4PV1B

Cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
b'ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
pubmed doi rcsb
molecule tags Electron transport/inhibitor
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4pv1B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4pv1B01
5L8RJ 4H13B 1ZRTE 1JB0J 2E76B 2YIUC 2QSIA 4IL6X 5KKZC 2QJYC 2WSEJ 4H0LB 4OGQB 4Y28J 2E74B 2D2CB 2O01J 3LW5J 1S5LX 2WPVB 5KLIC 2WSFJ 2E75B 4PV1B 2K9YA 4RKUJ 2FYNC 2QIWA 1VF5B 1Q90D 4KT0J 4I7ZB 2QJPC 2QJKC 2WSCJ 2ZT9B 4H44B 3C8VA
chains in the Genus database with same CATH superfamily
1NR1A 3B5NB 1WP8A 3O65A 5JWPA 4CC5A 3L73E 1NTZE 3CPWO 1M56C 2FKWB 4H0LC 1XMOO 4YY3O 2A9HA 5L3FA 2R5DA 3A0HH 3Q4HB 4X1KA 3CMAV 5LXTA 1BSNA 4KJMA 1FZCA 2XDJA 4JYBA 1GU4A 1GD2E 3H1ID 1L0NJ 3L75J 1M9NA 2UXNA 5APUA 1S9KE 1K92A 3V4QA 4JI2B 4WCEV 1JY3O 3T97A 1I94B 3SPIA 3SPJA 3FAVA 1GL2D 3ZJZA 1RY3A 4EFBA 2RDCA 3QWOC 1N7SA 1ZSPA 1ZRTD 4H44D 4LH6A 4JI7O 2UUCB 2JDIG 4IOIH 3CE2A 3JD2A 1S3JA 1WA8B 3UO2A 4JAVA 3CX5E 5B5EH 1ZR4A 1H88A 2ZXXA 3M06A 1LP1A 3V2NA 1U7JA 2NR5A 5KJ7C 2WLIA 4CH6A 2L6LA 1XNQO 1ZN5A 2K1EA 3VOUA 1BQZA 5CJ0A 4J7JA 3SYPA 1LWUB 3WU2Z 5B1AC 4DR2O 5AW7B 1JMKC 1YJWP 3B4SA 1YBKA 4LF6B 3CC2V 2LW7A 2F43G 1XUQA 3B5NA 1SQQG 2ZT9D 3VBBA 1YTFB 1H2GA 3P8MC 4I1LA 1N73B 5LOVA 1JPXA 4KP4A 4QE7A 1R3JC 1G8MA 4IGGA 3SJAC 5EFWB 2KP8A 3HPLC 4FM0A 4I4TB 1HBWA 1RM1C 4A5UB 2QG4A 2UXDB 1JY3P 5IDJA 3E22B 1GL2C 3A5TA 3RYIA 1A02J 4DCKA 3OGIB 2QA4V 1FPOA 3U1AA 5KAFE 1U96A 4DUYO 4H44C 2B9ZA 1VARA 2P10A 4HAMA 2ATKC 3A0RA 4NXMB 1J1EC 1ZV8A 2KOGA 1WA8A 2N1TB 4UCOA 4GODA 5KLVG 2XUMA 4U3JB 1NT2B 1JJOA 2ZJSE 4EEQA 1R5SA 5LL6Y 3GHGA 3SWYA 4O4IB 1VQ8V 2ZR3A 2X6CA 3ZHQA 1KC8W 3PRJA 4DZOA 1E1QG 1R6NA 4D7TA 3E8HA 2EBOA 3QO7A 3HD7B 3OTFA 2JEUA 2ZT9C 3O6QB 1WNSA 3TXSA 3CX5F 1W0JG 3IAOA 3WG7C 3QVNA 1VQ9V 5IY5C 1R5LA 1MKMA 3CWBE 3H1LG 5AW1B 2CPSA 2L5GB 1N73A 3FKSG 4LF7O 2P2UA 5CCGA 2LP7A 1N86A 1OCCB 3CRMA 4G27B 1X9VA 1JY2O 3K5LA 3I5CA 3H32B 3S9OA 1SQPH 1RQVA 1BE3J 5B1NA 2KG7B 1MNGA 2IJIA 3TCUA 3ZHSA 1XNRO 2UUBB 1COWG 4DV6O 1BGYE 2M3BA 3E22A 4LLHA 4UB8H 3DXRB 1PP9J 1KTMA 1NU1E 4AQYO 1GRJA 2P67A 4RESB 2EILB 3ZRXA 3WUVA 1E79G 2IU0A 3VQWA 1SVFA 1BCCH 2MJZA 3CC4P 3BABA 2Y0CA 4UCVA 4X1IB 2CDYA 3A0BE 3CS5A 3K57A 3B77A 4CH5A 4Z1MG 4JI8B 1L0NK 5AVWB 1N0JA 4JV5O 1HGZA 3D6YA 3OT7A 3DTUB 5H6RA 1KBHA 3L73G 1NTZG 4U3JA 3RGBA 2Z5HA 3BHPA 3MHSC 4JTDB 1L0ND 3L75D 1PZQA 1FFTB 1BHBA 5C8YB 1NAFA 1X59A 1LTBC 5M1BA 4YY3B 3BPZA 3ABMC 2FTKA 3PP5A 1NVOA 1TUEB 1V55C 2Y9YA 3AK2A 3D71A 1EZVD 3FD9A 2Q8VA 3O6QA 3OJAB 4HNAA 1D7MA 2WLNA 3H1KH 5AW8B 3USSA 2KKWA 3DGEA 4W4KA 1S0VA 3SJCC 4MTXA 3G71V 1NKNA 2K3RA 3HKDB 4JASA 2GM4A 1JY2P 5DECA 1XOUA 3SYCA 4PI0A 3D6ZA 2EJRA 4JZ2A 2Q5ZA 2LGQA 2J58A 3RL0D 1SF9A 3HKEB 3CCQV 2KG7A 2AZ0A 2WPVB 4KXRA 4X65O 2YIDA 1XILA 3CP1A 3UT5B 2WSSG 1LTTC 1ZOYC 1N8RW 4GX1A 4UXNA 1XNQB 1RH5B 2FXPA 1PPJG 1FAVA 3B2EE 1KB9I 4I7ZC 3OD4A 3WU2H 4YXDC 1VQ4P 4X1YB 4DR2B 4X1IA 2IH1C 3ZMTA 4PDVA 2Z4EA 2MK3A 2WAMA 4QMAA 2A06H 1YIJP 2FYUH 5B1BB 2KSDA 2KUBA 2K88A 3KZIE 2IYPA 5IYZA 1VQ7P 2QWQB 4I2LC 3U11A 5D5QA 1NKDA 3ZMZA 4K8XA 2Q7EA 2XV5A 5CN0A 1YJNV 2IW5A 1Y9BA 4PD4H 4YJ3A 3KCXA 2I8DA 2P22C 2B87B 1NH2B 3T1YO 4X66O 2YEVB 4DV7O 1IBMO 4DR7O 3JALB 3MAQA 3L71E 5KHGA 4X8AA 2B1GA 4LCUC 2BCCH 1LTIC 2ZYGA 3JATA 2ZDIA 1IXBA 1DTOA 3HKDA 3CLQA 2BEQD 1GDTA 5AVVB 3RL0C 1J5EO 2XKMA 4C7UA 1LTJB 3AE6C 1NS1A 2YSUB 3ZMVA 2WPSA 1I5XA 3UT5A 1J2JB 3BCCE 3JD3A 2PTMA 3OR7C 2IBZG 3TGUE 1M57D 3EFFK 1XL4A 2ZINA 1M1JC 4RJTA 4KHPB 3V2QA 4ASVA 2KQXA 1R3KC 3N4XA 1LT9B 3GLMA 4B3RO 4HZ3A 2W6IG 1RQUA 1YHQV 1RF1C 2PRRA 3CWBG 1R3LC 2NPSB 4BRYB 3SWFA 1BE3D 1N2DC 2QR4A 4LF7B 1FXVA 4Q6GA 2V4DA 1PP9D 1Y4MA 4HH2A 2DYSC 1W2BU 2YS8A 4CZZA 3QTCA 1HR0O 3CCEV 2Y48A 1PIXA 1BHAA 1N32B 1BGYG 1KC8Q 1GK6A 1XNRB 3SR2C 2QJ1A 1IBLO 1FOSE 4DV6B 1K9MW 1NU1G 1VL2A 3Q5SA 5KA5A 4AQYB 4U3FD 1YYCA 1URQA 1VF6A 3JALA 3MDSA 4K8ZA 4DXWA 1FS0E 4C7NA 3ABKC 3N2KB 4ICGA 3IC9A 1RP3B 5CCHC 3TF5A 2RMZA 1NTKD 1ZWIC 2Y0PA 4JV5B 4GKKO 1LTJA 1Y76A 3PTZA 2HR3A 1SQFA 2QWPB 1R3IC 1L0LE 4WBNB 1M57C 1Q43A 4PJ0H 5EK0A 2QJPB 1VIBA 3LNMB 3P3PA 4DR5B 2Y0IA 1CPYA 1K73Q 2JJ2G 4BR6A 3VQVA 3ZMSA 1IX9A 4RO2A 4DJGA 4LGDE 2FBWC 2YC0A 3G6EV 3JAWB 3CMEV 2F4VB 3H1KJ 4R4MA 3EHBB 2M5AB 4BRYA 4NTXA 3WB1A 2FL4A 5KKZB 1SETA 4Y28J 2PF4E 3MD0A 2EIKC 1S5LX 1NTMH 4XDLA 3H1IH 2O3JA 1IVSA 3SSUA 2HJFC 3AG4B 3K0GA 1PKXA 4PV1D 4X65B 1FXKB 1Q7YQ 1AQ5A 1GKFA 3H01A 4DV5O 4NB5A 3K03A 4QE9A 3RK2B 3N2KA 4IHJB 4J10A 4X64O 3KQGA 1Y66A 1GAXA 4MW3A 1SESA 3CC7P 2QVAA 3CRAA 4LFBO 3OFNG 4WBAA 4FK5C 4WBNA 1FOSF 5JQGA 1M4UA 5H9CA 4RQEA 2P7JA 2E75B 4I0XB 2M7WA 4UVBA 2QIWA 3CD6V 5L3CA 5LMUO 4JI6O 3ETGA 1GW3A 3Q2YA 4KUMA 1LTSC 3FWNA 1YVWA 2IX7C 1L8DA 2QTOA 4AYCA 2M3EA 1WN7A 2OGUA 4JPRA 4PD4I 3CCMP 1GK4A 1KFNA 2CGNA 2CK3G 1TGOA 2CTPA 1SRYA 1A32A 3JARB 3T1YB 2FY8A 3JAWA 4X66B 1NHLA 2V4HA 4DV7B 4DR7B 2ZVOB 3L71G 5H6QA 3AG1B 1SFCA 1IBKO 2AEFA 1SQVH 4JYAB 5B5EE 2XNDG 4DV0B 2ADQB 2ETNA 2CH7A 2OTLP 2Q7GA 4I50B 1J5EB 1YI2V 1ZMEC 5J9PC 1KB9E 1M1KW 2JRIA 2W8ZA 5D5PA 3BCCG 4WB4A 4QPKA 1KUQA 3MIWA 1FXKA 1IXMA 1IK7A 4W7YA 2ZFCA 2PYJA 3JD0A 1TUBB 3ZHRA 3TGUG 5KTBA 4DV4O 1E5WA 2F95B 2C0XA 2A45H 3L72J 1RE4C 3LIEA 3FWLA 2KS1B 1UPGA 2EZOA 5IWAO 1M56B 3WMM0 4FLVA 4B3RB 2E42A 1AVMA 1ZL8A 1THZA 3HKCB 1CSBA 2WZ7A 1GN2A 1K4DC 1EDIA 5LP6C 1GM7A 4X89A 3SGIA 3CXHH 2XT9A 1D5NA 1NKZB 2HPCB 2Q3EA 3RT3C 2HP8A 2JO1A 4I0XA 4O4LA 4IL6H 2QM7A 3JD4A 1JTHA 3B8MA 4BIZA 3ZX6A 2PY5A 3ZRWB 2UWJE 3T4DA 4XE5B 3E83A 1B6QA 2JGUA 5B66E 1W2EA 3BVHA 1S72P 3JARA 5JCOA 4ASUG 4YXWG 1FS0G 2YNYA 1NTZJ 3CRQA 2P4KA 5BMVB 2DOSA 5KMGB 3L36A 4AI8A 3CCUV 3CX5I 3CRCA 3P7KA 1KP3A 4DYLA 5EC1C 2Q0OC 1L0LG 3E8FA 4N3YB 5APSA 1FJGO 4I6MC 1VQNV 5B1AB 2OIGA 1J1DC 4HKZH 4DW0A 2HJDA 1TUBA 2Q73A 3LUTB 1K9MQ 1PL5A 2AW9A 3AEFC 2ZE6A 3D70A 2M6YA 3H1KD 1KQGB 2ZCEA 4WVZA 1LTGC 5CBOA 2KS1A 4K0KO 2O01H 2MKVA 4KHXA 3HKCA 1JMBA 3N2GB 1AR4A 5AVSB 2X0LA 4B86A 5FL7G 1YDXA 1L0NH 1D5AA 3L75H 1OMIA 2B88A 5KHKA 2EX3A 1WMKA 4DK0A 1RM1B 1SQPE 4J7ZA 1Y47A 3E1IA 1KILD 3KPEA 4DV1O 1L4AA 5L3GA 1GL2B 3V4WA 1IFNA 1OW8A 1NTMJ 2VQFO 1VDFA 3AECC 1FFXA 1OIPA 2UXCO 3U0ZA 1EZVH 1JCDA 4JI5B 1BCCE 3LSSA 1XL6A 5LMNB 5AW3B 1AI6A 3AG3B 4DV5B 1J1EB 2KLVA 4JPZB 3JYCA 2A06D 2FFDB 4XBFA 5APTA 1ENVA 3GVMA 3CCRP 1I08A 3FB7C 1TAEA 2OIEA 3ABVC 2EIMC 2OYIC 4TV8B 1NYHA 2CE4A 3ZBHA 2HLOA 3RYCB 2OTJP 1R1BA 3CMAP 4LFBB 1ROPA 3E8BA 2QE7G 4TQFA 5EZYB 3HUSB 4BW9A 5FPRA 1FYJA 1FAFA 2C9LY 1OW6A 1WPBA 1R73A 3AEGC 5LMUB 3A2FA 3JAMN 1HTLC 4Z1VA 3ETDA 3KDPB 1US6A 3WG7B 3P32A 4AILC 1Y67A 3VQYA 4QJFB 3FXDA 1DGSA 1NOHA 3SJBC 1KILC 3U1CA 1Z5WA 3SJQC 5GTIZ 4UCRA 3DC6A 4L75A 1MFZA 1SQVJ 1YQ3C 5H2FZ 3ASOC 3IJ4A 2IZ0A 1JOYA 4J42A 1VQMP 3ABLC 4R8CA 3L72D 1GM9A 2GSMB 4GOFA 3VMXA 3SPGA 1TU3F 3K3WA 2WT7B 3CC2P 1XTGB 4ABMA 5K1XA 3VOPA 5CBFA 5KHIA 5CBHA 2A45I 3RK3D 2FFDA 1AR5A 3CB2A 2FYUE 3NMDA 4TV8A 4WY4A 3RYCA 5AVUB 4N6JA 1JM0A 2R5BA 2AXTH 4QPJA 3FB5C 3HUSA 1H0TB 2WPQA 4LC1A 1S76D 1R6TA 1WLEA 4P9OA 4M3LA 1BZKA 3VMAA 1QVFO 1T3UA 1V55B 4CC6A 4PD4E 4FZ1A 3GF3A 4PA3A 2KNCA 4CS3A 1VMGA 4PA7A 4EB6A 1W0KG 4J11A 1NTZD 3WUTA 5BVZA 1L1FA 3KHUA 1PFIA 2LO1A 2YXQB 3OMIB 2M0BA 2BCCE 3ZHUA 4DV3O 1BE3H 1V9PA 2P06A 4KFMA 2GUSA 4GX2A 3AE4C 4BWAA 2FB5A 1N34O 1PP9H 3SWKA 1NI8A 3AEBC 1F51A 3CCLP 3NR7A 5EYPB 3ETEA 4D6TJ 5E79E 1XQ8A 1VQ8P 1NR7A 2WTYA 2ZVNB 4I7ZB 4JI1B 1EDJA 1HNZB 3M91A 1FJGB 3H25A 1OX3A 2RN9A 1OCZC 4U3FH 4DR3B 4JYYA 2UU9O 2P1JA 3AEAC 1VQ6P 1X22A 2WT7A 1ZR2A 3B71A 2YUAA 1X4TA 1PGPA 4XDJA 1NTMK 1NTKH 2IPPA 3BFRA 3HE4B 1M7LA 4C46A 1O9GA 3K04A 5AVYB 1TA8A 2O01J 1RE3A 1OWAA 3H1JE 5AVQB 1HJBA 1NVPD 2ZNIA 1NTMD 1PPJD 4FLZA 1H0TA 1KQSU 2Q3IA 4PA6A 1QU7A 1VF7A 2GHYA 4LWSB 2EIJC 1SP4A 1OZ0A 2QJKC 3OAAG 4TOIA 1P84D 3ZDMA 1H2NA 1R6KA 3AE7C 2DYRB 1GN6A 3M9HA 2YIUC 1R8EA 1HWTC 1XMQO 2JEEA 2DW3A 1YTZT 3GG2A 1MOFA 3VTPC 1SA0B 4P9PA 5LGUA 5C39A 4PD4F 1JX9A 4JTAB 2QM4A 3ZRSA 5J2TB 1PNKA 3SPCA 1DF4A 4D7SA 3D36C 2X6BA 4JYCA 3SPHA 3GF7A 4PJ0E 3F89A 3JCZA 1T2KD 1BS3A 1UFIA 3PH0A 1HNXB 3ZMUA 1SQXE 4H33A 1SQVK 1MV8A 1UIIA 1RF1B 4J9ZB 2KLUA 4DW1A 4YHHO 4LFAB 5FLXN 5TISH 1SQVD 3G71P 1OZHA 3Q4HA 2GA1A 4JAUA 3GWKC 4O2BB 2IBZD 1AVOA 2DYSB 1HNWB 4EDFA 5KUKA 4EOTA 5APYA 5GTIH 1SS1A 3H1IE 2P4VA 4LWSA 3CCQP 2LJ2A 1BDCA 3OAKA 3L74J 1BDDA 1N7LA 3E7KA 4JI0O 4QNHB 1M8OB 4MVRA 5CA1B 1WJZA 1S5LE 5CMZA 1SQBH 4JAAA 3E35A 3ABKB 1ZRTE 4F6RB 1XHXA 3H1HJ 1QLEB 3SYQA 3K59A 2QWNB 1LGHB 3EVKA 4X62B 3S4RA 1MA1A 1AFOA 1IC2A 5AG2A 1SA0A 1ORQC 2FYUG 3CXHD 1DEEG 1SQGA 4BIOA 1M57B 2W6JG 1I0HA 1T2KC 1LWUA 1Q86W 3H6PA 2JS3A 5AVRB 4UB6Z 1WB7A 4LF4O 3IFMA 5GTHH 2IH3C 2XAHA 2H43A 2VRZA 3L70E 2R9IA 2E76B 3G4SV 2PGDA 4FVMA 1EDKA 4LF9B 2P5OA 3JD1A 3J7AU 2BCCG 1W5CE 3R2PA 2RJZA 3FGAD 2D2CB 3AE5C 2EIKB 4D6TD 4O2BA 4DV3B 1X79B 4I4TA 1MABG 4OPAA 1EC5A 4JI3B 4YPCA 1N34B 2QGNA 3JSLA 5F2VO 3STZC 2YDEA 1VF5D 5L3DA 1K73W 3IAYA 3W7XA 2WLMA 1FBMA 1ZW0A 2DN9A 5CCHA 1N7SD 3OMAB 4U3FJ 2N1TA 4X9QA 5EIBD 2F66C 2GBOA 1YHQP 4H13D 1DF5A 2ZXWC 1U57A 2RMKB 1X8YA 3JAKB 1XMOB 1IZNB 2PUSA 4O4IA 1NTKJ 3H1JG 1B04A 1HVVA 2PP6A 4RAIA 4LF5O 1OVRA 2O01N 1P84F 4TV9B 2LKMA 3CCEP 4I5SA 1Q7YW 4TWKA 1CP9A 2YMKA 3HD7A 4B7EA 2IFMA 1YITP 3F5TA 3D8CA 1EXIA 3TETA 3OTOO 2O1KA 2ZQMA 3B5ND 2QKCA 4BAYA 1N33O 1K33A 4JI7B 3TK1A 3F5WC 1XMQB 1FZCC 2BOCC 2IJJA 2I1JA 3H32A 1WB8A 1KZUB 3DXRA 1QX8A 1VF5C 5AW2B 1AILA 4N78D 1G4YB 4NPFX 2QTSA 5CA3A 1IFIA 4EFEA 1K34A 3JCUE 1K8AQ 3K5BA 5CB4B 1VQ5V 2VS0A 3K9SA 1N7SC 2OCCC 2L91A 5EIBC 3M0DA 4H13C 1SQXG 1FDMA 2K1AA 1NO4A 1NH4A 3G6EP 3ICXA 4OGQB 3CMEP 5LP6B 2WLLB 4J7KA 3I55P 3B8NA 5B3SC 1L0NE 2GUZB 3L75E 5C8YA 5CBNA 2E3CA 1IFMA 5KAFZ 4ZOLB 1EN4A 1ZXGA 1YJ9V 4TV9A 3L74D 1RF0A 3H1IG 2KZJA 4A7PA 1OCRB 1MZEA 3LDCA 4TUYB 1YF2A 3HKBB 2B5UA 4BIUA 1EZVE 3IR9A 3B5NC 5KLVH 3AG7A 3H1HD 4MVOA 3CJHB 3MUDA 4ZNCA 1PGQA 2B89A 5JH7B 5K5GB 4DUYB 4X88A 1QR8A 3CXHF 1YTFD 1SQBJ 3PLNA 3L37A 3G80A 2K9PA 1Y74B 3W7UA 2RN0A 5CCGD 3UM7A 5BU8B 1H8AA 1P49A 3HKEA 2IJHA 1MZ9A 2E74D 1QVGO 1K3EA 4L8JA 2IDBA 2JEXA 3ETQA 4TLFA 1KYOH 1J1DB 4DR1O 1GN3A 3Q5RA 3L72H 1XEQA 4GDOA 5CB4A 4X1YA 2EINC 2W6AA 1DX7A 2H94A 1GW4A 1QVFU 2UXBO 1F4MA 1KECA 5HFLA 3L70G 3QG5A 2N1TD 2WLLA 2DMXA 2BSKB 2XAQA 2QSAA 2GUZA 2WPDG 1FJKA 3GHGC 2HVJC 3OE7G 4ZOLA 3VP8A 1E79H 2YI8A 4Z2WA 4GOEA 3ABUA 1XI1A 3CC4V 2NZ2A 4TUYA 1YI2P 3A0BZ 3HKBA 3BVOA 4Z1MH 1WAZA 2B87A 1RHZB 1Q86Q 1H2LA 3N27A 3L73H 4JTCB 1NTZH 2YEVA 3CJHA 1NTKK 5JH7A 1PD3A 4OX9O 1MSWD 1HDJA 2A45G 2YKOA 5CMUA 4B3MO 4DUZO 2LXCB 2WQYC 3W7TA 4JQ0D 3OUSA 3EFGA 1Y74A 2JS5A 2WSFH 3HRNA 2P58A 5C93A 4LFCO 2E74C 2EIMB 5BY1A 4TT3H 2OYIB 3O8ZA 5DJUB 3APOA 1J95A 2XASA 3ZS8C 5LHIA 2A79B 1LT1A 2WA4A 2AXTE 4ZKIA 5KA6A 4ZKPA 4CS2A 4LF5B 4IIJB 1PV3A 2RCVA 4NXNO 1LT9A 2UUAO 3GW6A 4P30A 3CCVP 1LR1A 1MSDA 2NPSA 2ITCC 2ARHA 1KD1W 2OT5A 4CPGA 1KQSO 1PNLA 2BSKA 3P8CD 1BE3E 3R65A 2WSSH 1KKCA 1KILB 1MMMA 1N33B 2W83C 1PPJH 1Q81W 1PP9E 3ZHVA 1VQ4V 1V54B 1Z56A 3I56V 3ABLB 4JF7A 1ZLZA 1VQNP 2R72A 1P84H 3CI9A 4IT5A 2W0XA 3E2EA 3X2QC 4FLTA 2R44A 1SQQJ 3KZIZ 3SYOA 3AE1C 4H37A 4N21A 4DK1A 2OYIA 1A02F 4PDLA 2H8PD 2Q7CA 3MHHC 1KP2A 2BTOA 4MVZA 1AJQA 5IJ0B 3I5DA 2OWOA 3A0HE 4IFFA 1L0NG 3L75G 5KLIC 1CW5A 2V1DA 1Y8AA 2ADPA 1T5EA 4N23A 4IIJA 3V2RA 1SQBK 1SS3A 2YXRB 5LA6B 2KK7A 2AHYA 1SQBD 3C90A 1EZJA 2KSJA 4RQFA 2ZD9A 1VQLP 2M5AA 1IBMB 2OYHC 5KLVJ 1VQKP 4IFMA 1OJHA 1K97A 3A3YB 5LBQA 4JZGA 1Z5VA 2QEXP 4FIPC 2IBZH 3FFQA 1JQ0A 4PV1C 4PA4A 1EFRG 2YICA 4MTFA 2K37A 2P6JA 3HB3B 2KIKA 1G1XB 3CCJV 2YIBA 3JSNA 4DRXB 2M8RA 5AW9B 4IHJA 1URQD 1KQFB 3H1LJ 1JB0J 2ZDIC 3FB6C 5EBWC 4IL6X 2H8PC 2WSEJ 4H0LB 2GDSA 2E5YA 4K3AA 5LGNA 5TISE 5IJ0A 3CYOA 4B3SO 1NU1H 2BTQB 2YXHA 3K06A 5AVXB 3TYYA 2XNXA 3MHVA 4KT0J 2EIJB 1OHHG 4J80A 2JWAA 1OXZA 1HR0B 2QJKB 1PL4A 5LA6A 3II6A 3A0BH 2Q6AA 3V5BA 1XTCC 1IBLB 2A3QA 1LNQA 1Q8IA 5L8RJ 2WLKA 2CAZC 3GWOA 5B1BC 1Q3EA 4DR4O 3L73J 2GV9A 5JJJB 2NPSD 2AEMA 1L2PA 4B3MB 3S3WA 4D6TH 3UO3A 1DK1A 2DQ0A 1CI6B 4I50A 4GKKB 2WSFJ 3JC22 1S4XA 2H88C 4U7OA 3RYHB 3OMNB 2XU6A 5KAIH 4O2AB 1FKAO 2NRGA 1URQC 1VF6C 4R50A 5GTHE 4L74A 3Q5PA 4X20B 2G38A 3U59A 4NXNB 4UCUA 3NTNA 2MW2B 3ZIAG 4GZRB 4NKGB 1MFTA 5L3EA 3AEDC 2QJYC 1LTJC 3CHXA 3AE8C 2WA3A 4YIPA 2CGOA 4OVNF 1G1IA 3QO8A 4CH4A 2HPCA 3O9OA 2VWJA 2BTQA 1SQQK 3EXAA 2LGWA 1PP9G 1O9HA 5KAIE 4UB8E 3BAAA 3KG2A 3ZRWA 3W68A 1CEZA 1SQQD 1Y6XA 2V7QG 3LIDA 1GO3F 3FB8C 4F6EA 1KQLA 4H44B 2WLHA 4CS4A 1IFPA 4UV9A 4BWNA 5GONB 1P84I 5HFMA 1WRGA 4LP8A 1F7YA 3TNUB 1KD1Q 3ZHTA 5BMVA 5DEDA 3QNEA 4LR3A 5KMGA 1KFMA 1SFCD 2P90A 5KJ7A 4X64B 1H2SB 4JI2O 1CI6A 4OWFA 1I94O 5H5NA 1H38A 2WPRA 3C1LA 1Q81Q 1U7MA 1QNMA 1YSCA 5E1AC 4ASWA 3APQA 4FM2A 1Q5OA 4K35A 1MZFA 3RYHA 4AQRD 5KLVK 1H89A 3JASB 3IFXA 3IN6A 3L71H 2ZT9B 4JI6B 5APVA 3B09A 1S2EA 3VMYA 1G2CB 5KLVD 3H1KE 5B5EZ 1E1RG 1FXHA 5IY5B 2XNDH 1K7DA 2XOKG 3RK2D 1YXBA 1JR9A 4FLUA 4FZ0A 1NAYA 3N2GA 2OTLV 2ZIOA 1SZXA 2IJKA 4RWUA 2XHBA 3BCCH 3BA9A 4I9WA 2Y4TA 4W4LA 1IBKB 4PDRA 3TJTA 3KCYA 1U97A 3L74H 4LF6O 4GIFA 1GL2A 1VQOV 1KILE 3RYFB 2E75D 3VQXA 1KYOD 1DD4A 1VQPV 1FD9A 4F4LA 1QVGU 1SERA 3H1LD 3LNNA 3WU2E 2H89C 3H1HH 4GUNA 5GONA 4DV4B 1B06A 3CWBJ 3HE5B 2N04A 3SYAA 1SFCC 5KKZC 5IJ9B 2A06E 4I55B 1Q6UA 2ZXWB 5IWAB 4LF8O 3UKMA 2UXDO 3AE2C 3G3ZA 1PGJA 4UFZA 1KORA 4WFFA 3AG4C 4ZKUA 3ABMB 5B66Z 1BGYJ 1GTOA 2Q68A 5EZYA 1FE6A 1Q2NA 3CXHI 1BSMA 4FPPA 1NTZK 3JASA 3T4ZA 3CCSV 1F4NA 1S72V 1NU1J 2QWRB 1EBOA 2YIAA 2BEZF 5CA0B 2QA4P 3L73D 1UJWB 4MVMA 4HB1A 3ZRVA 1X0TA 1S77D 2F93B 4X1KB 4YIOA 1AP5A 4DR4B 1LTAC 1FZCB 1CXZB 3Q3DA 5AW5B 4WFEA 3T2MA 1S9KD 2N9BA 1KKDA 2VWKA 1LUWA 1RSOB 4LH7A 2FYNC 5LHHA 1VF5B 3KXDA 1L4AD 5J2UB 4ZBMA 1AROP 3L72E 1N7SB 2ZYDA 3M9BA 2OCCB 5JCOC 3HTKB 5AVZB 3RK3C 4H13B 3HE5A 2ZE7A 2C0WA 3AG1C 3CX5D 3D3QA 1JA8A 2LQTA 5L3BA 3RK3E 4I55A 1VQ9P 1LP1B 3G4SP 4K0KB 2QWOB 3M0AA 2WLIB 1PNMA 3OM3B 5B3SB 5CBGA 3BRTB 1UIXA 1AB3A 1AP6A 2K9JB 1SQPG 2O57A 4B3TO 1SKVA 1OV9A 1BT8A 1M5IA 2WSCJ 5LYJB 4DV1B 4JI8O 1K8AW 1AVYA 1TVKB 4WFGA 5CA0A 1EN5A 3AG2C 3M99B 2NNUA 4MVQA 2VQFB 1K05A 3A7OA 1LJ2A 2A0LA 3RBZA 3CCRV 5APXA 2UXCB 3LSQA 1HWYA 1BCCG 2JGDB 3AE3C 4RUEA 1EZVI 5LOVB 2RNBA 2ITDC 3GMAA 2OTJV 2Z0AA 2WMMA 1HJ0A 3DC5A 3RL0B 4GKJO 2QE7H 4DT0A 1JEKA 2AGAA 1RSOA 2Y69C 5EYPA 1L4AC 2R32A 3RYIB 2X7RB 2Q67A 5J2UA 2JJLA 1M1JB 2EINB 5AW4B 5JVDB 1K04A 3HTKA 4KL1A 3C3SA 2YKPA 1H8HG 3H1KG 1LUVA 2Q7HA 1JFFB 4PELA 3L71J 3LW5H 3ZN1A 3LSUA 5BXZA 3HE4A 3K5MA 2B1IA 4RO0A 3GHGB 1F23A 2XAJA 3C3TA 1AV1A 1KB9H 1VQMV 1KYOF 4WY4D 3S1KA 4U7NA 3NXSA 1NTME 4NR1A 1PPJE 1HF9A 2K9JA 3BCCJ 1FJPA 2ZYAA 5H2FH 1M90W 1OVVA 5LYJA 3OGCC 3RWRD 3TGUJ 1YZBA 1TVKA 2Q4PA 4FMTA 2HODB 1HW7A 2JKVA 3ZEDA 3CWBD 1FDIA 1P84E 3L70D 3OA7A 2JK5C 1GN4A 1FU1A 1OCOC 2JGDA 1VQ5P 4J9YB 3E1RA 3BEHA 2YKQA 1NU1K 2VQEO 1DLBA 2E74B 2HLDG 2A06G 4Y99C 3CXCU 1VEWA 2R3CA 3CEIA 1BGYD 4FFKA 2NLJC 4O4HB 4WFBV 4LF8B 1NU1D 5J2TA 5B66H 3MZWB 1YJ9P 5KHJA 1JVMA 1YJNP 1M1JA 2ZR2A 3OR6C 5JVDA 2W27A 1T3JA 3M8AA 3AG3C 2RH0A 3EQ2A 1DD3A 2Y9ZA 1G6UA 1I5YA 1Q82W 1RF1A 1FZGA 2FFDC 1JFFA 3BRCA 3ASNC 4DR6O 4NTWA 3VP9A 3CCLV 4WY4C 5E79Z 2IU3A 1S1CX 1K4CC 1SQVE 2YO2A 3W7WA 2QM8A 3E8GA 2IBZE 1KU9A 3HUSC 3N7NA 4KHPO 1L0LJ 3SFDC 2XAFA 3ZCCA 1VQ6V 2Y4UA 3A8TA 3OW2U 2HODA 4HNAB 4UVAA 2DQ3A 4ZMDA 1GZLA 3X2QB 5CA1A 1YTZI 3L72G 1GM8A 3AK3A 4F6RA 4EYYQ 2EJ7A 2UU9B 4BXLA 2BOBC 1AI5A 2ITAA 3J80N 4UUJC 2PI5A 4PA9A 2G8YA 1WPXA 4DO2A 1N32O 4O4HA 2QKSA 3CXHE 5KLIB 2ODMA 1USDA 1BSHA 1IDSA 4MT8A 4OH8B 3AEEC 1H8EG 3H9VA 2RQ6A 4P2ZA 3IGAC 4IL6E 2CUGA 3QH9A 2V7QJ 1S5HC 4B3TB 2JDIH 1ZTEA 2IM9A 3J81N 2JIZG 2JJ1G 4PHZA 3FX7A 1NGMB 1H2KA 3HR0A 1HUCA 2OYHB 3K9AA 4W80A 4XA4A 5IYZB 1AQTA 4OXSA 4OPHA 1RE3C 4MVSA 4JI4O 4L76A 4D6TE 4PJ0Z 2AEJA 4TT3G 5FNVB 5B1OA 4UV8A 4DR5O 4GT1A 4GKJB 4PV1B 2HFED 4MTGA 5EC2C 1YJWV 2VRSA 4FFBB 4RKUJ 2R9AA 1QL2A 4YJ3B 3THOA 1QBZA 1SQQH 1NJIW 4GKGA 2F4VO 4E4EA 3L71D 3JATB 4FLYA 4IYHA 2C2AA 2IZ1A 4HYTB 1JO5A 1SZTA 3WB2A 2WWWA 2ZE8A 4O4JB 3V6IA 3LW5J 1URFA 4MTOA 1VPCA 3JAKA 3BCCD 1DIPA 4YHHB 3ML0A 2FMLA 3RFRA 2Q6QA 4FM1A 4PDMA 5EBMC 4IFDK 1IFDA 3TGUD 1NTMG 4R6ZA 1S5LZ 1GMGA 3I56P 4XDKA 2D3OW 2YMYA 2Z5UA 2GTSA 2AZ2A 3K79A 2N74A 4XFJA 2PAJA 2N05A 4MN4C 2OYHA 1QQCA 4JI0B 3ABTA 2ZM6O 3MGNA 2HFEC 2PGGA 2W6JH 2DJVA 3OEEG 3RVZA 4NVPA 5FNVA 2VQEB 4FFBA 5K1PA 2Q1KA 4B08A 2IFNA 4J41A 2ILMA 2RKLA 4N78E 1M90Q 2Q9LA 3CD6P 2DW4A 1URQB 3GB7C 3H1LH 4E2LA 1YCIA 2DYRC 4C7NB 4UB6H 1RE4A 4JYAO 2WSEH 3T1HO 2HKOA 4DV0O 2J5UA 4LF4B 2W0FC 1L0LK 1NQTA 4UVCA 5KX5B 3F7VC 4YTPC 4GX0A 3TXQA 2QJYB 5CCHD 5AVTB 4O4JA 4GLXA 1QLED 1Y76B 5LP6A 2YO3A 1L0LD 2R3SA 1Z2GA 4DR6B 5E79H 2X6AA 4BW5A 1P7GA 1SQVG 1RPOA 3TSIA 2ZIMA 2ZKOA 1PGOA 3SDLA 1LWUC 3VYIA 2BE3A 1M93A 3L74E 1RPRA 1P4RA 2Q9IA 4R7CA 4LNUB 2JVDA 2L35A 4NYKA 3HD7D 3BASA 2JR8A 3WUUA 2CPBA 3H1HE 3CCJP 5DM6V 1Q82Q 3A2AA 1N73C 5JJNB 2EZPA 3H1JH 3RN4A 2E76D 1FC2C 5CCGC 5FPOA 3UCSC 3S3XA 3BY6A 4IL6Z 4TSFG 2D2CD 2KXPB 3W7SA 1QCEA 1B3QA 2OYQA 4WWIA 5KUMA 1SQPJ 2B9BA 4AUWA 4HBNA 2C9NY 1KMIZ 1K5SA 2F1MA 1AI7A 1YITV 4NPEA 2XZRA 5AW0B 1EM1A 1JMMA 4CBCA 4EI2A 1T6AA 2N9YB 2Q0AA 1BCCJ 2LR2A 1FZFA 4GYCB 5KX5A 2N1TC 1QLEC 1XBLA 1ZP0C 3CX5H 3G6BA 4JBZA 3RBXA 1XDCA 2UXXA 3OTOB 1ZLLA 2XTAA 1HGVA 3CPWU 1YEWA 1ZAUA 2Z3YA 4I9QA 5JQGB 1EQ7A 2E5TA 1DH3A 2K9YA 2A7WA 3JCUZ 4D6TG 3ASOB 4ZHQB 4JI4B 4QGPA 2JWDA 2QRXA 3CCUP 3PJSK 2E5LO 4FLWA 3G9RA 3HD7C 3RGUA 3K5OA 1SQXH 3F5HA 4MS2A 4LNUA 1AJYA 3C8VA 3K5NA 4DV2O 1YIJV 4U3FE 3KYQA 2E76C 3I55V 1VQ7V 1SFCB 2W90A 3RVYA 2D2CC 1OCCC 3ZN0A 1NTKE 2NN4A 2CH7B 1N36O 4UCTA 1KB9D 2P7TC 1JY3N 1K5QA 3EWKA 1GH6A 3UQ8A 4JI5O 5KAFH 2EILC 5LMNO 1IZ3A 1QL1A 4FJCC 2HYNA 3FXEA 1S5LH 1NJIQ 1FZEA 2QKAA 1N4CA 3CSXA 3M0DC 3G67A 1EZVG 5KHHA 4G28B 1GMJA 2CTRA 1ZL8B 2KB1A 1VP7A 1NBMG 5LHGA 1KILA 3DSQA 2ZM6B 2FYUJ 3P8CE 4OGQD 3FX0A 4O4LB 4ZHQA 1KV4A 1WP7A 2FYNB 2OCHA 1N8RQ 1JTHB 1RF0C 5LGTA 1FDOA 5AW6B 1WT6A 2WLJA 1XREA 1XHZA 2PYLA 1H2MA 2QDOA 1AI4A 1OCZB 3CWBH 1IURA 4DR1B 1KYOI 3MUDC 3L70H 1NH2D 1NZ6A 4C7RA 3RK3B 2ZXEB 3TDKA 4MVUA 1OW7A 4B7KA 4O9BA 2CTQA 2PZSA 4GCZA 3UIAA 3T1HB 2UXBB 2YI9A 2BCCJ 1YQ4C 4DOJA 2KI7B 1BGYH 2Q5UA 1HP8A 5GW7A 1P7BA 1ZUQA 4EKWA 3RL0g 5BR8O 4QIWF 5A2QN 2OARA 3PN1A 1JCHA 5GTIE 1EXJA 2HEPA 1EDLA 3L74G 1SC5B 4AHCA 5H2FE 1VQOP 4JF3A 5APQA 3AG2B 4YJ2B 3LDDA 2FXOA 2CTWA 1VQPP 1RFYA 2HHHO 1QR9A 1SQBE 1SQPK 3H1HG 2YIUB 5ITZB 4OGQC 2AXTZ 4OX9B 4L87A 5BU5A 2KYVA 1SQPD 4DUZB 3FYIB 2HG5D 3H1JJ 3OW2O 2Y69B 4LFCB 1L4AB 1OVUA 2OYOA 1OCRC 1AA0A 1FZAA 3K58A 1FFXB 1DEBA 1BCCD 2J59M 3CCVV 1KN7A 5IE9A 1GK9A 1JOCA 2BASA 2SPZA 3CCSP 3L9DA 2ZNJA 4DRXA 4NPDA 2JP3A 5EBLC 2DWDC 2KZIA 1S5JA 1GU5A 2FYZA 4GX5A 2KSEA 1JY2N 2UUAB 3QO5A 3IF4A 3VMZA 5CJ4A 3AE9C 1AJNA 1NVPB 1QGKB 4EIJA 1Q6HA 4JI1O 1BE3G 1HNZO 3FYEB 2WSCH 1OFCX 1MG1A 2OQQA 4DR3O 3JCUH 2W6BA 3IC7A 3E86A 4W7ZA 4YJ2A 1PL0A 5CHXA 1LT9C 2OTKE 2E5LB 1Q6IA 1OCOB 2AXCA 4R4LA 3WB0A 1SQXJ 2NPSC 1CZQA 4U3FG 3BA8A 2FKXA 3OEHG 3A0HZ 5ITZA 3CC7V 4DV2B 2LW1A 3KZIH 3AEIA 3AK1A 1KB9F 3D3IA 5IT9N 2WVRA 2HG5C 4Y99B 2GUVA 3KKYA 3QF7A 1GTWA 1NTKG 1QEXA 1ZX3A 1N0NA 4Q20A 3C9IA 1PM9A 4ZI7B 2LFRA 5DN6G 1Q90D 1N36B 4JGSA 3H1IJ 3D36A 3CCMV 2CK3H 4O2AA 2GTAA 3P30A 2YXLA 2UUCO 1JJ2U 2FYUK 3NFQA 1VQLV 1AJPA 5BZBA 4X20A 4IYIA 1VQKV 1IJDB 4WFAV 2YIBD 2QEXV 2FYUD 2WITA 3BRVB 3CRRA 3ASNB 3R66A 4TQDA 4WY4B 1BL8A 1BQ0A 3T1CA 4HYOA 1PV0A 3TGUH 4PD4D 2AHZA 1HNXO 4WFHA 2PI4A 1I7FA 2QJPC 2IBZI 2KNCB 2KB7P 4UCSA 1SQQE 4EB6B 2FXMA 3MP7B 3F7YC 2G3AA 4PI2A 4LFAO 2BCCD 5TISZ 3L4FA 1USEA 3BATA 3Q1MA 3L70J 1HNWO 3TNUA 2POHA 2H3OA 3PHLA 4ZIBA 2LXBA 3MTUE 2DWEC 4U7JA 2HVKC 1JUNA 1V54C 4ZI7A 3R4YA 1T8ZA 5DJTB 1JCCA 4B3SB 1FXKC 1SLQA 5BR8B 3K0DA 3STLC 5IYBO 4NXMO 3CL3D 4WF9V 3P3NA 4FLXA 4CH3A 4YXWH 3RW0A 3ITKA 3RK2C 2Q69A 2IYOA 1G2CA 3L35A 2R9RB 4X62O 2F23A 1AR1B 5KLVE 2ZE5A 3OUFA 2QSIA 4NTYA 5IYCO 3U10A 1W59A 1EN6A 1SQBG 2I1KA 2E43A 2HHHB 1M56D 4LBEC 3H1JD 3JSVC 2EULA 4H0LD 5TJHA 1L0LH 2XAGA 5LXTB 2PFXA 1NWQA 2E75C 1M1KQ 1G1JA 2Y0DA 2LFSA 4G2KA 3B40A 3RYFA 2ZAEB 5GTHZ 3T97B 1KYOE 2Y0EA 3FAVB 4L73A 1IFJA 4LF9O 3H1LE 4RUFA 3WFVA 5APWA 3M7MX 4UB6E 3V2PA 1W2BO 2H7HA 1HH0A 4MW8A 1MUUA 1JNMA 5IJ9A 3E89A 5JJEB 2Z5IA 2YXYA 1QLNA 4JI3O 2R70A 2UUBO 5KAIZ 3VN0A 4UB8Z 1IO4A 1IK9A 2DE0X 1QHTA 5KJ7D 1D2DA 2V7QH 3B8EB 3LDEA 1SQXK 4MSWC 1BMFG 2O1JA 5A9GA 3SFEC 4HJGH 3W67A 3M9QA 5IYDO 1SQXD 1FZBA 3K08A
chains in the Genus database with same CATH topology
1MKMA 5L8RJ 4H13C 1ZRTE 1OW7A 2MKVA 1NGMB 4H0LC 5KKZC 2BEQD 2E76D 4OGQB 3AE2C 1YQ4C 3AE4C 3AE6C 1OMIA 3S9OA 1RQVA 1WMKA 1KORA 2D2CD 3AEBC 2WSFJ 2E75B 4PV1B 3RL0g 1HF9A 4RKUJ 1KTMA 2QIWA 1OW8A 1EXJA 4I7ZB 1KMIZ 2H88C 3AECC 2QJPC 3Q2YA 3H25A 2BEZF 3AEAC 1FDIA 3GLMA 2G3AA 3Q5PA 1RQUA 3AE1C 3B71A 4H44D 3D6YA 2E76B 1ZP0C 3AEDC 3Q1MA 2QJYC 4OGQC 3AE8C 3ABVC 2E74B 2D2CB 2O01J 3AE5C 3FGAD 3LW5J 1NYHA 4U7JA 3Q3DA 1DIPA 5M1BA 2E74D 5KLIC 1ZMEC 2K9YA 1PIXA 2IDBA 3R4YA 2FYNC 1VF5B 1IK7A 1OW6A 1VL2A 3G9RA 3Q5RA 2QJKC 3Q5SA 3D71A 1VF5D 3AEGC 3O6QA 4GDOA 1AJYA 4H44B 3C8VA 3AE7C 1DD3A 2ZT9D 2JP3A 3IAOA 4H13B 2E76C 4XFJA 2YIUC 1R8EA 2QSIA 3RK3E 4H13D 2D2CC 3AE9C 3D6ZA 1U57A 4H0LD 1S1CX 2WPVB 2JO1A 1UIXA 1YQ3C 2E75C 4PV1C 3EWKA 2NZ2A 1ZOYC 2OQQA 3SFDC 2FXPA 3GF7A 4I7ZC 3T97B 2WSCJ 4YXDC 4Z1MH 2YMKA 3IN6A 4H44C 2ZT9B 1K05A 2P10A 1TU3F 2FBWC 4R4LA 3AE3C 2J5UA 1KQFB 1EXIA 1JB0J 1GMJA 4R4MA 4YTPC 2WQYC 4IL6X 3GMAA 2WSEJ 4H0LB 1HJ0A 4Y28J 4TT3H 2E74C 2G8YA 1S5LX 4OGQD 1KILE 1Q90D 1VF5C 1Y9BA 2E75D 1FDOA 3AEEC 4KT0J 4PV1D 1DD4A 3SFEC 3GF3A 1PL5A 1PV3A 2V7QJ 3AEFC 2ZT9C 3D70A 1KQGB 1K04A 2H89C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R J;  4H13 B;  1ZRT E;  1JB0 J;  2E76 B;  2YIU C;  2QSI A;  4IL6 X;  5KKZ C;  2QJY C;  2WSE J;  4H0L B;  4OGQ B;  4Y28 J;  2E74 B;  2D2C B;  2O01 J;  3LW5 J;  1S5L X;  2WPV B;  5KLI C;  2WSF J;  2E75 B;  4PV1 B;  2K9Y A;  4RKU J;  2FYN C;  2QIW A;  1VF5 B;  1Q90 D;  4KT0 J;  4I7Z B;  2QJP C;  2QJK C;  2WSC J;  2ZT9 B;  4H44 B;  3C8V A; 
#chains in the Genus database with same CATH topology
 1NR1 A;  3B5N B;  1WP8 A;  3O65 A;  5JWP A;  4CC5 A;  3L73 E;  1NTZ E;  3CPW O;  1M56 C;  2FKW B;  4H0L C;  1XMO O;  4YY3 O;  2A9H A;  5L3F A;  2R5D A;  3A0H H;  3Q4H B;  4X1K A;  3CMA V;  5LXT A;  1BSN A;  4KJM A;  1FZC A;  2XDJ A;  4JYB A;  1GU4 A;  1GD2 E;  3H1I D;  1L0N J;  3L75 J;  1M9N A;  2UXN A;  5APU A;  1S9K E;  1K92 A;  3V4Q A;  4JI2 B;  4WCE V;  1JY3 O;  3T97 A;  1I94 B;  3SPI A;  3SPJ A;  3FAV A;  1GL2 D;  3ZJZ A;  1RY3 A;  4EFB A;  2RDC A;  3QWO C;  1N7S A;  1ZSP A;  1ZRT D;  4H44 D;  4LH6 A;  4JI7 O;  2UUC B;  2JDI G;  4IOI H;  3CE2 A;  3JD2 A;  1S3J A;  1WA8 B;  3UO2 A;  4JAV A;  3CX5 E;  5B5E H;  1ZR4 A;  1H88 A;  2ZXX A;  3M06 A;  1LP1 A;  3V2N A;  1U7J A;  2NR5 A;  5KJ7 C;  2WLI A;  4CH6 A;  2L6L A;  1XNQ O;  1ZN5 A;  2K1E A;  3VOU A;  1BQZ A;  5CJ0 A;  4J7J A;  3SYP A;  1LWU B;  3WU2 Z;  5B1A C;  4DR2 O;  5AW7 B;  1JMK C;  1YJW P;  3B4S A;  1YBK A;  4LF6 B;  3CC2 V;  2LW7 A;  2F43 G;  1XUQ A;  3B5N A;  1SQQ G;  2ZT9 D;  3VBB A;  1YTF B;  1H2G A;  3P8M C;  4I1L A;  1N73 B;  5LOV A;  1JPX A;  4KP4 A;  4QE7 A;  1R3J C;  1G8M A;  4IGG A;  3SJA C;  5EFW B;  2KP8 A;  3HPL C;  4FM0 A;  4I4T B;  1HBW A;  1RM1 C;  4A5U B;  2QG4 A;  2UXD B;  1JY3 P;  5IDJ A;  3E22 B;  1GL2 C;  3A5T A;  3RYI A;  1A02 J;  4DCK A;  3OGI B;  2QA4 V;  1FPO A;  3U1A A;  5KAF E;  1U96 A;  4DUY O;  4H44 C;  2B9Z A;  1VAR A;  2P10 A;  4HAM A;  2ATK C;  3A0R A;  4NXM B;  1J1E C;  1ZV8 A;  2KOG A;  1WA8 A;  2N1T B;  4UCO A;  4GOD A;  5KLV G;  2XUM A;  4U3J B;  1NT2 B;  1JJO A;  2ZJS E;  4EEQ A;  1R5S A;  5LL6 Y;  3GHG A;  3SWY A;  4O4I B;  1VQ8 V;  2ZR3 A;  2X6C A;  3ZHQ A;  1KC8 W;  3PRJ A;  4DZO A;  1E1Q G;  1R6N A;  4D7T A;  3E8H A;  2EBO A;  3QO7 A;  3HD7 B;  3OTF A;  2JEU A;  2ZT9 C;  3O6Q B;  1WNS A;  3TXS A;  3CX5 F;  1W0J G;  3IAO A;  3WG7 C;  3QVN A;  1VQ9 V;  5IY5 C;  1R5L A;  1MKM A;  3CWB E;  3H1L G;  5AW1 B;  2CPS A;  2L5G B;  1N73 A;  3FKS G;  4LF7 O;  2P2U A;  5CCG A;  2LP7 A;  1N86 A;  1OCC B;  3CRM A;  4G27 B;  1X9V A;  1JY2 O;  3K5L A;  3I5C A;  3H32 B;  3S9O A;  1SQP H;  1RQV A;  1BE3 J;  5B1N A;  2KG7 B;  1MNG A;  2IJI A;  3TCU A;  3ZHS A;  1XNR O;  2UUB B;  1COW G;  4DV6 O;  1BGY E;  2M3B A;  3E22 A;  4LLH A;  4UB8 H;  3DXR B;  1PP9 J;  1KTM A;  1NU1 E;  4AQY O;  1GRJ A;  2P67 A;  4RES B;  2EIL B;  3ZRX A;  3WUV A;  1E79 G;  2IU0 A;  3VQW A;  1SVF A;  1BCC H;  2MJZ A;  3CC4 P;  3BAB A;  2Y0C A;  4UCV A;  4X1I B;  2CDY A;  3A0B E;  3CS5 A;  3K57 A;  3B77 A;  4CH5 A;  4Z1M G;  4JI8 B;  1L0N K;  5AVW B;  1N0J A;  4JV5 O;  1HGZ A;  3D6Y A;  3OT7 A;  3DTU B;  5H6R A;  1KBH A;  3L73 G;  1NTZ G;  4U3J A;  3RGB A;  2Z5H A;  3BHP A;  3MHS C;  4JTD B;  1L0N D;  3L75 D;  1PZQ A;  1FFT B;  1BHB A;  5C8Y B;  1NAF A;  1X59 A;  1LTB C;  5M1B A;  4YY3 B;  3BPZ A;  3ABM C;  2FTK A;  3PP5 A;  1NVO A;  1TUE B;  1V55 C;  2Y9Y A;  3AK2 A;  3D71 A;  1EZV D;  3FD9 A;  2Q8V A;  3O6Q A;  3OJA B;  4HNA A;  1D7M A;  2WLN A;  3H1K H;  5AW8 B;  3USS A;  2KKW A;  3DGE A;  4W4K A;  1S0V A;  3SJC C;  4MTX A;  3G71 V;  1NKN A;  2K3R A;  3HKD B;  4JAS A;  2GM4 A;  1JY2 P;  5DEC A;  1XOU A;  3SYC A;  4PI0 A;  3D6Z A;  2EJR A;  4JZ2 A;  2Q5Z A;  2LGQ A;  2J58 A;  3RL0 D;  1SF9 A;  3HKE B;  3CCQ V;  2KG7 A;  2AZ0 A;  2WPV B;  4KXR A;  4X65 O;  2YID A;  1XIL A;  3CP1 A;  3UT5 B;  2WSS G;  1LTT C;  1ZOY C;  1N8R W;  4GX1 A;  4UXN A;  1XNQ B;  1RH5 B;  2FXP A;  1PPJ G;  1FAV A;  3B2E E;  1KB9 I;  4I7Z C;  3OD4 A;  3WU2 H;  4YXD C;  1VQ4 P;  4X1Y B;  4DR2 B;  4X1I A;  2IH1 C;  3ZMT A;  4PDV A;  2Z4E A;  2MK3 A;  2WAM A;  4QMA A;  2A06 H;  1YIJ P;  2FYU H;  5B1B B;  2KSD A;  2KUB A;  2K88 A;  3KZI E;  2IYP A;  5IYZ A;  1VQ7 P;  2QWQ B;  4I2L C;  3U11 A;  5D5Q A;  1NKD A;  3ZMZ A;  4K8X A;  2Q7E A;  2XV5 A;  5CN0 A;  1YJN V;  2IW5 A;  1Y9B A;  4PD4 H;  4YJ3 A;  3KCX A;  2I8D A;  2P22 C;  2B87 B;  1NH2 B;  3T1Y O;  4X66 O;  2YEV B;  4DV7 O;  1IBM O;  4DR7 O;  3JAL B;  3MAQ A;  3L71 E;  5KHG A;  4X8A A;  2B1G A;  4LCU C;  2BCC H;  1LTI C;  2ZYG A;  3JAT A;  2ZDI A;  1IXB A;  1DTO A;  3HKD A;  3CLQ A;  2BEQ D;  1GDT A;  5AVV B;  3RL0 C;  1J5E O;  2XKM A;  4C7U A;  1LTJ B;  3AE6 C;  1NS1 A;  2YSU B;  3ZMV A;  2WPS A;  1I5X A;  3UT5 A;  1J2J B;  3BCC E;  3JD3 A;  2PTM A;  3OR7 C;  2IBZ G;  3TGU E;  1M57 D;  3EFF K;  1XL4 A;  2ZIN A;  1M1J C;  4RJT A;  4KHP B;  3V2Q A;  4ASV A;  2KQX A;  1R3K C;  3N4X A;  1LT9 B;  3GLM A;  4B3R O;  4HZ3 A;  2W6I G;  1RQU A;  1YHQ V;  1RF1 C;  2PRR A;  3CWB G;  1R3L C;  2NPS B;  4BRY B;  3SWF A;  1BE3 D;  1N2D C;  2QR4 A;  4LF7 B;  1FXV A;  4Q6G A;  2V4D A;  1PP9 D;  1Y4M A;  4HH2 A;  2DYS C;  1W2B U;  2YS8 A;  4CZZ A;  3QTC A;  1HR0 O;  3CCE V;  2Y48 A;  1PIX A;  1BHA A;  1N32 B;  1BGY G;  1KC8 Q;  1GK6 A;  1XNR B;  3SR2 C;  2QJ1 A;  1IBL O;  1FOS E;  4DV6 B;  1K9M W;  1NU1 G;  1VL2 A;  3Q5S A;  5KA5 A;  4AQY B;  4U3F D;  1YYC A;  1URQ A;  1VF6 A;  3JAL A;  3MDS A;  4K8Z A;  4DXW A;  1FS0 E;  4C7N A;  3ABK C;  3N2K B;  4ICG A;  3IC9 A;  1RP3 B;  5CCH C;  3TF5 A;  2RMZ A;  1NTK D;  1ZWI C;  2Y0P A;  4JV5 B;  4GKK O;  1LTJ A;  1Y76 A;  3PTZ A;  2HR3 A;  1SQF A;  2QWP B;  1R3I C;  1L0L E;  4WBN B;  1M57 C;  1Q43 A;  4PJ0 H;  5EK0 A;  2QJP B;  1VIB A;  3LNM B;  3P3P A;  4DR5 B;  2Y0I A;  1CPY A;  1K73 Q;  2JJ2 G;  4BR6 A;  3VQV A;  3ZMS A;  1IX9 A;  4RO2 A;  4DJG A;  4LGD E;  2FBW C;  2YC0 A;  3G6E V;  3JAW B;  3CME V;  2F4V B;  3H1K J;  4R4M A;  3EHB B;  2M5A B;  4BRY A;  4NTX A;  3WB1 A;  2FL4 A;  5KKZ B;  1SET A;  4Y28 J;  2PF4 E;  3MD0 A;  2EIK C;  1S5L X;  1NTM H;  4XDL A;  3H1I H;  2O3J A;  1IVS A;  3SSU A;  2HJF C;  3AG4 B;  3K0G A;  1PKX A;  4PV1 D;  4X65 B;  1FXK B;  1Q7Y Q;  1AQ5 A;  1GKF A;  3H01 A;  4DV5 O;  4NB5 A;  3K03 A;  4QE9 A;  3RK2 B;  3N2K A;  4IHJ B;  4J10 A;  4X64 O;  3KQG A;  1Y66 A;  1GAX A;  4MW3 A;  1SES A;  3CC7 P;  2QVA A;  3CRA A;  4LFB O;  3OFN G;  4WBA A;  4FK5 C;  4WBN A;  1FOS F;  5JQG A;  1M4U A;  5H9C A;  4RQE A;  2P7J A;  2E75 B;  4I0X B;  2M7W A;  4UVB A;  2QIW A;  3CD6 V;  5L3C A;  5LMU O;  4JI6 O;  3ETG A;  1GW3 A;  3Q2Y A;  4KUM A;  1LTS C;  3FWN A;  1YVW A;  2IX7 C;  1L8D A;  2QTO A;  4AYC A;  2M3E A;  1WN7 A;  2OGU A;  4JPR A;  4PD4 I;  3CCM P;  1GK4 A;  1KFN A;  2CGN A;  2CK3 G;  1TGO A;  2CTP A;  1SRY A;  1A32 A;  3JAR B;  3T1Y B;  2FY8 A;  3JAW A;  4X66 B;  1NHL A;  2V4H A;  4DV7 B;  4DR7 B;  2ZVO B;  3L71 G;  5H6Q A;  3AG1 B;  1SFC A;  1IBK O;  2AEF A;  1SQV H;  4JYA B;  5B5E E;  2XND G;  4DV0 B;  2ADQ B;  2ETN A;  2CH7 A;  2OTL P;  2Q7G A;  4I50 B;  1J5E B;  1YI2 V;  1ZME C;  5J9P C;  1KB9 E;  1M1K W;  2JRI A;  2W8Z A;  5D5P A;  3BCC G;  4WB4 A;  4QPK A;  1KUQ A;  3MIW A;  1FXK A;  1IXM A;  1IK7 A;  4W7Y A;  2ZFC A;  2PYJ A;  3JD0 A;  1TUB B;  3ZHR A;  3TGU G;  5KTB A;  4DV4 O;  1E5W A;  2F95 B;  2C0X A;  2A45 H;  3L72 J;  1RE4 C;  3LIE A;  3FWL A;  2KS1 B;  1UPG A;  2EZO A;  5IWA O;  1M56 B;  3WMM 0;  4FLV A;  4B3R B;  2E42 A;  1AVM A;  1ZL8 A;  1THZ A;  3HKC B;  1CSB A;  2WZ7 A;  1GN2 A;  1K4D C;  1EDI A;  5LP6 C;  1GM7 A;  4X89 A;  3SGI A;  3CXH H;  2XT9 A;  1D5N A;  1NKZ B;  2HPC B;  2Q3E A;  3RT3 C;  2HP8 A;  2JO1 A;  4I0X A;  4O4L A;  4IL6 H;  2QM7 A;  3JD4 A;  1JTH A;  3B8M A;  4BIZ A;  3ZX6 A;  2PY5 A;  3ZRW B;  2UWJ E;  3T4D A;  4XE5 B;  3E83 A;  1B6Q A;  2JGU A;  5B66 E;  1W2E A;  3BVH A;  1S72 P;  3JAR A;  5JCO A;  4ASU G;  4YXW G;  1FS0 G;  2YNY A;  1NTZ J;  3CRQ A;  2P4K A;  5BMV B;  2DOS A;  5KMG B;  3L36 A;  4AI8 A;  3CCU V;  3CX5 I;  3CRC A;  3P7K A;  1KP3 A;  4DYL A;  5EC1 C;  2Q0O C;  1L0L G;  3E8F A;  4N3Y B;  5APS A;  1FJG O;  4I6M C;  1VQN V;  5B1A B;  2OIG A;  1J1D C;  4HKZ H;  4DW0 A;  2HJD A;  1TUB A;  2Q73 A;  3LUT B;  1K9M Q;  1PL5 A;  2AW9 A;  3AEF C;  2ZE6 A;  3D70 A;  2M6Y A;  3H1K D;  1KQG B;  2ZCE A;  4WVZ A;  1LTG C;  5CBO A;  2KS1 A;  4K0K O;  2O01 H;  2MKV A;  4KHX A;  3HKC A;  1JMB A;  3N2G B;  1AR4 A;  5AVS B;  2X0L A;  4B86 A;  5FL7 G;  1YDX A;  1L0N H;  1D5A A;  3L75 H;  1OMI A;  2B88 A;  5KHK A;  2EX3 A;  1WMK A;  4DK0 A;  1RM1 B;  1SQP E;  4J7Z A;  1Y47 A;  3E1I A;  1KIL D;  3KPE A;  4DV1 O;  1L4A A;  5L3G A;  1GL2 B;  3V4W A;  1IFN A;  1OW8 A;  1NTM J;  2VQF O;  1VDF A;  3AEC C;  1FFX A;  1OIP A;  2UXC O;  3U0Z A;  1EZV H;  1JCD A;  4JI5 B;  1BCC E;  3LSS A;  1XL6 A;  5LMN B;  5AW3 B;  1AI6 A;  3AG3 B;  4DV5 B;  1J1E B;  2KLV A;  4JPZ B;  3JYC A;  2A06 D;  2FFD B;  4XBF A;  5APT A;  1ENV A;  3GVM A;  3CCR P;  1I08 A;  3FB7 C;  1TAE A;  2OIE A;  3ABV C;  2EIM C;  2OYI C;  4TV8 B;  1NYH A;  2CE4 A;  3ZBH A;  2HLO A;  3RYC B;  2OTJ P;  1R1B A;  3CMA P;  4LFB B;  1ROP A;  3E8B A;  2QE7 G;  4TQF A;  5EZY B;  3HUS B;  4BW9 A;  5FPR A;  1FYJ A;  1FAF A;  2C9L Y;  1OW6 A;  1WPB A;  1R73 A;  3AEG C;  5LMU B;  3A2F A;  3JAM N;  1HTL C;  4Z1V A;  3ETD A;  3KDP B;  1US6 A;  3WG7 B;  3P32 A;  4AIL C;  1Y67 A;  3VQY A;  4QJF B;  3FXD A;  1DGS A;  1NOH A;  3SJB C;  1KIL C;  3U1C A;  1Z5W A;  3SJQ C;  5GTI Z;  4UCR A;  3DC6 A;  4L75 A;  1MFZ A;  1SQV J;  1YQ3 C;  5H2F Z;  3ASO C;  3IJ4 A;  2IZ0 A;  1JOY A;  4J42 A;  1VQM P;  3ABL C;  4R8C A;  3L72 D;  1GM9 A;  2GSM B;  4GOF A;  3VMX A;  3SPG A;  1TU3 F;  3K3W A;  2WT7 B;  3CC2 P;  1XTG B;  4ABM A;  5K1X A;  3VOP A;  5CBF A;  5KHI A;  5CBH A;  2A45 I;  3RK3 D;  2FFD A;  1AR5 A;  3CB2 A;  2FYU E;  3NMD A;  4TV8 A;  4WY4 A;  3RYC A;  5AVU B;  4N6J A;  1JM0 A;  2R5B A;  2AXT H;  4QPJ A;  3FB5 C;  3HUS A;  1H0T B;  2WPQ A;  4LC1 A;  1S76 D;  1R6T A;  1WLE A;  4P9O A;  4M3L A;  1BZK A;  3VMA A;  1QVF O;  1T3U A;  1V55 B;  4CC6 A;  4PD4 E;  4FZ1 A;  3GF3 A;  4PA3 A;  2KNC A;  4CS3 A;  1VMG A;  4PA7 A;  4EB6 A;  1W0K G;  4J11 A;  1NTZ D;  3WUT A;  5BVZ A;  1L1F A;  3KHU A;  1PFI A;  2LO1 A;  2YXQ B;  3OMI B;  2M0B A;  2BCC E;  3ZHU A;  4DV3 O;  1BE3 H;  1V9P A;  2P06 A;  4KFM A;  2GUS A;  4GX2 A;  3AE4 C;  4BWA A;  2FB5 A;  1N34 O;  1PP9 H;  3SWK A;  1NI8 A;  3AEB C;  1F51 A;  3CCL P;  3NR7 A;  5EYP B;  3ETE A;  4D6T J;  5E79 E;  1XQ8 A;  1VQ8 P;  1NR7 A;  2WTY A;  2ZVN B;  4I7Z B;  4JI1 B;  1EDJ A;  1HNZ B;  3M91 A;  1FJG B;  3H25 A;  1OX3 A;  2RN9 A;  1OCZ C;  4U3F H;  4DR3 B;  4JYY A;  2UU9 O;  2P1J A;  3AEA C;  1VQ6 P;  1X22 A;  2WT7 A;  1ZR2 A;  3B71 A;  2YUA A;  1X4T A;  1PGP A;  4XDJ A;  1NTM K;  1NTK H;  2IPP A;  3BFR A;  3HE4 B;  1M7L A;  4C46 A;  1O9G A;  3K04 A;  5AVY B;  1TA8 A;  2O01 J;  1RE3 A;  1OWA A;  3H1J E;  5AVQ B;  1HJB A;  1NVP D;  2ZNI A;  1NTM D;  1PPJ D;  4FLZ A;  1H0T A;  1KQS U;  2Q3I A;  4PA6 A;  1QU7 A;  1VF7 A;  2GHY A;  4LWS B;  2EIJ C;  1SP4 A;  1OZ0 A;  2QJK C;  3OAA G;  4TOI A;  1P84 D;  3ZDM A;  1H2N A;  1R6K A;  3AE7 C;  2DYR B;  1GN6 A;  3M9H A;  2YIU C;  1R8E A;  1HWT C;  1XMQ O;  2JEE A;  2DW3 A;  1YTZ T;  3GG2 A;  1MOF A;  3VTP C;  1SA0 B;  4P9P A;  5LGU A;  5C39 A;  4PD4 F;  1JX9 A;  4JTA B;  2QM4 A;  3ZRS A;  5J2T B;  1PNK A;  3SPC A;  1DF4 A;  4D7S A;  3D36 C;  2X6B A;  4JYC A;  3SPH A;  3GF7 A;  4PJ0 E;  3F89 A;  3JCZ A;  1T2K D;  1BS3 A;  1UFI A;  3PH0 A;  1HNX B;  3ZMU A;  1SQX E;  4H33 A;  1SQV K;  1MV8 A;  1UII A;  1RF1 B;  4J9Z B;  2KLU A;  4DW1 A;  4YHH O;  4LFA B;  5FLX N;  5TIS H;  1SQV D;  3G71 P;  1OZH A;  3Q4H A;  2GA1 A;  4JAU A;  3GWK C;  4O2B B;  2IBZ D;  1AVO A;  2DYS B;  1HNW B;  4EDF A;  5KUK A;  4EOT A;  5APY A;  5GTI H;  1SS1 A;  3H1I E;  2P4V A;  4LWS A;  3CCQ P;  2LJ2 A;  1BDC A;  3OAK A;  3L74 J;  1BDD A;  1N7L A;  3E7K A;  4JI0 O;  4QNH B;  1M8O B;  4MVR A;  5CA1 B;  1WJZ A;  1S5L E;  5CMZ A;  1SQB H;  4JAA A;  3E35 A;  3ABK B;  1ZRT E;  4F6R B;  1XHX A;  3H1H J;  1QLE B;  3SYQ A;  3K59 A;  2QWN B;  1LGH B;  3EVK A;  4X62 B;  3S4R A;  1MA1 A;  1AFO A;  1IC2 A;  5AG2 A;  1SA0 A;  1ORQ C;  2FYU G;  3CXH D;  1DEE G;  1SQG A;  4BIO A;  1M57 B;  2W6J G;  1I0H A;  1T2K C;  1LWU A;  1Q86 W;  3H6P A;  2JS3 A;  5AVR B;  4UB6 Z;  1WB7 A;  4LF4 O;  3IFM A;  5GTH H;  2IH3 C;  2XAH A;  2H43 A;  2VRZ A;  3L70 E;  2R9I A;  2E76 B;  3G4S V;  2PGD A;  4FVM A;  1EDK A;  4LF9 B;  2P5O A;  3JD1 A;  3J7A U;  2BCC G;  1W5C E;  3R2P A;  2RJZ A;  3FGA D;  2D2C B;  3AE5 C;  2EIK B;  4D6T D;  4O2B A;  4DV3 B;  1X79 B;  4I4T A;  1MAB G;  4OPA A;  1EC5 A;  4JI3 B;  4YPC A;  1N34 B;  2QGN A;  3JSL A;  5F2V O;  3STZ C;  2YDE A;  1VF5 D;  5L3D A;  1K73 W;  3IAY A;  3W7X A;  2WLM A;  1FBM A;  1ZW0 A;  2DN9 A;  5CCH A;  1N7S D;  3OMA B;  4U3F J;  2N1T A;  4X9Q A;  5EIB D;  2F66 C;  2GBO A;  1YHQ P;  4H13 D;  1DF5 A;  2ZXW C;  1U57 A;  2RMK B;  1X8Y A;  3JAK B;  1XMO B;  1IZN B;  2PUS A;  4O4I A;  1NTK J;  3H1J G;  1B04 A;  1HVV A;  2PP6 A;  4RAI A;  4LF5 O;  1OVR A;  2O01 N;  1P84 F;  4TV9 B;  2LKM A;  3CCE P;  4I5S A;  1Q7Y W;  4TWK A;  1CP9 A;  2YMK A;  3HD7 A;  4B7E A;  2IFM A;  1YIT P;  3F5T A;  3D8C A;  1EXI A;  3TET A;  3OTO O;  2O1K A;  2ZQM A;  3B5N D;  2QKC A;  4BAY A;  1N33 O;  1K33 A;  4JI7 B;  3TK1 A;  3F5W C;  1XMQ B;  1FZC C;  2BOC C;  2IJJ A;  2I1J A;  3H32 A;  1WB8 A;  1KZU B;  3DXR A;  1QX8 A;  1VF5 C;  5AW2 B;  1AIL A;  4N78 D;  1G4Y B;  4NPF X;  2QTS A;  5CA3 A;  1IFI A;  4EFE A;  1K34 A;  3JCU E;  1K8A Q;  3K5B A;  5CB4 B;  1VQ5 V;  2VS0 A;  3K9S A;  1N7S C;  2OCC C;  2L91 A;  5EIB C;  3M0D A;  4H13 C;  1SQX G;  1FDM A;  2K1A A;  1NO4 A;  1NH4 A;  3G6E P;  3ICX A;  4OGQ B;  3CME P;  5LP6 B;  2WLL B;  4J7K A;  3I55 P;  3B8N A;  5B3S C;  1L0N E;  2GUZ B;  3L75 E;  5C8Y A;  5CBN A;  2E3C A;  1IFM A;  5KAF Z;  4ZOL B;  1EN4 A;  1ZXG A;  1YJ9 V;  4TV9 A;  3L74 D;  1RF0 A;  3H1I G;  2KZJ A;  4A7P A;  1OCR B;  1MZE A;  3LDC A;  4TUY B;  1YF2 A;  3HKB B;  2B5U A;  4BIU A;  1EZV E;  3IR9 A;  3B5N C;  5KLV H;  3AG7 A;  3H1H D;  4MVO A;  3CJH B;  3MUD A;  4ZNC A;  1PGQ A;  2B89 A;  5JH7 B;  5K5G B;  4DUY B;  4X88 A;  1QR8 A;  3CXH F;  1YTF D;  1SQB J;  3PLN A;  3L37 A;  3G80 A;  2K9P A;  1Y74 B;  3W7U A;  2RN0 A;  5CCG D;  3UM7 A;  5BU8 B;  1H8A A;  1P49 A;  3HKE A;  2IJH A;  1MZ9 A;  2E74 D;  1QVG O;  1K3E A;  4L8J A;  2IDB A;  2JEX A;  3ETQ A;  4TLF A;  1KYO H;  1J1D B;  4DR1 O;  1GN3 A;  3Q5R A;  3L72 H;  1XEQ A;  4GDO A;  5CB4 A;  4X1Y A;  2EIN C;  2W6A A;  1DX7 A;  2H94 A;  1GW4 A;  1QVF U;  2UXB O;  1F4M A;  1KEC A;  5HFL A;  3L70 G;  3QG5 A;  2N1T D;  2WLL A;  2DMX A;  2BSK B;  2XAQ A;  2QSA A;  2GUZ A;  2WPD G;  1FJK A;  3GHG C;  2HVJ C;  3OE7 G;  4ZOL A;  3VP8 A;  1E79 H;  2YI8 A;  4Z2W A;  4GOE A;  3ABU A;  1XI1 A;  3CC4 V;  2NZ2 A;  4TUY A;  1YI2 P;  3A0B Z;  3HKB A;  3BVO A;  4Z1M H;  1WAZ A;  2B87 A;  1RHZ B;  1Q86 Q;  1H2L A;  3N27 A;  3L73 H;  4JTC B;  1NTZ H;  2YEV A;  3CJH A;  1NTK K;  5JH7 A;  1PD3 A;  4OX9 O;  1MSW D;  1HDJ A;  2A45 G;  2YKO A;  5CMU A;  4B3M O;  4DUZ O;  2LXC B;  2WQY C;  3W7T A;  4JQ0 D;  3OUS A;  3EFG A;  1Y74 A;  2JS5 A;  2WSF H;  3HRN A;  2P58 A;  5C93 A;  4LFC O;  2E74 C;  2EIM B;  5BY1 A;  4TT3 H;  2OYI B;  3O8Z A;  5DJU B;  3APO A;  1J95 A;  2XAS A;  3ZS8 C;  5LHI A;  2A79 B;  1LT1 A;  2WA4 A;  2AXT E;  4ZKI A;  5KA6 A;  4ZKP A;  4CS2 A;  4LF5 B;  4IIJ B;  1PV3 A;  2RCV A;  4NXN O;  1LT9 A;  2UUA O;  3GW6 A;  4P30 A;  3CCV P;  1LR1 A;  1MSD A;  2NPS A;  2ITC C;  2ARH A;  1KD1 W;  2OT5 A;  4CPG A;  1KQS O;  1PNL A;  2BSK A;  3P8C D;  1BE3 E;  3R65 A;  2WSS H;  1KKC A;  1KIL B;  1MMM A;  1N33 B;  2W83 C;  1PPJ H;  1Q81 W;  1PP9 E;  3ZHV A;  1VQ4 V;  1V54 B;  1Z56 A;  3I56 V;  3ABL B;  4JF7 A;  1ZLZ A;  1VQN P;  2R72 A;  1P84 H;  3CI9 A;  4IT5 A;  2W0X A;  3E2E A;  3X2Q C;  4FLT A;  2R44 A;  1SQQ J;  3KZI Z;  3SYO A;  3AE1 C;  4H37 A;  4N21 A;  4DK1 A;  2OYI A;  1A02 F;  4PDL A;  2H8P D;  2Q7C A;  3MHH C;  1KP2 A;  2BTO A;  4MVZ A;  1AJQ A;  5IJ0 B;  3I5D A;  2OWO A;  3A0H E;  4IFF A;  1L0N G;  3L75 G;  5KLI C;  1CW5 A;  2V1D A;  1Y8A A;  2ADP A;  1T5E A;  4N23 A;  4IIJ A;  3V2R A;  1SQB K;  1SS3 A;  2YXR B;  5LA6 B;  2KK7 A;  2AHY A;  1SQB D;  3C90 A;  1EZJ A;  2KSJ A;  4RQF A;  2ZD9 A;  1VQL P;  2M5A A;  1IBM B;  2OYH C;  5KLV J;  1VQK P;  4IFM A;  1OJH A;  1K97 A;  3A3Y B;  5LBQ A;  4JZG A;  1Z5V A;  2QEX P;  4FIP C;  2IBZ H;  3FFQ A;  1JQ0 A;  4PV1 C;  4PA4 A;  1EFR G;  2YIC A;  4MTF A;  2K37 A;  2P6J A;  3HB3 B;  2KIK A;  1G1X B;  3CCJ V;  2YIB A;  3JSN A;  4DRX B;  2M8R A;  5AW9 B;  4IHJ A;  1URQ D;  1KQF B;  3H1L J;  1JB0 J;  2ZDI C;  3FB6 C;  5EBW C;  4IL6 X;  2H8P C;  2WSE J;  4H0L B;  2GDS A;  2E5Y A;  4K3A A;  5LGN A;  5TIS E;  5IJ0 A;  3CYO A;  4B3S O;  1NU1 H;  2BTQ B;  2YXH A;  3K06 A;  5AVX B;  3TYY A;  2XNX A;  3MHV A;  4KT0 J;  2EIJ B;  1OHH G;  4J80 A;  2JWA A;  1OXZ A;  1HR0 B;  2QJK B;  1PL4 A;  5LA6 A;  3II6 A;  3A0B H;  2Q6A A;  3V5B A;  1XTC C;  1IBL B;  2A3Q A;  1LNQ A;  1Q8I A;  5L8R J;  2WLK A;  2CAZ C;  3GWO A;  5B1B C;  1Q3E A;  4DR4 O;  3L73 J;  2GV9 A;  5JJJ B;  2NPS D;  2AEM A;  1L2P A;  4B3M B;  3S3W A;  4D6T H;  3UO3 A;  1DK1 A;  2DQ0 A;  1CI6 B;  4I50 A;  4GKK B;  2WSF J;  3JC2 2;  1S4X A;  2H88 C;  4U7O A;  3RYH B;  3OMN B;  2XU6 A;  5KAI H;  4O2A B;  1FKA O;  2NRG A;  1URQ C;  1VF6 C;  4R50 A;  5GTH E;  4L74 A;  3Q5P A;  4X20 B;  2G38 A;  3U59 A;  4NXN B;  4UCU A;  3NTN A;  2MW2 B;  3ZIA G;  4GZR B;  4NKG B;  1MFT A;  5L3E A;  3AED C;  2QJY C;  1LTJ C;  3CHX A;  3AE8 C;  2WA3 A;  4YIP A;  2CGO A;  4OVN F;  1G1I A;  3QO8 A;  4CH4 A;  2HPC A;  3O9O A;  2VWJ A;  2BTQ A;  1SQQ K;  3EXA A;  2LGW A;  1PP9 G;  1O9H A;  5KAI E;  4UB8 E;  3BAA A;  3KG2 A;  3ZRW A;  3W68 A;  1CEZ A;  1SQQ D;  1Y6X A;  2V7Q G;  3LID A;  1GO3 F;  3FB8 C;  4F6E A;  1KQL A;  4H44 B;  2WLH A;  4CS4 A;  1IFP A;  4UV9 A;  4BWN A;  5GON B;  1P84 I;  5HFM A;  1WRG A;  4LP8 A;  1F7Y A;  3TNU B;  1KD1 Q;  3ZHT A;  5BMV A;  5DED A;  3QNE A;  4LR3 A;  5KMG A;  1KFM A;  1SFC D;  2P90 A;  5KJ7 A;  4X64 B;  1H2S B;  4JI2 O;  1CI6 A;  4OWF A;  1I94 O;  5H5N A;  1H38 A;  2WPR A;  3C1L A;  1Q81 Q;  1U7M A;  1QNM A;  1YSC A;  5E1A C;  4ASW A;  3APQ A;  4FM2 A;  1Q5O A;  4K35 A;  1MZF A;  3RYH A;  4AQR D;  5KLV K;  1H89 A;  3JAS B;  3IFX A;  3IN6 A;  3L71 H;  2ZT9 B;  4JI6 B;  5APV A;  3B09 A;  1S2E A;  3VMY A;  1G2C B;  5KLV D;  3H1K E;  5B5E Z;  1E1R G;  1FXH A;  5IY5 B;  2XND H;  1K7D A;  2XOK G;  3RK2 D;  1YXB A;  1JR9 A;  4FLU A;  4FZ0 A;  1NAY A;  3N2G A;  2OTL V;  2ZIO A;  1SZX A;  2IJK A;  4RWU A;  2XHB A;  3BCC H;  3BA9 A;  4I9W A;  2Y4T A;  4W4L A;  1IBK B;  4PDR A;  3TJT A;  3KCY A;  1U97 A;  3L74 H;  4LF6 O;  4GIF A;  1GL2 A;  1VQO V;  1KIL E;  3RYF B;  2E75 D;  3VQX A;  1KYO D;  1DD4 A;  1VQP V;  1FD9 A;  4F4L A;  1QVG U;  1SER A;  3H1L D;  3LNN A;  3WU2 E;  2H89 C;  3H1H H;  4GUN A;  5GON A;  4DV4 B;  1B06 A;  3CWB J;  3HE5 B;  2N04 A;  3SYA A;  1SFC C;  5KKZ C;  5IJ9 B;  2A06 E;  4I55 B;  1Q6U A;  2ZXW B;  5IWA B;  4LF8 O;  3UKM A;  2UXD O;  3AE2 C;  3G3Z A;  1PGJ A;  4UFZ A;  1KOR A;  4WFF A;  3AG4 C;  4ZKU A;  3ABM B;  5B66 Z;  1BGY J;  1GTO A;  2Q68 A;  5EZY A;  1FE6 A;  1Q2N A;  3CXH I;  1BSM A;  4FPP A;  1NTZ K;  3JAS A;  3T4Z A;  3CCS V;  1F4N A;  1S72 V;  1NU1 J;  2QWR B;  1EBO A;  2YIA A;  2BEZ F;  5CA0 B;  2QA4 P;  3L73 D;  1UJW B;  4MVM A;  4HB1 A;  3ZRV A;  1X0T A;  1S77 D;  2F93 B;  4X1K B;  4YIO A;  1AP5 A;  4DR4 B;  1LTA C;  1FZC B;  1CXZ B;  3Q3D A;  5AW5 B;  4WFE A;  3T2M A;  1S9K D;  2N9B A;  1KKD A;  2VWK A;  1LUW A;  1RSO B;  4LH7 A;  2FYN C;  5LHH A;  1VF5 B;  3KXD A;  1L4A D;  5J2U B;  4ZBM A;  1ARO P;  3L72 E;  1N7S B;  2ZYD A;  3M9B A;  2OCC B;  5JCO C;  3HTK B;  5AVZ B;  3RK3 C;  4H13 B;  3HE5 A;  2ZE7 A;  2C0W A;  3AG1 C;  3CX5 D;  3D3Q A;  1JA8 A;  2LQT A;  5L3B A;  3RK3 E;  4I55 A;  1VQ9 P;  1LP1 B;  3G4S P;  4K0K B;  2QWO B;  3M0A A;  2WLI B;  1PNM A;  3OM3 B;  5B3S B;  5CBG A;  3BRT B;  1UIX A;  1AB3 A;  1AP6 A;  2K9J B;  1SQP G;  2O57 A;  4B3T O;  1SKV A;  1OV9 A;  1BT8 A;  1M5I A;  2WSC J;  5LYJ B;  4DV1 B;  4JI8 O;  1K8A W;  1AVY A;  1TVK B;  4WFG A;  5CA0 A;  1EN5 A;  3AG2 C;  3M99 B;  2NNU A;  4MVQ A;  2VQF B;  1K05 A;  3A7O A;  1LJ2 A;  2A0L A;  3RBZ A;  3CCR V;  5APX A;  2UXC B;  3LSQ A;  1HWY A;  1BCC G;  2JGD B;  3AE3 C;  4RUE A;  1EZV I;  5LOV B;  2RNB A;  2ITD C;  3GMA A;  2OTJ V;  2Z0A A;  2WMM A;  1HJ0 A;  3DC5 A;  3RL0 B;  4GKJ O;  2QE7 H;  4DT0 A;  1JEK A;  2AGA A;  1RSO A;  2Y69 C;  5EYP A;  1L4A C;  2R32 A;  3RYI B;  2X7R B;  2Q67 A;  5J2U A;  2JJL A;  1M1J B;  2EIN B;  5AW4 B;  5JVD B;  1K04 A;  3HTK A;  4KL1 A;  3C3S A;  2YKP A;  1H8H G;  3H1K G;  1LUV A;  2Q7H A;  1JFF B;  4PEL A;  3L71 J;  3LW5 H;  3ZN1 A;  3LSU A;  5BXZ A;  3HE4 A;  3K5M A;  2B1I A;  4RO0 A;  3GHG B;  1F23 A;  2XAJ A;  3C3T A;  1AV1 A;  1KB9 H;  1VQM V;  1KYO F;  4WY4 D;  3S1K A;  4U7N A;  3NXS A;  1NTM E;  4NR1 A;  1PPJ E;  1HF9 A;  2K9J A;  3BCC J;  1FJP A;  2ZYA A;  5H2F H;  1M90 W;  1OVV A;  5LYJ A;  3OGC C;  3RWR D;  3TGU J;  1YZB A;  1TVK A;  2Q4P A;  4FMT A;  2HOD B;  1HW7 A;  2JKV A;  3ZED A;  3CWB D;  1FDI A;  1P84 E;  3L70 D;  3OA7 A;  2JK5 C;  1GN4 A;  1FU1 A;  1OCO C;  2JGD A;  1VQ5 P;  4J9Y B;  3E1R A;  3BEH A;  2YKQ A;  1NU1 K;  2VQE O;  1DLB A;  2E74 B;  2HLD G;  2A06 G;  4Y99 C;  3CXC U;  1VEW A;  2R3C A;  3CEI A;  1BGY D;  4FFK A;  2NLJ C;  4O4H B;  4WFB V;  4LF8 B;  1NU1 D;  5J2T A;  5B66 H;  3MZW B;  1YJ9 P;  5KHJ A;  1JVM A;  1YJN P;  1M1J A;  2ZR2 A;  3OR6 C;  5JVD A;  2W27 A;  1T3J A;  3M8A A;  3AG3 C;  2RH0 A;  3EQ2 A;  1DD3 A;  2Y9Z A;  1G6U A;  1I5Y A;  1Q82 W;  1RF1 A;  1FZG A;  2FFD C;  1JFF A;  3BRC A;  3ASN C;  4DR6 O;  4NTW A;  3VP9 A;  3CCL V;  4WY4 C;  5E79 Z;  2IU3 A;  1S1C X;  1K4C C;  1SQV E;  2YO2 A;  3W7W A;  2QM8 A;  3E8G A;  2IBZ E;  1KU9 A;  3HUS C;  3N7N A;  4KHP O;  1L0L J;  3SFD C;  2XAF A;  3ZCC A;  1VQ6 V;  2Y4U A;  3A8T A;  3OW2 U;  2HOD A;  4HNA B;  4UVA A;  2DQ3 A;  4ZMD A;  1GZL A;  3X2Q B;  5CA1 A;  1YTZ I;  3L72 G;  1GM8 A;  3AK3 A;  4F6R A;  4EYY Q;  2EJ7 A;  2UU9 B;  4BXL A;  2BOB C;  1AI5 A;  2ITA A;  3J80 N;  4UUJ C;  2PI5 A;  4PA9 A;  2G8Y A;  1WPX A;  4DO2 A;  1N32 O;  4O4H A;  2QKS A;  3CXH E;  5KLI B;  2ODM A;  1USD A;  1BSH A;  1IDS A;  4MT8 A;  4OH8 B;  3AEE C;  1H8E G;  3H9V A;  2RQ6 A;  4P2Z A;  3IGA C;  4IL6 E;  2CUG A;  3QH9 A;  2V7Q J;  1S5H C;  4B3T B;  2JDI H;  1ZTE A;  2IM9 A;  3J81 N;  2JIZ G;  2JJ1 G;  4PHZ A;  3FX7 A;  1NGM B;  1H2K A;  3HR0 A;  1HUC A;  2OYH B;  3K9A A;  4W80 A;  4XA4 A;  5IYZ B;  1AQT A;  4OXS A;  4OPH A;  1RE3 C;  4MVS A;  4JI4 O;  4L76 A;  4D6T E;  4PJ0 Z;  2AEJ A;  4TT3 G;  5FNV B;  5B1O A;  4UV8 A;  4DR5 O;  4GT1 A;  4GKJ B;  4PV1 B;  2HFE D;  4MTG A;  5EC2 C;  1YJW V;  2VRS A;  4FFB B;  4RKU J;  2R9A A;  1QL2 A;  4YJ3 B;  3THO A;  1QBZ A;  1SQQ H;  1NJI W;  4GKG A;  2F4V O;  4E4E A;  3L71 D;  3JAT B;  4FLY A;  4IYH A;  2C2A A;  2IZ1 A;  4HYT B;  1JO5 A;  1SZT A;  3WB2 A;  2WWW A;  2ZE8 A;  4O4J B;  3V6I A;  3LW5 J;  1URF A;  4MTO A;  1VPC A;  3JAK A;  3BCC D;  1DIP A;  4YHH B;  3ML0 A;  2FML A;  3RFR A;  2Q6Q A;  4FM1 A;  4PDM A;  5EBM C;  4IFD K;  1IFD A;  3TGU D;  1NTM G;  4R6Z A;  1S5L Z;  1GMG A;  3I56 P;  4XDK A;  2D3O W;  2YMY A;  2Z5U A;  2GTS A;  2AZ2 A;  3K79 A;  2N74 A;  4XFJ A;  2PAJ A;  2N05 A;  4MN4 C;  2OYH A;  1QQC A;  4JI0 B;  3ABT A;  2ZM6 O;  3MGN A;  2HFE C;  2PGG A;  2W6J H;  2DJV A;  3OEE G;  3RVZ A;  4NVP A;  5FNV A;  2VQE B;  4FFB A;  5K1P A;  2Q1K A;  4B08 A;  2IFN A;  4J41 A;  2ILM A;  2RKL A;  4N78 E;  1M90 Q;  2Q9L A;  3CD6 P;  2DW4 A;  1URQ B;  3GB7 C;  3H1L H;  4E2L A;  1YCI A;  2DYR C;  4C7N B;  4UB6 H;  1RE4 A;  4JYA O;  2WSE H;  3T1H O;  2HKO A;  4DV0 O;  2J5U A;  4LF4 B;  2W0F C;  1L0L K;  1NQT A;  4UVC A;  5KX5 B;  3F7V C;  4YTP C;  4GX0 A;  3TXQ A;  2QJY B;  5CCH D;  5AVT B;  4O4J A;  4GLX A;  1QLE D;  1Y76 B;  5LP6 A;  2YO3 A;  1L0L D;  2R3S A;  1Z2G A;  4DR6 B;  5E79 H;  2X6A A;  4BW5 A;  1P7G A;  1SQV G;  1RPO A;  3TSI A;  2ZIM A;  2ZKO A;  1PGO A;  3SDL A;  1LWU C;  3VYI A;  2BE3 A;  1M93 A;  3L74 E;  1RPR A;  1P4R A;  2Q9I A;  4R7C A;  4LNU B;  2JVD A;  2L35 A;  4NYK A;  3HD7 D;  3BAS A;  2JR8 A;  3WUU A;  2CPB A;  3H1H E;  3CCJ P;  5DM6 V;  1Q82 Q;  3A2A A;  1N73 C;  5JJN B;  2EZP A;  3H1J H;  3RN4 A;  2E76 D;  1FC2 C;  5CCG C;  5FPO A;  3UCS C;  3S3X A;  3BY6 A;  4IL6 Z;  4TSF G;  2D2C D;  2KXP B;  3W7S A;  1QCE A;  1B3Q A;  2OYQ A;  4WWI A;  5KUM A;  1SQP J;  2B9B A;  4AUW A;  4HBN A;  2C9N Y;  1KMI Z;  1K5S A;  2F1M A;  1AI7 A;  1YIT V;  4NPE A;  2XZR A;  5AW0 B;  1EM1 A;  1JMM A;  4CBC A;  4EI2 A;  1T6A A;  2N9Y B;  2Q0A A;  1BCC J;  2LR2 A;  1FZF A;  4GYC B;  5KX5 A;  2N1T C;  1QLE C;  1XBL A;  1ZP0 C;  3CX5 H;  3G6B A;  4JBZ A;  3RBX A;  1XDC A;  2UXX A;  3OTO B;  1ZLL A;  2XTA A;  1HGV A;  3CPW U;  1YEW A;  1ZAU A;  2Z3Y A;  4I9Q A;  5JQG B;  1EQ7 A;  2E5T A;  1DH3 A;  2K9Y A;  2A7W A;  3JCU Z;  4D6T G;  3ASO B;  4ZHQ B;  4JI4 B;  4QGP A;  2JWD A;  2QRX A;  3CCU P;  3PJS K;  2E5L O;  4FLW A;  3G9R A;  3HD7 C;  3RGU A;  3K5O A;  1SQX H;  3F5H A;  4MS2 A;  4LNU A;  1AJY A;  3C8V A;  3K5N A;  4DV2 O;  1YIJ V;  4U3F E;  3KYQ A;  2E76 C;  3I55 V;  1VQ7 V;  1SFC B;  2W90 A;  3RVY A;  2D2C C;  1OCC C;  3ZN0 A;  1NTK E;  2NN4 A;  2CH7 B;  1N36 O;  4UCT A;  1KB9 D;  2P7T C;  1JY3 N;  1K5Q A;  3EWK A;  1GH6 A;  3UQ8 A;  4JI5 O;  5KAF H;  2EIL C;  5LMN O;  1IZ3 A;  1QL1 A;  4FJC C;  2HYN A;  3FXE A;  1S5L H;  1NJI Q;  1FZE A;  2QKA A;  1N4C A;  3CSX A;  3M0D C;  3G67 A;  1EZV G;  5KHH A;  4G28 B;  1GMJ A;  2CTR A;  1ZL8 B;  2KB1 A;  1VP7 A;  1NBM G;  5LHG A;  1KIL A;  3DSQ A;  2ZM6 B;  2FYU J;  3P8C E;  4OGQ D;  3FX0 A;  4O4L B;  4ZHQ A;  1KV4 A;  1WP7 A;  2FYN B;  2OCH A;  1N8R Q;  1JTH B;  1RF0 C;  5LGT A;  1FDO A;  5AW6 B;  1WT6 A;  2WLJ A;  1XRE A;  1XHZ A;  2PYL A;  1H2M A;  2QDO A;  1AI4 A;  1OCZ B;  3CWB H;  1IUR A;  4DR1 B;  1KYO I;  3MUD C;  3L70 H;  1NH2 D;  1NZ6 A;  4C7R A;  3RK3 B;  2ZXE B;  3TDK A;  4MVU A;  1OW7 A;  4B7K A;  4O9B A;  2CTQ A;  2PZS A;  4GCZ A;  3UIA A;  3T1H B;  2UXB B;  2YI9 A;  2BCC J;  1YQ4 C;  4DOJ A;  2KI7 B;  1BGY H;  2Q5U A;  1HP8 A;  5GW7 A;  1P7B A;  1ZUQ A;  4EKW A;  3RL0 g;  5BR8 O;  4QIW F;  5A2Q N;  2OAR A;  3PN1 A;  1JCH A;  5GTI E;  1EXJ A;  2HEP A;  1EDL A;  3L74 G;  1SC5 B;  4AHC A;  5H2F E;  1VQO P;  4JF3 A;  5APQ A;  3AG2 B;  4YJ2 B;  3LDD A;  2FXO A;  2CTW A;  1VQP P;  1RFY A;  2HHH O;  1QR9 A;  1SQB E;  1SQP K;  3H1H G;  2YIU B;  5ITZ B;  4OGQ C;  2AXT Z;  4OX9 B;  4L87 A;  5BU5 A;  2KYV A;  1SQP D;  4DUZ B;  3FYI B;  2HG5 D;  3H1J J;  3OW2 O;  2Y69 B;  4LFC B;  1L4A B;  1OVU A;  2OYO A;  1OCR C;  1AA0 A;  1FZA A;  3K58 A;  1FFX B;  1DEB A;  1BCC D;  2J59 M;  3CCV V;  1KN7 A;  5IE9 A;  1GK9 A;  1JOC A;  2BAS A;  2SPZ A;  3CCS P;  3L9D A;  2ZNJ A;  4DRX A;  4NPD A;  2JP3 A;  5EBL C;  2DWD C;  2KZI A;  1S5J A;  1GU5 A;  2FYZ A;  4GX5 A;  2KSE A;  1JY2 N;  2UUA B;  3QO5 A;  3IF4 A;  3VMZ A;  5CJ4 A;  3AE9 C;  1AJN A;  1NVP B;  1QGK B;  4EIJ A;  1Q6H A;  4JI1 O;  1BE3 G;  1HNZ O;  3FYE B;  2WSC H;  1OFC X;  1MG1 A;  2OQQ A;  4DR3 O;  3JCU H;  2W6B A;  3IC7 A;  3E86 A;  4W7Z A;  4YJ2 A;  1PL0 A;  5CHX A;  1LT9 C;  2OTK E;  2E5L B;  1Q6I A;  1OCO B;  2AXC A;  4R4L A;  3WB0 A;  1SQX J;  2NPS C;  1CZQ A;  4U3F G;  3BA8 A;  2FKX A;  3OEH G;  3A0H Z;  5ITZ A;  3CC7 V;  4DV2 B;  2LW1 A;  3KZI H;  3AEI A;  3AK1 A;  1KB9 F;  3D3I A;  5IT9 N;  2WVR A;  2HG5 C;  4Y99 B;  2GUV A;  3KKY A;  3QF7 A;  1GTW A;  1NTK G;  1QEX A;  1ZX3 A;  1N0N A;  4Q20 A;  3C9I A;  1PM9 A;  4ZI7 B;  2LFR A;  5DN6 G;  1Q90 D;  1N36 B;  4JGS A;  3H1I J;  3D36 A;  3CCM V;  2CK3 H;  4O2A A;  2GTA A;  3P30 A;  2YXL A;  2UUC O;  1JJ2 U;  2FYU K;  3NFQ A;  1VQL V;  1AJP A;  5BZB A;  4X20 A;  4IYI A;  1VQK V;  1IJD B;  4WFA V;  2YIB D;  2QEX V;  2FYU D;  2WIT A;  3BRV B;  3CRR A;  3ASN B;  3R66 A;  4TQD A;  4WY4 B;  1BL8 A;  1BQ0 A;  3T1C A;  4HYO A;  1PV0 A;  3TGU H;  4PD4 D;  2AHZ A;  1HNX O;  4WFH A;  2PI4 A;  1I7F A;  2QJP C;  2IBZ I;  2KNC B;  2KB7 P;  4UCS A;  1SQQ E;  4EB6 B;  2FXM A;  3MP7 B;  3F7Y C;  2G3A A;  4PI2 A;  4LFA O;  2BCC D;  5TIS Z;  3L4F A;  1USE A;  3BAT A;  3Q1M A;  3L70 J;  1HNW O;  3TNU A;  2POH A;  2H3O A;  3PHL A;  4ZIB A;  2LXB A;  3MTU E;  2DWE C;  4U7J A;  2HVK C;  1JUN A;  1V54 C;  4ZI7 A;  3R4Y A;  1T8Z A;  5DJT B;  1JCC A;  4B3S B;  1FXK C;  1SLQ A;  5BR8 B;  3K0D A;  3STL C;  5IYB O;  4NXM O;  3CL3 D;  4WF9 V;  3P3N A;  4FLX A;  4CH3 A;  4YXW H;  3RW0 A;  3ITK A;  3RK2 C;  2Q69 A;  2IYO A;  1G2C A;  3L35 A;  2R9R B;  4X62 O;  2F23 A;  1AR1 B;  5KLV E;  2ZE5 A;  3OUF A;  2QSI A;  4NTY A;  5IYC O;  3U10 A;  1W59 A;  1EN6 A;  1SQB G;  2I1K A;  2E43 A;  2HHH B;  1M56 D;  4LBE C;  3H1J D;  3JSV C;  2EUL A;  4H0L D;  5TJH A;  1L0L H;  2XAG A;  5LXT B;  2PFX A;  1NWQ A;  2E75 C;  1M1K Q;  1G1J A;  2Y0D A;  2LFS A;  4G2K A;  3B40 A;  3RYF A;  2ZAE B;  5GTH Z;  3T97 B;  1KYO E;  2Y0E A;  3FAV B;  4L73 A;  1IFJ A;  4LF9 O;  3H1L E;  4RUF A;  3WFV A;  5APW A;  3M7M X;  4UB6 E;  3V2P A;  1W2B O;  2H7H A;  1HH0 A;  4MW8 A;  1MUU A;  1JNM A;  5IJ9 A;  3E89 A;  5JJE B;  2Z5I A;  2YXY A;  1QLN A;  4JI3 O;  2R70 A;  2UUB O;  5KAI Z;  3VN0 A;  4UB8 Z;  1IO4 A;  1IK9 A;  2DE0 X;  1QHT A;  5KJ7 D;  1D2D A;  2V7Q H;  3B8E B;  3LDE A;  1SQX K;  4MSW C;  1BMF G;  2O1J A;  5A9G A;  3SFE C;  4HJG H;  3W67 A;  3M9Q A;  5IYD O;  1SQX D;  1FZB A;  3K08 A; 
#chains in the Genus database with same CATH homology
 1MKM A;  5L8R J;  4H13 C;  1ZRT E;  1OW7 A;  2MKV A;  1NGM B;  4H0L C;  5KKZ C;  2BEQ D;  2E76 D;  4OGQ B;  3AE2 C;  1YQ4 C;  3AE4 C;  3AE6 C;  1OMI A;  3S9O A;  1RQV A;  1WMK A;  1KOR A;  2D2C D;  3AEB C;  2WSF J;  2E75 B;  4PV1 B;  3RL0 g;  1HF9 A;  4RKU J;  1KTM A;  2QIW A;  1OW8 A;  1EXJ A;  4I7Z B;  1KMI Z;  2H88 C;  3AEC C;  2QJP C;  3Q2Y A;  3H25 A;  2BEZ F;  3AEA C;  1FDI A;  3GLM A;  2G3A A;  3Q5P A;  1RQU A;  3AE1 C;  3B71 A;  4H44 D;  3D6Y A;  2E76 B;  1ZP0 C;  3AED C;  3Q1M A;  2QJY C;  4OGQ C;  3AE8 C;  3ABV C;  2E74 B;  2D2C B;  2O01 J;  3AE5 C;  3FGA D;  3LW5 J;  1NYH A;  4U7J A;  3Q3D A;  1DIP A;  5M1B A;  2E74 D;  5KLI C;  1ZME C;  2K9Y A;  1PIX A;  2IDB A;  3R4Y A;  2FYN C;  1VF5 B;  1IK7 A;  1OW6 A;  1VL2 A;  3G9R A;  3Q5R A;  2QJK C;  3Q5S A;  3D71 A;  1VF5 D;  3AEG C;  3O6Q A;  4GDO A;  1AJY A;  4H44 B;  3C8V A;  3AE7 C;  1DD3 A;  2ZT9 D;  2JP3 A;  3IAO A;  4H13 B;  2E76 C;  4XFJ A;  2YIU C;  1R8E A;  2QSI A;  3RK3 E;  4H13 D;  2D2C C;  3AE9 C;  3D6Z A;  1U57 A;  4H0L D;  1S1C X;  2WPV B;  2JO1 A;  1UIX A;  1YQ3 C;  2E75 C;  4PV1 C;  3EWK A;  2NZ2 A;  1ZOY C;  2OQQ A;  3SFD C;  2FXP A;  3GF7 A;  4I7Z C;  3T97 B;  2WSC J;  4YXD C;  4Z1M H;  2YMK A;  3IN6 A;  4H44 C;  2ZT9 B;  1K05 A;  2P10 A;  1TU3 F;  2FBW C;  4R4L A;  3AE3 C;  2J5U A;  1KQF B;  1EXI A;  1JB0 J;  1GMJ A;  4R4M A;  4YTP C;  2WQY C;  4IL6 X;  3GMA A;  2WSE J;  4H0L B;  1HJ0 A;  4Y28 J;  4TT3 H;  2E74 C;  2G8Y A;  1S5L X;  4OGQ D;  1KIL E;  1Q90 D;  1VF5 C;  1Y9B A;  2E75 D;  1FDO A;  3AEE C;  4KT0 J;  4PV1 D;  1DD4 A;  3SFE C;  3GF3 A;  1PL5 A;  1PV3 A;  2V7Q J;  3AEF C;  2ZT9 C;  3D70 A;  1KQG B;  1K04 A;  2H89 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...