4PV1B

Cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
pubmed doi rcsb
molecule tags Electron transport/inhibitor
molecule keywords Cytochrome b6
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4pv1B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4pv1B01
4IL6X 4RKUJ 2O01J 2QIWA 1JB0J 2ZT9B 2WSEJ 4PV1B 2WSCJ 2QJYC 2K9YA 4OGQB 2E75B 2E74B 2QJPC 1VF5B 4I7ZB 2WPVB 5L8RJ 4H0LB 1Q90D 4H44B 1ZRTE 2WSFJ 3C8VA 2YIUC 5KKZC 1S5LX 4Y28J 3LW5J 4H13B 2E76B 2QSIA 2D2CB 4KT0J 5KLIC 2QJKC 2FYNC
chains in the Genus database with same CATH superfamily
3WG7B 1FD9A 2B1GA 2GUVA 1AJNA 3EQ2A 2POHA 4JI0B 1VQ4P 1L4AC 1GMJA 2Z0AA 1N2DC 2FYUG 4DUZB 4DR3O 2ZAEB 4IYIA 1LTJB 2UXDO 1Y6XA 1IBLO 1N4CA 3B77A 4LF9O 3RVYA 2ZFCA 2WSSH 4JI7B 1MABG 4M3LA 2M3BA 4JYBA 2V4HA 3BA9A 3H1JD 1NTKG 3OJAB 3II6A 3I56P 2ZXWB 1A02F 3DXRA 4PDMA 1NQTA 4TUYB 3NR7A 4PD4I 2HLOA 3H01A 4DV1B 5EBMC 1AR4A 3CXHI 3ABLC 1NH2D 1MFZA 1XREA 5K1XA 4GKKO 4DV6O 2KZIA 3CCQV 4HKZH 3AG3B 4HZ3A 4DV4B 2PRRA 3ABUA 4TWKA 3ZBHA 5GTHH 1RF1B 4LCUC 1MV8A 5CBHA 1SQVJ 4DV7B 1JR9A 1WB8A 4WFEA 5CBGA 2IBZE 4CBCA 2QKAA 3JARA 4J10A 1GDTA 1BDCA 3OD4A 3ZS8C 2F95B 3LW5J 3AEGC 1YVWA 1SQQK 4DR1B 1FC2C 2XNXA 3J81N 1K9MQ 2FYUE 4CS4A 3D3QA 2JEUA 3AG4C 5L3BA 3IJ4A 1PL0A 2DN9A 4PV1B 3AEFC 2R9IA 3SJCC 5LMUB 4G27B 2ZVNB 1L0LJ 4NXNO 2YNYA 3ABLB 5HFLA 5K1PA 1MMMA 3TCUA 3ICXA 4JI4B 5H2FZ 4QPKA 1LWUC 4LWSB 1CEZA 2B87A 1EDKA 2E76B 2M6YA 4DR4B 2OWOA 1AJYA 1LP1B 4BRYB 4ZKPA 3MZWB 1VQ4V 3BVHA 2F4VO 3H1IJ 4LH7A 1NU1K 5LYJA 1YYCA 2QDOA 1WA8B 4U3FH 3SGIA 3CCQP 1B6QA 2FKXA 3WMM0 3S4RA 3BY6A 1UJWB 4LF5O 3L37A 1YITV 2IZ1A 2IH3C 2KQXA 2Y0CA 2A7WA 2AEFA 4U3FE 1IFJA 1DTOA 4JI2B 1S72V 4JI5B 2CUGA 5LGTA 1JY2P 2QE7H 3K9AA 1DK1A 4AUWA 3H1HH 1IXBA 2P58A 1GU4A 2QM8A 1BCCG 2Z5UA 4GLXA 1ZSPA 2DWEC 3GMAA 5KAIZ 2JGDA 3IC7A 4DCKA 1IZ3A 1W2BO 1Y76B 1CSBA 2Y0IA 4PJ0H 4RESB 3E89A 3KQGA 3F89A 3QWOC 3NTNA 4NTXA 2Y69B 3AG2B 1JB0J 1L0NH 4FPPA 4BIUA 1Q82W 4KUMA 3H1JJ 2YICA 1XBLA 3ABMB 5TISE 2OYHA 3A3YB 1UIXA 3HE5B 2EIJB 4AYCA 1VQKP 1QVFO 1BT8A 4FLVA 3PH0A 4JF3A 4EI2A 1EXIA 3MIWA 1AJQA 1WAZA 5LXTA 4B3SB 2D2CB 2H94A 2EJRA 4LF7B 4Z1VA 4PD4D 1S5JA 1S5LH 2NPSD 2F66C 4I50A 2HP8A 2JVDA 1VF5C 1VQ7V 3EWKA 4EDFA 5LP6B 2BTQB 3G6EV 2EINC 2Q69A 4J7JA 1AV1A 1KP2A 1Y9BA 3QVNA 3H32A 1BCCE 2KB7P 4X65B 5EC1C 3OGCC 2QWPB 1LT9B 3JD3A 2B9BA 2BSKB 2EILB 1FXHA 2VRZA 2WPDG 1KBHA 3SFDC 3G67A 2VQEO 5EK0A 1OCOB 1JY3P 1VQMV 1S0VA 4J7KA 1PPJD 1Q81Q 1LP1A 3CMEV 3STLC 5B3SC 1I5XA 4HYOA 3VMAA 1GU5A 4IIJA 2KG7B 1M1KQ 2YO3A 3J7AU 3RK2B 2YC0A 3RBZA 5C8YB 2P2UA 5AVQB 4WBAA 2K1EA 3BPZA 2D2CD 1T6AA 1X79B 1HJBA 2NRGA 2PY5A 2E74B 4X62B 2UUAO 2ZINA 3LIEA 3ZEDA 3UCSC 3TETA 4FLUA 3CJHA 3JATA 1CI6A 1H2NA 1FFXA 5GTIH 2QWQB 2ILMA 1IK7A 3JSVC 4LWSA 2B87B 3K08A 4OGQC 1BGYJ 1FOSF 2DQ0A 1K92A 1ORQC 2ZE5A 3JCZA 3CC7V 3V4QA 3NMDA 4AILC 1A02J 1AVMA 3QF7A 1JOYA 4FLWA 4Y99C 2E76C 1R5SA 3CYOA 3QTCA 4UB8Z 4JI3O 1P84F 2UXCB 4RUEA 1N34O 4LLHA 3ZHRA 2OYIA 3L70H 3L73E 4X1KA 4IIJB 5CB4B 1AP5A 2QEXV 2OCHA 2PYJA 3VQVA 3SPGA 2VWJA 1J5EO 2MW2B 2GDSA 1N8RW 1NTKD 3H1KG 2OCCB 2PP6A 1X0TA 1IBMB 1YJ9V 1QLEB 4K3AA 1J95A 3D36C 3RK3D 2W83C 1SQXK 3CCLV 3HUSA 4J9ZB 3KHUA 1HNWB 2KYVA 2ZXWC 1KFNA 1OWAA 3CCUP 2QJYC 1YEWA 2WA3A 4YIPA 1SZXA 4LH6A 1S9KD 4GKGA 4DR6B 1K5SA 2P6JA 4EYYQ 3BRTB 2BCCH 1Q2NA 2P7JA 1PNLA 4JI1O 3R65A 3L74H 3CXCU 1OZ0A 4PJ0E 4Y28J 2AEJA 1G8MA 3K06A 2FXOA 4HBNA 2Q6AA 1NU1J 2WLLB 4X66O 3J80N 2O1JA 2BCCE 5CN0A 1NTZH 1TUEB 1ZUQA 3AG1B 4Z1MH 2UXDB 5JH7A 3OE7G 2M8RA 1VF7A 4I55A 1GKFA 1SQFA 3JALA 5TISH 1K34A 1KILA 4IL6H 4H13D 3APQA 3ABKC 5LHHA 2WSCH 4TSFG 3TJTA 1SQPD 1RP3B 4RJTA 3CS5A 1KTMA 3JD2A 5APXA 3CX5D 3RYHB 2EIKB 4FZ0A 2A0LA 2HHHO 3JSNA 1W59A 3LDCA 4JI0O 3H1KD 4U7NA 1VQNP 1H2MA 1GN6A 2Q8VA 3HKBB 2H7HA 1T3UA 1KZUB 4UB8H 5KMGB 3T97B 3UO3A 3ZCCA 1E79H 2OQQA 5DJTB 2CTPA 2QEXP 4DT0A 4K8XA 3L75D 2FYUJ 5CMUA 3QG5A 4DR1O 3VYIA 3B5NA 1L8DA 1LTAC 3H1LG 3CP1A 3CCVP 5AW1B 4JI6O 4H13B 2OYHC 3K0DA 2AHYA 1KYOF 1AP6A 1JFFA 4G28B 1Q6UA 3D71A 4LFAO 1RE3A 1JJ2U 1L0LK 1GW3A 1YQ4C 1IFNA 4DZOA 5AW6B 3D36A 5APYA 4H44C 1LGHB 4DV0O 1AFOA 4JPRA 4RQFA 2Q0OC 4AQYB 2H88C 5B3SB 2Q6QA 3H1IE 1IBLB 3B2EE 4HNAA 1K73Q 4YJ3A 2E43A 5IJ0A 2YIUC 4I50B 5AVVB 2C0WA 3JD1A 1R6KA 4RO0A 4YIOA 2W6IG 2JWAA 4IFMA 3ETDA 1R3KC 4QMAA 3OGIB 1NTMD 4DR5B 1HR0O 4JGSA 1OCOC 2ADPA 3MDSA 3L73J 3EXAA 2A45G 1OMIA 1L0LD 5BXZA 1GTWA 2IYPA 3SPIA 3K59A 4GODA 1S9KE 1Y67A 2IFNA 1FPOA 3O9OA 5CA0A 4GKKB 2WT7B 4LR3A 4I55B 3CMAV 1L0NJ 1V54B 3C3SA 4O2AB 1LWUA 2N04A 4DV2O 5KLVH 1VQ9P 1XHXA 1ROPA 1IFPA 3L72D 3H1JG 1BGYH 3F5TA 5FNVB 1VQNV 3H1HE 2IFMA 3MHVA 1SERA 3RK3C 4BIOA 4PV1D 2F4VB 1FZCB 1X22A 3G6EP 1YI2V 2VQEB 5DN6G 4JZGA 4H0LD 3H1IG 1OJHA 2X0LA 1VQ6V 2Q67A 1YTZI 5AVXB 4JYAB 5CCGC 1N33B 1BHBA 5AW4B 1FKAO 2JDIG 4WBNB 5J2TB 1YITP 1WA8A 1GL2A 2N1TB 1RFYA 3T4ZA 3CXHE 3G9RA 3HE4A 3QO8A 3S3WA 2XKMA 3TSIA 1U96A 1U97A 4KFMA 1NTZJ 1VF6C 1BCCJ 4FM0A 5KLVJ 2MK3A 2XOKG 3K03A 3KZIZ 2A06E 2XAQA 5KLVK 2QVAA 1PM9A 3CRRA 3B8NA 1KQSO 1VMGA 3RYCB 1ENVA 4B3RO 1G2CB 5C93A 1P7GA 2HR3A 2W6AA 4MVQA 4L8JA 3H1JE 3ML0A 2K1AA 1K4CC 4JI2O 5LP6A 4JI5O 5CHXA 3A2FA 5AW2B 1F4MA 2AXCA 2HG5C 2Q7CA 1CW5A 1EFRG 2P06A 4B7EA 3HTKA 3KZIH 2CE4A 2QM7A 3AE5C 4FFKA 4FVMA 2Q73A 2Y0EA 3ZHUA 1WT6A 4JI3B 4HJGH 1NU1E 2Q4PA 1HNXO 3L70E 3U1CA 5APQA 1FFXB 3L9DA 2UXNA 2UUAB 4B08A 2FYUK 1MOFA 1L2PA 3CPWO 4IFFA 5KHJA 1NVOA 1BQ0A 1FU1A 4H0LC 5J9PC 2BOCC 4DK1A 4FJCC 4D6TD 2DYSC 2CPBA 3SYOA 3SWFA 4JAVA 2HKOA 3EVKA 1NTKK 5JCOA 3LSUA 5JH7B 1IVSA 4JASA 2R3SA 4J42A 3BRVB 3L71D 1R5LA 1FZBA 3CWBD 2P1JA 1SQPJ 1N32B 1DD3A 3E22A 1VQ6P 2YXLA 4LF7O 1XNQO 3JASB 1MZ9A 5H6QA 2IBZG 2QJPB 3SFEC 4FMTA 4H37A 4K0KO 2E74C 3CMEP 3LNNA 3CCEP 2DOSA 3K04A 2ADQB 3N2GA 2Q3IA 3TGUJ 4ZKIA 3SYQA 3L72J 4UVBA 1XMQB 4JYYA 3W67A 1H8HG 3RW0A 3M8AA 1VQOV 2HYNA 1ZMEC 3G3ZA 3L70G 2G3AA 2FYZA 3SPJA 3AK2A 3WUTA 5IDJA 4LFCO 2WMMA 1ZLLA 3BA8A 3CMAP 5KAIE 4DOJA 4JV5B 5LP6C 4BRYA 2HLDG 5CB4A 4WFBV 1XHZA 5A9GA 1SA0A 3BCCG 4IGGA 4ZI7A 3RBXA 1NT2B 2KXPB 2LQTA 1S5LE 2KZJA 4JYCA 1JCDA 2X6BA 1HGZA 4H33A 2ZE7A 1H2GA 3KCXA 2FXMA 5JQGA 3W7UA 2JR8A 3F7YC 4Q6GA 2QJ1A 1NU1H 4NKGB 3GVMA 1SQBH 2YIBA 2JO1A 3C3TA 1F51A 3KCYA 4XDJA 2WPQA 4CH6A 3D6YA 1JVMA 1SQVK 2KS1A 5JJNB 1OFCX 1ZR2A 3AE2C 3H6PA 1SQPK 3P8CE 5B1BC 2ZJSE 1KQFB 3ABKB 1SFCA 1SQXG 3AG7A 3JCUZ 1RF1A 2ZT9B 3A2AA 2O3JA 4FIPC 5AVUB 3TYYA 1RPOA 2FBWC 1SQBD 2KNCA 4WY4B 2FKWB 2XUMA 4I4TB 1NJIQ 4PELA 4L75A 2OTJV 1NU1D 3K5LA 2IH1C 2JS3A 3AE4C 1M5IA 2GHYA 1YI2P 1V54C 1L1FA 4DR3B 2WLMA 2RMKB 1VF5D 3O6QB 4W7ZA 3V6IA 3H1LJ 2LFSA 4JAAA 3A0BZ 4DO2A 1KKCA 3ETGA 2Z5IA 3E1RA 1JQ0A 4EFBA 4JTAB 5CJ4A 1HF9A 4BXLA 1I5YA 3K5NA 3SYCA 1K8AW 2AZ0A 2WZ7A 1WPXA 1VQ8P 1ZN5A 2K37A 3AEIA 2ZR3A 2YKPA 3JCUE 4Z2WA 2Q0AA 3OT7A 3SJBC 3H1IH 1KB9D 4LFAB 2Y4UA 2Q9LA 1R6TA 5L3DA 1YTZT 2ZD9A 2KIKA 2C2AA 4X66B 3HD7A 3LIDA 5H9CA 1YTFD 2N1TC 4A5UB 5LHIA 1R8EA 3KYQA 4GCZA 2Z5HA 3X2QB 1X9VA 3OM3B 1GM9A 1QR9A 2EIMB 2ITAA 3CB2A 2QM4A 4WBNA 1PIXA 2Y0DA 3D6ZA 2KKWA 4DUYB 1RQUA 2FYUD 4CC6A 1MFTA 2P7TC 4R4LA 3L73G 2NN4A 4DV3B 1NVPD 4JI8O 3H1KE 1IDSA 3VOPA 4C46A 1OCRB 2UUBB 1LTJC 1OW7A 1KP3A 1PGOA 2QWNB 3NXSA 3W7XA 5EBLC 4DW1A 4ZIBA 1YJWP 4JAUA 3F7VC 2Q3EA 1L0NE 3L74E 1H8AA 4TV9B 1EQ7A 2AXTH 4DR2B 3L75E 1SKVA 1VQ5V 1L0LG 5IY5C 2WSCJ 1SQVD 1RE4A 4IHJB 3LDDA 1J1DC 5E79E 3IGAC 1IC2A 2A9HA 2W90A 2ARHA 2R70A 4DRXB 2FTKA 5KJ7D 3Q5RA 1ZWIC 2JJLA 4F4LA 3JC22 3FYEB 4NYKA 3UT5B 1SQQD 1HVVA 2YMKA 2Z4EA 2JGUA 2K88A 2YUAA 3IR9A 4UVCA 3P8CD 3CRQA 4DK0A 4NTYA 1SQBJ 1YIJV 2B9ZA 2QTSA 1R3IC 2VQFO 1SQVE 5GONA 4NPDA 2WWWA 1GM7A 3P32A 3L35A 1G2CA 4N21A 4WFFA 5B1NA 3N2KB 3B5ND 1RF0C 2GBOA 2M5AB 3HKDA 1N7SB 2YSUB 1BSHA 1PV0A 2JK5C 3DC5A 3C9IA 3KPEA 4UXNA 3E2EA 1S5LZ 5JWPA 1ZRTD 1L0LE 4O2BB 1VQ5P 3EFFK 1W0KG 2WA4A 5LOVB 1DD4A 2K9JB 4MTXA 4FM2A 1AR5A 1OCZB 1KKDA 1PNKA 4B3MB 4X8AA 1PV3A 1Q43A 4WCEV 1MSWD 4ZMDA 3AG1C 4WFGA 1VQKV 1P84D 1AI5A 4PA9A 1VPCA 3AEAC 5FPOA 5TISZ 3MUDC 1Q90D 4GZRB 4QIWF 1RPRA 4TUYA 3ITKA 4X20B 1RY3A 1BCCD 1NTZK 3JASA 2RNBA 3Q2YA 2ZYDA 4GX1A 2RH0A 1QNMA 2Q5ZA 2H3OA 2HODB 5APTA 1NTZG 5APSA 1DGSA 5KLVG 1M56D 2B89A 1PPJE 2O01J 4F6RA 3B4SA 2WT7A 3PTZA 3UM7A 4IHJA 3PRJA 2CPSA 2LXCB 2WTYA 5CA0B 4PHZA 3SDLA 3BCCH 3V2QA 1G1IA 1N32O 1OHHG 2AW9A 1KILE 3PHLA 4O4JA 3M7MX 2JWDA 3RK2D 2IPPA 3W68A 2M7WA 3MD0A 4X1IB 4WY4C 3IFMA 3RGUA 3H1LE 4EB6A 2NR5A 1L4AA 1PGQA 2WLJA 1Q6IA 2RMZA 3LW5H 1Y47A 3H1ID 4WFAV 1N36O 2WSFH 4YY3O 1KQSU 4OGQB 1EDLA 3M9HA 1VQ7P 2NPSB 3CCMP 4ZOLB 1P84I 5KLIB 4GX5A 3H1HG 3CHXA 3I5CA 1NTME 5KKZC 4C7NB 3B40A 5JCOC 1WB7A 2LFRA 4KHPO 1FJGO 4O2BA 1M56C 4DXWA 4GYCB 2R5BA 3OEHG 4WFHA 1HUCA 2J5UA 2C0XA 2H8PD 1XUQA 1WRGA 2PYLA 4GX0A 1H8EG 4D7TA 5KLVD 1N8RQ 3MP7B 3ZDMA 1N0NA 2FYUH 2W0FC 4ZHQB 4MSWC 5TJHA 2KNCB 3AEBC 5E79Z 3CC4P 5KX5B 2E75B 3E83A 2JJ2G 3JYCA 3APOA 1JY3N 3H1HD 3CCSP 2OYIC 4GKJO 2GSMB 1GL2C 3QNEA 3CWBH 4W7YA 4MVSA 2BTOA 4JV5O 3U10A 1YJWV 4ABMA 1OVVA 1HNWO 4I5SA 2A06G 5D5PA 2E74D 4WWIA 4ASWA 1DEEG 1FS0E 1JTHB 1NKZB 1D5AA 1TGOA 3GB7C 4K0KB 2ZDIC 4DRXA 1F23A 1SFCC 1P84E 3BCCJ 4R6ZA 1OCRC 4B86A 2Y48A 3AK1A 2HFEC 3G6BA 1YJNV 4RWUA 1N0JA 3B5NC 1FXVA 2RJZA 3HB3B 1GRJA 4YHHB 4AI8A 4LF8O 1HTLC 1NU1G 1M1JA 1O9HA 1M8OB 3C90A 3FFQA 4XFJA 1X4TA 2IDBA 1BE3H 1JCHA 1GK6A 1KU9A 2ZIMA 3CSXA 4YJ2B 1RM1C 3QH9A 1H2KA 1BE3E 3T4DA 1H88A 1PP9H 3ABTA 2ZNJA 1VEWA 5LMUO 4HNAB 2RCVA 1Q81W 2QTOA 3K9SA 4X1YB 4NXNB 2YIUB 3L75H 2HG5D 2O57A 5GTHE 3K5BA 2ODMA 4A7PA 2HPCA 3ASNB 3A0BE 4UCSA 1XQ8A 1FS0G 5LOVA 3ZRXA 4FLXA 4L73A 3H1KH 1Q82Q 1RF0A 4UCRA 2UUCO 3H1LD 3L36A 1Y8AA 1WPBA 2W27A 4PDLA 2N05A 5KAIH 3E8HA 3WB1A 3DGEA 4X1KB 4MVUA 1GK4A 1S2EA 3FWNA 4ZNCA 1JO5A 3BRCA 4UCTA 4OVNF 5K5GB 4MVZA 4I9QA 3T1HO 4N78E 1VQLP 4RQEA 2XU6A 2IJIA 2WPVB 5LA6A 3RYFB 1T2KD 3CWBG 4MTOA 1BE3G 1AI7A 5KAFE 3M0DC 2QSIA 3HKEB 2IBZD 1NTMK 5IJ9A 2EIJC 1RE4C 5KKZB 4LF4O 4U7OA 1ZV8A 1L0LH 5CMZA 5H2FH 4I4TA 2BCCD 2LP7A 1M1KW 3P7KA 1YQ3C 4MT8A 2VS0A 5IYZA 4ZHQA 3AE7C 1RSOB 1G6UA 4MVRA 3AE9C 1YTFB 1DLBA 2OIGA 1I94O 1IX9A 3VTPC 1S77D 2GUZA 1ZOYC 2UXBO 3WU2Z 5APVA 2GTAA 1KECA 1S5LX 1SC5B 2KS1B 1CP9A 5JJEB 3FXDA 2P22C 2R9RB 3BCCD 4C7RA 2CK3G 3SJQC 3WFVA 5H6RA 1EDIA 3U0ZA 4NPEA 4NPFX 3HTKB 5AW8B 1ZTEA 1Q8IA 2W6JG 5BZBA 1K05A 4BWNA 3A0HE 5J2TA 4PI0A 5GTHZ 2E76D 3SWYA 5JJJB 1FZCC 1P49A 1OIPA 1HP8A 3HKBA 4QE9A 4DV3O 2F43G 2LGQA 3M99B 1TVKB 1XI1A 1L4AB 1NTMJ 3OMIB 1KD1W 2WAMA 5LBQA 2UUBO 2F93B 2L91A 2DYRB 5FLXN 1BE3D 1Z56A 1GO3F 2GM4A 5L3GA 1FOSE 1RF1C 1YZBA 4JQ0D 1P84H 3N7NA 2VQFB 2YI9A 4IL6X 1SQXH 1M9NA 4TQFA 3HE5A 1VL2A 3KXDA 1TVKA 1USDA 4UCOA 1D7MA 3M9BA 1URQD 2WQYC 1JY3O 1SS3A 5EZYB 1IBKO 1EZVH 2LXBA 4BW5A 3G4SP 2AHZA 4X65O 2LGWA 3BVOA 1ZL8A 1M90W 4TV9A 2KSJA 3SWKA 4B3RB 1Y76A 3ASOC 2E3CA 4DYLA 3ABMC 5FNVA 4I9WA 1US6A 5IJ0B 2A3QA 3CL3D 4AQRD 1NKDA 1WP8A 1USEA 2K3RA 1SRYA 1K97A 3MHSC 1GTOA 1MNGA 1FJGB 4KHPB 1GAXA 4N78D 3SJAC 1SQXD 2YXRB 3TXQA 5KA6A 2FXPA 3CCLP 3CXHF 3JAKB 1MSDA 1HNZO 1OW6A 4H13C 3H25A 1OCCC 5GW7A 2OYOA 3A0HZ 1QHTA 2WLKA 1J5EB 1KN7A 1JFFB 2P67A 1BGYG 3JAWB 4D6TH 3ZRSA 3HD7B 4CH4A 2LJ2A 1NKNA 3VMYA 1IO4A 2Q68A 2EILC 4I7ZC 4W4KA 3HKDB 1N7SA 1X59A 4O4HB 2UWJE 1SFCD 4TLFA 1A32A 1X8YA 2QKSA 2RN9A 4UB6Z 5APWA 1TUBB 3SPCA 1KUQA 5KX5A 1QBZA 1THZA 1N34B 5KAFH 1XNQB 2DJVA 1RQVA 1FJKA 3UO2A 2CAZC 3WB2A 5LMNO 2IU0A 3UKMA 1L0ND 2Y4TA 2PUSA 2E5TA 4KHXA 2YIAA 1QVFU 1B3QA 5IWAO 1HWYA 3HE4B 4GT1A 1L0NK 3A0RA 3FB6C 3TGUG 1LNQA 3N27A 1XTCC 5KUKA 1GH6A 1GL2B 2W6BA 1QVGU 1BQZA 2ZE6A 3H32B 4BW9A 1I7FA 3L75G 3CRMA 2QA4V 3HKCA 4LNUA 2PI4A 3FB5C 3MHHC 4JZ2A 1N73A 1KB9F 3C8VA 1YHQV 2IM9A 3CCMV 4YTPC 3VQXA 2B1IA 1FYJA 5AW9B 1K73W 2EINB 3A7OA 5AVSB 5BVZA 4J80A 3TGUD 5EYPB 2P4VA 4YXWG 1G4YB 1JX9A 4YHHO 3G80A 1QVGO 1N73B 1Q6HA 5B5EZ 2ZDIA 1ZW0A 2DYRC 2D2CC 2A45I 4O2AA 1GZLA 3B8EB 2QJKB 4HYTB 1OXZA 4TT3G 2C9LY 1XNRO 1B04A 3KG2A 2WSFJ 4D6TE 4JI6B 5LYJB 4TV8A 5DECA 1Q5OA 3MGNA 3TGUE 4P9OA 3TXSA 1VIBA 4DR7O 5KLVE 3QO5A 5EC2C 2Q5UA 2PI5A 3IF4A 3E86A 4HH2A 3GWOA 5BR8O 3L71E 1XOUA 1CI6B 4PA3A 3RT3C 2N1TD 2I1JA 2R5DA 4QJFB 3GF3A 1KYOD 1NO4A 1O9GA 1EDJA 1YSCA 4I0XB 4CS2A 4DR4O 3FX7A 1M90Q 2UUCB 4LF8B 1M56B 4OWFA 1JNMA 2IW5A 4BR6A 1SQGA 2AGAA 4RAIA 4TQDA 2JJ1G 5HFMA 4JTCB 2UU9B 2DQ3A 3MUDA 3A0BH 2R72A 2KP8A 4W80A 1T8ZA 4X88A 3CWBJ 2E75D 4HB1A 2IBZH 4I1LA 1V55B 1BE3J 4DR6O 3ZHQA 1KYOE 3JARB 2SPZA 1VQ8V 4XBFA 2QA4P 2Q7HA 1QX8A 2FB5A 1FXKC 5IYZB 4DV6B 2YI8A 1YBKA 4D6TG 3N4XA 2XZRA 2JIZG 2A79B 1AROP 3CI9A 5AVTB 3SSUA 2KSDA 5C8YA 3AE3C 3CC2P 4B7KA 1EBOA 3ZMUA 4DV7O 1JTHA 5CJ0A 4LF4B 3SR2C 2ZR2A 2YKOA 1GL2D 1VQPV 5GTIE 1EZVD 2OTLP 1ZAUA 5LL6Y 1PPJH 4WVZA 1FXKA 3D70A 2FMLA 1I94B 4PA7A 4U3FD 1N7SC 5KHGA 2YEVB 1XILA 3VN0A 1OVRA 2V7QJ 3LUTB 1W0JG 2WVRA 4B3TO 4KP4A 2L5GB 1NR7A 3L73H 1NWQA 1BMFG 1Y74B 3T1YB 4ASVA 2JKVA 3TGUH 2L35A 1YJ9P 4UV9A 4LF6O 3RK2C 2OT5A 1NH2B 2EBOA 2XAJA 1K04A 4EIJA 1NTMG 1LT9C 4KJMA 1ZX3A 2EZPA 2QJKC 1N7LA 2PZSA 3LSSA 2R3CA 3Q1MA 2HPCB 3OAAG 3KKYA 3JAKA 1VF6A 1PNMA 4J41A 1GMGA 1QU7A 5EZYA 4I0XA 1WP7A 2XT9A 2BTQA 4GIFA 1J1EC 4KXRA 4YXDC 2JDIH 2YIDA 3HUSB 1R1BA 3CCUV 3FXEA 3IAYA 1FZAA 1PKXA 1PP9G 5KJ7A 4JPZB 4N6JA 5F2VO 3GW6A 1IFDA 1FZCA 2R32A 1HW7A 3ZMTA 2GTSA 1SETA 4DV0B 3RL0C 3L72E 1EZJA 1KYOH 1PD3A 1SQPE 3JD4A 3OMNB 4YJ2A 3A5TA 4TT3H 3FB8C 4AQYO 2LKMA 1IBKB 4MW3A 5BMVB 1FZEA 4QGPA 2OYHB 2OYIB 3Q5SA 4IFDK 5AW7B 1VARA 2DMXA 5FL7G 2OTKE 4UVAA 3RVZA 1QLEC 2YEVA 3ZJZA 1QLNA 5E79H 5KMGA 2QR4A 3L71J 1BCCH 2VWKA 1CXZB 3WB0A 1GN2A 1YCIA 1M57D 1BDDA 4LP8A 3I55V 3WU2E 1Q3EA 2HVJC 5AW3B 4UCVA 2BEQD 1IXMA 4NXMB 2RQ6A 2YO2A 1KILC 5CCHD 2LW1A 2PGGA 2QSAA 4O4IA 3G71P 4DV5O 3HKCB 1GK9A 4LNUB 3HD7D 3CC2V 4QPJA 1XL4A 1TUBA 2QG4A 1KD1Q 1Y66A 3KDPB 1Q7YQ 4MN4C 2Q9IA 4U7JA 3BASA 2G8YA 4FLYA 2FFDB 1NH4A 3SPHA 1FAVA 1SQPG 2Y9ZA 1K7DA 3B8MA 2YXYA 5KHKA 1KYOI 3VMZA 1ZR4A 1AQ5A 3CX5E 2E5YA 2WPSA 2EIMC 2XAGA 3M0AA 1R6NA 5DM6V 1KILD 5CCHC 5CBNA 3PJSK 4B3SO 3HR0A 1M57B 2BSKA 1SQQE 2JEEA 1JA8A 1URQC 2FFDA 3ZN1A 4FM1A 3FD9A 5LMNB 4PD4F 4CZZA 1NBMG 4P30A 3GLMA 1SQQH 2Q7EA 4UV8A 4DW0A 4F6EA 1MZFA 3M91A 3OA7A 3K57A 2G38A 4LBEC 1E1QG 1IK9A 1QGKB 2DW3A 3CCRV 3EFGA 2W6JH 4EKWA 4IT5A 4ZI7B 2DW4A 5EIBD 3CCJP 4PDVA 4CC5A 3HKEA 2IJHA 1XL6A 3GF7A 1KB9I 2OTJP 1ZL8B 2X6AA 1H2SB 4NVPA 3RYIB 3IAOA 2ZXEB 1KQLA 5AW0B 2YIBD 3K0GA 3GHGA 2YXHA 5E1AC 3E1IA 1LTTC 1FDOA 2X6CA 2UXXA 4EEQA 5AG2A 3HPLC 1W5CE 4RO2A 1BS3A 3DXRB 3OMAB 1S5HC 3R4YA 1LTBC 2NZ2A 4LFBO 1AA0A 1T5EA 3FYIB 4X20A 5H5NA 1COWG 1MUUA 2QIWA 4ASUG 5EFWB 2PFXA 3RL0B 3BAAA 4L87A 1RM1B 3BHPA 4L74A 3CLQA 2AXTE 3ZRWB 5B5EH 4UB8E 1SLQA 2W8ZA 1U7MA 3TF5A 1IZNB 1DF5A 2UXCO 2V7QH 1HGVA 2K9JA 4GOFA 1SQPH 1AB3A 3RFRA 5BR8B 4XA4A 2ZM6O 1EN5A 4PA4A 1NR1A 1QCEA 2KG7A 1KFMA 3JD0A 4DUZO 3AG4B 2NNUA 4Y99B 1K3EA 3L74J 1NTKJ 1NZ6A 5BY1A 1R3JC 3T1CA 5APUA 4X9QA 3HD7C 4QNHB 2XDJA 1SZTA 2UU9O 4CPGA 2K9YA 3UIAA 4JI8B 2O1KA 1KMIZ 1QQCA 1YHQP 1SQBE 4H0LB 2OCCC 4R4MA 3USSA 1JY2O 4DV1O 1QLED 3OTFA 2AXTZ 4EB6B 1M57C 3E8FA 2WITA 3VP8A 3Q4HA 2A06D 4JI1B 3D8CA 1I08A 1LTSC 1SQXE 4OX9B 4NR1A 1XMOB 2WLNA 3T1YO 1FE6A 2P4KA 2CH7A 4DV2B 2BEZF 1VQPP 2E5LB 4OXSA 2CDYA 4O9BA 2NPSA 4UB6H 3LNMB 3FGAD 2ATKC 5IYCO 2CGNA 5B1AC 1N86A 2CK3H 3RN4A 1XNRB 5CBFA 3M0DA 3N2GB 1Z5VA 3W7TA 1GN4A 5DEDA 1SQQJ 1XEQA 4R50A 2V7QG 1SS1A 1MZEA 3L70D 1N73C 1B06A 5IJ9B 3ABVC 1KB9E 3AG2C 2PGDA 2HEPA 3T1HB 1M7LA 2QWRB 1BGYE 3A0HH 4OPAA 3AE8C 2BE3A 3CRAA 1E1RG 2HJFC 3L72H 4JI4O 1BHAA 2I1KA 4G2KA 4IL6Z 1LT9A 1HDJA 3M9QA 2AEMA 1OCCB 5B5EE 1K5QA 4O4LB 4LF6B 3VQWA 5KUMA 2KB1A 1BSMA 3FAVB 5B1BB 2FL4A 3D3IA 4MVMA 4R7CA 1M1JC 1WMKA 1PZQA 1EM1A 4ICGA 3FB7C 4PJ0Z 5IYBO 3RWRD 1SA0B 1CZQA 2Y0PA 3S9OA 2WLIA 1LT1A 1YF2A 3P3NA 2HVKC 3ZHVA 2O01N 2L6LA 4OGQD 1FAFA 1FBMA 2XTAA 3FKSG 3Q4HB 1HR0B 4JTDB 2E75C 1AJPA 3UQ8A 1M1JB 4YPCA 2E42A 2KLUA 2QE7G 2RKLA 1WN7A 4YJ3B 3C1LA 3FX0A 2EZOA 1FZFA 4TOIA 2QGNA 3L71H 4J11A 1XTGB 2QJPC 5J2UB 3RL0g 2QWOB 4F6RB 5LGNA 5L8RJ 3TNUA 4LC1A 4Z1MG 1YJNP 4O4HA 1NJIW 4PV1C 3G4SV 3IFXA 1YDXA 1P4RA 2B88A 1L0NG 1F4NA 5CA3A 1KQGB 2MJZA 2KOGA 2BCCJ 3L71G 3O8ZA 1VQ9V 2IBZI 2XV5A 2NLJC 3CJHB 3JATB 4QE7A 1W2BU 3L4FA 4FLZA 3T2MA 4UB6E 3RGBA 1GM8A 1YXBA 2N1TA 5CBOA 3N2KA 1H38A 3L73D 5AVRB 4IYHA 1NTKE 1R73A 4PD4E 1SFCB 1UFIA 1JOCA 1NHLA 1CPYA 3IN6A 2WSSG 2KK7A 2LR2A 2ZIOA 3RK3E 1VQOP 3P30A 5IY5B 3CXHH 2KLVA 2NPSC 1R3LC 5GTIZ 1XDCA 3AK3A 1S76D 3P8MC 3OUFA 1EZVG 4GDOA 2LO1A 2IJJA 5D5QA 3CX5H 3WU2H 3MTUE 1XMQO 3OW2O 1K4DC 2CTWA 4FFBB 2GV9A 3P3PA 4MTFA 3OR7C 1KC8W 4O4JB 1JMMA 4X64B 5LA6B 5J2UA 4OPHA 4LFCB 1YIJP 4H44D 3AEDC 1URFA 3GHGB 5DJUB 1SF9A 1LTJA 1UPGA 4CS3A 3K3WA 4I7ZB 1F7YA 3JALB 2P90A 2ZT9D 3E7KA 5M1BA 1TAEA 2IZ0A 3PLNA 2ZE8A 3OEEG 4BIZA 1FZGA 2M0BA 1HNXB 3OFNG 2Q7GA 1AILA 1NTZD 4C7NA 2ZCEA 4HAMA 3CCJV 1J2JB 4DV5B 1NGMB 3ETEA 3L74D 3ZMVA 5AVZB 2F1MA 1LJ2A 1LTIC 2IJKA 5EBWC 2PF4E 3BCCE 5CA1A 2XNDH 3H1HJ 1I0HA 1KC8Q 4YY3B 3CD6V 4O4LA 4K35A 2YS8A 1H0TA 4X1YA 3OW2U 3S3XA 2ZNIA 1EZVE 1EN6A 4GX2A 3ZHSA 1DIPA 4H44B 4UUJC 2IYOA 5EYPA 1J1DB 4X1IA 1SVFA 1NTZE 3H1LH 2JP3A 1URQB 2F23A 3O65A 1KORA 2OYQA 1PPJG 5B1OA 1Q7YW 3EHBB 3CEIA 1EZVI 4U3FG 1JJOA 3U11A 2V1DA 3OR6C 4D7SA 1M93A 4RKUJ 2GUZB 3ASNC 2EJ7A 1N7SD 5C39A 1T3JA 1AQTA 1DX7A 4U3JA 1PGJA 2YKQA 2ZVOB 1U57A 4R8CA 5IYDO 1E79G 2ITCC 3RYIA 4ZBMA 1IBMO 2WSEH 2OGUA 3STZC 5FPRA 3T97A 4IL6E 4W4LA 1EC5A 1Q86Q 2CH7B 3L72G 2ZT9C 1NYHA 3L70J 3V4WA 5JVDA 2B5UA 4BAYA 1ZRTE 1WNSA 1AR1B 1D2DA 4FZ1A 1JMBA 1NS1A 2XAFA 2ZQMA 1FFTB 3OTOO 1JY2N 2OIEA 1SQVH 2D3OW 4WY4A 3AEEC 5KA5A 2H43A 1VF5B 4EOTA 2YDEA 4YXWH 2E5LO 1T2KC 5L3CA 1IJDB 1K33A 1Z5WA 4XE5B 1AVYA 4WF9V 4JI7O 2P10A 5AVYB 1G1XB 1PP9E 4NB5A 2ZKOA 2WLLA 1URQA 2FFDC 3CX5I 5KHHA 1S4XA 1JPXA 1E5WA 5CCHA 3WUVA 5JQGB 3MAQA 4PDRA 1HJ0A 3TNUB 4JBZA 3BEHA 4AHCA 2A45H 3HRNA 1JUNA 3CX5F 4DR7B 2R9AA 3K5OA 1OVUA 1SQXJ 2EX3A 2HHHB 1VP7A 3SYAA 5L3FA 2EIKC 1XMOO 2RDCA 3JSLA 2ZM6B 4DR2O 1LUVA 3ZMSA 2GA1A 3CCSV 1LTGC 5IE9A 5EIBC 3OUSA 3RYHA 1PP9D 5LHGA 3E22B 1DEBA 4PA6A 1NAFA 3W7SA 1SQQG 1ZLZA 2ITDC 3DSQA 5IT9N 5LXTB 1KB9H 3Q3DA 2VRSA 4BWAA 2DE0X 5B1AB 3RYFA 1V9PA 3L74G 1H89A 1AVOA 2WSEJ 1LR1A 2ZXXA 3CXHD 2BOBC 1Q86W 4U3JB 2JRIA 1MKMA 5ITZB 2FYNB 2WLHA 3ZIAG 2UXBB 3CCVV 4N23A 3RK3B 2JS5A 3ETQA 4FLTA 2DYSB 1M4UA 4K8ZA 3CD6P 1PL4A 2YXQB 1WJZA 1OZHA 2H8PC 3TDKA 2ZYGA 2I8DA 1FDMA 4DV4O 3Q5PA 1GW4A 1NOHA 3FWLA 2FYNC 2KI7B 4OH8B 1RH5B 3V2PA 2AZ2A 4LF9B 4D6TJ 4WB4A 4DUYO 5B66Z 1SQVG 3CCEV 1JCCA 2H89C 4DR5O 3W7WA 3CRCA 4XDKA 2HFED 3K5MA 4I2LC 4UFZA 4FFBA 1HBWA 1PFIA 2Y69C 1NTKH 3VP9A 4GOEA 2A06H 4MS2A 2XHBA 2MKVA 3K58A 1S3JA 2BASA 3HUSC 4KT0J 4B3TB 4N3YB 4OX9O 4IOIH 1S1CX 3B5NB 5BU8B 3ZX6A 3AG3C 1K9MW 2J58A 4L76A 4ZOLA 2JEXA 1OV9A 1RSOA 1H2LA 3H1JH 1V55C 4ZKUA 2DWDC 2XASA 3JAMN 2PTMA 3CWBE 3G71V 3KZIE 1VDFA 2WPRA 1DF4A 4RUFA 3WUUA 3RL0D 1BGYD 1W2EA 4LF5B 1OCZC 3ZMZA 3O6QA 2IU3A 4JYAO 3AE6C 1N33O 2CGOA 3F5WC 1EXJA 1MA1A 4XDLA 3V2RA 1LUWA 3JAWA 2P5OA 2WLIB 3K79A 3I56V 2Q1KA 5BU5A 4E2LA 1NVPB 5B66H 1AI6A 2IX7C 3R2PA 1SQBG 4JF7A 5ITZA 2XNDG 1FDIA 4PI2A 1KILB 1PP9J 4MVOA 4P2ZA 5B66E 2N9BA 1SQBK 2O01H 3WG7C 3E8GA 1UIIA 1HH0A 4MW8A 4LGDE 2HJDA 1N36B 4KL1A 1MG1A 4Q20A 1TA8A 1D5NA 4X64O 3A8TA 4P9PA 2RN0A 3F5HA 2JGDB 1SP4A 5KHIA 1JEKA 2GUSA 5KLIC 3I55P 1BZKA 1QL1A 5L3EA 2BCCG 1VQLV 1EN4A 1K8AQ 1GN3A 2Z3YA 1LWUB 3CC7P 4X89A 3THOA 1NAYA 1H0TB 2Y9YA 2W0XA 2OTLV 3U59A 1OW8A 4J7ZA 5CA1B 3H9VA 4NXMO 1QEXA 2QRXA 2K9PA 3QO7A 3CC4V 3CE2A 3R66A 1DH3A 1AI4A 3AECC 1PGPA 2X7RB 1BSNA 4CH3A 3CCRP 3S1KA 1U7JA 1WLEA 4TV8B 1IFIA 1P7BA 1ZP0C 4J9YB 4GKJB 1RE3C 5LGUA 4NTWA 3LDEA 2KUBA 5AVWB 1Y74A 1GD2E 3PP5A 2M5AA 3VOUA 1PL5A 3FAVA 4B3MO 3BATA 4U3FJ 1G1JA 3E8BA 3ZRVA 3AE1C 2C9NY 3BFRA 4FK5C 2FY8A 3RYCA 3BABA 2M3EA 2CTRA 3B71A 1JM0A 3VMXA 1BL8A 3H1KJ 1FXKB 2HODA 1QL2A 1RHZB 2N74A 3LSQA 3V2NA 4X62O 5JVDB 1NTMH 2LW7A 2XAHA 1IURA 1Z2GA 4WY4D 2OARA 5IWAB 1OX3A 3E35A 3I5DA 2R44A 5CCGD 2CTQA 3L75J 3TK1A 1Y4MA 4E4EA 3NFQA 4EFEA 1L4AD 1NI8A 3U1AA 4C7UA 5H2FE 5KAFZ 4MTGA 3ZN0A 3V5BA 1SESA 3GWKC 3PN1A 3ZHTA 4UCUA 1FJPA 5A2QN 2J59M 1ZXGA 3OTOB 2N9YB 3CPWU 1IFMA 4PD4H 2KSEA 5AW5B 5KTBA 2ZYAA 4DJGA 1HNZB 2YMYA 3VQYA 1JMKC 2V4DA 1J1EB 3GG2A 4GUNA 3ZRWA 3M06A 1TU3F 2EULA 3JCUH 3ASOB 2ETNA 4CH5A 5KJ7C 4LFBB 5GONB 1HWTC 3SYPA 1QR8A 3B09A 2PAJA 3OAKA 4O4IB 3DTUB 1KV4A 4I6MC 3GHGC 2QJYB 5BMVA 3DC6A 3VBBA 1S72P 3IC9A 3X2QC 3UT5A 1VQMP 2QKCA 5CCGA
chains in the Genus database with same CATH topology
3SFEC 3AE8C 3Q3DA 4IL6X 1NGMB 2E74C 3Q1MA 1VL2A 2O01J 1JB0J 1PIXA 2WSEJ 1OMIA 2D2CC 3IAOA 3D6ZA 1OW8A 1GMJA 2QJYC 1MKMA 1RQUA 2WQYC 4R4LA 4YXDC 1FDOA 1UIXA 1WMKA 1ZMEC 2G3AA 4H44B 1KILE 2WSFJ 3AECC 1DIPA 3S9OA 1EXIA 1OW7A 4Y28J 2JP3A 3R4YA 1KORA 4PV1D 4OGQD 2D2CB 2NZ2A 3Q5PA 4TT3H 1ZP0C 2E75C 2FYNC 4Z1MH 3GF3A 3EWKA 1VF5C 4RKUJ 2QIWA 3Q5SA 4H0LD 1PL5A 2WSCJ 1Y9BA 4OGQB 1U57A 2FXPA 2QJPC 4H13D 3AE1C 2H89C 1OW6A 2WPVB 4H13C 5L8RJ 3RL0g 3H25A 3Q5RA 3B71A 3G9RA 3SFDC 4PV1C 5KKZC 2JO1A 2ZT9C 3LW5J 1KQGB 2YMKA 3AEGC 1KTMA 2QSIA 1NYHA 3D6YA 2MKVA 2E75D 4KT0J 3AE2C 1ZRTE 1S1CX 2J5UA 4I7ZC 1KQFB 2ZT9B 3T97B 4PV1B 1YQ3C 3AEFC 2D2CD 3AEBC 2FBWC 2OQQA 2K9YA 2E75B 2E74B 3AE7C 3AEEC 4U7JA 1VF5B 1KMIZ 3AE9C 2G8YA 1RQVA 4H0LB 3AE3C 4R4MA 1ZOYC 3IN6A 3AE5C 1S5LX 3O6QA 3RK3E 3AE4C 4H13B 1IK7A 2P10A 2E76B 3AE6C 2E74D 4GDOA 1AJYA 1EXJA 1VF5D 4OGQC 1DD4A 3D71A 3D70A 2BEZF 1PV3A 1YQ4C 1K05A 1HJ0A 4H0LC 1HF9A 2E76C 4H44D 3AEDC 2E76D 3GLMA 4H44C 3FGAD 1TU3F 2V7QJ 1FDIA 4I7ZB 2H88C 3AEAC 2ZT9D 1Q90D 3C8VA 2YIUC 5M1BA 4YTPC 4XFJA 2IDBA 3Q2YA 3ABVC 3GMAA 3GF7A 1K04A 1DD3A 5KLIC 2QJKC 2BEQD 1R8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 X;  4RKU J;  2O01 J;  2QIW A;  1JB0 J;  2ZT9 B;  2WSE J;  4PV1 B;  2WSC J;  2QJY C;  2K9Y A;  4OGQ B;  2E75 B;  2E74 B;  2QJP C;  1VF5 B;  4I7Z B;  2WPV B;  5L8R J;  4H0L B;  1Q90 D;  4H44 B;  1ZRT E;  2WSF J;  3C8V A;  2YIU C;  5KKZ C;  1S5L X;  4Y28 J;  3LW5 J;  4H13 B;  2E76 B;  2QSI A;  2D2C B;  4KT0 J;  5KLI C;  2QJK C;  2FYN C; 
#chains in the Genus database with same CATH topology
 3WG7 B;  1FD9 A;  2B1G A;  2GUV A;  1AJN A;  3EQ2 A;  2POH A;  4JI0 B;  1VQ4 P;  1L4A C;  1GMJ A;  2Z0A A;  1N2D C;  2FYU G;  4DUZ B;  4DR3 O;  2ZAE B;  4IYI A;  1LTJ B;  2UXD O;  1Y6X A;  1IBL O;  1N4C A;  3B77 A;  4LF9 O;  3RVY A;  2ZFC A;  2WSS H;  4JI7 B;  1MAB G;  4M3L A;  2M3B A;  4JYB A;  2V4H A;  3BA9 A;  3H1J D;  1NTK G;  3OJA B;  3II6 A;  3I56 P;  2ZXW B;  1A02 F;  3DXR A;  4PDM A;  1NQT A;  4TUY B;  3NR7 A;  4PD4 I;  2HLO A;  3H01 A;  4DV1 B;  5EBM C;  1AR4 A;  3CXH I;  3ABL C;  1NH2 D;  1MFZ A;  1XRE A;  5K1X A;  4GKK O;  4DV6 O;  2KZI A;  3CCQ V;  4HKZ H;  3AG3 B;  4HZ3 A;  4DV4 B;  2PRR A;  3ABU A;  4TWK A;  3ZBH A;  5GTH H;  1RF1 B;  4LCU C;  1MV8 A;  5CBH A;  1SQV J;  4DV7 B;  1JR9 A;  1WB8 A;  4WFE A;  5CBG A;  2IBZ E;  4CBC A;  2QKA A;  3JAR A;  4J10 A;  1GDT A;  1BDC A;  3OD4 A;  3ZS8 C;  2F95 B;  3LW5 J;  3AEG C;  1YVW A;  1SQQ K;  4DR1 B;  1FC2 C;  2XNX A;  3J81 N;  1K9M Q;  2FYU E;  4CS4 A;  3D3Q A;  2JEU A;  3AG4 C;  5L3B A;  3IJ4 A;  1PL0 A;  2DN9 A;  4PV1 B;  3AEF C;  2R9I A;  3SJC C;  5LMU B;  4G27 B;  2ZVN B;  1L0L J;  4NXN O;  2YNY A;  3ABL B;  5HFL A;  5K1P A;  1MMM A;  3TCU A;  3ICX A;  4JI4 B;  5H2F Z;  4QPK A;  1LWU C;  4LWS B;  1CEZ A;  2B87 A;  1EDK A;  2E76 B;  2M6Y A;  4DR4 B;  2OWO A;  1AJY A;  1LP1 B;  4BRY B;  4ZKP A;  3MZW B;  1VQ4 V;  3BVH A;  2F4V O;  3H1I J;  4LH7 A;  1NU1 K;  5LYJ A;  1YYC A;  2QDO A;  1WA8 B;  4U3F H;  3SGI A;  3CCQ P;  1B6Q A;  2FKX A;  3WMM 0;  3S4R A;  3BY6 A;  1UJW B;  4LF5 O;  3L37 A;  1YIT V;  2IZ1 A;  2IH3 C;  2KQX A;  2Y0C A;  2A7W A;  2AEF A;  4U3F E;  1IFJ A;  1DTO A;  4JI2 B;  1S72 V;  4JI5 B;  2CUG A;  5LGT A;  1JY2 P;  2QE7 H;  3K9A A;  1DK1 A;  4AUW A;  3H1H H;  1IXB A;  2P58 A;  1GU4 A;  2QM8 A;  1BCC G;  2Z5U A;  4GLX A;  1ZSP A;  2DWE C;  3GMA A;  5KAI Z;  2JGD A;  3IC7 A;  4DCK A;  1IZ3 A;  1W2B O;  1Y76 B;  1CSB A;  2Y0I A;  4PJ0 H;  4RES B;  3E89 A;  3KQG A;  3F89 A;  3QWO C;  3NTN A;  4NTX A;  2Y69 B;  3AG2 B;  1JB0 J;  1L0N H;  4FPP A;  4BIU A;  1Q82 W;  4KUM A;  3H1J J;  2YIC A;  1XBL A;  3ABM B;  5TIS E;  2OYH A;  3A3Y B;  1UIX A;  3HE5 B;  2EIJ B;  4AYC A;  1VQK P;  1QVF O;  1BT8 A;  4FLV A;  3PH0 A;  4JF3 A;  4EI2 A;  1EXI A;  3MIW A;  1AJQ A;  1WAZ A;  5LXT A;  4B3S B;  2D2C B;  2H94 A;  2EJR A;  4LF7 B;  4Z1V A;  4PD4 D;  1S5J A;  1S5L H;  2NPS D;  2F66 C;  4I50 A;  2HP8 A;  2JVD A;  1VF5 C;  1VQ7 V;  3EWK A;  4EDF A;  5LP6 B;  2BTQ B;  3G6E V;  2EIN C;  2Q69 A;  4J7J A;  1AV1 A;  1KP2 A;  1Y9B A;  3QVN A;  3H32 A;  1BCC E;  2KB7 P;  4X65 B;  5EC1 C;  3OGC C;  2QWP B;  1LT9 B;  3JD3 A;  2B9B A;  2BSK B;  2EIL B;  1FXH A;  2VRZ A;  2WPD G;  1KBH A;  3SFD C;  3G67 A;  2VQE O;  5EK0 A;  1OCO B;  1JY3 P;  1VQM V;  1S0V A;  4J7K A;  1PPJ D;  1Q81 Q;  1LP1 A;  3CME V;  3STL C;  5B3S C;  1I5X A;  4HYO A;  3VMA A;  1GU5 A;  4IIJ A;  2KG7 B;  1M1K Q;  2YO3 A;  3J7A U;  3RK2 B;  2YC0 A;  3RBZ A;  5C8Y B;  2P2U A;  5AVQ B;  4WBA A;  2K1E A;  3BPZ A;  2D2C D;  1T6A A;  1X79 B;  1HJB A;  2NRG A;  2PY5 A;  2E74 B;  4X62 B;  2UUA O;  2ZIN A;  3LIE A;  3ZED A;  3UCS C;  3TET A;  4FLU A;  3CJH A;  3JAT A;  1CI6 A;  1H2N A;  1FFX A;  5GTI H;  2QWQ B;  2ILM A;  1IK7 A;  3JSV C;  4LWS A;  2B87 B;  3K08 A;  4OGQ C;  1BGY J;  1FOS F;  2DQ0 A;  1K92 A;  1ORQ C;  2ZE5 A;  3JCZ A;  3CC7 V;  3V4Q A;  3NMD A;  4AIL C;  1A02 J;  1AVM A;  3QF7 A;  1JOY A;  4FLW A;  4Y99 C;  2E76 C;  1R5S A;  3CYO A;  3QTC A;  4UB8 Z;  4JI3 O;  1P84 F;  2UXC B;  4RUE A;  1N34 O;  4LLH A;  3ZHR A;  2OYI A;  3L70 H;  3L73 E;  4X1K A;  4IIJ B;  5CB4 B;  1AP5 A;  2QEX V;  2OCH A;  2PYJ A;  3VQV A;  3SPG A;  2VWJ A;  1J5E O;  2MW2 B;  2GDS A;  1N8R W;  1NTK D;  3H1K G;  2OCC B;  2PP6 A;  1X0T A;  1IBM B;  1YJ9 V;  1QLE B;  4K3A A;  1J95 A;  3D36 C;  3RK3 D;  2W83 C;  1SQX K;  3CCL V;  3HUS A;  4J9Z B;  3KHU A;  1HNW B;  2KYV A;  2ZXW C;  1KFN A;  1OWA A;  3CCU P;  2QJY C;  1YEW A;  2WA3 A;  4YIP A;  1SZX A;  4LH6 A;  1S9K D;  4GKG A;  4DR6 B;  1K5S A;  2P6J A;  4EYY Q;  3BRT B;  2BCC H;  1Q2N A;  2P7J A;  1PNL A;  4JI1 O;  3R65 A;  3L74 H;  3CXC U;  1OZ0 A;  4PJ0 E;  4Y28 J;  2AEJ A;  1G8M A;  3K06 A;  2FXO A;  4HBN A;  2Q6A A;  1NU1 J;  2WLL B;  4X66 O;  3J80 N;  2O1J A;  2BCC E;  5CN0 A;  1NTZ H;  1TUE B;  1ZUQ A;  3AG1 B;  4Z1M H;  2UXD B;  5JH7 A;  3OE7 G;  2M8R A;  1VF7 A;  4I55 A;  1GKF A;  1SQF A;  3JAL A;  5TIS H;  1K34 A;  1KIL A;  4IL6 H;  4H13 D;  3APQ A;  3ABK C;  5LHH A;  2WSC H;  4TSF G;  3TJT A;  1SQP D;  1RP3 B;  4RJT A;  3CS5 A;  1KTM A;  3JD2 A;  5APX A;  3CX5 D;  3RYH B;  2EIK B;  4FZ0 A;  2A0L A;  2HHH O;  3JSN A;  1W59 A;  3LDC A;  4JI0 O;  3H1K D;  4U7N A;  1VQN P;  1H2M A;  1GN6 A;  2Q8V A;  3HKB B;  2H7H A;  1T3U A;  1KZU B;  4UB8 H;  5KMG B;  3T97 B;  3UO3 A;  3ZCC A;  1E79 H;  2OQQ A;  5DJT B;  2CTP A;  2QEX P;  4DT0 A;  4K8X A;  3L75 D;  2FYU J;  5CMU A;  3QG5 A;  4DR1 O;  3VYI A;  3B5N A;  1L8D A;  1LTA C;  3H1L G;  3CP1 A;  3CCV P;  5AW1 B;  4JI6 O;  4H13 B;  2OYH C;  3K0D A;  2AHY A;  1KYO F;  1AP6 A;  1JFF A;  4G28 B;  1Q6U A;  3D71 A;  4LFA O;  1RE3 A;  1JJ2 U;  1L0L K;  1GW3 A;  1YQ4 C;  1IFN A;  4DZO A;  5AW6 B;  3D36 A;  5APY A;  4H44 C;  1LGH B;  4DV0 O;  1AFO A;  4JPR A;  4RQF A;  2Q0O C;  4AQY B;  2H88 C;  5B3S B;  2Q6Q A;  3H1I E;  1IBL B;  3B2E E;  4HNA A;  1K73 Q;  4YJ3 A;  2E43 A;  5IJ0 A;  2YIU C;  4I50 B;  5AVV B;  2C0W A;  3JD1 A;  1R6K A;  4RO0 A;  4YIO A;  2W6I G;  2JWA A;  4IFM A;  3ETD A;  1R3K C;  4QMA A;  3OGI B;  1NTM D;  4DR5 B;  1HR0 O;  4JGS A;  1OCO C;  2ADP A;  3MDS A;  3L73 J;  3EXA A;  2A45 G;  1OMI A;  1L0L D;  5BXZ A;  1GTW A;  2IYP A;  3SPI A;  3K59 A;  4GOD A;  1S9K E;  1Y67 A;  2IFN A;  1FPO A;  3O9O A;  5CA0 A;  4GKK B;  2WT7 B;  4LR3 A;  4I55 B;  3CMA V;  1L0N J;  1V54 B;  3C3S A;  4O2A B;  1LWU A;  2N04 A;  4DV2 O;  5KLV H;  1VQ9 P;  1XHX A;  1ROP A;  1IFP A;  3L72 D;  3H1J G;  1BGY H;  3F5T A;  5FNV B;  1VQN V;  3H1H E;  2IFM A;  3MHV A;  1SER A;  3RK3 C;  4BIO A;  4PV1 D;  2F4V B;  1FZC B;  1X22 A;  3G6E P;  1YI2 V;  2VQE B;  5DN6 G;  4JZG A;  4H0L D;  3H1I G;  1OJH A;  2X0L A;  1VQ6 V;  2Q67 A;  1YTZ I;  5AVX B;  4JYA B;  5CCG C;  1N33 B;  1BHB A;  5AW4 B;  1FKA O;  2JDI G;  4WBN B;  5J2T B;  1YIT P;  1WA8 A;  1GL2 A;  2N1T B;  1RFY A;  3T4Z A;  3CXH E;  3G9R A;  3HE4 A;  3QO8 A;  3S3W A;  2XKM A;  3TSI A;  1U96 A;  1U97 A;  4KFM A;  1NTZ J;  1VF6 C;  1BCC J;  4FM0 A;  5KLV J;  2MK3 A;  2XOK G;  3K03 A;  3KZI Z;  2A06 E;  2XAQ A;  5KLV K;  2QVA A;  1PM9 A;  3CRR A;  3B8N A;  1KQS O;  1VMG A;  3RYC B;  1ENV A;  4B3R O;  1G2C B;  5C93 A;  1P7G A;  2HR3 A;  2W6A A;  4MVQ A;  4L8J A;  3H1J E;  3ML0 A;  2K1A A;  1K4C C;  4JI2 O;  5LP6 A;  4JI5 O;  5CHX A;  3A2F A;  5AW2 B;  1F4M A;  2AXC A;  2HG5 C;  2Q7C A;  1CW5 A;  1EFR G;  2P06 A;  4B7E A;  3HTK A;  3KZI H;  2CE4 A;  2QM7 A;  3AE5 C;  4FFK A;  4FVM A;  2Q73 A;  2Y0E A;  3ZHU A;  1WT6 A;  4JI3 B;  4HJG H;  1NU1 E;  2Q4P A;  1HNX O;  3L70 E;  3U1C A;  5APQ A;  1FFX B;  3L9D A;  2UXN A;  2UUA B;  4B08 A;  2FYU K;  1MOF A;  1L2P A;  3CPW O;  4IFF A;  5KHJ A;  1NVO A;  1BQ0 A;  1FU1 A;  4H0L C;  5J9P C;  2BOC C;  4DK1 A;  4FJC C;  4D6T D;  2DYS C;  2CPB A;  3SYO A;  3SWF A;  4JAV A;  2HKO A;  3EVK A;  1NTK K;  5JCO A;  3LSU A;  5JH7 B;  1IVS A;  4JAS A;  2R3S A;  4J42 A;  3BRV B;  3L71 D;  1R5L A;  1FZB A;  3CWB D;  2P1J A;  1SQP J;  1N32 B;  1DD3 A;  3E22 A;  1VQ6 P;  2YXL A;  4LF7 O;  1XNQ O;  3JAS B;  1MZ9 A;  5H6Q A;  2IBZ G;  2QJP B;  3SFE C;  4FMT A;  4H37 A;  4K0K O;  2E74 C;  3CME P;  3LNN A;  3CCE P;  2DOS A;  3K04 A;  2ADQ B;  3N2G A;  2Q3I A;  3TGU J;  4ZKI A;  3SYQ A;  3L72 J;  4UVB A;  1XMQ B;  4JYY A;  3W67 A;  1H8H G;  3RW0 A;  3M8A A;  1VQO V;  2HYN A;  1ZME C;  3G3Z A;  3L70 G;  2G3A A;  2FYZ A;  3SPJ A;  3AK2 A;  3WUT A;  5IDJ A;  4LFC O;  2WMM A;  1ZLL A;  3BA8 A;  3CMA P;  5KAI E;  4DOJ A;  4JV5 B;  5LP6 C;  4BRY A;  2HLD G;  5CB4 A;  4WFB V;  1XHZ A;  5A9G A;  1SA0 A;  3BCC G;  4IGG A;  4ZI7 A;  3RBX A;  1NT2 B;  2KXP B;  2LQT A;  1S5L E;  2KZJ A;  4JYC A;  1JCD A;  2X6B A;  1HGZ A;  4H33 A;  2ZE7 A;  1H2G A;  3KCX A;  2FXM A;  5JQG A;  3W7U A;  2JR8 A;  3F7Y C;  4Q6G A;  2QJ1 A;  1NU1 H;  4NKG B;  3GVM A;  1SQB H;  2YIB A;  2JO1 A;  3C3T A;  1F51 A;  3KCY A;  4XDJ A;  2WPQ A;  4CH6 A;  3D6Y A;  1JVM A;  1SQV K;  2KS1 A;  5JJN B;  1OFC X;  1ZR2 A;  3AE2 C;  3H6P A;  1SQP K;  3P8C E;  5B1B C;  2ZJS E;  1KQF B;  3ABK B;  1SFC A;  1SQX G;  3AG7 A;  3JCU Z;  1RF1 A;  2ZT9 B;  3A2A A;  2O3J A;  4FIP C;  5AVU B;  3TYY A;  1RPO A;  2FBW C;  1SQB D;  2KNC A;  4WY4 B;  2FKW B;  2XUM A;  4I4T B;  1NJI Q;  4PEL A;  4L75 A;  2OTJ V;  1NU1 D;  3K5L A;  2IH1 C;  2JS3 A;  3AE4 C;  1M5I A;  2GHY A;  1YI2 P;  1V54 C;  1L1F A;  4DR3 B;  2WLM A;  2RMK B;  1VF5 D;  3O6Q B;  4W7Z A;  3V6I A;  3H1L J;  2LFS A;  4JAA A;  3A0B Z;  4DO2 A;  1KKC A;  3ETG A;  2Z5I A;  3E1R A;  1JQ0 A;  4EFB A;  4JTA B;  5CJ4 A;  1HF9 A;  4BXL A;  1I5Y A;  3K5N A;  3SYC A;  1K8A W;  2AZ0 A;  2WZ7 A;  1WPX A;  1VQ8 P;  1ZN5 A;  2K37 A;  3AEI A;  2ZR3 A;  2YKP A;  3JCU E;  4Z2W A;  2Q0A A;  3OT7 A;  3SJB C;  3H1I H;  1KB9 D;  4LFA B;  2Y4U A;  2Q9L A;  1R6T A;  5L3D A;  1YTZ T;  2ZD9 A;  2KIK A;  2C2A A;  4X66 B;  3HD7 A;  3LID A;  5H9C A;  1YTF D;  2N1T C;  4A5U B;  5LHI A;  1R8E A;  3KYQ A;  4GCZ A;  2Z5H A;  3X2Q B;  1X9V A;  3OM3 B;  1GM9 A;  1QR9 A;  2EIM B;  2ITA A;  3CB2 A;  2QM4 A;  4WBN A;  1PIX A;  2Y0D A;  3D6Z A;  2KKW A;  4DUY B;  1RQU A;  2FYU D;  4CC6 A;  1MFT A;  2P7T C;  4R4L A;  3L73 G;  2NN4 A;  4DV3 B;  1NVP D;  4JI8 O;  3H1K E;  1IDS A;  3VOP A;  4C46 A;  1OCR B;  2UUB B;  1LTJ C;  1OW7 A;  1KP3 A;  1PGO A;  2QWN B;  3NXS A;  3W7X A;  5EBL C;  4DW1 A;  4ZIB A;  1YJW P;  4JAU A;  3F7V C;  2Q3E A;  1L0N E;  3L74 E;  1H8A A;  4TV9 B;  1EQ7 A;  2AXT H;  4DR2 B;  3L75 E;  1SKV A;  1VQ5 V;  1L0L G;  5IY5 C;  2WSC J;  1SQV D;  1RE4 A;  4IHJ B;  3LDD A;  1J1D C;  5E79 E;  3IGA C;  1IC2 A;  2A9H A;  2W90 A;  2ARH A;  2R70 A;  4DRX B;  2FTK A;  5KJ7 D;  3Q5R A;  1ZWI C;  2JJL A;  4F4L A;  3JC2 2;  3FYE B;  4NYK A;  3UT5 B;  1SQQ D;  1HVV A;  2YMK A;  2Z4E A;  2JGU A;  2K88 A;  2YUA A;  3IR9 A;  4UVC A;  3P8C D;  3CRQ A;  4DK0 A;  4NTY A;  1SQB J;  1YIJ V;  2B9Z A;  2QTS A;  1R3I C;  2VQF O;  1SQV E;  5GON A;  4NPD A;  2WWW A;  1GM7 A;  3P32 A;  3L35 A;  1G2C A;  4N21 A;  4WFF A;  5B1N A;  3N2K B;  3B5N D;  1RF0 C;  2GBO A;  2M5A B;  3HKD A;  1N7S B;  2YSU B;  1BSH A;  1PV0 A;  2JK5 C;  3DC5 A;  3C9I A;  3KPE A;  4UXN A;  3E2E A;  1S5L Z;  5JWP A;  1ZRT D;  1L0L E;  4O2B B;  1VQ5 P;  3EFF K;  1W0K G;  2WA4 A;  5LOV B;  1DD4 A;  2K9J B;  4MTX A;  4FM2 A;  1AR5 A;  1OCZ B;  1KKD A;  1PNK A;  4B3M B;  4X8A A;  1PV3 A;  1Q43 A;  4WCE V;  1MSW D;  4ZMD A;  3AG1 C;  4WFG A;  1VQK V;  1P84 D;  1AI5 A;  4PA9 A;  1VPC A;  3AEA C;  5FPO A;  5TIS Z;  3MUD C;  1Q90 D;  4GZR B;  4QIW F;  1RPR A;  4TUY A;  3ITK A;  4X20 B;  1RY3 A;  1BCC D;  1NTZ K;  3JAS A;  2RNB A;  3Q2Y A;  2ZYD A;  4GX1 A;  2RH0 A;  1QNM A;  2Q5Z A;  2H3O A;  2HOD B;  5APT A;  1NTZ G;  5APS A;  1DGS A;  5KLV G;  1M56 D;  2B89 A;  1PPJ E;  2O01 J;  4F6R A;  3B4S A;  2WT7 A;  3PTZ A;  3UM7 A;  4IHJ A;  3PRJ A;  2CPS A;  2LXC B;  2WTY A;  5CA0 B;  4PHZ A;  3SDL A;  3BCC H;  3V2Q A;  1G1I A;  1N32 O;  1OHH G;  2AW9 A;  1KIL E;  3PHL A;  4O4J A;  3M7M X;  2JWD A;  3RK2 D;  2IPP A;  3W68 A;  2M7W A;  3MD0 A;  4X1I B;  4WY4 C;  3IFM A;  3RGU A;  3H1L E;  4EB6 A;  2NR5 A;  1L4A A;  1PGQ A;  2WLJ A;  1Q6I A;  2RMZ A;  3LW5 H;  1Y47 A;  3H1I D;  4WFA V;  1N36 O;  2WSF H;  4YY3 O;  1KQS U;  4OGQ B;  1EDL A;  3M9H A;  1VQ7 P;  2NPS B;  3CCM P;  4ZOL B;  1P84 I;  5KLI B;  4GX5 A;  3H1H G;  3CHX A;  3I5C A;  1NTM E;  5KKZ C;  4C7N B;  3B40 A;  5JCO C;  1WB7 A;  2LFR A;  4KHP O;  1FJG O;  4O2B A;  1M56 C;  4DXW A;  4GYC B;  2R5B A;  3OEH G;  4WFH A;  1HUC A;  2J5U A;  2C0X A;  2H8P D;  1XUQ A;  1WRG A;  2PYL A;  4GX0 A;  1H8E G;  4D7T A;  5KLV D;  1N8R Q;  3MP7 B;  3ZDM A;  1N0N A;  2FYU H;  2W0F C;  4ZHQ B;  4MSW C;  5TJH A;  2KNC B;  3AEB C;  5E79 Z;  3CC4 P;  5KX5 B;  2E75 B;  3E83 A;  2JJ2 G;  3JYC A;  3APO A;  1JY3 N;  3H1H D;  3CCS P;  2OYI C;  4GKJ O;  2GSM B;  1GL2 C;  3QNE A;  3CWB H;  4W7Y A;  4MVS A;  2BTO A;  4JV5 O;  3U10 A;  1YJW V;  4ABM A;  1OVV A;  1HNW O;  4I5S A;  2A06 G;  5D5P A;  2E74 D;  4WWI A;  4ASW A;  1DEE G;  1FS0 E;  1JTH B;  1NKZ B;  1D5A A;  1TGO A;  3GB7 C;  4K0K B;  2ZDI C;  4DRX A;  1F23 A;  1SFC C;  1P84 E;  3BCC J;  4R6Z A;  1OCR C;  4B86 A;  2Y48 A;  3AK1 A;  2HFE C;  3G6B A;  1YJN V;  4RWU A;  1N0J A;  3B5N C;  1FXV A;  2RJZ A;  3HB3 B;  1GRJ A;  4YHH B;  4AI8 A;  4LF8 O;  1HTL C;  1NU1 G;  1M1J A;  1O9H A;  1M8O B;  3C90 A;  3FFQ A;  4XFJ A;  1X4T A;  2IDB A;  1BE3 H;  1JCH A;  1GK6 A;  1KU9 A;  2ZIM A;  3CSX A;  4YJ2 B;  1RM1 C;  3QH9 A;  1H2K A;  1BE3 E;  3T4D A;  1H88 A;  1PP9 H;  3ABT A;  2ZNJ A;  1VEW A;  5LMU O;  4HNA B;  2RCV A;  1Q81 W;  2QTO A;  3K9S A;  4X1Y B;  4NXN B;  2YIU B;  3L75 H;  2HG5 D;  2O57 A;  5GTH E;  3K5B A;  2ODM A;  4A7P A;  2HPC A;  3ASN B;  3A0B E;  4UCS A;  1XQ8 A;  1FS0 G;  5LOV A;  3ZRX A;  4FLX A;  4L73 A;  3H1K H;  1Q82 Q;  1RF0 A;  4UCR A;  2UUC O;  3H1L D;  3L36 A;  1Y8A A;  1WPB A;  2W27 A;  4PDL A;  2N05 A;  5KAI H;  3E8H A;  3WB1 A;  3DGE A;  4X1K B;  4MVU A;  1GK4 A;  1S2E A;  3FWN A;  4ZNC A;  1JO5 A;  3BRC A;  4UCT A;  4OVN F;  5K5G B;  4MVZ A;  4I9Q A;  3T1H O;  4N78 E;  1VQL P;  4RQE A;  2XU6 A;  2IJI A;  2WPV B;  5LA6 A;  3RYF B;  1T2K D;  3CWB G;  4MTO A;  1BE3 G;  1AI7 A;  5KAF E;  3M0D C;  2QSI A;  3HKE B;  2IBZ D;  1NTM K;  5IJ9 A;  2EIJ C;  1RE4 C;  5KKZ B;  4LF4 O;  4U7O A;  1ZV8 A;  1L0L H;  5CMZ A;  5H2F H;  4I4T A;  2BCC D;  2LP7 A;  1M1K W;  3P7K A;  1YQ3 C;  4MT8 A;  2VS0 A;  5IYZ A;  4ZHQ A;  3AE7 C;  1RSO B;  1G6U A;  4MVR A;  3AE9 C;  1YTF B;  1DLB A;  2OIG A;  1I94 O;  1IX9 A;  3VTP C;  1S77 D;  2GUZ A;  1ZOY C;  2UXB O;  3WU2 Z;  5APV A;  2GTA A;  1KEC A;  1S5L X;  1SC5 B;  2KS1 B;  1CP9 A;  5JJE B;  3FXD A;  2P22 C;  2R9R B;  3BCC D;  4C7R A;  2CK3 G;  3SJQ C;  3WFV A;  5H6R A;  1EDI A;  3U0Z A;  4NPE A;  4NPF X;  3HTK B;  5AW8 B;  1ZTE A;  1Q8I A;  2W6J G;  5BZB A;  1K05 A;  4BWN A;  3A0H E;  5J2T A;  4PI0 A;  5GTH Z;  2E76 D;  3SWY A;  5JJJ B;  1FZC C;  1P49 A;  1OIP A;  1HP8 A;  3HKB A;  4QE9 A;  4DV3 O;  2F43 G;  2LGQ A;  3M99 B;  1TVK B;  1XI1 A;  1L4A B;  1NTM J;  3OMI B;  1KD1 W;  2WAM A;  5LBQ A;  2UUB O;  2F93 B;  2L91 A;  2DYR B;  5FLX N;  1BE3 D;  1Z56 A;  1GO3 F;  2GM4 A;  5L3G A;  1FOS E;  1RF1 C;  1YZB A;  4JQ0 D;  1P84 H;  3N7N A;  2VQF B;  2YI9 A;  4IL6 X;  1SQX H;  1M9N A;  4TQF A;  3HE5 A;  1VL2 A;  3KXD A;  1TVK A;  1USD A;  4UCO A;  1D7M A;  3M9B A;  1URQ D;  2WQY C;  1JY3 O;  1SS3 A;  5EZY B;  1IBK O;  1EZV H;  2LXB A;  4BW5 A;  3G4S P;  2AHZ A;  4X65 O;  2LGW A;  3BVO A;  1ZL8 A;  1M90 W;  4TV9 A;  2KSJ A;  3SWK A;  4B3R B;  1Y76 A;  3ASO C;  2E3C A;  4DYL A;  3ABM C;  5FNV A;  4I9W A;  1US6 A;  5IJ0 B;  2A3Q A;  3CL3 D;  4AQR D;  1NKD A;  1WP8 A;  1USE A;  2K3R A;  1SRY A;  1K97 A;  3MHS C;  1GTO A;  1MNG A;  1FJG B;  4KHP B;  1GAX A;  4N78 D;  3SJA C;  1SQX D;  2YXR B;  3TXQ A;  5KA6 A;  2FXP A;  3CCL P;  3CXH F;  3JAK B;  1MSD A;  1HNZ O;  1OW6 A;  4H13 C;  3H25 A;  1OCC C;  5GW7 A;  2OYO A;  3A0H Z;  1QHT A;  2WLK A;  1J5E B;  1KN7 A;  1JFF B;  2P67 A;  1BGY G;  3JAW B;  4D6T H;  3ZRS A;  3HD7 B;  4CH4 A;  2LJ2 A;  1NKN A;  3VMY A;  1IO4 A;  2Q68 A;  2EIL C;  4I7Z C;  4W4K A;  3HKD B;  1N7S A;  1X59 A;  4O4H B;  2UWJ E;  1SFC D;  4TLF A;  1A32 A;  1X8Y A;  2QKS A;  2RN9 A;  4UB6 Z;  5APW A;  1TUB B;  3SPC A;  1KUQ A;  5KX5 A;  1QBZ A;  1THZ A;  1N34 B;  5KAF H;  1XNQ B;  2DJV A;  1RQV A;  1FJK A;  3UO2 A;  2CAZ C;  3WB2 A;  5LMN O;  2IU0 A;  3UKM A;  1L0N D;  2Y4T A;  2PUS A;  2E5T A;  4KHX A;  2YIA A;  1QVF U;  1B3Q A;  5IWA O;  1HWY A;  3HE4 B;  4GT1 A;  1L0N K;  3A0R A;  3FB6 C;  3TGU G;  1LNQ A;  3N27 A;  1XTC C;  5KUK A;  1GH6 A;  1GL2 B;  2W6B A;  1QVG U;  1BQZ A;  2ZE6 A;  3H32 B;  4BW9 A;  1I7F A;  3L75 G;  3CRM A;  2QA4 V;  3HKC A;  4LNU A;  2PI4 A;  3FB5 C;  3MHH C;  4JZ2 A;  1N73 A;  1KB9 F;  3C8V A;  1YHQ V;  2IM9 A;  3CCM V;  4YTP C;  3VQX A;  2B1I A;  1FYJ A;  5AW9 B;  1K73 W;  2EIN B;  3A7O A;  5AVS B;  5BVZ A;  4J80 A;  3TGU D;  5EYP B;  2P4V A;  4YXW G;  1G4Y B;  1JX9 A;  4YHH O;  3G80 A;  1QVG O;  1N73 B;  1Q6H A;  5B5E Z;  2ZDI A;  1ZW0 A;  2DYR C;  2D2C C;  2A45 I;  4O2A A;  1GZL A;  3B8E B;  2QJK B;  4HYT B;  1OXZ A;  4TT3 G;  2C9L Y;  1XNR O;  1B04 A;  3KG2 A;  2WSF J;  4D6T E;  4JI6 B;  5LYJ B;  4TV8 A;  5DEC A;  1Q5O A;  3MGN A;  3TGU E;  4P9O A;  3TXS A;  1VIB A;  4DR7 O;  5KLV E;  3QO5 A;  5EC2 C;  2Q5U A;  2PI5 A;  3IF4 A;  3E86 A;  4HH2 A;  3GWO A;  5BR8 O;  3L71 E;  1XOU A;  1CI6 B;  4PA3 A;  3RT3 C;  2N1T D;  2I1J A;  2R5D A;  4QJF B;  3GF3 A;  1KYO D;  1NO4 A;  1O9G A;  1EDJ A;  1YSC A;  4I0X B;  4CS2 A;  4DR4 O;  3FX7 A;  1M90 Q;  2UUC B;  4LF8 B;  1M56 B;  4OWF A;  1JNM A;  2IW5 A;  4BR6 A;  1SQG A;  2AGA A;  4RAI A;  4TQD A;  2JJ1 G;  5HFM A;  4JTC B;  2UU9 B;  2DQ3 A;  3MUD A;  3A0B H;  2R72 A;  2KP8 A;  4W80 A;  1T8Z A;  4X88 A;  3CWB J;  2E75 D;  4HB1 A;  2IBZ H;  4I1L A;  1V55 B;  1BE3 J;  4DR6 O;  3ZHQ A;  1KYO E;  3JAR B;  2SPZ A;  1VQ8 V;  4XBF A;  2QA4 P;  2Q7H A;  1QX8 A;  2FB5 A;  1FXK C;  5IYZ B;  4DV6 B;  2YI8 A;  1YBK A;  4D6T G;  3N4X A;  2XZR A;  2JIZ G;  2A79 B;  1ARO P;  3CI9 A;  5AVT B;  3SSU A;  2KSD A;  5C8Y A;  3AE3 C;  3CC2 P;  4B7K A;  1EBO A;  3ZMU A;  4DV7 O;  1JTH A;  5CJ0 A;  4LF4 B;  3SR2 C;  2ZR2 A;  2YKO A;  1GL2 D;  1VQP V;  5GTI E;  1EZV D;  2OTL P;  1ZAU A;  5LL6 Y;  1PPJ H;  4WVZ A;  1FXK A;  3D70 A;  2FML A;  1I94 B;  4PA7 A;  4U3F D;  1N7S C;  5KHG A;  2YEV B;  1XIL A;  3VN0 A;  1OVR A;  2V7Q J;  3LUT B;  1W0J G;  2WVR A;  4B3T O;  4KP4 A;  2L5G B;  1NR7 A;  3L73 H;  1NWQ A;  1BMF G;  1Y74 B;  3T1Y B;  4ASV A;  2JKV A;  3TGU H;  2L35 A;  1YJ9 P;  4UV9 A;  4LF6 O;  3RK2 C;  2OT5 A;  1NH2 B;  2EBO A;  2XAJ A;  1K04 A;  4EIJ A;  1NTM G;  1LT9 C;  4KJM A;  1ZX3 A;  2EZP A;  2QJK C;  1N7L A;  2PZS A;  3LSS A;  2R3C A;  3Q1M A;  2HPC B;  3OAA G;  3KKY A;  3JAK A;  1VF6 A;  1PNM A;  4J41 A;  1GMG A;  1QU7 A;  5EZY A;  4I0X A;  1WP7 A;  2XT9 A;  2BTQ A;  4GIF A;  1J1E C;  4KXR A;  4YXD C;  2JDI H;  2YID A;  3HUS B;  1R1B A;  3CCU V;  3FXE A;  3IAY A;  1FZA A;  1PKX A;  1PP9 G;  5KJ7 A;  4JPZ B;  4N6J A;  5F2V O;  3GW6 A;  1IFD A;  1FZC A;  2R32 A;  1HW7 A;  3ZMT A;  2GTS A;  1SET A;  4DV0 B;  3RL0 C;  3L72 E;  1EZJ A;  1KYO H;  1PD3 A;  1SQP E;  3JD4 A;  3OMN B;  4YJ2 A;  3A5T A;  4TT3 H;  3FB8 C;  4AQY O;  2LKM A;  1IBK B;  4MW3 A;  5BMV B;  1FZE A;  4QGP A;  2OYH B;  2OYI B;  3Q5S A;  4IFD K;  5AW7 B;  1VAR A;  2DMX A;  5FL7 G;  2OTK E;  4UVA A;  3RVZ A;  1QLE C;  2YEV A;  3ZJZ A;  1QLN A;  5E79 H;  5KMG A;  2QR4 A;  3L71 J;  1BCC H;  2VWK A;  1CXZ B;  3WB0 A;  1GN2 A;  1YCI A;  1M57 D;  1BDD A;  4LP8 A;  3I55 V;  3WU2 E;  1Q3E A;  2HVJ C;  5AW3 B;  4UCV A;  2BEQ D;  1IXM A;  4NXM B;  2RQ6 A;  2YO2 A;  1KIL C;  5CCH D;  2LW1 A;  2PGG A;  2QSA A;  4O4I A;  3G71 P;  4DV5 O;  3HKC B;  1GK9 A;  4LNU B;  3HD7 D;  3CC2 V;  4QPJ A;  1XL4 A;  1TUB A;  2QG4 A;  1KD1 Q;  1Y66 A;  3KDP B;  1Q7Y Q;  4MN4 C;  2Q9I A;  4U7J A;  3BAS A;  2G8Y A;  4FLY A;  2FFD B;  1NH4 A;  3SPH A;  1FAV A;  1SQP G;  2Y9Z A;  1K7D A;  3B8M A;  2YXY A;  5KHK A;  1KYO I;  3VMZ A;  1ZR4 A;  1AQ5 A;  3CX5 E;  2E5Y A;  2WPS A;  2EIM C;  2XAG A;  3M0A A;  1R6N A;  5DM6 V;  1KIL D;  5CCH C;  5CBN A;  3PJS K;  4B3S O;  3HR0 A;  1M57 B;  2BSK A;  1SQQ E;  2JEE A;  1JA8 A;  1URQ C;  2FFD A;  3ZN1 A;  4FM1 A;  3FD9 A;  5LMN B;  4PD4 F;  4CZZ A;  1NBM G;  4P30 A;  3GLM A;  1SQQ H;  2Q7E A;  4UV8 A;  4DW0 A;  4F6E A;  1MZF A;  3M91 A;  3OA7 A;  3K57 A;  2G38 A;  4LBE C;  1E1Q G;  1IK9 A;  1QGK B;  2DW3 A;  3CCR V;  3EFG A;  2W6J H;  4EKW A;  4IT5 A;  4ZI7 B;  2DW4 A;  5EIB D;  3CCJ P;  4PDV A;  4CC5 A;  3HKE A;  2IJH A;  1XL6 A;  3GF7 A;  1KB9 I;  2OTJ P;  1ZL8 B;  2X6A A;  1H2S B;  4NVP A;  3RYI B;  3IAO A;  2ZXE B;  1KQL A;  5AW0 B;  2YIB D;  3K0G A;  3GHG A;  2YXH A;  5E1A C;  3E1I A;  1LTT C;  1FDO A;  2X6C A;  2UXX A;  4EEQ A;  5AG2 A;  3HPL C;  1W5C E;  4RO2 A;  1BS3 A;  3DXR B;  3OMA B;  1S5H C;  3R4Y A;  1LTB C;  2NZ2 A;  4LFB O;  1AA0 A;  1T5E A;  3FYI B;  4X20 A;  5H5N A;  1COW G;  1MUU A;  2QIW A;  4ASU G;  5EFW B;  2PFX A;  3RL0 B;  3BAA A;  4L87 A;  1RM1 B;  3BHP A;  4L74 A;  3CLQ A;  2AXT E;  3ZRW B;  5B5E H;  4UB8 E;  1SLQ A;  2W8Z A;  1U7M A;  3TF5 A;  1IZN B;  1DF5 A;  2UXC O;  2V7Q H;  1HGV A;  2K9J A;  4GOF A;  1SQP H;  1AB3 A;  3RFR A;  5BR8 B;  4XA4 A;  2ZM6 O;  1EN5 A;  4PA4 A;  1NR1 A;  1QCE A;  2KG7 A;  1KFM A;  3JD0 A;  4DUZ O;  3AG4 B;  2NNU A;  4Y99 B;  1K3E A;  3L74 J;  1NTK J;  1NZ6 A;  5BY1 A;  1R3J C;  3T1C A;  5APU A;  4X9Q A;  3HD7 C;  4QNH B;  2XDJ A;  1SZT A;  2UU9 O;  4CPG A;  2K9Y A;  3UIA A;  4JI8 B;  2O1K A;  1KMI Z;  1QQC A;  1YHQ P;  1SQB E;  4H0L B;  2OCC C;  4R4M A;  3USS A;  1JY2 O;  4DV1 O;  1QLE D;  3OTF A;  2AXT Z;  4EB6 B;  1M57 C;  3E8F A;  2WIT A;  3VP8 A;  3Q4H A;  2A06 D;  4JI1 B;  3D8C A;  1I08 A;  1LTS C;  1SQX E;  4OX9 B;  4NR1 A;  1XMO B;  2WLN A;  3T1Y O;  1FE6 A;  2P4K A;  2CH7 A;  4DV2 B;  2BEZ F;  1VQP P;  2E5L B;  4OXS A;  2CDY A;  4O9B A;  2NPS A;  4UB6 H;  3LNM B;  3FGA D;  2ATK C;  5IYC O;  2CGN A;  5B1A C;  1N86 A;  2CK3 H;  3RN4 A;  1XNR B;  5CBF A;  3M0D A;  3N2G B;  1Z5V A;  3W7T A;  1GN4 A;  5DED A;  1SQQ J;  1XEQ A;  4R50 A;  2V7Q G;  1SS1 A;  1MZE A;  3L70 D;  1N73 C;  1B06 A;  5IJ9 B;  3ABV C;  1KB9 E;  3AG2 C;  2PGD A;  2HEP A;  3T1H B;  1M7L A;  2QWR B;  1BGY E;  3A0H H;  4OPA A;  3AE8 C;  2BE3 A;  3CRA A;  1E1R G;  2HJF C;  3L72 H;  4JI4 O;  1BHA A;  2I1K A;  4G2K A;  4IL6 Z;  1LT9 A;  1HDJ A;  3M9Q A;  2AEM A;  1OCC B;  5B5E E;  1K5Q A;  4O4L B;  4LF6 B;  3VQW A;  5KUM A;  2KB1 A;  1BSM A;  3FAV B;  5B1B B;  2FL4 A;  3D3I A;  4MVM A;  4R7C A;  1M1J C;  1WMK A;  1PZQ A;  1EM1 A;  4ICG A;  3FB7 C;  4PJ0 Z;  5IYB O;  3RWR D;  1SA0 B;  1CZQ A;  2Y0P A;  3S9O A;  2WLI A;  1LT1 A;  1YF2 A;  3P3N A;  2HVK C;  3ZHV A;  2O01 N;  2L6L A;  4OGQ D;  1FAF A;  1FBM A;  2XTA A;  3FKS G;  3Q4H B;  1HR0 B;  4JTD B;  2E75 C;  1AJP A;  3UQ8 A;  1M1J B;  4YPC A;  2E42 A;  2KLU A;  2QE7 G;  2RKL A;  1WN7 A;  4YJ3 B;  3C1L A;  3FX0 A;  2EZO A;  1FZF A;  4TOI A;  2QGN A;  3L71 H;  4J11 A;  1XTG B;  2QJP C;  5J2U B;  3RL0 g;  2QWO B;  4F6R B;  5LGN A;  5L8R J;  3TNU A;  4LC1 A;  4Z1M G;  1YJN P;  4O4H A;  1NJI W;  4PV1 C;  3G4S V;  3IFX A;  1YDX A;  1P4R A;  2B88 A;  1L0N G;  1F4N A;  5CA3 A;  1KQG B;  2MJZ A;  2KOG A;  2BCC J;  3L71 G;  3O8Z A;  1VQ9 V;  2IBZ I;  2XV5 A;  2NLJ C;  3CJH B;  3JAT B;  4QE7 A;  1W2B U;  3L4F A;  4FLZ A;  3T2M A;  4UB6 E;  3RGB A;  1GM8 A;  1YXB A;  2N1T A;  5CBO A;  3N2K A;  1H38 A;  3L73 D;  5AVR B;  4IYH A;  1NTK E;  1R73 A;  4PD4 E;  1SFC B;  1UFI A;  1JOC A;  1NHL A;  1CPY A;  3IN6 A;  2WSS G;  2KK7 A;  2LR2 A;  2ZIO A;  3RK3 E;  1VQO P;  3P30 A;  5IY5 B;  3CXH H;  2KLV A;  2NPS C;  1R3L C;  5GTI Z;  1XDC A;  3AK3 A;  1S76 D;  3P8M C;  3OUF A;  1EZV G;  4GDO A;  2LO1 A;  2IJJ A;  5D5Q A;  3CX5 H;  3WU2 H;  3MTU E;  1XMQ O;  3OW2 O;  1K4D C;  2CTW A;  4FFB B;  2GV9 A;  3P3P A;  4MTF A;  3OR7 C;  1KC8 W;  4O4J B;  1JMM A;  4X64 B;  5LA6 B;  5J2U A;  4OPH A;  4LFC B;  1YIJ P;  4H44 D;  3AED C;  1URF A;  3GHG B;  5DJU B;  1SF9 A;  1LTJ A;  1UPG A;  4CS3 A;  3K3W A;  4I7Z B;  1F7Y A;  3JAL B;  2P90 A;  2ZT9 D;  3E7K A;  5M1B A;  1TAE A;  2IZ0 A;  3PLN A;  2ZE8 A;  3OEE G;  4BIZ A;  1FZG A;  2M0B A;  1HNX B;  3OFN G;  2Q7G A;  1AIL A;  1NTZ D;  4C7N A;  2ZCE A;  4HAM A;  3CCJ V;  1J2J B;  4DV5 B;  1NGM B;  3ETE A;  3L74 D;  3ZMV A;  5AVZ B;  2F1M A;  1LJ2 A;  1LTI C;  2IJK A;  5EBW C;  2PF4 E;  3BCC E;  5CA1 A;  2XND H;  3H1H J;  1I0H A;  1KC8 Q;  4YY3 B;  3CD6 V;  4O4L A;  4K35 A;  2YS8 A;  1H0T A;  4X1Y A;  3OW2 U;  3S3X A;  2ZNI A;  1EZV E;  1EN6 A;  4GX2 A;  3ZHS A;  1DIP A;  4H44 B;  4UUJ C;  2IYO A;  5EYP A;  1J1D B;  4X1I A;  1SVF A;  1NTZ E;  3H1L H;  2JP3 A;  1URQ B;  2F23 A;  3O65 A;  1KOR A;  2OYQ A;  1PPJ G;  5B1O A;  1Q7Y W;  3EHB B;  3CEI A;  1EZV I;  4U3F G;  1JJO A;  3U11 A;  2V1D A;  3OR6 C;  4D7S A;  1M93 A;  4RKU J;  2GUZ B;  3ASN C;  2EJ7 A;  1N7S D;  5C39 A;  1T3J A;  1AQT A;  1DX7 A;  4U3J A;  1PGJ A;  2YKQ A;  2ZVO B;  1U57 A;  4R8C A;  5IYD O;  1E79 G;  2ITC C;  3RYI A;  4ZBM A;  1IBM O;  2WSE H;  2OGU A;  3STZ C;  5FPR A;  3T97 A;  4IL6 E;  4W4L A;  1EC5 A;  1Q86 Q;  2CH7 B;  3L72 G;  2ZT9 C;  1NYH A;  3L70 J;  3V4W A;  5JVD A;  2B5U A;  4BAY A;  1ZRT E;  1WNS A;  1AR1 B;  1D2D A;  4FZ1 A;  1JMB A;  1NS1 A;  2XAF A;  2ZQM A;  1FFT B;  3OTO O;  1JY2 N;  2OIE A;  1SQV H;  2D3O W;  4WY4 A;  3AEE C;  5KA5 A;  2H43 A;  1VF5 B;  4EOT A;  2YDE A;  4YXW H;  2E5L O;  1T2K C;  5L3C A;  1IJD B;  1K33 A;  1Z5W A;  4XE5 B;  1AVY A;  4WF9 V;  4JI7 O;  2P10 A;  5AVY B;  1G1X B;  1PP9 E;  4NB5 A;  2ZKO A;  2WLL A;  1URQ A;  2FFD C;  3CX5 I;  5KHH A;  1S4X A;  1JPX A;  1E5W A;  5CCH A;  3WUV A;  5JQG B;  3MAQ A;  4PDR A;  1HJ0 A;  3TNU B;  4JBZ A;  3BEH A;  4AHC A;  2A45 H;  3HRN A;  1JUN A;  3CX5 F;  4DR7 B;  2R9A A;  3K5O A;  1OVU A;  1SQX J;  2EX3 A;  2HHH B;  1VP7 A;  3SYA A;  5L3F A;  2EIK C;  1XMO O;  2RDC A;  3JSL A;  2ZM6 B;  4DR2 O;  1LUV A;  3ZMS A;  2GA1 A;  3CCS V;  1LTG C;  5IE9 A;  5EIB C;  3OUS A;  3RYH A;  1PP9 D;  5LHG A;  3E22 B;  1DEB A;  4PA6 A;  1NAF A;  3W7S A;  1SQQ G;  1ZLZ A;  2ITD C;  3DSQ A;  5IT9 N;  5LXT B;  1KB9 H;  3Q3D A;  2VRS A;  4BWA A;  2DE0 X;  5B1A B;  3RYF A;  1V9P A;  3L74 G;  1H89 A;  1AVO A;  2WSE J;  1LR1 A;  2ZXX A;  3CXH D;  2BOB C;  1Q86 W;  4U3J B;  2JRI A;  1MKM A;  5ITZ B;  2FYN B;  2WLH A;  3ZIA G;  2UXB B;  3CCV V;  4N23 A;  3RK3 B;  2JS5 A;  3ETQ A;  4FLT A;  2DYS B;  1M4U A;  4K8Z A;  3CD6 P;  1PL4 A;  2YXQ B;  1WJZ A;  1OZH A;  2H8P C;  3TDK A;  2ZYG A;  2I8D A;  1FDM A;  4DV4 O;  3Q5P A;  1GW4 A;  1NOH A;  3FWL A;  2FYN C;  2KI7 B;  4OH8 B;  1RH5 B;  3V2P A;  2AZ2 A;  4LF9 B;  4D6T J;  4WB4 A;  4DUY O;  5B66 Z;  1SQV G;  3CCE V;  1JCC A;  2H89 C;  4DR5 O;  3W7W A;  3CRC A;  4XDK A;  2HFE D;  3K5M A;  4I2L C;  4UFZ A;  4FFB A;  1HBW A;  1PFI A;  2Y69 C;  1NTK H;  3VP9 A;  4GOE A;  2A06 H;  4MS2 A;  2XHB A;  2MKV A;  3K58 A;  1S3J A;  2BAS A;  3HUS C;  4KT0 J;  4B3T B;  4N3Y B;  4OX9 O;  4IOI H;  1S1C X;  3B5N B;  5BU8 B;  3ZX6 A;  3AG3 C;  1K9M W;  2J58 A;  4L76 A;  4ZOL A;  2JEX A;  1OV9 A;  1RSO A;  1H2L A;  3H1J H;  1V55 C;  4ZKU A;  2DWD C;  2XAS A;  3JAM N;  2PTM A;  3CWB E;  3G71 V;  3KZI E;  1VDF A;  2WPR A;  1DF4 A;  4RUF A;  3WUU A;  3RL0 D;  1BGY D;  1W2E A;  4LF5 B;  1OCZ C;  3ZMZ A;  3O6Q A;  2IU3 A;  4JYA O;  3AE6 C;  1N33 O;  2CGO A;  3F5W C;  1EXJ A;  1MA1 A;  4XDL A;  3V2R A;  1LUW A;  3JAW A;  2P5O A;  2WLI B;  3K79 A;  3I56 V;  2Q1K A;  5BU5 A;  4E2L A;  1NVP B;  5B66 H;  1AI6 A;  2IX7 C;  3R2P A;  1SQB G;  4JF7 A;  5ITZ A;  2XND G;  1FDI A;  4PI2 A;  1KIL B;  1PP9 J;  4MVO A;  4P2Z A;  5B66 E;  2N9B A;  1SQB K;  2O01 H;  3WG7 C;  3E8G A;  1UII A;  1HH0 A;  4MW8 A;  4LGD E;  2HJD A;  1N36 B;  4KL1 A;  1MG1 A;  4Q20 A;  1TA8 A;  1D5N A;  4X64 O;  3A8T A;  4P9P A;  2RN0 A;  3F5H A;  2JGD B;  1SP4 A;  5KHI A;  1JEK A;  2GUS A;  5KLI C;  3I55 P;  1BZK A;  1QL1 A;  5L3E A;  2BCC G;  1VQL V;  1EN4 A;  1K8A Q;  1GN3 A;  2Z3Y A;  1LWU B;  3CC7 P;  4X89 A;  3THO A;  1NAY A;  1H0T B;  2Y9Y A;  2W0X A;  2OTL V;  3U59 A;  1OW8 A;  4J7Z A;  5CA1 B;  3H9V A;  4NXM O;  1QEX A;  2QRX A;  2K9P A;  3QO7 A;  3CC4 V;  3CE2 A;  3R66 A;  1DH3 A;  1AI4 A;  3AEC C;  1PGP A;  2X7R B;  1BSN A;  4CH3 A;  3CCR P;  3S1K A;  1U7J A;  1WLE A;  4TV8 B;  1IFI A;  1P7B A;  1ZP0 C;  4J9Y B;  4GKJ B;  1RE3 C;  5LGU A;  4NTW A;  3LDE A;  2KUB A;  5AVW B;  1Y74 A;  1GD2 E;  3PP5 A;  2M5A A;  3VOU A;  1PL5 A;  3FAV A;  4B3M O;  3BAT A;  4U3F J;  1G1J A;  3E8B A;  3ZRV A;  3AE1 C;  2C9N Y;  3BFR A;  4FK5 C;  2FY8 A;  3RYC A;  3BAB A;  2M3E A;  2CTR A;  3B71 A;  1JM0 A;  3VMX A;  1BL8 A;  3H1K J;  1FXK B;  2HOD A;  1QL2 A;  1RHZ B;  2N74 A;  3LSQ A;  3V2N A;  4X62 O;  5JVD B;  1NTM H;  2LW7 A;  2XAH A;  1IUR A;  1Z2G A;  4WY4 D;  2OAR A;  5IWA B;  1OX3 A;  3E35 A;  3I5D A;  2R44 A;  5CCG D;  2CTQ A;  3L75 J;  3TK1 A;  1Y4M A;  4E4E A;  3NFQ A;  4EFE A;  1L4A D;  1NI8 A;  3U1A A;  4C7U A;  5H2F E;  5KAF Z;  4MTG A;  3ZN0 A;  3V5B A;  1SES A;  3GWK C;  3PN1 A;  3ZHT A;  4UCU A;  1FJP A;  5A2Q N;  2J59 M;  1ZXG A;  3OTO B;  2N9Y B;  3CPW U;  1IFM A;  4PD4 H;  2KSE A;  5AW5 B;  5KTB A;  2ZYA A;  4DJG A;  1HNZ B;  2YMY A;  3VQY A;  1JMK C;  2V4D A;  1J1E B;  3GG2 A;  4GUN A;  3ZRW A;  3M06 A;  1TU3 F;  2EUL A;  3JCU H;  3ASO B;  2ETN A;  4CH5 A;  5KJ7 C;  4LFB B;  5GON B;  1HWT C;  3SYP A;  1QR8 A;  3B09 A;  2PAJ A;  3OAK A;  4O4I B;  3DTU B;  1KV4 A;  4I6M C;  3GHG C;  2QJY B;  5BMV A;  3DC6 A;  3VBB A;  1S72 P;  3IC9 A;  3X2Q C;  3UT5 A;  1VQM P;  2QKC A;  5CCG A; 
#chains in the Genus database with same CATH homology
 3SFE C;  3AE8 C;  3Q3D A;  4IL6 X;  1NGM B;  2E74 C;  3Q1M A;  1VL2 A;  2O01 J;  1JB0 J;  1PIX A;  2WSE J;  1OMI A;  2D2C C;  3IAO A;  3D6Z A;  1OW8 A;  1GMJ A;  2QJY C;  1MKM A;  1RQU A;  2WQY C;  4R4L A;  4YXD C;  1FDO A;  1UIX A;  1WMK A;  1ZME C;  2G3A A;  4H44 B;  1KIL E;  2WSF J;  3AEC C;  1DIP A;  3S9O A;  1EXI A;  1OW7 A;  4Y28 J;  2JP3 A;  3R4Y A;  1KOR A;  4PV1 D;  4OGQ D;  2D2C B;  2NZ2 A;  3Q5P A;  4TT3 H;  1ZP0 C;  2E75 C;  2FYN C;  4Z1M H;  3GF3 A;  3EWK A;  1VF5 C;  4RKU J;  2QIW A;  3Q5S A;  4H0L D;  1PL5 A;  2WSC J;  1Y9B A;  4OGQ B;  1U57 A;  2FXP A;  2QJP C;  4H13 D;  3AE1 C;  2H89 C;  1OW6 A;  2WPV B;  4H13 C;  5L8R J;  3RL0 g;  3H25 A;  3Q5R A;  3B71 A;  3G9R A;  3SFD C;  4PV1 C;  5KKZ C;  2JO1 A;  2ZT9 C;  3LW5 J;  1KQG B;  2YMK A;  3AEG C;  1KTM A;  2QSI A;  1NYH A;  3D6Y A;  2MKV A;  2E75 D;  4KT0 J;  3AE2 C;  1ZRT E;  1S1C X;  2J5U A;  4I7Z C;  1KQF B;  2ZT9 B;  3T97 B;  4PV1 B;  1YQ3 C;  3AEF C;  2D2C D;  3AEB C;  2FBW C;  2OQQ A;  2K9Y A;  2E75 B;  2E74 B;  3AE7 C;  3AEE C;  4U7J A;  1VF5 B;  1KMI Z;  3AE9 C;  2G8Y A;  1RQV A;  4H0L B;  3AE3 C;  4R4M A;  1ZOY C;  3IN6 A;  3AE5 C;  1S5L X;  3O6Q A;  3RK3 E;  3AE4 C;  4H13 B;  1IK7 A;  2P10 A;  2E76 B;  3AE6 C;  2E74 D;  4GDO A;  1AJY A;  1EXJ A;  1VF5 D;  4OGQ C;  1DD4 A;  3D71 A;  3D70 A;  2BEZ F;  1PV3 A;  1YQ4 C;  1K05 A;  1HJ0 A;  4H0L C;  1HF9 A;  2E76 C;  4H44 D;  3AED C;  2E76 D;  3GLM A;  4H44 C;  3FGA D;  1TU3 F;  2V7Q J;  1FDI A;  4I7Z B;  2H88 C;  3AEA C;  2ZT9 D;  1Q90 D;  3C8V A;  2YIU C;  5M1B A;  4YTP C;  4XFJ A;  2IDB A;  3Q2Y A;  3ABV C;  3GMA A;  3GF7 A;  1K04 A;  1DD3 A;  5KLI C;  2QJK C;  2BEQ D;  1R8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...