1KQGB

Formate dehydrogenase n from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 89
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqgB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqgB02
4XDCA 1KQGB 3MMCB 2VPWB 4YDDB 2FJBB 2GMJA 2VPXB 3MM6B 1FEHA 3MM8A 1B0PA 1JB0C 3OR2A 4CI0B 1FDBA 7FD1A 2WSCC 1FRXA 1D3WA 1FCAA 1BLUA 1FRIA 4XK8C 1G3OA 6FDRA 2C3PA 2VPYB 7FDRA 1BWEA 1H7XA 2O01C 2UZAA 3MM6A 4DHVA 2PDAA 3MMAB 1F5BA 2WB1D 1RGVA 2ZVSA 1FXRA 3MM7B 1GAOA 2GMHA 4OV1A 2FJEB 3OR1A 3EGWB 1SJ1A 3C8YA 3MMAA 3MMBB 5BYQA 1B0TA 1G6BA 2C3UA 1FDDA 4Y28C 1FXDA 1F2GA 2VPZB 1FERA 2V4JB 4L6V3 1FF2A 1H7WA 3MMCA 2FD2A 3IR6B 1CLFA 5BYSA 1SIZA 2WAQD 1WTFA 1DAXA 2Y0SD 1KEKA 2WSEC 1GT8A 2XSJB 1XERA 5BYRA 1IQZA 2Z8QA 1C4CA 1H0HB 1H98A 3HKZD 1PC4A 2FGOA 1FDAA 1HFEL 3MM9B 1AXQA 2IVFB 1BD6A 5FD1A 3MM5B 1F5CA 1Y5NB 2C3OA 2PA8D 2C3MA 5CH7B 3MM7A 1FTCA 3LW5C 1GTEA 3GYXB 6FD1A 1Y5IB 1ROFA 2VKRA 3MM9A 2C42A 4AYBD 5CHCB 3MM8B 3MMBA 3IR7B 4OMFG 4XDDA 3OR2B 5E7OB 1FRHA 2C3YA 1FD2A 1K0TA 1FDNA 1Q16B 2V4JA 1FRJA 3PNIA 1VJWA 1BC6A 1B0VA 1SIWB 3EUNA 1BQXA 1FRMA 5L8RC 1DURA 2V2KA 1GTHA 1KQFB 2FJDB 3IR5B 2XSJA 1C4AA 3EXYA 1DFDA 2FDNA 4ID8A 1FRLA 2FJAB 3OR1B 1A6LA 1PC5A 4RKUC 1JNRB 1FRKA 1Y4ZB 2PMZD 2WSFC 4KT0C 1IR0A 1Y5LB 3MM5A 1R27B 1JNZB
chains in the Genus database with same CATH superfamily
1GFWB 2VPWB 2F8HA 4EOTA 4LFCJ 3WZ0A 5AW6B 4QOTA 1JJ4A 2DEIA 3MM8A 1X4BA 1VF5D 4WY4D 1BCCG 4DPTA 2H4YB 1UWAA 2YH1A 2HPUA 4NA3A 2DHAA 3MEGB 2X1GA 2ZOGA 4OHXA 3TSIA 3KNAA 1RWWB 4KY3A 4QWEA 2VBYA 3CT9A 3J7A1 3M8RA 3MFHA 1TVRA 2I1KA 1PV3A 1SQBE 3KLGB 2VODA 3TQEA 2CQDA 1EQMA 3L74E 1NU4A 1FZCC 1HI8A 3I9ZA 1NO8A 2O5DA 2ERRA 1FKAF 2EFGA 4J9NA 2VHGA 5FDLA 1KV4A 3BPSP 2XZTB 2JOQA 2LXBA 4RW6A 2D2CC 3EM1A 2DR9A 5G4DA 4ZOSA 1X7VA 4H4OA 4QMAA 3T1HJ 3FWNA 2RKLA 2K3RA 3H1ID 3KLIA 4XPCA 3Q24A 4RKUC 1T0TV 1RAAB 1U1MA 5HSPA 1R3NA 5GVQA 5DO2A 3OLAA 4HI2A 3FWLA 3BRVB 1EP4B 2K3IA 4JB8B 3DGVA 3N79A 2N1TD 4IFFA 1WI6A 2XMTA 2XO7A 1JEKA 1HKAA 1F3VA 1HVVA 2E75B 4J9LA 1EZVI 5I3UA 4KBIA 3JS9A 2YO3A 2JWDA 4Q2LA 4DPWA 4ZP7A 3VTPC 1HBMA 2ZHOA 1JMTA 4QYZJ 2HHQA 3KK2B 3CW2C 2M7SA 2QSFA 3H5SA 3MPUB 1DEEG 1NGMB 1LGHB 1LWXA 2X1AA 4ECUA 1VDFA 5CYQB 3H32A 3SYZA 1DAXA 1WWHA 4M3LA 2PO4A 3TW0A 2EEYA 2Z8QA 4K7QA 3CULA 2H43A 1WKLA 3IRXB 4PYDA 4HLBA 1GW4A 2LQ8A 3J80Y 5CH7B 5KFCA 5ETLA 2MKKA 4FN5A 1S9KD 3CCZA 4V19J 2PRRA 4OMFG 3HULA 1K0VA 4W90B 3HD7D 2P6SA 3TR5A 3J7YU 2E75C 5HQLA 3R9LA 5AW8B 4JI4J 4ICLB 3D28A 2E42A 1DTTB 2IYOA 2QO3A 5KLVJ 1KILE 4ILMA 2XEXA 2XHCA 1NCLA 3QT6A 2VBZA 3UD3P 2YX7A 5AT1B 4CO3A 5KFJA 5D3GA 2HRUA 4NZ7A 3TNVA 5IWAF 3FQLA 1KTMA 1A0OB 4K2JA 4X64F 4YHHJ 5A8RB 4KV8A 4MKVA 3KHLA 3OTEA 3EQ2A 2JFKA 2ZVSA 3HF5A 3V6IA 4LSNA 2ZUGA 1X60A 4UB8H 2XCAA 3JTNA 5CCHA 2K9YA 1YRUA 2J7WA 2UVWA 4YY3J 2E7VA 2Q3IA 2ZH2A 2RQCA 2NXJA 2ASDA 1RE1B 2ZH8A 2I1RA 2J6UA 4NPEA 2MTLA 5K5GB 4NCAA 3NP5A 1YVFA 3R5GA 4K5SA 1RAIB 1NTME 1EC5A 2NPSC 2XMKA 2W7PA 2J5UA 1SQGA 2IZ1A 3KMQA 5AVWB 1KSPA 3MM7A 4AYCA 1VRUB 2KKHA 1REVB 1ZZFA 2DNHA 3OA7A 3B5NB 2OSQA 5AE1A 4WFNQ 4DS4A 1C1CB 3TOQA 4Y99C 3QZ7A 2DYAA 5KAFH 4RUHA 3CJKB 1T9TA 1N2DC 1KVKA 4USMA 2EKYA 1N54B 3R5DA 3Q1MA 4OYAA 1ZPWX 1D9AA 4ID8A 1CULA 4BRYB 2ACYA 3ZFVA 3MCOA 4QWAA 1X0FA 2KT5A 2E76D 3TP2A 4KT0C 2JJLA 4C11B 3BB5A 3MD0A 4DL2A 1SQXJ 3TA2A 4YTPC 2CPBA 2GMJA 1PCAA 3I82A 1JWWA 2MKSA 3LP0A 1N5YB 2YXRB 3L71J 2ALYB 1S6UA 1RTDA 1DTQB 4WXOA 2MLXA 4KHPF 3T5JA 1CJTB 1UW4A 3B5NC 3PVXA 3EDRB 5APSA 1AYEA 4K4YA 2HIYA 5L8RJ 4EFAC 4XIUA 3PZPA 1VISA 5B0BA 3Q8VA 1Q82Q 1U1PA 4I4BA 1FWLA 1IKVB 4IUFA 1JXLA 2ASJA 4KRWA 4LF9J 2RJZA 3ENWA 3JC22 2V67A 1PBAA 3W64A 1NTKJ 4I2PB 2W8KA 4CLYA 1R6VA 3MR6A 3IN6A 4BWMA 1WMKA 2C2MB 1J1EB 4P2MA 2VA2A 3A8EA 2O01J 2R2SA 2IVMA 2HQ3A 4KH1B 3HTKA 2LQ5A 2NSCA 1X0PA 3T6JA 4KQZA 4F7VA 1GZLA 1YI2P 3TAMB 4GVBB 2N4DA 3TZXA 2BACA 3GFYA 1XR6A 1NK0A 4DQPA 1J27A 1PILA 3UW1A 1FZCA 3W2WB 3VYIA 3BDEA 4P71A 4PWWA 2CUYA 1S59A 3RRHA 3BSOA 3DMJA 2E1MC 4TLQA 4JI8F 3C3LA 5LSRA 2BJ9A 3EVOA 3NMDA 1NNDA 1L0LJ 2ROPA 1I94J 3FEXB 5F3ZA 1DH3A 3TNUA 3Q3DA 4URGA 1NK9A 1RQUA 4GRSA 2I1JA 1T9UA 1S9FA 1OS5A 2WBMA 4LRAA 4L6V3 2FC8A 2VV5A 2QJ3A 4DJBA 1XNRJ 1HBWA 4EO6A 1D09B 2JEEA 5APUA 1SVFA 2JP3A 3PJ9A 1P6TA 1NZAA 1KILD 4RBVA 3KLGA 2VOOA 3GMAA 3QT5A 3RAQA 4RW9B 2HVEA 1F5CA 2XCPA 1PSDA 1RHQB 4WZMA 1WELA 1Y9OA 2HK3A 3H1JG 2HWTA 1H2TZ 2YKNB 5F9LA 5J1NA 3VGVA 4MJKA 4HL9A 4QYZK 1NTZG 4OYWA 4C8MA 2LDIA 3G82B 4OV6A 1Q86Q 2ZZTA 3CXHE 5E0OA 1QTNB 4ZLLA 3L35A 4N76A 3JSMB 4U7JA 2ZH3A 3E7KA 3D5MA 1XC9A 1WHWA 1ZP0C 3FJ2A 4I6WA 2WVFA 1HPZA 2R8GA 2B87B 2JLGA 2WSCC 1NTMD 2ZC4A 2PMHA 4KGKA 3J7AN 3RK2B 3M1VB 3LP1B 2PDAA 1RYSA 3HVTB 2AYGA 4YP3A 2ALZA 5GAEU 4PQUB 1RHUB 4IRDA 3L73E 1TV6B 5HO4A 1N5TA 3AXMA 4A48A 4CNYA 1BQNB 4B3RJ 4JI1J 2E29A 3CCJP 3QAUA 1JKHB 3KK2A 1FZBA 5L39A 1VRTB 4DR5F 5KLVK 2K1RB 4M94A 1FJKA 1KFMA 3W9HA 3BM7A 5CYQA 2RB7A 4B3SJ 3NCRA 3M9MB 1NU1E 2FFDB 3ZO7A 2KLUA 5KFOA 1AVOA 3ZZZA 4FDFA 1ZAXA 4PWDB 2O3JA 1XR5A 1AB8A 3HSZA 4UZCA 1FZEA 2VZ9A 5HQMA 1KFDA 5CYJA 2CJYB 2EFVA 1K0TA 2HAIA 5K5MA 2FLLA 4C0HA 2I38A 2IJNA 1BDDA 3MD1A 4ICLA 1DTTA 2P10A 3CL3D 3Q8UA 5AXLA 4FF4A 2OI2A 4IYQA 1M0SA 3I5AA 3CC4S 4NXMJ 2L9NA 2NPSA 1NKZB 1VQ7P 4ZIVA 4DXLA 4I1TA 3EX7B 1WUUA 3MI7X 5T7LB 4RNFA 3FNNA 1HGVA 2F63A 3AEEC 4CIOA 2M52A 2UXBF 3J7Z5 3POTB 3OV7A 3TVYA 4I7FB 1O6XA 2DXDA 1FD8A 1AV1A 2MZ1A 1R8AA 1KFSA 3CWBE 1S0NA 1D0EA 2BJ1A 2IDEA 2L08A 1V6HA 1KORA 2KFYA 2YNFA 4DCKA 2YBVA 2EK6A 3WMM0 4OGQB 4ID5B 5IOLA 2Y1IA 2KSEA 3OT9A 5EUHA 2NREA 1WC6A 4OQJA 1SQXK 1FVSA 4IO9Q 1RT7B 1LOUA 3HXMA 2DGSA 3VOPA 1PGZA 1KFNA 1VHFA 3H25A 1U0HA 1VK3A 4QR1A 1B7FA 2MLYA 4F26A 1ZPVA 1K47A 4CO2A 1K05A 3B5NA 1J5OB 1C1CA 3R5AA 1R8PA 3CJKA 5HMZA 2KL8A 1AUDA 3OUYB 3F56A 3GE9A 4WTYA 1LTTC 2J9CA 2MQLA 5IC6B 4ZS6A 4ZJOA 4CLPA 2ZNYA 4BRYA 1GDTA 1HBUB 2MYFA 1X0TA 3O8ZA 3WHIA 2FVCA 4NYPA 3N6NA 2FXOA 2UUBJ 4OI6A 4FYXB 2CG4A 2MGZA 3TZYA 3AD9C 3K0JA 2V9KA 3TEHB 3H4BA 2OKQA 2LLZA 1CJTA 5F0WA 3PX6A 4W92B 1F9EB 3HD2A 3EE3A 2QIWA 4NLWA 2KRRA 4DSEA 5B08A 1UL3A 3FRYA 3R2CJ 1T3UA 2DRDA 1RT2A 2HGMA 2DR7A 3NOCA 2R7UA 4G1PA 3VZHA 3H6PA 3CXHD 9RUBA 1SPBP 5IM0A 3MUDC 2B8QA 2O01H 3BR9A 1Q5YA 3F5HA 4U67Q 2IX7C 1U47A 5LMUF 2A06G 1N8RT 1BE3J 2WW4A 3SDEB 4C4WA 1L0LK 1JOCA 4RW8B 1IFPA 2R2RA 3Q23A 2MZSA 1U1RA 4AL5A 1D8ZA 2FJAB 1SQPJ 1SP4A 2HQFA 3EGNA 3ENVA 1VIXA 2YX4A 2QL9B 3TAMA 4I68A 1FKPA 1RP5A 2D3O1 4X4NA 2VPXB 2DR5A 2K88A 1T9VA 1M5SA 1OPZA 2EKNA 2KS1B 1N5VA 1D9DA 1NU1D 1GW3A 2HQGA 2YXQB 5AVQB 4MK7A 2CPHA 4DV5F 3V4MA 2QE7H 1LQ9A 3H7HB 4LF5F 3TARA 3DRYA 1WF0A 1EZZB 1Q81Q 4CLSA 5ETQA 4FP9A 2G3AA 2EK1A 4OZ3A 4EGLA 5J2QA 3GW6A 3L72E 1MROA 1GMWA 1JUNA 2XGQA 5HBMB 3HE5B 3KYQA 1ZOYC 3CI9A 1SIZA 3SV3A 4O4GB 1XTGB 2IA0A 2J7UA 3MD3A 2CQ3A 2MZJA 1Q1KA 5H2FE 1T05B 4QW9A 2PSZA 3TJAA 1MMLA 1HQEB 5KFSA 3DXBA 4Z2XA 3CMEP 2FC9A 1LEOA 1FX2A 3ZTQA 4HHUA 3DI6B 3GYXB 2VQFJ 2XO6A 3SFDC 2R3SA 1S77D 3MAAB 3QWPA 2NXUA 3O44A 1U8WA 3I6PA 2KTQA 3Q2SC 2D7SA 1QEXA 3DRRB 2CJ9A 1TTHB 1ZW0A 1RI7A 5JXSA 3FQKA 2M88A 2CVEA 2V2QA 3CPWO 3H42A 4NLTA 1VGYA 4LF8J 2K2PA 2WW8A 3PW4A 3HHLB 3NGSA 3ZZUA 3AOCA 2A1BA 1WT6A 3KJFB 1RE3C 3OR2A 1R8BA 4FS1A 3T1YF 2LKMA 1VK8A 2D69A 4ZPTR 1P84H 3AFGA 2B87A 4AQYJ 4FPRA 4AQRD 3MTKA 3BGLA 4Z7YA 2FJEB 1H89A 1K9MT 1VYAA 4DSIA 3ZC4A 3BJYA 2YWGA 1DQAA 4FKYA 3HVTA 4OZ2A 4MKBA 2AKWB 3UCUP 1RWNB 2RVJA 4PXDA 3OTOF 3IM8A 4PXEA 4OWFA 3PRDA 4B3OB 3W60A 2IFNA 3MUTP 3CC7S 1TL3B 2FLOA 1TUVA 1SL1A 2FHJA 3BRTB 5DLFA 1D1UA 1J2VA 2JEIA 2EWHA 3TEGA 2K1RA 1CBKA 1U7MA 2WSSH 2H8PD 2POKA 2VG6B 3RBXA 2ZHBA 1NM2A 4IQXA 3UE2A 1JMBA 2CFXA 3LA0A 4CH0S 1ZXGA 1S6PB 5AJ3F 1B0VA 4RL1A 1LP1B 1GL2D 3M9QA 4B9MA 3VAKA 3Q8RB 4U8YA 1SKRA 3EPGA 2FYUK 1MN7A 2BOAA 2R7TA 1GU5A 2RS2A 4NLSA 4BDPA 1S9EB 1KYOE 1QM9A 4WIIA 4CH7A 1LJ2A 5ETRA 2CAJA 3USSA 4Y2IA 3T9NA 1JIHA 1G3OA 1NPPA 2YWFA 2GA7A 4BBYA 2FYNB 1IK9A 4L3KA 5FIIA 1GAOA 3BPDA 4OZLA 1F0XA 3VGSA 1VS3A 3TO8A 4NMXA 4X4QA 2V4HA 3PHTA 1SJ1A 2YKAA 4L72B 2RQMA 3MPWA 1F1BB 3POTA 2H5JB 1NZ8A 2HK2A 1Z4UA 4I7FA 1WF2A 1OJ4A 1RADB 1IBLJ 2KHCA 2UV8G 2Z5HA 2XLKA 4PXBA 2HZVA 5HK4A 4F4WA 3OBIA 4ED5A 4WF9Q 4D3GA 5DGAA 3D6ZA 5KLVG 2W2NP 2W2QP 2KSJA 4DV3F 4DF4A 3NAIA 2MKHA 2Z58B 2DR8A 5ETSA 2CJAA 1ZM9A 3MR3A 4H4MA 5ADZA 3QBCA 2HWHA 3ET6B 1ZMEC 3BF4A 4ZVQB 2BASA 1GTHA 4FXWA 3JTPA 2VFRA 4MK8A 4PPDA 1Y3KA 2JWAA 1TL4A 1RUSA 3BCCE 1F6TA 3K7RA 1FNMA 2ZJRQ 4GDOA 4RO0A 5LT5A 3BO3A 4X4RA 4QZVB 2BCCG 3UVJB 1V3ZA 1IKXB 4CO5A 3L36A 3M9HA 3MUDA 1S99A 2CKWA 1N33J 3S01A 3VAIA 4FPIA 1EXIA 2KG0A 4DR4F 2I8EA 2WSEH 1EJ7L 2QLBB 1W5CE 2JEFA 2KHDA 4P73A 2RHSB 3OJAB 3VTIA 4M5DB 2UXCJ 4OYOA 1HJBA 2BR0A 4ZJQA 3NXZA 3RL0g 1LW2A 3IFEA 1EETA 1FNOA 3GJTB 2EW9A 4CO1A 2HHHF 1JLAB 1SQPK 3HKZD 2FGOA 2E76C 2WTFA 4LRCA 4UB8E 1VQ9S 5HI7A 4AUKA 3FX0A 3H1KD 6FD1A 3CJSA 1RT6B 4NPDA 1EIYB 1EDJA 1S4EA 4E98A 5CAAA 4E2FB 3H1IJ 2KYZA 2FZKB 3N5BA 3NWGA 1U1KA 2HBRB 3LTOA 1MLAA 3KUGA 3MTUE 2WVEA 2EG2A 1IWAA 1MMNA 2BMBA 1FI4A 4Q0BA 4WP9A 4I7ZC 3AEFC 4DSJA 5KAFE 2Z30B 2XMUA 2OQQA 2X1FA 7FDRA 3KK1B 2XMMA 5KTBA 1RCXB 2KIKA 1XWLA 2BA9A 1ZM4A 2NYHA 3HHEA 4MIAA 3QJPA 3NG8A 3WUTA 1XMQJ 1T7PA 1NO4A 2QX0A 4ILLA 3M9NB 4WCEQ 1PBUA 1PZQA 5HBMA 1H0HB 4Q45A 1F2HA 1RWOB 1QE1B 2KB7P 4O4GA 3I9V9 4C3MA 4OYMA 2HGLA 1RE3A 1KYOD 2QSWA 1RA7A 1S1VB 1JXEA 3E1RA 4NLYA 2PEBA 4LF1A 1NEEA 1KQSO 4WPAA 3PYEA 3C15B 2YNIA 2IRYA 1QL2A 2ATCB 5C42A 2M3BA 3RGUA 1CC7A 2HFVA 2DNGA 3P96A 4QIGA 1ZAWA 1L4AD 2CVIA 2Y0EA 3VMXA 4HACA 4JV5F 1OIPA 1T3OA 2M8HA 4N8NA 1AJYA 1JLGA 4WBFA 1PAEX 4S0MA 2RUGA 3SWYA 1FRIA 2NUHA 2JH3A 2PEHA 3D71A 4CO4A 4YHHF 3HFZB 2C3PA 2HFSA 3NGKA 3TZWA 2E7WA 4O3SA 2FHKA 2XS2A 2ZXEB 2PGCA 2OIHA 3W67A 3SMZA 3VF0B 2F3JA 3Q8QB 3EVMA 1FERA 2H88C 3N28A 3VQTA 4YB7A 1E79H 1HW9A 1M1JB 2KM8C 1WEZA 2K06A 2B89A 2LKZA 3CD0A 3ZTRA 2LEPA 4I69A 1EAYC 3L4BC 3P5TL 2KYXA 4KR0B 5HMXA 3A1YG 1CI6B 4LC1A 2IA6A 3ZZYA 2HAFA 2KXHA 4KH0B 1B70B 2W01A 3GONA 1JB0J 1XMOJ 4B3MF 4KKOB 2EBEA 3CD7A 1IN0A 2W2MP 2ZAEB 3WX8A 3H59A 4RJTA 3S4RA 2VG6A 3G6XA 5AVXB 1EX8A 4ZVUB 1SQBJ 1NUEA 2V4RA 2H3EB 3WU2E 4CM0A 2HWIA 3CCRS 1N8RQ 3L74J 3I31A 1VR6A 1N88A 3V2NA 1WF1A 4EYHB 3A13A 4CI0B 3M2VB 5GAGI 3L70E 5A2QU 3RZAA 3K5OA 1JMMA 3CJTA 4NCGB 2N4CA 3BZQA 3MMAB 2CNOB 1JCCA 1SJRA 4RNHA 5ETNA 4XFJA 3Q8PB 4PZVA 3Q8YA 4USWA 1SC6A 3QO9B 4ED1A 2RRBA 4J9MA 4ZHRB 2J9EA 3LQVA 1SC3B 1J1DB 4C8YA 3W1YC 3KFWX 5A76A 2HGNA 4LF4F 1K04A 3HZEA 4DU8A 3RK3E 2H51B 2VASA 2JVOA 4C98A 1UFWA 3H2LA 4M1KA 5KT3A 3M32A 3RK3B 1HR0J 1N7SB 5D0GA 1FOSF 2DNKA 4P72A 4KTQA 5KOWA 2UVVA 1R0AB 5L1IA 1N6QA 1M7LA 3NTNA 5CMZA 2ZBPA 2HVDA 1BQMB 3QWOC 4KE5A 3LUYA 1PPJG 3PNIA 2Q6QA 3UO0A 3QWUA 1IR1A 3H0PA 3R4YA 1HF9A 3M6VA 1HWIA 2GCFA 3P49B 5CCLA 2EBGA 2D9PA 2A18A 3R7NB 3GYGA 2PFXA 3Q2TC 5KFEA 2WSFC 1M1KT 1J1DC 2E5LF 3W9IA 1MFTA 4LBHA 1CJVB 2XMAA 4AL6A 3GSIA 2GX8A 2ZM6F 1NJZA 4F4AA 4M5HA 3QRRA 2FYUG 1JM0A 3VAJA 4WK1A 4CP5A 5D8HB 1UZHA 1Q95G 2LXUA 3UVJA 5KFZA 3W9JA 3AD7C 3R97A 4IKAA 2QN6B 1T9WA 1I94F 4BWNA 2VC1A 4F2RA 5HN0A 4K59A 3CX5I 3CCRP 4CZCA 3CDEA 1T11A 3X1LB 4HTJA 2MQOA 2FKWB 1EKRA 2WK4A 4M5DA 4A8OA 3AEBC 2BUNA 3D9BA 5KJ7D 1K9MQ 3THTA 3TUIC 4XTTA 5L1KA 4WFYA 2GNKA 5F8IA 1YQ3C 2GHWA 1KC8T 2ZVIA 1N56A 1NPKA 1WG5A 4UY8T 1S72S 1ZH5A 2DNZA 2R8KA 5GADI 1S97A 4BHQA 2P9EA 2O1PA 4PV1D 2ZDOA 2GQ2A 4V1Ak 2CXEA 1YJNP 2JO1A 4QCLA 3FCWA 4IH7A 3E01A 1H2VZ 1VQ6P 4IR1A 1NSKL 1DFDA 4N8OA 4JOUA 4GKJJ 3ONQA 2OARA 1RF1C 1Q53A 4HTIA 2C1EB 1Y9BA 1AZSB 1NTMJ 1FDOA 4K4VA 1VL2A 4GMKA 1T94A 5B0FA 1TMMA 1VLYA 2A45H 1Z2ZA 1IFDA 4DL7A 1UW9A 2BOPA 3C14B 3TVZA 1WORA 2DITA 4DZOA 2GMHA 3G6YA 3T9ZA 3KK1A 2VDIA 3MMBB 4J5OA 5C24B 2IBZD 2V4JB 3HSJA 4Q44A 2P7JA 3FZBA 4KC5A 3NWRA 3MZIA 2CPJA 2ZE2B 1S48A 3HPOA 3IBWA 1S0VA 1T2KD 3KHHA 2O66A 2YO2A 1ZBTA 4I2QA 1X79B 1HHSA 1VBZA 1HWLA 4G6VB 1YJVA 4R0JA 4USTA 1H73A 1JCDA 4NASA 2V7QJ 4A8FA 2M5AB 3OTDA 3R7SB 2FB0A 1SQPG 2ZJPQ 3DKDA 1K1SA 3GIKA 2B88A 3BN7A 2C0XA 1U1NA 1NSAA 1FNXH 4ZVTB 2QFIA 1X4EA 2CQPA 2HMIB 3H5XA 4GKKJ 1S5ZA 1FXLA 1ZLLA 4ED4A 3UN3A 3CJRA 4USVA 2HFUA 2V50A 1S72P 2GHPA 2D3OR 3AODA 3ZTSA 3PFEA 4FYWB 4FF3A 3IAM9 1U25A 2W4PA 4KAIA 4KGVB 4HYTB 3NNAA 1FEEA 1UPMB 1TKZA 5FLXY 1BWEA 1NAYA 4Y34A 3AOAA 1S1WB 2GZOA 1QX8A 4YEAA 3AE7C 2MQNA 3OR1A 5K8MA 4DFPA 4I56A 2W6AA 4NLQA 3T1AA 4CTAA 2XWXA 4L76A 1QLNA 1GT8A 2JDJA 1W2BO 2CJQA 2KI7B 1WNEA 4MYTA 1FKOB 2D3UA 1U1QA 3CO9A 5LXRA 3D6YA 3H1HE 3M8SA 2WOMA 2W8LA 5F8GA 1S76D 4H44B 4PYAA 1CI6A 1CJKB 4HHJA 4DV4J 2CA9A 3KXDA 3B4DA 1HYSA 1RCOB 2G8YA 2KXNB 2AYBA 4RUBA 2IM3A 3M8WA 1VC0A 5E2QA 3A8KA 3OQ2A 1X4GA 2G1HA 1JY3P 3TX0A 2AU0A 1U6FA 4I6YA 2DCLA 1K73T 1R5SA 3GF3A 3HT0A 1K44A 3DLBA 2B3TB 4DL3A 1LXJA 2EVZA 4IO1A 1BGYE 1SFCB 2BEQD 4JYAF 1OW7A 1MU2B 1X5PA 2LU2A 1N34J 2XGPA 3LAMA 2DR6A 1P8GA 2UUBF 2B9XA 3K8VA 2QJPC 2GAHC 3M2VA 1KN7A 1OVUA 3CE8A 3PH0A 3G9CA 2K1AA 2UWJE 1U1OA 1TL7A 3MMAA 4JI0J 3JSVC 5KG6A 4J9UE 2OD6A 2CQ4A 5F8LA 2VFSA 2Q6CA 3DLJA 2WONB 1GL2C 3QO9A 4X62J 1RU2A 4ZHRA 3E2EA 4ZMDA 2C2OB 4TKTA 4URSA 3QGHA 2J6TA 4B3TJ 5GAHI 3ITHB 2DW3A 4O3QA 2BZ2A 2MKCA 1Q7LB 3W5ZA 1PGPA 4JI5J 4PR6A 1UPPA 1U48A 3P3DA 4DI6A 3DLHA 3B6BA 3L73J 1BC6A 2CJBA 1BQMA 4OX8A 2KNCA 2AW0A 1U6BA 4BLGA 3DC2A 1C0UA 1SQXD 4DR2J 1YGYA 2J8AA 3BBBA 2H7HA 5A8WB 4TQRA 3NEKA 3L71D 4EYIB 5JUMA 4IL6H 3M6XA 2EC2A 1FZGA 4KGMA 3OVSA 3SSQA 1NU1J 1KLMA 1SH2A 4ERDA 2XLJA 1H3DA 1UVKA 1FRXA 1CJVA 1FCAA 4H0LB 3K5NA 3OTBA 3U1NA 3LW5J 2GIRA 3IBCB 2VL1A 2F9DA 4USUA 2PA3A 3R5JB 5KFNA 5L38A 1CJUA 4AT1B 3BGRB 1DBDA 4OLPA 3C16B 4HEA9 2OMLA 3E8OA 3V2RA 2A0FB 5LJ5Y 1PGJA 1Y11A 3UWTA 1VHIA 3SSUA 1OSDA 1NTKD 1L0NG 2AJFE 1DZ5A 1RF1A 1REGX 5SUHA 3KG0A 1LTBC 2B9BA 3ENQA 2GMLA 2AX1A 1NTMK 3N4WA 1Y5NB 2ZH7A 3E3XA 3AE5C 4UY85 4TU8A 2WWWA 4GO7X 2HNZA 5GTIE 2QMXA 1IJDB 2KFZA 2IRUA 3H1JE 1HBNB 1FK9B 4H0LC 4H13D 5D4OA 5ETPA 2WMMA 1DHMA 1URQB 4CQ1A 3GJSB 4OJ3A 4LREA 4R25A 3TUPA 3GLJA 2BKNA 2E74D 2BE9B 1HNVB 1OWAA 3SQGA 1NTZE 5JMNA 1NHLA 4F4ZA 4X66F 1S3JA 2W9AA 3UFCX 1N73C 5IV3A 4WE1B 2HNDA 2MHEA 1RT5B 3CCMP 3M9OB 5F9NA 1DX7A 5A0YA 2Z2YB 2XSFA 2W83C 3BSAA 4DBQA 2YKQA 5KAKA 4B9NA 3PV8A 1AZSA 4F3MA 1S0MA 4IG0A 1U6ZA 2FLNA 3EGZA 2E1RA 4KFBA 2B7BB 5DQHA 3L7UA 4A4JA 4H44D 3H1HD 4UB6E 1IFIA 2ZOFA 4FZVA 1D7MA 2N3OA 1J5EJ 2J9DE 3SFEC 4OI1A 1B64A 3C6TB 3HJVA 4EBEA 3D66A 3MTJA 1WG1A 2NPFA 2OGUA 1RAJA 3BGOP 2ZXXA 3ZZRA 4NEZA 3V4IB 2HHVA 4DN9A 1URNA 4NCBA 3H1IG 4RBUA 2CPXA 2KP8A 4IG3A 2GVZB 4IRKA 1RLDA 2VH7A 2JDIH 1Q79A 5T41A 5KG7A 5KFXA 2B4VA 3CLQA 1FTCA 1GTEA 5CCGD 3DLKB 3HKWA 3KK3A 2E1PA 4C0BA 3P7KA 1BGYD 2WT7B 2QTWA 3RAMA 2HPCB 2R7SA 4AE5A 4CYUB 1KRPA 1Q8KA 3BH6B 5MLCV 4JQ0D 1V3RA 3PEHA 1BSHA 3A8IA 5CZXA 3IF4A 1HNZF 2AV5A 2M0BA 1H8AA 4ETXA 2HMIA 1F60B 2SXLA 3CCUS 4ZLJA 1UMJA 3QNWB 3BV8A 3F41A 5DDQC 4YR3A 2XB2D 1W25A 1P84D 3VP8A 5HP1B 5A6PA 2WPRA 1IKYB 1M1KQ 2GUVA 4U6PA 1HNXF 3V6HA 5D0RA 2Y1JA 2DNOA 3CCVS 2JZ5A 4IFMA 3N7NA 2HFZA 2VJVA 4ANCA 5DM6Q 1EDLA 3CMAS 1A9NB 4Y28C 2HZAA 4IOBA 4Y00A 1HNWJ 4DV2J 4UQTA 1H6KX 3DU5A 3NFQA 3KTQA 1RHMB 1FJPA 4ZPAA 2CQ2A 1JJ2R 3Q5SA 4QQBA 1L4AC 1NAQA 3H2UB 5BR8F 4DG1B 1AT1B 1Y5IB 3T5KA 3K17A 1UKUA 1U24A 4X4SA 1HWTC 2RF2B 2UUCJ 1VQSA 5ETKA 4J37A 5KKZC 1RBAA 2MEWA 1KC8Q 2P2CB 1F3FA 1PP9G 2WSCH 2RQ4A 3L72J 5HLFA 2GW8A 5L1JA 1VQ8P 3CJ3A 3I0SB 3L4FA 1GL2A 5C2CA 2X7IA 4ED6A 2HHXA 3PHLA 1RAOA 3AA9A 3UDLA 2QA4G 2NQPA 4UOGA 1RJJA 1TL1B 1LWCB 4ECWA 3O5TB 4K0KF 1JLFB 3ETOA 4TU9A 1UIIA 1U02A 2IJRA 4OHWA 3QMQA 4RNMA 3KDPB 3KLFB 2RNEA 1KOOA 2BKOA 3F89A 2YPZA 1OY9A 3D6TB 2BYCA 3GPAA 1VQ5P 4CLUA 1RT4A 1QL1A 4NLGA 2KVIA 3QIDA 3QQCD 2YPYA 2BANB 3O3LA 1GMJA 2IDLA 1RKJA 1BGXT 3M8PA 1BUXA 3FC9A 1KB9I 1NU1K 1TU3F 3CMAP 4UOFA 1G2CA 3MM8B 2A06E 1C0TA 1ELOA 3JB9k 4PD4I 5GADU 2BE7D 1Y47A 2FJDB 1U1LA 5K9FA 1T6AA 3GR0A 2DCUB 4USIA 3W65A 4LQ9A 4DJGA 1FRLA 1Z2LA 4ZPVR 3M7VA 1VDHA 3I4HX 2NS1B 4KPYA 3MM5A 1R27B 3MHVA 3OHAA 2EFNA 4K50A 3GFXA 2BX6A 3QGIA 1HUCA 4M63A 2BDPA 3LW5H 2RDDA 5A8WA 2OMOA 5B09A 4HB1A 1SXLA 2BKPA 2Y8YA 3HFVA 2AJ2A 4KIAA 1FC2C 2O1JA 4TN2A 2MSSA 5M2RA 1KOHA 3M0DC 3ULHA 4F02A 3KHUA 3JTOA 4HVZA 4DR6J 1XNQJ 2JC1A 2ZC3A 3MWBA 2AYEA 2QL7B 3U7JA 4G3IA 3UDCA 1H7WA 3C16A 2ITAA 4H4OB 4N47A 3ICLA 3R5BA 3HSDA 4ECYA 1N73A 3KLIB 2Y8WA 2JRSA 3I56S 1QVGR 4EUVA 2C0WA 2KT2A 2CIMA 1BE3D 1U26A 3UQSA 3NAHA 4JV2A 1USDA 2OEJA 1VMBA 1U2FA 4ZPCA 2LU1A 2VG5A 4K8RA 1QUVA 1R31A 1XTZA 2MY8A 2PMWA 1NKBA 3RUBL 4NE9C 3NGDA 2WVRA 2DNNA 4DUYF 5M2UA 3AD8C 1KHVA 2R7WA 1KN6A 3PYDA 3UDVA 2DXEA 2YH0A 5IQ6A 4HKQA 2CPYA 4ZPDA 3IP0A 1RZMA 3THVA 1RT5A 1NK8A 3GFZA 5DZ6A 1UVLA 2XNQA 2Q3PA 4X4PA 2QJKB 2LECA 2P9GA 4C8OA 3UNGC 1ULRA 2GO9A 1FU1A 1UVMA 2D1CA 2KI2A 2GUSA 4GO5X 3KJVB 1UFLA 5APYA 3BS9A 3D67A 5KFKA 2BE2A 1WOOA 2ZT9B 2YTCA 2RN0A 4UQGA 4OH8B 5THWA 4AD6A 4IL6X 2Y0DA 2RUSA 3C6TA 3BCCJ 4MT1A 1MG7A 3GCXP 3G71S 1HLWA 4DUZJ 2RKIB 3G8TA 3MEDA 4DFKA 2HSEB 2C3OA 3Q8SB 3G4SP 3MPVA 3PIOQ 1N0UA 4YR0A 2I2YA 1K8AT 5LMNF 1HNIB 3D68A 2QM8A 2RU9A 3OXGA 4IR9A 4KV8B 1OW8A 3OFGA 3DLKA 2QJKC 4Z7CA 1EQ0A 2WT7A 3I56P 4B9TA 1S12A 1M5OC 4NLRA 4LSNB 4NZ0A 2HPCA 5D78A 1TKXB 2FXMA 4O44A 4ZCMA 3AB2B 3W5XA 2RRAA 1JLBA 4PRFA 3R1LA 1Q8BA 4WWIA 1L4AA 4U8VA 3GB0A 4A8MP 1FT8A 1L3TA 3PTWA 2QC3A 2V0NA 4K35A 2BM1A 4OZ5A 5G0RB 4DSKA 3MM7B 4QYRA 4NA1A 3U27A 3FBCA 3PEJA 2UUTA 3U1LA 5HP1A 3K5MA 3M8ZA 1N52B 4A47A 3KQGA 4PQAA 1EARA 3LAKA 4JUZA 1IM6A 4DV1F 4RUCA 2YXLA 2AMCB 1CULB 4UTGA 3CJ5A 3I96A 4ECVA 4IH5A 4LSLA 4W98A 4C8NA 5F8NA 5KLVE 2CDQA 2QVAA 2OP5A 3NS5A 4K4ZA 2KZIA 2HFNA 1S9GA 3DRPA 2H9ZA 2BRKA 4LFAF 3G71P 1SV5A 2UXDF 5KG1A 2HKEA 2FHMA 2K9JB 2RF2A 1VQMS 3MECB 4B9VA 2JFDA 2C9NY 1HWUA 3TYYA 1UEUA 4N7TA 2OTLP 1AQ5A 3MFIA 4YMEA 4OX6A 5J2NB 1N32F 2JKVA 2Z4PA 2BCCE 3VGTA 5KLIB 2Z2MA 3PY8A 4XA4A 7FD1A 1OVRA 2NXNA 1I6JA 4BCAA 4OHZA 5A6WA 2UZAA 4RPFA 3NMRA 2ROEA 3H5UA 1TL1A 1LWCA 1X4FA 4X2BA 5B0GA 5CYMB 1WOSA 1JLFA 2EFPA 4U7UD 5F8HA 2L5GB 1SUQA 4ZCIA 4YXDC 4G1IA 3KLFA 5HATA 3A4TA 4C7QA 1S4XA 3D6HB 5D0HA 3QZ8A 2IPPA 3CF5Q 3OJUA 3BQ0A 2WQYC 2IYPA 2IHR1 1R5LA 1FE6A 1FZCB 1MW7A 2BANA 5F8MA 2XYPB 4HR2A 3DMJB 5GMDA 4ECRA 1M90T 2GGPA 4HHHA 5KT4A 3M0DA 1YJTA 1FRMA 1DURA 1RA6A 3HCXA 1SQQG 1MWZA 3VVUA 2ZT9D 2D2CB 1IJFB 3WUUA 3TNUB 3A3NB 3JAMY 5CA5A 1QDUB 3AE6C 1P27B 4DCPB 4I0WA 4I2LC 1RTJA 3AT1B 3GWCA 2ZKTA 1SQEA 5B5EH 1F9FA 3MAHA 3GIMA 2HNYA 3BR8A 1VFJA 3ZXWA 3C66A 4F8RA 2PFDA 1VQMP 4HT5A 2HHUA 1NJIT 2VOPA 2AF6A 1RK8A 5AVSB 2HQCA 5C7PA 1Y00A 1B0TA 2E66A 1R8CA 1F2GA 1FOSE 1KYOH 3T6BA 2MSTA 3M06A 3N5FA 5E3CA 3FMWA 2QMUB 3ILLA 1BSNA 2U2FA 4LIWA 1NRKA 4R8UA 5EWFA 2R7VA 3RU0A 1RHKB 4F4XA 3P4UB 3K5LA 3R5CA 3L70J 2IYGA 4N3YB 1TFYA 2C42A 1HPZB 1FD2A 4JI2F 3EMTA 1X22A 4P2XA 3VP9A 4RW7B 4CWBA 1IJEB 5L8RC 2UUWA 1IWGA 1IQTA 1I51B 2O01N 1AROP 3DGPA 3DRXA 2LYVA 3BKFA 2W4DA 2IBOA 2NCKL 3FVYA 1FRKA 1FJEB 3FSYA 1KR4A 3SFGA 4OI4A 1NYHA 3K58A 3H98A 1FFGB 1T03A 4WU3A 2X3DA 4F25A 1NH7A 2BJ3A 1N5SA 2DGWA 2O01C 2AEJA 2GQQA 5HJYA 2M9KA 5GMEA 3G6ES 1MFZA 1X8DA 4PG8A 5IWAJ 2ZBIA 2Z2ZA 4IL6E 3TDKA 2CZ9A 4X64J 1TK0A 3H1LE 2R32A 3KJVA 4JBCA 3GLMA 5AVZB 2BABA 4PCQA 2E74C 1LKZA 1QVFR 2A2DA 1GU4A 1DRZA 5BYRA 3CXCR 1QAYA 3L7PA 2KFNA 1F9HA 2RKIA 2M3DA 1U0SA 4A8WA 3UN5A 2BCCD 1J2JB 1WHVA 2NPSB 1WRGA 3N01A 4DV4F 2RS8A 2AZ1A 4URQU 3LPYA 4YPCA 1HNIA 1TK5A 3OL8A 4WU2A 2VQEF 1C4AA 2AIRB 1YHQP 3RL0D 2HLTA 4Y99B 2CPSA 3J7ZT 4RR5A 3VZIA 1TKXA 1UJ5A 1ZR4A 2IDBA 2VONA 2BW7A 3N6LA 1Q90D 2YNFB 2DGXA 3B8HA 2DHGA 4DX8H 2QM7A 3R6GB 3ZTPA 3BH7B 5HL7Q 4JI3F 2B4PA 2B9YA 2MKYA 4CLWA 5EHHA 1HJ0A 1HMVB 4JI6F 1YI2S 1ZETA 4J9VA 5G0RA 1U0HB 3F44A 2F4VF 1UEKA 4BS2A 4LQ3A 3MMCA 3BO2A 2GVDA 1U2CA 3A3OB 4U3FE 4QIEA 4X62F 3QLHB 1RACB 4KHPJ 1A02F 3MAQA 3I55S 2BVZA 2LA4A 4F0KA 3L75E 3UD5A 1ZM3A 1FJCA 2E5HA 4G1QA 3G6EP 4N56A 2PA8D 1M1GA 3TVKA 1FDIA 1T9XA 1IBKF 2UV8A 4RW4A 4XO0A 1M1HA 5FLXU 1SQBD 1OYDA 4WP3A 1PPJE 3M0AA 1KLNA 5GTHE 2AGOA 3L74D 3UIAA 4WTOB 3PRJA 1LFWA 4EI2A 4TLFA 2MGZB 1YTYA 2KT3A 4EZ9A 2CK3H 4WKYA 2K9JA 3DM2A 3MECA 2HVHA 1WHXA 3NY0A 1RF0C 1IUJA 2VC0A 4D6TE 5RUBA 1WKKA 2C22A 2FYUE 2H48B 3M91A 5JJBA 2QFJA 1VJQA 5J2NA 2J0SD 1D3WA 1RT2B 3ITKA 1VQLP 5IM0B 3GP9A 1CC8A 2IFXA 1M8OB 5LXYA 2C2RA 1OWXA 5ETVA 3MMJA 1FESA 2IMOA 3II6A 2O3DA 1FVQA 5KOXA 3OVAA 4P74A 4F0HA 2QLWA 1DD4A 4JI8J 1N86A 3PXGa 4Y3CA 3PRBA 2E75D 5H1SV 2Q66A 5CYMA 4DU7A 4KGZB 4ASWA 4OX9F 1UIXA 2H5IB 5AVUB 5KG2A 3OL6A 1RWKB 4IOCQ 2LXCB 4DR3F 1Q0NA 4UT4A 4C9DA 2E1AA 3ZNUA 2E1CA 1FKPB 4ENOA 3IWLA 3MOZA 5ETOA 1JTHA 1FDNA 3U1CA 1CPZA 3G3ZA 4PPZA 5D6GA 2PGDA 4TQSA 2W6BA 3CCJS 3I55P 3HHDA 3GHGC 3JSRA 4DV6F 2YMYA 4IFYA 4P2SA 1L3VA 4KSEB 1YZ7A 5KG0A 3R8YA 3M8QB 4FF2A 2IBKA 5E3PA 5J2QB 2ZYGA 1MROB 4QIWD 5AW7B 3H1LD 9ATCB 1PIXA 1FJGJ 2L41A 3H1HJ 4W7YA 1XTCC 4QIVA 4DL4A 2W9BA 4K4WA 1WACA 3UR0A 1C1BA 2ZH6A 2H54B 4DZ6A 1RGVA 4WYLA 4ECXA 2VKZG 2AHOB 3SSRA 3V4WA 2Z57B 1CEZA 3H1KG 3WU2H 4ED2A 4UF4A 2DVIA 3RW7A 2QLFB 2DGTA 1NDPA 3EFFK 1L2PA 2FD2A 5J2PB 4JF7A 1UWBA 3S9OA 1VQ7S 1OFCX 2PC6A 2OYHC 4NA2A 1RXOB 1BGYJ 2YKMB 4DR7J 1R8EA 1FAVA 2Z5IA 1ROFA 2WSFH 2XNXA 2V63A 4DR5J 4LF7J 3OR2B 3WIVA 2BBEA 3P8CE 3M2UA 3KG1A 1BMQB 3W68A 4ZLPA 1ZTWA 2XS7A 1U09A 3WX4A 1YWXA 1UA0A 4XAKA 2EXUA 3HUSB 4RW7A 3J7YI 1QY7A 4TLRA 4C48A 4OYXA 2DHHA 1AA1B 3B5ND 2G1DA 4PG4A 1GK4A 1RHRB 4LRDA 4ZK7M 1LV5A 4XDCA 2V8GA 3DOKA 3QFHA 4U3FD 4NZ6A 4F4YA 2ABYA 2AEFA 4DT0A 1NK4A 1OYEA 3L75D 4TYAA 3QGPA 5HVHA 2M70A 3CDBA 4FYVB 3TK1A 2NXEA 1N36F 2F65A 1IKWB 3TI0A 2R3VA 1MKMA 3R1HA 4O9BA 1SI9A 3LGMA 1RT3B 1Q8LA 2GS8A 2JNJA 4GC7A 2E5GA 2Y0SD 2UXBJ 3PR5B 1R7IA 3HUSC 1YSJA 3AE4C 2YX1A 3K5BA 2XNDH 1JLQB 5AW3B 3D54A 3SCJE 3KHRA 1CQNA 1HD0A 4D6TD 3CJ4A 2F9JA 1EZVE 2W90A 5IZHA 3JQMA 2MJZA 5T14A 2UVUA 2V8HA 4M5IA 3DOMB 3TA0A 4ZPWR 3VGUA 1SJ4P 3ILIA 2E5IA 1KMIZ 1DLOB 4FBTA 5CJ4A 2IAJA 3P5BP 4PUOB 2RU3A 1KP6A 4ITSA 2RH3A 2AZ3A 1M90Q 5H9EJ 3V6JA 2I5JA 3D1HA 1LK7A 4DDFA 3GU0A 1VQOS 2M5YA 3AQOA 4DS5A 4JBZA 5IQQA 1S0OA 2BW2A 1FEHA 1B0PA 4TY9A 4AUWA 1OMIA 2CPDA 2LXIA 1KWMA 3BVHA 3H1JJ 4C3KA 4ED7A 2AJQA 1FXRA 3R7BB 1S6QA 2OEKA 4OV1A 4NLPA 3OD2A 4LR9A 1CQMA 2GJFA 4HYKA 2XS5A 3HFKA 5J2MB 2LXFA 3FK4A 4DEZA 1HI0P 2AGPA 4TXSA 3KKFA 4H4MB 1NTZJ 3BQ2A 1HMVA 1NOHA 1CLFA 5F8JA 2PP6A 4Q8FA 3T5HA 4ZCKA 5K8OA 2DGVA 1RF0A 3MGNA 5MAOA 3PACA 1AFJA 4CCHA 1U7JA 4ES1A 4GODA 2DIUA 3QLHA 1WC3A 2E9RX 3M2RA 2ZYAA 3HDSA 2NR0A 4LJMA 3HLUA 2N7CA 3LO3A 5E7OB 4ZCLA 2B0GA 1IR2A 3FEYB 3PRVA 4DUTA 4BWJA 2N9BA 2DK2A 1NTKK 2VG7A 1WOPA 2LEBA 1IBMJ 4DX5A 5LMUJ 1KDNA 1NH8A 1LW2B 3CMES 1EETB 2WSEJ 3QIPA 1N5QA 1Z56A 5DQGA 4LFBJ 1IM4A 3EFGA 2LQJA 1YJ9P 3L37A 1VRQC 5DS7A 4DQRA 3AY0A 2YVSA 1WSRA 2I9SA 1JY2N 1JK9B 1QSSA 3AJDA 2W7OA 2V69A 1S57A 2ZOMA 3OLBA 1VQOP 2AXTH 1TZ0A 1XNQF 2B7CB 1SC1B 4WXWA 4PJ0E 2AD9A 3GHGA 3OSNA 5KG3A 1L3SA 2ILZA 4IRCA 1L0NE 2KJWA 1RAFB 3RK2D 2RT3A 2AT1B 1SLQA 3JQKA 4DV0F 4DV5J 3B54A 2MKJA 3CDWA 4LF5J 5IS2A 1RAEB 3GV5B 4A46A 4HJGH 1ZV8A 1FS0E 2W2PP 4DZDA 2NYIA 2XY6A 4OI2A 4Q0BB 3L73D 1LWUC 5K8PA 2BJDA 2FHJD 3G2XA 2HZCA 3BBFA 1VLOA 1NB2A 3EICA 3NXSA 2WVDA 2VD3A 2DH9A 4QPXA 3I4PA 1VF5B 3A3YB 4MMOA 4WY4B 1KQKA 4DOZA 3TAPA 1U8SA 8ATCB 3C6UA 5DG9A 3OL9A 3MPDA 4ZKAA 2YQ3A 2CNLB 2QGFB 4WFXA 4BC9A 5IFMA 5BU5A 3S1TA 2XHWA 4OL8A 4GOEA 2DNLA 2WVBA 4OYIA 3AE8C 1RHJB 3M8QA 4F3QA 4LGDE 4ZVSB 3U1MA 3B71A 2FJBB 1S1UB 3C1LA 2MB0B 5CBOA 1NJWA 3FGVA 1ZOTA 4LR7A 3HE4B 1QTMA 2NSBA 3HK2A 4LSZB 3UDEA 2EFOA 3RBEA 2JR8A 4P52A 1KVIA 2ZH1A 1EZVD 2Z56B 4EMDA 4P9SA 3TF5A 4DR1F 3TWZA 2X51A 2HG5D 2Q1LA 3BSNA 1KNZA 5DDOC 3D0HE 3T1YJ 2N7YA 2NZ2A 5KAIE 2YNIB 3IR6B 5APTA 1NPRA 1VF5C 1DY3A 5GAEI 1UEVA 4WY4C 1RSCA 3PJXA 1W7WA 5C42B 4B08A 3ZNJ1 3EWKA 2BQRA 3BYRA 5J2PA 4NRUA 3EJMA 3W8PA 3IC1A 4HACB 1O0PA 1JLGB 1VQNS 4RJVA 5L46A 2J59M 2B5JA 2YKMA 5CHCB 3PX4A 3R27A 3CWBD 2U1AA 1WC0A 2XULA 4DMZA 4YXWH 2DD8S 1FWKA 4OGQD 3S1KA 1T02A 2F8EX 2N1TB 4Y2MA 3EPIA 4X65F 3PR4A 2GHVC 3SCLE 4CT8A 4BC7A 4OLOA 1SH0A 1JY3O 1OSCA 2IBZG 3HUSA 5AJ3J 4ILRA 4A8YA 2J76E 4EEYA 3L3CA 2ASLA 2NZCA 2ZBCA 3TGUE 4Z1MH 3SXLA 2L48A 2V8PA 3MGJA 4USHA 5J1EA 5APWA 3ELHA 4OI0A 5SZTA 4ELUA 3NBPA 1SQVE 2FGCA 1B3TA 2J58A 5B5EE 1I5OB 3C8VA 2VBWA 1IKWA 3Q86A 1U2RA 1QUPA 1GX6A 4UW2A 2N1TC 1XQIA 3HD7B 2IY5B 1RT3A 3WIUA 2HODA 5H9EK 4K4SA 4N78E 2VRSA 4FXVA 2ZVNB 2IVFB 3S6EA 2M2BA 4M5LA 1S1XA 2A10A 1L3UA 1JLQA 1NSPA 3VAFA 5CXTA 2HBZB 3V81B 3M8YA 1AA0A 3FBEA 2MZRA 2CQCA 3M30A 2UU9J 2KYVA 2YNHA 2J5AA 2CPFA 4OIXA 4DL5A 2OPQA 1HL6A 1PP9E 4OJ1A 2XZRA 1MSWD 4WYWA 3CB4A 4PXCA 1JX4A 3D7SB 3HZGA 3DOMA 4W4MA 4DV3J 4E8UA 2HVZA 5KFYA 1DLOA 4PUOA 3M6UA 1VQNP 1NTZK 1WTBA 4CPGA 3QGGA 1L0ND 5KFTA 3HD7C 4NPOA 3MM6B 5JVGQ 5GTIH 2R3CA 1F5AA 3MEKA 3U02A 3M32B 3HP6A 1RWMB 1OX3A 3TZZA 4HI1A 3TJ9A 2MZQA 1W2IA 1WJ9A 1N6QB 2W6JH 4PWUA 3C8YA 2FY1A 4CH1A 4OHVA 2VPZB 1WC4A 3V2UC 4R4LA 3C2PA 2LR2A 3CX5H 4DR4J 5J2MA 3NGRA 2RHQB 3IMQJ 2ACMA 1FZFA 2BEFA 2V4QA 3CXHI 3D2WA 3CCWA 3RL0C 1CSBA 4IOIH 3RJMB 2OJ3A 2WHOA 4EO8A 1WD6A 2W24A 5C39A 4UB6H 1FA0A 2XI3A 4NLXA 1X9WA 2ATLA 4F50A 1U49A 2YIUC 2HBQB 5AW2B 2E76B 3L72D 3TA1A 5KFPA 4K4TA 5C25A 2HHHJ 2DRAA 4QWDA 3KJNB 3IN5A 1K1QA 4LFCF 5KFLA 4Q7AA 2CQ0A 1O51A 4MIWA 1RY3A 2ZZNA 3ILJA 2I8DA 5DG7A 5F41A 2OFGX 3M4XA 4ZJLA 2OTJS 1S1TA 1VQKP 1JB0C 2I6WA 1NKEA 4MTPA 4ZVRB 5DDPC 6FDRA 3D3CJ 3FBFA 2VPYB 3CNQP 3ZTOA 1LWFB 1LWUA 4I7ZB 1QSLA 3I87A 5E41A 1O8BA 3MURP 4L74A 3HHLD 3OTCA 4FF1A 4GT1A 3GMGA 1LT1A 3PW5A 4RX6A 2VB6A 4ZVPB 5KFQA 4J9KA 2G9OA 2QRRA 4IH6A 3OSPA 4O0IA 3C9IA 3E01B 4NI2B 2FLPA 3K59A 1M56D 3IRWP 4C46A 2XZWA 4E0DA 1SQXG 2K7JA 3HJFA 3T1HF 1FBMA 2IIHA 2OPPB 1HBOA 1LTAC 2RMLA 3L71G 1JY2P 2M8DB 2XYGB 2M0GB 5HVFA 3QFWA 1VBXA 1TU0B 4TYBA 3EWGA 5HMWA 3EXCX 4MK9A 1GXLA 1RTZA 1YJ7A 3TGUD 4A8XA 4NLOA 3DRSB 3FSXA 1HH0A 2ROGA 1PYTA 1SIWB 5KFDA 5A2QY 3IR5B 1U57A 3CDAA 1MV8A 1ZRTE 3Q2YA 4QWCA 2QEXS 5EWEA 1OZHA 1SQVD 3HVRA 3KZIE 3OXFA 4WY4A 3CC2S 2OLWA 1D8YA 2PN6A 2ADBA 2W25A 1RTHA 2AEMA 2J7KA 1NTKG 4EZ6A 4X4UA 2K3KA 1YTZI 1YQHA 4N78D 2Z2LA 4I2QB 1LT9B 1S1UA 3AE9C 3BATA 1TKTA 1KILB 3GZ7A 2R2TA 2GV1A 4JV5J 4ED3A 3HE4A 4ECTA 1ZA2B 3LALA 4ZVOB 1X5SA 7AT1B 1KTQA 3CTRA 1UCNA 1Q81T 1C2PA 2OTJP 1PP9D 2WAQD 5E3RA 1MWYA 2WPQA 3JAMU 1XERA 2FJXA 4A8QA 2H5EA 3GF7A 4C7NB 3MCSA 2BCCJ 4UZBA 4JI4F 2CNNB 2V2VA 2Q6BA 2JEGA 3HHKA 5B0CA 2KM8B 3MUVP 2B6AB 2HG4A 4M5NA 2QYGA 4OZJA 5EGYA 2R44A 1GK8A 1L0LG 1BE4A 2HFED 1AQTA 3VR1A 3LOUA 1Q16B 1TKZB 4P75A 2P8IA 1LT9C 4X4VA 1KILC 2XI2A 3TRGA 3D1OA 3VCDA 3H1HG 2XNRA 3OR1B 4B3MJ 3KLEB 2GIQA 3VQSA 2N1TA 1IR0A 4ECQA 3RB6A 4NRTA 4GC6A 1NJXA 4ZITA 4ETZA 4MFBA 3TUJC 2YNGB 4CTAB 4YY3F 1P1TA 5IT4A 1IC2A 2DY9A 2ILYA 1NSQA 1UZDA 2WOMB 2QIFA 2QEXP 1NHKL 3DN9A 1TK8A 1RB0A 3BCCD 3GYNA 2QJYB 2ZEJA 3CC2P 4CO0A 1BGYG 3ZDMA 3LP2A 1NHUA 3J81Y 1LTIC 1HYSB 2M3EA 5AW5B 2VFVA 2WPVB 4KHMA 4RKUJ 2AX0A 2VU5A 2FPHX 2RMZA 1H98A 1NLKL 1OY6A 2QA4S 1HQUA 3HD7A 2R9LA 1KD1T 4I64A 5CD4A 4ECZA 4LR8A 3NL0A 4LF4J 1HHQA 3CIZA 3PJWA 1S7HA 1DARA 5KFRA 3OFEA 1JQGA 2OD4A 5KG4A 2IZ0A 4U7UK 3D1QA 3V81A 1VQYA 3JYTB 4LF2A 2XSJA 2QJYC 3IWNC 2QV6A 1SL2A 3J80U 1X8YA 3GIIA 1TL7B 4R4MA 4M5MA 5DG8A 2OUGA 2C2DA 1CG2A 4HDGA 4Q5VA 1JNZB 3V6DA 2XMJA 4ALZA 2KK7A 2QA2A 2E43A 1LWEA 2DNPA 2MJUA 1X4AA 5J1PA 1T8ZA 5DRKA 1RU1A 3GTYX 3IS9A 2OPRB 5KT5A 5I42B 4CLKA 3MM6A 2A3JA 1YJNS 2E5LJ 1TQLA 4J9RA 4LF9F 3FSIA 1NJYA 1VQ6S 2ZM6J 2DNMA 3R2DJ 3MOJB 3Q89A 2V8VA 5DM7Q 2ZDPA 4AFFA 1KS2A 4D3HA 1KONA 3Q5RA 2VJUA 2RQKA 4MIBA 5BYSA 2CPEA 4B9SA 1RLCL 2KNCB 2W1BA 3OFHA 3MPYA 1J1EC 4OYBA 1C0UB 1ZRTD 5DZ7A 1QAJA 3SCKE 3MEGA 1LTGC 1R0BG 2E9ZA 1NH4A 2AJ4A 3PX0A 2CYYA 4WK3A 2LVWA 1KLMB 4Y2CA 3JXOA 4X4OA 2WPSA 1VJWA 4IDKB 4ASVA 2QMWA 1SQQE 1EXJA 4RU2A 4DWIA 3GV8B 1BCCE 4U96A 1CJUB 3L7OA 1OQ3A 3H1LJ 2QA4P 3VALA 2QSIA 1HTLC 4NEYA 4QU6A 1A6LA 1QVGO 3CGIA 1UFKA 3KDOA 2ZBRA 2Z0GA 3M9BA 4JV0A 4ZIWA 4WZQA 2JVRA 1RABB 2HEKA 1FJGF 3RG6A 2XM3A 1RF1B 3MIWA 2HHPA 2H1YA 2QA1A 2DPIA 3EZ5A 2N3LA 1XNRF 1H7XA 3HHNB 1ZR2A 3P6YC 5AE2A 5EFWB 4N5SA 4ZP9A 5APQA 4GIFA 4DPOA 2MJNA 5ITHA 2Y9YA 2HNZB 1LWFA 1SC4B 2G2OA 2P5VA 3GV7B 5JVHQ 1E6YB 4KO0B 1XK8A 3CEDA 2IYIA 3V5RA 1EP4A 3DLLQ 4B9LA 2R7XA 3L09A 3SQGB 5IT9Y 1KYOI 4KT0J 3RTVA 4L3NA 1S5LH 3PTZA 1R0CB 2CWKA 1S2EA 4NI2A 5C2GA 4DR7F 2HNDB 5LJ3Y 3EDQB 2BEZF 5CHXA 5A0YB 3GIJA 4OI3A 4R0EA 2OPPA 1UTAA 4LF7F 2WCXA 1FRHA 4IG0B 4OYZA 3PJSK 1MNEA 3H2VE 4KFBB 2B9WA 2KO1A 1LK5A 1NB7A 2ZH4A 4DLGA 1R8HA 2FIUA 2VICA 3DRSA 3LGNA 4WKRA 2KXPB 3AH6A 3RW6A 4C97A 4U3FJ 2GQCA 3FUYA 1DJ0A 3IRXA 5DJTB 3PIPQ 4LRFA 1UP1A 4WB4A 2DGUA 3L75J 3HO1A 3RK2C 4DX7A 4ELVA 1UETA 3Q5PA 4XK8C 4B3RF 4JI1F 2PAJA 1NXIA 5APVA 3HI9A 4IG3B 3QJJA 1IFMA 2Q9IA 1BE3G 3KK3B 2KB2A 2YMKA 4B3SF 1LT9A 1KILA 2P2UA 3PDNA 1W26A 3ZZPA 2FFDC 4LVOP 1PAUB 3L70D 5A8RA 3CVKA 4D6TJ 3IAS9 2FYUJ 3LH2S 4PEOA 3UPFA 5D15A 2W9CB 2XKMA 3PYFA 4C7NA 3LW5C 2AXTE 1YYCA 1HW8A 2ZJSE 2WBRA 3A0BH 4ZN3A 2VKRA 2ZWPA 1RH5B 2B6AA 3LPEA 2C3YA 2V34A 2LQ9A 2L91A 4NXMF 3RK3D 2Q7CA 2SPZA 2P9CA 2FJWA 1N7SD 3NOGA 1L3KA 3NS6A 3D70A 2JSXA 2FVQA 3OW2O 3SIPB 3ZZOA 2M4MA 1VRUA 1RTIB 1REVA 4YDDB 2DO4A 3KLEA 1RQVA 4ES3A 1FDBA 3SWKA 1V3SA 3A12A 4YN3B 2BQUA 1BHNA 1PIEA 2YNGA 1SQBK 1B99A 1G2EA 1RAGB 3PP5A 4IOAQ 3NLCA 4JYAJ 2QJPB 4C11A 3IWXA 2UVRA 3FCVA 4IQMA 2PI5A 4OGQC 5KFGA 1SQQD 5HLFB 1BCCD 1GXTA 1N5YA 3GQCA 2CZVC 3SQOP 6AT1B 5BU8B 1DTQA 2CG8A 1GL2B 3FFIB 3PCOB 3CO0P 2YQ1A 3CC4P 2FY8A 2R42A 1H74A 2X1BA 4O23A 5LSOA 4ZKPA 2WSCJ 3CCQS 2KVQE 3SSSA 2G2YA 5AVRB 3NS7B 4RLEA 4M5GA 4GOFA 2CQHA 4EU0A 1EDIA 2MQPA 5E79E 1IKVA 2G13A 3EUNA 3AOBA 1KB9H 2K7KA 3TQ1A 3AE2C 3DDNA 3NGUA 2I0XA 1OPIA 1APSA 2ZHAA 5ETMA 3PG9A 4B9UA 4PD4H 4I2PA 3JYTA 1IBMF 2YWKA 3G8QA 3SFUA 1SJFA 1EHWA 2DTJA 2QG4A 2C9LY 1RISA 3BN4A 2J8SA 3K8WA 4JI7J 4I6MC 3LANA 3HM9A 3UD4P 4ZP6A 4DQIA 4LFBF 1RT4B 2OTKE 4KHRA 2Y0BB 2PI4A 3T3FA 3AECC 2DGQA 2HYNA 4P2FA 3I5BA 3M8PB 3AEAC 3TJ8A 1KQLA 5APXA 4ZKUA 2OPRA 4GVBA 1S4FA 5I42A 1M57D 1G2CB 3R6LB 1FDDA 1QSYA 1C0TB 1X9MA 3NKYA 3W2WA 2J0QD 3CCMS 4JYBA 1QAXA 4F67A 4X4TA 1E6VB 1T8EA 1H88A 1FWPA 1RBLA 2OEMA 2QE5A 3MM5B 3AE1C 1PYSB 4NPFX 4O3PA 4CLFA 2AJ1A 2KH9A 2C2EA 3GJQB 4ZNCA 2WB4A 2KDOA 1TUWA 1R89A 1TP7A 4QPTA 2WZ7A 3CJQA 3FCHA 3GG2A 4RWXA 2RAQA 2ZITA 5B0EA 4QIFA 3EXYA 1V5IB 1DQ8A 4IDKA 1YQ4C 1PC5A 5CQGA 4RW9A 2CQIA 3EZUA 3TAQA 3H20A 3CCQP 4C8LA 5K14B 2VF3A 3A0HH 3CCSS 3QPIA 1N73B 1SKSA 3ETMA 1FTRA 4X66J 2YKNA 3PW7A 3FEZA 3H90A 3QT7A 2DY1A 4LVNP 1O5JA 2A6MA 3HT3A 2IBZI 2DHXA 5CABA 3AEGC 3H1KE 3G82A 3KOAA 2RDIA 2VFTA 2FJVA 2VG5B 2QYCA 1ICEB 3JSMA 4UOHA 2VQFF 2EG1A 4K5RA 3SV4A 5TJHA 3ABVC 1TL5A 3VAMA 3TYTA 1NAFA 2DNYA 1E6YA 4KO0A 2XG8A 1PC4A 3M1VA 2OSRA 3LP1A 4MKYA 3CWBJ 4FYYB 2ASYA 3I0RB 4PQUA 3MXHP 1EB0A 3RBZA 1TV6A 4C8KA 2ZJQQ 5IXUA 3CX5E 4LF8F 1FRJA 1BQNA 1RYRA 1KD1Q 1JKHA 1ZAVA 4NL5A 3EVWA 1VRTA 1KQFB 4F36A 2H4WB 2KU7A 2R7OA 1QVFO 3H8YA 3HHLC 3IM9A 4FVCA 5CZVA 3NNHA 2FFDA 2BE2B 4AQYF 2LCWA 3HD1A 2C2KB 3MDFA 2Y9ZA 2F7VA 2JLFA 4PWDA 3W66A 1OMSA 3GG1A 3MEDB 1SJ3P 4I1LA 4WP8A 1Q4RA 1HNZJ 4DHVA 5GTHH 4DL6A 3P8MC 1S49A 4RU9A 1VQ8S 1SFCD 2DEJA 5LOQA 1WHYA 1RDRA 4RUAA 1I1GA 3CCSP 3GILA 5AW4B 1PKUA 2AJ0A 3T5LA 3N9UC 2KXFA 2P6TA 1HNXJ 3CIMA 2O67A 5T7LA 2MPUA 1UJ4A 3IG1B 4O44B 5IT0A 1BXNA 1JLBB 1XBWA 3BSCA 3WBZA 2A45G 2DH7A 4DV7J 2FZGB 3U1AA 1L4AB 2W9CA 3B4MA 3DDIA 2HRYA 2UU9F 2DISA 2CRLA 1HA1A 1GQEA 3MCNA 1KZUB 3GG0A 4H54A 4QWBA 4LF6J 5BR8J 1AVYA 4DPXA 2CZ4A 3AHPA 5KFWA 5K8NA 1VQ5S 2Y9HA 2EI5A 4MYUA 5KKZB 1L0NJ 1S5LX 2FQQB 4ID5A 3ADAC 5GAGU 3RB4A 2VIHA 2JC0A 1AW0A 2EPIA 1RT7A 4PG6A 4H4KC 2FYNC 5TISH 5DQIA 1CW5A 4NLDA 3CC7P 1X9SA 1RTIA 4ER8A 1IBLF 1VI7A 3B82A 1WC1A 4LSLB 1J5OA 4V19X 2H89C 1HD1A 1LXNA 3OUYA 2MKIA 2ZKUA 1S9GB 2PIIA 3AQPA 3DRPB 4FXDA 1WEXA 4MKAA 1X4HA 4EK2A 2X3GA 1NKNA 4H0LD 1SV5B 5BXIA 3I32A 4K0KJ 3PFOA 4CLZA 5M2PA 3QYYA 1HBUA 4KHXA 2RILA 3C19A 3G9RA 4LT6A 5DJUB 3V2PA 3RB0A 1BD6A 3P45B 4C6AA 3W3SA 2C3MA 3KJQB 1MN9A 3MR7A 3FFIA 2IM2A 5KT2A 3BASA 3W7BA 2Z4EA 3DNCA 2W8ZA 3L9ZA 2Q1KA 1VCTA 2QL5B 2DKOB 3O1LA 1BY9A 5KFFA 2V9WA 3CDUA 1VQ4S 1YDLA 3IGNA 3CJ8A 1N33F 2IJFA 1XEZA 3RAXA 1CS4B 1X5TA 1FX4A 3PM9A 1HWKA 1SUQB 3K2YA 4PKDB 1OW6A 1WI8A 2UXCF 1URQD 3H1JD 4LMZA 2NRGA 2DJWA 2XU6A 3SDEA 5LM7E 2W7AA 4RW8A 4WBAA 1GK6A 1SVDA 1YX2A 1IZNB 5KFHA 4ZLNA 1NTZD 1D9FA 2DGOA 2J0WA 5D0EA 2HW3A 2IPOB 2HR3A 4OZ1A 3EGVA 3DU6A 1AUSL 3CX5D 2GGPB 1YBKA 1SQBG 2PFFB 4ZN1A 4YB5A 1KEKA 3UR3C 3PO4A 2C2NA 3L74G 1T95A 2NPIA 3VWSA 5U47A 4C2MA 1T3NA 2KS1A 4PAAA 3IBFB 3US5A 1GD2E 5FD1A 1RTJB 4O3RA 2WITA 4EYYQ 1E6VA 1YBUA 5LSLA 1FJ7A 3TGUJ 2B9EA 2HNYB 4TVAB 4AYBD 3OJSA 3M05A 4EDFA 3NGTA 2OYIB 1LTJB 3HE5A 1FHTA 5KFUA 4WVZA 1SQVJ 1T05A 1SL0A 3N4XA 1XIQA 1HQEA 4M95A 2BQ3A 2GO8A 1DD3A 3DI6A 3G4SS 4DPYA 2V68A 3MAAA 1SBRA 3OFFA 5DJBA 2AGQA 3D6MB 1BLUA 4DUYJ 4HH1A 1WSVA 4R8UB 5KFMA 1XMQF 5K14A 2FBWC 1VQ9P 1VQ4P 3DRRA 5HQ8A 1S10A 2FVPA 4W7ZA 2FHOB 4K3AA 1B7YB 5AW0B 4Y2AA 4PG5A 4B86A 2R5DA 3IFMA 1PP9J 1WC5A 3BEGB 4F0MA 2OYIC 2NXCA 1LTJC 5FJ4A 4ZA1A 3PKMA 3HHLA 1PFIA 1WTFA 3K57A 3CSKA 2HRTA 1IBCB 3CWJA 2OH2A 3DGPB 4PV1B 4P7VA 4RNOA 2PT0A 3Q22A 3PLNA 3JCUH 1ZTTA 1FFWB 1CVJA 4JP8A 5AXKA 2GIFA 3H1LG 4I6AA 2BJ8A 3F73A 1T03B 5D77A 1PJ7A 2XTJP 3U59A 2BXJA 2KN4A 1RWXB 5I4MA 1JY3N 3I0RA 1PJ5A 5D4PA 4K4UA 5KJ7C 1GEHA 4NX9A 3WDOA 3MHYA 4OVNF 4B3OA 1K73Q 1TL3A 5LMNJ 4N77A 2BM0A 3VV2B 1Y4ZB 3O6QB 3R2PA 3ISND 5H9FJ 2IBZE 1NDLA 4JV1A 2QG9B 1KQGB 3D3BJ 1P84I 4JYCA 1HI1A 2IC3B 2G0IA 4FKXA 4PV1C 3G86A 2NZ4A 4DSLA 2KZMA 1S6PA 4EBDA 1QAIA 1LP1A 1F5BA 1NBEB 3MEEB 2FVRA 1V9OA 5K20B 1M1JC 2Y3YA 1R43A 2VA3A 4AL7A 3VAGA 4PG7A 2OTLS 1S9EA 2ZNZA 2CADA 4Q43A 1XMOF 3CD5A 3LIDA 3HRNA 4QJVA 4FYDA 2LA6A 3VVTA 1NTMG 2KZJA 1L0NK 4GKGA 4DPUA 3MM9B 4H4KA 2UUAJ 2L3MA 2ZH5A 2R5BA 2ZYDA 1X5OA 3QJLA 1AFOA 3OPKA 2HS4A 4QR2A 3GR1A 3IG1A 4QR0A 4NXNJ 4DV1J 3G6VA 3DHWC 4U3FG 4TT3H 4PJ0H 5HMYA 3L75G 4DX6A 1SKWA 3PYGA 4USJC 2KZZA 1T3JA 1UVNA 1T2KC 1OVVA 1S5LE 3QATA 2YWHA 2HLOA 2XBPA 5KFIA 5AE3A 2RIJA 4LFAJ 1EQ7A 3MMCB 1YRTA 2GVDB 4YR2A 2AWZA 2UXDJ 4U7CA 1QJHA 5I3PA 3H40A 4DFMA 5AVTB 2A06D 1N0VC 1V5VA 4QBUA 5AW1B 2HFOA 4ANEA 3ET6A 4X84A 1H2UX 1ACMB 2EC0A 3KDNA 1VOMA 1S7IA 5AVVB 1W2EA 2B51A 4G1QB 1Q7YT 1H0TB 1N32J 1FZAA 2DNQA 4RW4B 4WJBA 3EGWB 4D6TG 2GC8A 1HR0F 1TAUA 1SCJB 4ES2A 1RWPB 3RK3C 5GAHU 1N7SC 2DO0A 1NK6A 1IKXA 1GMUA 4CLLA 3AXKA 2DT9A 3DM2B 3SWFA 2CPIA 2YQ0A 3ISZA 1M5PC 5F3TA 2XDJA 3MCMA 4LBPA 2XMWA 2MLZA 4YB6A 2R2UA 3NNCA 4J7CA 2ZWOA 2OHDA 2BJEA 2POHA 1JLCB 2XQCA 2DB1A 4JPZB 2FTRA 1WG4A 3TANA 3AA8A 1JJCB 5KAIH 2GJIA 4YQWA 5KG5A 5B0AA 2C2ZB 4OJGA 2GJ2A 4YFUA 1RHZB 1JLAA 2AXCA 3IA0A 2YKOA 5B66H 3J81U 5CJ0A 1VPCA 1CS4A 3A0BE 3FRZA 3P8BB 3E51A 2J6SA 4G65A 1RT6A 2D74B 3JSYA 1CSJA 4N41A 4KGXB 4MN4C 3IAOA 5IV4A 3KYLA 3G96A 2FZCB 1MZ9A 1DEBA 1JTHB 1FXDA 2YKPA 1GH8A 4CT9A 1SQVK 2CQ1A 1DQ9A 5HVGA 2IM1A 2CPZA 4J9QA 4ZMMA 1UA1A 2DH8A 4LRBA 1X9VA 1IQZA 4IFYB 2QLJB 4DFJA 1SQXE 2GA1A 2HS0A 1NK5A 4Q2MA 5DLGA 3L71E 1JNMA 2HQDA 3BKTA 4GKJF 2QLXA 2HURA 3WQPA 4KJIA 3L95X 4RNNA 4DN0A 2W9BB 1FO1A 1HIYA 5CD4H 3H4DA 4NWBA 1C1BB 5KT6A 2VBXA 2OYIA 1LTJA 3AEDC 5KFAA 2JJ4D 2UP1A 3BQ1A 2HIQA 2FXPA 1QE1A 4OJHA 3KLVA 3K89A 1SS1A 4JI2J 2RE1A 1S1VA 3OAKA 1YG0A 2V94A 3DCAA 1NTKE 2J0XA 2RSQA 2XC9A 3IO1A 1UWBB 2HQIA 4J90A 3O2IA 4K2XA 2LEAA 3FBBA 1G4CA 5CCHD 1KB9E 4Q8EA 1Q8IA 3C15A 2BJ7A 1DIPA 2Q79A 3BDPA 4P6QA 3ENAA 3NMAA 2IMWP 4PD4E 3DXSX 1YHQS 3L73G 5KJ7A 4MAKA 3M2UB 5HROB 4NLVA 4ZVGA 3M6WA 2JHEA 2E7XA 3RRGA 3AJ2A 4H13B 2HHSA 2WSFJ 3CPWR 2O1KA 1NU1G 5H9FK 2E74B 4Y65A 4GKKF 5EN1A 2F5GA 3QSIA 2F4FA 3DOKB 2GAGC 1L0LE 1PG5B 2R8HA 3CCTA 3GCWP 2BRLA 1M1JA 2V2KA 4Y6IA 3V5BA 2YY3A 3DOLB 1G7CB 1EZVG 5KLVD 4ELTA 2Q3EA 2HHTA 4DQSA 3T41A 3Q0AA 4KKOA 5IT9U 4H13C 3O6QA 4USKA 2VQEJ 3KMSA 1GNKA 2IC3A 4AXJA 3MF5A 3W61A 3W5YA 1BWVA 1PL5A 2WB1D 1QGKB 1RBOB 2E5YA 4CLTA 3PW0A 1M5VC 4EBCA 1M5KC 2OPSB 5A8KB 2F1FA 1SQQJ 4C3LA 3CCES 3MEEA 1BCCJ 3CWBG 2IFMA 3UCZP 3A0HE 1RKIA 4EIJA 1UVJA 3RRKA 4ZDNA 4JI3J 2IAJB 1LW0B 2CQBA 4H44C 4JI6J 1YK9A 2L9DA 4NCGA 2I5JB 1VQLS 2ZBQA 3A7OA 1KBRA 2F4VJ 3T19A 3OVBA 3MM9A 4DOJA 3IR7B 4U95A 1A02J 1OIAA 3VAHA 1P84E 2MY7A 5KT7A 3B8EB 2MHNA 3FXEA 3OL7A 1N34F 1S6QB 1IBKJ 3A2AA 4A7PA 1B4SA 3Q83A 5KFVA 1SFCC 4YUDA 1N7SA 3NCPA 4KYZA 1Y5LB 5CCGC 3IXQA 1R0AA 1IFJA 3CMQA 3K5PA 3A3PB 1VQPS 4JI7F 1GTWA 1USEA 4JI0F 3CUNA 4J9OA 2B4OA 2D2CD 3D6FB 1I3OB 3RR7A 1MUUA 1YKWA 3M2RB 3FXDA 4B3TF 2Y1RI 2GFFA 2MXYA 3KZIH 2L9WA 1H0TA 1P9QC 4C7RA 4OYPA 2NLWA 3QSYB 3RYLA 5M1BA 4JI5F 3ILOA 3A8JA 3CJ2A 1SQFA 4MH8A 3BYPA 4O3NA 4KB7A 3B4SA 2LMIA 4Y2KA 4J9SA 1VC5A 2E9TA 4A8KA 2VG7B 2R8JA 4DF8A 2YWEA 2Q5UA 2XYHB 2K8GA 3F0NA 1PO6A 1A7GE 3QIPB 3CCEP 3HX9A 4TU7A 4DR2F 2DIVA 3FKBA 4LUBA 4FBUA 1Z1ZA 1JY2O 4XDDA 2BV3A 4OX9J 4R5PB 1HGZA 2P58A 1GXUA 5ETTA 1KB9D 3D0IE 3LIEA 5BVZA 3X3UA 5E33A 4DR3J 4F4KA 5B7WA 2H65B 1JLCA 2Q43A 3GFHA 4PD4D 5DDRC 1H72C 2XWYA 4OZ0A 4TY8B 3GHGB 2G4BA 3UNYA 2B43A 3PKYA 4F04B 1XMBA 4DV6J 1WDTA 4LBIA 5L9XA 1NVOA 4NMLA 2D9OA 2AYMA 3KNGA 3S8SA 2KG1A 2HS3A 3FGAD 1TELA 2G0CA 3CCLS 2HLUA 1L0LD 3V4QA 3DYAB 1SH3A 2LDYA 5BYQA 2VUGA 3L72G 2C3UA 1VQPP 2R8IA 5TISE 3G8SA 4AXIA 2HHWA 3LWLA 1YITS 1XR7A 2JEJA 3PO5A 2Y0CA 4CM2A 1YJWS 3C6UB 4M5KA 4ATNA 1IFNA 1FDAA 3C14A 5AW9B 1K8AQ 3FDSA 5I3QA 4QU7A 1YZ6A 1FDMA 2D3ZA 1URQC 1YIJS 2OYHB 4P10A 2XY5A 3MMBA 2E5TA 3LF0A 5C24A 1JLEB 3JQJA 4IFVB 2V4JA 1S6OA 2V7QH 2W4CA 3WC0A 5CBNA 1RE4C 1SB6A 2ZE2A 2A45I 3OHBA 1LNQA 1Y7PA 2FYXA 2NPSD 4UUWA 5HAOA 2ZFCA 1G1JA 3HVAA 1LTSC 4O3OA 1J5EF 1OQ6A 1RT1B 5E3QA 1M5HA 2M5AA 2FUG9 4DL0C 3N6MA 2ZD1B 1SKUB 3S7RA 1X4DA 1UAWA 1Y8AA 3DLEB 3BREA 2KOGA 3T97B 2ZZMA 3QAEA 4WFZA 1RWUA 8RUCA 1BE3E 1GMVA 3AB4B 2B5JB 2MQ8A 1GX5A 3CD6S 1MWQA 2M8RA 4PABA 1KQSR 4ZVEA 1FE4A 3OXLA 4FNIA 4XPEA 3TGUG 1Q7YQ 1NWQA 2XLIA 1X4CA 5KTQA 1SQPE 3W2VB 2WSEC 1N36J 5HROA 4HH2A 1X31C 1RAHB 2EFQA 1PGQA 1SQVG 1PJ6A 1S1WA 3CCLP 4OFZA 3E1IA 3CJ0A 5BJRA 3DLGB 1VBKA 4Z37A 4DV7F 4U9RA 1ZZNA 4M8LA 2IVYA 3BGFA 4Y0FA 3RBDA 2R4FA 2VDHA 2IRXA 1YITP 4F3OA 3MZWB 2E44A 1YJWP 5J1EB 4LF6F 4W80A 1ZN5A 1KTVA 3NBPB 3SEOA 1FKOA 1SQQK 1YBTA 3SCIE 1HARA 4K4XA 3W63A 2OFHX 1YIJP 3LWMA 2AQ4A 1Q2NA 2LP4A 1TUGB 3DOLA 5L9NA 5EX0A 5E3AA 4IFDK 1CJKA 2YWWA 1PPJD 1RQ0A 4WIQA 1UVIA 2HODB 4M5JA 1HNWF 2CWXA 4DV2F 2MQMA 5HANA 1YTZT 2CNKB 3HSGA 2XV5A 1S1XB 3GIRA 2PD1A 2OO4A 2HYIB 3KLHB 3W62A 3M30B 2Y1LB 3BKUA 1FF2A 1IVZA 2YNHB 3VMAA 2OPQB 2FYUD 2OPSA 5A8KA 1SFCA 4NLUA 1MU2A 2UUCF 2P1JA 3VHQA 2NUUG 5CCGA 3WC2A 1YJ9S 4ANDA 1KVJA 2MDAA 1ZS6A 3ISNC 1LW0A 3AAWB 3CXHH 3CD6P 3CCUP 2QRXA 3DDKA 3V6KA 1S1CX 1ZYQA 4CDIA 4YOEA 2XY7A 1WDDA 1OO0B 4NOHA 4FNHA 3ZZ0A 1P1LA 3H1KJ 3B78A 1XJWB 2WONA 1BQXA 2OAUA 2OYOA 3MUMP 3CCVP 5DGBA 5EWGA 2B4UA 2OELA 2B56A 2AP6A 3JCUE 3BCCG 4GVLA 2PMZD 3ITHA 3O8WA 4WWSA 2DPJA 2E5JA 2HVIA 1ZA1B 4A8SA 5L1LA 3VMYA 4LLHA 3SBMA 2V6AA 3MR5A 5EX3A 3QH9A 3KHGA 4RBTA 2C28A 1NJIQ 2FVSA 3SI8A 3AE3C 4ED8A 1NK7A 1TVRB 3UI3A 1GMWD 1NDKA 3BGUA 3D0GE 4O0NA 2ZVOB 1JO5A 2MZTA 1NHVA 4QW8A 3VN0A 5C25B 2F8MA 4FVMA 1AFIA 4HDHA 2JWNA 1IXKA 3UCGA 5FDLB 1VC6A 3FMBA 1U45A 5E5NA 4O4RA 3QRQA 1YRXA 4HT7A 2KLVA 1AXQA 1TFWA 4OZNA 2LFVA 3RB3A 2WTYA 4RW6B 3BGRA 3KUHA 1S1TB 3H5YA 1VIOA 5IC4B 4DV0J 2CJKA 3TUZC 2W27A 2ZH9A 5AXMA 1LWUB 2N82B 4R5PA 2R7RA 2HBYB 2FDNA 4Y28J 3IGVA 4DSFA 1JNRB 1P9YA 1JJHA 3IR9A 3G87A 1U7LA 4DR6F 3KWMA 1SQPD 5I3UB 2N9YB 1CZQA 2ADCA 4C0OC 3P8CD 4TY8A 2FYZA 1FK9A 1HBNA 2G0JA 1QLED 4HKZH 3QT8A 4C8ZA 5D4NA 1HBMB 1URQA 4DLEA 1Q82T 5HJXA 1HBOB 1Y10A 3I5CA 1HNVA 1Y3JA 5LL6d 4UUXA 2DRBA 1KKHA 1HQ2A 3H32B 4I67A 2LQBA 1G6BA 4WE1A 1RE4A 1OY8A 3EZOA 4B02A 5F0UA 1Q5VA 3DYAA 1TKDA 4OX7A 2A6OA 1BDCA 1Q78A 3J81j 1C4CA 4UOCA 2V5HG 4RWWA 3LGHA 1QD1A 4ED0A 4N6JA 3V2QA 4DR1J 2KUBA 1TAQA 2G2ZA 1YLXA 1L5UA 1RTHB 2F40A 3NRBA 2JLEA 1URRA 1R6YA 2XZDB 1G1IA 3N0VA 2J9DA 1WEYA 1N48A 2WZ1A 2OYHA 3PHEA 2CDRB 3V4IA 2K37A 3A5TA 1IO4A 2W2OP 1TKTB 1JLEA 4IFVA 2QZ8A 3RR8A 1OXZA 3C46A 2WRMA 3R3TA 2GVZA 5D3GB 2DXFA 4L73A 5C5JA 4J91A 4WFAQ 1LFPA 4YB1P 3ZZTA 1YJUA 1YJRA 1SJQA 2DBBA 4LIRA 3KG4A 1NKCA 3BO4A 4YS2A 1E5WA 5CCMA 1RT1A 4X65J 4RESB 5D4LA 3KUEA 3QRPA 2ZT9C 2ZD1A 5E79H 2WVCA 4CYUA 5AXNA 4DUZF 4P7TA 3DLEA 3H1IE 3AJ1A 2RRNA 5B66E 1TR0A 3T97A 3GSDA 3NCQA 3VMZA 3DFEA 2ZUAA 3DHXA 1KHWA 1MMDA 3OTOJ 2XMVA 1ITPA 4ZP8A 1G1XA 1YBAA 8AT1B 1PYOB 4NYZA 3FZ2A 2CQGA 1IKYA 4WFBQ 3PW2A 1HFEL 3W2VA 2UUAF 4ZVHA 4F2SA 2D41A 4ZVFA 4MFBB 3EYZA 4TNOA 1EKSA 4NXNF 1FFSB 3D4JA 3UN2A 3MR2A 3DLGA 5CCHC 3JSBA 1Q86T 1RWVB 4CNZA 4EWTA 4NYOA 4DQQA 3OW2R 4KJMA 3THPA 1ZM2A 2DNRA 2B8PA 1XN9A 2APOA 2ZFHA 2IM0A 2GM4A 3HVWA 4ZPBA 3GJRB