 1Y3JA 1QLED 4C7RA 2QL5B 1CJKB 3QT7A 3W7BA 3D68A 2PO4A 4X62F 2LXBA 1YYCA 4FNHA 4Y3CA 2WPSA 5KLVK 4HH1A 2Q3PA 2GIRA 3I9V9 5ETRA 5CD4A 1UW9A 1N8RQ 2D7SA 1S1VB 4JI6F 4FYXB 1WI8A 4R0EA 3TGUJ 1QSYA 1AXQA 5IT9Y 4FDFA 4U7UK 3ZNJ1 5AW0B 3UIAA 4DV2J 1L3KA 3L3CA 3OR1A 4HDGA 2XS5A 2XS2A 2WZ7A 3CXHE 2WMMA 2Y8YA 1N5QA 3DRPB 4JV5F 1RE4A 3S4RA 4QIGA 4DV7F 1JO5A 4A8FA 4LFCJ 1RBLA 3EWKA 2Y9YA 3BGOP 2PSZA 3TNUB 4B9TA 2V69A 2OIHA 4FYVB 4PYAA 3CCUS 2BANB 1VJWA 3H1IJ 3RR7A 1W25A 4EUVA 2DW3A 2YO3A 3MM5A 2M8RA 5LMNF 4IO9Q 5AXKA 2K88A 2KS1A 3VMXA 2AZ1A 3H1KG 1IM6A 3TJ9A 1AZSA 1BD6A 5GAGI 4B17A 1IWAA 2YKQA 5AW3B 1SFCA 3W2WA 5KFTA 2HS0A 3D3BJ 1JJ4A 2XHWA 2ZJSE 1R7IA 1HYSA 4Q8FA 3GFYA 3NGDA 3KOAA 1NU1J 1S9KD 2CQ1A 3VCDA 5F41A 5K9FA 1T9TA 2BE7D 3BDPA 2C9NY 4Y2AA 4U3FE 4F4ZA 3D0GE 2V7QH 3P6YC 5C2CA 3IS9B 1NB7A 3DMJA 3GLJA 1AVOA 1KVIA 5B0FA 4UTGA 3CO9A 1HD1A 1VC6A 2A3JA 2LEAA 2Y0CA 2IY5B 5E2QA 4MKAA 2RIJA 2B87B 1ZS6A 2Z56B 2YWKA 2KJVA 1W2EA 3DGPA 2VRSA 3QSYB 1D1UA 1GDTA 3HHDA 2RSQA