4PV1B

Cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
pubmed doi rcsb
molecule tags Electron transport/inhibitor
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4pv1B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4pv1B01
2ZT9B 1S5LX 3C8VA 4KT0J 4H44B 2QJPC 2QIWA 3LW5J 1JB0J 2QJYC 2E74B 1ZRTE 4PV1B 5KKZC 2E76B 4H13B 2D2CB 4OGQB 2E75B 2K9YA 4Y28J 2O01J 4H0LB 1Q90D 2QSIA 5L8RJ 2WPVB 2FYNC 2WSEJ 4RKUJ 5KLIC 4IL6X 2WSCJ 2WSFJ 1VF5B 4I7ZB 2QJKC 2YIUC
chains in the Genus database with same CATH superfamily
3ETGA 5CA1B 1PV3A 3II6A 1M7LA 4PA7A 5IDJA 5KLIB 2Z5HA 1VEWA 1FDOA 1PPJG 2BEZF 2GUVA 1Q82Q 4PV1D 2IBZE 4B08A 2KSEA 5APTA 5B5EH 5J2UA 4QJFB 3CCLP 1K4DC 1SFCB 2JDIH 4R8CA 2LR2A 2NRGA 1VQ9V 3UM7A 1KYOI 1W2EA 1TUEB 3J80N 2KNCB 4DYLA 3SR2C 1IBMB 2PI5A 1NTZD 4EKWA 4U3FE 4KFMA 3M7MX 3A5TA 1YYCA 1IFPA 2IH1C 4I6MC 1KC8W 1K8AW 2IJHA 4O4LB 3PHLA 4AHCA 5BZBA 3FD9A 4ASUG 4I50A 4O4IA 1OW6A 2Q7CA 4X9QA 1ZMEC 3TF5A 2QJKB 2HG5D 3WB1A 3C9IA 1OCCB 2Y0PA 4I55A 3SPJA 1BDCA 5JJEB 2EIJB 5C93A 3JAKA 2F66C 4E4EA 3CXCU 3K9AA 5K1PA 1NKZB 1RE4A 3BPZA 3E35A 4UB8Z 5FPRA 1ZTEA 2K1EA 1AJPA 3HKBA 2WA3A 5IY5B 1ZAUA 3FB8C 4X20A 1EM1A 4WFGA 1JY2N 1FZCB 1NU1G 1OVUA 1RE3C 3BCCD 3OW2U 4MVOA 1Y8AA 2RMKB 4WFFA 5IWAO 1K97A 1GD2E 2PAJA 1EXIA 4FVMA 5GW7A 4UB6E 2OTKE 4ICGA 4BR6A 1Q90D 1M57D 2Y0CA 1T6AA 3O65A 4XFJA 1JUNA 4CZZA 1TUBB 4NXNO 3ZHTA 2FXPA 3VQXA 2I1JA 4DV0B 5B3SB 1IDSA 4DV2B 1T8ZA 2KS1A 2P4VA 3JCZA 1BE3J 2UU9O 1OFCX 1S5LX 1N8RQ 1SF9A 1RSOB 3KXDA 4WY4D 5M1BA 4HNAA 3APOA 3UCSC 3DGEA 4LH6A 5LMNB 1RF0C 1QEXA 3NMDA 3T97B 2ARHA 4EB6B 2CK3G 3A2FA 1L0LE 5EYPB 2Q3EA 3L73E 5GTIH 5GTHZ 3T1HO 1VQ5V 4MT8A 3A8TA 1KILD 1NTKJ 2UXNA 2CPSA 4U3JA 5BR8O 2ZKOA 1G4YB 4JI7B 1KQSO 2Q9IA 3TGUJ 1KKCA 3CMAP 5L3GA 3CCQP 2OTJP 1G1JA 3CX5E 4U7NA 2JWAA 1N36B 1J95A 4IL6Z 1X22A 3ASOC 2M5AA 1SQQE 4WY4A 4NR1A 4DR4B 2KG7A 3PH0A 3D3IA 3HD7D 4X65B 3CCVP 3K5NA 2OYIC 4CH5A 2B1GA 2FBWC 4LLHA 3WMM0 4DV4O 4KHPO 2Y0IA 3BATA 3VMAA 2IU0A 3R66A 1FXHA 1MNGA 5BXZA 2QE7H 2XZRA 3WB0A 2L35A 2Q68A 4K8ZA 1MOFA 1NT2B 3CEIA 2XDJA 3CC4P 2RDCA 1EFRG 1FS0G 4IYIA 2QM7A 2POHA 5CA3A 4H44D 5KHGA 3OM3B 4PJ0H 1OWAA 3KPEA 5AW9B 4HH2A 3F7YC 4WFAV 1NU1D 2IW5A 5HFLA 2QTSA 1NYHA 4H13D 3HD7A 3F7VC 1M1JB 3ETEA 1QCEA 1XI1A 3IJ4A 1SA0A 2O01H 1SQPG 1LJ2A 1JY3O 3H1IJ 4UB8E 3SYCA 2FB5A 3CX5F 3GMAA 4JAVA 5L3CA 2UWJE 1XNQO 2ZYGA 4D7TA 2WSFH 1DIPA 2K88A 1HR0B 2G8YA 4EDFA 1N34B 3RW0A 5K1XA 3X2QC 1YJNV 2GA1A 4WFEA 1XDCA 4WF9V 3H01A 2ZCEA 4W7YA 3IFXA 1YVWA 2WPRA 1VQLV 5KMGA 1BZKA 1SQBG 4R7CA 2GTAA 4O2BB 1KYOD 2WQYC 4JI3O 4LC1A 1G1XB 3P30A 2KOGA 1MUUA 5EK0A 4D6TD 5JWPA 1BCCG 4WVZA 1NWQA 2YUAA 1I5YA 2L5GB 2KB1A 3CRRA 1TAEA 2RJZA 1Z56A 2E5YA 5TISZ 1VQPV 1THZA 3I56V 3K0DA 4B3TO 4ASWA 3ETDA 1YJWV 1GU4A 4CH4A 2FKWB 3MHVA 1NJIQ 2ITDC 2EZPA 3H1HE 2N1TD 5JQGB 5GTHE 4EFEA 2A0LA 5LOVA 3N2GB 3OTOO 1SQXE 2WSEH 3AE7C 3RT3C 3KZIH 4LF5O 1JMMA 1AJYA 1QNMA 5CA1A 1ROPA 4JI1B 1NTMD 4JAAA 2YNYA 1GL2A 1Q3EA 3AEAC 3IC7A 4IL6E 2LFSA 2FYUH 1EBOA 3ZMTA 3TJTA 1P4RA 2YSUB 3RYHB 1M90W 2IZ1A 3OGCC 4EI2A 3G6EP 3JSLA 4GKGA 3H32B 1IFJA 1B06A 4DCKA 2Q0OC 2QGNA 4UVBA 5DJUB 3SYPA 4YHHO 3FB6C 1SQPD 1JNMA 2JS5A 5KAIZ 1G6UA 2Q5UA 1AROP 1GU5A 2Q6QA 3MUDC 3L75H 1WAZA 4J10A 1VF7A 4YJ3B 4FLTA 2L91A 1AR4A 3VYIA 3L70J 4PV1C 1JVMA 4QE7A 2Z3YA 1PPJH 1HF9A 2YXYA 1PP9J 5L3DA 1FXKC 5GONB 3TNUA 3LW5J 4OGQD 1AI7A 2DWDC 4MVRA 1IURA 4LNUA 1D2DA 1RFYA 2E75D 3TSIA 2P06A 2FXOA 3VQWA 1AQ5A 3SGIA 2ZAEB 1JA8A 1BGYE 3T4DA 3W7SA 1QVGU 1HGVA 4X66B 2QJ1A 3H9VA 1KD1W 3E8BA 2QSIA 3L71E 1K8AQ 3M0DA 5AW6B 1SQBD 2W6IG 5IE9A 5B5EZ 5DN6G 2DYRC 5JH7B 1O9GA 3TGUG 3USSA 5JVDA 1PGPA 2FXMA 2HHHB 1X79B 3TXSA 3F89A 1BCCD 2HG5C 3OUFA 2QKAA 1TU3F 4DR3O 2NLJC 4P9PA 1VF6C 4LGDE 2WLJA 1EZVE 3PTZA 2Q6AA 3DXRA 1FAVA 4WBAA 5CCGD 3ASOB 3N27A 3D6ZA 4TQDA 2DE0X 2UXBO 4B7KA 4JAUA 3LUTB 3H1JG 4OVNF 1IC2A 3WB2A 3N2KB 4RKUJ 2OYIB 1Q7YW 1VPCA 5LP6C 2WSCJ 4HAMA 1CW5A 5AW8B 1FDMA 3RBXA 3DTUB 1NKNA 2C9NY 1H2KA 4F6RA 2UU9B 1RQVA 3P8CE 3ABTA 4KXRA 2ZD9A 4C7RA 4IHJA 1AVMA 4X64O 4FLWA 5TISE 1M5IA 2E5TA 4IFFA 3CC7V 4JI4O 1M57C 3T2MA 5EYPA 4A5UB 1P84E 2EINB 3FX7A 2XNDG 4JPRA 1F4MA 2YDEA 2HVJC 1G2CB 5AVSB 3T1HB 3G6BA 2LW7A 5CCHD 3WUUA 5BR8B 1ZL8B 4AILC 4I5SA 3CWBE 5LHGA 3OTFA 3G71V 2W6BA 3K0GA 5KX5A 1M1KW 1FDIA 1M8OB 3TDKA 1NGMB 3AK1A 5BU5A 4NVPA 1QVFO 5LGTA 2JJ1G 4JBZA 2MK3A 2HKOA 3CCUP 2F1MA 1LT9C 2CK3H 1KILC 1XQ8A 1N73C 2OTLP 3OW2O 4DV4B 5KA6A 2IH3C 5KAIE 2FYNC 2OIGA 4GX5A 1VQ8P 3CE2A 1NTZJ 1L0NE 3A0HH 3E22B 3MHSC 5KUKA 1F4NA 3H1IE 5C8YB 1KZUB 3LIEA 5GTIZ 3L74E 3CCRP 2BASA 1GW3A 3L72G 3B2EE 5H2FE 1P84F 2P6JA 1M1JA 2BTQA 1Q6IA 1ZR4A 3B5ND 3ABMC 3TCUA 1XTCC 2W0XA 5FL7G 1MV8A 2WPVB 3PJSK 3G4SV 2VQEB 3H1JD 1WPXA 2YC0A 3ZMSA 3E86A 4H44C 5B5EE 1DF5A 1NTZK 1MKMA 3F5WC 2CDYA 1XNQB 3I5DA 1U7JA 1OW7A 5AVUB 4GKKO 4AQRD 1JX9A 1GK6A 3OUSA 3BCCJ 4H13C 2FMLA 3QWOC 3HE4A 5IJ9B 2P4KA 4GCZA 1SRYA 2DQ3A 2P90A 1NO4A 1H88A 4PJ0Z 1JTHB 4L74A 2H89C 1HBWA 1K92A 1JMKC 3IN6A 5APVA 2P10A 3RBZA 1N32O 1KQSU 4Q20A 1WMKA 4LFBB 4R50A 2P2UA 5LHHA 1SQFA 1I5XA 2M7WA 4UCUA 3U1CA 2RH0A 4FMTA 5H6RA 4JZ2A 1NVPB 4QE9A 2YO2A 2E43A 1KU9A 2X0LA 4NTXA 1JOCA 1NH2B 3AE2C 4I2LC 1N4CA 3EFFK 3Q3DA 4I9WA 3OAKA 3SFEC 4P9OA 1NVOA 4B3MB 3UO2A 5LXTB 3FFQA 4PV1B 3SPGA 1URQD 3GHGC 3BASA 5IYZB 3UT5B 1OZHA 3HUSA 1JY2O 1OCRC 4GZRB 3SPCA 1FXKB 2JGUA 1SQVG 4Z2WA 4WBNA 1WN7A 2CTRA 1AA0A 4LF5B 4IOIH 5EBLC 2IM9A 4DV0O 1J1DC 4DV2O 4LF7O 1P7GA 3VOUA 4LFCO 2Y48A 4L87A 1N2DC 4F4LA 2N9BA 2DYRB 4MTGA 3OT7A 3L72D 3RYCA 1H2NA 3RK3D 3CC2P 2N1TC 3D3QA 2E76D 4WWIA 1HDJA 2WPSA 5AG2A 1D7MA 2WA4A 1FXVA 1Q81Q 5L3FA 3JD0A 1OHHG 1SLQA 1YCIA 1CPYA 5LA6A 4HZ3A 4YHHB 2WLIB 4X8AA 1MSWD 1L4AD 3GW6A 1Y76A 2ZR3A 5LHIA 4DW1A 4JI7O 2LO1A 1XMOO 1V55B 2JIZG 1SVFA 2H94A 4K0KB 4L73A 5GTIE 4MTXA 4XDJA 1BDDA 1NU1J 1JFFB 3KZIZ 5JJNB 3VBBA 4KUMA 5LP6B 3WU2H 2IU3A 1SC5B 4B3RB 5EZYA 2HODB 4X65O 1UJWB 4DUZB 3RYFA 2A06G 2EJRA 4N78E 3CXHD 2MJZA 2RKLA 1T2KC 1MMMA 1VQKV 1N7SD 3E8GA 1EN4A 1M57B 2R9IA 2OIEA 1R3JC 3JARB 3SJQC 3H1LD 4KJMA 4Y99C 2KLVA 2MKVA 1A32A 4FFKA 4UVCA 4K35A 1BE3H 1ZRTD 4OGQC 1XILA 3J7AU 4PD4H 1VQMV 1FAFA 2E75C 1NU1K 1AJNA 1M93A 2C2AA 5AVVB 3IFMA 2A45H 4PJ0E 1VQ9P 3ZRSA 2Q9LA 3FYIB 3JC22 4DJGA 2ZDIA 2A9HA 1YZBA 1NKDA 4OPHA 1OCOC 3IAYA 1HNWB 4OPAA 1SQVD 1BQZA 5KJ7D 5KHJA 1LT9B 1NTKH 2K9JB 2ZQMA 1KILB 1N73B 3ZJZA 4O4HB 3TGUH 4D6TJ 1KN7A 5AVWB 1I08A 1HR0O 1N34O 3IF4A 1LTGC 2H3OA 1TVKA 1OZ0A 1LWUC 5CCGC 4X64B 1BL8A 1WPBA 2D2CD 4YJ2B 1HNZO 2NPSA 1H2SB 1ZOYC 3B40A 2LW1A 1J5EB 5ITZA 4NB5A 1ZL8A 5CA0B 3ABMB 1FD9A 3A0BE 2W6JG 2WLNA 1SQQK 4P30A 1NTMJ 4IYHA 1Q2NA 5E79H 2R32A 2KSDA 1Z5VA 2LGQA 4IIJA 1YXBA 4ZIBA 1RP3B 3S3WA 4B3SB 3QO5A 5KLVG 1VDFA 1MSDA 1XUQA 3WUTA 4CH6A 4H13B 2PRRA 3I55V 5CCHC 1SQPJ 2ZIMA 5AW7B 5AVTB 3K03A 2PTMA 3HKDB 3CD6V 2N74A 1R6TA 4PA4A 1KB9H 3RL0C 2ZXWC 3E22A 3S4RA 4Z1MH 3ABVC 5C8YA 4BWNA 1L2PA 5AW1B 3DSQA 1NTMK 4JI1O 4HB1A 2IBZG 2RQ6A 3CCJV 4QGPA 4JYCA 4DZOA 1FU1A 3GG2A 3KZIE 3AE8C 5CBOA 3RGBA 2QSAA 2BSKA 1CI6B 1XBLA 2QWOB 3FB5C 1K5SA 1AQTA 1VQ5P 1S1CX 1HJ0A 4MW3A 1AI6A 2QEXV 2QWNB 2FYUE 1G1IA 1SQPK 2K1AA 3W7XA 3ABKC 3OMIB 1SQBJ 3GHGB 2JVDA 3TYYA 2LQTA 5LL6Y 2ATKC 3CX5I 4X88A 4FZ1A 2YEVB 1JO5A 3E2EA 1FZFA 1OCRB 4TUYB 2W27A 2YIBA 2UXDB 5IJ9A 1WT6A 4UCVA 1BCCJ 2YIUC 2YKOA 4GKKB 4KT0J 4AUWA 3D36A 3B5NC 3P8MC 3SWKA 3VP9A 1SS3A 4D7SA 1M56C 3A0HZ 3UQ8A 2IFMA 2ZYAA 3L75E 1J1DB 4U7OA 1USEA 2OWOA 3FKSG 4NTWA 1VQOV 1PPJE 1N32B 3CRMA 3K06A 2JS3A 2J59M 4X66O 2N1TB 1FOSE 1SQBK 3BA9A 4I1LA 4BIZA 4JI8B 1AI4A 2FFDC 4W80A 4C7NB 1QVFU 1P7BA 2BCCD 2X6BA 1ZXGA 2HHHO 3IR9A 1U57A 1CXZB 3HE5A 2OYHA 3AG2C 1JCDA 2JJ2G 2J58A 3CP1A 4MN4C 5F2VO 1PV0A 1A02J 5KLVD 3Q4HB 1KQLA 1K9MW 1WLEA 3CXHH 2KLUA 2GUZB 5KTBA 3BA8A 3E7KA 4ZI7B 4PHZA 4OH8B 2UUAB 1RF1A 1RPRA 2WLMA 4NYKA 4ZMDA 4DV3B 3HPLC 4TV8A 3ZHRA 5B1AC 3EHBB 5J9PC 4W4KA 4QIWF 3ZRVA 3G80A 1NR7A 2ZYDA 1YJNP 4DR6B 5EC2C 3L70H 2IBZD 4LF7B 1URQC 3EFGA 4LFCB 2H43A 3K04A 1PP9H 3F5TA 3LW5H 4MTFA 2CH7B 1VQ6V 1Z5WA 3H1KG 2IZ0A 3OFNG 2EBOA 1FOSF 2E75B 1E1QG 1XEQA 1Y9BA 2PFXA 1Y74A 1GZLA 2R70A 2K3RA 4U3FD 4BIUA 4FM0A 2LGWA 5CB4A 1OJHA 3AG3C 1E1RG 2PI4A 2WZ7A 2YXQB 1SQQG 1XMOB 1Y6XA 4D6TG 1WA8B 2G38A 4MVUA 3D70A 3RK3C 1OCOB 3AK2A 4AQYB 2UXCB 4L8JA 1VQPP 3I56P 2E76C 5FNVB 2HODA 4DV6B 1YJWP 1N33O 4IFDK 1E5WA 1Q8IA 2HPCB 5APXA 2ZE8A 4XDKA 1L4AC 1ZUQA 3G3ZA 2V7QG 4BWAA 1M9NA 2ZE5A 1Y47A 2JO1A 1QU7A 1QL1A 2PP6A 3A7OA 1Q86Q 1ZWIC 4E2LA 4JASA 3H1JJ 1QHTA 3MD0A 4O2AA 3JASB 3U10A 1O9HA 4I9QA 4UCSA 4CS2A 2LXBA 2WSCH 1JR9A 1IJDB 1NTMG 3AK3A 2ZT9D 1EDJA 1H38A 2M3EA 4DK1A 1VIBA 1LP1A 1R5LA 2IJKA 5J2TB 1BQ0A 1FZEA 2Z4EA 1MA1A 2JGDA 4I0XB 3A0HE 2WWWA 3LDEA 2DW3A 5JCOA 4FLXA 1N7SC 2XT9A 2A06H 1YITV 4J42A 3AE9C 2WPDG 2OT5A 3NTNA 1Q6HA 3WU2Z 1OXZA 3FB7C 4TV9A 1YDXA 1BHBA 1FFXA 2VQEO 4TLFA 3SJBC 1GK9A 4WCEV 3S1KA 1H0TB 1VF5D 3H25A 2VS0A 2Y9ZA 3RL0B 1GMGA 2ZXWB 3ZS8C 2GBOA 3SFDC 2UUBB 4LH7A 1LTJA 3M9QA 2IYPA 4DRXA 2C9LY 2NNUA 4MVZA 4YJ2A 1L0LD 1SZTA 3BABA 2DN9A 4LWSB 3FWLA 3HTKB 3L73D 4M3LA 5DJTB 3SWFA 3AE6C 5D5QA 1HNZB 3H1KD 5KJ7C 4ZOLA 1EN5A 5CJ4A 1OCZC 5CA0A 2IJJA 4BW5A 4X1KA 4C7UA 4LFBO 1KUQA 3VN0A 3O6QB 3IC9A 2AEMA 5C39A 3CX5D 4K3AA 2YXLA 3JATB 3NR7A 3ZIAG 3R4YA 1NTZH 3PLNA 1MABG 2ZNJA 1QR8A 1SQQD 2ADQB 3THOA 2G3AA 4LF8B 4QNHB 1GL2D 3HKCA 2WSSH 2PUSA 4FFBB 1EZVI 3OR7C 2D2CC 2DMXA 3L72J 1IFDA 4KL1A 3CCEV 3V4QA 4B3MO 2V4HA 5BU8B 2YIUB 2E42A 1SQXG 1QL2A 1NBMG 3IAOA 3N7NA 5KKZC 3B5NB 2W83C 3ZDMA 1J1EC 1FE6A 1M56B 1KP2A 3APQA 2JKVA 3UIAA 1QLNA 4EIJA 1W2BU 2W6JH 4RAIA 3JALB 3AEDC 3W7WA 1FJGO 4FLZA 4IL6X 1TGOA 1R3KC 1YHQV 3NXSA 4J11A 2DQ0A 4ZKIA 5AVXB 2JK5C 4MTOA 1XHXA 5KHIA 3BCCH 3CC7P 5AVQB 1P84I 3OAAG 2FFDB 3S9OA 1M4UA 1S77D 2B87B 4JTDB 3B4SA 3QO7A 2Y69C 2ZM6B 1VQ4V 5E79Z 5HFMA 4JI5B 2EILC 1SFCA 3MHHC 4RQFA 4TT3H 3LSUA 2HVKC 2R9AA 2YICA 3SJAC 2N05A 2Q5ZA 2PGGA 3SPHA 2JEUA 2KNCA 3H1LJ 3G71P 2A79B 4NXMO 4K0KO 2GTSA 2HP8A 1AVYA 2XKMA 4O4LA 2X7RB 5B1AB 3D8CA 5EFWB 3GB7C 3CCSV 4B3RO 3L71G 2QJYC 4DO2A 1DX7A 1AJQA 1RE4C 4J7JA 3KDPB 4DUZO 5IJ0B 2P7JA 3WU2E 2W90A 2WLLB 1SQVJ 3L37A 4ZBMA 1KC8Q 3MTUE 2R5BA 1FZBA 2QKSA 1H2MA 1Q6UA 3CCMV 3L36A 5LGUA 3AEGC 1IVSA 2HEPA 1FZCA 2P22C 3RWRD 4HYTB 4KP4A 1EZVG 3AG3B 2FTKA 4J80A 1JMBA 2Q0AA 3Q4HA 3LDDA 4HYOA 3H1HD 3BFRA 2GUZA 4UUJC 3AEBC 3RK3B 2OYQA 3W68A 4PD4E 2E76B 1BE3E 1SQXD 2WT7B 3G4SP 5IT9N 2R3SA 1HUCA 2EIMC 2AGAA 1SQVK 3MIWA 1VQNV 1HNWO 1TUBA 2NN4A 3CHXA 3RVZA 1OMIA 2Q67A 1BSMA 4TOIA 2AZ2A 4GX1A 2XAQA 2CGOA 1RSOA 4CPGA 1NTKE 3LSSA 1NU1H 1EC5A 5KA5A 1PD3A 3TGUE 4RUEA 3CMEV 3T97A 1Q43A 1F23A 4EB6A 2QA4V 1FC2C 2WVRA 5APSA 3FWNA 3CWBG 1K33A 4O4JB 4Q6GA 4Y28J 1J5EO 3CPWU 1KP3A 1JEKA 3FX0A 2F95B 1I7FA 4YIPA 2KSJA 1H2GA 4GLXA 2KB7P 3K5OA 4CC5A 2GHYA 4WY4C 1T3UA 2N9YB 2PF4E 1S5LH 1QR9A 4PA9A 5CMUA 4X62B 1FJKA 1LTSC 4J9ZB 4B3SO 4PD4F 3IGAC 3BRVB 3S3XA 1IXMA 2R3CA 1N33B 1BGYD 4R6ZA 1K05A 2NR5A 3H1KH 3ZEDA 3L71D 3JAWB 4PDLA 1DEEG 3X2QB 2VRSA 1GK4A 1KYOH 2VQFO 3M91A 4MSWC 3CLQA 4X1IB 1OCZB 4D6TH 1YI2V 1ZSPA 2K37A 1KKDA 4PA3A 4UV9A 1KB9E 1QLED 2ZINA 3BY6A 1EZVD 3HD7C 1PL4A 2R72A 2WLKA 3ZN1A 2E74D 2AXCA 3U1AA 4I4TB 4X1YB 1YBKA 2D2CB 3ZRWB 4QMAA 2K9YA 1YTFB 2P5OA 2WPQA 2JDIG 3ZCCA 1GM9A 2QWQB 4JI0B 2KI7B 1Q82W 1T3JA 2ZT9C 3A3YB 5KKZB 3P8CD 3SSUA 4NPFX 1MZFA 1NTMH 2F43G 3LNNA 1J1EB 2UXDO 2BCCJ 1JJOA 1FZGA 1JPXA 1LTAC 3JD3A 1H8HG 1PNMA 1NHLA 2RN0A 3I5CA 1P84D 3SJCC 1JCCA 3C1LA 5KLVJ 2QIWA 3L9DA 1YJ9V 1VQKP 3WG7C 1S0VA 2PGDA 3BEHA 3O6QA 3CWBD 4ZKPA 1SQPH 5J2UB 4FLVA 2Y69B 4JI2O 1VF5C 2QG4A 4O2BA 4I7ZC 2Q7HA 2EILB 1NR1A 3E8FA 4JI8O 1F7YA 3H1LG 1KB9F 1Z2GA 1VQMP 3OEEG 5B66H 4DR7B 3KYQA 1KQFB 4G27B 2V1DA 4HKZH 2SPZA 3RGUA 3Q1MA 3GWOA 2YMKA 2VWJA 5FPOA 2IDBA 1U7MA 5KLVK 4DW0A 4GYCB 4I50B 4O4IB 1E79G 3DC6A 1KECA 4ABMA 3CI9A 3E1IA 5DECA 4EFBA 5JQGA 1V54C 1L0ND 4U3FJ 2UUAO 4I55B 3PRJA 3K9SA 1N7LA 3N2GA 2WMMA 2YKPA 3ITKA 4JGSA 4XDLA 2QJYB 1SQBH 2CAZC 3JAKB 3L74D 2ITCC 2DW4A 4DR2B 3HRNA 5EC1C 4DV3O 1GL2C 1CP9A 3CXHE 1YIJP 2O57A 1PZQA 1FJGB 5AW3B 4TQFA 4DR6O 1BCCH 2B87A 4X20B 2Q3IA 3RK2D 2FL4A 2FYUK 3RYHA 4YXDC 5LMUB 5KAFH 3H32A 1RE3A 3L70E 2CUGA 3ZHQA 4PI0A 2LKMA 2DYSC 1N8RW 1CZQA 3LIDA 1PP9E 1XREA 1GM8A 2Y9YA 4YJ3A 4HBNA 4ASVA 1PL5A 1N0NA 1U96A 4CH3A 4JV5B 2EIMB 1M90Q 4G28B 4NXMB 3AG7A 5LBQA 1XOUA 4LBEC 1J2JB 4AQYO 2UXCO 5LGNA 5BY1A 5GONA 2RCVA 4GT1A 1YQ3C 4DV6O 4FM2A 3NFQA 1W5CE 3I55P 5CN0A 2ADPA 4FZ0A 2JEXA 1FYJA 4HNAB 3E8HA 4KHXA 3CD6P 2WLLA 3PN1A 1NQTA 2M6YA 3M0DC 2AXTH 3VQVA 3O8ZA 3CXHF 2HYNA 1RF0A 1SZXA 2QE7G 3CCJP 5JH7A 1R5SA 4U3JB 1HGZA 2Q73A 2O1JA 3D6YA 1W2BO 2Q7GA 1YQ4C 2J5UA 3C8VA 2IX7C 2ZE7A 3UO3A 1L0LJ 4TWKA 4DV5B 2QEXP 1KD1Q 3L73J 1HWYA 4WY4B 1U97A 3CRQA 3H1KJ 3CJHB 2KG7B 4WFHA 2WAMA 2NPSD 2V4DA 5KHKA 3RVYA 2EJ7A 1OIPA 5B3SC 1GO3F 3N2KA 4LF6B 3E89A 1AB3A 2OYIA 1WJZA 1S9KE 3AEEC 2A06E 1SQQJ 2P58A 3T1YO 5AW2B 4A7PA 2FYNB 1GN2A 2HR3A 3ZRXA 2UUBO 2HLOA 1VQOP 1L0LK 5L3BA 2XOKG 1R1BA 3M06A 3OMNB 1PGOA 3WUVA 2V7QJ 1Q7YQ 3HD7B 1G2CA 1YTZI 2DJVA 2XAJA 3WFVA 3H1JH 3QNEA 2B88A 1LTBC 2YMYA 1X9VA 1HNXB 2YKQA 5D5PA 4JZGA 1PNLA 4YY3O 4UCRA 1W0KG 2BCCG 4B7EA 4LF8O 2ZT9B 2BOBC 2B9ZA 3JD4A 4H44B 1R3LC 4BW9A 1NTZE 1S2EA 4N78D 3HKEB 4GX2A 5APYA 4PELA 4LFAB 1JOYA 3ICXA 2ZXEB 4H37A 3GLMA 2PY5A 2FYZA 1WB7A 4RO2A 5BMVB 2XNDH 4JQ0D 3AG1C 1EDLA 1JM0A 2C0WA 1GW4A 1IO4A 3FXDA 1M1KQ 3C3TA 1RPOA 2XHBA 5KMGB 1V9PA 3WG7B 2VQFB 4UXNA 4DUYB 1XNRB 1OX3A 2YIBD 1GMJA 2PYLA 4DR1B 1VF5B 1NJIW 4I7ZB 2ETNA 2AEFA 1M1JC 5H5NA 1VQ6P 3CS5A 4JF7A 2FYUG 4I4TA 1JCHA 4F6EA 3OE7G 1X4TA 2ZM6O 1XL6A 3DC5A 1S5LZ 4JI5O 4EOTA 4LF4B 4J7KA 1RHZB 3BCCE 5IYCO 2KIKA 2UXXA 4U3FG 3CRAA 3TK1A 1K04A 1VQ7V 1K3EA 4U7JA 4IT5A 1DF4A 4DXWA 5LOVB 2JJLA 1QLEC 3AE3C 4RO0A 1V54B 3O9OA 3QH9A 2E5LO 3CPWO 3B8NA 2E74C 1KFNA 4GODA 1MFZA 1GL2B 3L72H 3H1HJ 4H33A 2RMZA 5BVZA 4B86A 3G67A 3P3NA 3JSVC 3C90A 1JTHA 4UVAA 3OD4A 1LUVA 1SQXJ 2H8PD 3F5HA 1NS1A 3VMYA 3B77A 3BVOA 2KQXA 3CB2A 2ZVOB 4OWFA 1JY3P 4YXWG 3JCUH 2I1KA 4JI2B 3Q5PA 1HJBA 4Z1VA 2CGNA 3ML0A 2DYSB 2YI8A 2Q69A 1H2LA 1S5JA 1LT1A 5AVRB 1UIIA 2Z5UA 1KILE 5A2QN 3MUDA 2ZVNB 1JQ0A 4BRYB 1YITP 4J9YB 5LXTA 3HUSC 3AE5C 1ZLZA 4EYYQ 3CYOA 2A3QA 3KG2A 3OMAB 3UT5A 5IYZA 3TNUB 1SQXK 3LSQA 1VL2A 1B6QA 1FXKA 2FY8A 4DV1B 3W67A 4LNUB 1XMQB 1AR1B 2O1KA 2VRZA 2GSMB 2I8DA 3LNMB 3H1LH 3QF7A 1ZW0A 4W4LA 3UKMA 2PYJA 1PGJA 4XBFA 1HP8A 3VOPA 2QM4A 2YO3A 5JVDB 1PNKA 1SQGA 1FJPA 2QR4A 1BGYJ 1K5QA 2FYUD 1L0LG 4Y99B 3V4WA 1IBLB 3ZX6A 3L71J 1E79H 3L73G 2MW2B 5B66Z 1VQLP 1X8YA 1YEWA 3AEIA 3B71A 2D3OW 1P49A 4OGQB 3H6PA 1NU1E 2WLIA 1UIXA 1VF6A 3ZMZA 3DXRB 2KK7A 1GTOA 1H8AA 5CMZA 1KFMA 4CC6A 1SQVH 4ZHQB 2UUCB 2R44A 3ASNC 4OXSA 1Y66A 1VP7A 3T4ZA 5H6QA 4DR5O 3RK2C 3V2QA 3FAVB 3L75D 3CCEP 1KQGB 2ITAA 1I0HA 1JFFA 4MVSA 1EDKA 5LP6A 3E1RA 4X62O 1S72V 4F6RB 3ZHSA 1PPJD 4JYBA 3SYAA 4IHJB 5CBNA 2OQQA 3JD2A 4DV7O 1S5LE 5CJ0A 4H0LD 4CS3A 2AHYA 4PA6A 1EN6A 5AW4B 1YHQP 1LWUB 3STLC 3H1KE 3AG4C 3JARA 5KAFZ 3TETA 1NH4A 4OX9B 3CCLV 1LUWA 1PM9A 3K59A 1R8EA 1AFOA 2YS8A 3PP5A 2DOSA 4TSFG 1Y67A 2F4VB 1VQ4P 1AR5A 3C3SA 1KYOE 1B04A 1YTZT 3M9BA 2B5UA 2QJPC 2ILMA 5KX5B 4JYAO 3CJHA 4D6TE 3MZWB 2ZDIC 1W59A 1WP7A 3CWBJ 3KCXA 3OJAB 1G8MA 3RFRA 2JR8A 1LT9A 2K9JA 2ZJSE 4JI0O 1KILA 4GOEA 1N73A 1NTKK 2AEJA 4O4HA 3A2AA 1B3QA 1OVVA 1IBKB 2GM4A 2ODMA 2ZFCA 2AXTZ 3AG1B 3CCSP 2Y0DA 2KP8A 3T1YB 2WLHA 1I94B 3AE1C 1GAXA 2EINC 1S76D 2NPSC 2HFED 1URFA 1Y4MA 3CRCA 1NTME 1FS0E 3EXAA 2P67A 3VMZA 3OGIB 4XA4A 4MVQA 1YSCA 2BTQB 1L0NJ 5APUA 1HW7A 3QTCA 3CCMP 3K58A 4LR3A 5CBFA 3KCYA 3L74J 5AVYB 2KUBA 4ZKUA 3P3PA 3N4XA 1KYOF 4O9BA 1US6A 2Y4TA 4FIPC 1SQPE 4YY3B 3ABLC 1AV1A 2BTOA 2KYVA 1CSBA 3GF7A 4DR7O 3ABKB 4PDVA 3HKEA 1IXBA 2LXCB 2CPBA 4PD4I 1KTMA 1QLEB 2YIDA 3KKYA 4IGGA 2Y0EA 3H1HG 3HE4B 5CBGA 3JAMN 5BMVA 5K5GB 3A0BH 2KXPB 2E74B 5B66E 1VQNP 2A45I 1L0NK 1MZ9A 1SFCD 3HKDA 5IYBO 2B89A 1W0JG 2AHZA 5CHXA 3VMXA 3SDLA 4DR2O 2Q7EA 3BVHA 1ZV8A 2BEQD 4JTCB 2BCCH 1GH6A 3CMEP 4R4LA 1SQBE 3QVNA 4GDOA 3MDSA 2QA4P 1CI6A 3CL3D 1IK9A 1KBHA 4AI8A 4LF9O 3CMAV 5DM6V 5KLVH 3RYIB 3CCQV 5LMUO 2OTJV 1VARA 4FLYA 1L8DA 3ZN0A 1D5NA 1BCCE 1R6NA 4FLUA 2IJIA 1OW8A 1X59A 4DT0A 3K79A 3AG2B 5A9GA 3Q5SA 3GHGA 3HUSB 2EULA 3ZMUA 3CCVV 5B1BC 2YEVA 1MFTA 5KAFE 3JD1A 3BAAA 4TUYA 1KORA 2IPPA 3ETQA 4WBNB 2XASA 1Q81W 3D36C 4JV5O 1FZAA 2E5LB 2HJFC 2IBZH 2OCCC 4PDRA 3CC4V 2YI9A 2CE4A 1BGYG 5AVZB 3RYCB 3GWKC 2WTYA 1SS1A 3E83A 1URQB 1T5EA 2N1TA 4U3FH 1YI2P 3V5BA 3EQ2A 3L35A 3EWKA 1N0JA 5LA6B 1T2KD 1KB9I 4C7NA 1Y76B 1K73W 2AXTE 2NZ2A 2OARA 3V2NA 2OYHC 2WITA 4BRYA 2XTAA 1EZJA 3M8AA 3ASNB 4J41A 2XUMA 1BE3G 2CTPA 3K57A 1MZEA 2H8PC 1NZ6A 5H2FZ 3RK2B 4MS2A 2YXRB 1IZ3A 2K9PA 4DV5O 4L75A 2LJ2A 4UV8A 5LYJB 2GV9A 4ZI7A 2M3BA 2A45G 4N6JA 1RF1C 5EZYB 4FPPA 3GF3A 4YXWH 1COWG 3RYFB 5EIBD 4LF6O 1IX9A 1FPOA 1SERA 1NTKG 1Q5OA 1L4AB 1HVVA 2BE3A 3JCUZ 4BAYA 3TXQA 1K9MQ 5CBHA 1CEZA 2X6AA 3AG4B 3AE4C 1YJ9P 1SKVA 1BS3A 3R65A 4WFBV 1ZN5A 2QKCA 4UB6H 1UFIA 1R3IC 4JTAB 5IWAB 1LR1A 2CH7A 1DD3A 2X6CA 1JY2P 1A02F 4ZHQA 2QJPB 1V55C 1IZNB 2KZIA 4NPDA 4UCTA 4JYYA 3FAVA 3JSNA 1N7SB 1HNXO 3V2RA 4NXNB 1WA8A 4FK5C 4DR5B 1S3JA 1WNSA 1KMIZ 3CSXA 1ZP0C 1OV9A 3H1JE 3M9HA 1H8EG 5FNVA 1RH5B 1PFIA 1L0LH 2DWEC 4MVMA 2Q8VA 3L73H 3BHPA 2HPCA 3QO8A 1TVKB 4LFAO 2F93B 2XNXA 5E79E 1BSHA 4DV7B 1LWUA 5CCGA 3CXHI 2NPSB 1L0NG 1USDA 2O01J 2W8ZA 3H1IG 2KKWA 3JASA 3G6EV 5ITZB 3CX5H 3L74G 4JI6O 3K5LA 4QPKA 4Z1MG 1DH3A 1XNRO 1K4CC 4DUYO 1SQQH 1UPGA 2B1IA 3RL0D 3FGAD 2JWDA 2WSFJ 2L6LA 4DR1O 1ENVA 5J2TA 2W0FC 1RM1C 2C0XA 4DK0A 4I0XA 4PD4D 5JCOC 1BE3D 4IIJB 4BXLA 3R2PA 4JYAB 4H0LC 3ABLB 2M0BA 1IK7A 1JB0J 4GKJO 2V7QH 1GN3A 4LF4O 1F51A 4KHPB 2XV5A 2HLDG 3K5MA 3B8EB 1R73A 4IFMA 1H0TA 5CCHA 3G9RA 1HTLC 1ZLLA 1NTKD 2EIKC 2AZ0A 5E1AC 1LTJC 4HJGH 3EVKA 4RJTA 3TGUD 1RY3A 1ORQC 3AEFC 1XTGB 1BT8A 1EXJA 3V2PA 1JY3N 1AVOA 4LWSA 3U11A 3A0RA 3HTKA 2H88C 4C46A 1GTWA 4ZNCA 1SP4A 4W7ZA 4X89A 2BSKB 4UB8H 2YIAA 4CBCA 1M56D 3L72E 3RK3E 2HJDA 4GIFA 2JP3A 3JATA 1LNQA 4RUFA 2ZNIA 2WSEJ 4YPCA 4N21A 1IBMO 2Y4UA 1AP5A 2HFEC 3JCUE 4FFBA 1DEBA 5B1BB 4DOJA 3OR6C 4N23A 3Q5RA 2FYUJ 1GRJA 2QVAA 1NAYA 2O01N 5TJHA 4AYCA 2OCCB 3HB3B 1GN6A 3B5NA 3J81N 2M8RA 3KHUA 4DV1O 1PGQA 2JEEA 1XMQO 3U0ZA 4QPJA 1XHZA 1LGHB 5DEDA 3ABUA 2FKXA 3JALA 3H1ID 4K8XA 1H89A 1KB9D 2OCHA 4P2ZA 3JYCA 4JI3B 1EQ7A 5KLIC 3BRTB 3L75J 2Q1KA 3HKBB 3L70G 3ZHUA 2FFDA 3RYIA 5EBWC 3H1LE 2R5DA 3H1HH 3VTPC 1PP9G 3HE5B 2OYHB 1SFCC 4LF9B 5GTHH 3U59A 1IBLO 2EZOA 5FLXN 2VWKA 1ZRTE 4L76A 1SQXH 4B3TB 3KQGA 1VMGA 1NOHA 2H7HA 3SWYA 2P1JA 3VQYA 1IFMA 1S5HC 2JRIA 3CCUV 2UUCO 3A0BZ 3OTOB 4YIOA 1RF1B 2OTLV 4IL6H 1SETA 3M0AA 1ZX3A 4TV8B 3L4FA 4NTYA 1GDTA 1DD4A 2QJKC 2QWRB 1SQVE 4YTPC 1VQ8V 4FJCC 1OCCC 1DTOA 3ZBHA 2ZR2A 2IYOA 2XAGA 2KS1B 2EIJC 4RQEA 4NKGB 1MG1A 2OYOA 2EX3A 3CCRV 5LMNO 2YXHA 1URQA 2XAHA 1RQUA 2LP7A 1AILA 1WP8A 5IJ0A 5KHHA 4RWUA 4JPZB 2QWPB 5IY5C 5B1OA 3ZHVA 4XE5B 2PZSA 1Y74B 2QM8A 3MGNA 5AW0B 5L8RJ 2RNBA 1FZCC 4EEQA 5CB4B 4OX9O 3K5BA 1GKFA 2N04A 2Z0AA 1HWTC 4GX0A 1LTIC 3RL0g 1QX8A 2QDOA 1Q86W 4G2KA 2F4VO 2GUSA 1D5AA 3P32A 2ZXXA 1N36O 2W6AA 1JJ2U 3K08A 5B1NA 5LYJA 3BRCA 1BGYH 4DR4O 4GUNA 1K34A 2IFNA 1TA8A 3L71H 3RN4A 3FXEA 2WT7A 2M5AB 1QQCA 1K73Q 1VQ7P 1NAFA 1XL4A 2BOCC 1K7DA 5EBMC 3T1CA 2Q4PA 5APWA 1BMFG 1L4AA 4FM1A 3SYQA 1DK1A 1BHAA 3D71A 5JJJB 1IBKO 4O2AB 2XU6A 4MW8A 1DGSA 3ZMVA 2Z5IA 4PI2A 2IBZI 1EZVH 2E3CA 1I94O 3L70D 1LP1B 4J7ZA 4CS4A 4DR3B 2CTQA 3OA7A 1PP9D 2O3JA 2JGDB 3B09A 2ZE6A 3QG5A 4O4JA 5H9CA 5EIBC 3W7TA 1RM1B 1KV4A 3B8MA 2UXBB 5APQA 4H0LB 1N7SA 4LCUC 1FBMA 1SA0B 2XAFA 5IYDO 4TV9B 1WRGA 1GM7A 1NTZG 1FFXB 3M99B 3VP8A 5TISH 2RN9A 3HR0A 1IFNA 1YIJV 2WSSG 1L1FA 1P84H 2A7WA 1WB8A 1YF2A 2B9BA 5KUMA 4LP8A 2EIKB 3LDCA 5AW5B 2F23A 3W7UA 3FYEB 4UFZA 3P7KA 1AI5A 1LTJB 4DRXB 4RESB 3JAWA 3V6IA 4JI4B 1YTFD 1OVRA 4GOFA 1PL0A 3CWBH 4R4MA 3Q2YA 4UB6Z 1GN4A 4ZOLB 3CC2V 1NI8A 4UCOA 3MAQA 4X1IA 4X1KB 1BSNA 3AECC 5KJ7A 4NPEA 1AP6A 4JI6B 2KZJA 4N3YB 1HH0A 1FKAO 1PKXA 2AW9A 3MP7B 1QVGO 1N86A 1EDIA 1ZR2A 1PIXA 3BCCG 3HKCB 3K3WA 2P7TC 3OEHG 2QRXA 4JF3A 4WB4A 1S4XA 4X1YA 2BCCE 5KAIH 1DLBA 1LTTC 2R9RB 1IFIA 3ZRWA 4GKJB 1S9KD 3STZC 2GDSA 4BIOA 1L0NH 2LFRA 3SYOA 3SPIA 2A06D 2OGUA 3H1IH 1QBZA 4TT3G 5KLVE 2QTOA 3L74H 2ZIOA 1SESA 1NVPD 1X0TA 3GVMA 5H2FH 1S72P 1FFTB 4PDMA 5L3EA 1NH2D 3L75G 1R6KA 2CTWA 1QGKB
chains in the Genus database with same CATH topology
1KILE 1PV3A 1KQFB 3AEFC 3AE1C 3AEAC 1FDIA 2D2CC 1EXJA 1NGMB 3Q1MA 1FDOA 2H88C 2BEZF 2YMKA 2IDBA 3AE5C 4PV1D 2E76D 3IAOA 2V7QJ 5KKZC 4H13B 1VL2A 2E75B 3GF3A 2FBWC 1Y9BA 4Y28J 3RK3E 2JP3A 3D71A 2FYNC 4Z1MH 2WSEJ 3ABVC 3AEDC 4IL6X 3GF7A 4H44D 3D70A 2ZT9B 4PV1C 3AE4C 2E76C 4H44B 3Q5RA 1KTMA 3AE8C 1HF9A 3S9OA 4YXDC 1OW6A 1ZMEC 1K05A 1NYHA 3LW5J 4OGQD 4H13D 2E74B 1DD3A 1S1CX 3B71A 1HJ0A 2E75D 3GLMA 2JO1A 4OGQB 1UIXA 4TT3H 4H0LB 2QSIA 2WPVB 4H44C 5KLIC 1PL5A 1MKMA 2BEQD 3GMAA 1GMJA 1KMIZ 2MKVA 1KQGB 1VF5B 2ZT9D 4I7ZB 1DIPA 1OW7A 1ZP0C 2YIUC 2G8YA 4R4LA 4OGQC 4H13C 4KT0J 4GDOA 2E75C 1TU3F 1YQ3C 2E74D 2OQQA 2QJYC 1ZRTE 2H89C 1EXIA 2D2CB 1OW8A 3IN6A 3AE9C 4H0LD 3D6ZA 2P10A 4R4MA 1WMKA 2K9YA 3Q2YA 2O01J 3Q5SA 1Q90D 1K04A 2ZT9C 3AECC 4U7JA 1KORA 2WQYC 4RKUJ 4XFJA 3AE3C 2FXPA 1VF5D 2WSCJ 3FGAD 3H25A 3AEGC 1R8EA 2WSFJ 1DD4A 2QJKC 4YTPC 3AE2C 2E74C 3D6YA 1U57A 1PIXA 1YQ4C 2J5UA 1S5LX 3C8VA 1RQVA 3SFDC 3Q3DA 2QJPC 5M1BA 4H0LC 3SFEC 3AEBC 2QIWA 1IK7A 1JB0J 4PV1B 1RQUA 2D2CD 3AE6C 3T97B 2E76B 1ZOYC 3O6QA 1VF5C 4I7ZC 3EWKA 5L8RJ 3Q5PA 3AEEC 3AE7C 3G9RA 3R4YA 1OMIA 1AJYA 2NZ2A 3RL0g 2G3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT9 B;  1S5L X;  3C8V A;  4KT0 J;  4H44 B;  2QJP C;  2QIW A;  3LW5 J;  1JB0 J;  2QJY C;  2E74 B;  1ZRT E;  4PV1 B;  5KKZ C;  2E76 B;  4H13 B;  2D2C B;  4OGQ B;  2E75 B;  2K9Y A;  4Y28 J;  2O01 J;  4H0L B;  1Q90 D;  2QSI A;  5L8R J;  2WPV B;  2FYN C;  2WSE J;  4RKU J;  5KLI C;  4IL6 X;  2WSC J;  2WSF J;  1VF5 B;  4I7Z B;  2QJK C;  2YIU C; 
#chains in the Genus database with same CATH topology
 3ETG A;  5CA1 B;  1PV3 A;  3II6 A;  1M7L A;  4PA7 A;  5IDJ A;  5KLI B;  2Z5H A;  1VEW A;  1FDO A;  1PPJ G;  2BEZ F;  2GUV A;  1Q82 Q;  4PV1 D;  2IBZ E;  4B08 A;  2KSE A;  5APT A;  5B5E H;  5J2U A;  4QJF B;  3CCL P;  1K4D C;  1SFC B;  2JDI H;  4R8C A;  2LR2 A;  2NRG A;  1VQ9 V;  3UM7 A;  1KYO I;  1W2E A;  1TUE B;  3J80 N;  2KNC B;  4DYL A;  3SR2 C;  1IBM B;  2PI5 A;  1NTZ D;  4EKW A;  4U3F E;  4KFM A;  3M7M X;  3A5T A;  1YYC A;  1IFP A;  2IH1 C;  4I6M C;  1KC8 W;  1K8A W;  2IJH A;  4O4L B;  3PHL A;  4AHC A;  5BZB A;  3FD9 A;  4ASU G;  4I50 A;  4O4I A;  1OW6 A;  2Q7C A;  4X9Q A;  1ZME C;  3TF5 A;  2QJK B;  2HG5 D;  3WB1 A;  3C9I A;  1OCC B;  2Y0P A;  4I55 A;  3SPJ A;  1BDC A;  5JJE B;  2EIJ B;  5C93 A;  3JAK A;  2F66 C;  4E4E A;  3CXC U;  3K9A A;  5K1P A;  1NKZ B;  1RE4 A;  3BPZ A;  3E35 A;  4UB8 Z;  5FPR A;  1ZTE A;  2K1E A;  1AJP A;  3HKB A;  2WA3 A;  5IY5 B;  1ZAU A;  3FB8 C;  4X20 A;  1EM1 A;  4WFG A;  1JY2 N;  1FZC B;  1NU1 G;  1OVU A;  1RE3 C;  3BCC D;  3OW2 U;  4MVO A;  1Y8A A;  2RMK B;  4WFF A;  5IWA O;  1K97 A;  1GD2 E;  2PAJ A;  1EXI A;  4FVM A;  5GW7 A;  4UB6 E;  2OTK E;  4ICG A;  4BR6 A;  1Q90 D;  1M57 D;  2Y0C A;  1T6A A;  3O65 A;  4XFJ A;  1JUN A;  4CZZ A;  1TUB B;  4NXN O;  3ZHT A;  2FXP A;  3VQX A;  2I1J A;  4DV0 B;  5B3S B;  1IDS A;  4DV2 B;  1T8Z A;  2KS1 A;  2P4V A;  3JCZ A;  1BE3 J;  2UU9 O;  1OFC X;  1S5L X;  1N8R Q;  1SF9 A;  1RSO B;  3KXD A;  4WY4 D;  5M1B A;  4HNA A;  3APO A;  3UCS C;  3DGE A;  4LH6 A;  5LMN B;  1RF0 C;  1QEX A;  3NMD A;  3T97 B;  2ARH A;  4EB6 B;  2CK3 G;  3A2F A;  1L0L E;  5EYP B;  2Q3E A;  3L73 E;  5GTI H;  5GTH Z;  3T1H O;  1VQ5 V;  4MT8 A;  3A8T A;  1KIL D;  1NTK J;  2UXN A;  2CPS A;  4U3J A;  5BR8 O;  2ZKO A;  1G4Y B;  4JI7 B;  1KQS O;  2Q9I A;  3TGU J;  1KKC A;  3CMA P;  5L3G A;  3CCQ P;  2OTJ P;  1G1J A;  3CX5 E;  4U7N A;  2JWA A;  1N36 B;  1J95 A;  4IL6 Z;  1X22 A;  3ASO C;  2M5A A;  1SQQ E;  4WY4 A;  4NR1 A;  4DR4 B;  2KG7 A;  3PH0 A;  3D3I A;  3HD7 D;  4X65 B;  3CCV P;  3K5N A;  2OYI C;  4CH5 A;  2B1G A;  2FBW C;  4LLH A;  3WMM 0;  4DV4 O;  4KHP O;  2Y0I A;  3BAT A;  3VMA A;  2IU0 A;  3R66 A;  1FXH A;  1MNG A;  5BXZ A;  2QE7 H;  2XZR A;  3WB0 A;  2L35 A;  2Q68 A;  4K8Z A;  1MOF A;  1NT2 B;  3CEI A;  2XDJ A;  3CC4 P;  2RDC A;  1EFR G;  1FS0 G;  4IYI A;  2QM7 A;  2POH A;  5CA3 A;  4H44 D;  5KHG A;  3OM3 B;  4PJ0 H;  1OWA A;  3KPE A;  5AW9 B;  4HH2 A;  3F7Y C;  4WFA V;  1NU1 D;  2IW5 A;  5HFL A;  2QTS A;  1NYH A;  4H13 D;  3HD7 A;  3F7V C;  1M1J B;  3ETE A;  1QCE A;  1XI1 A;  3IJ4 A;  1SA0 A;  2O01 H;  1SQP G;  1LJ2 A;  1JY3 O;  3H1I J;  4UB8 E;  3SYC A;  2FB5 A;  3CX5 F;  3GMA A;  4JAV A;  5L3C A;  2UWJ E;  1XNQ O;  2ZYG A;  4D7T A;  2WSF H;  1DIP A;  2K88 A;  1HR0 B;  2G8Y A;  4EDF A;  1N34 B;  3RW0 A;  5K1X A;  3X2Q C;  1YJN V;  2GA1 A;  4WFE A;  1XDC A;  4WF9 V;  3H01 A;  2ZCE A;  4W7Y A;  3IFX A;  1YVW A;  2WPR A;  1VQL V;  5KMG A;  1BZK A;  1SQB G;  4R7C A;  2GTA A;  4O2B B;  1KYO D;  2WQY C;  4JI3 O;  4LC1 A;  1G1X B;  3P30 A;  2KOG A;  1MUU A;  5EK0 A;  4D6T D;  5JWP A;  1BCC G;  4WVZ A;  1NWQ A;  2YUA A;  1I5Y A;  2L5G B;  2KB1 A;  3CRR A;  1TAE A;  2RJZ A;  1Z56 A;  2E5Y A;  5TIS Z;  1VQP V;  1THZ A;  3I56 V;  3K0D A;  4B3T O;  4ASW A;  3ETD A;  1YJW V;  1GU4 A;  4CH4 A;  2FKW B;  3MHV A;  1NJI Q;  2ITD C;  2EZP A;  3H1H E;  2N1T D;  5JQG B;  5GTH E;  4EFE A;  2A0L A;  5LOV A;  3N2G B;  3OTO O;  1SQX E;  2WSE H;  3AE7 C;  3RT3 C;  3KZI H;  4LF5 O;  1JMM A;  1AJY A;  1QNM A;  5CA1 A;  1ROP A;  4JI1 B;  1NTM D;  4JAA A;  2YNY A;  1GL2 A;  1Q3E A;  3AEA C;  3IC7 A;  4IL6 E;  2LFS A;  2FYU H;  1EBO A;  3ZMT A;  3TJT A;  1P4R A;  2YSU B;  3RYH B;  1M90 W;  2IZ1 A;  3OGC C;  4EI2 A;  3G6E P;  3JSL A;  4GKG A;  3H32 B;  1IFJ A;  1B06 A;  4DCK A;  2Q0O C;  2QGN A;  4UVB A;  5DJU B;  3SYP A;  4YHH O;  3FB6 C;  1SQP D;  1JNM A;  2JS5 A;  5KAI Z;  1G6U A;  2Q5U A;  1ARO P;  1GU5 A;  2Q6Q A;  3MUD C;  3L75 H;  1WAZ A;  4J10 A;  1VF7 A;  4YJ3 B;  4FLT A;  2L91 A;  1AR4 A;  3VYI A;  3L70 J;  4PV1 C;  1JVM A;  4QE7 A;  2Z3Y A;  1PPJ H;  1HF9 A;  2YXY A;  1PP9 J;  5L3D A;  1FXK C;  5GON B;  3TNU A;  3LW5 J;  4OGQ D;  1AI7 A;  2DWD C;  4MVR A;  1IUR A;  4LNU A;  1D2D A;  1RFY A;  2E75 D;  3TSI A;  2P06 A;  2FXO A;  3VQW A;  1AQ5 A;  3SGI A;  2ZAE B;  1JA8 A;  1BGY E;  3T4D A;  3W7S A;  1QVG U;  1HGV A;  4X66 B;  2QJ1 A;  3H9V A;  1KD1 W;  3E8B A;  2QSI A;  3L71 E;  1K8A Q;  3M0D A;  5AW6 B;  1SQB D;  2W6I G;  5IE9 A;  5B5E Z;  5DN6 G;  2DYR C;  5JH7 B;  1O9G A;  3TGU G;  3USS A;  5JVD A;  1PGP A;  2FXM A;  2HHH B;  1X79 B;  3TXS A;  3F89 A;  1BCC D;  2HG5 C;  3OUF A;  2QKA A;  1TU3 F;  4DR3 O;  2NLJ C;  4P9P A;  1VF6 C;  4LGD E;  2WLJ A;  1EZV E;  3PTZ A;  2Q6A A;  3DXR A;  1FAV A;  4WBA A;  5CCG D;  3ASO B;  3N27 A;  3D6Z A;  4TQD A;  2DE0 X;  2UXB O;  4B7K A;  4JAU A;  3LUT B;  3H1J G;  4OVN F;  1IC2 A;  3WB2 A;  3N2K B;  4RKU J;  2OYI B;  1Q7Y W;  1VPC A;  5LP6 C;  2WSC J;  4HAM A;  1CW5 A;  5AW8 B;  1FDM A;  3RBX A;  3DTU B;  1NKN A;  2C9N Y;  1H2K A;  4F6R A;  2UU9 B;  1RQV A;  3P8C E;  3ABT A;  4KXR A;  2ZD9 A;  4C7R A;  4IHJ A;  1AVM A;  4X64 O;  4FLW A;  5TIS E;  1M5I A;  2E5T A;  4IFF A;  3CC7 V;  4JI4 O;  1M57 C;  3T2M A;  5EYP A;  4A5U B;  1P84 E;  2EIN B;  3FX7 A;  2XND G;  4JPR A;  1F4M A;  2YDE A;  2HVJ C;  1G2C B;  5AVS B;  3T1H B;  3G6B A;  2LW7 A;  5CCH D;  3WUU A;  5BR8 B;  1ZL8 B;  4AIL C;  4I5S A;  3CWB E;  5LHG A;  3OTF A;  3G71 V;  2W6B A;  3K0G A;  5KX5 A;  1M1K W;  1FDI A;  1M8O B;  3TDK A;  1NGM B;  3AK1 A;  5BU5 A;  4NVP A;  1QVF O;  5LGT A;  2JJ1 G;  4JBZ A;  2MK3 A;  2HKO A;  3CCU P;  2F1M A;  1LT9 C;  2CK3 H;  1KIL C;  1XQ8 A;  1N73 C;  2OTL P;  3OW2 O;  4DV4 B;  5KA6 A;  2IH3 C;  5KAI E;  2FYN C;  2OIG A;  4GX5 A;  1VQ8 P;  3CE2 A;  1NTZ J;  1L0N E;  3A0H H;  3E22 B;  3MHS C;  5KUK A;  1F4N A;  3H1I E;  5C8Y B;  1KZU B;  3LIE A;  5GTI Z;  3L74 E;  3CCR P;  2BAS A;  1GW3 A;  3L72 G;  3B2E E;  5H2F E;  1P84 F;  2P6J A;  1M1J A;  2BTQ A;  1Q6I A;  1ZR4 A;  3B5N D;  3ABM C;  3TCU A;  1XTC C;  2W0X A;  5FL7 G;  1MV8 A;  2WPV B;  3PJS K;  3G4S V;  2VQE B;  3H1J D;  1WPX A;  2YC0 A;  3ZMS A;  3E86 A;  4H44 C;  5B5E E;  1DF5 A;  1NTZ K;  1MKM A;  3F5W C;  2CDY A;  1XNQ B;  3I5D A;  1U7J A;  1OW7 A;  5AVU B;  4GKK O;  4AQR D;  1JX9 A;  1GK6 A;  3OUS A;  3BCC J;  4H13 C;  2FML A;  3QWO C;  3HE4 A;  5IJ9 B;  2P4K A;  4GCZ A;  1SRY A;  2DQ3 A;  2P90 A;  1NO4 A;  1H88 A;  4PJ0 Z;  1JTH B;  4L74 A;  2H89 C;  1HBW A;  1K92 A;  1JMK C;  3IN6 A;  5APV A;  2P10 A;  3RBZ A;  1N32 O;  1KQS U;  4Q20 A;  1WMK A;  4LFB B;  4R50 A;  2P2U A;  5LHH A;  1SQF A;  1I5X A;  2M7W A;  4UCU A;  3U1C A;  2RH0 A;  4FMT A;  5H6R A;  4JZ2 A;  1NVP B;  4QE9 A;  2YO2 A;  2E43 A;  1KU9 A;  2X0L A;  4NTX A;  1JOC A;  1NH2 B;  3AE2 C;  4I2L C;  1N4C A;  3EFF K;  3Q3D A;  4I9W A;  3OAK A;  3SFE C;  4P9O A;  1NVO A;  4B3M B;  3UO2 A;  5LXT B;  3FFQ A;  4PV1 B;  3SPG A;  1URQ D;  3GHG C;  3BAS A;  5IYZ B;  3UT5 B;  1OZH A;  3HUS A;  1JY2 O;  1OCR C;  4GZR B;  3SPC A;  1FXK B;  2JGU A;  1SQV G;  4Z2W A;  4WBN A;  1WN7 A;  2CTR A;  1AA0 A;  4LF5 B;  4IOI H;  5EBL C;  2IM9 A;  4DV0 O;  1J1D C;  4DV2 O;  4LF7 O;  1P7G A;  3VOU A;  4LFC O;  2Y48 A;  4L87 A;  1N2D C;  4F4L A;  2N9B A;  2DYR B;  4MTG A;  3OT7 A;  3L72 D;  3RYC A;  1H2N A;  3RK3 D;  3CC2 P;  2N1T C;  3D3Q A;  2E76 D;  4WWI A;  1HDJ A;  2WPS A;  5AG2 A;  1D7M A;  2WA4 A;  1FXV A;  1Q81 Q;  5L3F A;  3JD0 A;  1OHH G;  1SLQ A;  1YCI A;  1CPY A;  5LA6 A;  4HZ3 A;  4YHH B;  2WLI B;  4X8A A;  1MSW D;  1L4A D;  3GW6 A;  1Y76 A;  2ZR3 A;  5LHI A;  4DW1 A;  4JI7 O;  2LO1 A;  1XMO O;  1V55 B;  2JIZ G;  1SVF A;  2H94 A;  4K0K B;  4L73 A;  5GTI E;  4MTX A;  4XDJ A;  1BDD A;  1NU1 J;  1JFF B;  3KZI Z;  5JJN B;  3VBB A;  4KUM A;  5LP6 B;  3WU2 H;  2IU3 A;  1SC5 B;  4B3R B;  5EZY A;  2HOD B;  4X65 O;  1UJW B;  4DUZ B;  3RYF A;  2A06 G;  2EJR A;  4N78 E;  3CXH D;  2MJZ A;  2RKL A;  1T2K C;  1MMM A;  1VQK V;  1N7S D;  3E8G A;  1EN4 A;  1M57 B;  2R9I A;  2OIE A;  1R3J C;  3JAR B;  3SJQ C;  3H1L D;  4KJM A;  4Y99 C;  2KLV A;  2MKV A;  1A32 A;  4FFK A;  4UVC A;  4K35 A;  1BE3 H;  1ZRT D;  4OGQ C;  1XIL A;  3J7A U;  4PD4 H;  1VQM V;  1FAF A;  2E75 C;  1NU1 K;  1AJN A;  1M93 A;  2C2A A;  5AVV B;  3IFM A;  2A45 H;  4PJ0 E;  1VQ9 P;  3ZRS A;  2Q9L A;  3FYI B;  3JC2 2;  4DJG A;  2ZDI A;  2A9H A;  1YZB A;  1NKD A;  4OPH A;  1OCO C;  3IAY A;  1HNW B;  4OPA A;  1SQV D;  1BQZ A;  5KJ7 D;  5KHJ A;  1LT9 B;  1NTK H;  2K9J B;  2ZQM A;  1KIL B;  1N73 B;  3ZJZ A;  4O4H B;  3TGU H;  4D6T J;  1KN7 A;  5AVW B;  1I08 A;  1HR0 O;  1N34 O;  3IF4 A;  1LTG C;  2H3O A;  1TVK A;  1OZ0 A;  1LWU C;  5CCG C;  4X64 B;  1BL8 A;  1WPB A;  2D2C D;  4YJ2 B;  1HNZ O;  2NPS A;  1H2S B;  1ZOY C;  3B40 A;  2LW1 A;  1J5E B;  5ITZ A;  4NB5 A;  1ZL8 A;  5CA0 B;  3ABM B;  1FD9 A;  3A0B E;  2W6J G;  2WLN A;  1SQQ K;  4P30 A;  1NTM J;  4IYH A;  1Q2N A;  5E79 H;  2R32 A;  2KSD A;  1Z5V A;  2LGQ A;  4IIJ A;  1YXB A;  4ZIB A;  1RP3 B;  3S3W A;  4B3S B;  3QO5 A;  5KLV G;  1VDF A;  1MSD A;  1XUQ A;  3WUT A;  4CH6 A;  4H13 B;  2PRR A;  3I55 V;  5CCH C;  1SQP J;  2ZIM A;  5AW7 B;  5AVT B;  3K03 A;  2PTM A;  3HKD B;  3CD6 V;  2N74 A;  1R6T A;  4PA4 A;  1KB9 H;  3RL0 C;  2ZXW C;  3E22 A;  3S4R A;  4Z1M H;  3ABV C;  5C8Y A;  4BWN A;  1L2P A;  5AW1 B;  3DSQ A;  1NTM K;  4JI1 O;  4HB1 A;  2IBZ G;  2RQ6 A;  3CCJ V;  4QGP A;  4JYC A;  4DZO A;  1FU1 A;  3GG2 A;  3KZI E;  3AE8 C;  5CBO A;  3RGB A;  2QSA A;  2BSK A;  1CI6 B;  1XBL A;  2QWO B;  3FB5 C;  1K5S A;  1AQT A;  1VQ5 P;  1S1C X;  1HJ0 A;  4MW3 A;  1AI6 A;  2QEX V;  2QWN B;  2FYU E;  1G1I A;  1SQP K;  2K1A A;  3W7X A;  3ABK C;  3OMI B;  1SQB J;  3GHG B;  2JVD A;  3TYY A;  2LQT A;  5LL6 Y;  2ATK C;  3CX5 I;  4X88 A;  4FZ1 A;  2YEV B;  1JO5 A;  3E2E A;  1FZF A;  1OCR B;  4TUY B;  2W27 A;  2YIB A;  2UXD B;  5IJ9 A;  1WT6 A;  4UCV A;  1BCC J;  2YIU C;  2YKO A;  4GKK B;  4KT0 J;  4AUW A;  3D36 A;  3B5N C;  3P8M C;  3SWK A;  3VP9 A;  1SS3 A;  4D7S A;  1M56 C;  3A0H Z;  3UQ8 A;  2IFM A;  2ZYA A;  3L75 E;  1J1D B;  4U7O A;  1USE A;  2OWO A;  3FKS G;  4NTW A;  1VQO V;  1PPJ E;  1N32 B;  3CRM A;  3K06 A;  2JS3 A;  2J59 M;  4X66 O;  2N1T B;  1FOS E;  1SQB K;  3BA9 A;  4I1L A;  4BIZ A;  4JI8 B;  1AI4 A;  2FFD C;  4W80 A;  4C7N B;  1QVF U;  1P7B A;  2BCC D;  2X6B A;  1ZXG A;  2HHH O;  3IR9 A;  1U57 A;  1CXZ B;  3HE5 A;  2OYH A;  3AG2 C;  1JCD A;  2JJ2 G;  2J58 A;  3CP1 A;  4MN4 C;  5F2V O;  1PV0 A;  1A02 J;  5KLV D;  3Q4H B;  1KQL A;  1K9M W;  1WLE A;  3CXH H;  2KLU A;  2GUZ B;  5KTB A;  3BA8 A;  3E7K A;  4ZI7 B;  4PHZ A;  4OH8 B;  2UUA B;  1RF1 A;  1RPR A;  2WLM A;  4NYK A;  4ZMD A;  4DV3 B;  3HPL C;  4TV8 A;  3ZHR A;  5B1A C;  3EHB B;  5J9P C;  4W4K A;  4QIW F;  3ZRV A;  3G80 A;  1NR7 A;  2ZYD A;  1YJN P;  4DR6 B;  5EC2 C;  3L70 H;  2IBZ D;  4LF7 B;  1URQ C;  3EFG A;  4LFC B;  2H43 A;  3K04 A;  1PP9 H;  3F5T A;  3LW5 H;  4MTF A;  2CH7 B;  1VQ6 V;  1Z5W A;  3H1K G;  2IZ0 A;  3OFN G;  2EBO A;  1FOS F;  2E75 B;  1E1Q G;  1XEQ A;  1Y9B A;  2PFX A;  1Y74 A;  1GZL A;  2R70 A;  2K3R A;  4U3F D;  4BIU A;  4FM0 A;  2LGW A;  5CB4 A;  1OJH A;  3AG3 C;  1E1R G;  2PI4 A;  2WZ7 A;  2YXQ B;  1SQQ G;  1XMO B;  1Y6X A;  4D6T G;  1WA8 B;  2G38 A;  4MVU A;  3D70 A;  3RK3 C;  1OCO B;  3AK2 A;  4AQY B;  2UXC B;  4L8J A;  1VQP P;  3I56 P;  2E76 C;  5FNV B;  2HOD A;  4DV6 B;  1YJW P;  1N33 O;  4IFD K;  1E5W A;  1Q8I A;  2HPC B;  5APX A;  2ZE8 A;  4XDK A;  1L4A C;  1ZUQ A;  3G3Z A;  2V7Q G;  4BWA A;  1M9N A;  2ZE5 A;  1Y47 A;  2JO1 A;  1QU7 A;  1QL1 A;  2PP6 A;  3A7O A;  1Q86 Q;  1ZWI C;  4E2L A;  4JAS A;  3H1J J;  1QHT A;  3MD0 A;  4O2A A;  3JAS B;  3U10 A;  1O9H A;  4I9Q A;  4UCS A;  4CS2 A;  2LXB A;  2WSC H;  1JR9 A;  1IJD B;  1NTM G;  3AK3 A;  2ZT9 D;  1EDJ A;  1H38 A;  2M3E A;  4DK1 A;  1VIB A;  1LP1 A;  1R5L A;  2IJK A;  5J2T B;  1BQ0 A;  1FZE A;  2Z4E A;  1MA1 A;  2JGD A;  4I0X B;  3A0H E;  2WWW A;  3LDE A;  2DW3 A;  5JCO A;  4FLX A;  1N7S C;  2XT9 A;  2A06 H;  1YIT V;  4J42 A;  3AE9 C;  2WPD G;  2OT5 A;  3NTN A;  1Q6H A;  3WU2 Z;  1OXZ A;  3FB7 C;  4TV9 A;  1YDX A;  1BHB A;  1FFX A;  2VQE O;  4TLF A;  3SJB C;  1GK9 A;  4WCE V;  3S1K A;  1H0T B;  1VF5 D;  3H25 A;  2VS0 A;  2Y9Z A;  3RL0 B;  1GMG A;  2ZXW B;  3ZS8 C;  2GBO A;  3SFD C;  2UUB B;  4LH7 A;  1LTJ A;  3M9Q A;  2IYP A;  4DRX A;  2C9L Y;  2NNU A;  4MVZ A;  4YJ2 A;  1L0L D;  1SZT A;  3BAB A;  2DN9 A;  4LWS B;  3FWL A;  3HTK B;  3L73 D;  4M3L A;  5DJT B;  3SWF A;  3AE6 C;  5D5Q A;  1HNZ B;  3H1K D;  5KJ7 C;  4ZOL A;  1EN5 A;  5CJ4 A;  1OCZ C;  5CA0 A;  2IJJ A;  4BW5 A;  4X1K A;  4C7U A;  4LFB O;  1KUQ A;  3VN0 A;  3O6Q B;  3IC9 A;  2AEM A;  5C39 A;  3CX5 D;  4K3A A;  2YXL A;  3JAT B;  3NR7 A;  3ZIA G;  3R4Y A;  1NTZ H;  3PLN A;  1MAB G;  2ZNJ A;  1QR8 A;  1SQQ D;  2ADQ B;  3THO A;  2G3A A;  4LF8 B;  4QNH B;  1GL2 D;  3HKC A;  2WSS H;  2PUS A;  4FFB B;  1EZV I;  3OR7 C;  2D2C C;  2DMX A;  3L72 J;  1IFD A;  4KL1 A;  3CCE V;  3V4Q A;  4B3M O;  2V4H A;  5BU8 B;  2YIU B;  2E42 A;  1SQX G;  1QL2 A;  1NBM G;  3IAO A;  3N7N A;  5KKZ C;  3B5N B;  2W83 C;  3ZDM A;  1J1E C;  1FE6 A;  1M56 B;  1KP2 A;  3APQ A;  2JKV A;  3UIA A;  1QLN A;  4EIJ A;  1W2B U;  2W6J H;  4RAI A;  3JAL B;  3AED C;  3W7W A;  1FJG O;  4FLZ A;  4IL6 X;  1TGO A;  1R3K C;  1YHQ V;  3NXS A;  4J11 A;  2DQ0 A;  4ZKI A;  5AVX B;  2JK5 C;  4MTO A;  1XHX A;  5KHI A;  3BCC H;  3CC7 P;  5AVQ B;  1P84 I;  3OAA G;  2FFD B;  3S9O A;  1M4U A;  1S77 D;  2B87 B;  4JTD B;  3B4S A;  3QO7 A;  2Y69 C;  2ZM6 B;  1VQ4 V;  5E79 Z;  5HFM A;  4JI5 B;  2EIL C;  1SFC A;  3MHH C;  4RQF A;  4TT3 H;  3LSU A;  2HVK C;  2R9A A;  2YIC A;  3SJA C;  2N05 A;  2Q5Z A;  2PGG A;  3SPH A;  2JEU A;  2KNC A;  3H1L J;  3G71 P;  2A79 B;  4NXM O;  4K0K O;  2GTS A;  2HP8 A;  1AVY A;  2XKM A;  4O4L A;  2X7R B;  5B1A B;  3D8C A;  5EFW B;  3GB7 C;  3CCS V;  4B3R O;  3L71 G;  2QJY C;  4DO2 A;  1DX7 A;  1AJQ A;  1RE4 C;  4J7J A;  3KDP B;  4DUZ O;  5IJ0 B;  2P7J A;  3WU2 E;  2W90 A;  2WLL B;  1SQV J;  3L37 A;  4ZBM A;  1KC8 Q;  3MTU E;  2R5B A;  1FZB A;  2QKS A;  1H2M A;  1Q6U A;  3CCM V;  3L36 A;  5LGU A;  3AEG C;  1IVS A;  2HEP A;  1FZC A;  2P22 C;  3RWR D;  4HYT B;  4KP4 A;  1EZV G;  3AG3 B;  2FTK A;  4J80 A;  1JMB A;  2Q0A A;  3Q4H A;  3LDD A;  4HYO A;  3H1H D;  3BFR A;  2GUZ A;  4UUJ C;  3AEB C;  3RK3 B;  2OYQ A;  3W68 A;  4PD4 E;  2E76 B;  1BE3 E;  1SQX D;  2WT7 B;  3G4S P;  5IT9 N;  2R3S A;  1HUC A;  2EIM C;  2AGA A;  1SQV K;  3MIW A;  1VQN V;  1HNW O;  1TUB A;  2NN4 A;  3CHX A;  3RVZ A;  1OMI A;  2Q67 A;  1BSM A;  4TOI A;  2AZ2 A;  4GX1 A;  2XAQ A;  2CGO A;  1RSO A;  4CPG A;  1NTK E;  3LSS A;  1NU1 H;  1EC5 A;  5KA5 A;  1PD3 A;  3TGU E;  4RUE A;  3CME V;  3T97 A;  1Q43 A;  1F23 A;  4EB6 A;  2QA4 V;  1FC2 C;  2WVR A;  5APS A;  3FWN A;  3CWB G;  1K33 A;  4O4J B;  4Q6G A;  4Y28 J;  1J5E O;  3CPW U;  1KP3 A;  1JEK A;  3FX0 A;  2F95 B;  1I7F A;  4YIP A;  2KSJ A;  1H2G A;  4GLX A;  2KB7 P;  3K5O A;  4CC5 A;  2GHY A;  4WY4 C;  1T3U A;  2N9Y B;  2PF4 E;  1S5L H;  1QR9 A;  4PA9 A;  5CMU A;  4X62 B;  1FJK A;  1LTS C;  4J9Z B;  4B3S O;  4PD4 F;  3IGA C;  3BRV B;  3S3X A;  1IXM A;  2R3C A;  1N33 B;  1BGY D;  4R6Z A;  1K05 A;  2NR5 A;  3H1K H;  3ZED A;  3L71 D;  3JAW B;  4PDL A;  1DEE G;  3X2Q B;  2VRS A;  1GK4 A;  1KYO H;  2VQF O;  3M91 A;  4MSW C;  3CLQ A;  4X1I B;  1OCZ B;  4D6T H;  1YI2 V;  1ZSP A;  2K37 A;  1KKD A;  4PA3 A;  4UV9 A;  1KB9 E;  1QLE D;  2ZIN A;  3BY6 A;  1EZV D;  3HD7 C;  1PL4 A;  2R72 A;  2WLK A;  3ZN1 A;  2E74 D;  2AXC A;  3U1A A;  4I4T B;  4X1Y B;  1YBK A;  2D2C B;  3ZRW B;  4QMA A;  2K9Y A;  1YTF B;  2P5O A;  2WPQ A;  2JDI G;  3ZCC A;  1GM9 A;  2QWQ B;  4JI0 B;  2KI7 B;  1Q82 W;  1T3J A;  2ZT9 C;  3A3Y B;  5KKZ B;  3P8C D;  3SSU A;  4NPF X;  1MZF A;  1NTM H;  2F43 G;  3LNN A;  1J1E B;  2UXD O;  2BCC J;  1JJO A;  1FZG A;  1JPX A;  1LTA C;  3JD3 A;  1H8H G;  1PNM A;  1NHL A;  2RN0 A;  3I5C A;  1P84 D;  3SJC C;  1JCC A;  3C1L A;  5KLV J;  2QIW A;  3L9D A;  1YJ9 V;  1VQK P;  3WG7 C;  1S0V A;  2PGD A;  3BEH A;  3O6Q A;  3CWB D;  4ZKP A;  1SQP H;  5J2U B;  4FLV A;  2Y69 B;  4JI2 O;  1VF5 C;  2QG4 A;  4O2B A;  4I7Z C;  2Q7H A;  2EIL B;  1NR1 A;  3E8F A;  4JI8 O;  1F7Y A;  3H1L G;  1KB9 F;  1Z2G A;  1VQM P;  3OEE G;  5B66 H;  4DR7 B;  3KYQ A;  1KQF B;  4G27 B;  2V1D A;  4HKZ H;  2SPZ A;  3RGU A;  3Q1M A;  3GWO A;  2YMK A;  2VWJ A;  5FPO A;  2IDB A;  1U7M A;  5KLV K;  4DW0 A;  4GYC B;  4I50 B;  4O4I B;  1E79 G;  3DC6 A;  1KEC A;  4ABM A;  3CI9 A;  3E1I A;  5DEC A;  4EFB A;  5JQG A;  1V54 C;  1L0N D;  4U3F J;  2UUA O;  4I55 B;  3PRJ A;  3K9S A;  1N7L A;  3N2G A;  2WMM A;  2YKP A;  3ITK A;  4JGS A;  4XDL A;  2QJY B;  1SQB H;  2CAZ C;  3JAK B;  3L74 D;  2ITC C;  2DW4 A;  4DR2 B;  3HRN A;  5EC1 C;  4DV3 O;  1GL2 C;  1CP9 A;  3CXH E;  1YIJ P;  2O57 A;  1PZQ A;  1FJG B;  5AW3 B;  4TQF A;  4DR6 O;  1BCC H;  2B87 A;  4X20 B;  2Q3I A;  3RK2 D;  2FL4 A;  2FYU K;  3RYH A;  4YXD C;  5LMU B;  5KAF H;  3H32 A;  1RE3 A;  3L70 E;  2CUG A;  3ZHQ A;  4PI0 A;  2LKM A;  2DYS C;  1N8R W;  1CZQ A;  3LID A;  1PP9 E;  1XRE A;  1GM8 A;  2Y9Y A;  4YJ3 A;  4HBN A;  4ASV A;  1PL5 A;  1N0N A;  1U96 A;  4CH3 A;  4JV5 B;  2EIM B;  1M90 Q;  4G28 B;  4NXM B;  3AG7 A;  5LBQ A;  1XOU A;  4LBE C;  1J2J B;  4AQY O;  2UXC O;  5LGN A;  5BY1 A;  5GON A;  2RCV A;  4GT1 A;  1YQ3 C;  4DV6 O;  4FM2 A;  3NFQ A;  1W5C E;  3I55 P;  5CN0 A;  2ADP A;  4FZ0 A;  2JEX A;  1FYJ A;  4HNA B;  3E8H A;  4KHX A;  3CD6 P;  2WLL A;  3PN1 A;  1NQT A;  2M6Y A;  3M0D C;  2AXT H;  3VQV A;  3O8Z A;  3CXH F;  2HYN A;  1RF0 A;  1SZX A;  2QE7 G;  3CCJ P;  5JH7 A;  1R5S A;  4U3J B;  1HGZ A;  2Q73 A;  2O1J A;  3D6Y A;  1W2B O;  2Q7G A;  1YQ4 C;  2J5U A;  3C8V A;  2IX7 C;  2ZE7 A;  3UO3 A;  1L0L J;  4TWK A;  4DV5 B;  2QEX P;  1KD1 Q;  3L73 J;  1HWY A;  4WY4 B;  1U97 A;  3CRQ A;  3H1K J;  3CJH B;  2KG7 B;  4WFH A;  2WAM A;  2NPS D;  2V4D A;  5KHK A;  3RVY A;  2EJ7 A;  1OIP A;  5B3S C;  1GO3 F;  3N2K A;  4LF6 B;  3E89 A;  1AB3 A;  2OYI A;  1WJZ A;  1S9K E;  3AEE C;  2A06 E;  1SQQ J;  2P58 A;  3T1Y O;  5AW2 B;  4A7P A;  2FYN B;  1GN2 A;  2HR3 A;  3ZRX A;  2UUB O;  2HLO A;  1VQO P;  1L0L K;  5L3B A;  2XOK G;  1R1B A;  3M06 A;  3OMN B;  1PGO A;  3WUV A;  2V7Q J;  1Q7Y Q;  3HD7 B;  1G2C A;  1YTZ I;  2DJV A;  2XAJ A;  3WFV A;  3H1J H;  3QNE A;  2B88 A;  1LTB C;  2YMY A;  1X9V A;  1HNX B;  2YKQ A;  5D5P A;  4JZG A;  1PNL A;  4YY3 O;  4UCR A;  1W0K G;  2BCC G;  4B7E A;  4LF8 O;  2ZT9 B;  2BOB C;  2B9Z A;  3JD4 A;  4H44 B;  1R3L C;  4BW9 A;  1NTZ E;  1S2E A;  4N78 D;  3HKE B;  4GX2 A;  5APY A;  4PEL A;  4LFA B;  1JOY A;  3ICX A;  2ZXE B;  4H37 A;  3GLM A;  2PY5 A;  2FYZ A;  1WB7 A;  4RO2 A;  5BMV B;  2XND H;  4JQ0 D;  3AG1 C;  1EDL A;  1JM0 A;  2C0W A;  1GW4 A;  1IO4 A;  3FXD A;  1M1K Q;  3C3T A;  1RPO A;  2XHB A;  5KMG B;  1V9P A;  3WG7 B;  2VQF B;  4UXN A;  4DUY B;  1XNR B;  1OX3 A;  2YIB D;  1GMJ A;  2PYL A;  4DR1 B;  1VF5 B;  1NJI W;  4I7Z B;  2ETN A;  2AEF A;  1M1J C;  5H5N A;  1VQ6 P;  3CS5 A;  4JF7 A;  2FYU G;  4I4T A;  1JCH A;  4F6E A;  3OE7 G;  1X4T A;  2ZM6 O;  1XL6 A;  3DC5 A;  1S5L Z;  4JI5 O;  4EOT A;  4LF4 B;  4J7K A;  1RHZ B;  3BCC E;  5IYC O;  2KIK A;  2UXX A;  4U3F G;  3CRA A;  3TK1 A;  1K04 A;  1VQ7 V;  1K3E A;  4U7J A;  4IT5 A;  1DF4 A;  4DXW A;  5LOV B;  2JJL A;  1QLE C;  3AE3 C;  4RO0 A;  1V54 B;  3O9O A;  3QH9 A;  2E5L O;  3CPW O;  3B8N A;  2E74 C;  1KFN A;  4GOD A;  1MFZ A;  1GL2 B;  3L72 H;  3H1H J;  4H33 A;  2RMZ A;  5BVZ A;  4B86 A;  3G67 A;  3P3N A;  3JSV C;  3C90 A;  1JTH A;  4UVA A;  3OD4 A;  1LUV A;  1SQX J;  2H8P D;  3F5H A;  1NS1 A;  3VMY A;  3B77 A;  3BVO A;  2KQX A;  3CB2 A;  2ZVO B;  4OWF A;  1JY3 P;  4YXW G;  3JCU H;  2I1K A;  4JI2 B;  3Q5P A;  1HJB A;  4Z1V A;  2CGN A;  3ML0 A;  2DYS B;  2YI8 A;  2Q69 A;  1H2L A;  1S5J A;  1LT1 A;  5AVR B;  1UII A;  2Z5U A;  1KIL E;  5A2Q N;  3MUD A;  2ZVN B;  1JQ0 A;  4BRY B;  1YIT P;  4J9Y B;  5LXT A;  3HUS C;  3AE5 C;  1ZLZ A;  4EYY Q;  3CYO A;  2A3Q A;  3KG2 A;  3OMA B;  3UT5 A;  5IYZ A;  3TNU B;  1SQX K;  3LSQ A;  1VL2 A;  1B6Q A;  1FXK A;  2FY8 A;  4DV1 B;  3W67 A;  4LNU B;  1XMQ B;  1AR1 B;  2O1K A;  2VRZ A;  2GSM B;  2I8D A;  3LNM B;  3H1L H;  3QF7 A;  1ZW0 A;  4W4L A;  3UKM A;  2PYJ A;  1PGJ A;  4XBF A;  1HP8 A;  3VOP A;  2QM4 A;  2YO3 A;  5JVD B;  1PNK A;  1SQG A;  1FJP A;  2QR4 A;  1BGY J;  1K5Q A;  2FYU D;  1L0L G;  4Y99 B;  3V4W A;  1IBL B;  3ZX6 A;  3L71 J;  1E79 H;  3L73 G;  2MW2 B;  5B66 Z;  1VQL P;  1X8Y A;  1YEW A;  3AEI A;  3B71 A;  2D3O W;  1P49 A;  4OGQ B;  3H6P A;  1NU1 E;  2WLI A;  1UIX A;  1VF6 A;  3ZMZ A;  3DXR B;  2KK7 A;  1GTO A;  1H8A A;  5CMZ A;  1KFM A;  4CC6 A;  1SQV H;  4ZHQ B;  2UUC B;  2R44 A;  3ASN C;  4OXS A;  1Y66 A;  1VP7 A;  3T4Z A;  5H6Q A;  4DR5 O;  3RK2 C;  3V2Q A;  3FAV B;  3L75 D;  3CCE P;  1KQG B;  2ITA A;  1I0H A;  1JFF A;  4MVS A;  1EDK A;  5LP6 A;  3E1R A;  4X62 O;  1S72 V;  4F6R B;  3ZHS A;  1PPJ D;  4JYB A;  3SYA A;  4IHJ B;  5CBN A;  2OQQ A;  3JD2 A;  4DV7 O;  1S5L E;  5CJ0 A;  4H0L D;  4CS3 A;  2AHY A;  4PA6 A;  1EN6 A;  5AW4 B;  1YHQ P;  1LWU B;  3STL C;  3H1K E;  3AG4 C;  3JAR A;  5KAF Z;  3TET A;  1NH4 A;  4OX9 B;  3CCL V;  1LUW A;  1PM9 A;  3K59 A;  1R8E A;  1AFO A;  2YS8 A;  3PP5 A;  2DOS A;  4TSF G;  1Y67 A;  2F4V B;  1VQ4 P;  1AR5 A;  3C3S A;  1KYO E;  1B04 A;  1YTZ T;  3M9B A;  2B5U A;  2QJP C;  2ILM A;  5KX5 B;  4JYA O;  3CJH A;  4D6T E;  3MZW B;  2ZDI C;  1W59 A;  1WP7 A;  3CWB J;  3KCX A;  3OJA B;  1G8M A;  3RFR A;  2JR8 A;  1LT9 A;  2K9J A;  2ZJS E;  4JI0 O;  1KIL A;  4GOE A;  1N73 A;  1NTK K;  2AEJ A;  4O4H A;  3A2A A;  1B3Q A;  1OVV A;  1IBK B;  2GM4 A;  2ODM A;  2ZFC A;  2AXT Z;  3AG1 B;  3CCS P;  2Y0D A;  2KP8 A;  3T1Y B;  2WLH A;  1I94 B;  3AE1 C;  1GAX A;  2EIN C;  1S76 D;  2NPS C;  2HFE D;  1URF A;  1Y4M A;  3CRC A;  1NTM E;  1FS0 E;  3EXA A;  2P67 A;  3VMZ A;  3OGI B;  4XA4 A;  4MVQ A;  1YSC A;  2BTQ B;  1L0N J;  5APU A;  1HW7 A;  3QTC A;  3CCM P;  3K58 A;  4LR3 A;  5CBF A;  3KCY A;  3L74 J;  5AVY B;  2KUB A;  4ZKU A;  3P3P A;  3N4X A;  1KYO F;  4O9B A;  1US6 A;  2Y4T A;  4FIP C;  1SQP E;  4YY3 B;  3ABL C;  1AV1 A;  2BTO A;  2KYV A;  1CSB A;  3GF7 A;  4DR7 O;  3ABK B;  4PDV A;  3HKE A;  1IXB A;  2LXC B;  2CPB A;  4PD4 I;  1KTM A;  1QLE B;  2YID A;  3KKY A;  4IGG A;  2Y0E A;  3H1H G;  3HE4 B;  5CBG A;  3JAM N;  5BMV A;  5K5G B;  3A0B H;  2KXP B;  2E74 B;  5B66 E;  1VQN P;  2A45 I;  1L0N K;  1MZ9 A;  1SFC D;  3HKD A;  5IYB O;  2B89 A;  1W0J G;  2AHZ A;  5CHX A;  3VMX A;  3SDL A;  4DR2 O;  2Q7E A;  3BVH A;  1ZV8 A;  2BEQ D;  4JTC B;  2BCC H;  1GH6 A;  3CME P;  4R4L A;  1SQB E;  3QVN A;  4GDO A;  3MDS A;  2QA4 P;  1CI6 A;  3CL3 D;  1IK9 A;  1KBH A;  4AI8 A;  4LF9 O;  3CMA V;  5DM6 V;  5KLV H;  3RYI B;  3CCQ V;  5LMU O;  2OTJ V;  1VAR A;  4FLY A;  1L8D A;  3ZN0 A;  1D5N A;  1BCC E;  1R6N A;  4FLU A;  2IJI A;  1OW8 A;  1X59 A;  4DT0 A;  3K79 A;  3AG2 B;  5A9G A;  3Q5S A;  3GHG A;  3HUS B;  2EUL A;  3ZMU A;  3CCV V;  5B1B C;  2YEV A;  1MFT A;  5KAF E;  3JD1 A;  3BAA A;  4TUY A;  1KOR A;  2IPP A;  3ETQ A;  4WBN B;  2XAS A;  1Q81 W;  3D36 C;  4JV5 O;  1FZA A;  2E5L B;  2HJF C;  2IBZ H;  2OCC C;  4PDR A;  3CC4 V;  2YI9 A;  2CE4 A;  1BGY G;  5AVZ B;  3RYC B;  3GWK C;  2WTY A;  1SS1 A;  3E83 A;  1URQ B;  1T5E A;  2N1T A;  4U3F H;  1YI2 P;  3V5B A;  3EQ2 A;  3L35 A;  3EWK A;  1N0J A;  5LA6 B;  1T2K D;  1KB9 I;  4C7N A;  1Y76 B;  1K73 W;  2AXT E;  2NZ2 A;  2OAR A;  3V2N A;  2OYH C;  2WIT A;  4BRY A;  2XTA A;  1EZJ A;  3M8A A;  3ASN B;  4J41 A;  2XUM A;  1BE3 G;  2CTP A;  3K57 A;  1MZE A;  2H8P C;  1NZ6 A;  5H2F Z;  3RK2 B;  4MS2 A;  2YXR B;  1IZ3 A;  2K9P A;  4DV5 O;  4L75 A;  2LJ2 A;  4UV8 A;  5LYJ B;  2GV9 A;  4ZI7 A;  2M3B A;  2A45 G;  4N6J A;  1RF1 C;  5EZY B;  4FPP A;  3GF3 A;  4YXW H;  1COW G;  3RYF B;  5EIB D;  4LF6 O;  1IX9 A;  1FPO A;  1SER A;  1NTK G;  1Q5O A;  1L4A B;  1HVV A;  2BE3 A;  3JCU Z;  4BAY A;  3TXQ A;  1K9M Q;  5CBH A;  1CEZ A;  2X6A A;  3AG4 B;  3AE4 C;  1YJ9 P;  1SKV A;  1BS3 A;  3R65 A;  4WFB V;  1ZN5 A;  2QKC A;  4UB6 H;  1UFI A;  1R3I C;  4JTA B;  5IWA B;  1LR1 A;  2CH7 A;  1DD3 A;  2X6C A;  1JY2 P;  1A02 F;  4ZHQ A;  2QJP B;  1V55 C;  1IZN B;  2KZI A;  4NPD A;  4UCT A;  4JYY A;  3FAV A;  3JSN A;  1N7S B;  1HNX O;  3V2R A;  4NXN B;  1WA8 A;  4FK5 C;  4DR5 B;  1S3J A;  1WNS A;  1KMI Z;  3CSX A;  1ZP0 C;  1OV9 A;  3H1J E;  3M9H A;  1H8E G;  5FNV A;  1RH5 B;  1PFI A;  1L0L H;  2DWE C;  4MVM A;  2Q8V A;  3L73 H;  3BHP A;  2HPC A;  3QO8 A;  1TVK B;  4LFA O;  2F93 B;  2XNX A;  5E79 E;  1BSH A;  4DV7 B;  1LWU A;  5CCG A;  3CXH I;  2NPS B;  1L0N G;  1USD A;  2O01 J;  2W8Z A;  3H1I G;  2KKW A;  3JAS A;  3G6E V;  5ITZ B;  3CX5 H;  3L74 G;  4JI6 O;  3K5L A;  4QPK A;  4Z1M G;  1DH3 A;  1XNR O;  1K4C C;  4DUY O;  1SQQ H;  1UPG A;  2B1I A;  3RL0 D;  3FGA D;  2JWD A;  2WSF J;  2L6L A;  4DR1 O;  1ENV A;  5J2T A;  2W0F C;  1RM1 C;  2C0X A;  4DK0 A;  4I0X A;  4PD4 D;  5JCO C;  1BE3 D;  4IIJ B;  4BXL A;  3R2P A;  4JYA B;  4H0L C;  3ABL B;  2M0B A;  1IK7 A;  1JB0 J;  4GKJ O;  2V7Q H;  1GN3 A;  4LF4 O;  1F51 A;  4KHP B;  2XV5 A;  2HLD G;  3K5M A;  3B8E B;  1R73 A;  4IFM A;  1H0T A;  5CCH A;  3G9R A;  1HTL C;  1ZLL A;  1NTK D;  2EIK C;  2AZ0 A;  5E1A C;  1LTJ C;  4HJG H;  3EVK A;  4RJT A;  3TGU D;  1RY3 A;  1ORQ C;  3AEF C;  1XTG B;  1BT8 A;  1EXJ A;  3V2P A;  1JY3 N;  1AVO A;  4LWS A;  3U11 A;  3A0R A;  3HTK A;  2H88 C;  4C46 A;  1GTW A;  4ZNC A;  1SP4 A;  4W7Z A;  4X89 A;  2BSK B;  4UB8 H;  2YIA A;  4CBC A;  1M56 D;  3L72 E;  3RK3 E;  2HJD A;  4GIF A;  2JP3 A;  3JAT A;  1LNQ A;  4RUF A;  2ZNI A;  2WSE J;  4YPC A;  4N21 A;  1IBM O;  2Y4U A;  1AP5 A;  2HFE C;  3JCU E;  4FFB A;  1DEB A;  5B1B B;  4DOJ A;  3OR6 C;  4N23 A;  3Q5R A;  2FYU J;  1GRJ A;  2QVA A;  1NAY A;  2O01 N;  5TJH A;  4AYC A;  2OCC B;  3HB3 B;  1GN6 A;  3B5N A;  3J81 N;  2M8R A;  3KHU A;  4DV1 O;  1PGQ A;  2JEE A;  1XMQ O;  3U0Z A;  4QPJ A;  1XHZ A;  1LGH B;  5DED A;  3ABU A;  2FKX A;  3JAL A;  3H1I D;  4K8X A;  1H89 A;  1KB9 D;  2OCH A;  4P2Z A;  3JYC A;  4JI3 B;  1EQ7 A;  5KLI C;  3BRT B;  3L75 J;  2Q1K A;  3HKB B;  3L70 G;  3ZHU A;  2FFD A;  3RYI A;  5EBW C;  3H1L E;  2R5D A;  3H1H H;  3VTP C;  1PP9 G;  3HE5 B;  2OYH B;  1SFC C;  4LF9 B;  5GTH H;  3U59 A;  1IBL O;  2EZO A;  5FLX N;  2VWK A;  1ZRT E;  4L76 A;  1SQX H;  4B3T B;  3KQG A;  1VMG A;  1NOH A;  2H7H A;  3SWY A;  2P1J A;  3VQY A;  1IFM A;  1S5H C;  2JRI A;  3CCU V;  2UUC O;  3A0B Z;  3OTO B;  4YIO A;  1RF1 B;  2OTL V;  4IL6 H;  1SET A;  3M0A A;  1ZX3 A;  4TV8 B;  3L4F A;  4NTY A;  1GDT A;  1DD4 A;  2QJK C;  2QWR B;  1SQV E;  4YTP C;  1VQ8 V;  4FJC C;  1OCC C;  1DTO A;  3ZBH A;  2ZR2 A;  2IYO A;  2XAG A;  2KS1 B;  2EIJ C;  4RQE A;  4NKG B;  1MG1 A;  2OYO A;  2EX3 A;  3CCR V;  5LMN O;  2YXH A;  1URQ A;  2XAH A;  1RQU A;  2LP7 A;  1AIL A;  1WP8 A;  5IJ0 A;  5KHH A;  4RWU A;  4JPZ B;  2QWP B;  5IY5 C;  5B1O A;  3ZHV A;  4XE5 B;  2PZS A;  1Y74 B;  2QM8 A;  3MGN A;  5AW0 B;  5L8R J;  2RNB A;  1FZC C;  4EEQ A;  5CB4 B;  4OX9 O;  3K5B A;  1GKF A;  2N04 A;  2Z0A A;  1HWT C;  4GX0 A;  1LTI C;  3RL0 g;  1QX8 A;  2QDO A;  1Q86 W;  4G2K A;  2F4V O;  2GUS A;  1D5A A;  3P32 A;  2ZXX A;  1N36 O;  2W6A A;  1JJ2 U;  3K08 A;  5B1N A;  5LYJ A;  3BRC A;  1BGY H;  4DR4 O;  4GUN A;  1K34 A;  2IFN A;  1TA8 A;  3L71 H;  3RN4 A;  3FXE A;  2WT7 A;  2M5A B;  1QQC A;  1K73 Q;  1VQ7 P;  1NAF A;  1XL4 A;  2BOC C;  1K7D A;  5EBM C;  3T1C A;  2Q4P A;  5APW A;  1BMF G;  1L4A A;  4FM1 A;  3SYQ A;  1DK1 A;  1BHA A;  3D71 A;  5JJJ B;  1IBK O;  4O2A B;  2XU6 A;  4MW8 A;  1DGS A;  3ZMV A;  2Z5I A;  4PI2 A;  2IBZ I;  1EZV H;  2E3C A;  1I94 O;  3L70 D;  1LP1 B;  4J7Z A;  4CS4 A;  4DR3 B;  2CTQ A;  3OA7 A;  1PP9 D;  2O3J A;  2JGD B;  3B09 A;  2ZE6 A;  3QG5 A;  4O4J A;  5H9C A;  5EIB C;  3W7T A;  1RM1 B;  1KV4 A;  3B8M A;  2UXB B;  5APQ A;  4H0L B;  1N7S A;  4LCU C;  1FBM A;  1SA0 B;  2XAF A;  5IYD O;  4TV9 B;  1WRG A;  1GM7 A;  1NTZ G;  1FFX B;  3M99 B;  3VP8 A;  5TIS H;  2RN9 A;  3HR0 A;  1IFN A;  1YIJ V;  2WSS G;  1L1F A;  1P84 H;  2A7W A;  1WB8 A;  1YF2 A;  2B9B A;  5KUM A;  4LP8 A;  2EIK B;  3LDC A;  5AW5 B;  2F23 A;  3W7U A;  3FYE B;  4UFZ A;  3P7K A;  1AI5 A;  1LTJ B;  4DRX B;  4RES B;  3JAW A;  3V6I A;  4JI4 B;  1YTF D;  1OVR A;  4GOF A;  1PL0 A;  3CWB H;  4R4M A;  3Q2Y A;  4UB6 Z;  1GN4 A;  4ZOL B;  3CC2 V;  1NI8 A;  4UCO A;  3MAQ A;  4X1I A;  4X1K B;  1BSN A;  3AEC C;  5KJ7 A;  4NPE A;  1AP6 A;  4JI6 B;  2KZJ A;  4N3Y B;  1HH0 A;  1FKA O;  1PKX A;  2AW9 A;  3MP7 B;  1QVG O;  1N86 A;  1EDI A;  1ZR2 A;  1PIX A;  3BCC G;  3HKC B;  3K3W A;  2P7T C;  3OEH G;  2QRX A;  4JF3 A;  4WB4 A;  1S4X A;  4X1Y A;  2BCC E;  5KAI H;  1DLB A;  1LTT C;  2R9R B;  1IFI A;  3ZRW A;  4GKJ B;  1S9K D;  3STZ C;  2GDS A;  4BIO A;  1L0N H;  2LFR A;  3SYO A;  3SPI A;  2A06 D;  2OGU A;  3H1I H;  1QBZ A;  4TT3 G;  5KLV E;  2QTO A;  3L74 H;  2ZIO A;  1SES A;  1NVP D;  1X0T A;  3GVM A;  5H2F H;  1S72 P;  1FFT B;  4PDM A;  5L3E A;  1NH2 D;  3L75 G;  1R6K A;  2CTW A;  1QGK B; 
#chains in the Genus database with same CATH homology
 1KIL E;  1PV3 A;  1KQF B;  3AEF C;  3AE1 C;  3AEA C;  1FDI A;  2D2C C;  1EXJ A;  1NGM B;  3Q1M A;  1FDO A;  2H88 C;  2BEZ F;  2YMK A;  2IDB A;  3AE5 C;  4PV1 D;  2E76 D;  3IAO A;  2V7Q J;  5KKZ C;  4H13 B;  1VL2 A;  2E75 B;  3GF3 A;  2FBW C;  1Y9B A;  4Y28 J;  3RK3 E;  2JP3 A;  3D71 A;  2FYN C;  4Z1M H;  2WSE J;  3ABV C;  3AED C;  4IL6 X;  3GF7 A;  4H44 D;  3D70 A;  2ZT9 B;  4PV1 C;  3AE4 C;  2E76 C;  4H44 B;  3Q5R A;  1KTM A;  3AE8 C;  1HF9 A;  3S9O A;  4YXD C;  1OW6 A;  1ZME C;  1K05 A;  1NYH A;  3LW5 J;  4OGQ D;  4H13 D;  2E74 B;  1DD3 A;  1S1C X;  3B71 A;  1HJ0 A;  2E75 D;  3GLM A;  2JO1 A;  4OGQ B;  1UIX A;  4TT3 H;  4H0L B;  2QSI A;  2WPV B;  4H44 C;  5KLI C;  1PL5 A;  1MKM A;  2BEQ D;  3GMA A;  1GMJ A;  1KMI Z;  2MKV A;  1KQG B;  1VF5 B;  2ZT9 D;  4I7Z B;  1DIP A;  1OW7 A;  1ZP0 C;  2YIU C;  2G8Y A;  4R4L A;  4OGQ C;  4H13 C;  4KT0 J;  4GDO A;  2E75 C;  1TU3 F;  1YQ3 C;  2E74 D;  2OQQ A;  2QJY C;  1ZRT E;  2H89 C;  1EXI A;  2D2C B;  1OW8 A;  3IN6 A;  3AE9 C;  4H0L D;  3D6Z A;  2P10 A;  4R4M A;  1WMK A;  2K9Y A;  3Q2Y A;  2O01 J;  3Q5S A;  1Q90 D;  1K04 A;  2ZT9 C;  3AEC C;  4U7J A;  1KOR A;  2WQY C;  4RKU J;  4XFJ A;  3AE3 C;  2FXP A;  1VF5 D;  2WSC J;  3FGA D;  3H25 A;  3AEG C;  1R8E A;  2WSF J;  1DD4 A;  2QJK C;  4YTP C;  3AE2 C;  2E74 C;  3D6Y A;  1U57 A;  1PIX A;  1YQ4 C;  2J5U A;  1S5L X;  3C8V A;  1RQV A;  3SFD C;  3Q3D A;  2QJP C;  5M1B A;  4H0L C;  3SFE C;  3AEB C;  2QIW A;  1IK7 A;  1JB0 J;  4PV1 B;  1RQU A;  2D2C D;  3AE6 C;  3T97 B;  2E76 B;  1ZOY C;  3O6Q A;  1VF5 C;  4I7Z C;  3EWK A;  5L8R J;  3Q5P A;  3AEE C;  3AE7 C;  3G9R A;  3R4Y A;  1OMI A;  1AJY A;  2NZ2 A;  3RL0 g;  2G3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...