1KQGB

Formate dehydrogenase n from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
289
structure length
289
Chain Sequence
b'AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 89
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqgB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB02
1VJWA 2PDAA 2PA8D 1H0HB 2V2KA 1HFEL 1JNRB 2FJEB 1K0TA 1FF2A 5CH7B 4YDDB 1F2GA 2C3UA 2GMHA 3MM6B 2WSFC 2VPZB 1DAXA 1JNZB 2O01C 4ID8A 1KQGB 2GMJA 2Z8QA 3EUNA 1DFDA 1C4CA 1SIWB 2FJDB 1FXRA 3IR6B 3LW5C 3MM9A 3MMBB 3OR1A 1FDNA 1A6LA 2C42A 1G6BA 1SJ1A 4XDCA 4DHVA 3MMAA 1KEKA 4RKUC 2VKRA 1FTCA 1FRLA 1AXQA 1PC5A 4KT0C 4Y28C 3MMCA 1FRHA 1F5CA 1WTFA 1FRKA 2VPYB 3HKZD 1FDBA 4OV1A 1Y5LB 1XERA 2VPWB 1BD6A 5E7OB 1JB0C 1F5BA 6FDRA 1SIZA 4AYBD 1D3WA 2WAQD 5L8RC 1FDAA 5BYQA 1BC6A 2VPXB 2C3MA 4CI0B 3MM7A 1G3OA 2V4JA 1GTEA 2FGOA 4OMFG 2PMZD 2FD2A 1B0PA 3GYXB 1FCAA 2XSJA 2FJAB 2FJBB 1FEHA 2WB1D 3MM5A 1GT8A 3OR2A 3C8YA 1RGVA 5CHCB 3MM9B 6FD1A 3OR1B 1Y5IB 1ROFA 2ZVSA 1FXDA 3MMAB 1IQZA 4L6V3 1FRMA 1BWEA 3MM8A 1H7WA 1DURA 3MMCB 1CLFA 1Y4ZB 2C3PA 2FDNA 7FD1A 1GTHA 2C3YA 1KQFB 1FD2A 1FRXA 1FRJA 1BLUA 3MM6A 3MM8B 1Y5NB 3IR7B 1FERA 3EGWB 1Q16B 1H7XA 1FDDA 1IR0A 2WSCC 3EXYA 5BYRA 1BQXA 4XK8C 3MM7B 5BYSA 1C4AA 1R27B 1PC4A 2C3OA 2V4JB 1GAOA 2WSEC 3MMBA 3PNIA 4XDDA 1B0VA 1FRIA 2XSJB 2IVFB 5FD1A 3IR5B 3MM5B 3OR2B 2UZAA 1H98A 7FDRA 2Y0SD 1B0TA
chains in the Genus database with same CATH superfamily
1B7FA 3G96A 4OV6A 5KT7A 5I42B 2FHOB 2C3UA 5AXLA 1FESA 3OTOJ 1DQ8A 5HK4A 1KQGB 1FEEA 5B7WA 1Z2LA 1VOMA 3TAQA 3HUSB 3DRSA 3M9OB 4PJ0E 1MKMA 5HANA 2BKOA 4K8RA 1FRHA 1KFDA 2KS1A 4OV1A 1LW0A 2RILA 2GO8A 3EM1A 2K3IA 3VAHA 1F5BA 5LM7E 1HF9A 4KIAA 3C1LA 2YY3A 4PWWA 4E8UA 3AJ2A 2BM0A 4EO6A 1Q86Q 1ZAWA 5L46A 3TJ8A 5GAGU 2IPPA 4BRYB 1G2CA 3R8YA 3GV8B 1BWVA 1D8ZA 4Q43A 2DVIA 1Q95G 1RUSA 3BATA 2H43A 4DX7A 1VQ8P 2OSRA 1UVLA 5HLFA 2D69A 3MM6A 3GILA 2ZE2A 4FNIA 1P1TA 3BZQA 1QTMA 1S72P 2QFJA 3AD8C 2W01A 3LGHA 3H4BA 4ID5B 1LTIC 3HZGA 4DLEA 1ICEB 2YMYA 3CCJP 3RK2C 4LJMA 2MKKA 5AW3B 5EGYA 2KUBA 3G82A 5CYMA 3IC1A 1U1NA 4K4ZA 1U45A 2FKWB 2QVAA 4TLRA 2V9KA 3GSIA 3N6MA 2P10A 3EWKA 4F4XA 3MR5A 4KHRA 1X4DA 1NTKD 2XEXA 4JI0F 3H40A 1RT7B 2JVOA 4O3QA 3IBWA 1SJ1A 4A46A 3Q86A 2UUBJ 2N1TC 5B0BA 2HFZA 2DPJA 1TK8A 2NQPA 1H0TA 1SIZA 4KQZA 3RK3C 1C0UB 2LA6A 1FBMA 2DXEA 2E1MC 4J9RA 4ZDNA 4KFBB 4NL5A 1WUUA 2E1AA 1NJWA 4Z7YA 3AE9C 2PN6A 5A0YA 2CPHA 2YKMA 2GQCA 4EZ9A 2HAFA 1OPZA 3IWXA 1H2TZ 3G6XA 3CCRP 2AX1A 3OT9A 4TY9A 4CYUB 4ER8A 1FE0A 1SBRA 1NHKL 1SLQA 3CX5E 1TFWA 4LRBA 5DO2A 5AW2B 4RW4B 2C3OA 4URGA 1E79H 4ZP8A 3PFEA 4F2SA 5IOLA 1N5SA 2EKNA 2V0NA 2JEEA 1SJ4P 5T7LA 1Q8BA 4DL5A 1RT5B 3FBFA 4OX9J 3NS7B 3VVTA 3V4MA 1BSNA 3QZ8A 2GJFA 4N78E 2AJFE 3NGKA 4F67A 1UMJA 1RQVA 3MGJA 2CQ4A 2DHSA 4I4BA 2LXIA 2MQMA 2J0XA 1EZVG 1JLBA 2PO4A 5D0GA 2KXNB 2V4RA 2FHJA 4OI6A 4HYKA 2Q3IA 2XMMA 1M1KT 3K17A 2BDPA 1IO4A 5KFXA 3ENAA 5C5JA 2I1JA 4LF8F 2W8ZA 2NZCA 2KHDA 2G9OA 3O3LA 1L0NG 2YXRB 3VZHA 4A48A 3SYZA 3MP7B 2D74B 4DV6F 3W2VB 5EWFA 3W68A 3TVYA 3BN7A 4M95A 2ZJRQ 3QGPA 3OVBA 3MM8B 1TV6B 4EEYA 4FF1A 4ICLA 5MLCV 2CJAA 1NH7A 3BSAA 2K1AA 2Q6QA 3ILIA 4ZPVR 3UW1A 3VF0B 3ZZPA 3L75J 5FLXU 5DZ6A 3E7KA 2CK3H 5IXUA 1YJNS 3KJFB 1X22A 2UUAJ 3OXFA 2APOA 4JV5J 1GK6A 3UR0A 1BQNB 1N48A 2KFZA 2QSIA 3KJNB 4X66J 3KDPB 3H1LD 1W2BR 1CC8A 1BE4A 2BOPA 5KG3A 2V69A 1X8YA 2ZOMA 2LR2A 1KP6A 2HPCA 4DR4J 3S8SA 1IJDB 3QSIA 1UWBA 3GCXP 2K8GA 3EJMA 2AD9A 2WPVB 1FK9B 2QT7A 3L71E 5A76A 4LF2A 5JVGQ 1IFNA 1NAFA 4LF6J 2D3OR 2Y9ZA 3PV8A 4YUDA 4GO5X 2IVMA 3DOKB 2QSFA 3MCMA 3HJVA 5K14B 1L4AD 4DV1J 1OWXA 1KD1Q 3B8HA 3H0PA 3TJ9A 5E5NA 5BU8B 3I0SB 1VF5D 4IH6A 2MJUA 3UPFA 1H7WA 1VRUA 1TAUA 1T3OA 1WSVA 1ZRTE 3UIAA 3W5YA 1VR6A 1RHZB 5AT1B 3KLFA 3BRVB 1EETA 1TU0B 2HZVA 2BW7A 1KB9E 1Q16B 1X4BA 5DG8A 4FXDA 2NCKL 2EFNA 1VQYA 4Y2IA 4ECWA 3J7Z5 1S6QB 4H0LD 2C2MB 3HP6A 4V1Ak 1PP9J 1KC8Q 3JQKA 1RHKB 2MDAA 1PFIA 1N6QB 3R7SB 1JKHA 8RUCA 2UXBF 2AGPA 1X9WA 2XY6A 2X1AA 3LIEA 1H6KX 3R27A 4ZJLA 1U0HB 4QIGA 4ENOA 2BJ8A 2VHGA 3HI9A 3OPKA 4ZLPA 3V6DB 2J5AA 4PD4E 3WMM0 3VQSA 2HRUA 2C0WA 2CG4A 2GVDB 2ZH2A 1HWJA 1L0LJ 4RUBA 4I6WA 4I2LC 3H1IE 4PV1D 4YXDC 1L4AB 4BC7A 4EMDA 2DNLA 1Q53A 3W63A 4KE5A 4ANEA 4PWDB 3QRQA 4YMEA 3JYTA 1R0AB 1VF5B 1S12A 2JNJA 2ZH4A 3TGUJ 1IFJA 2VKZG 4DQSA 3PKYA 2VOOA 1Y4ZB 1TUGB 2DGXA 3L73D 3KLIA 4IDKB 5APQA 2DIVA 1FRXA 4ECQA 3L70J 3RL0g 4JI7F 1S0NA 1HQEA 2HHXA 2HFED 1BQXA 3OL8A 4CO2A 4H0LB 5C42A 1FZEA 3TUPA 1HBMA 3TF5A 4XO0A 1GNKA 4ZMMA 2MJZA 2PI5A 2MY8A 4H13C 4R25A 2M70A 2YWKA 1RF1B 2CDQA 1RYRA 3SWYA 5H9FJ 1HYSA 1SQBE 3DI6A 2VU5A 2D3ZA 4UW2A 1URQD 4JV1A 5J1EA 2LU1A 1OFCX 1PPJD 1JQGA 4LBPA 4NRTA 4RKUC 1ZW0A 1S1TA 4Q0BA 2J7KA 2HSEB 3HULA 4PV1B 3A8KA 1N73C 3HD1A 4GKKJ 3GG2A 2ZDPA 3LO3A 5LMNJ 2MKVA 3EICA 1HH0A 2V4JA 2NLWA 4G65A 3SCJE 4IOIH 3X3UA 1B70B 4A7PA 3W67A 4FBUA 2G0JA 4J9PA 3FK4A 5CCGA 3UN2A 1YRXA 2JC0A 4LSZB 4YP3A 3AT1B 2HHTA 1OVVA 3CB4A 3RR8A 2JWAA 4XFJA 1RYSA 4RNOA 4B3OA 4CPGA 2B51A 4QR1A 4DG1A 1F0XA 3R2DJ 3UNYA 2E7XA 3KHRA 2UVVA 1V6HA 4O3PA 2PA8D 2VBWA 3AOCA 2V2KA 3TAMB 3GLJA 1G1IA 1AA0A 1URQB 3O1LA 1ZOTA 4CP5A 1JIHA 3VMYA 4ED4A 4PYDA 3G9RA 1GH8A 5GAHI 3P96A 1ZYQA 1YZ7A 4YFUA 3K89A 1JLFA 1OX3A 4PQAA 4P6QA 3M06A 3MMAA 3A0BH 3LP2A 4KKOA 4C6AA 1YDLA 5B0AA 1FDBA 3BCCJ 1W7WA 1C2PA 5D0HA 4TU7A 3RR7A 2IDLA 2UWJE 2H51B 2M2BA 1UFKA 1LV5A 1OMSA 4ZP7A 4HVZA 1IBMF 2JOQA 2LXCB 2VFRA 4I6AA 1I5OB 3CCMS 2EWHA 4NLDA 4ZNCA 4KO0A 1RGVA 1SQQD 4OYPA 1HHSA 4FYXB 4NI2A 1QSLA 5CD4H 3Q22A 1BWEA 5H2FH 1E6YA 1VK3A 1JLQB 2VH7A 4QJVA 3PHTA 1CPZA 2CJQA 3BF4A 3IN6A 1K44A 5E3AA 3MUDC 1D8YA 2C1EB 1SVDA 4KV8A 4ZIWA 2AYBA 3AB2B 5HQLA 3ZXWA 1PYOB 1VQKS 1RB0A 1SVFA 4W4MA 4MYTA 3ZNJ1 1R5LA 3KHLA 3V5RA 3UN3A 1S1CX 5F8NA 1EKSA 3W8PA 1AJYA 5KFTA 1RT1A 1NTZG 1WG5A 2DNZA 3H1HJ 2B8QA 2E74D 1KLMA 2AHOB 2GMJA 4MFBB 4JI1J 1MUUA 4NZ6A 4C7RA 1C4CA 3CTRA 2GX8A 3DKDA 1ZOYC 3OR1A 4OZ2A 1PBUA 1XNRF 2RB7A 5KOWA 4GOEA 2KB7P 3OJSA 4M5MA 3DXBA 1CULB 4CLPA 2AWZA 4DV3J 4L74A 2KFYA 2YNGA 3M30B 3BREA 1SJQA 3KJQB 3TI0A 3UDEA 1R6YA 1RE3C 2FXOA 4JYAJ 2VJVA 3SFUA 2E76D 4DSLA 4J9OA 2GGPB 3QAUA 5KAKA 2FZKB 1PL5A 1XIQA 2GVZA 4CLWA 2LEPA 2N1TA 2QLBB 2BQUA 5DZ7A 3BGOP 3PIPQ 4DSIA 2DY1A 2NPSC 2WRMA 4ECSA 4TYAA 1H7XA 1U57A 2O01N 1FNOA 4B3MF 1YBTA 1HNWF 3HHLD 1SXLA 3HJFA 2MZSA 1UVJA 1YRTA 4HHJA 1A02J 5AW6B 5KFNA 2WONB 2FPHX 2RE1A 3AAWB 2QGFB 2OUGA 2ATLA 3SFDC 4JI6J 2E74B 4JUZA 3GHGB 2ZHBA 2OLWA 1JY2O 2FY1A 4K4SA 4BS2A 4B3SF 2GQQA 3CMQA 3W1YC 2E1PA 1DTTB 2W6JH 4WB4A 3MM9A 3VAKA 2E5HA 2A06E 5AW9B 3QIDA 1R8BA 5J2NB 5C2CA 1WDDA 2X1BA 2DXFA 1TTHB 5DDOC 3MAHA 4DPWA 3UDCA 3EGNA 2AKWB 3H6PA 2E76B 3RBEA 2HHHF 2OTJS 3HRNA 4DUYF 2P7JA 1KTVA 2RQCA 1XJWB 4C4WA 2QX0A 4IFVB 5EFWB 3PX0A 4DCOB 2VG5A 3TX0A 4JI8J 3QIPB 3AHPA 5A8KB 2FJVA 1U1QA 2VASA 4X62J 2ZC4A 2LQ5A 3QATA 3FXEA 1T03B 3PJSK 1SJ3P 1N5TA 2PEHA 4R4MA 1YJNP 1CSJA 2CYYA 2WW4A 3HHLB 2EC2A 3OTOF 1AB8A 2WHOA 2WSEC 1RLCL 2FFDA 1L3SA 2MYFA 1RT4A 2MTLA 4KGKA 4X4PA 2ZM6J 3GYNA 1L4AC 2XU6A 4N5SA 1X4CA 1HNVB 1Z4UA 4JPZB 1RWPB 2G2OA 1BCCE 2DXDA 4C46A 3MPVA 1VF5C 4W90B 2GHPA 3JTPA 3F5HA 2HLOA 2CPFA 3RL0D 2QMXA 1BE3D 2BJEA 2IHR1 2IAJB 3CWBD 4PPZA 1QJHA 2HK2A 3FRYA 3VAIA 2ALZA 3V2NA 5HMYA 2VKRA 3WBZA 2V4HA 4GVLA 1SQVD 1N0UA 4WTYA 1CBKA 5EX0A 3PHLA 2FYUD 4H0LC 3TUZC 2A0FB 3SXLA 4I1TA 2RKIA 3TNUB 1UL3A 2K37A 2ZBQA 1RF1C 1X31C 2YQ3A 3P3DA 1WF0A 4NASA 4UB6E 2WVCA 3D0GE 1S9FA 5AVYB 4LQ3A 3P8CD 1X4GA 1CLFA 4ZHRB 1ZA2B 4TLQA 4B9UA 3N9UC 3BJYA 4ATNA 4IH7A 1X0TA 1L0LE 2FYNC 5B0CA 3SSUA 4DT0A 2LMIA 3MTUE 4ES1A 5FLXY 1FERA 4CO4A 1JMMA 1A0OB 1HI0P 4HACB 3HDSA 2HNYB 4DZOA 2IVFB 4AD6A 1TFYA 2YWEA 1Q2NA 4H44D 2QA4S 1R6VA 1M1JC 3JSVC 3FRZA 2MQQA 2BEZF 3EXCX 2KH9A 1L5UA 3RL0B 3DHXA 3H1JJ 2MHEA 3GPAA 4IO1A 4NLGA 4LLHA 3KNGA 2QV6A 3I96A 3G87A 1I6JA 1HBUB 2QLWA 1KILD 1QEXA 3R97A 1YBAA 3UDVA 4F4WA 1U7MA 3NGTA 1XNQJ 1EDIA 1F5AA 3ZNUA 4OI4A 1WC6A 1H72C 1D9FA 5KAFH 3TQEA 3KLHA 3CMAS 2RSQA 3OD2A 4F02A 4NLYA 4UOHA 1FDAA 5F41A 4DV2J 1N4LA 2LKZA 1SQGA 3P8BB 1NK5A 2V9WA 1URQC 3FXDA 1S1WB 3SCLE 1S7IA 1IXKA 2NYHA 3CW2C 2XLJA 3HE4A 3GJSB 3DXSX 3UR3C 3IGVA 1QAYA 4O0IA 1MU2B 3OW2R 4USVA 1YI2S 1RU1A 3ET6A 4I68A 4ZVPB 1N8RT 3ENVA 2WSCJ 1IM6A 2XZWA 2AYEA 2V2ZA 4H44B 1B0VA 4OX9F 1SKRA 5I42A 2BQ3A 4KR0B 1JJ4A 1TL5A 2CJ9A 1Q79A 3MZWB 3NGSA 5G4DA 3T1AA 5DQGA 2DNPA 1I94F 2CG8A 4ECTA 3ELHA 1NM2A 4TYBA 5C2GA 1XTGB 1N33F 3DLLQ 1KILB 2KM8B 3CJ3A 5KG4A 3NBPA 1G4CA 4KY3A 2HHQA 4JI4J 2ZD1B 1YJVA 1LGHB 1FFSB 2BJ7A 2I38A 3QRRA 1YJ7A 3DLEA 2IZ1A 2J6TA 2AEFA 2WZ7A 1RH5B 4A8WA 4OI1A 5BYQA 2A6OA 1RTDA 2W9CB 1JY2P 3AQPA 3EPIA 4IOAQ 3WC2A 2YTCA 3P5BP 1IFMA 1HKAA 3CDWA 3CC4S 4Y00A 2COLA 3MMCB 4A8SA 3Q2SC 3PKMA 1NPPA 3K5PA 1VLYA 2Y8YA 2YX7A 2FZCB 1HLWA 1N73A 3DYAB 4X66F 4LRAA 2VB6A 1Y9OA 2WPSA 4WP9A 3PFOA 1N52B 2XSJB 4DR2J 1AZSA 1U8WA 3IG1A 1VIOA 3DOMB 3EZ5A 1GDTA 2H4WB 1CQNA 2MY7A 1GD2E 1MN7A 4NPDA 1VQLP 2AJ0A 4CQ1A 4K0KJ 3B6BA 2CQGA 4QR2A 2W90A 1N7SC 2EKYA 2IRYA 4U9RA 2VPZB 4LF6F 2J9EA 1JB0J 4QWBA 2XKMA 3A0BE 3AJ1A 1TQLA 3D6HB 4YTPC 5I3UB 2C28A 1I1GA 5EWEA 3M32A 1U26A 3P32A 4NA3A 4FF2A 4FS1A 1JM0A 3RK3E 3I5AA 4RU9A 2AU0A 1K0VA 3DLJA 1C0UA 1FNMA 4USJC 3V81B 3JSMB 3H20A 4NWBA 4OZ1A 1SQBK 2H5IB 1LT9B 2Z57B 2IBKA 1YHQS 1RWUA 2KXPB 4OMFG 4RW6A 5H2FE 4GVBB 5HVGA 4DX8H 3H2VE 3PDNA 1WF2A 4CYUA 4G1QA 1DZ5A 4J5OA 3GHGC 3BGRA 5GAHU 2FHKA 3T5KA 2D7SA 1UPMB 3D0HE 4RW4A 4XPCA 1XR5A 5J2QA 1M5SA 4PXCA 2HBRB 3HVAA 2B4UA 1VQKP 2GS8A 3D6MB 4KSEB 4NLQA 3MR2A 1MWZA 2HFSA 3SWFA 3SSSA 4ZLNA 3MM5B 3OR2B 2JDJA 3A0HH 1SQXE 2Y0BB 4EZ6A 4PUOA 1UP1A 3UD5A 5L39A 2CVIA 1UEVA 2ZKUA 2E76C 3TJAA 1ZLLA 1WG4A 4DR3J 2G3AA 4HH1A 4J9LA 2B4PA 3CJKA 1Y0HA 1Q82T 1GXTA 2PRRA 2V7QJ 1LTJB 1IKWB 2F8EX 1IR1A 5IWAJ 1KFSA 1Z2ZA 3HFVA 4XPEA 2HVEA 3L7UA 2BCCG 1UZHA 1R8AA 2H9ZA 3MAQA 4OX8A 4U7UK 1O0PA 5C24A 2IIHA 3MUDA 1YJ9S 1Q8KA 2CWKA 2OQQA 1FRLA 2O3JA 1F2HA 3O5TB 4JI3J 1BGYE 1QY7A 3S6EA 4NXNF 3I5BA 2N7CA 5GMDA 3WUUA 1XTCC 3D70A 2QE5A 1YJTA 1RDRA 1KS2A 1J1DB 4QIVA 2W4PA 4LF5J 2WMMA 3RAXA 5CHXA 4GMKA 2XSFA 2PD1A 5TISH 4HTIA 4NXMF 4I0WA 2KZJA 1Y5IB 2ZVSA 4L6V3 5D4PA 2XHWA 1HHQA 3MM8A 1TV6A 3AE4C 2FLPA 2QLJB 3VN0A 4I64A 4RW9A 5KFSA 1VBXA 1FRJA 2ZFHA 3OJAB 2F40A 3A8IA 4ZLJA 4M5DA 4N6JA 3FC9A 2YH1A 1U25A 3V4IB 3AEBC 3M1VA 3GV7B 4LF4F 1RE3A 3FDSA 2Q3EA 3C16B 2B6AB 3TDKA 1JY3O 1NZAA 1VK8A 4O44A 3R1LA 4NLPA 1CJUB 2VA3A 2XTJP 3USSA 3EFGA 4WFXA 3T1HJ 1RWOB 2GJ2A 1EZZB 2ZBPA 2B9XA 1N5QA 1U09A 4GKKF 1DTQB 5L8RJ 2NPSA 3LAKA 5LMNF 2GW8A 2B5JB 3HZEA 2RAQA 2C22A 2DR8A 3CULA 1OIPA 3DOKA 5APXA 4TQRA 1E5WA 1PJ5A 2XYHB 4NX9A 2KZMA 3MEEB 3CF5Q 4GC7A 1OYEA 5KFEA 2OTJP 3ZTQA 5ETKA 1NJYA 1PCAA 4DFKA 1XMQJ 1EZVI 2OELA 3GIRA 2KHCA 2XNDH 1GW3A 3IAM9 3H1KG 4DS4A 3TZYA 3A8EA 1UIXA 1T9XA 1D9DA 4B08A 2OYHB 2XI3A 2XDJA 4QW8A 3CCUS 4I2QB 2E5LJ 5HL7Q 1IBKF 3LAMA 1N2DC 4Y2MA 1SQPE 1S6QA 1FDDA 2HKEA 1PC4A 4WCEQ 5LXYA 4AXJA 2C2RA 3F44A 1GTWA 5DJTB 1U1PA 2Y0SD 5G0RB 1S0VA 2Q66A 3GW6A 3H1IG 3GE9A 2K1RB 1TVRB 3MTKA 1X9MA 2J58A 2UUWA 4E2FB 2QL9B 1S97A 2IJRA 2MB0B 2AT1B 2OPPB 2Y9YA 2BXJA 4PG8A 2MQOA 3C66A 4G6VB 3WUTA 1N32F 3QO9A 4OJHA 3L74J 2LEAA 5KLVD 5GTHH 4H4MB 1HGZA 1B64A 3F89A 2EK6A 3GIKA 5MAOA 3Q0AA 3T1YF 3ZTOA 1J5EJ 3CJTA 2N9YB 1WDTA 1M1HA 4U3FJ 1EC5A 1PBAA 2V5HG 2E7WA 2ASDA 2ASJA 4LBIA 3U59A 1K73T 2IBZD 1Y7PA 4P9SA 1MROA 1N34F 3HE5A 1ROFA 5D77A 2I5JA 5HP1A 4M5JA 3R5JB 1KILC 2KM8C 4DCKA 2J8SA 3ZZRA 2RRBA 3SMZA 3J7AN 1FD2A 4HHUA 4LSLA 4IR1A 3KK3B 2HGLA 4LC1A 1OYDA 1HJ0A 1NK8A 2E9ZA 3AEFC 2QA4P 3B8EB 2QJPB 3MECA 4I7FB 3OAKA 4ED5A 3GP9A 1HPZA 2XMAA 3L72E 5KG5A 1REVA 1QVFO 4U7JA 1UW4A 2XLIA 1JLAB 1NU1J 2VRSA 1B0TA 4A8YA 4KGMA 2EFVA 2JWNA 1AUSL 5KG1A 3D6YA 1T9VA 2ZZNA 2KKHA 2MKCA 3AA8A 4ID8A 1Q7YT 2E75D 5A2QU 3CDAA 4HH2A 2L41A 4DV3F 2IDEA 2R2RA 1RTHA 2ZBRA 3LQVA 5IQQA 3BASA 3CMAP 5KAFE 2FXMA 4DF8A 3OLBA 3THTA 2Q43A 4JYAF 2DNHA 1U7JA 1M1JA 4CLUA 1RE4A 4CH7A 4B9VA 2B9EA 1P9QC 5AVSB 4DV5F 3BKUA 1SS1A 2CPEA 5H9EJ 2XHCA 4OYAA 1CI6A 1X5PA 1LWEB 2ITAA 2OPSA 2G2ZA 3RB6A 1ZM3A 3CC7S 4ILMA 2UXCJ 3DOLA 1S6PB 2YO3A 5KJ7A 2OP5A 5JUMA 3RBXA 4YB6A 5CXTA 3EGZA 1VHIA 2XMKA 4KHXA 2XZTB 4X4NA 3PX6A 5J1PA 1KZUB 4W92B 4KH0B 2GA1A 3GF3A 4X2BA 2ZZMA 1URQA 1YJWP 1LT9C 3JAMU 1LOUA 2BX6A 2G2YA 1EP4B 2ATCB 4DEZA 4H54A 3MEGA 2XO7A 1PJ6A 3QWOC 2E75B 2XO6A 2WSFC 2B88A 2H4YB 3AH6A 1FJKA 1X79B 3WU2H 3CO0P 1EQMA 3M9HA 2U2FA 2HPUA 1N5YA 1LEOA 5GMEA 1T9WA 1NJIT 3HCXA 1GMWA 3O6QB 1FJCA 4WE1B 3FJ2A 3M0AA 4UZCA 5AE3A 3TP2A 3EFFK 1K8AQ 5D6GA 2QC3A 4DZDA 2YNHB 1JY3P 3HD2A 2M3BA 1TKXB 1REGX 2BABA 1BHNA 4JI8F 4OQJA 5CYQA 1BY9A 5E79H 1RJJA 4M1KA 3CC4P 1F3VA 2ZNZA 2ZUAA 1NTKE 5AXKA 5HBMB 1VBKA 2IZ0A 3H90A 1OMIA 4ZOSA 4PEOA 4FDFA 5AE1A 4WY4D 3HHDA 2J6SA 2R7SA 3NWRA 4N8NA 2GUSA 3TA0A 2ZM6F 1RKJA 3G8QA 1SUQB 3GF7A 3PR4A 2I0XA 1YITS 3DDKA 2AEMA 2CRLA 1CEZA 2QSWA 2QE7H 3ZO7A 1SC4B 4LFBJ 2Z2LA 1J1DC 4KYZA 3QNWB 1RF0A 2DGWA 1P27B 3IWNC 4Z7CA 2WPQA 1GL2A 1O8BA 4MFBA 3FFIA 1X4FA 1NUEA 1IBLJ 4LRFA 5F9LA 3TSIA 2BE9B 2FHMA 5ETMA 3MWBA 2JWDA 3RGIA 2U1AA 2KRRA 1WC3A 3CIZA 3TNVA 2B87A 2A2CA 3MD0A 3M91A 2XYGB 2GGPA 1EZVE 1FKOB 1N7SA 1WI6A 2IYOA 2MZJA 4O4GB 2CJBA 3AB4B 1NNDA 5IFMA 3MHVA 4WY4B 2ASLA 3BDPA 1T9UA 4ZCIA 2HHVA 3NGDA 5HMZA 1JX4A 1YX2A 3VQTA 2FVPA 5H9EK 1CJVB 3KNAA 3L75D 2X1GA 3T97B 2DGQA 2HIQA 3SIPB 3HLUA 2V94A 3A0HE 4GIFA 2POHA 2A06G 1WKKA 5DLGA 4HLBA 3L75G 2O01J 2DNMA 1EARA 1KYOD 3N4WA 1NSKL 1SFCD 4Y2KA 4W7ZA 2H88C 3M8PB 1RXOB 4JP8A 1T8EA 1JK9B 3T5JA 3B82A 3Q2YA 4J91A 2R3SA 3PVXA 1UVKA 4C8OA 3KLEB 4CM2A 2J7UA 4IOBA 1A6LA 3K5BA 2JP3A 2R5DA 4K7QA 4H4OB 2CNLB 2QEXS 4Y28C 2BACA 4DFJA 5AVZB 3OHAA 4LF7J 2O1JA 3H1LE 3IM9A 2R5BA 2K7JA 2Y0CA 2W6AA 4PQUA 2RDDA 3BQ0A 2R3VA 2UU9J 1JXLA 3LWMA 5TISE 3CMES 4FYDA 3VTIA 4YR0A 2A1BA 1WD6A 4HDGA 5K20B 4JOUA 2M5AB 3UCZP 3OUYA 1FRMA 2QJKB 4FP9A 4YB5A 5KFJA 2XMUA 3H5UA 1NKNA 3M8YA 2WW8A 1C1BB 4B9NA 3VAMA 1WEYA 2ZZTA 1PP9D 4EI2A 1X0FA 2PT0A 4UOGA 2HNZB 4QYZJ 2F5GA 4DQIA 3II6A 1ZM9A 2QG4A 1SFCB 2DW3A 1LW2B 4LFAF 3ZZ0A 2CQBA 1NWQA 3ETMA 1YYCA 4JI4F 4NLOA 2Z2YB 3DLKB 3A1YG 4ZS6A 1CJTB 2DR7A 1LWUB 5AW1B 3PY8A 3KPEA 2RQMA 1DQ9A 5AVUB 4CTAB 3E01A 1T7PA 4ZPAA 3T9ZA 4TQSA 4N47A 2QZ8A 4K35A 2FYUJ 4J7CA 4F04B 3CC2P 3I4PA 1L0LG 2QJPC 1NB2A 2WB4A 3VAGA 3AEDC 3OTCA 2Q79A 3IS9B 1UEKA 4Y3CA 1VQ9S 3TGUD 1MN9A 3QJLA 5D4LA 3TAPA 2C3MA 3T41A 3H4DA 4PG4A 1UFWA 1FFGB 1LFPA 2L3MA 3L70D 1NPKA 2WK4A 3AA9A 2CJXB 1RQUA 3VWSA 1PO6A 2WVBA 1VQ7S 4DR2F 4IL6H 5A8RB 3PRBA 3ITHB 3L70G 5GAGI 1LK5A 2OAUA 1ELOA 3L7OA 2ZH7A 3RAQA 5KT3A 4RW7B 2ZNYA 2GQ2A 3GONA 2KB2A 2IC3B 3HHKA 1WHWA 5E3CA 3POTA 3SBMA 3PYFA 3JQMA 2M8DB 4ZKAA 1HQUB 3LW5J 2W7PA 1HD1A 2PFDA 3OVAA 4LVNP 3L73E 4I6YA 3A3YB 5F8GA 3T19A 2RMZA 1RHUB 3AXKA 5GTHE 2J9CA 3H2LA 3I4HX 4R0JA 3CT9A 3BGFA 5DDRC 4J37A 4D6TJ 5ADZA 3C14B 1U8SA 2FJDB 3L35A 3DM2A 1S59A 1WELA 4MAKA 1AFOA 2A3JA 4IQXA 2UUTA 2HS4A 3NS6A 2HYNA 2ZH5A 5FDLB 3B5NA 2B4OA 2G1DA 3CWJA 3QYYA 4FKYA 2GHWA 1NB7A 1K05A 2WBRA 2FD2A 4RBUA 1FJGJ 3IBCB 3I32A 1ZH5A 4NA1A 3M8QB 3AD7C 2W2PP 5DETA 2KSJA 1Q81T 3BKFA 4NCAA 5FJ4A 3NNCA 4TY8A 4KHPJ 2KZZA 4KGVB 2DB1A 3M9MB 3V2RA 4IG3B 2XGQA 4F4AA 2ZC3A 3ISNC 1GMUA 2ADCA 3MPDA 4YR2A 2F9DA 4ASWA 5CCLA 3C6UB 1NTMJ 3W2WB 2H48B 4QIWD 2ZJSE 1S9KD 2VC0A 1ZAXA 3IFEA 4QYZK 2X1FA 2DITA 3M2RB 3MAAA 2Z5IA 1SQFA 4RNNA 2WSFH 4USMA 4NMLA 2R7WA 1QLNA 1SQPK 1WC5A 3BCCD 2HBQB 2IYIA 3VGVA 2R7TA 3CJ4A 4UY85 2HBYB 2AJ1A 5FIIA 3HD7D 2JJLA 3HX9A 8AT1B 3E2EA 4LF5F 5LSOA 5KT6A 2FYZA 4OYMA 1Q82Q 2MQPA 4JBZA 3BSNA 5F0WA 3AE7C 4DDFA 2K9JA 5B5EH 4R8UA 1UJ4A 2Y9HA 4HH0A 1D3WA 3CC7P 2D3O1 1R3NA 1NXIA 5M1BA 1QX8A 1IJEB 4Z1MH 3M6UA 3KK2A 4OZ5A 4ZPBA 4K4WA 4UY8T 2XMJA 4NEZA 5AW7B 2N7YA 4DPOA 4N3YB 3SV4A 5KFKA 3PTWA 2YX4A 1GTHA 1M5KC 3TX8A 3G6ES 2WTYA 3NFQA 3NGRA 2B9YA 4DJGA 2OYIB 5AXMA 1FZCB 1M56D 2HEKA 2AW0A 3PNIA 4FVCA 4DUTA 1F9HA 2EFQA 1SQQE 5F3ZA 4GKJJ 5DGBA 3PW4A 3H1HD 1YLXA 4ELTA 4ASVA 1WKJA 5BXIA 1LWCB 4B3TF 5A2QY 4DLGA 2V8VA 3WU2E 2ZJPQ 4P7VA 3AOAA 1OVUA 3G8TA 1GMJA 1VL2A 2QM7A 2VQEJ 3HVTA 3HD7B 3OTBA 4ZKUA 2QN6B 5K9FA 1TL1B 3MMBB 5AVXB 1NTZE 4Q8FA 1JLEB 5D3GB 1S1UA 1XMQF 1AFIA 3D6FB 2LKMA 4OH8B 2P1JA 4PKDB 2Q9IA 2RRAA 2KP8A 1WI8A 1KQKA 1RU2A 3SV3A 5E79E 3K7RA 3AEGC 3DMJA 3NCPA 5A8WB 3BYRA 5AW8B 3TA2A 2YKPA 2XV5A 3GIMA 4X65J 2NXUA 1SQXG 2ZJQQ 4ED1A 2IX7C 2NREA 2GIRA 1FI4A 4FYVB 2EI5A 2P6TA 4ZVFA 2QM8A 1RA6A 2BW2A 2HRYA 2EEYA 4B3RJ 5CCHA 4MIBA 1HNXF 3G71S 4OFZA 1JO5A 4LUBA 3CCEP 2XCAA 3CIMA 4L73A 3C6TA 3GG0A 4NRUA 2LEBA 2YNYA 2HFNA 4NLVA 4I7ZC 4D3GA 1L0NJ 2HWHA 1OPIA 1BGYG 2MKJA 2OEJA 2RF2A 3PH0A 1ULRA 4ZPDA 2KNCA 3Q5RA 1QE1B 4XAKA 2XMWA 5AVRB 3CCLS 1TKZB 4DV0J 1R0CB 4OIXA 2XULA 2YNFA 3KHUA 2WQYC 2JJ4D 5B08A 3RRHA 3OV7A 3W66A 5KFCA 2RKLA 1J5EF 4QWEA 2W7OA 4OJGA 2QJKC 4QU7A 2BRLA 4ECVA 5I3QA 1J2JB 3L71D 3EE3A 2WT7A 4DJBA 1VDFA 1XEZA 3DLGB 3KUHA 2FJXA 1MLAA 4HYTB 3M2VB 2MKIA 3RW7A 3ZZZA 4KTQA 2WOMA 1GU4A 3VHQA 4YY3F 2IFNA 1FKAF 2QL7B 2VBYA 1HA1A 4C11B 3HKWA 3I0RA 5AXNA 5T41A 4E98A 1B0PA 3NY0A 4PR6A 3C8YA 2YQ0A 2OKQA 3RB0A 2FBWC 2NXCA 1KB9H 4NCGB 5HJYA 4FBTA 4Y34A 3MPWA 4DMZA 3C15B 3D6TB 2F7VA 4FXVA 2WSSH 1T05B 4X4SA 3B71A 2LQ9A 2XS5A 1HL6A 4RW8B 3LOUA 2FC8A 3LA0A 1GK4A 1C1CB 2B6AA 2E66A 1NTKK 1V5VA 2WSEJ 1OY8A 3BO2A 2F8HA 4OX6A 4K4TA 2B9WA 2QTWA 2XGPA 1YSJA 4KB7A 4ED3A 2ROPA 1OO0B 2VL1A 3I9V9 2M0GB 4EO8A 3R7BB 1NKCA 2Z4EA 5AJ3J 4BBYA 4QYRA 2MHNA 5DG7A 2YNIA 1LP1A 1VRTB 4URQU 5J2PA 1X5SA 1X9SA 3P6YC 3UFCX 3MR3A 1AROP 3ILLA 3LP1B 1MW7A 1KHWA 1UW9A 4MKYA 1CS4B 2M8HA 1QL1A 2Z0GA 1S5ZA 3QT5A 1HARA 3EDQB 2CQIA 4WP3A 1YG0A 2AYGA 3L4BC 1SQPG 2UXCF 4OL8A 1RABB 1FS0E 5DJBA 1BE3E 4M8LA 3CWBE 2HG5D 1VJQA 1V3SA 2A2DA 4NPOA 5APYA 2UVRA 3P7KA 2GA7A 1SQVE 1IQZA 3P8MC 3ZDMA 1RAIB 4FNHA 3KG4A 2FYUE 3RB3A 4N76A 4XE5B 3PJWA 3CEDA 3H5YA 1SL0A 3PTZA 2C2KB 4USWA 9ATCB 5G0RA 5IT9U 5AW4B 3OL6A 2V2QA 2K1RA 1FZFA 3H1JD 2AMCB 2M0BA 1BDCA 2B43A 1U0SA 3M4XA 3P8CE 3H2UB 4FKXA 1DD4A 3V4QA 4KBIA 1SQBD 2CIMA 3W9JA 3HVWA 5EHHA 4WFAQ 3M2UB 2NS1B 1R0BG 1M5PC 2XCPA 5M2PA 5J2MB 2XNXA 4MN4C 3CXHD 3H98A 4ZN1A 3KMQA 2GIFA 4A8XA 2W2MP 4NLXA 4AFFA 2HMIB 1VQ9P 3A7OA 1GX5A 3HVRA 2CJYB 2YPZA 5KFYA 3KTQA 1NK6A 2GMLA 1VFJA 4B9SA 1RTIA 4LF9F 1I3OB 2N3OA 1MMNA 4NCBA 2RVJA 1P1LA 3R5DA 2KI7B 3QPIA 4QIFA 2WVRA 1NEEA 1KILE 4IL6E 3DRSB 1KB9I 1CSBA 3BH7B 2PI4A 3S7RA 2QA1A 1DQAA 2KL8A 2PEBA 2J7WA 2KS1B 2ZH8A 3DDNA 4Y0FA 1LW0B 1LTBC 2VC1A 4LFBF 4Q2MA 2VIHA 4IRDA 2Y3YA 4MIWA 4U7UD 2OI2A 1R31A 5AVQB 1G2CB 1OJ4A 2ROGA 2OPQA 1GQEA 2L9DA 3CCQS 3VR1A 2F65A 4OWFA 3IWLA 1HQ2A 3SFGA 1IBLF 3SCIE 2ZWOA 1S0OA 4DV7J 1XTZA 3CGIA 4HTJA 1RWNB 1R8PA 2LVWA 4PD4I 2PAJA 2OMOA 5HLFB 3MM6B 4UZBA 2ZE2B 4ZVGA 1P9YA 2AV5A 2RT3A 2ZH9A 3TVKA 3QJJA 1S1XA 2VFTA 1GXUA 3N6NA 3R5GA 4R5PA 1SB6A 2JR8A 4CLKA 1N54B 2KOGA 1RT3A 3EVMA 4MJKA 5CZXA 2RU9A 3D9BA 3NAHA 5GAEU 3G82B 5CYMB 1BC6A 1H3DA 1IKVA 4IFYA 2FGOA 2LQ8A 1JCCA 3LGMA 2WB1D 5CHCB 3KHGA 1K9MQ 1V9OA 2FZGB 1FO1A 1TK5A 1DURA 2D41A 3FSXA 5ETPA 3SDEA 1YTZI 2NR0A 1G2EA 3HD7C 3D1QA 7FD1A 5APSA 1TKDA 1FZBA 3NGUA 3KYQA 1NO8A 3MD3A 1RISA 1H0TB 2F9JA 2VFSA 3GWCA 2FHJD 1NYHA 4EIJA 1LWFA 2DJWA 5KFUA 4DN9A 1S5LH 3A8JA 4LMZA 5HROA 5A0YB 2K9YA 2FGCA 2YKMB 2VF3A 2W25A 5ETTA 1H98A 2IBZI 3UCGA 3UVJB 2BANA 2VQFJ 4W80A 2ZT9D 2F4FA 2W9BA 3E1RA 1TKTA 1NTKG 2W2OP 1QAXA 4LF7F 3CPWO 1XMOJ 4YOEA 1JEKA 3WIVA 3RYLA 1KOOA 2CKWA 5KT4A 2VDIA 2UU9F 4CLZA 4F3MA 4MK9A 5B5EE 3SWKA 1HMVA 3G8SA 4MH8A 4B9TA 1DIPA 2HW3A 1SH0A 3OTEA 4KHMA 1IWAA 4D3HA 4WFNQ 1HW9A 2I2YA 2HK3A 5T7LB 2BASA 5EX3A 2IVYA 3VMAA 1Q86T 1LFWA 4UB8H 1EKRA 2VFUA 2H3EB 2XMVA 2QFIA 4CCHA 3I9ZA 1JLBB 3NXSA 1UETA 5IM0A 2Q5UA 4WFBQ 1FX4A 1HTLC 4OVNF 1JMBA 2HURA 1HR0F 1YBUA 3KFWX 4UOFA 2M5YA 4RLEA 1NSQA 5TJHA 4CWBA 4OJ3A 3K5MA 4U8VA 2ZT9B 3G4SS 1N86A 2ZH1A 1TL3A 1HWTC 2E9RX 4QQBA 3LTOA 1RTJA 4F3OA 2OIHA 2P58A 5LJ3Y 4P74A 1USDA 3RBDA 1R8EA 1PILA 1PIXA 2K3RA 2ILYA 4BWNA 4Z37A 2BCCE 3O2IA 3Q23A 2IPOB 4B17A 1NK4A 1FOSE 4NMXA 2VPWB 4N8OA 1KYOH 1F9FA 1FKOA 4BHQA 4AYBD 2UVWA 3T6BA 2ZH3A 4X84A 3MM7A 2DRAA 2HPCB 2EG1A 2ZVIA 4WYWA 3GQCA 1M5OC 3FGAD 1FCAA 5K8NA 1V5IB 1UWBB 1WORA 1GU5A 2C0XA 3AE2C 4FN5A 1N0VC 3ZC4A 2DISA 5DG9A 4IFFA 1V3RA 1VHFA 1R5SA 2BQRA 2VBXA 1UCNA 3EXYA 3GTYX 4JV2A 2ZVOB 3NS5A 3H1LG 1LQ9A 3Q8RB 1CZQA 1U6ZA 3W61A 2FJEB 1BCCD 1YTZT 3QT7A 3D67A 3ZZYA 1L3VA 1VRUB 2PGDA 3DGPA 4FPRA 2BZ2A 4O3SA 2X51A 3KLFB 1EETB 3M6XA 1A9NB 4L72B 4JI5J 1SQQK 3IR6B 4AQRD 1UAWA 2DNYA 1S10A 5I3PA 2UUCJ 1ZXGA 1M0SA 5KLIB 4DR7J 5T14A 1JKHB 1F6TA 3H7HB 2DHXA 2CQPA 4DL0C 3FBEA 2JEGA 2E29A 3R5AA 1LWXA 2GO9A 3BN4A 4OZJA 4UB6H 1NCLA 2VPXB 5KOXA 4CI0B 5DJUB 2I8EA 2CNKB 4AQYJ 1NTZK 2QIFA 1PGJA 4IFDK 1UKUA 1HBOA 3NLCA 4LRDA 1S1VA 1U6BA 3PG9A 3BPDA 4DBQA 2CJKA 3H1KE 1Z1ZA 5DRKA 4X4TA 1IKXB 3D2WA 3VOPA 3DU5A 4UUWA 3FCHA 1RWWB 3R4YA 5BJRA 1FE6A 1NJZA 3JYTB 2E5GA 3BM7A 3WDOA 2GIQA 3M9BA 2DNOA 4Y2AA 5F8JA 2OPRA 3L74D 2W7AA 4OJ1A 4N41A 4IUFA 3I56P 4Y2CA 1VC5A 4LF8J 1WEXA 5CCGD 4C3MA 1RKIA 3DU6A 2ZYAA 1VS3A 2R8KA 4YS2A 4DV6J 3U1CA 2J9DE 4IQMA 3MFIA 3L74G 3CJQA 1YQHA 1HQEB 2RRNA 7AT1B 2A10A 3I55P 3GJRB 5A6PA 2ZH6A 3C8VA 4LFCJ 1KNZA 4MIAA 1RBLA 1SIWB 1YJUA 2HQIA 4U3FD 5C42B 1HBMB 4XDCA 2C2ZB 1W2IA 2ZHOA 3UCUP 4EBDA 4F2RA 4OLOA 1F3FA 3D0IE 4JF7A 3VGSA 4EYHB 4UOCA 2J5UA 4KRWA 3OFFA 3DI6B 3HUSC 3L37A 1JNMA 2JRSA 5KLVE 2PE8A 5J1EB 4MKBA 1TUVA 2N3LA 3L73G 3D6ZA 1S1TB 4G1IA 2MJNA 4ZVHA 4O3OA 4DQPA 4Q0BB 1BQMA 4RJTA 2M52A 4YXWH 4OZ3A 3B54A 4GKJF 4JI2F 1HNIA 1NU1D 3KLGA 1J1EB 3N5BA 2DR5A 2CPJA 4DFPA 5CZVA 3D1OA 4AUWA 4WIIA 3DDIA 2ZXEB 2V4JB 2IBZE 5FD1A 4ETXA 5CJ0A 1KC8T 3Q8UA 5HVFA 1S6UA 3DCAA 1H0HB 2OFGX 1O5JA 4EYYQ 2IBOA 5BU5A 2Q6CA 2HHPA 3M8SA 2R7VA 4OYWA 3KG0A 1Y3KA 1AFJA 4HI1A 1PPJG 2G1HA 1ZPWX 4USKA 4U95A 2R8GA 4B3OB 2ZEJA 2QA2A 3LALA 1WACA 3TZXA 4CH0S 3L9ZA 1CJKA 4DG1B 4UQGA 3TUIC 4X65F 5ITHA 2DR9A 2J8AA 2I6WA 4YQWA 1IFDA 2DH7A 1C0TA 1HGVA 1YBKA 4WJBA 2FUG9 2L9WA 4MKAA 3CCJS 4EOTA 1PZQA 1KQLA 2UP1A 4B3RF 2CVEA 2DHGA 3B4MA 2UXBJ 3VV2B 3L3CA 2KJVA 5CAAA 2PA3A 3MMAB 3LP2B 3MXHP 1JLGA 4KKOB 4GODA 4K4VA 2QIWA 4PG6A 3BH6B 3AFGA 5B09A 5KFQA 2FLOA 1FOSF 5IT9Y 3CCQP 5AE2A 4NPEA 2QRXA 1MWYA 1NPRA 1SV5A 3SQGA 3NKYA 3RK2D 2YPYA 3EZOA 2O66A 4KO0B 5LL6d 1XN9A 3HPOA 2HODA 4NI2B 1KFNA 2Z2MA 3VCDA 3W9IA 3QZ7A 1ZS6A 4K50A 1E6YB 3D28A 3TR5A 3OQ2A 2M8RA 3GJTB 1H8AA 5LMUF 4GKGA 4DV4F 2N1TD 4RNMA 2O5DA 3KOAA 1T95A 1IKYB 3QFWA 1AA1B 3PZPA 2AGOA 4NZ7A 4L3NA 4WFZA 3RK3D 1O6XA 4MK7A 3P49B 4JI7J 4KV8B 4RUHA 2P8IA 1FKPA 2X7IA 4QBUA 1RBOB 1TAQA 1RAGB 3FBBA 1BD6A 1JB0C 2XZRA 1KMIZ 3PYDA 1J27A 2JEIA 4TT3H 4ZLLA 1SQQG 2YX1A 2GFFA 3QLHA 4LSNA 4QIEA 3K57A 1KLMB 3KG1A 1ZTWA 4P2SA 4DSKA 1VC0A 3OR1B 3BKTA 1NKZB 3BS9A 2VG7A 4C0HA 3HT3A 1ZPVA 2RN0A 2PSZA 3Q8PB 3EX7B 3Q83A 4AT1B 3HMJG 2M9KA 1IQTA 1S5LE 2H1YA 4RO0A 1URNA 2VOPA 3RK2B 3DRPA 2LXBA 3IRXA 2CPBA 3MOZA 2GC8A 2BR0A 3IBFB 3JSRA 2FVRA 4GOFA 5B0DA 2OYOA 1QUVA 3FZBA 2IM3A 2PDAA 3CE8A 2KLUA 2BMBA 4RPFA 5D4OA 3R9LA 2GVZB 3PACA 5CH7B 1IN0A 1P8GA 3G6VA 2N1TB 4H4KC 5BR8F 1E6VA 2C9NY 2I1KA 3L95X 3HD7A 1S9EA 4YN3B 3PYEA 2Y1LB 4CO0A 3RK3B 1JLEA 4V19X 1DFDA 3RGUA 4HT7A 2VG6A 3MEDA 3PW2A 1L3KA 5E41A 1HI8A 1ZP0C 3W5XA 1Y47A 2IM1A 5H1SV 2V2VA 2B7BB 2OFHX 2DY9A 5JXSA 2HVDA 1PIEA 3JXOA 1U4BA 3IF4A 4UB8E 1WG1A 2GNKA 3JSYA 1NMEB 1FJPA 3H32A 3MDFA 3CJ0A 1QVFR 3MM9B 6FD1A 1S49A 2QRRA 2H89C 3UQSA 3QRPA 2R7UA 1Q1KA 4DUZF 3V4WA 5CD4A 1MSWD 5HQ8A 1WHVA 3G4SP 3AE6C 5KLIC 4KPYA 1Z56A 3NRBA 1QE1A 1U02A 4X64J 4IG0A 1IBMJ 1PAUB 2HHSA 2CXEA 3LIDA 3L75E 1HHTP 4HR2A 1T3JA 1Q78A 2W4DA 4A8FA 3NP5A 3GFXA 5D8HB 5L9XA 3LP0A 4ZVTB 5DQIA 3L71J 2ZWPA 2ACYA 3OXGA 4OI2A 1IK9A 3JTNA 2KSEA 1KYOE 2FFDB 1H89A 1RT4B 2SXLA 4ES3A 2F8MA 4Y28J 2KIKA 2W4CA 3T6JA 1SQEA 2JX2A 1RT6A 4WK3A 3EDRB 3VZIA 3W9HA 5L8RC 1QSSA 2KFNA 2KXFA 2CZVC 1X9VA 4GRSA 1VQMS 2PGCA 2BVZA 2NZ4A 1NHUA 1CQMA 2FC9A 3HTKA 2A6MA 1KN6A 2NUHA 4KPCA 2ADBA 1JCDA 3MUTP 3BEGB 1XNRJ 4DV7F 2RHQB 3WQPA 1RSCA 1U2FA 5KFRA 2RKIB 2RH3A 5THWA 1R27B 4OHYA 3R5CA 4OYZA 4XDDA 2BUNA 3JC22 2RDJA 2CQHA 4MMOA 2D1CA 4DX5A 1YKWA 3AE3C 3QWUA 2KVQE 1HNZJ 2HYIB 2P9EA 2Z2ZA 2GMHA 1BE3G 2DNRA 1JTHA 1PP9E 4Q44A 1QVGO 1RWMB 1IJFB 2FYXA 3CWBG 3MPUB 3LUYA 5L1LA 1DAXA 3IRWP 3EQ2A 4WXOA 4K2XA 3ITKA 1SQVG 1CS4A 1RAJA 1M57D 3H1IJ 2FYUG 5IZHA 5F8IA 2ZFCA 3KK1A 1Y8AA 1SPBP 1JJHA 5CQGA 2YKAA 2P67A 4F0MA 4C98A 4LQ9A 3MUMP 4YDXA 1NAYA 2RU3A 5KT5A 4FF4A 3AEEC 5C25A 1PJ7A 3LANA 2IMWP 4PV1C 4TKTA 1TMJA 3CXHH 4B3SJ 3FVYA 5LSRA 4TLFA 1AVOA 1HJBA 1B99A 3TGUE 3KLHB 2VQFF 1P84D 2B7CB 2IM0A 1NHVA 2UUBF 4H13D 2V8PA 4K59A 5ETVA 3L70E 1RQ0A 4ANCA 1RT2A 2UZAA 3GSDA 2VA2A 1XMOF 1JOCA 1VJWA 3MPYA 1SQBJ 3H5SA 3FSYA 4D6TD 1HFEL 2GAGC 2YKOA 2HHHJ 3HE4B 4CLTA 4DUYJ 4HB1A 1CVJA 2WSCH 4YB7A 4WVZA 2HNDA 3MD1A 4QPXA 1IM4A 3ET6B 4U67Q 2W8LA 4ILRA 1B3TA 3KJVA 3ABVC 2MGZB 2EG2A 4U6PA 2H5EA 2VODA 2C2DA 1TL7B 1RHJB 5DM7Q 2JDIH 2RS2A 2EW9A 4N77A 5IV3A 3ZTRA 1QTNB 1G1XA 2KT3A 3WC0A 3OFGA 3W60A 1HBNA 1DD3A 1JLCA 1JJCB 2WAQD 3Q8SB 1J5OA 5APUA 2VJUA 4QOTA 3A5TA 3ZTPA 5KFVA 2PMZD 2WPRA 3QFHA 1OQ3A 3I5CA 3NBPB 3WUVA 1FU1A 2CPYA 3OFHA 3OL7A 1NAQA 2QJ3A 1U49A 1NTMD 2CPXA 3K5LA 2E1RA 4H13B 1OSDA 2OEKA 3DLEB 4QPTA 3R7NB 5GADU 1AQTA 4LVOP 3LPYA 2JZ5A 3HUSA 1BSHA 1NTMG 1RTDB 1YGYA 3TYTA 2EFPA 1KKHA 3DC2A 2CZ4A 2IYPA 1VQPS 4ELVA 2XBPA 3H5XA 2B89A 3HFZB 1VYAA 1YK9A 5EDWA 1EB0A 3ZZOA 2OGUA 1VQNS 5JVHQ 4CNYA 3OLAA 1Q90D 1N73B 4NZ0A 3GFYA 3V6KA 4BRYA 1HBWA 4OYBA 4ILLA 3WHIA 5D4NA 2IRUA 1AZSB 1S9KE 1X4HA 3IG1B 3JCUH 4TU9A 1PKUA 4PG7A 3SFEC 3VP8A 3V6HA 5E2QA 3ETOA 4RNHA 3ZFVA 3L7PA 1A7GE 2BM1A 1M1KQ 2HVIA 1NBEB 2YMKA 1EQ0A 1J2VA 2DNKA 2LDYA 4DXLA 3BCCE 2UUAF 4JV5F 4WZMA 2LCWA 1NRKA 1HWKA 4ID5A 3CXHI 3M32B 2LXFA 3C3LA 3CXCR 3M7VA 4Q45A 4JV0A 1D9AA 2N4CA 4JYBA 4DR4F 1S76D 4WKRA 3GMAA 5I4MA 1H88A 5KG2A 2CQ0A 1BLUA 3QAEA 2H54B 2H5JB 1VMBA 4P2FA 3M8RA 5KLVK 2HQDA 5KFPA 3Q8VA 3UVJA 2LQBA 1RT7A 3J7A1 4RW6B 1LT1A 1RP5A 2M88A 3IA0A 4EGLA 3P5TL 4JI5F 4G1QB 5F8MA 3MZIA 2IDBA 4K4YA 4WWIA 4KGXB 4DV1F 3BGRB 3PW7A 1OXZA 3U1MA 2UUCF 1M7LA 2MZ1A 5HQMA 3J80U 5F8LA 4DR7F 2AX0A 3CCMP 5D0EA 9RUBA 4KFBA 5J2QB 3PRJA 3NOGA 2WVFA 1OW8A 2VICA 1W2EA 4Q2LA 3H1HE 1KDNA 2QG9B 3RAMA 3Q1MA 4B9MA 1WT6A 1FTCA 1QGKB 2VPYB 4PUOB 3AEAC 2V7QH 2E74C 4AQYF 4M5NA 2P9CA 3FEZA 4LIWA 3O8ZA 3CJKB 2HLUA 5K8OA 1EZVD 2LFVA 2DNQA 3WZ0A 3MUVP 3KWMA 1I94J 3TOQA 3NNAA 2AP6A 2DH8A 3PP5A 2NPSD 5C24B 3EZUA 2RNEA 2W8KA 4ZPCA 2OMLA 2XY5A 1VPCA 1N33J 1MNEA 4ZPTR 1VQ6S 1L0ND 1EQ7A 3AE1C 2YVSA 3OHBA 4P73A 1SCJB 1K1QA 1RT5A 2F63A 2FFDC 1Y5NB 3L4FA 3VMXA 2IMOA 2EBEA 4WP8A 4A8QA 2RUSA 3FNNA 2GAHC 1TR0A 2AXCA 4LFCF 4NYPA 2WWWA 1RK8A 4RW9B 4TVAB 2N9BA 3HHLC 5HMWA 2QYCA 4M5DB 2O01C 5KAIH 2AXTH 4X4VA 3M1VB 3NEKA 2BBEA 4DPUA 3W2VA 3BV8A 1AXQA 4NLUA 1FRKA 3KLVA 4KGZB 4O44B 4X4QA 1MV8A 4PPDA 3BO4A 1H38A 3M9QA 2XZDB 4EK2A 2DIUA 4H4KA 2CWXA 2QLXA 4ZMDA 1BMQB 4DSEA 2E44A 1FJ7A 2NPSB 2C2OB 4YHHJ 2K2PA 2W1BA 2YH0A 2FVCA 1FE4A 1BQNA 4JYCA 1DY3A 1RWXB 1AYEA 2Q3PA 4FXWA 1KQFB 3RRKA 3A4TA 3QGHA 3S4RA 4M5IA 4BWJA 4CLLA 4Y65A 2MLYA 1EXJA 5BYSA 2XS2A 3KUGA 2R7OA 4CLFA 2DR6A 1FK9A 1KTMA 1BCCJ 2K3KA 1NOHA 3W7BA 5EUHA 3R3TA 5GMKa 3OJUA 3PW0A 1VBZA 4L75A 4DR6J 3ILOA 2HIYA 3BSOA 2OO4A 2R42A 3KKFA 4P2MA 1UWAA 1UPPA 3GB0A 5B0GA 3GZ7A 5K14A 3B78A 4CT9A 4JB8B 3DFEA 5KFZA 3FWNA 2XY7A 4I1LA 1KBRA 4GT1A 2RH0A 1FVSA 4C8NA 3I0SA 1FWPA 5IT4A 1X5OA 1QAJA 3RL0C 5HMXA 1LNQA 1VQMP 4RX6A 3TRGA 3DRRB 4E0DA 2HQGA 4C8MA 3IO1A 1IVZA 1WMKA 4ED2A 3NMRA 4P2XA 1NDPA 5J1NA 2QO3A 3QO9B 3F41A 3J7ZT 2UV8G 3NXZA 5IC6B 2FJWA 4TNOA 4FF3A 3GFZA 1N6QA 4MKVA 4CO3A 3DLBA 1GEHA 3BO3A 2C3YA 2OTLS 1IKXA 2YWHA 1VQ5S 2ZXXA 1U0HA 4ZJOA 4QWDA 1AV1A 5C39A 1M5HA 1IR0A 2K06A 3BGLA 2BJDA 4NXNJ 2YXQB 4IYQA 3V6DA 5KFGA 1T11A 1NHLA 1MROB 4K3AA 2B8PA 2GCFA 3HE5B 2GVDA 2I5JB 5HP1B 3PJ9A 4YDDB 1NKEA 4C8YA 5KLVG 5KJ7D 1L4AA 4NXMJ 4LSLB 2M3DA 4PWDA 3FX0A 4H44C 1JNZB 2Z8QA 3MECB 3NCRA 2G4BA 2W2NP 1R0AA 3U27A 4P75A 3LW5C 3H1JE 1HPZB 4TXSA 4V19J 1IUJA 1REVB 1LTTC 1RAAB 2RS8A 1U1LA 5LSLA 4EWTA 4IDKA 4LF4J 3RB4A 1FDMA 1VLOA 1KTQA 3HT0A 1T2KD 3RZAA 4ECRA 4OHXA 2IBZG 5LT5A 1LXNA 5IV4A 2FYNB 4ZK7M 1NSPA 3F73A 3CXHE 1MMLA 1IC2A 1RTHB 1N88A 3AODA 1KOHA 5AVVB 1FFWB 3M8ZA 2Y1RI 1RF1A 1L3TA 1GMWD 4JI1F 1M1JB 3M05A 4CO1A 3U1NA 3MEKA 3CNQP 1CI6B 2YIUB 3A13A 2V6AA 1DJ0A 2OPSB 1WSRA 2VONA 5E3PA 3SI8A 3DOLB 4BC9A 2XYPB 3MURP 1OW6A 2CZ9A 1PG5B 1UZDA 2R2UA 3U1LA 1D1UA 4K5RA 5AVTB 2JO1A 4EBEA 3L09A 4Q7AA 3HHNB 2P6SA 2Z4PA 2P9GA 4J9MA 2VZ9A 2IFXA 1IBKJ 3EPGA 2LDIA 4WTOB 3VTPC 1VQ4S 1XK8A 2KJWA 5CCMA 1MZ9A 1YI2P 2NXNA 2JFKA 3MEGB 3M6WA 1VQLS 3IN5A 3CJSA 1UVNA 3Q89A 1KWMA 2HFUA 2QA4G 1A02F 3E3XA 1GL2D 4U8YA 3Q2TC 5KG7A 3K5NA 4JI6F 1N5YB 3MF5A 1N32J 3UNGC 3TAMA 2ILZA 1WC4A 2XC9A 2Q6BA 4X64F 1BGXT 5APWA 2MLXA 4QWCA 2D2CD 1L0LK 1QLED 3T1YJ 1EJ7L 2Z58B 1VQPP 5CYQB 3A3NB 5F0UA 4J9QA 1VCTA 1N7SD 1VQNP 5KFAA 2FB0A 2VBZA 3K8WA 3BPSP 4OYIA 3N28A 2KYXA 4J9KA 4ZITA 4M3LA 4UTGA 1IKYA 4NE9C 4MYUA 1N34J 1FDIA 4NYZA 4IRCA 2VDHA 3D1HA 3W64A 4QZVB 1HWLA 4ZA1A 3CL3D 2A45G 1TL4A 2DK2A 1SL2A 3JCUE 4C0OC 1NTZD 3IAS9 3U02A 2R2TA 4X62F 2ZAEB 5L9NA 1ZM2A 5KG0A 4LIRA 1LTJC 1EDKA 4O0NA 4DOZA 3VGUA 1AUDA 1JLQA 4PAAA 2KRBA 2AJQA 2MQ8A 1GL2B 5IQ6A 3FFIB 4LGDE 4F7VA 3NL0A 1RHRB 3JSBA 4PWUA 5H9FK 3E1IA 3K5OA 2BKNA 1KQSO 3QJPA 2QJYB 1NO4A 2ALYB 3UDLA 1KLNA 2G0CA 3TANA 2BJ1A 2MEWA 1QAIA 2YWWA 3KDOA 1WF1A 2D2CB 2D9PA 2B87B 1WNEA 1HNZF 3PRVA 1SQXJ 3MIWA 4XK8C 1N7SB 3DN9A 3Q8YA 4I6MC 4P72A 2CPIA 2C2NA 2L9NA 3CCWA 5KFHA 1RI7A 4DV5J 1PGZA 3SZ2A 1NK0A 2PFXA 2PP6A 1CULA 2XMTA 3PHEA 1HWIA 4IR9A 1FWLA 1FWKA 3S1TA 2OARA 1YHQP 3M30A 4A8KA 3C9IA 2O01H 2HQFA 2ACMA 4DL2A 3NTNA 1T02A 4P7TA 3EVOA 1WOOA 3OSPA 3FZ2A 1BGYJ 2JLFA 2DNNA 3PLNA 1F9EB 2XM3A 4RU2A 1F60B 1RE1B 4WYLA 2DCLA 1OY9A 2EFOA 5KKZB 3AD9C 5ETRA 1NDKA 4ZVSB 2ZOFA 1K8AT 2ROEA 2DO0A 1DX7A 1VIXA 2RD5C 1WRGA 1N36J 4DX6A 2NSBA 3VGTA 2FY8A 5KFFA 4I2PB 3SCKE 4FS2A 2WZ1A 1VRQC 3GFHA 2V63A 1VQ6P 1FC2C 1GT8A 5K8MA 1S9GB 3CDEA 4ERDA 1QUPA 3PIOQ 1DLOB 2AZ3A 4M63A 1YTYA 1NGMB 2WONA 2E5YA 2BE7D 2J0WA 1PAEX 3LGNA 2QLFB 3M9NB 3KZIH 2K7KA 4PQUB 6AT1B 3GHGA 1CW5A 3N7NA 1HD0A 4FVMA 1M5VC 1DTTA 2F4VJ 1YJ9P 1XNQF 2VV5A 1S6OA 2OYHC 2HVZA 5M2UA 4CNZA 2DT9A 5B66H 5J2NA 2XQCA 2Y0DA 3NMAA 3VP9A 3V6JA 3J80Y 3OUYB 1KONA 4OI3A 1S2EA 4DV2F 2DGSA 4KAIA 5KAIE 1EDLA 2MMYA 2AXTE 3KDNA 3D3BJ 2IJNA 4YEAA 4I56A 4CT8A 4Z2XA 2M3EA 1HW8A 5GVQA 2CPZA 2VUGA 2ABYA 3BVHA 2V67A 4KC5A 1Y3JA 2FLLA 2GV1A 2KXHA 4IFVA 4Q8EA 1NDCA 3QIPA 5A8KA 3P45B 2ZYGA 3TYYA 3ONQA 5HVHA 2E42A 1T03A 4ZCMA 3PO4A 4RR5A 3H25A 2K88A 2JFDA 1KRPA 3HHLA 5CJ4A 4NA2A 3PRDA 1FDOA 2W6BA 1DBDA 1T9YA 3E01B 3D5MA 4F4KA 1FXDA 4WBAA 3RW6A 1HNVA 2AJ2A 4F0KA 1M1GA 5HAOA 2P2CB 1PP9G 3CI9A 1GMVA 3ADAC 3JQJA 1LJ2A 1SQPJ 2XB2D 3PX4A 3OL9A 3VVUA 1Q4RA 2J0SD 4USTA 2OTKE 1N8RQ 3W3SA 3CPWR 1SC1B 3H59A 1NJXA 2IAJA 3CD5A 2XWYA 3B5ND 3A3OB 2JL9A 1FRIA 1VGYA 3UE2A 1PYSB 3F56A 2DTJA 3KHHA 2D3UA 3PJXA 1SQXK 3J81U 2R4FA 2AIRB 2NSCA 4ECXA 1F1BB 8ATCB 1TU3F 4C7NB 3TNUA 2HQCA 4ED0A 2YWFA 3GR1A 4JBCA 3T5LA 1P84H 3LW5H 2CQ1A 2C42A 1G6BA 3POTB 1RE4C 3OTDA 3CCUP 3C2PA 3L74E 4KT0C 5KFBA 3BR8A 2D9OA 3TGUG 4ZHRA 1Y5LB 2YIUC 3BRTB 4DL7A 4JQ0D 3CLQA 2HWTA 1Y10A 4EFAC 1ZR4A 1BDDA 2BJ3A 4HACA 1ACMB 3HO1A 2B3TB 1QM9A 3CD0A 5KJ7C 2HNYA 2RDIA 4U3FE 3OA7A 4K0KF 3DM2B 3EYZA 2OTLP 2DCUB 3CCVS 1ZZFA 4CDIA 1BXNA 1ITPA 1VQ5P 2CNNB 5GAEI 1RCXB 3OFEA 3TZZA 2GZOA 3L72J 3PCOB 5CA5A 3B5NB 2IFMA 1NKBA 3LF0A 1C4AA 1HBUA 2KO1A 4N56A 1T2KC 2XI2A 4ANDA 2ZYDA 3SEOA 4RKUJ 1XC9A 4TY8B 1TP7A 4RZRA 3QT8A 1NU1E 3U1AA 5KT2A 2GHVC 2BA9A 2DHAA 2MGZA 4OHWA 2O3DA 1UJ6A 3MGNA 1TL7A 1ZA1B 1HUCA 4U7CA 3N0VA 4OI0A 1S1WA 3KYLA 2CFXA 4N7TA 3TWZA 2JEJA 2MKHA 4F8RA 4F0HA 1PPJE 2L48A 4OGQD 1F5CA 2M7SA 4WWSA 4M5GA 2E75C 1MU2A 1QDUB 1YJWS 4X4RA 1SKUB 4ITSA 2OEMA 1W2BO 5A6WA 1ZBTA 3MAAB 4F50A 4LFAJ 2HQ3A 4EBCA 2X3DA 3TW0A 4OZNA 2NUUG 4ZCKA 4DR3F 2HZCA 4QWAA 4O4RA 3F0NA 1RAHB 5HJXA 5SZTA 1LTAC 1QL2A 2DGTA 5IWAF 1Y9BA 2HFOA 1DEBA 2C3PA 1T3UA 4ZP6A 1GZLA 4DPTA 2K9JB 1SJRA 4R8UB 1UIIA 2R7RA 1N7LA 2MXYA 1KILA 4GO7X 2KVIA 1XBWA 4CO5A 3BR9A 3KK2B 4JI3F 1RF0C 4GDOA 2CPDA 3MCNA 2ZD1A 2ZITA 1URRA 5BVZA 4QMAA 1GL2C 3AY0A 1U1OA 3G3ZA 3WIUA 4ALZA 1K0TA 3RRGA 4DPXA 2ERRA 3BCCG 5K8PA 1MFTA 1R89A 2QJYC 4RNFA 4URSA 1T6AA 5CCHD 1P84I 1TZ0A 1PGQA 3G86A 1VQ4P 4WKYA 2W9CA 3HM9A 2CADA 1HIYA 4QR0A 3HXMA 4OGQB 3CVKA 2CAJA 3WX8A 2D2CC 2A18A 2GM4A 3QH9A 3MMCA 4YHHF 3T3FA 2CQCA 1NTKJ 1GK8A 2MLZA 1Y11A 2FTRA 3DYAA 3CX5D 1JY2N 2XSJA 3HVTB 1WTBA 2FJBB 2MQLA 1G1JA 3DOMA 2KLVA 3ENQA 4O9BA 3CD6S 3T1HF 4DCJB 2L91A 2DGUA 2KG1A 1S1UB 1YZ6A 2UXDJ 1UVIA 4YR3A 4MT1A 4DOJA 5KG6A 3IGNA 1FX2A 1TELA 3DMJB 4DR6F 4B86A 5L38A 3UN5A 1WC0A 5F3TA 3ISZA 4DL3A 3MR7A 4WY4C 3H1HG 5I3UA 5KKZC 3NNHA 3IM8A 2DKOB 1GAOA 3PM9A 1EX8A 5E0OA 1DRZA 2E5JA 4N78D 7FDRA 1UFLA 4ED6A 3PXGa 3KXDA 3V81A 3JSMA 2IM2A 5ETLA 1LT9A 4PZVA 2ZBCA 3VAFA 4K4UA 4RWXA 3C6TB 1S7HA 4B9LA 5IS2A 4GVBA 2KG0A 2E5LF 4OYOA 2BCCD 2BE2B 1T8ZA 4FZVA 1WTFA 3HKZD 5KTQA 3BYPA 2RF2B 4IL6X 1U24A 2KNCB 2MSSA 3C19A 5C7PA 3R2CJ 1YITP 2YKQA 3SQOP 3OVSA 2R7QA 2YNFB 3G2XA 4ED7A 1V3ZA 4BWMA 1T9TA 2V8DA 4WXWA 2Z56B 4Y99B 3O8WA 2F3JA 3MM5A 3OR2A 3SSRA 2J76E 2NPFA 2RIJA 2WT7B 4C3KA 1W5CE 4A8OA 2R3CA 3K59A 4RESB 5K5GB 1S4XA 2R8JA 1B7YB 1LTJA 1IKWA 1FT8A 2WOMB 2MZRA 4ZCLA 5JJBA 3UI3A 1JUNA 3EGWB 1IBCB 1ZM4A 2YKNB 5CBNA 4NOHA 1PGPA 3I0RB 4LR9A 4ELUA 5HI7A 1TUWA 2MSTA 3QWPA 5DDQC 2HZAA 2LYVA 2RQ4A 1X5TA 2Y0EA 5AW5B 2E43A 4OZ0A 2XNQA 5E3RA 1IWGA 2SPZA 3AE8C 4RJVA 1VI7A 3L71G 2WSEH 3R6GB 1SFCC 1JMTA 4K4XA 1IK7A 4LRCA 3H1LJ 2HGMA 1KEKA 4FYYB 3S1KA 2NYIA 5ETOA 1WKLA 1T0TV 4YPCA 1W25A 1LWUC 1ZRTD 4PABA 2QL5B 2IRXA 1N5VA 4PXEA 1K04A 3IAOA 3LPEA 3V4IA 4G3IA 1APSA 2YNIB 1LP1B 1KB9D 1JJ2R 4B3TJ 2E5IA 2CQ2A 1HVVA 5J2PB 4IOCQ 4GC6A 1K73Q 3NAIA 3C16A 4DWIA 1ZN5A 3KZIE 1G7CB 3K0JA 1CJUA 1NSAA 2DYAA 3H1KD 3CC2S 2P2UA 2N4DA 3QMQA 2MPUA 3HSZA 3QT6A 1DTQA 5B66E 4ZIVA 2B5JA 2QEXP 4M5LA 1S57A 1KV4A 4PD4D 3MEEA 4TN2A 2J59M 2C9LY 3LWLA 2JEFA 2DEJA 3GCWP 2XWXA 2HFVA 1M90T 4P10A 2H7HA 4ECYA 1TMMA 2BKPA 3QSYB 3H1ID 3CMEP 1JXVA 1UJ5A 4S0MA 2DRBA 2DNGA 4HHHA 2AJ4A 3QQCD 2BV3A 1Q0NA 1Q7YQ 2FIUA 5D0RA 3BGUA 4USHA 3EMTA 1HNXJ 5KFLA 4FYWB 3CJ5A 3DRRA 2OYHA 3B5NC 3VAJA 4C3LA 4I2QA 3UD3P 1AT1B 2EK1A 3TZWA 2OHDA 1R8HA 1RACB 4DR1J 1S99A 1FAVA 2R44A 3MHYA 4BCAA 2V68A 3TA1A 3G6YA 2JKVA 3GYXB 3HF5A 2HBZB 1TVRA 4C0BA 5F9NA 4OHVA 1OQ6A 3CDBA 2OPPA 2HHUA 5ETSA 1WOSA 3IR7B 1O51A 1RTIB 2DPIA 3H1JG 1FD8A 5L1KA 4CZCA 4H4MA 1KFMA 1Q8IA 2CQ3A 3L73J 1DHMA 1K1SA 4YY3J 3KUEA 4EU0A 1SQBG 4PRFA 2ASYA 2J6UA 1FF2A 2FQQB 1F2GA 1KR4A 1D09B 3G9CA 3D71A 2F1FA 1P84E 4CH1A 1RZMA 4F26A 3NWGA 1EDJA 2UV8A 4TU8A 2B4VA 4HJGH 1FA0A 3MMJA 2OPQB 1NJIQ 3OBIA 1VQ7P 1PC5A 4C2MA 4D6TE 4DCPB 1DEEG 1KVKA 3FBCA 2P5VA 1XERA 3QGIA 2KYVA 3GLMA 1VQSA 3BQ1A 2J9DA 3HHEA 3KK3A 4BXLA 5KFMA 4AYCA 1W26A 3CCVP 5F8HA 1U1MA 4I7FA 4IO9Q 4ECZA 4LT6A 2E9TA 1LXJA 3FEXB 2FJAB 2J0QD 1S77D 1JLAA 2G13A 3ISND 2DGVA 1S1XB 1ZTTA 2KK7A 1XR7A 4DU8A 4R5PB 1QD1A 2EC0A 1RT3B 4ZVRB 2EVZA 4OGQC 2NXEA 2RHSB 1P6TA 1U47A 4NLWA 5BYRA 3N01A 3J7YI 5HN0A 1IKVB 2XLKA 4IFYB 3J81Y 2IY5B 4WIQA 3FWLA 3RTVA 1OSCA 2W27A 1NTME 4NLTA 1XR6A 3SDEB 2OYIC 4F36A 2R9LA 3T5HA 1FZCC 3MI7X 2KT5A 1K47A 3JS9A 4DL6A 3FCVA 1LWEA 1UA0A 1RHQB 1X0PA 4USIA 1X7VA 4RWWA 2OSQA 1LWFB 3KMSA 1N36F 5D15A 4K2JA 4IFMA 5HROB 1S6PA 1Q5VA 2BANB 1MWQA 1KVIA 3EGVA 1YIJS 3L36A 4A4JA 2A45H 5CMZA 3JTOA 4DR5J 2W9BB 3ULHA 1ZR2A 4KJMA 1TKTB 4C8ZA 1Y00A 3CCZA 5KFWA 3MFHA 3GR0A 2KYZA 3HFKA 1U1KA 4PYAA 5CCHC 2YXLA 3FGVA 2KZIA 1HMVB 2F4VF 1PYTA 1EP4A 2OJ3A 5GTIH 4HL9A 1UTAA 3PO5A 1QVGR 4MTPA 3M8WA 2AF6A 4QW9A 1SQQJ 1T94A 1LK7A 1SH3A 4AL7A 1ZZNA 1RHMB 1JXEA 5CYJA 2R8HA 4ZN3A 2Y1IA 3TEGA 4LR8A 4LF9J 4DZ6A 1N56A 2NRGA 2WVEA 3O6QA 4HEA9 3FCWA 4WE1A 2DHHA 2ZUGA 1S3JA 2BEQD 4ES2A 3M0DC 4DFMA 3GU0A 2YNHA 4Y99C 2JSXA 1TKXA 3CO9A 5IM0B 4ZJQA 1NTZJ 2OH2A 2NPIA 4ETZA 4EDFA 3CCES 1TK0A 3GYGA 1U2CA 5HBMA 1MFZA 2MKSA 3R5BA 2WITA 2CDRB 1WOPA 2G0IA 3IP0A 1IZNB 1JY3N 3CDUA 3IXQA 2H65B 3G6EP 1NZ8A 1TL3B 4J9NA 1EHWA 3D54A 1NU1K 3DHWC 1SUQA 1ZAVA 1SP4A 1RLDA 2W2QP 1RTJB 3CD6P 2HLTA 3RBZA 4O3NA 3ENWA 1K9MT 1DH3A 1PSDA 4F3QA 2LXUA 2DRDA 4ZVUB 3X1LB 2HAIA 1AW0A 2CA9A 3DNCA 4R0EA 5E33A 1MG7A 2ZOGA 3A2AA 1SC3B 2KU7A 3TEHB 1LKZA 4AL6A 3MM7B 2GJIA 4ICLB 4OX7A 3AE5C 3PW5A 2A06D 4RUCA 3MR6A 2O1KA 4WF9Q 1L0NE 4WBFA 4WZQA 2VFVA 3OW2O 2Q7CA 3BB5A 3O44A 2I1RA 3FQKA 1RTZA 4M94A 1L3UA 1OIAA 3UD4P 1VDHA 4O4GA 1R8CA 4WY4A 3HSJA 5CBOA 3CSKA 2Q1KA 2R7XA 2CPSA 1CJVA 2A45I 3Q5PA 3VMZA 3BBCA 1USEA 3G71P 3IR9A 3HK2A 3I31A 2E7VA 1NVOA 5IC4B 3T97A 2PIIA 4I2PA 1SI9A 3EWGA 2PFFB 1AVYA 2VD3A 3DGPB 3TUJC 4JI0J 2YBVA 4DSJA 1VBYA 4Y6IA 5IT0A 2M4MA 2RJZA 1S9GA 3FUYA 3RU0A 1PV3A 1DLOA 2E5TA 3UO0A 2DD8S 2XNRA 1OS5A 1WC1A 3AXMA 4I7ZB 5LOQA 1U48A 3CCLP 3WX4A 4OHZA 3M8PA 2LP4A 2ZKTA 4MK8A 4HKQA 3CCTA 3CCSS 4A8MP 3GIJA 5APTA 2DBBA 3FMBA 1CG2A 1UVMA 2R2SA 1ZMEC 4K5SA 3KLEA 3M6VA 1BCCG 4H4OA 1WHXA 4A47A 4R4LA 2JLGA 5KFIA 4IRKA 1UEUA 1HBOB 5KTBA 1FJGF 2Q1LA 2HRTA 4ZP9A 1S1VB 2H8PD 3VYIA 1X4AA 3J81j 4KHPF 2XS7A 4PXDA 2M5AA 4DHVA 4ECUA 2NZ2A 3UWTA 3MCOA 5HATA 3PYGA 2OPRB 1C1BA 3N79A 2Y1JA 1BE3J 3RJMB 1HR0J 3R2PA 3CWBJ 3GIIA 4DS5A 3DGVA 1KN7A 1X4EA 4DSFA 4RL1A 1L0LD 4L76A 2HNZA 1LTGC 1SQVJ 1D0EA 2CQDA 4DF4A 1RWKB 1SFCA 2MZQA 1S5LX 3FEYB 2CUYA 4ZVQB 2HS0A 1LW2A 1FHTA 1Q81Q 1NK7A 4DQQA 2UVUA 4USUA 3CJRA 2FVSA 1OW7A 2YO2A 2I8DA 4C7QA 5JMNA 2KT2A 1Q7LB 3DLKA 5LJ5Y 1CJTA 1LWUA 3JB9k 2V4QA 1VQOS 3KLIB 1NU4A 1SKSA 3GJQB 1RAFB 4CTAA 4RBVA 3NCQA 4DI6A 1Q5YA 3D3CJ 1AQ5A 5HSPA 3P4UB 4HI2A 1BQMB 4C7NA 2AZ1A 1KYOI 5GADI 3IS9A 3LH2S 2R8IA 1HNIB 1X8DA 1OY6A 1IFPA 1RY3A 2MQNA 4U3FG 1GW4A 3KLGB 4XTTA 1S4EA 2QYGA 2IA6A 2KDOA 4U96A 1HYSB 2DEIA 4J9UE 3V5BA 3TARA 1R43A 4IH5A 1KD1T 4LF1A 3S9OA 2JLEA 2N82B 3D7SB 4CRJA 5A8RA 4F4YA 3FKBA 2ZBIA 4PJ0H 3ITHA 5B0FA 1T3NA 2HVHA 2LLZA 1RADB 4C97A 4RW7A 2UXDF 2DH9A 4G1PA 3ZZUA 2IC3A 1ZETA 1HQUA 1CJKB 4M5HA 2B0GA 4UF4A 4J9VA 1NU1G 4QU6A 1EIYB 1SH2A 1RCOB 1C0TB 2VQEF 2RUGA 1NLKL 4HT5A 1M8OB 4PXBA 4AUKA 2LQJA 4UT4A 2WSCC 3K8VA 1VQ8S 3C14A 3K2YA 3C46A 3S01A 5APVA 3DRYA 2R32A 4Q5VA 1FZAA 1S72S 1JLGB 1XWLA 1BUXA 2Z5HA 4F25A 2V34A 5FDLA 2QMUB 2BJ9A 1CC7A 4BDPA 5K5MA 1GFWB 3EUNA 3N5FA 1SV5B 3SQGB 1I51B 2JHEA 4IKAA 3M8QA 3I82A 4ED8A 1SC6A 2PMHA 2OD6A 1S79A 1JLFB 2HODB 2WCXA 3IFMA 4RUAA 1S4FA 2O1PA 4IG3A 1RBAA 4UQTA 1RWVB 5AVWB 4L3KA 3V2PA 1RA7A 1YWXA 2EBGA 4DN0A 3C6UA 3QBCA 3THPA 3W2WA 3D4JA 4DV0F 2DGOA 2EPIA 1FKPB 1NH8A 1Q8LA 1SQVK 3M2RA 5L1IA 1S0MA 2W83C 4NYOA 2FYUK 4KH1B 3AOBA 2Z30B 2EXUA 3CCRS 3CUNA 3QLHB 2WSFJ 2BRKA 4LSNB 4CIOA 2WTFA 3K58A 4BLGA 3CX5H 4CLYA 2POKA 4DL4A 3RUBL 2VG7B 2JC1A 1YVFA 3NMDA 3GV5B 2XG8A 1D7MA 2X3GA 3W65A 3FMWA 3BSCA 5DDPC 4NLRA 1B4SA 1QSYA 2OD4A 2WVDA 3DRPB 1RT1B 3IRXB 4JI2J 3IMQJ 2ZT9C 3I6PA 2V50A 4ZVEA 3W8GA 1YIJP 2MKYA 3EVWA 1EXIA 3NG8A 4F4ZA 3HSGA 3J7YU 1ZV8A 3DLHA 2HGNA 3PEJA 1E6VB 2OYIA 1S9EB 1FZCA 3B4DA 4YB1P 5DQHA 3KQGA 2C2EA 1RAEB 1XQIA 2YNGB 4DPYA 5B0EA 1KSPA 1HI1A 3OXLA 1WEZA 2VG6B 5GTIE 5AJ3F 1SQXD 4X4OA 3MEDB 1LWCA 2W9AA 4OZLA 4PG5A 3R1HA 3FSIA 3A12A 3Q5SA 3D68A 3US5A 5M2RA 1R7IA 1TL1A 4ZVOB 1LTSC 3MMBA 2NXJA 3H32B 3IR5B 4I67A 2LA4A 4J9SA 5D3GA 2G8YA 4DU7A 2RQKA 3ICLA 4WPAA 3AQOA 4FPIA 4C8LA 5EN1A 2I9SA 3HSDA 1BGYD 5A8WA 3AECC 4DQRA 1NK9A 4AE5A 5CABA 4ZKPA 4X4UA 5ETNA 3JAMY 4NPFX 1GXLA 2BE2A 3BDEA 2V8GA 2BCCJ 4DR1F 3SSQA 2KI2A 3H8YA 4CLSA 1FDNA 4IG0B 3U7JA 3BBFA 1M90Q 1NTMK 2QMWA 3DRXA 4M5KA 2MZTA 5E7OB 2AGQA 5DGAA 4LBHA 3M0DA 5U47A 4EYIB 4AL5A 1SL1A 3V2QA 1FZGA 4HKZH 2YWGA 3LP0B 3AJDA 1X60A 3E51A 5LMUJ 4DV4J 4B02A 1U6FA 3TO8A 4CM0A 3TVZA 3BQ2A 2PC6A 3V2UC 2V8HA 1H2VZ 1TKZA 3PEHA 5E3QA 1FNXH 5D78A 3OSNA 4J90A 4W98A 1RT6B 2YKNA 5DLFA 4NEYA 2VG5B 2B9BA 2JH3A 1OVRA 3NOCA 4I69A 2AQ4A 3CX5I 1YRUA 4W7YA 3R6LB 3D66A 3DLGA 3GG1A 1XMBA 4QCLA 2GUVA 1H2UX 1WHYA 3HTKB 2HWIA 3BBBA 4PCQA 3M2VA 4WU2A 3N4XA 1VISA 2IJFA 1OZHA 1IR2A 4C11A 3MCSA 3THVA 5KFDA 2ZHAA 4WU3A 1NH4A 5KFOA 2ZVNB 2KN4A 1FXRA 2L08A 2DO4A 3QGGA 4LREA 3ZZTA 4KJIA 2HG4A 5L1JA 5RUBA 1S48A 4NCGA 3B4SA 3C15A 5SUHA 5DM6Q 4C8KA 3I56S 1T05A 4XIUA 4PD4H 5DS7A 3W62A 1KVJA 2RMLA 4WFYA 2CNOB 1JTHB 4OLPA 4RW8A 1KORA 1UA1A 4WK1A 4C9DA 1C1CA 2WBMA 4P52A 1SQPD 2PMWA 1FVQA 1GTEA 1KHVA 3PR5B 5BR8J 4AXIA 1FEHA 1GX6A 3I55S 2LECA 3CJ8A 1DARA 3FQLA 1U2RA 3CCSP 3H1KJ 2ZDOA 3TK1A 3VALA 2E1CA 1HWUA 3KK1B 2HS3A 2FDNA 3E8OA 4ZPWR 5EWGA 3GMGA 2FXPA 4P71A 1FXLA 3I87A 2O67A 3MTJA 3CJ2A 1VRTA 3H42A 1JWWA 4C48A 1H74A 1SJFA 4OYXA 1OWAA 3LP1A