4PV1B

Cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
b'ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
molecule tags Electron transport/inhibitor
publication title Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
pubmed doi rcsb
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4pv1B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4pv1B01
4Y28J 4H13B 4RKUJ 2D2CB 2QJKC 1Q90D 4PV1B 2O01J 2K9YA 1JB0J 2YIUC 2E74B 2ZT9B 3LW5J 4KT0J 1VF5B 3C8VA 4H44B 5KLIC 2WPVB 4IL6X 5KKZC 2WSEJ 2WSFJ 2FYNC 4H0LB 2WSCJ 2QJPC 5L8RJ 2E76B 4OGQB 1S5LX 1ZRTE 4I7ZB 2QJYC 2QIWA 2E75B 2QSIA
chains in the Genus database with same CATH superfamily
4DR2O 5A9GA 4IHJA 2M6YA 4N3YB 3WUTA 2HR3A 1BHBA 1PFIA 2HG5C 4BIZA 5B5EZ 5C39A 1PV0A 4DV4O 2HEPA 5LMNO 3MHSC 3QNEA 2M3EA 1SQPH 3AE5C 2WWWA 3T2MA 3H1IJ 3HE4A 3B8NA 2FYUK 3WUVA 2ZJSE 4OH8B 2ZYAA 3FYEB 4H33A 3S3WA 1NKDA 4O4JA 2ZFCA 3L37A 2CGOA 4QE9A 3E1IA 1S3JA 5CHXA 3K04A 2ZVOB 5EZYB 1WA8A 5EK0A 3CSXA 2DWEC 5LMNB 3MIWA 1S5LH 1YJWP 1JQ0A 2XU6A 3N27A 2DMXA 2YICA 3ZIAG 2KS1B 3CMEP 2ZR3A 5C93A 4I6MC 1R8EA 4JTAB 1IK9A 4J80A 2E3CA 4PA6A 1P84I 2XASA 2EJ7A 1SQBE 1WT6A 1FZCC 1RF0C 4EKWA 3APOA 4HBNA 1LR1A 1R5LA 3AE8C 4E4EA 1JCDA 1KORA 2CK3H 5KTBA 3CB2A 1NTMJ 1XHZA 3P7KA 5APXA 3A0HH 2YI9A 4ZHQA 3GHGC 4HKZH 1AJQA 1YBKA 1ZW0A 5AVTB 3CCEV 3DC5A 2BTQA 4F4LA 4LF5B 3H1LE 2MJZA 4TLFA 2HFEC 1LT9B 1HWYA 2XTAA 3GF7A 1BGYH 1URQD 4JQ0D 1OHHG 5E79H 4CPGA 2PF4E 3SYOA 4X65O 1M5IA 1PM9A 4N23A 4Z2WA 3OMIB 4BIOA 3B71A 3BRVB 4BWAA 3CCVP 2WSSG 3CX5F 1SQQE 4A5UB 1PKXA 3RBZA 2WLKA 4DUZO 2ZXEB 1FAFA 4WY4D 5H2FZ 1TA8A 2W6BA 1LP1A 2ITCC 2LW7A 3ASOB 1Y9BA 3LIEA 1FXKA 1NYHA 1AV1A 1RHZB 2ZCEA 2WVRA 2O57A 3RL0g 2OWOA 4FVMA 3BVHA 2KNCB 4K35A 1KYOF 1NJIQ 2LO1A 2R9IA 2JDIG 2JP3A 2C0XA 5AVRB 4DR4B 2OYIA 1EFRG 3CWBD 3L75J 4B3MB 2QE7G 2QWQB 4X1KA 4JAAA 1ORQC 2BCCH 5IJ9B 1I94B 4LF6O 2KUBA 2WSFJ 5HFLA 2G3AA 4JI2O 1R6KA 2JR8A 3U1AA 1SQFA 1OXZA 5IYZB 4LFCB 5LHGA 1KFMA 3K0GA 1Q7YW 2HLOA 3PTZA 2OYHA 3DTUB 1EM1A 1RQVA 3OGIB 1NTZG 3LW5H 2JVDA 2QSIA 3SJCC 1YZBA 4I0XB 3FGAD 1MZFA 2AHYA 1SQXJ 3G6EP 3JD0A 5CN0A 2YO3A 2OYIC 3OGCC 5FNVB 3JARA 1NU1H 4LF8B 3F5HA 1RFYA 3FD9A 4EFBA 5KAFH 1HDJA 3E22A 1KC8W 2QKAA 3TGUH 4Z1MH 2C9LY 3AECC 1TVKA 1N2DC 4DCKA 4H0LB 3KYQA 2ARHA 4YIOA 2R44A 1QQCA 1T8ZA 5CCHA 3CCVV 2IFMA 1SQVH 1SQBH 2EINC 4BIUA 1KP3A 4JYCA 4UCOA 1XQ8A 4TWKA 4EEQA 5L3BA 1PPJD 5LGTA 1GTWA 4B3RO 2BSKA 3B09A 3GHGA 4O4LB 1GK9A 4JYAO 4H44B 1UIXA 3L70J 4I1LA 3PJSK 1N34O 1P7GA 1J5EO 1U96A 4UB6H 3V4QA 4ASWA 1T6AA 2AXTH 2AEMA 1RF0A 3HD7A 2K9PA 3K57A 4MTOA 1KTMA 2VQFB 2Y0EA 3L36A 1IDSA 1EZVH 4AILC 2QSAA 1JJOA 1RM1C 2N9BA 4JBZA 3KCXA 1QVGO 2WPSA 3CEIA 4OWFA 1QNMA 4H0LD 4ZI7B 2LFRA 4O4LA 3IFXA 1VQ6P 4TQFA 3SWKA 5CBHA 1HVVA 1JO5A 1M1JC 4JI7O 4TV8A 2IZ1A 5AW5B 2QEXV 4Z1MG 2ITAA 3H1KE 3M8AA 2UXBO 1BZKA 5DECA 2QWPB 4AI8A 1A32A 3RYIB 1EC5A 1ZXGA 1PL4A 2JEUA 3N4XA 2YMKA 1WRGA 1XOUA 5CBOA 3P3NA 1RF1A 3EXAA 4EFEA 1VF7A 4DV1B 2OIEA 3SGIA 1NAYA 5KLVE 2FYUJ 3CXHE 2OTJP 1WB7A 1NVPB 3K08A 1NH4A 4PDLA 4R50A 4GUNA 5AW2B 2CUGA 2ZQMA 3EFGA 3EHBB 2EZPA 1F51A 2E75B 3K0DA 3M91A 3WU2H 1OCCB 1K9MW 2XAQA 3K59A 3AEEC 2M7WA 2H88C 5KAIZ 4IOIH 3RK3D 2OGUA 3CE2A 1NR1A 1LTJA 1B04A 2WAMA 2YIUB 3OD4A 5E1AC 5L3GA 2JIZG 5CA0B 4JYAB 3L9DA 3BPZA 3L72D 1M7LA 1NAFA 2A45H 3M0DC 4I50A 2JS3A 2AZ0A 5GTIE 4WBAA 4TV9B 3JSNA 4MVOA 4WFHA 4GOFA 1S2EA 1FFXA 1HR0O 2K9YA 3FFQA 3HKDA 3B40A 3PN1A 5KHKA 3D36A 1SQXE 1NTKK 1JR9A 1LWUB 1LTJB 1DEBA 4IL6X 3D8CA 1SQBD 1EZVG 4ZHQB 5GW7A 1VQPV 3CI9A 1T2KC 2QTSA 1PPJH 3L74J 2R9AA 3ABVC 1BE3G 1B3QA 1ZOYC 5KJ7A 1BE3D 3CCEP 2AW9A 5B66E 1ZUQA 1AR5A 3HKBA 3P8MC 4RO0A 1VF5C 2N9YB 1SC5B 3NFQA 5JVDA 5APQA 1M90W 1JEKA 4X1IA 2YDEA 4N78E 1RF1B 2ZNIA 1X79B 4PI0A 3AG3B 4MW8A 2WPRA 1BSMA 4O9BA 4JF7A 4O4IB 5CMZA 2FFDB 5J2TA 3HUSA 3R66A 1XMQO 3KQGA 3JAWB 1G1JA 1SZXA 1VQ7V 2JGDA 3AE4C 2BCCD 1IX9A 5DJTB 2BCCG 1GN6A 2AZ2A 1JFFB 1BGYD 2Q9IA 4C7NB 2UXXA 4L76A 1QX8A 4Y99B 3L74H 1FJPA 1QU7A 4ASVA 2WLMA 2YSUB 2Y9YA 2R72A 3SR2C 1P7BA 2BTOA 4CC5A 2YKPA 1JY3O 4KP4A 4B7EA 5CA1B 1BE3H 4IFFA 3G3ZA 1L2PA 5H2FE 1M57D 3ABUA 1Y74A 4EDFA 3AG1C 4JI5O 3CXHD 1GM7A 3A8TA 1AROP 2WA4A 1BHAA 2DN9A 3H32A 5KMGA 1K97A 1KV4A 1PL5A 3LDEA 3HE5B 1V9PA 4UB8Z 1KU9A 2K1EA 4J9YB 4DK1A 2KSJA 3A0RA 1M1KW 5K1XA 1OIPA 3PP5A 1D7MA 3H1KH 1KYOD 3CCRP 3H1JH 5CCHD 4CH6A 2WLNA 4BAYA 3WUUA 2VWJA 5EBWC 1M90Q 1T3JA 1ZTEA 5EBLC 1MSDA 5L8RJ 1HGZA 1NTMG 2PTMA 4I7ZB 5D5QA 3B8MA 4DW0A 2R5DA 2DYRC 2HLDG 1NU1K 1YJNV 2Q8VA 2E5YA 2W0XA 3SYCA 1KBHA 4NPEA 2CGNA 4AQYO 1VDFA 1XHXA 4X1YB 4BW9A 1H2MA 3VP8A 3TXQA 2PFXA 2P22C 5AW8B 3AG2B 4JASA 2E75C 3Q5PA 3WG7C 1NTZK 3AG4C 1FKAO 1VQMV 3CX5D 1SQQG 4GKJO 3SWFA 5AVYB 2ZNJA 1Q82Q 2A06H 2HP8A 3VMXA 5FLXN 5GONA 3C3SA 2YIUC 2YIBD 2KSDA 3BEHA 4MSWC 3TGUJ 2AEFA 4W7ZA 1H89A 4HAMA 2K3RA 3TYYA 2RCVA 5IJ9A 4U7JA 3QWOC 2A0LA 2LGQA 1ZLZA 4I9QA 2ZT9C 1P84H 2NZ2A 3M06A 1SQXH 2OTLP 3LDDA 3JSLA 4R4LA 3M0DA 4GODA 3T1YO 3F7VC 5B5EE 4PD4E 3TDKA 4FM2A 2LGWA 1TGOA 4LGDE 1QLNA 1AA0A 4FIPC 1HNXB 1OCZC 2PYLA 3E22B 1S77D 1P49A 1K34A 1OCOC 1SFCC 4ABMA 1H2SB 5GONB 1LTJC 3L72E 1PD3A 2W6JG 2BEQD 2IYOA 1S1CX 4C46A 4W4LA 4XDKA 1F4NA 2XNXA 2RN9A 5H2FH 4I4TA 3VP9A 1DX7A 3D70A 1OVRA 5EC2C 1YITV 1XREA 4JI4O 1Z5WA 3NR7A 2C0WA 1E5WA 5KLVJ 1PL0A 1K7DA 1G1IA 3H1HD 2XUMA 1N73A 2EJRA 3WB1A 1EN6A 4L8JA 2FBWC 3G6BA 3BRCA 4QPKA 1RSOB 5TISZ 1XTGB 1KB9H 3E8FA 1L0LE 1SQVJ 4GOEA 1RF1C 2GSMB 3VQWA 4GX0A 3KXDA 3ICXA 5KA5A 5LXTA 2YC0A 2YIDA 4LFCO 2XDJA 5APVA 1BS3A 3I5DA 2ZDIA 5KAFE 4MTXA 3RVYA 1URQC 3TCUA 4MVMA 4WF9V 4B3MO 2KLUA 2Q5ZA 3CRCA 4RESB 4NTWA 3OA7A 3CRAA 3FX0A 5AW0B 5LOVA 5EBMC 1XDCA 1F7YA 2P67A 2F95B 1EZVI 2Q4PA 1SLQA 2W6IG 3LNNA 4NPDA 2IPPA 3OMNB 4NPFX 4HYOA 3HR0A 3HB3B 3OFNG 5KA6A 1OCRB 3OW2U 1EBOA 2QA4P 4DR7O 1GU4A 3K79A 1GM8A 1Q5OA 3L4FA 3RYCA 1BGYE 3CC4V 3CRQA 3BASA 5JVDB 1QL1A 3HD7C 3N7NA 4LF5O 3JASA 2P7JA 5AVUB 3JASB 1FPOA 1PNKA 3BA9A 4CZZA 1QLEB 2EILC 4AYCA 3A3YB 1DLBA 2QWRB 4FFBA 5CBFA 2D2CB 5IDJA 1XMOO 1SS1A 4W80A 1Q90D 4O2AB 3CCMP 2XT9A 1VF6A 1N73B 3ZHVA 1V54B 3E8HA 3QTCA 4H13C 4X9QA 2VS0A 1OWAA 2EULA 2ILMA 1QVFU 1QBZA 2JGDB 3CX5E 3CX5I 1OJHA 3ZHSA 4D7SA 2CPBA 2H89C 3E7KA 3H1ID 4I7ZC 2QJ1A 4GT1A 4FLYA 2DYRB 5KHHA 2GTAA 4DOJA 4LFBB 3L74G 4DV3B 3IFMA 3OAKA 3H1HG 4QGPA 1JMKC 2UXBB 2ZE8A 4I50B 2AXTE 2YMYA 1OMIA 4OGQC 4PDMA 4GYCB 3CCJP 2W6AA 1VQNP 3L71J 3EQ2A 2G8YA 4B86A 2A06E 1MZ9A 3L72H 4LFAB 3CD6V 1VQKV 4PI2A 1R73A 3AG4B 5DN6G 1VQLV 1X4TA 2Y48A 3M9BA 3RYHA 5L3FA 2UXNA 1Q81W 5H6QA 2UU9B 4IFMA 2OYHC 4FJCC 1OCCC 4FM1A 2QIWA 1OZHA 1P84E 5LBQA 3AK2A 3JCZA 3U0ZA 3WU2E 1NBMG 3OEEG 4JI3O 5J9PC 1FS0G 1H2LA 3L71G 3RGUA 2QR4A 3HTKA 4KHPO 5L3EA 3JD2A 2KB7P 1L4AD 1NTKG 2L5GB 2QG4A 4DV5B 1E1QG 4B08A 4OVNF 1R1BA 2VRZA 1NZ6A 4KJMA 4ZNCA 2YEVB 1I5YA 2WSEJ 2GUZB 1XNRB 2FYNC 4X1YA 1M8OB 3J81N 2QKCA 4DV0O 2QJKB 3H1JJ 4KXRA 4UFZA 2X6BA 1N33O 3E8GA 4U3FJ 1Y8AA 1YJ9P 2KKWA 1FOSF 3CMAV 1G1XB 4RUFA 4O4HA 1A02J 1GD2E 1K4CC 4CS2A 2O3JA 3LDCA 3T1CA 4DR1O 1W2EA 3VYIA 5B3SB 5TISH 1L0NE 3APQA 2N04A 5APWA 2KI7B 2QM4A 3CWBJ 1AVYA 3L75D 5JQGA 3Q4HA 1M93A 2P06A 1NU1G 1KQSO 3L35A 2H43A 3B5NA 4HNAB 3CWBH 3SPCA 1THZA 1PGQA 5APSA 1MA1A 3L70H 1SQQD 1FZCA 1KMIZ 3O65A 4PA3A 3L73G 1ZSPA 3VQXA 3TF5A 3I5CA 3W67A 1ZR4A 4L73A 1SESA 4FLXA 4RWUA 3UCSC 3FAVB 1XNQO 4GIFA 1RPOA 2AXTZ 1L0NG 2OTLV 4JI2B 3N2GB 2XHBA 3GW6A 3L72J 1NWQA 1LP1B 4M3LA 5AW6B 3CC2V 2BE3A 2ZXWB 4DO2A 1AJNA 5APTA 1K05A 1XI1A 3V2PA 4GKKO 4X88A 2WSEH 4ZI7A 3CXHI 4LLHA 4Y99C 5E79Z 2JK5C 1YVWA 1IFDA 1RPRA 1KKDA 3CMAP 2GTSA 4L87A 3SSUA 3CCSV 1KQGB 2N05A 2KSEA 3FXDA 2Y0IA 1G4YB 1MOFA 5JCOA 2FL4A 1HH0A 2N74A 3FKSG 4Z1VA 1SERA 3OTOB 2Z4EA 3ETEA 5APUA 3JD3A 3R2PA 1L1FA 5KAIE 1BQZA 5HFMA 1V54C 1BGYG 3SJQC 5F2VO 3RYCB 3U1CA 1YITP 2Y0DA 2E5LO 5IYZA 1S5LZ 1SF9A 4O2BB 5AVSB 2KS1A 4UUJC 2E43A 3G4SV 5EFWB 1DTOA 2EBOA 5EYPA 1PPJG 4C7NA 1YTFD 3C8VA 4QE7A 3UO2A 1IXMA 4LF9O 3W7UA 2Q1KA 3ZRWB 4UV9A 1L4AB 1FZAA 2ZINA 2MK3A 3CCQV 1O9HA 4J7JA 1QLED 1UIIA 4RO2A 2WPDG 3IF4A 4JI0O 2IU0A 1PP9H 3HUSB 3P3PA 2IDBA 2DW4A 2B87A 4BW5A 1BGYJ 4DR5B 3ZX6A 3K5NA 3GVMA 1TU3F 4EOTA 5B66Z 4JI8O 3TGUG 2JS5A 4I55A 4DR3O 3L73D 4K0KO 1R3IC 1AB3A 1VQOV 2IJIA 2EINB 5LMUB 4D7TA 3GG2A 2Y69C 1FJKA 1K9MQ 3ZMZA 1SKVA 1NTZE 1AQ5A 3FYIB 4JI6B 1LUVA 3FXEA 1RSOA 3ZS8C 1G2CB 3M9HA 2OYHB 1FYJA 3JD4A 1QHTA 3SPGA 2G38A 1JVMA 3S3XA 2ZYGA 3S4RA 3AG7A 4H44C 1SQGA 1PIXA 1NTKH 3ABMB 2V4DA 1WMKA 3K5MA 3C3TA 3M99B 1FDOA 4FK5C 4FZ0A 1H2KA 1X59A 2CTQA 3X2QC 4DXWA 5AVZB 2QWOB 3Q5SA 3JALA 2FYUG 3AEFC 3MZWB 2A45G 4I55B 1AI6A 5BU8B 2ZT9B 4OX9O 2FB5A 1XBLA 1L0LJ 3J80N 4J9ZB 3BAAA 1RM1B 1FE6A 4NTYA 1SQQH 4U3JA 3MDSA 1H8AA 2PAJA 1ZRTD 3HKCA 1G8MA 1IO4A 3Q2YA 1V55C 5BZBA 2W27A 1VQNV 1HJ0A 3KZIE 3D6YA 1OCOB 2CDYA 3TXSA 5CA0A 2P5OA 3CJHA 1VEWA 3SJBC 1VIBA 1G6UA 4G27B 3H1LG 5B1AB 1M1JB 3E35A 2E75D 2ODMA 4ZKIA 1MG1A 2YNYA 2IBZH 5B3SC 2P58A 1AP6A 1YEWA 3GWOA 4LWSB 1PP9J 3P8CE 2HKOA 3HE4B 3SPIA 3ABKB 4DV2O 1GAXA 1MFZA 2P7TC 1W2BU 1BCCG 2A7WA 4GCZA 4UB6E 1IBMO 1IFJA 1HNWO 1NI8A 1VQKP 2OIGA 4B3SO 2R5BA 1JA8A 1YJWV 1DD4A 2XAJA 2ZE6A 4MVSA 2E76C 4YHHB 3QG5A 4B7KA 1I5XA 5IJ0A 3CMEV 1BE3J 2UXDO 3B5NB 1AR1B 3RK2D 4QPJA 2JEEA 4DR3B 1NR7A 4YXDC 4JI8B 1L0NK 1R5SA 2RN0A 3OW2O 1HJBA 5AVVB 5D5PA 2XAHA 4TV8B 2KZJA 4HYTB 2KG7B 3FB8C 4PELA 3RL0D 1FZGA 2YIBA 2HG5D 1AFOA 3ZMTA 5IY5B 1N7SB 2IBZG 5CBGA 1LT9C 1I08A 3RK3C 5KLIB 4PJ0E 3SJAC 5BXZA 3CCMV 4X62O 2W90A 3THOA 4YXWG 1VQ7P 4PD4I 1VL2A 5LA6B 1JY2P 2N1TA 2B1IA 1S9KD 2H94A 3JAWA 2PGGA 1L0LK 5GTHE 2E42A 2CTRA 4X89A 3ASOC 1KB9I 3RYFA 4YJ3A 4IL6E 2F93B 3B5ND 4F6RA 1FAVA 1R3KC 1M56C 1LT1A 1GTOA 1J1EC 1GZLA 3H1HJ 3HTKB 2YXRB 1LWUC 1FXVA 1LNQA 1QLEC 2EILB 1W5CE 2QJPC 3BCCJ 2FYUE 3AK1A 3FWLA 3H01A 1WB8A 1XEQA 3K9SA 1SZTA 3AEIA 3G71V 1MMMA 4I0XA 2I1KA 1Y74B 1PP9E 4HJGH 4UCTA 4OPAA 4PV1B 2KIKA 3AEGC 5KUMA 1KD1Q 4O4HB 2IFNA 4HZ3A 2DOSA 4ZMDA 1L4AC 4X62B 3ZMVA 1NKZB 4IL6Z 2OYIB 1XTCC 3K5OA 4XDJA 4D6TJ 2AHZA 2FXPA 1IBKB 2K9JA 4JI1B 1YTFB 4NTXA 3GWKC 2JO1A 3AG3C 1USDA 2W6JH 3ETQA 3HKDB 3ZHUA 2JDIH 3L73J 1FFXB 3SDLA 3G6EV 1NOHA 1KFNA 4U3JB 5LHHA 4LNUA 1XNQB 3OAAG 2Q0AA 4I5SA 1VQ9P 2WZ7A 1SA0A 1N36O 3GLMA 1YJNP 2LR2A 2MKVA 3JARB 1Q3EA 1J1DC 4JV5O 4NVPA 2KLVA 4DV6O 2UUBB 3BRTB 4FLTA 2V1DA 4IIJB 1OFCX 5JJEB 4MTGA 3ABMC 1MFTA 5BR8O 2XNDG 4DT0A 1OX3A 4BWNA 3M0AA 1AR4A 4YIPA 1KUQA 3EFFK 1ZLLA 1H2NA 4UVCA 1BT8A 2PI4A 2DWDC 2ATKC 4N21A 3D71A 3AG1B 1YJ9V 4DV2B 3CRMA 2P90A 3OJAB 3JSVC 1ZV8A 3K58A 3ETDA 3IGAC 5LYJA 2FY8A 3F5WC 1S72V 1LWUA 4BXLA 2N1TB 4UB6Z 1A02F 5H6RA 4DYLA 3KKYA 2IM9A 5KKZB 2ZIMA 1P4RA 4DR6O 1IFPA 2Q69A 4LH6A 3BCCE 3CWBG 3CX5H 1Q86Q 2LJ2A 1GL2C 1FBMA 4FZ1A 3VOUA 4YY3O 4BRYB 3OE7G 5TJHA 3MUDC 2B1GA 3A0BE 3E89A 4J42A 1IFMA 4JAVA 4QNHB 4RAIA 2NPSD 4HB1A 3CCQP 5B1NA 2HODA 3L71D 3CCRV 2KP8A 5J2UB 1P84D 2CH7A 3JATB 3U10A 1CZQA 5JJJB 1PP9D 3ABKC 1PV3A 4FFBB 3CHXA 3L73H 1S5LE 2NPSC 5KMGB 1H88A 2IU3A 3CS5A 5CMUA 2UU9O 1JM0A 1VQOP 4XDLA 2Y9ZA 3FWNA 5LXTB 3JALB 1R6NA 1AJYA 3E83A 2DQ0A 2E76B 4ASUG 2Y0PA 1W0KG 1WN7A 5LYJB 2QEXP 1NTMK 4J10A 1BE3E 2UUBO 4GDOA 5KLVD 1KC8Q 1OVVA 1MZEA 5CA1A 4IFDK 1FFTB 4WCEV 3A0BZ 1N36B 3D3IA 4IYHA 1U57A 2IJJA 3M9QA 5AW1B 1S5HC 3SFEC 3IJ4A 1BMFG 3LNMB 1QVGU 5J2UA 4IYIA 4CC6A 1DK1A 1T3UA 2RKLA 3W7TA 5LL6Y 1SQVG 2ZXWC 4WBNB 2A06D 2QRXA 3RK2B 4JI0B 4IIJA 3P30A 1M9NA 4G2KA 2BSKB 3FB5C 4TT3G 2FFDA 1H0TB 2UUCB 3L75E 3CRRA 4U3FD 4AUWA 1Q6IA 1K8AQ 4BRYA 3JYCA 2QM7A 2EIJC 2B87B 4W7YA 3BATA 1I7FA 4L74A 1RH5B 3R4YA 3UIAA 3ABLC 1D5NA 2P4KA 2E5LB 1RE3C 4EB6A 4U7NA 2FXMA 4TSFG 2NRGA 2Q7EA 1T5EA 3DGEA 2ZYDA 1HNZO 1NT2B 2BOCC 4LF4B 4UVAA 2QJPB 3SYPA 3BCCD 1R3JC 1R3LC 1KILC 4HNAA 4MW3A 1URFA 4UCUA 3JCUH 1GW3A 2OCCB 2F23A 1HNZB 4LF4O 2I8DA 1AILA 2QJYC 4FLWA 1KILA 3TK1A 1COWG 4XE5B 2ZE5A 4WY4A 1NQTA 1NH2B 4RJTA 3OUFA 2UUAO 2K1AA 3CCLV 2KXPB 3H1JE 3PH0A 4MVZA 4X8AA 1PP9G 1GU5A 2EIMC 2A9HA 4D6TE 2JRIA 5H9CA 1N0NA 4KT0J 2ITDC 3AE3C 2GM4A 3V2RA 5KX5B 4I9WA 2F4VB 3ZDMA 4YJ3B 5BVZA 3GMAA 3U11A 4TUYB 3H1KG 2OQQA 2FFDC 2DYSB 3BCCH 1R6TA 1BCCH 3LUTB 1J1DB 2Y69B 1MKMA 3CYOA 2XZRA 2C9NY 2HVJC 2P10A 5AW7B 4WFGA 5ITZA 3IC9A 2YI8A 5EIBC 2Q3IA 3ZN1A 4YHHO 3ZRVA 3PRJA 1N7SA 3ZEDA 4DV7B 1IZ3A 1NTZH 4PA9A 5JH7A 4LF7O 1PGPA 1Z2GA 3I55V 3FAVA 4OGQD 5LP6C 2WLJA 1OCRC 4WFBV 5KLVK 5B1BC 3AE6C 5GTHZ 1FJGB 4JI4B 2R32A 3E8BA 1JY3P 1Q2NA 3Q1MA 1IFIA 1AJPA 3X2QB 2FTKA 5A2QN 5IJ0B 1N0JA 3UO3A 1L0LH 2HHHB 3BY6A 3CXCU 3RYFB 1N8RW 3A0BH 3HE5A 1KECA 2C2AA 5GTIZ 2NPSA 5JQGB 5FL7G 1IVSA 4J7ZA 2PRRA 3AEDC 3JAKB 3USSA 3ABTA 2KK7A 1FXKB 2KQXA 2AXCA 3OM3B 2CK3G 1NTKJ 2WLHA 4OPHA 3HKEA 4ZKUA 1IBLO 5IE9A 1RE4C 3RK3E 3NXSA 4U7OA 2Q6QA 5AVWB 5CCGC 4YY3B 2L91A 5AW3B 4CH3A 4X66B 3MUDA 2Q68A 1KYOH 2DJVA 2OYOA 2Q3EA 1IZNB 3MP7B 3H1JD 3UM7A 1GMGA 3CXHF 3OUSA 3IR9A 1CEZA 1WA8B 1RE4A 3PHLA 1ZL8A 3H1IH 4B3TO 2GUZA 2NPSB 2Z5IA 1XL6A 3E2EA 2PP6A 4KUMA 5J2TB 3W7WA 4U3FH 4O4JB 3RW0A 5AW9B 5KHGA 1X9VA 1WAZA 2F1MA 4WFFA 2Q6AA 4JGSA 2Q7HA 4UCVA 1NKNA 4NXMB 3T4DA 2FMLA 3ZHRA 4X1IB 2HVKC 1DEEG 2WLLA 5BR8B 1SP4A 4EYYQ 4P9OA 1JMBA 5CB4B 2WSFH 3QH9A 3H1KD 2K88A 3B5NC 4PJ0Z 3GHGB 3KZIZ 1QCEA 3L75H 3N2KB 5LMUO 5KHIA 1SQQJ 2R9RB 4GZRB 4P9PA 2JGUA 3SPHA 1EDIA 4K0KB 4DUYO 1FDIA 1QEXA 2J5UA 2CPSA 5IY5C 1N7SC 2BASA 1JFFA 5KLIC 1G2CA 1LTGC 1HF9A 5CBNA 2LXCB 1U97A 3HKCB 2X7RB 4PA7A 1IBKO 4X20B 3CL3D 3L72G 4N78D 2GBOA 1GMJA 1FDMA 1LTTC 4O4IA 3ABLB 1N7SD 2J58A 2QE7H 2LXBA 5APYA 2IJHA 4MVUA 2H8PD 2QJKC 1BCCE 2FKWB 2Z5UA 1WP8A 2MW2B 2W0FC 1LTAC 1XMOB 3A2FA 5CCGD 2ZM6B 2NNUA 3ZJZA 2AGAA 1HTLC 1SFCB 1SQPK 3F89A 5M1BA 1JOYA 1SQPJ 1GRJA 1K5QA 2OCCC 3W7SA 3O9OA 2B89A 3OTOO 3G80A 4BR6A 1PGJA 2Y0CA 4WY4C 1DIPA 1K92A 4MN4C 3ZMUA 3FX7A 3AK3A 4L75A 4DR7B 3QO8A 2Z0AA 1VQ9V 3KZIH 4HH2A 4PJ0H 1E1RG 4LP8A 1NS1A 2OYQA 2O01J 3O6QB 4W4KA 5KUKA 1JJ2U 1XILA 1NHLA 1SQVD 2LKMA 1YCIA 3SFDC 4PV1D 2ETNA 1OW8A 1RE3A 2JWDA 1Y47A 4GKKB 3ASNC 1YHQP 4J7KA 5IWAB 4TQDA 2ZM6O 3TNUA 3HD7D 1ZN5A 3JAMN 2I1JA 1FZFA 1JY3N 1KQLA 2O01H 1EXIA 1EDLA 2CAZC 4UB8H 1M57C 5IYBO 1EQ7A 2QWNB 4K8ZA 3MGNA 1K73Q 2IJKA 2Y4UA 3R65A 1QGKB 2UUCO 2Q7CA 3L70G 1JNMA 3LSUA 1YXBA 1F4MA 1S76D 2KG7A 4A7PA 2A79B 3UKMA 2DQ3A 2XV5A 3TGUE 2ZT9D 3MTUE 3CCUP 1NJIW 3E86A 4IHJB 3CCLP 2NR5A 2X6AA 3BA8A 4JTDB 3JC22 1DD3A 1USEA 2PYJA 3HD7B 5E79E 3W7XA 1N32B 1ZAUA 1S4XA 4FM0A 3ETGA 3MD0A 4WFAV 3T97B 2D2CC 1S9KE 1YTZT 3T1HB 4YJ2B 5C8YA 2UWJE 1N33B 1HUCA 1VQ5V 3HPLC 4NXMO 4JAUA 1U7JA 1K33A 3T1YB 1NU1E 1FXHA 1JPXA 2HYNA 3BFRA 5IYCO 5ITZB 3VMZA 4NR1A 4KHXA 3K3WA 1NGMB 3HKEB 2Y4TA 4FPPA 2BCCE 2XAFA 1EZJA 2RNBA 4MS2A 4GX1A 1SFCD 5DEDA 1SQVK 2CE4A 3H25A 1GL2A 4GKJB 2O1JA 2ZE7A 1LTIC 2FYUD 1BSNA 2JKVA 2Q73A 2X0LA 3RT3C 2GDSA 2YS8A 5FNVA 3AEBC 1MNGA 4DR6B 3H1IG 3H1KJ 4JYYA 1BCCJ 2QVAA 2KZIA 4DV1O 3ZRXA 3CCUV 1NTZD 4JI6O 2R3SA 2NN4A 1EN5A 4NXNO 2Q9LA 1B06A 4F6EA 2E76D 5BMVA 2HJDA 3STLC 5KHJA 5JH7B 1YTZI 1OW6A 4LCUC 3V2NA 3DSQA 4ZBMA 2E74B 2KYVA 3BABA 1SQVE 1VQLP 5IT9N 1EZVE 1IJDB 1UFIA 3CCJV 4RQEA 4R4MA 3AEAC 4QIWF 2KNCA 2FYZA 3ML0A 1JUNA 3L73E 1Q8IA 3UT5B 2P1JA 5KAIH 2P4VA 1GDTA 1H8HG 1JCHA 2OARA 4D6TG 2D2CD 1VQPP 2EZOA 3OR6C 2FYNB 5AVXB 2L6LA 1TVKB 4LH7A 3H1JG 1X22A 1V55B 2VWKA 4TV9A 1GN4A 2XNDH 2YO2A 4UB8E 1TUBA 4KFMA 4LR3A 2WSCH 2YKOA 4ICGA 4K3AA 5B5EH 1SQQK 2YXYA 5B1AC 5BMVB 4DZOA 1AI7A 1YYCA 3HKBB 4JI1O 2V7QJ 4MVRA 3CPWO 1H8EG 4GKGA 1L4AA 1WLEA 2WPVB 5EC1C 2QJYB 3L74D 1J5EB 1AP5A 3A0HZ 1OV9A 4ZKPA 4TOIA 3ZHTA 1NTMD 1NU1J 4F6RB 4B3RB 4EIJA 1Q7YQ 5JCOC 3IAOA 1E79H 3G71P 3B8EB 2IH3C 1SQBK 2BEZF 4D6TH 1NTKE 4ZOLB 1UPGA 3LSSA 5BY1A 2V7QG 3BCCG 3I55P 2ZR2A 4P30A 2NLJC 1FS0E 3V5BA 4UXNA 5KLVH 2EIKB 1H0TA 2RDCA 5L3CA 2DYSC 2LQTA 1EN4A 2YKQA 2J59M 4R6ZA 1VQ4P 1RP3B 1AVOA 2W83C 3VMYA 1GL2D 5CCGA 1YQ3C 4WWIA 3RGBA 3RK3B 1JY2N 1JOCA 3CXHH 1H38A 4R8CA 2F66C 5FPRA 1HW7A 5LOVB 3KDPB 1PGOA 3TNUB 2B9BA 2RQ6A 5KJ7D 1I0HA 2P2UA 1LTSC 1Y4MA 1WJZA 2ZXXA 2GV9A 3VOPA 1SRYA 4Q6GA 5B1BB 4YTPC 2PI5A 3N2KA 1EZVD 4YXWH 4DRXB 1AVMA 3FB7C 3C1LA 4LF6B 1M56B 3EVKA 5K1PA 2YXQB 4H13D 3H6PA 2V7QH 1J1EB 3AE9C 2FXOA 1BQ0A 4LWSA 3E1RA 3IC7A 5LP6A 3CC2P 4K8XA 2O1KA 4NXNB 2O01N 3CCSP 2L35A 1K4DC 2RMKB 2P6JA 4DJGA 1WPXA 1HNXO 1S72P 1YF2A 4AHCA 1WNSA 2HODB 1JY2O 1HNWB 3DC6A 2IW5A 2CH7B 3JATA 1KP2A 1L8DA 2WT7B 2E74D 1MSWD 1VQMP 3RL0C 1XNRO 1ZP0C 3ZRSA 3V2QA 4NKGB 2K37A 1GO3F 1SA0B 1KQSU 4RQFA 1YHQV 3VQVA 1QR8A 3HUSC 2LW1A 1JMMA 3RN4A 3A0HE 5GTIH 2QGNA 3K9AA 2CTPA 3MHHC 1Y76A 3ZRWA 1DH3A 3AG2C 1US6A 2WPQA 3WG7B 3SYQA 2XOKG 5KX5A 1BCCD 4N6JA 1NTZJ 3G4SP 3T1HO 2WA3A 1QL2A 4FLUA 4WVZA 1ZRTE 2YXHA 1RQUA 3AE2C 1FU1A 4IL6H 4JPZB 1N32O 4LFAO 1Y66A 2ZD9A 1KYOI 1K8AW 2IBZE 3DXRA 4J41A 4OXSA 1K3EA 1ZR2A 3STZC 5K5GB 4P2ZA 1NTKD 2N1TD 2ZVNB 3S1KA 1FJGO 1AI4A 3J7AU 3H1LH 3D36C 4JI7B 1L0LG 4X1KB 4XFJA 1L0LD 4DV3O 1KILE 4LFBO 1HWTC 4DV7O 4Q20A 2ZKOA 3Q3DA 4DV6B 1GL2B 2IH1C 3D6ZA 4JV5B 3ITKA 2FYUH 1VQ5P 2M8RA 4CH4A 5B1OA 3NTNA 2JJ2G 2YXLA 3RFRA 1N7LA 2VRSA 3OMAB 2V4HA 4DV4B 2FKXA 1FC2C 4GX2A 3KCYA 2QTOA 1QVFO 1J2JB 2Q7GA 4PDVA 2VQFO 2IBZI 2UXCO 2GA1A 3NMDA 3B2EE 3DXRB 2F4VO 3MHVA 4JYBA 4E2LA 1CSBA 5IWAO 4NYKA 5LGNA 1CP9A 2KOGA 1FOSE 4CS3A 4LF9B 2JJ1G 1PNLA 1S0VA 1NU1D 1GN3A 2H7HA 1H2GA 4PD4D 4YPCA 3BHPA 3JCUZ 1CPYA 1RY3A 3FB6C 2F43G 1ZX3A 2HPCB 1XL4A 2PUSA 2YIAA 3M7MX 4MT8A 2W8ZA 3V6IA 5GTHH 2PY5A 1BDCA 4CS4A 1F23A 1SQXD 1Y76B 3O8ZA 5AVQB 2EIKC 3OR7C 3ZCCA 1YIJV 2B5UA 2DW3A 1N4CA 1L0ND 3CP1A 1Q6HA 1SQBG 1VQ8V 1Q43A 4ZIBA 4KL1A 1XMQB 2QA4V 4MVQA 4G28B 2RMZA 1WPBA 5AG2A 3S9OA 1MABG 1GKFA 2E5TA 1CXZB 1Y6XA 1S5LX 3CJHB 3GF3A 4CBCA 1SS3A 1M1JA 2WT7A 4FMTA 1N86A 3H1LJ 1K04A 5TISE 2GHYA 4GX5A 4WBNA 3T97A 4PD4H 1IXBA 1LTBC 4R7CA 1KB9E 3Q5RA 3VQYA 3OEHG 4TT3H 4JPRA 5CJ0A 1JX9A 2DE0X 2B9ZA 2XKMA 5DJUB 1SQBJ 5KAFZ 1DGSA 4WB4A 2RJZA 3H1HH 1YSCA 3K03A 1IK7A 1DF5A 1UJWB 3H32B 2IYPA 1W0JG 3QO5A 2Q67A 4ZOLA 1KB9D 4XA4A 3P32A 1I94O 4J11A 3ZMSA 1NTME 4DUYB 4UCRA 5L3DA 3QVNA 4DR4O 1KB9F 4DRXA 1GK6A 3LIDA 1FZEA 3JD1A 4PA4A 3SYAA 1EDKA 4LC1A 2QM8A 1D2DA 3G9RA 2ADQB 4FFKA 3T4ZA 3CPWU 1AQTA 1VF5D 2SPZA 3F7YC 2JJLA 4LBEC 3II6A 3RL0B 3LW5J 4PV1C 2X6CA 5DM6V 1N8RQ 3D3QA 1SFCA 4DUZB 1EDJA 1VP7A 1CI6A 1TUEB 3CD6P 2VQEO 3IN6A 3SPJA 5EZYA 2PZSA 1YI2V 1VQ8P 3K06A 4D6TD 4OGQB 1OVUA 2BCCJ 3WB2A 1KD1W 1ZMEC 4B3TB 5CCHC 2LP7A 2WLIB 1GN2A 4LNUB 1HBWA 1Z56A 2WLIA 1JCCA 1KILD 3O6QA 3SWYA 4X66O 2LFSA 1CW5A 4DV0B 4H44D 1KKCA 3ZHQA 3B4SA 4GLXA 4X20A 3UT5A 3RBXA 4UVBA 2QKSA 3QO7A 4IT5A 1BDDA 1IC2A 1NO4A 2ZAEB 1IBLB 3OTFA 1QR9A 4WFEA 2IBZD 1OW7A 1W2BO 4OX9B 3GB7C 3RYHB 2R3CA 1MV8A 4QMAA 1BL8A 3F5TA 1GK4A 4KHPB 2POHA 1Y67A 4O2BA 5FPOA 3IAYA 3B77A 1NVOA 1SQXK 4X64B 1WP7A 2HFED 2E74C 4AQYB 3PLNA 2BOBC 1FD9A 2WLLB 2HHHO 1ZWIC 1PNMA 4UV8A 2OT5A 5CB4A 2WSSH 1T2KD 1NH2D 1U7MA 1KN7A 2N1TC 4C7UA 3K5LA 3VTPC 1JTHA 4LF7B 3WMM0 5KKZC 1M4UA 2IX7C 3L75G 3KPEA 4H37A 2WQYC 1Z5VA 1FXKC 1KZUB 2OTKE 1PPJE 2GUVA 3JCUE 3H9VA 1CI6B 1OCZB 3WFVA 4U3FG 4IGGA 5AW4B 1YI2P 4DW1A 1W59A 1ZL8B 4PHZA 1FZBA 2OCHA 1LT9A 3L70D 2WITA 2BTQB 5EYPB 3AE1C 3WU2Z 1GW4A 5LGUA 3A2AA 4DR5O 3RVZA 1AI5A 1VMGA 4XBFA 1SQXG 1Q81Q 3AE7C 4DR2B 1K73W 1EXJA 1ENVA 4X64O 3RWRD 1NVPD 2JWAA 2WMMA 4FLVA 1LUWA 1M56D 1VQ4V 2XAGA 3L71H 2Q0OC 1VF6C 1YQ4C 2A45I 5C8YB 4YJ2A 1HP8A 1VQ6V 1N34B 2M5AB 3I56P 4JI5B 2KB1A 1SQPD 4PDRA 1SQPG 1D5AA 4CH5A 4DK0A 1FZCB 1MUUA 2Z3YA 2D3OW 2UUAB 3VBBA 1BSHA 3TGUD 1TAEA 2R70A 1JB0J 2RH0A 1L0NJ 2H3OA 1SQPE 1URQB 3RYIA 4QJFB 3LSQA 1J95A 1KQFB 2A3QA 1LGHB 5CJ4A 3K5BA 4EI2A 3CC7P 4MTFA 1E79G 2QDOA 4NB5A 2VQEB 3MAQA 2OTJV 3RK2C 3CLQA 1X8YA 3H1LD 4PD4F 1X0TA 3CWBE 3CC4P 3JAKA 3A7OA 4LF8O 4RKUJ 5KLVG 2CTWA 3N2GA 2K9JB 4U3FE 2EIJB 2Q5UA 3KG2A 2AEJA 1URQA 3A5TA 3KHUA 2HJFC 2ZDIC 1S5JA 3P8CD 1VPCA 4I2LC 3TETA 2ADPA 4JF3A 2A06G 4C7RA 1SETA 2H8PC 1B6QA 2HPCA 1YDXA 3Q4HB 5KJ7C 5JJNB 1O9GA 1L0NH 4JZ2A 4AQRD 1XUQA 2JEXA 4I4TB 3QF7A 3ZN0A 3I56V 2UXDB 2M5AA 1KYOE 3H1HE 1N73C 1KILB 1GH6A 1Q82W 1YIJP 4Y28J 2M3BA 4WY4B 4H13B 1Q86W 3TJTA 5B66H 3L74E 3C9IA 3V4WA 2ZIOA 3H1IE 1OZ0A 1HR0B 3L70E 4B3SB 1NTMH 1TUBB 3BVOA 1VF5B 4FLZA 2PGDA 2YUAA 1IBMB 2EIMB 5H5NA 4EB6B 1ROPA 1IURA 1P84F 2B88A 2WSCJ 4DR1B 5LA6A 4X65B 1SVFA 4TUYA 3ASNB 3CC7V 3C90A 2GUSA 3OT7A 3U59A 3VN0A 5JWPA 4H0LC 2YEVA 3L71E 1JTHB 2WTYA 1DF4A 1GM9A 5LHIA 3TSIA 1PZQA 2Z5HA 1M57B 5CA3A 2IZ0A 1LJ2A 3VMAA 1HGVA 1IFNA 5IYDO 3EWKA 3W68A 4JZGA 3UQ8A 3HRNA 1VARA 5BU5A 4DV5O 4RUEA 1K5SA 4O2AA 3ZBHA 5EIBD 2M0BA 3WB0A 1M1KQ 3G67A 2EX3A 1Q6UA 5LP6B 4JTCB 4UCSA 4JI3B 2UXCB
chains in the Genus database with same CATH topology
2E76C 3FGAD 3G9RA 3IAOA 1JB0J 3AEEC 3T97B 1VF5D 2H88C 2BEZF 2D2CC 4YXDC 1FDIA 1PL5A 3AE5C 3LW5J 2J5UA 4KT0J 4PV1C 1KQFB 3AE3C 3C8VA 4Z1MH 5KLIC 4XFJA 3AECC 1HF9A 3IN6A 1KILE 2WSEJ 3Q3DA 4H0LB 2FYNC 3D6ZA 5L8RJ 3GMAA 4OGQB 2IDBA 4I7ZB 2OQQA 1GMJA 1ZMEC 1NGMB 1YQ3C 1TU3F 1MKMA 4RKUJ 2QJKC 1VL2A 2P10A 2K9YA 3O6QA 1PV3A 4H44D 3H25A 1R8EA 4YTPC 4H44B 1UIXA 5M1BA 4IL6X 4OGQD 1OW7A 2E75C 3AE6C 3AEBC 4H44C 1AJYA 1PIXA 3Q5PA 2QJPC 2E76B 4H13D 1DIPA 3Q1MA 1WMKA 1RQVA 3AE9C 1FDOA 3AE8C 3ABVC 4GDOA 1KMIZ 1ZOYC 1KORA 4Y28J 1KTMA 4H13B 2E74C 2D2CB 2E76D 1Q90D 4PV1B 1OW6A 3AEGC 2O01J 1VF5C 2YIUC 1U57A 3Q5SA 3SFEC 3AEFC 4H13C 2E74B 3AEDC 2ZT9B 3SFDC 4PV1D 4H0LD 1VF5B 1OW8A 3GF7A 4R4MA 4U7JA 3AEAC 2H89C 2E74D 5KKZC 2FXPA 4I7ZC 2ZT9C 1ZP0C 2NZ2A 3RK3E 3B71A 2WQYC 3S9OA 2JO1A 2WSCJ 1K05A 3Q2YA 4R4LA 1S5LX 1HJ0A 2D2CD 3D6YA 3AE4C 3GF3A 4H0LC 1EXIA 3AE1C 4OGQC 1OMIA 1Y9BA 1K04A 1NYHA 2E75D 3R4YA 3GLMA 3RL0g 3Q5RA 2MKVA 2G8YA 3AE7C 4TT3H 1KQGB 2BEQD 1EXJA 1S1CX 2JP3A 2YMKA 2V7QJ 1IK7A 2WPVB 3EWKA 3D70A 2ZT9D 1YQ4C 2WSFJ 2G3AA 1ZRTE 3D71A 1RQUA 1DD3A 3AE2C 2QJYC 2QIWA 2E75B 1DD4A 2FBWC 2QSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 J;  4H13 B;  4RKU J;  2D2C B;  2QJK C;  1Q90 D;  4PV1 B;  2O01 J;  2K9Y A;  1JB0 J;  2YIU C;  2E74 B;  2ZT9 B;  3LW5 J;  4KT0 J;  1VF5 B;  3C8V A;  4H44 B;  5KLI C;  2WPV B;  4IL6 X;  5KKZ C;  2WSE J;  2WSF J;  2FYN C;  4H0L B;  2WSC J;  2QJP C;  5L8R J;  2E76 B;  4OGQ B;  1S5L X;  1ZRT E;  4I7Z B;  2QJY C;  2QIW A;  2E75 B;  2QSI A; 
#chains in the Genus database with same CATH topology
 4DR2 O;  5A9G A;  4IHJ A;  2M6Y A;  4N3Y B;  3WUT A;  2HR3 A;  1BHB A;  1PFI A;  2HG5 C;  4BIZ A;  5B5E Z;  5C39 A;  1PV0 A;  4DV4 O;  2HEP A;  5LMN O;  3MHS C;  3QNE A;  2M3E A;  1SQP H;  3AE5 C;  2WWW A;  3T2M A;  3H1I J;  3HE4 A;  3B8N A;  2FYU K;  3WUV A;  2ZJS E;  4OH8 B;  2ZYA A;  3FYE B;  4H33 A;  3S3W A;  1NKD A;  4O4J A;  2ZFC A;  3L37 A;  2CGO A;  4QE9 A;  3E1I A;  1S3J A;  5CHX A;  3K04 A;  2ZVO B;  5EZY B;  1WA8 A;  5EK0 A;  3CSX A;  2DWE C;  5LMN B;  3MIW A;  1S5L H;  1YJW P;  1JQ0 A;  2XU6 A;  3N27 A;  2DMX A;  2YIC A;  3ZIA G;  2KS1 B;  3CME P;  2ZR3 A;  5C93 A;  4I6M C;  1R8E A;  4JTA B;  1IK9 A;  4J80 A;  2E3C A;  4PA6 A;  1P84 I;  2XAS A;  2EJ7 A;  1SQB E;  1WT6 A;  1FZC C;  1RF0 C;  4EKW A;  3APO A;  4HBN A;  1LR1 A;  1R5L A;  3AE8 C;  4E4E A;  1JCD A;  1KOR A;  2CK3 H;  5KTB A;  3CB2 A;  1NTM J;  1XHZ A;  3P7K A;  5APX A;  3A0H H;  2YI9 A;  4ZHQ A;  3GHG C;  4HKZ H;  1AJQ A;  1YBK A;  1ZW0 A;  5AVT B;  3CCE V;  3DC5 A;  2BTQ A;  4F4L A;  4LF5 B;  3H1L E;  2MJZ A;  4TLF A;  2HFE C;  1LT9 B;  1HWY A;  2XTA A;  3GF7 A;  1BGY H;  1URQ D;  4JQ0 D;  1OHH G;  5E79 H;  4CPG A;  2PF4 E;  3SYO A;  4X65 O;  1M5I A;  1PM9 A;  4N23 A;  4Z2W A;  3OMI B;  4BIO A;  3B71 A;  3BRV B;  4BWA A;  3CCV P;  2WSS G;  3CX5 F;  1SQQ E;  4A5U B;  1PKX A;  3RBZ A;  2WLK A;  4DUZ O;  2ZXE B;  1FAF A;  4WY4 D;  5H2F Z;  1TA8 A;  2W6B A;  1LP1 A;  2ITC C;  2LW7 A;  3ASO B;  1Y9B A;  3LIE A;  1FXK A;  1NYH A;  1AV1 A;  1RHZ B;  2ZCE A;  2WVR A;  2O57 A;  3RL0 g;  2OWO A;  4FVM A;  3BVH A;  2KNC B;  4K35 A;  1KYO F;  1NJI Q;  2LO1 A;  2R9I A;  2JDI G;  2JP3 A;  2C0X A;  5AVR B;  4DR4 B;  2OYI A;  1EFR G;  3CWB D;  3L75 J;  4B3M B;  2QE7 G;  2QWQ B;  4X1K A;  4JAA A;  1ORQ C;  2BCC H;  5IJ9 B;  1I94 B;  4LF6 O;  2KUB A;  2WSF J;  5HFL A;  2G3A A;  4JI2 O;  1R6K A;  2JR8 A;  3U1A A;  1SQF A;  1OXZ A;  5IYZ B;  4LFC B;  5LHG A;  1KFM A;  3K0G A;  1Q7Y W;  2HLO A;  3PTZ A;  2OYH A;  3DTU B;  1EM1 A;  1RQV A;  3OGI B;  1NTZ G;  3LW5 H;  2JVD A;  2QSI A;  3SJC C;  1YZB A;  4I0X B;  3FGA D;  1MZF A;  2AHY A;  1SQX J;  3G6E P;  3JD0 A;  5CN0 A;  2YO3 A;  2OYI C;  3OGC C;  5FNV B;  3JAR A;  1NU1 H;  4LF8 B;  3F5H A;  1RFY A;  3FD9 A;  4EFB A;  5KAF H;  1HDJ A;  3E22 A;  1KC8 W;  2QKA A;  3TGU H;  4Z1M H;  2C9L Y;  3AEC C;  1TVK A;  1N2D C;  4DCK A;  4H0L B;  3KYQ A;  2ARH A;  4YIO A;  2R44 A;  1QQC A;  1T8Z A;  5CCH A;  3CCV V;  2IFM A;  1SQV H;  1SQB H;  2EIN C;  4BIU A;  1KP3 A;  4JYC A;  4UCO A;  1XQ8 A;  4TWK A;  4EEQ A;  5L3B A;  1PPJ D;  5LGT A;  1GTW A;  4B3R O;  2BSK A;  3B09 A;  3GHG A;  4O4L B;  1GK9 A;  4JYA O;  4H44 B;  1UIX A;  3L70 J;  4I1L A;  3PJS K;  1N34 O;  1P7G A;  1J5E O;  1U96 A;  4UB6 H;  3V4Q A;  4ASW A;  1T6A A;  2AXT H;  2AEM A;  1RF0 A;  3HD7 A;  2K9P A;  3K57 A;  4MTO A;  1KTM A;  2VQF B;  2Y0E A;  3L36 A;  1IDS A;  1EZV H;  4AIL C;  2QSA A;  1JJO A;  1RM1 C;  2N9B A;  4JBZ A;  3KCX A;  1QVG O;  2WPS A;  3CEI A;  4OWF A;  1QNM A;  4H0L D;  4ZI7 B;  2LFR A;  4O4L A;  3IFX A;  1VQ6 P;  4TQF A;  3SWK A;  5CBH A;  1HVV A;  1JO5 A;  1M1J C;  4JI7 O;  4TV8 A;  2IZ1 A;  5AW5 B;  2QEX V;  4Z1M G;  2ITA A;  3H1K E;  3M8A A;  2UXB O;  1BZK A;  5DEC A;  2QWP B;  4AI8 A;  1A32 A;  3RYI B;  1EC5 A;  1ZXG A;  1PL4 A;  2JEU A;  3N4X A;  2YMK A;  1WRG A;  1XOU A;  5CBO A;  3P3N A;  1RF1 A;  3EXA A;  4EFE A;  1VF7 A;  4DV1 B;  2OIE A;  3SGI A;  1NAY A;  5KLV E;  2FYU J;  3CXH E;  2OTJ P;  1WB7 A;  1NVP B;  3K08 A;  1NH4 A;  4PDL A;  4R50 A;  4GUN A;  5AW2 B;  2CUG A;  2ZQM A;  3EFG A;  3EHB B;  2EZP A;  1F51 A;  2E75 B;  3K0D A;  3M91 A;  3WU2 H;  1OCC B;  1K9M W;  2XAQ A;  3K59 A;  3AEE C;  2M7W A;  2H88 C;  5KAI Z;  4IOI H;  3RK3 D;  2OGU A;  3CE2 A;  1NR1 A;  1LTJ A;  1B04 A;  2WAM A;  2YIU B;  3OD4 A;  5E1A C;  5L3G A;  2JIZ G;  5CA0 B;  4JYA B;  3L9D A;  3BPZ A;  3L72 D;  1M7L A;  1NAF A;  2A45 H;  3M0D C;  4I50 A;  2JS3 A;  2AZ0 A;  5GTI E;  4WBA A;  4TV9 B;  3JSN A;  4MVO A;  4WFH A;  4GOF A;  1S2E A;  1FFX A;  1HR0 O;  2K9Y A;  3FFQ A;  3HKD A;  3B40 A;  3PN1 A;  5KHK A;  3D36 A;  1SQX E;  1NTK K;  1JR9 A;  1LWU B;  1LTJ B;  1DEB A;  4IL6 X;  3D8C A;  1SQB D;  1EZV G;  4ZHQ B;  5GW7 A;  1VQP V;  3CI9 A;  1T2K C;  2QTS A;  1PPJ H;  3L74 J;  2R9A A;  3ABV C;  1BE3 G;  1B3Q A;  1ZOY C;  5KJ7 A;  1BE3 D;  3CCE P;  2AW9 A;  5B66 E;  1ZUQ A;  1AR5 A;  3HKB A;  3P8M C;  4RO0 A;  1VF5 C;  2N9Y B;  1SC5 B;  3NFQ A;  5JVD A;  5APQ A;  1M90 W;  1JEK A;  4X1I A;  2YDE A;  4N78 E;  1RF1 B;  2ZNI A;  1X79 B;  4PI0 A;  3AG3 B;  4MW8 A;  2WPR A;  1BSM A;  4O9B A;  4JF7 A;  4O4I B;  5CMZ A;  2FFD B;  5J2T A;  3HUS A;  3R66 A;  1XMQ O;  3KQG A;  3JAW B;  1G1J A;  1SZX A;  1VQ7 V;  2JGD A;  3AE4 C;  2BCC D;  1IX9 A;  5DJT B;  2BCC G;  1GN6 A;  2AZ2 A;  1JFF B;  1BGY D;  2Q9I A;  4C7N B;  2UXX A;  4L76 A;  1QX8 A;  4Y99 B;  3L74 H;  1FJP A;  1QU7 A;  4ASV A;  2WLM A;  2YSU B;  2Y9Y A;  2R72 A;  3SR2 C;  1P7B A;  2BTO A;  4CC5 A;  2YKP A;  1JY3 O;  4KP4 A;  4B7E A;  5CA1 B;  1BE3 H;  4IFF A;  3G3Z A;  1L2P A;  5H2F E;  1M57 D;  3ABU A;  1Y74 A;  4EDF A;  3AG1 C;  4JI5 O;  3CXH D;  1GM7 A;  3A8T A;  1ARO P;  2WA4 A;  1BHA A;  2DN9 A;  3H32 A;  5KMG A;  1K97 A;  1KV4 A;  1PL5 A;  3LDE A;  3HE5 B;  1V9P A;  4UB8 Z;  1KU9 A;  2K1E A;  4J9Y B;  4DK1 A;  2KSJ A;  3A0R A;  1M1K W;  5K1X A;  1OIP A;  3PP5 A;  1D7M A;  3H1K H;  1KYO D;  3CCR P;  3H1J H;  5CCH D;  4CH6 A;  2WLN A;  4BAY A;  3WUU A;  2VWJ A;  5EBW C;  1M90 Q;  1T3J A;  1ZTE A;  5EBL C;  1MSD A;  5L8R J;  1HGZ A;  1NTM G;  2PTM A;  4I7Z B;  5D5Q A;  3B8M A;  4DW0 A;  2R5D A;  2DYR C;  2HLD G;  1NU1 K;  1YJN V;  2Q8V A;  2E5Y A;  2W0X A;  3SYC A;  1KBH A;  4NPE A;  2CGN A;  4AQY O;  1VDF A;  1XHX A;  4X1Y B;  4BW9 A;  1H2M A;  3VP8 A;  3TXQ A;  2PFX A;  2P22 C;  5AW8 B;  3AG2 B;  4JAS A;  2E75 C;  3Q5P A;  3WG7 C;  1NTZ K;  3AG4 C;  1FKA O;  1VQM V;  3CX5 D;  1SQQ G;  4GKJ O;  3SWF A;  5AVY B;  2ZNJ A;  1Q82 Q;  2A06 H;  2HP8 A;  3VMX A;  5FLX N;  5GON A;  3C3S A;  2YIU C;  2YIB D;  2KSD A;  3BEH A;  4MSW C;  3TGU J;  2AEF A;  4W7Z A;  1H89 A;  4HAM A;  2K3R A;  3TYY A;  2RCV A;  5IJ9 A;  4U7J A;  3QWO C;  2A0L A;  2LGQ A;  1ZLZ A;  4I9Q A;  2ZT9 C;  1P84 H;  2NZ2 A;  3M06 A;  1SQX H;  2OTL P;  3LDD A;  3JSL A;  4R4L A;  3M0D A;  4GOD A;  3T1Y O;  3F7V C;  5B5E E;  4PD4 E;  3TDK A;  4FM2 A;  2LGW A;  1TGO A;  4LGD E;  1QLN A;  1AA0 A;  4FIP C;  1HNX B;  1OCZ C;  2PYL A;  3E22 B;  1S77 D;  1P49 A;  1K34 A;  1OCO C;  1SFC C;  4ABM A;  1H2S B;  5GON B;  1LTJ C;  3L72 E;  1PD3 A;  2W6J G;  2BEQ D;  2IYO A;  1S1C X;  4C46 A;  4W4L A;  4XDK A;  1F4N A;  2XNX A;  2RN9 A;  5H2F H;  4I4T A;  3VP9 A;  1DX7 A;  3D70 A;  1OVR A;  5EC2 C;  1YIT V;  1XRE A;  4JI4 O;  1Z5W A;  3NR7 A;  2C0W A;  1E5W A;  5KLV J;  1PL0 A;  1K7D A;  1G1I A;  3H1H D;  2XUM A;  1N73 A;  2EJR A;  3WB1 A;  1EN6 A;  4L8J A;  2FBW C;  3G6B A;  3BRC A;  4QPK A;  1RSO B;  5TIS Z;  1XTG B;  1KB9 H;  3E8F A;  1L0L E;  1SQV J;  4GOE A;  1RF1 C;  2GSM B;  3VQW A;  4GX0 A;  3KXD A;  3ICX A;  5KA5 A;  5LXT A;  2YC0 A;  2YID A;  4LFC O;  2XDJ A;  5APV A;  1BS3 A;  3I5D A;  2ZDI A;  5KAF E;  4MTX A;  3RVY A;  1URQ C;  3TCU A;  4MVM A;  4WF9 V;  4B3M O;  2KLU A;  2Q5Z A;  3CRC A;  4RES B;  4NTW A;  3OA7 A;  3CRA A;  3FX0 A;  5AW0 B;  5LOV A;  5EBM C;  1XDC A;  1F7Y A;  2P67 A;  2F95 B;  1EZV I;  2Q4P A;  1SLQ A;  2W6I G;  3LNN A;  4NPD A;  2IPP A;  3OMN B;  4NPF X;  4HYO A;  3HR0 A;  3HB3 B;  3OFN G;  5KA6 A;  1OCR B;  3OW2 U;  1EBO A;  2QA4 P;  4DR7 O;  1GU4 A;  3K79 A;  1GM8 A;  1Q5O A;  3L4F A;  3RYC A;  1BGY E;  3CC4 V;  3CRQ A;  3BAS A;  5JVD B;  1QL1 A;  3HD7 C;  3N7N A;  4LF5 O;  3JAS A;  2P7J A;  5AVU B;  3JAS B;  1FPO A;  1PNK A;  3BA9 A;  4CZZ A;  1QLE B;  2EIL C;  4AYC A;  3A3Y B;  1DLB A;  2QWR B;  4FFB A;  5CBF A;  2D2C B;  5IDJ A;  1XMO O;  1SS1 A;  4W80 A;  1Q90 D;  4O2A B;  3CCM P;  2XT9 A;  1VF6 A;  1N73 B;  3ZHV A;  1V54 B;  3E8H A;  3QTC A;  4H13 C;  4X9Q A;  2VS0 A;  1OWA A;  2EUL A;  2ILM A;  1QVF U;  1QBZ A;  2JGD B;  3CX5 E;  3CX5 I;  1OJH A;  3ZHS A;  4D7S A;  2CPB A;  2H89 C;  3E7K A;  3H1I D;  4I7Z C;  2QJ1 A;  4GT1 A;  4FLY A;  2DYR B;  5KHH A;  2GTA A;  4DOJ A;  4LFB B;  3L74 G;  4DV3 B;  3IFM A;  3OAK A;  3H1H G;  4QGP A;  1JMK C;  2UXB B;  2ZE8 A;  4I50 B;  2AXT E;  2YMY A;  1OMI A;  4OGQ C;  4PDM A;  4GYC B;  3CCJ P;  2W6A A;  1VQN P;  3L71 J;  3EQ2 A;  2G8Y A;  4B86 A;  2A06 E;  1MZ9 A;  3L72 H;  4LFA B;  3CD6 V;  1VQK V;  4PI2 A;  1R73 A;  3AG4 B;  5DN6 G;  1VQL V;  1X4T A;  2Y48 A;  3M9B A;  3RYH A;  5L3F A;  2UXN A;  1Q81 W;  5H6Q A;  2UU9 B;  4IFM A;  2OYH C;  4FJC C;  1OCC C;  4FM1 A;  2QIW A;  1OZH A;  1P84 E;  5LBQ A;  3AK2 A;  3JCZ A;  3U0Z A;  3WU2 E;  1NBM G;  3OEE G;  4JI3 O;  5J9P C;  1FS0 G;  1H2L A;  3L71 G;  3RGU A;  2QR4 A;  3HTK A;  4KHP O;  5L3E A;  3JD2 A;  2KB7 P;  1L4A D;  1NTK G;  2L5G B;  2QG4 A;  4DV5 B;  1E1Q G;  4B08 A;  4OVN F;  1R1B A;  2VRZ A;  1NZ6 A;  4KJM A;  4ZNC A;  2YEV B;  1I5Y A;  2WSE J;  2GUZ B;  1XNR B;  2FYN C;  4X1Y A;  1M8O B;  3J81 N;  2QKC A;  4DV0 O;  2QJK B;  3H1J J;  4KXR A;  4UFZ A;  2X6B A;  1N33 O;  3E8G A;  4U3F J;  1Y8A A;  1YJ9 P;  2KKW A;  1FOS F;  3CMA V;  1G1X B;  4RUF A;  4O4H A;  1A02 J;  1GD2 E;  1K4C C;  4CS2 A;  2O3J A;  3LDC A;  3T1C A;  4DR1 O;  1W2E A;  3VYI A;  5B3S B;  5TIS H;  1L0N E;  3APQ A;  2N04 A;  5APW A;  2KI7 B;  2QM4 A;  3CWB J;  1AVY A;  3L75 D;  5JQG A;  3Q4H A;  1M93 A;  2P06 A;  1NU1 G;  1KQS O;  3L35 A;  2H43 A;  3B5N A;  4HNA B;  3CWB H;  3SPC A;  1THZ A;  1PGQ A;  5APS A;  1MA1 A;  3L70 H;  1SQQ D;  1FZC A;  1KMI Z;  3O65 A;  4PA3 A;  3L73 G;  1ZSP A;  3VQX A;  3TF5 A;  3I5C A;  3W67 A;  1ZR4 A;  4L73 A;  1SES A;  4FLX A;  4RWU A;  3UCS C;  3FAV B;  1XNQ O;  4GIF A;  1RPO A;  2AXT Z;  1L0N G;  2OTL V;  4JI2 B;  3N2G B;  2XHB A;  3GW6 A;  3L72 J;  1NWQ A;  1LP1 B;  4M3L A;  5AW6 B;  3CC2 V;  2BE3 A;  2ZXW B;  4DO2 A;  1AJN A;  5APT A;  1K05 A;  1XI1 A;  3V2P A;  4GKK O;  4X88 A;  2WSE H;  4ZI7 A;  3CXH I;  4LLH A;  4Y99 C;  5E79 Z;  2JK5 C;  1YVW A;  1IFD A;  1RPR A;  1KKD A;  3CMA P;  2GTS A;  4L87 A;  3SSU A;  3CCS V;  1KQG B;  2N05 A;  2KSE A;  3FXD A;  2Y0I A;  1G4Y B;  1MOF A;  5JCO A;  2FL4 A;  1HH0 A;  2N74 A;  3FKS G;  4Z1V A;  1SER A;  3OTO B;  2Z4E A;  3ETE A;  5APU A;  3JD3 A;  3R2P A;  1L1F A;  5KAI E;  1BQZ A;  5HFM A;  1V54 C;  1BGY G;  3SJQ C;  5F2V O;  3RYC B;  3U1C A;  1YIT P;  2Y0D A;  2E5L O;  5IYZ A;  1S5L Z;  1SF9 A;  4O2B B;  5AVS B;  2KS1 A;  4UUJ C;  2E43 A;  3G4S V;  5EFW B;  1DTO A;  2EBO A;  5EYP A;  1PPJ G;  4C7N A;  1YTF D;  3C8V A;  4QE7 A;  3UO2 A;  1IXM A;  4LF9 O;  3W7U A;  2Q1K A;  3ZRW B;  4UV9 A;  1L4A B;  1FZA A;  2ZIN A;  2MK3 A;  3CCQ V;  1O9H A;  4J7J A;  1QLE D;  1UII A;  4RO2 A;  2WPD G;  3IF4 A;  4JI0 O;  2IU0 A;  1PP9 H;  3HUS B;  3P3P A;  2IDB A;  2DW4 A;  2B87 A;  4BW5 A;  1BGY J;  4DR5 B;  3ZX6 A;  3K5N A;  3GVM A;  1TU3 F;  4EOT A;  5B66 Z;  4JI8 O;  3TGU G;  2JS5 A;  4I55 A;  4DR3 O;  3L73 D;  4K0K O;  1R3I C;  1AB3 A;  1VQO V;  2IJI A;  2EIN B;  5LMU B;  4D7T A;  3GG2 A;  2Y69 C;  1FJK A;  1K9M Q;  3ZMZ A;  1SKV A;  1NTZ E;  1AQ5 A;  3FYI B;  4JI6 B;  1LUV A;  3FXE A;  1RSO A;  3ZS8 C;  1G2C B;  3M9H A;  2OYH B;  1FYJ A;  3JD4 A;  1QHT A;  3SPG A;  2G38 A;  1JVM A;  3S3X A;  2ZYG A;  3S4R A;  3AG7 A;  4H44 C;  1SQG A;  1PIX A;  1NTK H;  3ABM B;  2V4D A;  1WMK A;  3K5M A;  3C3T A;  3M99 B;  1FDO A;  4FK5 C;  4FZ0 A;  1H2K A;  1X59 A;  2CTQ A;  3X2Q C;  4DXW A;  5AVZ B;  2QWO B;  3Q5S A;  3JAL A;  2FYU G;  3AEF C;  3MZW B;  2A45 G;  4I55 B;  1AI6 A;  5BU8 B;  2ZT9 B;  4OX9 O;  2FB5 A;  1XBL A;  1L0L J;  3J80 N;  4J9Z B;  3BAA A;  1RM1 B;  1FE6 A;  4NTY A;  1SQQ H;  4U3J A;  3MDS A;  1H8A A;  2PAJ A;  1ZRT D;  3HKC A;  1G8M A;  1IO4 A;  3Q2Y A;  1V55 C;  5BZB A;  2W27 A;  1VQN V;  1HJ0 A;  3KZI E;  3D6Y A;  1OCO B;  2CDY A;  3TXS A;  5CA0 A;  2P5O A;  3CJH A;  1VEW A;  3SJB C;  1VIB A;  1G6U A;  4G27 B;  3H1L G;  5B1A B;  1M1J B;  3E35 A;  2E75 D;  2ODM A;  4ZKI A;  1MG1 A;  2YNY A;  2IBZ H;  5B3S C;  2P58 A;  1AP6 A;  1YEW A;  3GWO A;  4LWS B;  1PP9 J;  3P8C E;  2HKO A;  3HE4 B;  3SPI A;  3ABK B;  4DV2 O;  1GAX A;  1MFZ A;  2P7T C;  1W2B U;  1BCC G;  2A7W A;  4GCZ A;  4UB6 E;  1IBM O;  1IFJ A;  1HNW O;  1NI8 A;  1VQK P;  2OIG A;  4B3S O;  2R5B A;  1JA8 A;  1YJW V;  1DD4 A;  2XAJ A;  2ZE6 A;  4MVS A;  2E76 C;  4YHH B;  3QG5 A;  4B7K A;  1I5X A;  5IJ0 A;  3CME V;  1BE3 J;  2UXD O;  3B5N B;  1AR1 B;  3RK2 D;  4QPJ A;  2JEE A;  4DR3 B;  1NR7 A;  4YXD C;  4JI8 B;  1L0N K;  1R5S A;  2RN0 A;  3OW2 O;  1HJB A;  5AVV B;  5D5P A;  2XAH A;  4TV8 B;  2KZJ A;  4HYT B;  2KG7 B;  3FB8 C;  4PEL A;  3RL0 D;  1FZG A;  2YIB A;  2HG5 D;  1AFO A;  3ZMT A;  5IY5 B;  1N7S B;  2IBZ G;  5CBG A;  1LT9 C;  1I08 A;  3RK3 C;  5KLI B;  4PJ0 E;  3SJA C;  5BXZ A;  3CCM V;  4X62 O;  2W90 A;  3THO A;  4YXW G;  1VQ7 P;  4PD4 I;  1VL2 A;  5LA6 B;  1JY2 P;  2N1T A;  2B1I A;  1S9K D;  2H94 A;  3JAW A;  2PGG A;  1L0L K;  5GTH E;  2E42 A;  2CTR A;  4X89 A;  3ASO C;  1KB9 I;  3RYF A;  4YJ3 A;  4IL6 E;  2F93 B;  3B5N D;  4F6R A;  1FAV A;  1R3K C;  1M56 C;  1LT1 A;  1GTO A;  1J1E C;  1GZL A;  3H1H J;  3HTK B;  2YXR B;  1LWU C;  1FXV A;  1LNQ A;  1QLE C;  2EIL B;  1W5C E;  2QJP C;  3BCC J;  2FYU E;  3AK1 A;  3FWL A;  3H01 A;  1WB8 A;  1XEQ A;  3K9S A;  1SZT A;  3AEI A;  3G71 V;  1MMM A;  4I0X A;  2I1K A;  1Y74 B;  1PP9 E;  4HJG H;  4UCT A;  4OPA A;  4PV1 B;  2KIK A;  3AEG C;  5KUM A;  1KD1 Q;  4O4H B;  2IFN A;  4HZ3 A;  2DOS A;  4ZMD A;  1L4A C;  4X62 B;  3ZMV A;  1NKZ B;  4IL6 Z;  2OYI B;  1XTC C;  3K5O A;  4XDJ A;  4D6T J;  2AHZ A;  2FXP A;  1IBK B;  2K9J A;  4JI1 B;  1YTF B;  4NTX A;  3GWK C;  2JO1 A;  3AG3 C;  1USD A;  2W6J H;  3ETQ A;  3HKD B;  3ZHU A;  2JDI H;  3L73 J;  1FFX B;  3SDL A;  3G6E V;  1NOH A;  1KFN A;  4U3J B;  5LHH A;  4LNU A;  1XNQ B;  3OAA G;  2Q0A A;  4I5S A;  1VQ9 P;  2WZ7 A;  1SA0 A;  1N36 O;  3GLM A;  1YJN P;  2LR2 A;  2MKV A;  3JAR B;  1Q3E A;  1J1D C;  4JV5 O;  4NVP A;  2KLV A;  4DV6 O;  2UUB B;  3BRT B;  4FLT A;  2V1D A;  4IIJ B;  1OFC X;  5JJE B;  4MTG A;  3ABM C;  1MFT A;  5BR8 O;  2XND G;  4DT0 A;  1OX3 A;  4BWN A;  3M0A A;  1AR4 A;  4YIP A;  1KUQ A;  3EFF K;  1ZLL A;  1H2N A;  4UVC A;  1BT8 A;  2PI4 A;  2DWD C;  2ATK C;  4N21 A;  3D71 A;  3AG1 B;  1YJ9 V;  4DV2 B;  3CRM A;  2P90 A;  3OJA B;  3JSV C;  1ZV8 A;  3K58 A;  3ETD A;  3IGA C;  5LYJ A;  2FY8 A;  3F5W C;  1S72 V;  1LWU A;  4BXL A;  2N1T B;  4UB6 Z;  1A02 F;  5H6R A;  4DYL A;  3KKY A;  2IM9 A;  5KKZ B;  2ZIM A;  1P4R A;  4DR6 O;  1IFP A;  2Q69 A;  4LH6 A;  3BCC E;  3CWB G;  3CX5 H;  1Q86 Q;  2LJ2 A;  1GL2 C;  1FBM A;  4FZ1 A;  3VOU A;  4YY3 O;  4BRY B;  3OE7 G;  5TJH A;  3MUD C;  2B1G A;  3A0B E;  3E89 A;  4J42 A;  1IFM A;  4JAV A;  4QNH B;  4RAI A;  2NPS D;  4HB1 A;  3CCQ P;  5B1N A;  2HOD A;  3L71 D;  3CCR V;  2KP8 A;  5J2U B;  1P84 D;  2CH7 A;  3JAT B;  3U10 A;  1CZQ A;  5JJJ B;  1PP9 D;  3ABK C;  1PV3 A;  4FFB B;  3CHX A;  3L73 H;  1S5L E;  2NPS C;  5KMG B;  1H88 A;  2IU3 A;  3CS5 A;  5CMU A;  2UU9 O;  1JM0 A;  1VQO P;  4XDL A;  2Y9Z A;  3FWN A;  5LXT B;  3JAL B;  1R6N A;  1AJY A;  3E83 A;  2DQ0 A;  2E76 B;  4ASU G;  2Y0P A;  1W0K G;  1WN7 A;  5LYJ B;  2QEX P;  1NTM K;  4J10 A;  1BE3 E;  2UUB O;  4GDO A;  5KLV D;  1KC8 Q;  1OVV A;  1MZE A;  5CA1 A;  4IFD K;  1FFT B;  4WCE V;  3A0B Z;  1N36 B;  3D3I A;  4IYH A;  1U57 A;  2IJJ A;  3M9Q A;  5AW1 B;  1S5H C;  3SFE C;  3IJ4 A;  1BMF G;  3LNM B;  1QVG U;  5J2U A;  4IYI A;  4CC6 A;  1DK1 A;  1T3U A;  2RKL A;  3W7T A;  5LL6 Y;  1SQV G;  2ZXW C;  4WBN B;  2A06 D;  2QRX A;  3RK2 B;  4JI0 B;  4IIJ A;  3P30 A;  1M9N A;  4G2K A;  2BSK B;  3FB5 C;  4TT3 G;  2FFD A;  1H0T B;  2UUC B;  3L75 E;  3CRR A;  4U3F D;  4AUW A;  1Q6I A;  1K8A Q;  4BRY A;  3JYC A;  2QM7 A;  2EIJ C;  2B87 B;  4W7Y A;  3BAT A;  1I7F A;  4L74 A;  1RH5 B;  3R4Y A;  3UIA A;  3ABL C;  1D5N A;  2P4K A;  2E5L B;  1RE3 C;  4EB6 A;  4U7N A;  2FXM A;  4TSF G;  2NRG A;  2Q7E A;  1T5E A;  3DGE A;  2ZYD A;  1HNZ O;  1NT2 B;  2BOC C;  4LF4 B;  4UVA A;  2QJP B;  3SYP A;  3BCC D;  1R3J C;  1R3L C;  1KIL C;  4HNA A;  4MW3 A;  1URF A;  4UCU A;  3JCU H;  1GW3 A;  2OCC B;  2F23 A;  1HNZ B;  4LF4 O;  2I8D A;  1AIL A;  2QJY C;  4FLW A;  1KIL A;  3TK1 A;  1COW G;  4XE5 B;  2ZE5 A;  4WY4 A;  1NQT A;  1NH2 B;  4RJT A;  3OUF A;  2UUA O;  2K1A A;  3CCL V;  2KXP B;  3H1J E;  3PH0 A;  4MVZ A;  4X8A A;  1PP9 G;  1GU5 A;  2EIM C;  2A9H A;  4D6T E;  2JRI A;  5H9C A;  1N0N A;  4KT0 J;  2ITD C;  3AE3 C;  2GM4 A;  3V2R A;  5KX5 B;  4I9W A;  2F4V B;  3ZDM A;  4YJ3 B;  5BVZ A;  3GMA A;  3U11 A;  4TUY B;  3H1K G;  2OQQ A;  2FFD C;  2DYS B;  3BCC H;  1R6T A;  1BCC H;  3LUT B;  1J1D B;  2Y69 B;  1MKM A;  3CYO A;  2XZR A;  2C9N Y;  2HVJ C;  2P10 A;  5AW7 B;  4WFG A;  5ITZ A;  3IC9 A;  2YI8 A;  5EIB C;  2Q3I A;  3ZN1 A;  4YHH O;  3ZRV A;  3PRJ A;  1N7S A;  3ZED A;  4DV7 B;  1IZ3 A;  1NTZ H;  4PA9 A;  5JH7 A;  4LF7 O;  1PGP A;  1Z2G A;  3I55 V;  3FAV A;  4OGQ D;  5LP6 C;  2WLJ A;  1OCR C;  4WFB V;  5KLV K;  5B1B C;  3AE6 C;  5GTH Z;  1FJG B;  4JI4 B;  2R32 A;  3E8B A;  1JY3 P;  1Q2N A;  3Q1M A;  1IFI A;  1AJP A;  3X2Q B;  2FTK A;  5A2Q N;  5IJ0 B;  1N0J A;  3UO3 A;  1L0L H;  2HHH B;  3BY6 A;  3CXC U;  3RYF B;  1N8R W;  3A0B H;  3HE5 A;  1KEC A;  2C2A A;  5GTI Z;  2NPS A;  5JQG B;  5FL7 G;  1IVS A;  4J7Z A;  2PRR A;  3AED C;  3JAK B;  3USS A;  3ABT A;  2KK7 A;  1FXK B;  2KQX A;  2AXC A;  3OM3 B;  2CK3 G;  1NTK J;  2WLH A;  4OPH A;  3HKE A;  4ZKU A;  1IBL O;  5IE9 A;  1RE4 C;  3RK3 E;  3NXS A;  4U7O A;  2Q6Q A;  5AVW B;  5CCG C;  4YY3 B;  2L91 A;  5AW3 B;  4CH3 A;  4X66 B;  3MUD A;  2Q68 A;  1KYO H;  2DJV A;  2OYO A;  2Q3E A;  1IZN B;  3MP7 B;  3H1J D;  3UM7 A;  1GMG A;  3CXH F;  3OUS A;  3IR9 A;  1CEZ A;  1WA8 B;  1RE4 A;  3PHL A;  1ZL8 A;  3H1I H;  4B3T O;  2GUZ A;  2NPS B;  2Z5I A;  1XL6 A;  3E2E A;  2PP6 A;  4KUM A;  5J2T B;  3W7W A;  4U3F H;  4O4J B;  3RW0 A;  5AW9 B;  5KHG A;  1X9V A;  1WAZ A;  2F1M A;  4WFF A;  2Q6A A;  4JGS A;  2Q7H A;  4UCV A;  1NKN A;  4NXM B;  3T4D A;  2FML A;  3ZHR A;  4X1I B;  2HVK C;  1DEE G;  2WLL A;  5BR8 B;  1SP4 A;  4EYY Q;  4P9O A;  1JMB A;  5CB4 B;  2WSF H;  3QH9 A;  3H1K D;  2K88 A;  3B5N C;  4PJ0 Z;  3GHG B;  3KZI Z;  1QCE A;  3L75 H;  3N2K B;  5LMU O;  5KHI A;  1SQQ J;  2R9R B;  4GZR B;  4P9P A;  2JGU A;  3SPH A;  1EDI A;  4K0K B;  4DUY O;  1FDI A;  1QEX A;  2J5U A;  2CPS A;  5IY5 C;  1N7S C;  2BAS A;  1JFF A;  5KLI C;  1G2C A;  1LTG C;  1HF9 A;  5CBN A;  2LXC B;  1U97 A;  3HKC B;  2X7R B;  4PA7 A;  1IBK O;  4X20 B;  3CL3 D;  3L72 G;  4N78 D;  2GBO A;  1GMJ A;  1FDM A;  1LTT C;  4O4I A;  3ABL B;  1N7S D;  2J58 A;  2QE7 H;  2LXB A;  5APY A;  2IJH A;  4MVU A;  2H8P D;  2QJK C;  1BCC E;  2FKW B;  2Z5U A;  1WP8 A;  2MW2 B;  2W0F C;  1LTA C;  1XMO B;  3A2F A;  5CCG D;  2ZM6 B;  2NNU A;  3ZJZ A;  2AGA A;  1HTL C;  1SFC B;  1SQP K;  3F89 A;  5M1B A;  1JOY A;  1SQP J;  1GRJ A;  1K5Q A;  2OCC C;  3W7S A;  3O9O A;  2B89 A;  3OTO O;  3G80 A;  4BR6 A;  1PGJ A;  2Y0C A;  4WY4 C;  1DIP A;  1K92 A;  4MN4 C;  3ZMU A;  3FX7 A;  3AK3 A;  4L75 A;  4DR7 B;  3QO8 A;  2Z0A A;  1VQ9 V;  3KZI H;  4HH2 A;  4PJ0 H;  1E1R G;  4LP8 A;  1NS1 A;  2OYQ A;  2O01 J;  3O6Q B;  4W4K A;  5KUK A;  1JJ2 U;  1XIL A;  1NHL A;  1SQV D;  2LKM A;  1YCI A;  3SFD C;  4PV1 D;  2ETN A;  1OW8 A;  1RE3 A;  2JWD A;  1Y47 A;  4GKK B;  3ASN C;  1YHQ P;  4J7K A;  5IWA B;  4TQD A;  2ZM6 O;  3TNU A;  3HD7 D;  1ZN5 A;  3JAM N;  2I1J A;  1FZF A;  1JY3 N;  1KQL A;  2O01 H;  1EXI A;  1EDL A;  2CAZ C;  4UB8 H;  1M57 C;  5IYB O;  1EQ7 A;  2QWN B;  4K8Z A;  3MGN A;  1K73 Q;  2IJK A;  2Y4U A;  3R65 A;  1QGK B;  2UUC O;  2Q7C A;  3L70 G;  1JNM A;  3LSU A;  1YXB A;  1F4M A;  1S76 D;  2KG7 A;  4A7P A;  2A79 B;  3UKM A;  2DQ3 A;  2XV5 A;  3TGU E;  2ZT9 D;  3MTU E;  3CCU P;  1NJI W;  3E86 A;  4IHJ B;  3CCL P;  2NR5 A;  2X6A A;  3BA8 A;  4JTD B;  3JC2 2;  1DD3 A;  1USE A;  2PYJ A;  3HD7 B;  5E79 E;  3W7X A;  1N32 B;  1ZAU A;  1S4X A;  4FM0 A;  3ETG A;  3MD0 A;  4WFA V;  3T97 B;  2D2C C;  1S9K E;  1YTZ T;  3T1H B;  4YJ2 B;  5C8Y A;  2UWJ E;  1N33 B;  1HUC A;  1VQ5 V;  3HPL C;  4NXM O;  4JAU A;  1U7J A;  1K33 A;  3T1Y B;  1NU1 E;  1FXH A;  1JPX A;  2HYN A;  3BFR A;  5IYC O;  5ITZ B;  3VMZ A;  4NR1 A;  4KHX A;  3K3W A;  1NGM B;  3HKE B;  2Y4T A;  4FPP A;  2BCC E;  2XAF A;  1EZJ A;  2RNB A;  4MS2 A;  4GX1 A;  1SFC D;  5DED A;  1SQV K;  2CE4 A;  3H25 A;  1GL2 A;  4GKJ B;  2O1J A;  2ZE7 A;  1LTI C;  2FYU D;  1BSN A;  2JKV A;  2Q73 A;  2X0L A;  3RT3 C;  2GDS A;  2YS8 A;  5FNV A;  3AEB C;  1MNG A;  4DR6 B;  3H1I G;  3H1K J;  4JYY A;  1BCC J;  2QVA A;  2KZI A;  4DV1 O;  3ZRX A;  3CCU V;  1NTZ D;  4JI6 O;  2R3S A;  2NN4 A;  1EN5 A;  4NXN O;  2Q9L A;  1B06 A;  4F6E A;  2E76 D;  5BMV A;  2HJD A;  3STL C;  5KHJ A;  5JH7 B;  1YTZ I;  1OW6 A;  4LCU C;  3V2N A;  3DSQ A;  4ZBM A;  2E74 B;  2KYV A;  3BAB A;  1SQV E;  1VQL P;  5IT9 N;  1EZV E;  1IJD B;  1UFI A;  3CCJ V;  4RQE A;  4R4M A;  3AEA C;  4QIW F;  2KNC A;  2FYZ A;  3ML0 A;  1JUN A;  3L73 E;  1Q8I A;  3UT5 B;  2P1J A;  5KAI H;  2P4V A;  1GDT A;  1H8H G;  1JCH A;  2OAR A;  4D6T G;  2D2C D;  1VQP P;  2EZO A;  3OR6 C;  2FYN B;  5AVX B;  2L6L A;  1TVK B;  4LH7 A;  3H1J G;  1X22 A;  1V55 B;  2VWK A;  4TV9 A;  1GN4 A;  2XND H;  2YO2 A;  4UB8 E;  1TUB A;  4KFM A;  4LR3 A;  2WSC H;  2YKO A;  4ICG A;  4K3A A;  5B5E H;  1SQQ K;  2YXY A;  5B1A C;  5BMV B;  4DZO A;  1AI7 A;  1YYC A;  3HKB B;  4JI1 O;  2V7Q J;  4MVR A;  3CPW O;  1H8E G;  4GKG A;  1L4A A;  1WLE A;  2WPV B;  5EC1 C;  2QJY B;  3L74 D;  1J5E B;  1AP5 A;  3A0H Z;  1OV9 A;  4ZKP A;  4TOI A;  3ZHT A;  1NTM D;  1NU1 J;  4F6R B;  4B3R B;  4EIJ A;  1Q7Y Q;  5JCO C;  3IAO A;  1E79 H;  3G71 P;  3B8E B;  2IH3 C;  1SQB K;  2BEZ F;  4D6T H;  1NTK E;  4ZOL B;  1UPG A;  3LSS A;  5BY1 A;  2V7Q G;  3BCC G;  3I55 P;  2ZR2 A;  4P30 A;  2NLJ C;  1FS0 E;  3V5B A;  4UXN A;  5KLV H;  2EIK B;  1H0T A;  2RDC A;  5L3C A;  2DYS C;  2LQT A;  1EN4 A;  2YKQ A;  2J59 M;  4R6Z A;  1VQ4 P;  1RP3 B;  1AVO A;  2W83 C;  3VMY A;  1GL2 D;  5CCG A;  1YQ3 C;  4WWI A;  3RGB A;  3RK3 B;  1JY2 N;  1JOC A;  3CXH H;  1H38 A;  4R8C A;  2F66 C;  5FPR A;  1HW7 A;  5LOV B;  3KDP B;  1PGO A;  3TNU B;  2B9B A;  2RQ6 A;  5KJ7 D;  1I0H A;  2P2U A;  1LTS C;  1Y4M A;  1WJZ A;  2ZXX A;  2GV9 A;  3VOP A;  1SRY A;  4Q6G A;  5B1B B;  4YTP C;  2PI5 A;  3N2K A;  1EZV D;  4YXW H;  4DRX B;  1AVM A;  3FB7 C;  3C1L A;  4LF6 B;  1M56 B;  3EVK A;  5K1P A;  2YXQ B;  4H13 D;  3H6P A;  2V7Q H;  1J1E B;  3AE9 C;  2FXO A;  1BQ0 A;  4LWS A;  3E1R A;  3IC7 A;  5LP6 A;  3CC2 P;  4K8X A;  2O1K A;  4NXN B;  2O01 N;  3CCS P;  2L35 A;  1K4D C;  2RMK B;  2P6J A;  4DJG A;  1WPX A;  1HNX O;  1S72 P;  1YF2 A;  4AHC A;  1WNS A;  2HOD B;  1JY2 O;  1HNW B;  3DC6 A;  2IW5 A;  2CH7 B;  3JAT A;  1KP2 A;  1L8D A;  2WT7 B;  2E74 D;  1MSW D;  1VQM P;  3RL0 C;  1XNR O;  1ZP0 C;  3ZRS A;  3V2Q A;  4NKG B;  2K37 A;  1GO3 F;  1SA0 B;  1KQS U;  4RQF A;  1YHQ V;  3VQV A;  1QR8 A;  3HUS C;  2LW1 A;  1JMM A;  3RN4 A;  3A0H E;  5GTI H;  2QGN A;  3K9A A;  2CTP A;  3MHH C;  1Y76 A;  3ZRW A;  1DH3 A;  3AG2 C;  1US6 A;  2WPQ A;  3WG7 B;  3SYQ A;  2XOK G;  5KX5 A;  1BCC D;  4N6J A;  1NTZ J;  3G4S P;  3T1H O;  2WA3 A;  1QL2 A;  4FLU A;  4WVZ A;  1ZRT E;  2YXH A;  1RQU A;  3AE2 C;  1FU1 A;  4IL6 H;  4JPZ B;  1N32 O;  4LFA O;  1Y66 A;  2ZD9 A;  1KYO I;  1K8A W;  2IBZ E;  3DXR A;  4J41 A;  4OXS A;  1K3E A;  1ZR2 A;  3STZ C;  5K5G B;  4P2Z A;  1NTK D;  2N1T D;  2ZVN B;  3S1K A;  1FJG O;  1AI4 A;  3J7A U;  3H1L H;  3D36 C;  4JI7 B;  1L0L G;  4X1K B;  4XFJ A;  1L0L D;  4DV3 O;  1KIL E;  4LFB O;  1HWT C;  4DV7 O;  4Q20 A;  2ZKO A;  3Q3D A;  4DV6 B;  1GL2 B;  2IH1 C;  3D6Z A;  4JV5 B;  3ITK A;  2FYU H;  1VQ5 P;  2M8R A;  4CH4 A;  5B1O A;  3NTN A;  2JJ2 G;  2YXL A;  3RFR A;  1N7L A;  2VRS A;  3OMA B;  2V4H A;  4DV4 B;  2FKX A;  1FC2 C;  4GX2 A;  3KCY A;  2QTO A;  1QVF O;  1J2J B;  2Q7G A;  4PDV A;  2VQF O;  2IBZ I;  2UXC O;  2GA1 A;  3NMD A;  3B2E E;  3DXR B;  2F4V O;  3MHV A;  4JYB A;  4E2L A;  1CSB A;  5IWA O;  4NYK A;  5LGN A;  1CP9 A;  2KOG A;  1FOS E;  4CS3 A;  4LF9 B;  2JJ1 G;  1PNL A;  1S0V A;  1NU1 D;  1GN3 A;  2H7H A;  1H2G A;  4PD4 D;  4YPC A;  3BHP A;  3JCU Z;  1CPY A;  1RY3 A;  3FB6 C;  2F43 G;  1ZX3 A;  2HPC B;  1XL4 A;  2PUS A;  2YIA A;  3M7M X;  4MT8 A;  2W8Z A;  3V6I A;  5GTH H;  2PY5 A;  1BDC A;  4CS4 A;  1F23 A;  1SQX D;  1Y76 B;  3O8Z A;  5AVQ B;  2EIK C;  3OR7 C;  3ZCC A;  1YIJ V;  2B5U A;  2DW3 A;  1N4C A;  1L0N D;  3CP1 A;  1Q6H A;  1SQB G;  1VQ8 V;  1Q43 A;  4ZIB A;  4KL1 A;  1XMQ B;  2QA4 V;  4MVQ A;  4G28 B;  2RMZ A;  1WPB A;  5AG2 A;  3S9O A;  1MAB G;  1GKF A;  2E5T A;  1CXZ B;  1Y6X A;  1S5L X;  3CJH B;  3GF3 A;  4CBC A;  1SS3 A;  1M1J A;  2WT7 A;  4FMT A;  1N86 A;  3H1L J;  1K04 A;  5TIS E;  2GHY A;  4GX5 A;  4WBN A;  3T97 A;  4PD4 H;  1IXB A;  1LTB C;  4R7C A;  1KB9 E;  3Q5R A;  3VQY A;  3OEH G;  4TT3 H;  4JPR A;  5CJ0 A;  1JX9 A;  2DE0 X;  2B9Z A;  2XKM A;  5DJU B;  1SQB J;  5KAF Z;  1DGS A;  4WB4 A;  2RJZ A;  3H1H H;  1YSC A;  3K03 A;  1IK7 A;  1DF5 A;  1UJW B;  3H32 B;  2IYP A;  1W0J G;  3QO5 A;  2Q67 A;  4ZOL A;  1KB9 D;  4XA4 A;  3P32 A;  1I94 O;  4J11 A;  3ZMS A;  1NTM E;  4DUY B;  4UCR A;  5L3D A;  3QVN A;  4DR4 O;  1KB9 F;  4DRX A;  1GK6 A;  3LID A;  1FZE A;  3JD1 A;  4PA4 A;  3SYA A;  1EDK A;  4LC1 A;  2QM8 A;  1D2D A;  3G9R A;  2ADQ B;  4FFK A;  3T4Z A;  3CPW U;  1AQT A;  1VF5 D;  2SPZ A;  3F7Y C;  2JJL A;  4LBE C;  3II6 A;  3RL0 B;  3LW5 J;  4PV1 C;  2X6C A;  5DM6 V;  1N8R Q;  3D3Q A;  1SFC A;  4DUZ B;  1EDJ A;  1VP7 A;  1CI6 A;  1TUE B;  3CD6 P;  2VQE O;  3IN6 A;  3SPJ A;  5EZY A;  2PZS A;  1YI2 V;  1VQ8 P;  3K06 A;  4D6T D;  4OGQ B;  1OVU A;  2BCC J;  3WB2 A;  1KD1 W;  1ZME C;  4B3T B;  5CCH C;  2LP7 A;  2WLI B;  1GN2 A;  4LNU B;  1HBW A;  1Z56 A;  2WLI A;  1JCC A;  1KIL D;  3O6Q A;  3SWY A;  4X66 O;  2LFS A;  1CW5 A;  4DV0 B;  4H44 D;  1KKC A;  3ZHQ A;  3B4S A;  4GLX A;  4X20 A;  3UT5 A;  3RBX A;  4UVB A;  2QKS A;  3QO7 A;  4IT5 A;  1BDD A;  1IC2 A;  1NO4 A;  2ZAE B;  1IBL B;  3OTF A;  1QR9 A;  4WFE A;  2IBZ D;  1OW7 A;  1W2B O;  4OX9 B;  3GB7 C;  3RYH B;  2R3C A;  1MV8 A;  4QMA A;  1BL8 A;  3F5T A;  1GK4 A;  4KHP B;  2POH A;  1Y67 A;  4O2B A;  5FPO A;  3IAY A;  3B77 A;  1NVO A;  1SQX K;  4X64 B;  1WP7 A;  2HFE D;  2E74 C;  4AQY B;  3PLN A;  2BOB C;  1FD9 A;  2WLL B;  2HHH O;  1ZWI C;  1PNM A;  4UV8 A;  2OT5 A;  5CB4 A;  2WSS H;  1T2K D;  1NH2 D;  1U7M A;  1KN7 A;  2N1T C;  4C7U A;  3K5L A;  3VTP C;  1JTH A;  4LF7 B;  3WMM 0;  5KKZ C;  1M4U A;  2IX7 C;  3L75 G;  3KPE A;  4H37 A;  2WQY C;  1Z5V A;  1FXK C;  1KZU B;  2OTK E;  1PPJ E;  2GUV A;  3JCU E;  3H9V A;  1CI6 B;  1OCZ B;  3WFV A;  4U3F G;  4IGG A;  5AW4 B;  1YI2 P;  4DW1 A;  1W59 A;  1ZL8 B;  4PHZ A;  1FZB A;  2OCH A;  1LT9 A;  3L70 D;  2WIT A;  2BTQ B;  5EYP B;  3AE1 C;  3WU2 Z;  1GW4 A;  5LGU A;  3A2A A;  4DR5 O;  3RVZ A;  1AI5 A;  1VMG A;  4XBF A;  1SQX G;  1Q81 Q;  3AE7 C;  4DR2 B;  1K73 W;  1EXJ A;  1ENV A;  4X64 O;  3RWR D;  1NVP D;  2JWA A;  2WMM A;  4FLV A;  1LUW A;  1M56 D;  1VQ4 V;  2XAG A;  3L71 H;  2Q0O C;  1VF6 C;  1YQ4 C;  2A45 I;  5C8Y B;  4YJ2 A;  1HP8 A;  1VQ6 V;  1N34 B;  2M5A B;  3I56 P;  4JI5 B;  2KB1 A;  1SQP D;  4PDR A;  1SQP G;  1D5A A;  4CH5 A;  4DK0 A;  1FZC B;  1MUU A;  2Z3Y A;  2D3O W;  2UUA B;  3VBB A;  1BSH A;  3TGU D;  1TAE A;  2R70 A;  1JB0 J;  2RH0 A;  1L0N J;  2H3O A;  1SQP E;  1URQ B;  3RYI A;  4QJF B;  3LSQ A;  1J95 A;  1KQF B;  2A3Q A;  1LGH B;  5CJ4 A;  3K5B A;  4EI2 A;  3CC7 P;  4MTF A;  1E79 G;  2QDO A;  4NB5 A;  2VQE B;  3MAQ A;  2OTJ V;  3RK2 C;  3CLQ A;  1X8Y A;  3H1L D;  4PD4 F;  1X0T A;  3CWB E;  3CC4 P;  3JAK A;  3A7O A;  4LF8 O;  4RKU J;  5KLV G;  2CTW A;  3N2G A;  2K9J B;  4U3F E;  2EIJ B;  2Q5U A;  3KG2 A;  2AEJ A;  1URQ A;  3A5T A;  3KHU A;  2HJF C;  2ZDI C;  1S5J A;  3P8C D;  1VPC A;  4I2L C;  3TET A;  2ADP A;  4JF3 A;  2A06 G;  4C7R A;  1SET A;  2H8P C;  1B6Q A;  2HPC A;  1YDX A;  3Q4H B;  5KJ7 C;  5JJN B;  1O9G A;  1L0N H;  4JZ2 A;  4AQR D;  1XUQ A;  2JEX A;  4I4T B;  3QF7 A;  3ZN0 A;  3I56 V;  2UXD B;  2M5A A;  1KYO E;  3H1H E;  1N73 C;  1KIL B;  1GH6 A;  1Q82 W;  1YIJ P;  4Y28 J;  2M3B A;  4WY4 B;  4H13 B;  1Q86 W;  3TJT A;  5B66 H;  3L74 E;  3C9I A;  3V4W A;  2ZIO A;  3H1I E;  1OZ0 A;  1HR0 B;  3L70 E;  4B3S B;  1NTM H;  1TUB B;  3BVO A;  1VF5 B;  4FLZ A;  2PGD A;  2YUA A;  1IBM B;  2EIM B;  5H5N A;  4EB6 B;  1ROP A;  1IUR A;  1P84 F;  2B88 A;  2WSC J;  4DR1 B;  5LA6 A;  4X65 B;  1SVF A;  4TUY A;  3ASN B;  3CC7 V;  3C90 A;  2GUS A;  3OT7 A;  3U59 A;  3VN0 A;  5JWP A;  4H0L C;  2YEV A;  3L71 E;  1JTH B;  2WTY A;  1DF4 A;  1GM9 A;  5LHI A;  3TSI A;  1PZQ A;  2Z5H A;  1M57 B;  5CA3 A;  2IZ0 A;  1LJ2 A;  3VMA A;  1HGV A;  1IFN A;  5IYD O;  3EWK A;  3W68 A;  4JZG A;  3UQ8 A;  3HRN A;  1VAR A;  5BU5 A;  4DV5 O;  4RUE A;  1K5S A;  4O2A A;  3ZBH A;  5EIB D;  2M0B A;  3WB0 A;  1M1K Q;  3G67 A;  2EX3 A;  1Q6U A;  5LP6 B;  4JTC B;  4UCS A;  4JI3 B;  2UXC B; 
#chains in the Genus database with same CATH homology
 2E76 C;  3FGA D;  3G9R A;  3IAO A;  1JB0 J;  3AEE C;  3T97 B;  1VF5 D;  2H88 C;  2BEZ F;  2D2C C;  4YXD C;  1FDI A;  1PL5 A;  3AE5 C;  3LW5 J;  2J5U A;  4KT0 J;  4PV1 C;  1KQF B;  3AE3 C;  3C8V A;  4Z1M H;  5KLI C;  4XFJ A;  3AEC C;  1HF9 A;  3IN6 A;  1KIL E;  2WSE J;  3Q3D A;  4H0L B;  2FYN C;  3D6Z A;  5L8R J;  3GMA A;  4OGQ B;  2IDB A;  4I7Z B;  2OQQ A;  1GMJ A;  1ZME C;  1NGM B;  1YQ3 C;  1TU3 F;  1MKM A;  4RKU J;  2QJK C;  1VL2 A;  2P10 A;  2K9Y A;  3O6Q A;  1PV3 A;  4H44 D;  3H25 A;  1R8E A;  4YTP C;  4H44 B;  1UIX A;  5M1B A;  4IL6 X;  4OGQ D;  1OW7 A;  2E75 C;  3AE6 C;  3AEB C;  4H44 C;  1AJY A;  1PIX A;  3Q5P A;  2QJP C;  2E76 B;  4H13 D;  1DIP A;  3Q1M A;  1WMK A;  1RQV A;  3AE9 C;  1FDO A;  3AE8 C;  3ABV C;  4GDO A;  1KMI Z;  1ZOY C;  1KOR A;  4Y28 J;  1KTM A;  4H13 B;  2E74 C;  2D2C B;  2E76 D;  1Q90 D;  4PV1 B;  1OW6 A;  3AEG C;  2O01 J;  1VF5 C;  2YIU C;  1U57 A;  3Q5S A;  3SFE C;  3AEF C;  4H13 C;  2E74 B;  3AED C;  2ZT9 B;  3SFD C;  4PV1 D;  4H0L D;  1VF5 B;  1OW8 A;  3GF7 A;  4R4M A;  4U7J A;  3AEA C;  2H89 C;  2E74 D;  5KKZ C;  2FXP A;  4I7Z C;  2ZT9 C;  1ZP0 C;  2NZ2 A;  3RK3 E;  3B71 A;  2WQY C;  3S9O A;  2JO1 A;  2WSC J;  1K05 A;  3Q2Y A;  4R4L A;  1S5L X;  1HJ0 A;  2D2C D;  3D6Y A;  3AE4 C;  3GF3 A;  4H0L C;  1EXI A;  3AE1 C;  4OGQ C;  1OMI A;  1Y9B A;  1K04 A;  1NYH A;  2E75 D;  3R4Y A;  3GLM A;  3RL0 g;  3Q5R A;  2MKV A;  2G8Y A;  3AE7 C;  4TT3 H;  1KQG B;  2BEQ D;  1EXJ A;  1S1C X;  2JP3 A;  2YMK A;  2V7Q J;  1IK7 A;  2WPV B;  3EWK A;  3D70 A;  2ZT9 D;  1YQ4 C;  2WSF J;  2G3A A;  1ZRT E;  3D71 A;  1RQU A;  1DD3 A;  3AE2 C;  2QJY C;  2QIW A;  2E75 B;  1DD4 A;  2FBW C;  2QSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...