1KQGB

Formate dehydrogenase n from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
total genus 89
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqgB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB02
2Y0SD 2PMZD 2V4JA 4CI0B 1F5BA 2PDAA 3MM8A 1KQGB 1H98A 2XSJB 2IVFB 4ID8A 2VPXB 4DHVA 3MM6B 2C42A 2FJAB 1B0PA 3MM5B 5BYQA 2C3MA 3MM9A 1BD6A 1Y5IB 2FD2A 1FTCA 1BQXA 3OR2A 5CHCB 1FDBA 1Y4ZB 2V2KA 2FJDB 3EUNA 1F2GA 1KEKA 1SIZA 3IR7B 2FGOA 1PC4A 1H7WA 2GMHA 1GAOA 1G6BA 2FDNA 1DFDA 2WB1D 1B0TA 1D3WA 1G3OA 4OV1A 2C3UA 3MMCB 4XK8C 1FRLA 1FRJA 5E7OB 1JNRB 1JB0C 6FD1A 1HFEL 1GTEA 1RGVA 4KT0C 1FRXA 1DURA 1C4AA 3IR5B 1KQFB 1FXRA 3MMBB 1SIWB 3MMAB 3GYXB 7FDRA 2VPZB 2WSCC 1VJWA 2XSJA 3EXYA 3MM7A 1FEHA 1CLFA 3MM6A 1FERA 2FJEB 3LW5C 3OR2B 3C8YA 1GT8A 2WAQD 3MM5A 2FJBB 1Y5LB 4AYBD 1FF2A 1BLUA 1FD2A 1IQZA 2VKRA 1FRKA 6FDRA 3EGWB 1H0HB 2UZAA 1H7XA 3OR1B 4RKUC 1FRMA 1FDNA 2VPWB 2V4JB 2Z8QA 1JNZB 1B0VA 3MM8B 2WSFC 1WTFA 1SJ1A 1IR0A 1FXDA 1K0TA 2PA8D 2C3OA 5CH7B 1FDDA 5L8RC 2C3YA 4L6V3 2ZVSA 1F5CA 3IR6B 1Y5NB 4XDDA 7FD1A 3MMCA 1Q16B 3MM9B 1BWEA 2O01C 2VPYB 1R27B 1FDAA 3HKZD 1FRIA 4YDDB 3MM7B 1XERA 2WSEC 3MMBA 2GMJA 2C3PA 3MMAA 1C4CA 1PC5A 4Y28C 1DAXA 5BYRA 1FCAA 4XDCA 3PNIA 5FD1A 1ROFA 1BC6A 1A6LA 1AXQA 4OMFG 5BYSA 1FRHA 3OR1A 1GTHA
chains in the Genus database with same CATH superfamily
3GHGB 1OWXA 1FXLA 1R8PA 3I0RA 3QT7A 2E9RX 1F1BB 1WI6A 3H1HD 4HL9A 4TYAA 2RRNA 2AX0A 1HR0J 1EQMA 4C48A 4JUZA 3GF3A 3TAMA 4AYCA 1VQ9S 1DLOB 4IFVB 1IZNB 1W2EA 1S4EA 4MFBA 4DV4F 2FVQA 1FS0E 3CCRS 2N7CA 3IGVA 3C66A 3HT3A 2F8MA 3RL0g 1N0UA 4JI4F 3DLEA 3M8RA 2GQQA 2R8JA 1XNQJ 3CX5I 4WTYA 4X4NA 3D6HB 2OTJP 3MEKA 1FJ7A 2JX2A 4G1PA 3PRJA 1N33J 2I0XA 1WC5A 2MKYA 3V4QA 5D4OA 3F41A 3I0SB 1BE3G 1S0NA 3O8ZA 4JBCA 1LWCB 5FLXU 2BJ9A 3EVWA 2DH7A 5AE2A 5C5JA 1AFIA 2B87B 1LXJA 4OQJA 2W27A 3L75J 3CXHE 4HYTB 4BLGA 1S3JA 3M30A 3BO4A 1R0AB 2R2RA 1BY9A 5A8WA 3G86A 3V6JA 2YXQB 1RHMB 3ZZOA 2V7QH 4ZVSB 4RW4A 2WHOA 1BQMA 5KT3A 1Y11A 1SKUB 3KKFA 2MSTA 1NBEB 2RQ4A 3CJ8A 5H9FK 2MQLA 1FKAF 1AYEA 2OYHA 1OXZA 3WMM0 1U6BA 4USUA 1C1BB 5APVA 1X4AA 2CXEA 3TOQA 3PW7A 1RT1A 3KZIH 2ROGA 3AJDA 2P7JA 4GC6A 2DRAA 2VFTA 1GD2E 4DQSA 2LQ9A 4QCLA 1DTQA 2HWTA 1NWQA 5CYMA 1PKUA 4Q43A 1FDOA 5L1KA 5CCHD 1SXLA 1UFKA 3PY8A 2CQ2A 5GTIH 4R0JA 4DR4J 2HZCA 4EBEA 4OJ3A 1N52B 1B99A 2ZYDA 3H90A 4RWWA 1S79A 4GVLA 3DOKA 2B6AA 2YNHB 2ZH6A 3KHLA 1FKPA 4WIIA 4WZMA 4MN4C 1IKXA 2DY1A 1QLNA 5TISH 3LGHA 1YQ3C 2OFGX 1NVOA 2C9LY 2YWFA 3HVRA 1JOCA 4MYTA 2ZH1A 2IJNA 3CWBG 1VBZA 4DX8H 3LANA 2XLJA 2CPSA 2XS7A 4F02A 1UWBA 3ONQA 4N8OA 5CCGC 5KFVA 4ZIWA 1T6AA 1HBMA 3OW2R 3P5TL 4ZVPB 2UUCJ 2WRMA 1TKDA 1X9SA 2FZGB 4IFFA 3OL6A 1UW9A 1Q95G 1TK0A 3M2UA 1HMVA 3HM9A 1TL7A 1FOSF 2H5JB 3KK3B 4F4AA 2FLOA 4ANCA 2YWKA 1ZN5A 2FJWA 3TYTA 2VFUA 4GMKA 2FY8A 1YRTA 3GHGC 2C2KB 1N5YA 1HI1A 2ADBA 1H7WA 2CJQA 3TUPA 5KLVK 2GCFA 1RHZB 4K2XA 4LVNP 3SSUA 3MEEA 1S0VA 1LTIC 1XR6A 2J6SA 4ED5A 3IAS9 4OZJA 3MTJA 5A8KB 3PTZA 1FJGJ 2DH8A 1FFGB 1ZOYC 5M2PA 2FVRA 3OUYB 2OPSA 2QRXA 3KLFA 5B5EE 5KLVE 1P84I 2VODA 2F4FA 1UZHA 2ADCA 2V2QA 4M5NA 3AE6C 1R5LA 4ZPBA 1CPZA 2WTYA 2YVSA 3RU0A 1KYOH 5KLIB 1HWJA 3MM7B 1UWAA 3WX8A 1TVRA 4DUZJ 2GVDA 4HTIA 2DGQA 4HTJA 4CLZA 2F8HA 1SJ3P 4DS5A 3PJXA 5AW7B 5FD1A 1AXQA 3TA0A 1RTJA 1DEBA 3TVKA 5JXSA 4MIBA 5E0OA 1HBWA 2HNYB 4C2MA 2CNOB 3PH0A 1ZR4A 4YFUA 4IFMA 2IVMA 4RBTA 4J9OA 5AW1B 3JQKA 3VHQA 2OFHX 3DI6B 4KHXA 3CCUS 3E2EA 3M06A 3Q24A 2AYGA 1XMBA 3EGZA 2QSFA 4RR5A 1WOPA 1CJVA 1SQVK 3EWKA 4OI1A 2W4DA 2JWAA 1JY2O 1IKYA 2DT9A 1X5SA 2CPHA 2D9OA 4UB8H 3RW6A 5DJTB 1NTMK 1RWNB 2WQYC 2L5GB 1TTHB 2CIMA 2YX7A 4USIA 3WU2H 2YXLA 2VV5A 2FZCB 3T1HJ 2OJ3A 2G8YA 1AFOA 1SQVE 3TK1A 2KTQA 3VAJA 3MMCA 2D7SA 3GIKA 4O3OA 4URGA 3HX9A 1VLOA 2H1YA 1K05A 1NH8A 3W5XA 1L4AB 3QRPA 1U25A 3QWPA 4F0KA 1AV1A 1NTME 2KT3A 2MKIA 2I8EA 1RK8A 4LLHA 1BC6A 1JCCA 3RK2B 1RLCL 3OXLA 5KFQA 2HFZA 4KJIA 1QL1A 2HPUA 3V5RA 2VPXB 2L9WA 4Y00A 3KYLA 3S01A 5B08A 3L35A 2QMWA 5F41A 1AQ5A 4USKA 5BJRA 4GC7A 3T19A 4U6PA 1FVSA 2AJFE 1I1GA 3AH6A 3PTWA 4QWCA 4DZOA 1KQSO 2P1JA 4F0MA 1GL2B 2RQKA 3G4SS 5K9FA 3V81B 1W7WA 2E66A 3CD6S 4FXWA 4KT0J 3KLGB 5HN0A 3G6EP 2EC0A 4UW2A 3D3CJ 3KMSA 4X84A 4JI3J 3SFDC 1RWPB 3LPYA 1K9MQ 4LF7F 1XWLA 4MIAA 3OTEA 1HKAA 2JEGA 3W2WA 5ETRA 3CC4S 1RHUB 4DUTA 4HH2A 2QLWA 4FN5A 1RQUA 2B9YA 5F8JA 5AW4B 1YTYA 3D1OA 2NQPA 2K8GA 2AJ0A 3PHEA 1QEXA 2RUGA 1F3VA 2VBWA 2M5AA 5KG2A 3L7OA 3IWLA 4PAAA 1GMUA 4LQ3A 5KLIC 2XWYA 3GCWP 4ELTA 2WPRA 3OFGA 2FKWB 2CFXA 3HSZA 4I56A 4CM2A 1OFCX 1XR7A 2VU5A 4BHQA 5L9XA 5EFWB 3Q86A 3C6UB 2WT7B 5CBNA 2R5DA 4FYWB 2LU1A 1LTJA 2JHEA 5CA5A 5A76A 1S6PB 3N7NA 2PRRA 1PYTA 1QUPA 4HDGA 2C2ZB 2YNGA 4R8UA 4I69A 2VONA 3D4JA 2V8DA 2YPYA 2HGNA 1NUEA 4A46A 5KFNA 2ZDPA 2OTJS 4AXJA 2G2YA 5D0GA 1NDLA 1LFWA 1SH3A 5F8MA 1FEHA 2SPZA 1HARA 4IH6A 4NLTA 1J5OB 1F9HA 3CCSP 1FF2A 3BSNA 5G0RA 4PQUB 4USVA 3KUEA 4CZCA 2V4HA 3DRYA 1VQPP 2JLEA 3JS9A 3D9BA 2BANA 3D0IE 2R7UA 1RXOB 3TJ9A 3TDKA 4ILLA 1RCXB 1VQMS 4FP9A 3D5MA 4S0MA 4WZQA 1Q7YT 2YKAA 5AW6B 1YRUA 1NJYA 4PV1B 1LWUA 1RKIA 1ITPA 3RB0A 3CJSA 2P58A 1L4AC 5E2QA 2ZNYA 1N7SA 1A0OB 3KWMA 3LIEA 5H9EK 1HI8A 4OX9J 2A10A 4KH1B 3TNVA 3I56S 4NLXA 3QGPA 4P7VA 3GYGA 1Y5IB 2FD2A 2J0XA 1U2CA 4ZMDA 3RR8A 3AD8C 2HQCA 2AYBA 3KDNA 3QRQA 4DV6J 2O3DA 1WMKA 3CC2S 1XNRJ 2XZWA 1ZYQA 2JEEA 5KFHA 4FNHA 4ED0A 1RT7A 5E3QA 2EFQA 2B5JA 2N1TB 3MCNA 3I5CA 1GL2C 3TAPA 2FBWC 2OTLP 4IYQA 5GAHI 4KC5A 3EZ5A 3AE3C 3BB5A 4DL6A 2OPQA 2J8AA 4FYDA 2HAIA 3Q8UA 2M3BA 2W9AA 2DGXA 3DC2A 1PP9G 1KVJA 4F26A 4ZVTB 3L72G 1WG1A 3CCLS 1RAAB 1WC0A 3ZTOA 2KI2A 2M7SA 2NXUA 4TY9A 3MXHP 1S1XA 1YX2A 1Y10A 1HYSA 4B3MJ 4IH5A 3KLEA 2ZDOA 3KLIB 3D0HE 2ACYA 2MQNA 5BYRA 3EZOA 2ALYB 3V6DA 4K35A 3OL9A 4U8VA 3RG6A 4DBQA 1NTKJ 2PA3A 1QVFO 2VBZA 4RNMA 2LEBA 4D3GA 3H20A 3J7Z5 2GAHC 3BDEA 4DV5J 3AEAC 2FTRA 1X5OA 5AJ3F 3MR3A 4DV3J 1UW4A 3TANA 4OYAA 2QC3A 2YX1A 1S12A 3CJKA 5CXTA 3BCCJ 1KB9I 1AUDA 1SIZA 2AXTH 3JYTB 2NXNA 3ETOA 1UEKA 1N73B 3HSDA 3DLKB 5E3CA 1JLEA 1WD6A 3IRXA 4LF6F 5H2FH 1E6YA 2ASDA 3ILIA 1RA7A 4EU0A 3QO9A 1RT4A 1U02A 3DOLB 2UXCF 2ZHBA 2RHSB 3UDCA 1SUQB 2IM0A 3M4XA 3H1LD 2VQEF 1X4DA 4IRCA 1T9VA 1MROB 4F7VA 5CD4H 4NPDA 3NNHA 4XDDA 1Y3JA 1BE3D 4ZVGA 3W9JA 1V3ZA 2JC1A 4DV2F 2KZIA 4FF4A 3HTKA 1M1HA 4KHPJ 3JSRA 1WOOA 2LYVA 2ZBCA 1SVFA 5T14A 3D71A 4NLRA 4CQ1A 2ZE2A 1YI2P 4GODA 1YJVA 1S0OA 4JV2A 3BQ1A 2EKYA 2NXJA 1VGYA 3M9OB 4PV1C 1RT3B 1KR4A 2BE9B 3DU6A 4NLPA 4DSIA 1LWFA 3MMJA 3PJSK 2I2YA 4U9RA 1OQ6A 4OV6A 3V2NA 5ETTA 5LXRA 5E33A 2PIIA 1OY9A 2N4CA 4EI2A 1VL2A 2WWWA 2VG7B 3CMAS 3DDKA 4YR2A 3SSSA 2EXUA 3DFEA 3T97B 2OI2A 1SIWB 2RMZA 3VF0B 4K0KJ 1N86A 1SH0A 2HHHF 3RB4A 2VBXA 2GZOA 1FDIA 3A12A 2WOMB 4GKGA 2YKMA 2N1TC 1T9UA 1XMQF 3N5BA 1S6QB 4B3TF 2YY3A 3MM9B 2G0CA 3BO3A 4PG5A 3H4DA 2O01J 2W6JH 4DV0F 5K8NA 5CZXA 5C24A 4PJ0E 3BCCG 1U8WA 2HNZB 1UJ5A 4FVMA 1FCAA 2XEXA 3DRXA 4ZDNA 4ZP8A 2BOPA 2QV6A 4QYZJ 5EGYA 1RE4C 3CWBD 4LFAJ 2I9SA 1PG5B 1ZPVA 3OVSA 2LDIA 4HH1A 3H5XA 2C2MB 2VF3A 2YNFA 3I82A 2XZRA 4LC1A 1FZAA 1LP1A 2RRBA 3GMAA 3FEZA 2JH3A 3HHLD 2N9BA 1CEZA 4N5SA 4JP8A 1GMJA 1NSKL 2GA7A 2MZJA 1JO5A 2RF2B 2VG5A 4OI4A 5J2NB 2RIJA 3QSYB 3W63A 1EZVG 3CDEA 3TQEA 4C8ZA 1HIYA 3KOAA 4EEYA 1Y9BA 3CPWO 5BXIA 3UVJA 3FZ2A 3CXHH 4OX8A 2XG8A 1CI6A 3H8YA 4CH0S 3N6MA 4KGVB 3Q2TC 3KG0A 3G6ES 2J58A 5KFLA 1N73C 2J9DE 4RW6A 3LF0A 5T7LA 2ILYA 3KK1A 4LF1A 1U24A 3H1KJ 4OYZA 3DMJA 3UN2A 2RQMA 2W2OP 3P6YC 3FRYA 2LU2A 3RBZA 3NL0A 3WUTA 3IMQJ 2HFVA 2LR2A 1HLWA 1HD1A 1U2FA 1HL6A 1AROP 3UDEA 1QSYA 3A0BE 4QW8A 2BQRA 1NU1K 1BXNA 3VTIA 5J1PA 2YO3A 2MQMA 3I4PA 2R7WA 4UQTA 4ZA1A 1HWLA 3NXZA 4F4KA 1BQNB 2OLWA 2BYCA 1LTSC 1VYAA 1RF0C 2D3UA 1PAEX 1YQHA 3BGUA 3ZNUA 4WF9Q 4LSNB 3M1VA 1JJCB 1S4FA 1NU1E 1T3UA 1NK4A 3OR2A 2E1MC 1RWWB 1I51B 3SBMA 3M2RB 4JI8F 3BJYA 3GONA 4CLSA 2HYNA 2ZXEB 3DM2B 4I67A 4JI1F 2OAUA 3NS6A 4OZ0A 5K14B 2FHOB 3DGVA 2XQCA 3CX5E 5DQIA 3T5LA 2DR6A 2HLTA 3IBCB 4DR2J 1CJUB 1NK8A 3HSGA 4ZIVA 4Y0FA 2PMHA 1YQ4C 1OJ4A 2A6OA 5D0HA 2IA6A 3MD1A 1N48A 4ZN1A 3VGVA 2MPUA 3UDVA 3BKTA 3H4BA 2DTJA 1RTIA 3FGAD 1SQQK 2DR9A 4BWMA 1SQBJ 2NREA 4HACA 2MQQA 2DRBA 2QM7A 2E5GA 4P10A 3TO8A 4ZOSA 4FYXB 1JY3O 3H6PA 3WDOA 2HWIA 4KV8A 1LTBC 2NYHA 2K88A 3TNUA 2WW8A 3X3UA 1SQQE 3Q23A 5KG5A 1F5BA 3VQSA 4U3FE 2W6BA 4XPEA 1WKKA 2H48B 2DHGA 3ZZPA 4U7UK 3L7PA 2YIUB 1BGYJ 1TL5A 5APQA 4O44B 3H1KG 5HK4A 3K2YA 1D0EA 2H7HA 3CMEP 5GTHE 3GV7B 1C0UA 4TLFA 1AQTA 5KT2A 5CJ4A 5KFXA 2DHAA 3BZQA 3HT0A 2ILZA 4IQXA 1DURA 4USWA 1SJRA 5CCGD 2AJQA 1APSA 4P2FA 4CPGA 2WAQD 1R0CB 4H54A 1X4GA 3MCSA 1EZZB 2B89A 1B4SA 3CEDA 1T95A 4GVBB 3M8PB 2NPSD 3NOCA 3NCQA 3QT6A 1CSJA 1KB9D 3CCQP 1SL0A 2QTWA 2HGLA 5M2RA 4CH1A 3L73J 4ZJQA 2XTJP 2Z58B 3GIRA 4G6VB 3GJRB 1LOUA 5F8HA 4XDCA 4WCEQ 1Z2LA 3D1QA 1VQLS 4WYWA 2XSFA 4DV4J 4LF2A 2X1FA 3V2PA 3AAWB 4P75A 3MM8A 1EZVI 2AGPA 4U95A 1W26A 4JI4J 2D69A 3QAUA 3EPIA 4DLGA 1N36F 4N41A 4K4YA 1WWHA 2IAJB 2W2QP 5I42B 4ZKPA 1VQ4P 2PI5A 3P3DA 2NSCA 3F73A 1FJPA 2KSEA 1Z1ZA 3C19A 4YP3A 4DX6A 1N32F 1JUNA 3SCIE 4D3HA 1ZW0A 1KMIZ 1GZLA 1BHNA 4W7ZA 1NJIQ 4J5OA 5C42B 4R5PB 4Y2KA 2KG1A 3L36A 3P7KA 1EX8A 1MMDA 1YG0A 1PAUB 1SV5B 2XSJA 3KG4A 3KUHA 3KHRA 3C14A 1SFCB 1E79H 4KFBA 1P84E 2VKRA 2LQJA 1Z2ZA 3GU0A 3HVTB 1SKWA 5IC6B 4DSKA 4UUXA 5L9NA 4NCGB 1S0MA 1AZSB 1RHQB 3QGIA 1RU1A 4OJ1A 1NPKA 2G3AA 5KG7A 1BGYG 3DLLQ 4BDPA 4YDDB 3SQOP 2L3MA 1BMQB 4AUKA 2DHXA 4IOAQ 1LJ2A 3PNIA 3PRBA 1L0ND 3X1LB 1TQLA 4UOGA 5KFWA 4LR9A 1X22A 4CTAB 3HCXA 3LP2A 2K3RA 3CC7P 2UXDF 3ZNJ1 5AW0B 1K73Q 3OXGA 2GV1A 2M52A 2UP1A 1KTVA 2AYMA 3I4HX 2V2KA 4CYUB 1NAYA 3WUVA 4KY3A 3IM8A 2HG4A 1K8AQ 3L73G 2YIUC 4ILRA 3NGTA 2FYUD 2RAQA 1YBTA 3ETMA 4DL0C 1TL1A 1CJTB 4JI2F 1S7HA 4NI2A 1ZTWA 1GTWA 2JVOA 3EPGA 1H7XA 3OR1B 4NCBA 4FBTA 3C16A 2KIKA 2LXBA 4TNOA 3TYYA 2UV8A 5CABA 3N4XA 3MWBA 1AJYA 1FNMA 2EW9A 2DNRA 1Y3KA 4Q44A 1FKOA 3QAEA 3SV3A 1HWKA 3HHEA 1PP9D 2M70A 2WSSH 3L72D 2DNNA 3DKDA 3MZWB 1IBKF 1D9FA 4DPXA 3DRPA 1VHFA 1VF5B 4FXVA 5F8NA 3KJVB 1UVKA 3OAKA 3LP1A 3TZYA 1KQSR 3GZ7A 1GEHA 2QLFB 1JXVA 3SQGA 4DCPB 4BXLA 2HS0A 4EDFA 3J7A1 4LF8J 3CCES 2CRLA 2XMWA 3E01A 4JI7F 3LIDA 2NPIA 5APSA 1ZZFA 3L74J 2RMLA 2JEJA 1URQB 1JMTA 2YBVA 2WTFA 3KK2B 1A9NB 2ZYGA 3A8KA 5AW3B 2K7JA 3T6BA 1YHQS 2GVZB 4OHVA 2DGSA 4RUBA 3M8QB 1VK8A 1NDKA 1WHYA 3CWBE 2ZD1B 4ZP9A 3LW5H 1QDUB 3AE5C 1X9WA 1R8HA 2FLLA 4HR2A 1U2RA 1JLBB 3T6JA 1EHWA 1GX5A 1SJ1A 1EP4A 2IC3B 4AQYF 1D1UA 1KOOA 3C6TA 4NE9C 4Y2CA 3H1IJ 2DNPA 1SFCC 1ZTTA 2H51B 4KGXB 2Z0GA 4RNNA 3D6FB 4DXLA 2OEMA 1JLCB 1PCAA 3TZZA 1OYEA 4EYIB 4YOEA 3M8ZA 5AXKA 2I1JA 3R5BA 1SB6A 4ECSA 3S9OA 3SDEA 5BYSA 1KLMA 2HODA 2P6TA 3J80Y 3ET6B 5IQQA 1FHTA 1NHVA 3L75E 5IV4A 3BBFA 4ID8A 1Q81T 5APXA 5L1LA 1TL3A 3Q0AA 2YPZA 3MM5B 5JUMA 1RAJA 3HFKA 2JLFA 1JEKA 2KT2A 2MZTA 3A8JA 2HHSA 2Y1RI 2HQGA 1T2KC 2ZVIA 1NGMB 2HHXA 3M8SA 1RT6B 5DO2A 5AW9B 1CSBA 3BM7A 2H8PD 3QWUA 2CWXA 1VHIA 5K8MA 2AJ4A 2DK2A 1YJWP 1N33F 3QGHA 1C1CB 1K1SA 2HSEB 1L4AD 4NWBA 6FDRA 1RQVA 3B4MA 2XY7A 4NXMF 1RF1A 3AXKA 2VPWB 5DGBA 1S1CX 2WSFH 2E1PA 1IFDA 4ECRA 4YXWH 3VOPA 5KFEA 1KD1T 2BE2A 3W2VA 3MIWA 5D77A 5HROB 2G1HA 2YKOA 3GYNA 1O8BA 4X2BA 1BDCA 2V63A 1LGHB 5I3UB 1B7FA 4IFYB 1S1WA 1SJFA 2UVWA 4LFCF 3E1IA 4AFFA 5KFYA 3MHYA 4DFJA 1HI0P 4DI6A 3L74G 2HPCB 5EWEA 4H4MB 4RW8A 2PMZD 2V4JA 5IM0A 2FVPA 2KS1B 4K4XA 5LSOA 1JY2N 3HJVA 3QJLA 3IXQA 4CLUA 1Q86T 1RA6A 3VN0A 1HPZA 1VF5C 2AZ1A 2QA4G 1E6VA 4QZVB 2R5BA 4Y6IA 4H44B 2AZ3A 1PGOA 4DPOA 1VRUA 3H1IG 4LF7J 5I3PA 1SCJB 3Q8RB 1N2DC 2JKVA 3PRDA 1S9KD 3O5TB 4TQRA 4YEAA 1ZM2A 3DOMA 1EDKA 4TU8A 2CAJA 4WBAA 4ZKUA 4U7CA 2Y0BB 3NG8A 2I1RA 1URQC 2XY6A 4KRWA 4MK8A 4DS4A 3CDAA 3I0RB 3HKWA 3VAHA 5KFIA 2CQGA 4CO1A 4YB7A 3NWRA 1JNMA 1IJDB 2NCKL 4GOEA 1QVFR 3TAMB 3FRZA 2JFKA 4Y34A 4PRFA 1HHTP 2G0JA 1USDA 3CCJP 3PX6A 5SUHA 4ZPTR 2ZC4A 1PC5A 1FX2A 3QH9A 3DLEB 4B02A 2J6UA 1RT2A 1HWUA 4CM0A 2DKOB 2W25A 3HUSA 3EYZA 1EDLA 3IWXA 2M3DA 3AJ1A 2GGPB 4F0HA 2F1FA 4Q7AA 4DPTA 3DDIA 3NRBA 2W4PA 2UVUA 1R89A 4RU9A 3CJ4A 3CD5A 3NMDA 1U0HA 1WC4A 1G7CB 3H2LA 5D3GA 1PC4A 3T3FA 2EC2A 2MEWA 4YS2A 1E5WA 4DZ6A 2MKCA 2RS8A 1UVMA 2EG2A 1JB0C 3A0HE 5B0DA 3TI0A 3M30B 3QFHA 4M63A 5A8WB 1F0XA 1XQIA 3AE9C 5GVQA 2KYZA 3LW5C 4PJ0H 3L3CA 2ROEA 4J37A 2MKJA 5F9NA 3IRWP 1LW0B 1N6QA 1JY2P 1H2UX 3W9IA 2Z4PA 3C8VA 4KQZA 3G71P 4DPUA 2QJPB 3MTUE 4PV1D 2LLZA 2B88A 2H3EB 1R6YA 2P6SA 1SQVG 3PFEA 3CJ5A 3BH6B 2VHGA 4XA4A 3AE8C 2KXHA 2BEFA 2WSEH 6AT1B 4RZRA 3WIUA 1RT1B 3K57A 1L3SA 3RGIA 4KH0B 3P8BB 1ROFA 2HIYA 3VAGA 2I5JA 2KN4A 3UR0A 4BC9A 2HRUA 2NUUG 1T3NA 2ZKUA 4OYPA 2PP6A 1PPJG 2HFUA 5APWA 3D6ZA 2R2UA 2F3JA 2N1TD 1UVLA 1UEVA 2FLNA 5HQ8A 1IC2A 5K5GB 3DOKB 5IOLA 3TZXA 4HJGH 1UZDA 1T9TA 2Q5UA 2F5GA 1IKXB 2DXFA 2L9DA 4X66F 1EETA 3NCRA 3GFZA 1KS2A 2JDJA 4ENOA 4O4GA 3H1JD 3A1YG 4H44C 4M5KA 1U0SA 1UWBB 4LRBA 1RBOB 3A0BH 3HE4A 3CUNA 3TJ8A 4ALZA 2AW0A 3Q8QB 1HBMB 5KJ7A 2ZWOA 3A3NB 2UVVA 1C0TB 1SLQA 5CCHC 2WSFC 3DYAA 3T1HF 3H0PA 3M2UB 1V3SA 1HMVB 1GW3A 2WK4A 3BH7B 3O3LA 2DIVA 2BKOA 3Q8SB 3FQLA 1N5YB 1U6FA 3BVHA 3O8WA 2POHA 4M5HA 2FHJA 3K7RA 2RQCA 2DY9A 4QR0A 5AJ3J 2V8VA 2B51A 3MEEB 5KOWA 2AEMA 1GMVA 5D4PA 3Q2SC 3CX5H 4ANEA 1WTBA 3QMQA 3BR9A 2OPSB 1KFDA 3KLFB 3CPWR 3GV5B 2NPFA 2KH9A 2VJUA 2B4UA 5B09A 3PM9A 5AVSB 2KO1A 3VGUA 2MJZA 4M5GA 1IK9A 2UXCJ 2AJ2A 2MLZA 1UEUA 4IH7A 2AHOB 4CLKA 3NLCA 2VQEJ 2GVDB 2HIQA 3BASA 5A8RA 5FIIA 1HQUA 2E5TA 1QSLA 2V94A 1GXLA 2NZ2A 1CS4B 5GTIE 2MMYA 2KZZA 1T8EA 5D6GA 2Q1LA 1RTJB 3TA1A 2PEBA 2XNQA 4DV2J 4C9DA 1VQOS 3KLHB 1OW8A 5HANA 4EBCA 3W64A 2ACMA 3A8IA 2JZ5A 3G9CA 4LR7A 2XHCA 3HK2A 3R4YA 4ASVA 3HD2A 3L37A 3NMAA 2CQHA 1RE1B 2YH0A 4DFMA 2W7AA 3OTOJ 2QJPC 1JKHB 2OYHC 3D68A 4Y28J 1M5HA 3CJTA 2OH2A 1JIHA 3W61A 1MKMA 4QIGA 5AW2B 5GTHH 2BUNA 2O66A 1IKWA 3VVUA 3V6KA 1QLED 4K59A 3KHGA 4N3YB 1YGYA 5J2PB 4NZ6A 1QM9A 2AKWB 2ZM6F 3QZ7A 1ULRA 1KC8Q 2C2EA 3M32A 3HDSA 4OJHA 3HD7A 2HHHJ 4LUBA 3DRSA 4JOUA 1ZLLA 3M6XA 1EQ0A 3MMCB 2BE7D 1BCCD 4RWXA 1XMQJ 3D0GE 1YTZT 5C2CA 1YJWS 1AFJA 4B3TJ 1QE1A 3L73D 3HHKA 1EB0A 3QJJA 4DV0J 3POTA 3P8CE 1L2PA 1K9MT 4IKAA 1HNVB 2F9JA 4R4MA 1B7YB 4B08A 3HMJG 4RUCA 2H88C 4EBDA 1IKVA 1LKZA 3RB3A 3GHGA 4M5IA 2YO2A 2XI3A 1WG4A 2ROPA 4I1TA 5GAEI 1QGKB 4CLFA 4K5SA 3W5YA 1KLNA 2WSEC 2NR0A 1UTAA 3BV8A 1UVJA 3J80U 2RT3A 5I4MA 5DDOC 2RSQA 3H5UA 1NTKK 5KG6A 2HGMA 1ZA2B 1S49A 4I6WA 1K0VA 3H32B 1RBAA 1H98A 2E5IA 4PR6A 3T41A 2H4WB 2FJAB 2M8DB 3L4FA 1N8RT 4ZLPA 2KSJA 5KG1A 1U7LA 3PKYA 1F5AA 3UCUP 1RKJA 5CHCB 3DLGA 3EGNA 3MECB 2FJXA 2FLPA 2F63A 4PXBA 1P84H 4CLTA 3W2WB 5EUHA 4TQSA 4B3OA 4TY8A 1NTKE 4WYLA 4JI6F 3AOAA 1WJ9A 2B87A 5HAOA 5E7OB 2GC8A 2KP8A 1TKTB 2RKLA 2BM0A 3D7SB 4OI3A 1CQMA 2MGZA 2KJWA 2HZVA 3NGRA 1RJJA 3MM6A 3TJAA 2JNJA 2M5AB 5KTQA 3BCCE 3JSYA 2DR8A 4FF1A 2BCCJ 1EKRA 4Q2LA 1H74A 3D1HA 3UN5A 4MTPA 3MEDB 2A2DA 3ELHA 1GU4A 1MG7A 2HQFA 1QL2A 5BU8B 1Z56A 3WU2E 3H59A 1M0SA 4TKTA 1YITS 1T3OA 1UETA 1RB0A 1LTJB 4TU7A 1GFWB 2BOAA 1H73A 5ADZA 2FXMA 5KFPA 3CCJS 1TP7A 1YIJS 4WY4A 5GAHU 1S48A 2ZT9B 3CCWA 1C1BA 1TUWA 1F6TA 4R8UB 2Z30B 4B17A 3CXHD 1I6JA 1NTZJ 2D41A 1M1GA 1EZVE 4JI8J 4FXDA 2QA4S 4JYAJ 4FDFA 4JI1J 5ETSA 3W67A 4K3AA 2W9BB 4X4QA 3R5CA 4CH7A 1U1PA 5E5NA 5KFUA 1NYHA 2IFMA 2CNKB 1VQSA 4ETXA 2K2PA 3Q83A 4X64F 1KVIA 3M9HA 5C2GA 1SQXJ 2MKVA 1LWXA 4TLRA 2YNHA 1QTMA 4OX7A 2CNNB 3NS5A 2BANB 1SJ4P 3U1LA 2H43A 3M7VA 4DEZA 4J9MA 2GFFA 3I87A 3PJ9A 2YQ1A 4I6AA 1VCTA 4NOHA 1HNZF 2X1BA 3BGOP 5DQGA 2Y1IA 1QVGO 4UUWA 1RCOB 4PD4I 1LWUB 1NAQA 1WDTA 3I9ZA 4C3KA 1FTRA 2J0QD 2YWGA 3MUMP 1N7SB 2IRUA 2V4RA 3ZZRA 5KG4A 3BBCA 2DNHA 3AA9A 3V6HA 3AEDC 1YJNP 1FU1A 1FDAA 2QE5A 2PGCA 2X3GA 5IV3A 3KK3A 1TFYA 2KXPB 1KQLA 4BRYB 5AVYB 3RBXA 2JC0A 2MZ1A 1IFPA 2GHVC 3J7AN 3Q22A 2X7IA 3IF4A 1UVIA 3J81Y 4QYZK 1CULB 4ZITA 4YPCA 2RILA 1OW6A 4C8OA 2N7YA 2WITA 4AE5A 1BSHA 3CO9A 5A8KA 2QT7A 1T0TV 2C22A 9RUBA 2V8PA 2OPQB 2BCCG 1FE4A 2MZQA 2O1KA 2GIQA 4IL6H 2AGOA 2QFIA 3W9HA 4OZ3A 4LBIA 4WWIA 3R2CJ 4YUDA 1S1XB 3M2VA 3R1HA 1HYSB 2K9JA 1LNQA 5G4DA 2EG1A 1NSPA 3KLEB 4C8YA 3TGUJ 3MM7A 3H1ID 3V6DB 5BR8J 3HZGA 2APOA 1Y5LB 1VQNS 1NTZG 2RDJA 4NX9A 4QWEA 1RH5B 5KFCA 2OYOA 2HK3A 4KSEB 4NLSA 3IC1A 2LQ8A 4O3QA 4OVNF 5ETVA 3CCMS 3O6QB 4W92B 3AOBA 1WG5A 3VR1A 2VDHA 4F3OA 4DCOB 5AW8B 1BE4A 1U26A 5KLVD 2HS4A 1WKJA 3VMAA 1REVA 3NEKA 5A2QY 1N36J 3FDSA 4OYWA 3LP0B 2CZ9A 1SP4A 1WSVA 2GX8A 3H1KE 4I2PB 4NA2A 5DM7Q 1LTJC 3LAMA 3U1NA 3G82A 1GH8A 3ZZ0A 1MN9A 1N32J 3VWSA 1JLEB 1O5JA 4DCKA 1GXUA 2CZ4A 3LWMA 2ZT9C 2DITA 1O6XA 2CDQA 3QO9B 1RT4B 4Z2XA 5H1SV 2KKHA 2QJYB 4KKOB 4RW7A 4I1LA 5B7WA 4B3RJ 2NYIA 2QMXA 3AEBC 2QN6B 1NU1G 1KN7A 2FFDA 4M94A 3SMZA 1SFCD 5HSPA 4X4UA 3GQCA 4M3LA 1RACB 1S1VB 4X4PA 2C9NY 2Q43A 3CSKA 2ASJA 2XC9A 2QFJA 3SWFA 1EC5A 2C2OB 2R42A 4Z7YA 2N3LA 2LXIA 3TAQA 5L46A 3R8YA 4IOCQ 3I55P 1OS5A 4WK3A 1SQBK 3HVAA 4Z7CA 3HPOA 1ZZNA 2OPPA 1LWUC 4OI6A 2RH3A 1YK9A 2UXDJ 1T2KD 2IZ1A 2MYFA 3GJTB 1N7SC 2C3PA 2E1AA 3UWTA 4NLQA 3UR3C 4WFZA 1SQVD 4AL6A 4LBHA 3S1TA 4GDOA 4J9QA 4DDFA 3IN6A 1GL2A 3L4BC 5A0YA 3FGVA 1DH3A 4U3FG 3TGUG 3MAAB 1NTMD 3LH2S 1KHVA 2YWEA 3D67A 5DDQC 1MLAA 1RI7A 1JJ2R 4D6TJ 3EUNA 4CO0A 4PXDA 4JI2J 3PKMA 3NS7B 4Y3CA 1TR0A 1IVZA 3EZUA 1EQ7A 4A47A 4O0IA 2DGOA 1YJRA 1PPJD 2ZZNA 5J1NA 2Q66A 2L91A 3KPEA 3QYYA 4FYYB 4ED3A 1MU2B 2OUGA 4NMXA 2DNLA 3ILJA 4WU3A 2P9EA 3RJMB 1BGYE 3UQSA 2JFDA 2J76E 4B9SA 4DUYF 1PYOB 2YXRB 2R8HA 5D8HB 4ZPAA 2HK2A 3VVTA 1PO6A 2KDOA 4MIWA 1UAWA 3TVYA 2IPOB 2P5VA 1U8SA 4C8LA 2MQPA 1IBKJ 2PFDA 4ICLB 1VF5D 1LP1B 4MK7A 2KUBA 1OYDA 2OQQA 3GW6A 1YVFA 3BN4A 4DQRA 3C6UA 3UIAA 3IG1A 1XIQA 3E51A 1RADB 1S6PA 4ED1A 2GNKA 1DBDA 2ATCB 4ZHRA 3A8EA 5M2UA 4CO4A 4ZPVR 4DQQA 4IG0B 4JI7J 4DR7F 1F60B 3L73E 1VQ8S 1CI6B 4R4LA 1Q4RA 1TAUA 3A0HH 1Z4UA 3K89A 2DCUB 1URQD 5HATA 1V6HA 4DSFA 3D2WA 2YKPA 5T7LB 3ZFVA 3KK1B 1NPRA 4OZLA 1J5OA 2OP5A 1KEKA 5A6PA 4JV5F 1NZAA 2CJ9A 3PFOA 4USJC 4LFBF 3FSXA 3G3ZA 3G6XA 1NH4A 2QJYC 1KKHA 3BYPA 3UDLA 5ETQA 1ZV8A 4C8MA 3CMQA 4OZ1A 1DQ9A 8RUCA 4AQYJ 1FVQA 3EICA 3I5AA 1LT9A 5AVZB 3NXSA 1MUUA 2OELA 2BXJA 1UA0A 4OJGA 4L72B 4QOTA 2XB2D 1WEYA 1K44A 4RKUJ 2DPIA 5DDRC 2NPSB 4M1KA 4UTGA 1FDDA 3LPEA 1BWVA 2ZXXA 1F5CA 2DRDA 3MPDA 2WONB 3M1VB 5AVRB 1HA1A 1Q0NA 1J5EF 1RT5A 4D6TG 4L76A 1Q90D 1TKZB 2Q79A 1R8CA 4UY8T 3EFGA 4LRAA 3TF5A 3O44A 3KDPB 4ZLNA 4A7PA 4EO6A 4L3KA 4OMFG 3JC22 5KOXA 2PGDA 2HHQA 2Z56B 2EK1A 2EPIA 4GO7X 3QSIA 3K5NA 1DTTB 2L41A 4WFYA 4WBFA 4LVOP 4NYZA 1VLYA 1YBUA 4DU8A 3AT1B 4YMEA 3L70J 4I64A 4HI1A 2JLGA 1H3DA 1WT6A 3CXCR 1ZPWX 1HH0A 3WX4A 1RTIB 2ZH8A 4LMZA 4C7NB 4M5LA 4NXMJ 2AJ1A 4HACB 3W3SA 3K17A 3KJFB 4MKVA 2N9YB 3DN9A 2ZEJA 1RUSA 3RK3B 3ZDMA 3KLIA 2KYXA 3TNUB 2K1RB 4CDIA 4LFCJ 3NGUA 4F2RA 2OYIB 1QY7A 3R9LA 3BPDA 4QJVA 1UKUA 4DMZA 2HBYB 3N0VA 2ZBQA 2BJDA 3N79A 4LQ9A 4BWJA 4ECUA 1YWXA 4NRUA 3AODA 1NXIA 2Q3PA 3JYTA 1C0UB 4ECQA 1G1IA 2W9CB 3OSPA 2F4VF 3RTVA 3GJSB 4H44D 1M57D 1N73A 4TT3H 3ADAC 3MUDC 3EMTA 2AMCB 1X4CA 3D28A 1VQYA 4I6YA 2QSWA 4A8WA 7AT1B 3B5ND 1FOSE 1BQXA 2J7WA 4Q8EA 1VQ5P 5J2QA 2KLUA 1FFSB 3EVMA 4RUHA 5LMUJ 4OYXA 2DISA 1Q79A 2P8IA 2ZUAA 1SI9A 1B0TA 5IT9Y 1NJIT 4GT1A 3PACA 1XMOF 4C4WA 2ZH7A 2YMYA 2H4YB 3QLHA 2O1PA 4JBZA 2DNOA 4YTPC 4USHA 4X4OA 1HBNB 4NZ7A 2ATLA 3AQOA 1VOMA 4A4JA 2R7XA 1RWVB 1IFIA 2E44A 4ZP6A 3QGGA 3H1HJ 3OFFA 3PIPQ 3MM8B 1ZR2A 4DJBA 4I2LC 4KPCA 3L74E 1HWTC 3JQJA 3D66A 1LTGC 1DHMA 4ZVQB 1J1DB 5D78A 3V5BA 4Q45A 2JSXA 3ICLA 2H65B 4W80A 5ETPA 3QIPA 4OX6A 4RPFA 2NPSC 3RL0B 1XERA 3VCDA 3J81U 1X8DA 1S72S 2Z4EA 2J0SD 4QR2A 1H72C 1VQKS 1Q8LA 5CAAA 1JM0A 4O3RA 1UP1A 3JSMB 1KWMA 3H1IE 4URQU 5HMXA 2XSJB 1G1XA 1H38A 1K73T 3L75G 4Y65A 1P1TA 4DFKA 4LF8F 3C14B 2CK3H 4LIRA 4ZKAA 2CPYA 1DJ0A 3C46A 1Y7PA 4C11A 3F0NA 3LAKA 2AEFA 3ZZZA 2OSRA 3D3BJ 2WOMA 3IR7B 4IO9Q 3THPA 1KILA 5JVGQ 1Q53A 3D6TB 5APUA 1HBOA 3FMWA 1K8AT 3K5OA 2W01A 5A6WA 2D3OR 5BVZA 5CQGA 1S6QA 4NEZA 2V9WA 1KFMA 3GFYA 3W8PA 1HBUB 2E5LJ 2VRSA 1S57A 2XGQA 2E74B 2VICA 3GSDA 2QEXS 4Z37A 2HNZA 2Y0DA 5E41A 5APTA 2F65A 2KZMA 2XLKA 1NDCA 5E3PA 1NH7A 1JNZB 2M0GB 3W5ZA 3V2QA 2DNYA 4WVZA 1OSCA 1NCLA 1PZQA 5A2QU 4HYKA 3RK3C 2MQ8A 4EFAC 4NRTA 3UW1A 2KB2A 4RNFA 4OHYA 1REGX 2OYIC 5EWGA 4N56A 3CCVP 2AWZA 4CIOA 4DR1F 1DAXA 2KOGA 4F25A 1GU5A 3UN3A 4WFBQ 1USEA 1VQ6S 2GS8A 4G65A 2R3SA 1MFTA 2J0WA 1TL1B 5KFFA 4X66J 4NI2B 2R8KA 2AEJA 1UMJA 3QT8A 2LECA 2Y9YA 1AB8A 2VB6A 2NXCA 3Q5PA 1K47A 2W8ZA 4IDKA 3NBPA 1N5TA 2LP4A 2XDJA 1SL2A 5B66E 1JLGA 5AE1A 1G3OA 2QE7H 4ZCIA 5F0WA 1FKOB 3TARA 2IJFA 3Q5SA 1CJKA 5DM6Q 4KT0C 5DLFA 3IR5B 2XO7A 3T9NA 1Q82Q 1PYSB 5AVVB 3LOUA 3EM1A 4DX7A 3AE7C 1N56A 4V1Ak 4DG1B 2ZVOB 4WPAA 3BKUA 4IL6X 3SQGB 1BQNA 3GR0A 1UIXA 4G1IA 4C0BA 3K5PA 1NTZD 2IM1A 4C3MA 2DEIA 2V69A 1PPJE 3R1LA 3HXMA 3MF5A 1J1DC 1S5LH 3FCWA 1I5OB 4QPXA 5LT5A 3VP9A 2ZBPA 3MI7X 1NK7A 3S8SA 3DM2A 3PIOQ 1N5SA 3RL0C 3IFEA 5KFTA 4XPCA 4JV0A 2A2CA 3FSYA 2WVDA 2OEJA 1S1TB 2J6TA 2YKQA 3OTCA 3K8WA 2O1JA 1EP4B 3SSRA 3C6TB 3HE5A 3M6UA 3QQCD 5DG9A 5J2MB 3J81j 1HVVA 1SJQA 1NU1D 3PG9A 4HEA9 4KO0B 2PC6A 4DJGA 2DGVA 2RNEA 4DOJA 2XNDH 4RESB 1W2BR 2KXNB 1FERA 4UZCA 2RDIA 3AEEC 1KLMB 2WW4A 2HODB 4GOFA 3CX5D 3EGWB 1TKXB 3CCZA 2M5YA 3L95X 1NSAA 2U2FA 2N3OA 2E74C 1VDFA 3RBDA 1VRTA 1VQ7S 3W8GA 1TL3B 5CYQB 1WRGA 2RB7A 1SQGA 3VZHA 1J2VA 3EDQB 2V4QA 2O01H 4PG6A 4IRDA 4M95A 4ID5B 2GMJA 1Y8AA 3FNNA 1NK0A 1JLFB 2POKA 2CVEA 4OYOA 2CJBA 3OJUA 1DD3A 2ZM6J 1NMEB 4O4RA 1GW4A 1FE6A 2QO3A 4E2FB 2L48A 3USSA 4DHVA 4RU2A 3A2AA 1R31A 1VBXA 2B4VA 3IA0A 1YLXA 2CQ3A 5DETA 4WIQA 1U45A 1SQQD 2WMMA 4ER8A 4U3FD 3TGUD 4FBUA 3E1RA 1OMSA 3M8PA 4ECZA 1QVGR 3W2VB 1P6TA 3DGPA 1FZCB 2EFVA 4KR0B 3AHPA 1VQ9P 3HULA 1HNWF 3M8WA 3CCRP 3B71A 2AT1B 1JLAA 3QRRA 4PD4E 3I6PA 4UOCA 1VRQC 2G4BA 1S1UA 2V4JB 4M5JA 4DLEA 4U7UD 3SCJE 1VBYA 5L8RJ 1HPZB 1U48A 4RBVA 2ITAA 2EFGA 5AVXB 3CD7A 2VPYB 2P67A 1U1KA 2Z2LA 5I42A 4RW9B 1NNDA 1FEEA 2R9LA 5F3TA 4ES1A 1N34F 4ZMMA 4J9RA 2HLOA 3S1KA 4P2XA 4P74A 4X4VA 3AY0A 2X3DA 2LCWA 4MK9A 2W2NP 4PWDA 5C42A 4R5PA 2UVRA 1EDJA 3FWLA 4ZVOB 4JI6J 2NLWA 1JJHA 1U4BA 3SEOA 1SV5A 4UB6E 2CQCA 1SC4B 2OIHA 1CG2A 4UQGA 5CHXA 2C0WA 4B86A 3W68A 3HVTA 4PKDB 4ZN3A 1YTZI 4LSLA 3DLJA 1FNXH 1AZSA 2J9CA 3GG2A 4M5MA 3EX7B 4I7ZB 1IN0A 1LW2B 5HBMA 4E98A 3O2IA 2VJVA 2DNMA 3ZTPA 4PG8A 3BSAA 1RT2B 2CNLB 2ZWPA 1Q5YA 3KHUA 2CQDA 3KYQA 3M0AA 2ZZMA 3HUSB 2ZT9D 2IDEA 2GQ2A 2C3OA 1YJ9P 4ZVEA 3G8SA 4EYYQ 4YR3A 2FYXA 1P84D 1U0HB 4IG3B 1S99A 1NEEA 5D3GB 1M90Q 4PWWA 1YBAA 4NPEA 1RHJB 2B9BA 5KFAA 4IO1A 5F8LA 4FKYA 1YYCA 1PJ5A 4X65F 5B0EA 4D6TD 3BGRB 1AVOA 3MR2A 3OSNA 4P71A 4X64J 1MWYA 4OI2A 3W60A 1N4LA 2R3VA 2W2MP 2C42A 4K5RA 3IN5A 3JSVC 5KFMA 1EXJA 1CJTA 4NL5A 3FEXB 2HHTA 5IT9U 5ITHA 3CNQP 2ZNZA 2HHVA 1HNZJ 1RABB 1UL3A 3VMXA 1EARA 4N77A 2RJZA 4OHWA 1HFEL 1N7SD 2FHMA 2MZRA 4RNOA 4H13B 2RU3A 2GUVA 1K1QA 1CLFA 5AXMA 3V4WA 3TW0A 2V0NA 1FZCC 2I5JB 2G0IA 2LXFA 1RYSA 1NK9A 4K4TA 4F3MA 4FS2A 2R32A 3Q8VA 1OSDA 4EYHB 3MTKA 4MKAA 2PN6A 4DF4A 1LWEA 1V5VA 5D15A 4PZVA 2O01C 3PYEA 3EQ2A 2VA2A 2R7SA 2VQFF 1Q8IA 2V2VA 1FJEB 1ZRTE 3OTOF 1C4CA 1WEXA 3CCVS 3DDNA 3DXBA 2UV8G 4K4VA 2IMOA 1RAGB 1NKNA 3P49B 3F89A 2J7UA 1DX7A 2D2CD 3DRRB 3HF5A 3PVXA 2IA0A 1IUJA 3DU5A 2DNKA 2IX7C 3VAIA 2Z5HA 1RTHA 3NKYA 3FXEA 1XBWA 1MSWD 3HE4B 3MOZA 4NLDA 2F8EX 3T1AA 1XTGB 3M8QA 3BRVB 2SXLA 3R3TA 4X62F 2ZD1A 1A7GE 3J7YI 2XS2A 1KV4A 1WF0A 4ZPWR 2ZAEB 2HBQB 3JTPA 5HLFB 1NTKG 4XK8C 2HQDA 2XNXA 5CBOA 3JB9k 4F4XA 3PDNA 3CCUP 1KQKA 4ECTA 3C8YA 2E1RA 4ECXA 3MP7B 2VKZG 3LTOA 4ZCMA 3VAFA 1HTLC 4I7ZC 2GIRA 2NZ4A 3CW2C 2DH9A 4K50A 1KFSA 3PV8A 1N5VA 2IYIA 4Z1MH 3PHLA 2ZVSA 3KJQB 2Y0EA 1DEEG 3HUSC 1U7MA 4OYBA 3JCUE 3FFIA 3NOGA 2BVZA 1V9OA 5LXYA 3IAM9 4OIXA 3MMAA 2BCCE 5KT4A 1M5SA 2DYAA 2VOPA 2OGUA 3HHDA 1D8ZA 4CP5A 5L38A 1RT6A 1NTZK 3FKBA 4U7JA 3MUTP 2Y0SD 5C7PA 2VASA 2MJNA 3D6YA 3DLBA 5A8RB 3IP0A 5GAEU 2MTLA 3LA0A 1HQUB 3RZAA 3MZIA 3PEHA 3H1LJ 3OBIA 5GMEA 1RZMA 2A1BA 2IJRA 1JTHB 3OJAB 1KVKA 2CYYA 1BE3J 3TUIC 4J90A 3L75D 1NTZE 1S6OA 1M1KT 1D8YA 1OX3A 1SQXK 2WPVB 3SCKE 2YQ3A 1AUSL 2CVIA 1QAYA 3AE1C 4F2SA 4N6JA 1KILE 2D1CA 3ENVA 4WFNQ 4ECYA 1ZAXA 2IIHA 4W98A 4DL5A 3OTDA 4AD6A 1YDLA 3RYLA 3G4SP 4TU9A 1S9GB 3RUBL 2HNDB 5KFBA 1SQXE 3MDFA 3CD6P 3MPVA 1VJQA 4H13C 3NNCA 1X79B 1IM4A 1X4FA 1S76D 3T5KA 2KS1A 1CBKA 1KN6A 4RBUA 3P96A 5KFDA 1IXKA 1HW8A 2DNZA 1RY3A 1FRIA 3M32B 3HVWA 1YRXA 4C0HA 1BDDA 3CC4P 2EFPA 2GJIA 3MR7A 4JYAF 3BSOA 3OA7A 2CPFA 4L73A 3TX8A 2UXBF 2IVFB 4HVZA 2Q7CA 3F5HA 5CCHA 2A3JA 1PGQA 1H0TA 1L5UA 3OFHA 4DQPA 2XNRA 3EGVA 2CPIA 1QAIA 1JLQB 4GRSA 4CLLA 4DUYJ 3HFVA 3CDBA 1VS3A 2AXCA 3MURP 4DSLA 3BQ2A 1K04A 2Q9IA 3CCSS 3OL7A 3VGTA 1Q86Q 2XYPB 3G96A 2BW2A 4F4YA 3TR5A 2HHUA 5KJ7C 2V68A 2V2ZA 1EDIA 3R97A 1RYRA 5C25A 1KQFB 4OYIA 2XMUA 4OLOA 1ZOTA 1BUXA 3CWBJ 4P2SA 3TQ1A 1VQPS 2Y3YA 2NS1B 4GO5X 3SFGA 1IJEB 2WCXA 3SSQA 3MFHA 4AQRD 3FMBA 2NSBA 3ABVC 4DR5F 2QJKB 4NPOA 5IT0A 3KXDA 4I7FA 2XKMA 3AA8A 2GGPA 3ISNC 3H1LG 5GADU 4DR7J 2H5IB 4WXOA 3TGUE 3DLGB 1M5PC 2FUG9 3WIVA 4YQWA 4B3OB 3P8MC 1QTNB 4TY8B 3AE4C 2HMIA 1A02F 4FKXA 1WORA 2R7RA 4TN2A 2BM1A 3BSCA 4JPZB 3AXMA 3H5SA 1WHVA 4JV5J 2MLYA 2MGZB 2HEKA 4LFBJ 4ED4A 3NP5A 1VQMP 3MM6B 2ZUGA 3M9QA 2OPRA 1RTDA 3M0DA 2I8DA 3I31A 5MLCV 2HVEA 2CJYB 4I2QA 1LW0A 2MSSA 2OTLS 5HI7A 1NSQA 1TK8A 1JMBA 1D3WA 3TZWA 4XIUA 4G1QA 1S5LX 2YNYA 3I56P 3MEGA 4C7RA 3VMZA 4ZVHA 4JI5J 2DD8S 4WY4B 1SPBP 3GTYX 3GG1A 5BR8F 1NM2A 2YKNB 4A8XA 1J5EJ 3CC2P 1R3NA 4ZVUB 2HLUA 3CULA 1M56D 1P8GA 3FCVA 2CQ1A 4FPRA 4IOIH 2FVCA 1ZBTA 1HNXF 1L3KA 1K0TA 5AVUB 2C3YA 4QU7A 2AQ4A 1YJ9S 1T05A 2HQIA 2IYOA 2KFYA 4H4KA 1KP6A 2RE1A 5HQMA 1FNOA 3C15A 4WKRA 2XY5A 4V19J 2B9XA 4P2MA 5DZ6A 1Y0HA 3C3LA 2WZ1A 3BF4A 4J9LA 3CCLP 3CIZA 1FRHA 5B66H 1UA1A 3BS9A 2F7VA 1Q78A 3HD7C 3UD5A 2LFVA 5RUBA 2Y8WA 1SQBG 3I9V9 2AYEA 2EBEA 4B3RF 2KVIA 3JAMY 2Q1KA 1M1JA 2M8RA 1PFIA 4A48A 4M8LA 4KAIA 4P72A 4ZP7A 1WNEA 4OL8A 2UUBF 3RK3D 1V5IB 2Z57B 1C0TA 3KHHA 3M9NB 5K8PA 2CJKA 4OV1A 1NRKA 4ZLJA 2EKNA 1DRZA 3UE2A 2MJUA 1RGVA 1URNA 1EIYB 3OHBA 2W6AA 1OVUA 2JWDA 2JRSA 3ZZUA 4D6TE 2EVZA 2W24A 2CJXB 1VIXA 3A3PB 4WB4A 1KTMA 2XV5A 2UZAA 2YTCA 2BX6A 1GK8A 1X0PA 2J9DA 1OVRA 2F4VJ 5HMYA 2HRTA 4B9TA 1BWEA 1YI2S 3FSIA 3TA2A 2QJKC 4USMA 3T1YJ 1U1LA 2J7KA 2FGCA 2E9ZA 3ITHB 4JB8B 3M2VB 2K9JB 2XMKA 3Q1MA 3D54A 3V2UC 2RVJA 2E76D 4AUWA 4URSA 1T7PA 1IR2A 4DN0A 3V4MA 3MGNA 1T3JA 5C39A 3VAMA 1XMOJ 2CQPA 2ZH9A 2B56A 4RL1A 2BACA 1CS4A 3PR5B 2VOOA 3W7BA 2HFED 2AF6A 5T41A 5FJ4A 4RNHA 1FDMA 3US5A 5IS2A 3KLHA 2MXYA 3B8EB 3VYIA 1LQ9A 4N76A 1W2IA 1REVB 4UT4A 4A8SA 4LF9F 3HP6A 1WI8A 3ILLA 1X7VA 2KM8B 4C3LA 1FWLA 4BCAA 4C7QA 3G82B 3RL0D 2G1DA 3MPWA 4IUFA 1JKHA 1RP5A 1TU0B 2FXOA 3BREA 1G2CA 4WK1A 1L3UA 3CMAP 4WY4C 2QG9B 2IYGA 2KK7A 1LV5A 3L71J 4RW7B 2VZ9A 2W4CA 4NA1A 3OV7A 2BJ8A 5CZVA 5IT4A 1MZ9A 5J2PA 2FFDB 4XE5B 3THVA 2G9OA 2D9PA 1OPIA 2KVQE 3K8VA 4QW9A 2ZHOA 5AVTB 2WVBA 2AIRB 1D09B 4YB6A 4C46A 4HLBA 3PW2A 2BMBA 3FBEA 1GTHA 2ZH4A 3RB6A 2MDAA 2PMWA 2HVIA 1ZM4A 2OMLA 3GR1A 1LTTC 3A4TA 1ZA1B 2DR7A 5B0GA 5KFJA 1SH2A 3NFQA 2WBRA 4PD4H 4B9MA 3VP8A 2E74D 1DQAA 2E75B 3QBCA 4NXNJ 1IWGA 3BKFA 1HNVA 4IL6E 4DN9A 3CJQA 5LMNF 1PV3A 1J27A 3G8TA 1XC9A 2OPPB 4KIAA 1ZM9A 3KNGA 1JNRB 4CCHA 3J7ZT 2IYPA 2Q6QA 3CT9A 1L0NJ 1P9YA 3SWYA 1FXRA 1VK3A 1O51A 3FBFA 3C2PA 2DEJA 2YH1A 1SL1A 5DLGA 1FI4A 4Q8FA 3L70E 4QWDA 2MY7A 1QUVA 2E7VA 1H0HB 2R7VA 2C2NA 4LRDA 4MJKA 5A0YB 4DR1J 1URRA 1KONA 3CJ2A 3JTNA 2V67A 3H32A 1VBKA 1YZ6A 3P8CD 4WJBA 2R4FA 3O1LA 4OH8B 2L08A 4L74A 1N0VC 1NHKL 1FJKA 4UB6H 2U1AA 3KLVA 2O5DA 2FYUJ 1KFNA 3MECA 5J1EA 5AVQB 2VFSA 2V7QJ 4KPYA 3U1CA 3VTPC 1R8AA 2D74B 2A0FB 2ERRA 1M5VC 3KTQA 5CJ0A 1TKTA 4LREA 3UNYA 3WZ0A 2CPXA 1FK9A 2IM2A 1H6KX 2M2BA 4WE1B 2PO4A 1DD4A 1HNIB 5BYQA 1U1MA 2RDDA 2HG5D 1IFJA 5DG8A 4PG7A 2QLXA 3M05A 4N8NA 3HHNB 4NPFX 3MEDA 1NZ8A 1PP9J 4UF4A 3L72J 3L71G 3HZEA 1WDDA 3IG1B 2HHWA 1N8RQ 2CKWA 4H4OB 1D9DA 4HI2A 2J5UA 4HKZH 2CWKA 1Y9OA 2RN0A 3EXYA 4ZHRB 1NTKD 1RHRB 4PUOA 3UO0A 1UPMB 2YNIA 2K7KA 3GLMA 4V19X 5HJXA 4QIWD 3ZZYA 4KGZB 1XK8A 2OMOA 3R7BB 1WTFA 4B9NA 2MKHA 2KM8C 2ZJPQ 4DU7A 3AD9C 3BCCD 1P27B 4M5DA 2W9BA 1R27B 1XTZA 3BR8A 1PSDA 2CA9A 3NTNA 5KG0A 4LIWA 1T03B 1TV6B 2BV3A 3PX4A 1X9MA 2Y0CA 3H1HE 5L1JA 2BDPA 2EFOA 1JXLA 2LVWA 4PYDA 2FFDC 2PDAA 1L0NG 3F56A 4X4SA 3CMES 1LT9B 4Q0BB 2AD9A 3FQKA 5D4NA 1H2VZ 5LJ3Y 2M9KA 3B5NB 2BJEA 2RRAA 1EZVD 1VDHA 2FJDB 2E7XA 2KRRA 5LMUF 3ULHA 3S4RA 1HJBA 3OT9A 5FDLB 1IR1A 5E3RA 3GV8B 3SCLE 2W1BA 1RT5B 1BSNA 2BKPA 2E75C 3MAHA 4P6QA 3CCQS 3RK2C 1ZMEC 2LEPA 2FYUG 1WC1A 3QPIA 4BRYA 4N78D 1AT1B 4JQ0D 4MFBB 5ETMA 3TEHB 4EOTA 2R8IA 2VH7A 3WBZA 3M6VA 5KT6A 1CULA 2QGFB 5KT7A 2ZJSE 4YB1P 3OFEA 1Y5NB 2CPBA 4DR6F 3E3XA 3IS9A 1KOHA 2IRYA 2RKIA 2ZFCA 4EGLA 1NKZB 1L3VA 3FBCA 2OD6A 2WB4A 4NCAA 1IBCB 1VQ4S 3EE3A 2K3IA 4ZJLA 5HVGA 1RAHB 1LEOA 3NAHA 2F9DA 2E5YA 4CI0B 5KFZA 3Q89A 5JMNA 4B9UA 2H89C 4O23A 3G8QA 2PAJA 3ENAA 1WSRA 1B0PA 1H2TZ 4X4RA 1LT1A 1J2JB 2AX1A 1VQLP 1WHWA 1SQPJ 1MMLA 4NMLA 1HNWJ 5DS7A 4ASWA 2DCLA 1RU2A 4CLWA 4RW4B 2MKKA 1ZH5A 1BQMB 4QWBA 2GMLA 1U47A 2PE8A 3FJ2A 5DJUB 5F3ZA 2GHWA 4B9VA 4LGDE 3O6QA 2E5LF 2GW8A 2OYHB 3UI3A 1FO1A 3N5FA 4A8QA 3JCUH 3UD3P 4IRKA 2XMJA 2R2TA 3LP0A 3MAQA 3AB2B 2BQUA 4I2PA 1UCNA 2Z8QA 1NDPA 5ETKA 5DZ7A 1N34J 2XMTA 3IWNC 1AVYA 4MYUA 1DTQB 5CYMB 1G2EA 2R7TA 4GKKF 1R0BG 4DOZA 4DR3F 1S2EA 3RK3E 3CC7S 3RGUA 4KKOA 3HHLA 5J2QB 3G9RA 3FUYA 4WWSA 2VFRA 1KTQA 2HURA 2B6AB 4I6MC 3F44A 3G2XA 3MD3A 3QLHB 2C1EB 3PHTA 3JAMU 1FKPB 3CJRA 1XEZA 4L3NA 3P32A 1S1VA 4WP8A 3WC0A 1IFMA 1UFLA 3GJQB 1I94F 3KFWX 2ZBIA 3B82A 3H1KD 2KNCA 4EK2A 1RE3A 1Y4ZB 1MN7A 3A7OA 1LT9C 1NO4A 4OGQB 3SXLA 3B5NC 4QIFA 2WPSA 3QIPB 2Z2ZA 3MR5A 4ECVA 1Q1KA 3JTOA 2KFZA 2M0BA 1TL7B 1GQEA 2DO4A 4IQMA 3V4IA 5F8GA 1IJFB 3GG0A 2FYNB 1RQ0A 4NASA 2DB1A 2LQ5A 4B3SF 4NLUA 4FNIA 4X65J 1X5PA 3DCAA 3MAAA 4C11B 5EDWA 1SQPG 5IWAF 3PYDA 4DL4A 1S4XA 3OLAA 3MMBA 1YJTA 4Y28C 1KILB 1HQEA 4NEYA 2J8SA 2E42A 3RAMA 2L9NA 2LXCB 1HBOB 2BEQD 2FC9A 1IBLF 1G4CA 3BQ0A 4Q5VA 4YHHF 1MU2A 2KLVA 2QX0A 1TVRB 2XZTB 2XYGB 1FTCA 3GPAA 1FJCA 3SIPB 4H13D 3DHWC 3AEFC 4YXDC 4A8YA 1SQBD 1EJ7L 3M91A 2P10A 4MMOA 3OHAA 2VG6A 4ICLA 1JK9B 3CCEP 1DQ8A 1OY6A 2V8GA 1WKLA 1NPPA 3K5LA 1U49A 1QX8A 4XTTA 3GIMA 1Q82T 3MUDA 2VQFJ 3QIDA 3KMQA 2VDIA 3PJWA 3MR6A 1N54B 4H0LB 5U47A 3H2VE 4IG0A 2DGTA 1YHQP 3H5YA 1PIEA 1BGYD 1U6ZA 2P9GA 4L6V3 1CJVB 4P52A 4ZPDA 4LSZB 3PX0A 2GAGC 2IBKA 2CQ0A 3NBPB 4IDKB 4ZLLA 4FPIA 2Q3EA 2EI5A 4EUVA 2ZH5A 1IKYB 1VC0A 1FC2C 1JLGB 4N47A 3H1JJ 2K06A 5EN1A 5KJ7D 2Q6CA 4X62J 1YJUA 1X4BA 5LJ5Y 3JSBA 5CMZA 1YKWA 1CJKB 2O01N 1C4AA 2FY1A 4J9VA 2LQBA 1FAVA 1S9EA 5CCGA 2FHJD 1NB7A 1FZGA 1MWQA 5JVHQ 4KE5A 5HP1A 4E0DA 3UPFA 1KORA 3ISND 2NPSA 2IRXA 4AXIA 5KTBA 3K59A 2D3ZA 2WONA 2B4PA 3CJ0A 4I0WA 2E5JA 1TKZA 4OGQC 2IBZG 4CO3A 1RWOB 3R5AA 1OWAA 1IQZA 4CT9A 1FRKA 3HI9A 1DLOA 4IFVA 1O0PA 3HRNA 3CVKA 4FF3A 5GMDA 3GWCA 1IR0A 1RWMB 1TMJA 5DDPC 2A06G 2FYNC 1YJ7A 1DTTA 1OO0B 1U09A 2YQ0A 3JQMA 4DV1F 1FZEA 5GAGI 2CQIA 3SFUA 5KAFE 2XULA 4ED7A 1PGPA 3NY0A 4LJMA 4EO8A 4PABA 3HE5B 2IBOA 2VBYA 1J1EB 4YY3F 3SYZA 4C7NA 1WF2A 3I0SA 4NLGA 1TK5A 1LWCA 2I6WA 1RWXB 1T9XA 5EX3A 3ENQA 2DVIA 5APYA 1KILC 4ILMA 2N4DA 3VV2B 1RAIB 2BW7A 1KYOI 2CZVC 3R6LB 1FWPA 4J9UE 2ZC3A 1ZP0C 4C98A 2J9EA 2Q6BA 4J9NA 1R0AA 3N6LA 4HHUA 2K1RA 1VRTB 5KKZB 2K9YA 2OYIA 3R2PA 2C3UA 2X51A 1ICEB 3ZTQA 2XI2A 1AA0A 3CDWA 1NJXA 4OI0A 3OJSA 2QZ8A 4NLWA 5DQHA 2HQ3A 2HW3A 1W2BO 2P2UA 3T9ZA 5B5EH 1RISA 2R7OA 2W90A 3H1JG 4CWBA 3HD7D 4U96A 1AW0A 1FRMA 2W9CA 1CC7A 2ZJQQ 2XBPA 3ISZA 3AE2C 3OD2A 2YNGB 4TYBA 1FXDA 2KFNA 5EX0A 1U1QA 2DHSA 2GQCA 4ED8A 2MY8A 4EWTA 5KFSA 3TWZA 4GKJF 1T9YA 4DX5A 4ATNA 1X4HA 4ZK7M 2WVCA 4QYRA 2ZBRA 1NO8A 4H0LC 2UXBJ 2QSIA 3OPKA 3HO1A 4ED6A 3L7UA 4HB1A 1X0FA 4C8NA 3NCPA 1BCCJ 4Y2AA 4IR9A 4O3SA 2BKNA 5G0RB 3CJ3A 1S5LE 3DGPB 3CE8A 4CO2A 2XGPA 2DW3A 4HDHA 2BA9A 1MW7A 5E3AA 2UUAF 4N78E 3B78A 5IQ6A 4YB5A 3PW0A 1JLAB 2KL8A 3R5DA 1HBNA 2VUGA 2Y9ZA 4U67Q 1HD0A 4NYOA 3N9UC 1S1UB 1SQEA 3QJPA 1KNZA 4Y99B 4KB7A 4ZJOA 2GMHA 2ZYAA 2GJ2A 1R43A 4C6AA 5AT1B 4DR5J 3FEYB 3G71S 1KZUB 2PI4A 2QL5B 5THWA 2OD4A 3NGDA 2LEAA 3Q8PB 3A3YB 3L71D 1H8AA 2BEZF 5I3QA 4QQBA 4PWDB 1DY3A 2AU0A 2CJAA 3JSMA 2QYGA 1L0LJ 4KJMA 2Z2MA 3CI9A 1A02J 2QL7B 2JEFA 2IZ0A 1S59A 2K37A 3EWGA 4FF2A 4ZPCA 2LKMA 2LXUA 3WC2A 3W62A 3HFZB 1RT7B 1JX4A 4W90B 4DT0A 3TUJC 2B5JB 3R27A 1B64A 4HT7A 1M90T 3L74D 3P45B 4LSLB 4UOFA 3OUYA 5DG7A 2D2CB 4GIFA 3HD1A 1WC3A 2R3CA 1SBRA 4PPDA 2FIUA 4K2JA 2IVYA 5HBMB 2W83C 2Y1LB 1EXIA 1H88A 1HBUA 3U1MA 4NLYA 2D3O1 1J1EC 3H2UB 5B0BA 2JDIH 4CO5A 1JY3N 2EFNA 4WY4D 2UUTA 2IBZI 3LO3A 2NRGA 2V9KA 1MFZA 2A6MA 4DV7F 2DO0A 2K3KA 3RR7A 3IBWA 2WVRA 2B9EA 1SC6A 2QMUB 3C9IA 4J7CA 2AGQA 3EVOA 1HNXJ 3H1LE 2HNYA 5B0FA 1XTCC 4O9BA 5KKZC 1S7IA 1BCCG 1BGXT 3CJKB 2DGWA 1BE3E 1OY8A 3J7YU 3NMRA 1BLUA 3H98A 2FJVA 3DI6A 2C0XA 3FXDA 2XHWA 1PBUA 3VAKA 3CL3D 1TUGB 1SQXG 3RAQA 3FK4A 2PA8D 3CB4A 5HMWA 1XN9A 4IR1A 5DJBA 1DARA 4C97A 2ZVNB 2EEYA 1X0TA 3IRXB 3OLBA 1E6YB 4JI0F 3ENWA 2QL9B 2DGUA 2ASLA 3SV4A 1Q2NA 2DBBA 4J9KA 3QFWA 3V6IA 4WP3A 3WUUA 3OVBA 4LF5F 2CQ4A 2UUBJ 3QNWB 2DNQA 5H9FJ 1WELA 1UVNA 1R8EA 1EAYC 2FXPA 2C3MA 4DPYA 1DIPA 3RBEA 1D9AA 2FHKA 3HTKB 1VFJA 3Q8YA 1L4AA 1IWAA 1L0LG 3UCZP 1S5ZA 4DG1A 3M8YA 4LBPA 1IBMF 2A45H 2VC0A 1UJ6A 1LWEB 5K5MA 2ZE2B 2KHCA 1FRJA 3EJMA 5F0UA 1G1JA 2QA1A 4O0NA 5CCMA 4OLPA 4WFAQ 3PCOB 1LK7A 4Y99C 5LOQA 4F4WA 1RAOA 3UFCX 4LF4F 2X1AA 3RRGA 3ILOA 2QYCA 4K4UA 1FT8A 1LWFB 1HW9A 2CDRB 1HWIA 1RTHB 4WXWA 2FYZA 2XMAA 2BASA 3U1AA 1JY3P 1SQBE 2Z5IA 8ATCB 3V81A 3CD0A 2JEIA 2DIUA 3KLGA 2J59M 1S1TA 1VQOP 1Y47A 2HVZA 4KHRA 2IHR1 2YKMB 3OL8A 1S9FA 2UU9F 1UPPA 5J2MA 3NWGA 3LQVA 4KGMA 4PXCA 1FZFA 1X31C 4KO0A 3VZIA 1NHUA 2GM4A 1MNEA 2E29A 3LUYA 3UD4P 1HUCA 5C24B 2D2CC 1ACMB 2H5EA 4LF9J 2QA2A 4I4BA 4OZ2A 1TKXA 4BWNA 5KLVJ 2FDNA 3RRHA 2BJ7A 2JOQA 2E5HA 4A8OA 1RSCA 3BGLA 2B7BB 2KT5A 1HR0F 3NGSA 2B9WA 1OZHA 5CYQA 3CO0P 4N7TA 3FFIB 2H54B 2VIHA 1ZAWA 5BU5A 2YNFB 5KFRA 3MMAB 4DFPA 1ZM3A 2B0GA 1VI7A 2WT7A 4ID5A 3QT5A 4K8RA 1JLFA 2KI7B 1JJ4A 1KYOD 1F9EB 4RKUC 1CZQA 3V2RA 3Q2YA 1XNQF 2W2PP 2VG5B 1QSSA 1FE0A 3UVJB 3Q3DA 1S97A 3A5TA 5EHHA 2BQ3A 2QIWA 1OMIA 5ETNA 1IQTA 2FC8A 1RBLA 4RW6B 2V34A 2XMMA 1P9QC 1NJZA 2V8HA 4PQAA 3DMJB 2E75D 1SQPD 3RK2D 1R7IA 5AXLA 5KAIE 2IPPA 3SWKA 2JO1A 4PQUA 1FZCA 1GXTA 2CG8A 5LMNJ 3R7SB 4ECWA 4K4SA 2DHHA 4UZBA 1X8YA 4L75A 1F3FA 1LTAC 2GUSA 5TJHA 4QU6A 3GMGA 5K8OA 4PXEA 2HVDA 1GL2D 1VISA 3GSIA 6FD1A 5B0AA 1SC3B 1SQVJ 2BRLA 1B70B 1ZS6A 3R5JB 4JI5F 2C28A 2DXDA 2WSCH 3DLHA 4CNYA 4RW9A 2UUWA 3OR2B 4F8RA 3MCMA 2BJ1A 1NTMJ 2FPHX 3BBBA 1T02A 1B0VA 1T94A 4QBUA 2M4MA 4OZNA 2XO6A 2KYVA 2NZCA 1SQFA 3ZTSA 2O3JA 1H0TB 1M7LA 4PD4D 2ZH2A 4DR4F 3W65A 1N88A 5AW5B 4P73A 1H89A 1GK6A 2N1TA 1TMMA 1NU4A 3G6VA 3S7RA 5KLVG 3QZ8A 1FD8A 4O3NA 5L39A 2HFSA 2IY5B 1Q7YQ 1YITP 1OQ3A 2UWJE 2YX4A 3H7HB 4JF7A 4Y2MA 5C25B 1SKSA 3GIJA 1JWWA 1EKSA 3BGFA 1YIJP 5E79E 2XS5A 1LW2A 1LFPA 3B54A 2VA3A 1BD6A 1S77D 4PG4A 1RE4A 2LA4A 2XU6A 5ETLA 2PT0A 2UUCF 1Q7LB 4KV8B 2QA4P 1OPZA 3OVAA 3QWOC 4F4ZA 2WPQA 3MPYA 4I7FB 2ZITA 2XM3A 4OYMA 3BATA 3IO1A 4OHZA 1FRLA 3TP2A 1T9WA 1GDTA 3VGSA 2CPZA 3ZXWA 1KDNA 1KB9E 2VPZB 4IG3A 1U57A 2H9ZA 2HMIB 2HZAA 1YJNS 1T8ZA 4ERDA 2JJ4D 4LT6A 4RJVA 1VC6A 5HMZA 1HJ0A 1CW5A 1FDNA 1T11A 3MCOA 3ZTRA 3BGRA 4FVCA 3P4UB 5AXNA 2IBZD 4JV1A 2QJ3A 2MB0B 2OPRB 2KB7P 1FJGF 1RTDB 2GO8A 4RO0A 4QPTA 4C8KA 3CXHI 3DLKA 2P2CB 2K1AA 4PWUA 4I2QB 3T1YF 2A06D 2G13A 3G87A 4G1QB 1N7LA 3WQPA 3DOLA 2C2RA 1CC8A 3MEGB 2OO4A 9ATCB 4ES2A 5HQLA 1SUQA 1GMWD 2YWWA 2E76B 3L71E 3M6WA 1S6UA 4DUZF 1TFWA 1NHLA 3PLNA 1MROA 1I3OB 3NGKA 4EMDA 2HBZB 3M9MB 1NTMG 2ZKTA 4EZ9A 1GAOA 3RW7A 1RF0A 3PW4A 4KGKA 3QATA 3Q5RA 4ZVRB 1JQGA 3K58A 1T05B 2JL9A 1NAFA 3LWLA 4UOHA 1MWZA 1JB0J 2LKZA 4ELVA 3I96A 4DZDA 2G2ZA 4DSJA 1L0NK 2RH0A 3II6A 3C15B 1W5CE 3GYXB 1KRPA 3KUGA 1QJHA 4DR6J 3LW5J 4G3IA 3L70G 4ED2A 3TEGA 1RT3A 3FC9A 3KJNB 3GE9A 4EZ6A 3FX0A 1SKRA 3DRRA 2DR5A 4AL7A 5D0RA 4R25A 3TVZA 1L0NE 2XCPA 2NXEA 1S10A 5K20B 1M1JB 3PRVA 2HVHA 1WC6A 2VG7A 1VQNP 2OKQA 1OVVA 1RHKB 2CPJA 3T97A 1CQNA 2FYUK 4TLQA 4KFBB 5LL6d 5CD4A 1NK6A 1FBMA 2Y9HA 1TL4A 1XR5A 3CCMP 1M5OC 5HLFA 2LMIA 1F2HA 2W8KA 4ZNCA 4ZS6A 1ZRTD 3AJ2A 4K7QA 3W1YC 5H9EJ 3IR9A 1X60A 4WU2A 2EBGA 2ZFHA 1LXNA 2RUSA 4CLPA 1AA1B 4KBIA 3MM9A 2HYIB 2FYUE 2JWNA 3B8HA 1GNKA 3D70A 4NXNF 3AFGA 5HVHA 3OW2O 1FWKA 3R5GA 4B9LA 3LALA 3PR4A 3LP2B 3OXFA 3K5MA 5KG3A 1SVDA 3B6BA 1PGJA 2BABA 2KRBA 3IM9A 3I55S 2WSCC 1MV8A 3MGJA 4GKKJ 5KAFH 2FJEB 4RUAA 4LF6J 4UY85 3FZBA 4DR3J 3MUVP 2V50A 4NZ0A 3FCHA 1Q8KA 3KZIE 1ZXGA 5CCLA 2RD5C 1HQ2A 2V5HG 5IXUA 1PP9E 3L72E 5KT5A 1NKEA 2A45G 2WSFJ 4KYZA 2WBMA 4NA3A 2QLJB 2RF2A 2OTKE 5J2NA 3PO4A 7FD1A 2MQOA 3RAXA 4AT1B 1X9VA 2J5AA 1Q16B 3A13A 1RWKB 4JI3F 4A8MP 2QRRA 2WZ7A 3LGMA 2WVFA 2R7QA 1I94J 1JTHA 3PZPA 2IDBA 3EFFK 1HF9A 2LDYA 3IGNA 1L3TA 4OWFA 3H1HG 3TRGA 3C16B 4DSEA 3M0DC 4DL7A 1GX6A 2JR8A 3N6NA 1TZ0A 4OGQD 2CPEA 5TISE 1WEZA 4MKBA 3KQGA 4MAKA 2BCCD 1NKCA 4J9SA 4HT5A 4J91A 2B4OA 3DXSX 1G2CB 1VMBA 1JCDA 2E76C 2WSCJ 1S9GA 3DRPB 4ITSA 2HNDA 4Y2IA 3IFMA 1DZ5A 2FQQB 4WFXA 2OSQA 3LP1B 1NKBA 3U02A 3T5HA 4DL2A 2HR3A 1FRXA 3GFXA 3CGIA 4BC7A 4PPZA 2VL1A 4B3SJ 3EXCX 2KHDA 4LSNA 3E01B 1M1KQ 2GIFA 8AT1B 5IWAJ 4H4KC 3AQPA 1KILD 3M2RA 3CWJA 2GHPA 2VFVA 4XFJA 3M9BA 5CH7B 1HGVA 1YBKA 1U1OA 4W4MA 5K14A 2JJLA 1IBLJ 4WP9A 2CUYA 2E43A 1CJUA 2AV5A 1IK7A 4YHHJ 1SQXD 5DGAA 4HKQA 2B8QA 2DNGA 1JLQA 3W66A 2MKSA 4E8UA 3THTA 4ELUA 3VQTA 1A6LA 1SC1B 1M1JC 4RJTA 5HJYA 2VD3A 1PILA 2LA6A 2IFXA 4CNZA 3TX0A 2HBRB 1KYOE 2IM3A 4CLYA 5LSLA 5D0EA 4OHXA 1Y00A 3IAOA 1SQPK 3AEGC 1F2GA 3I5BA 1VQ8P 3SDEB 4TXSA 4AL5A 4DL3A 4H0LD 4OFZA 4USTA 4OX9F 3ZO7A 1KBRA 4YR0A 1B3TA 2M88A 1PIXA 1L0LD 1FESA 3H42A 4DCJB 5J1EB 4A8FA 1SQPE 5HL7Q 4DV6F 1MMNA 2FJBB 2PD1A 2CADA 2OHDA 1XNRF 3C1LA 1RWUA 1FX4A 1VC5A 2DPJA 1WOSA 4FYVB 3H40A 4O44A 1FK9B 1Q5VA 5L8RC 5DRKA 4CT8A 3BEGB 4Q2MA 5FLXY 4MH8A 3KDOA 1PBAA 3HKZD 2G2OA 2COLA 2WSEJ 2HFNA 2KXFA 2AP6A 4UB8E 1OIPA 3PP5A 2IDLA 1RF1B 3U27A 3A3OB 3CCTA 4PYAA 2W7OA 3PYGA 1RDRA 4GVBA 4B3MF 2E1CA 1HHQA 2BE2B 2HS3A 2CPDA 5L1IA 2KJVA 4PUOB 2YNIB 3N28A 1KSPA 3TSIA 1PGZA 3SFEC 2B43A 4WKYA 1S9KE 2YKNA 1S1WB 3PXGa 4P9SA 3BRTB 5D4LA 2W7PA 2BR0A 5JJBA 2V6AA 1WACA 2RS2A 3BPSP 2WB1D 1ZETA 4DV5F 1IFNA 4M5DB 4RW8B 1PJ6A 5IM0B 2QM8A 2VC1A 4ES3A 2A45I 4DV3F 2E9TA 3GILA 1M8OB 1R8BA 2CQBA 1VJWA 3GCXP 3GLJA 4LR8A 1WHXA 1E6VB 3PEJA 2IAJA 3VALA 4DV1J 4ZCKA 4PEOA 2BZ2A 4P7TA 3U59A 2BRKA 4QIEA 1VRUB 4DQIA 2N82B 5F9LA 5GADI 2QVAA 4K4WA 2FB0A 4YY3J 3GFHA 3FVYA 2E7WA 5HVFA 1U7JA 1RAFB 4HH0A 1PL5A 2ZJRQ 3DOMB 3AD7C 2WVEA 4NLVA 1NU1J 2YWHA 2HRYA 2CG4A 4F04B 3L09A 1SFCA 1R5SA 3BYRA 4F67A 1VQ5S 5ETOA 5MAOA 5KFGA 1KQGB 3KNAA 3R7NB 2ZOGA 4NCGA 1UIIA 5HO4A 2QIFA 2R44A 2M8HA 1QD1A 2EWHA 4KHPF 4MKYA 2IBZE 3GF7A 1XJWB 1JMMA 3VMYA 5M1BA 4ANDA 1TU3F 4F50A 3CIMA 2W8LA 2ZOFA 1GK4A 3LGNA 5CYJA 2XWXA 3B4DA 4I68A 3S6EA 3IS9B 2HKEA 4DWIA 2JVRA 2A06E 5B0CA 4CTAA 4RLEA 3I32A 2RKIB 4ZCLA 2KZJA 2HWHA 3GIIA 2FZKB 4GKJJ 3DHXA 2DJWA 3ITKA 2Q3IA 3IBFB 4AYBD 1FD2A 2I1KA 3EDRB 3PYFA 3OTBA 3ITHA 4CYUA 3BDPA 1IM6A 3RRKA 2B8PA 4DF8A 1VIOA 1SQQJ 4K0KF 4QWAA 3G6YA 4U3FJ 3R2DJ 3TUZC 1IO4A 1NJWA 2UUAJ 2XMVA 3PO5A 1X4EA 1SS1A 1RAEB 4NYPA 1N6QB 1YZ7A 4QMAA 1HGZA 3BN7A 2HFOA 5SZTA 1QAXA 3OR1A 3AB4B 3MFIA 4EIJA 1S72P 4F36A 2ABYA 1QAJA 1RF1C 2RHQB 4YDXA 2PEHA 1PJ7A 1VQKP 4TVAB 4NLOA 3GP9A 5EWFA 3MOJB 2PFXA 2XLIA 3H1JE 1FA0A 4LFAF 4BS2A 2FGOA 4IOBA 4PCQA 2ZZTA 2GA1A 4HHJA 2R2SA 5GMKa 2Z2YB 3KJVA 4QR1A 1R6VA 2GO9A 2M3EA 3HHLB 1KHWA 4DPWA 5KFOA 2ZH3A 2ZOMA 4A8KA 3CDUA 2GJFA 1P1LA 1Q8BA 1U1NA 1NB2A 4FZVA 3U7JA 4C0OC 2MHEA 2OARA 4W7YA 4F3QA 5KAIH 1EETB 3IR6B 2I38A 2EK6A 4O4GB 2KNCB 2QEXP 4WTOB 1URQA 3ZC4A 1OW7A 4X4TA 3KK2A 2ASYA 3NNAA 5IC4B 2GVZA 2BJ3A 1NOHA 3HSJA 2XCAA 4FS1A 3SZ2A 4LRCA 3BO2A 4RX6A 2Y8YA 3T5JA 2F40A 4O3PA 2B3TB 3DYAB 1M5KC 1JLBA 2YMKA 3K5BA 1X5TA 4DV7J 2IC3A 3AOCA 3FBBA 3PW5A 2B7CB 3V4IB 4ZVFA 2MHNA 3D6MB 2FVSA 4JYBA 1VR6A 5AE3A 1VQ6P 1JLCA 4YN3B 3FWNA 1U1RA 2P9CA 1ZAVA 1SQQG 2IMWP 1YSJA 3CTRA 3JXOA 1VPCA 3ET6A 3R6GB 3UCGA 3AECC 2BBEA 3N4WA 3MMBB 1N5QA 2QG4A 3MHVA 1HQEB 4ETZA 1UJ4A 1OIAA 3CLQA 2KG0A 1TELA 1F9FA 1GT8A 3MM5A 2AXTE 1FFWB 1RLDA 5LSRA 4KTQA 2JP3A 2NUHA 3HJFA 4JI0J 4DR2F 1FZBA 3L70D 1UFWA 4OZ5A 4WE1A 4LF5J 2PSZA 3K0JA 2HAFA 4U8YA 5E79H 1HNIA 5H2FE 3DNCA 2A18A 1D7MA 3H25A 2RU9A 4IFDK 1C1CA 2VG6B 1KC8T 5AVWB 1RTZA 1CVJA 4XO0A 4KHMA 1IBMJ 3N01A 2IFNA 3E7KA 4H4OA 2X1GA 1HHSA 1Q81Q 3MPUB 3OQ2A 1LK5A