4PV1B

Cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport/inhibitor
molecule keywords Cytochrome b6
publication title Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
pubmed doi rcsb
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4pv1B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4pv1B01
2QJPC 4I7ZB 2E76B 2D2CB 2WPVB 1VF5B 5KLIC 5L8RJ 4KT0J 2QJYC 4H0LB 2K9YA 5KKZC 2QSIA 2WSFJ 4IL6X 2ZT9B 4RKUJ 1JB0J 2QJKC 4H13B 4H44B 2E74B 3LW5J 1S5LX 4OGQB 4Y28J 2E75B 1ZRTE 1Q90D 2WSCJ 2YIUC 2O01J 4PV1B 2QIWA 2FYNC 2WSEJ 3C8VA
chains in the Genus database with same CATH superfamily
1V54C 3SR2C 1BGYJ 4X66O 5GTIE 4GX2A 3K57A 1LT9A 3VQWA 5KX5A 3TDKA 3L73E 3TNUB 4R50A 1I94O 3L74E 5J2TA 3RVYA 3SPCA 1IJDB 2F95B 4JYAB 3DC5A 5DJTB 4YJ3A 2IBZI 5EFWB 3M0DA 2W83C 2FMLA 5B1NA 3VYIA 5EC1C 2F23A 3JAMN 1Q86W 4HAMA 1BE3J 3JD0A 2L5GB 2GSMB 2P10A 1VQLP 2EIMB 3J81N 2EX3A 3W7XA 3K59A 2E5YA 4DV7O 4B3MB 3ABMB 1I7FA 4C7UA 3E8BA 4N21A 2ZKOA 2UUBB 4H33A 1BCCD 3VMAA 2JGUA 2H89C 4LC1A 3HR0A 1SQVG 2KXPB 2EIMC 2AHYA 1QVGO 1IBMO 2WSCJ 2YXRB 1KQSU 3IF4A 5APUA 2O01J 1W2BU 2VQFO 1KB9E 4BRYB 3FX7A 1R3IC 3ABMC 2IJJA 4EIJA 1BHAA 3JSLA 2V7QG 4JI1B 4Y99B 1CXZB 1AI6A 2WT7A 3JD4A 5B1AB 2X6CA 2ETNA 4DUYO 3BRTB 2QM8A 4JV5B 3GB7C 2QSIA 1KFMA 1S5LH 4PJ0E 5EIBD 1QX8A 4EYYQ 2BASA 1LTJA 3SYOA 4EFEA 1RF0A 5KJ7C 1K8AW 3EXAA 1QCEA 4Y99C 1MZFA 4UUJC 3L74J 3TXQA 2CGOA 5B1AC 1GN2A 3V4QA 1ZUQA 5L3DA 1ZMEC 3LDEA 5DJUB 2Q7HA 4JBZA 3CC4P 2IDBA 2I1JA 5AVVB 4I7ZB 3AEGC 1GN3A 1PP9E 2ZQMA 4FZ1A 2YMKA 1BGYG 3K5BA 5TJHA 1WB7A 1WN7A 5JH7B 3T97A 3OMAB 1Y76A 1GK4A 1QLED 2E76D 1LUWA 3K5MA 2XNXA 2ZR3A 1RQUA 4DRXB 4Z1VA 5KLVE 2QDOA 2OYIB 1JTHA 1NAFA 3CCVP 4NPFX 1NTME 1YTFB 1EBOA 4I7ZC 4TV8B 4DR1O 5EZYB 3M0AA 1IXMA 5BR8O 2FB5A 5FNVB 4LFAO 2R5DA 3R4YA 2L35A 1NKDA 1RH5B 2IYOA 5JVDA 3H1KE 4FM2A 2JDIG 2OYIC 3LSQA 2AEMA 1G6UA 2ZFCA 3IR9A 1DEEG 1BSNA 3QO8A 3TXSA 1SFCA 5CB4B 2JVDA 1QVFO 1JY2N 1NBMG 4CH3A 4JQ0D 1FXKA 2WLJA 2ZNJA 2ZXWB 4CPGA 2K37A 5EK0A 4GX5A 4FZ0A 1URQA 4WCEV 5B1BB 3MZWB 5TISE 2NR5A 4BWNA 1Y66A 5IYZA 1RY3A 4B3SB 5JJJB 3Q5RA 2H8PD 3G6EP 1P7GA 4R7CA 5CBNA 3DSQA 4NTYA 1MA1A 3WU2Z 1JCHA 2N74A 4FLWA 4I50B 4QE7A 4WBNB 1PPJG 4MSWC 3OM3B 5B1BC 3BCCE 3MDSA 2NPSA 1GAXA 5L3CA 3L72E 3BVHA 1XDCA 4RWUA 3EHBB 1HNZB 1K4CC 3B2EE 2L91A 2N1TA 4I55A 4CC6A 4DYLA 5IJ9B 4OX9O 1E1QG 2OT5A 1W0JG 4XDJA 1BSHA 2KYVA 1VQ6V 5KLVJ 2GUZB 2LXCB 3HD7A 1LT1A 3OAAG 1IFMA 2ZXXA 4QPJA 3K79A 1PNKA 4IIJA 1ZLLA 3LDDA 4IHJB 1VQ7P 1NWQA 2HVKC 2Q8VA 2IYPA 1SQQE 2ZT9B 1IVSA 3CXCU 1HBWA 2KK7A 5C8YB 1K73W 1LTTC 2QJYB 3K9AA 3OR6C 4JGSA 1FFXB 5LMNO 2PGDA 5AVXB 2P06A 5BZBA 4YHHB 5L3EA 3JAWB 1M7LA 2DYRB 1S3JA 2RKLA 3VMYA 4DR5B 2RN0A 2W0FC 4DR7O 2YMYA 1BT8A 4HNAA 2QG4A 3MHSC 2A06G 5JQGB 2ZT9C 2WLIA 1GM8A 1USEA 3H1LD 1W0KG 2JGDB 3JALA 1FDIA 2QJYC 4PA4A 3H6PA 3Q4HA 1SETA 1FDMA 3JD1A 1NU1E 2DYRC 1O9HA 4DXWA 1PL5A 3J80N 4JI5O 2Q73A 2GDSA 3AEFC 4MTFA 4GODA 4X65B 3U10A 5LP6B 3A2FA 3H1IH 2BE3A 4LWSA 1X8YA 3A7OA 3HKBA 2H43A 3ZX6A 1BDCA 4XA4A 3IFXA 4ZBMA 3HKDB 5KMGA 1L0NH 1FJGO 1RSOB 1SRYA 3UM7A 1F51A 3ZRXA 1KILD 4AQYO 4ZMDA 5LP6C 2ZYGA 4J10A 3UKMA 1HWTC 3S3WA 3KPEA 1IFDA 3Q2YA 4DUZB 1YJNP 3ZMUA 3FAVB 2P1JA 4WBAA 1AFOA 2LJ2A 1BCCG 1VQ5P 1GO3F 2AZ0A 4YIPA 1SERA 3M9BA 4X1IB 1FPOA 5AVWB 4I0XA 1YDXA 2Y0PA 4WFGA 3I5DA 4MVSA 4L87A 4FK5C 1L0LE 2I8DA 1KQFB 2WPSA 1H8AA 2Y4UA 4MVQA 1LGHB 2HYNA 1GL2A 4MT8A 1JMBA 4IYIA 2JJ2G 1LP1A 3MUDA 1VARA 2ZM6B 3B71A 4WY4C 2ZE8A 4LF8B 4YY3O 1PZQA 3LNNA 4QIWF 3T1HO 2FKWB 4I4TA 4U3JA 4Z2WA 3CMAP 4Z1MG 1RM1B 2BEQD 3CC4V 2Q6AA 1W59A 4G2KA 1G2CA 3Q1MA 2BEZF 2WPVB 1SQVH 1H0TA 5EBMC 3JC22 1JUNA 1IC2A 3JD3A 1S5LE 5LGTA 2YO2A 1HTLC 2VRZA 3CCVV 1WNSA 1RM1C 2V7QH 4BW9A 1N0JA 2OTLP 3APQA 4JI7B 1WP7A 4YXWG 3FYEB 1EN6A 2HG5C 4FMTA 4GX1A 2KKWA 2K88A 5AW2B 3A0HZ 1EZVD 4HBNA 1KP2A 3JATB 3OUFA 1T3UA 1SQXH 2DJVA 2WLNA 3RYFB 1HNWB 4JI1O 1I08A 5KJ7D 4BXLA 1RFYA 1KQGB 3G80A 1VQ8P 1L0LJ 3CS5A 4QNHB 1RE3C 4DV6O 3MP7B 3E1RA 4ABMA 1Q6HA 1SQBJ 1KP3A 3E8FA 4YTPC 1I5XA 1IFNA 1QL1A 3RK3B 1DIPA 5DECA 3AE9C 1PV3A 2YKQA 3VP8A 1K92A 4X66B 3BHPA 5KA6A 1EDKA 1GZLA 1NJIW 1OMIA 1I0HA 2Q0AA 2YEVB 1I94B 4H37A 1Q86Q 2CPBA 3T1YO 3AG4B 3JSNA 3RK3C 2IBZH 2LGQA 2YICA 1XTGB 4K0KB 1LT9B 5KX5B 2KLVA 5CCGA 2JDIH 3V2PA 2WLKA 2O57A 1PFIA 3QG5A 4LF6B 1AROP 1V55B 2QJKB 2ZJSE 3AG4C 3K08A 1YTFD 3SYPA 3A0HH 2N04A 1IK9A 2JO1A 1DF4A 1FOSE 1BSMA 4DV7B 2HKOA 4YPCA 1XILA 1LT9C 2ZVOB 1FOSF 4QGPA 2OCCB 1CI6A 1VQ9V 3D8CA 5H5NA 1H2SB 3CWBH 3OUSA 2XKMA 4N3YB 1QR8A 3CCUP 1V55C 3K58A 1LTGC 2CPSA 2QJKC 2IZ0A 2ZXEB 1NOHA 4OVNF 2WSEH 4DV4B 1IBMB 2AEFA 3ABKB 3WUVA 4Q6GA 3I55V 1PPJH 3CCQV 1Q43A 1GTWA 3A8TA 2VQFB 2ADQB 1K8AQ 2OCCC 4F6RA 1DH3A 1DLBA 1S77D 2XASA 1M1JB 2W90A 4B3SO 1T6AA 3ABVC 4X8AA 4QJFB 4DUYB 2OTKE 5KHKA 3FWNA 3H01A 1BMFG 3ABKC 4JYCA 1EDJA 3CD6P 1KYOD 3H1LG 2KP8A 2GM4A 4W4LA 1VQNP 1DTOA 4J9YB 3WG7B 4U3FD 1SF9A 1M1JC 3H1JJ 4N78D 2GV9A 5H2FZ 2CH7A 3WUUA 4PD4D 1GTOA 1N7SA 2OWOA 4OXSA 3SJQC 1L2PA 3APOA 5IYCO 1JEKA 1QLEB 3WG7C 1AQTA 1XTCC 1XNQB 5CJ0A 2LO1A 3S4RA 5KHHA 5BXZA 3OEHG 3UO2A 3V5BA 5AW6B 5GTHZ 3CXHD 3FB6C 3MAQA 1K5QA 3OW2U 5BVZA 1RF0C 3PN1A 5IT9N 1USDA 5E1AC 1ZLZA 1U96A 1VQ5V 3H1IE 2IJKA 1GRJA 1QLEC 2ZT9D 5AVUB 2YIBA 1T8ZA 4TUYA 3O8ZA 4ZOLB 5KUKA 1L0NE 4YHHO 1GK6A 2B87B 3CCSP 4CC5A 4DR5O 1JNMA 4HKZH 1X4TA 5J2UA 2GUSA 1QBZA 4KP4A 2B88A 4EOTA 2ADPA 4RESB 5JVDB 1W5CE 4LNUB 4P30A 1N36B 4YIOA 1OVRA 4FFBA 3EFGA 3NTNA 5D5PA 1MKMA 3TGUJ 2A9HA 2G8YA 3P8CD 4UCTA 3BATA 1SQPH 1FXKB 3HKCA 4O2BA 2AXTE 1URQB 3OA7A 5FPRA 1D5NA 2YSUB 3CRQA 4GOFA 3UQ8A 1PL0A 2R72A 4HH2A 1BCCH 2CDYA 3HRNA 4N6JA 1SFCC 3L75H 2LR2A 1GU5A 2KB1A 3AK2A 1Z56A 2LXBA 4PA9A 3SYAA 1FXKC 3K0GA 1URQC 3LW5J 1IBLO 2OTLV 1OVVA 2V1DA 5LMUB 1S5LX 2YO3A 2D2CC 2W6JH 2E75B 1QNMA 4TOIA 2QJ1A 1K73Q 4I9WA 1BE3D 3D6YA 3B09A 1R73A 1NO4A 3CX5D 2N1TB 2KSDA 3E35A 4NXMB 1EZVG 1SQVE 2XHBA 3KZIZ 4AI8A 1ZWIC 4WY4D 1WJZA 2E75C 1L0NJ 1AI5A 1M57C 2GHYA 4M3LA 2YDEA 1VQ8V 3M9HA 4QMAA 2Z3YA 4KXRA 4HJGH 1N33B 4WF9V 2N1TC 1YJ9V 5LMNB 1P49A 1GN6A 5LL6Y 5LA6A 2ZM6O 4NVPA 5CBFA 1VQKV 1Q3EA 4LF8O 4GKJB 3CSXA 2FYUE 2WLLB 2XU6A 4PD4I 2B9BA 4DR3O 1S76D 2PP6A 1Q7YQ 3AG2B 1PIXA 3L9DA 1JOCA 1SQXE 3FX0A 1JY2O 4FIPC 5IY5B 3TF5A 1YTZT 3ZRWA 2ZDIC 5APVA 1M90Q 4MTXA 5ITZB 1Y67A 3W7WA 2XAJA 2GBOA 4FM1A 4NTXA 3ZEDA 4EFBA 3HKEB 1NS1A 4JI5B 2YKPA 2RQ6A 4MW3A 3AG2C 2E43A 5KTBA 3L74D 2WPRA 3N4XA 1X0TA 1FC2C 5IY5C 1AP5A 1HJBA 1XHXA 4MTOA 1JJ2U 4JI7O 4NTWA 3GMAA 1FJGB 4K3AA 3CMEP 2AW9A 1HWYA 2P6JA 4LWSB 1VF7A 1OJHA 1BQ0A 1DD4A 4C7NA 4ZHQA 2IBZE 4W4KA 1MMMA 3AEBC 1X9VA 5EYPA 1J1DB 1VQ4P 2HVJC 3R65A 4FLVA 1VEWA 1JVMA 2ATKC 3GHGA 1H88A 1FYJA 2P58A 4GLXA 1NTZH 5LXTA 2Y0EA 3HE4A 4CS2A 3A0HE 2ZIMA 1NTKH 5AW7B 3RK3D 1J1DC 2R9IA 3CP1A 1K7DA 4OPAA 2E42A 2KIKA 2O1KA 1KB9D 4L75A 2DMXA 2FYUJ 3CWBE 2AHZA 1QR9A 1J5EB 1I5YA 3NMDA 3V6IA 3G67A 3RYCA 3CD6V 2QA4V 2ITAA 1VQNV 1WP8A 2QJPB 4RUFA 1XL4A 2JEEA 2JEXA 3FGAD 1KD1Q 1AP6A 1YVWA 3ZRVA 3QNEA 2LFRA 4YJ2B 4YY3B 4DV0O 4K0KO 3B5NA 4DV5O 3T1HB 1ROPA 1GN4A 4U3FG 3AG3B 4RQFA 1IO4A 4LF6O 1PNLA 3CX5I 2BCCE 4TSFG 3I56V 2QJPC 3RK2D 4O4LB 4GX0A 1P84D 2Q7EA 1GL2C 3EVKA 4I4TB 5H6RA 3AG3C 2QWPB 3G3ZA 3F89A 5BU5A 2JEUA 2XUMA 1OFCX 3MUDC 1JB0J 2M6YA 2CAZC 1NH4A 1K05A 3JAKA 1LUVA 1MOFA 2HJFC 2YI8A 3BPZA 3SPGA 1Y74A 2Q3EA 5KLVD 4DV4O 3E2EA 1K4DC 1T2KD 4JF7A 3DXRA 3A2AA 1AVYA 2RCVA 1SQBK 4JAVA 3H1LH 1HUCA 4D6TE 1Q5OA 2JR8A 3H1HH 3CCSV 2QTOA 2M0BA 1MZEA 3U0ZA 2HJDA 1L8DA 4CH6A 1RPRA 1NJIQ 2HPCB 2CTQA 3K04A 3ZIAG 5B1OA 4DV6B 3G71P 3QO7A 5L3BA 2YXLA 1N73A 2PUSA 4YXDC 3F5TA 3HE5A 3JASA 2EJ7A 2YUAA 1YQ4C 2QVAA 1RP3B 3L73J 4L76A 4PDRA 1EXJA 3FB7C 3RFRA 2IPPA 2UU9O 2XAGA 3ETEA 2XZRA 3M8AA 4X20A 5K5GB 3BRVB 4IL6Z 1QLNA 1QGKB 1CZQA 3C3SA 2LFSA 3T1YB 2P4KA 1E79H 1FAFA 3GWKC 4WFAV 1K9MQ 2M3BA 3U59A 1XNQO 2BCCJ 4W7YA 3VBBA 2A45I 1A02F 2B1IA 2K1EA 2RNBA 3BCCD 3L37A 1XHZA 3L72D 1SQPE 4WFHA 3J7AU 5APQA 2Y4TA 4EI2A 2FFDB 4X1KA 1ZR4A 1JFFB 1KECA 3OT7A 4GCZA 3D71A 1EQ7A 1S2EA 2ZYAA 3TYYA 2XT9A 3E7KA 1FD9A 2ITCC 2R9AA 1BE3G 3W7TA 2WWWA 1K3EA 1BCCE 3UT5B 3L75E 2WAMA 2FYNB 4D6TJ 3CCEV 2Z5UA 2FFDC 3HB3B 4XBFA 2WSSH 1JQ0A 4ZIBA 2BTQB 1EN5A 4H44B 1XOUA 5GW7A 3AE6C 3B8EB 1FJPA 2DN9A 2VWJA 1N36O 2DW4A 2K9JA 1CP9A 5AG2A 1SQQD 3RYHB 4GKKO 3C9IA 3AEDC 1X79B 2UXCB 2FYNC 4UVBA 1SESA 1SFCD 1KORA 4W7ZA 1VQPP 4IOIH 3STZC 3CEIA 2DW3A 5KUMA 4IL6H 4H44C 1URQD 1F4MA 2D2CD 1JJOA 2EULA 1MFTA 3G4SP 3OTFA 3L71H 3B8NA 1L4AA 4RUEA 1YF2A 1PP9J 1EZVH 4TQDA 4UFZA 3HUSA 1FZCA 4J41A 2OYHA 4JTCB 5FL7G 3L36A 1ZRTE 5LMUO 2YXYA 2KSJA 2PYLA 1PGOA 3L74G 1GU4A 4KHPO 1Z5WA 3PRJA 2E75D 3CL3D 1M57D 1NTMJ 5M1BA 3AE2C 3CPWO 2VQEO 3FB8C 4BIUA 4NXMO 3T4DA 2P7TC 2N1TD 2XNDG 4JPRA 5IE9A 3L70E 2JIZG 4ZKUA 2XV5A 3H32A 1VQ4V 2BSKA 2FYZA 1YSCA 3H1KJ 4LF4O 2WA3A 5KA5A 5KAFZ 1R6TA 1Q6UA 3HD7D 3CC2P 2UXDO 2A45G 3VOUA 1N33O 1MV8A 1S1CX 3FKSG 4QPKA 1Z5VA 1ZW0A 1P4RA 3ZS8C 1FJKA 3FD9A 4QE9A 1Y6XA 4GKJO 2WSFH 1TAEA 2Q9LA 3WU2H 2E3CA 1KTMA 3S9OA 3P32A 1YITP 2ITDC 1L0LD 5B5EZ 4O4HB 2JP3A 4UB6Z 1SQBD 1XUQA 5AW3B 4KL1A 5J2UB 1A32A 5FLXN 4RQEA 3BCCJ 1US6A 1NTZE 5E79E 3L72J 4GYCB 4O4JA 1S9KD 3WB2A 1Q7YW 1NTKE 2R5BA 1VF6C 2J58A 1JY2P 1VQLV 2IH3C 1T3JA 4PELA 1M90W 1EZJA 3E1IA 3GG2A 5KHIA 3JYCA 1N8RQ 4TV9A 4I1LA 1RE4A 5IJ0A 1XREA 5APSA 4N23A 4PDLA 1AVOA 5CCHA 1JMKC 1IBLB 4LFBB 1KILA 1PP9G 1S72P 1ZOYC 1TVKA 1OW8A 1NVPD 1YYCA 2W27A 5KAFH 3L70J 1Q90D 3B8MA 5CHXA 5LYJA 3IAOA 3ETDA 2JJ1G 1SQQJ 1YI2P 2NNUA 2OCHA 1FKAO 2KNCA 3ZMZA 2H3OA 2PI4A 2KOGA 5LGUA 2W0XA 4WY4B 5KLVG 3X2QC 3D6ZA 3A3YB 2WPDG 4ZNCA 4U3FH 3K9SA 3RYIA 3QWOC 2VS0A 1E5WA 1G1XB 1JY3N 1J5EO 3VQYA 3SPJA 3ZDMA 3E22B 4JI2O 2QRXA 3CYOA 5GONA 4PD4H 4UB6H 2OTJP 3ZJZA 2JKVA 3EWKA 3MD0A 2R44A 2Z4EA 4JYYA 1SC5B 4B3RO 3VMZA 4LH6A 3H25A 4DR3B 1NU1J 3H1LE 1GL2D 1ORQC 3H1HE 2KS1A 5APWA 3JCUZ 5LA6B 1B3QA 3IGAC 5JCOA 3CXHH 1TUBB 5JJNB 1HGZA 1NTKJ 2EIKB 3ABLB 1SP4A 2G3AA 5H9CA 3AE8C 1KD1W 1GM7A 1YEWA 4MTGA 2J5UA 3ZRSA 5AVZB 2PI5A 3F5WC 5H6QA 3H1JD 1G4YB 3ZRWB 3ZHSA 2XAHA 2F4VB 5C93A 3BCCG 1RF1A 3RGUA 3T2MA 2EIKC 3L72G 3ABLC 1KILE 2IZ1A 4LBEC 3KQGA 3SFEC 4DV2O 3HPLC 2C9NY 5CA0B 4XFJA 1WA8B 2Q6QA 2M5AA 2P22C 1JPXA 2ZE5A 2QE7G 2XOKG 1HF9A 3SDLA 5KLIB 1M56B 2HFEC 2NLJC 3KHUA 1H8EG 3JCZA 3K3WA 4P9PA 3NXSA 1OCZB 1BGYH 1J2JB 2QTSA 2IX7C 5EBLC 5LOVA 1FZBA 2Y69B 1CPYA 3G6EV 1SQQG 4WVZA 2EZPA 1FS0E 1VQPV 1KQLA 4FVMA 5B66Z 1VQOP 5KLIC 1M56C 2XAQA 3O9OA 3CRRA 2W6IG 1ENVA 3H1HJ 1OCZC 4Q20A 2CTWA 2E5TA 4OWFA 2X0LA 4ASVA 2EINB 4NXNO 4DCKA 4DV0B 2LW1A 4PI2A 5LGNA 2Y69C 3TGUD 4DV5B 3P30A 1BE3H 5K1PA 1FAVA 2PAJA 4L74A 2A79B 1XNRO 3CX5H 1YHQP 5J9PC 2QGNA 3PLNA 3RK2B 3ZHUA 5JH7A 3AG7A 3W7UA 2WPQA 5APYA 5J2TB 1SKVA 3C8VA 5CBGA 5D5QA 3AK1A 4B7KA 2EINC 4YJ3B 2MKVA 4IL6E 2OYIA 1K9MW 3A5TA 3ICXA 5L8RJ 3R66A 2CTRA 5CCGD 1SZTA 4TV8A 5EZYA 2H7HA 2ILMA 1VQ7V 1AJQA 2WSCH 1JCCA 3L71E 3RK2C 5FNVA 2O01H 1EZVE 4BW5A 3SJBC 5EBWC 3M9QA 3B5NC 5BMVA 2FTKA 3HTKA 4JI0O 1VL2A 4AUWA 3C3TA 3M0DC 1THZA 2DQ0A 2VRSA 1HDJA 4H44D 5A9GA 1PNMA 4DO2A 5CB4A 1GMGA 1N34O 2HHHO 4R4MA 2UXCO 4DJGA 4JZGA 3CJHA 3U11A 3DGEA 1R1BA 1T2KC 3DXRB 1MG1A 5B66H 1ZXGA 1L0ND 1YITV 4UVCA 1X59A 5DN6G 1OW6A 4RO2A 1FXHA 3L74H 4FLUA 3LDCA 3QH9A 4MVMA 4UB8Z 2ZE7A 2WT7B 1L0LG 2DQ3A 2ZD9A 2P67A 3BABA 4J80A 4Y28J 2XDJA 4I50A 4WBNA 2UU9B 1SQBG 4CS3A 1KC8W 1DX7A 1SS1A 2EZOA 1XMQO 3V2RA 4PA6A 2HEPA 1EZVI 1LTJB 2UXBO 2BOCC 2ZINA 4FPPA 3K5LA 4LF9B 3WU2E 2WQYC 2A45H 4KJMA 2CE4A 2QR4A 5IJ9A 2MJZA 1R5LA 5IWAO 3QF7A 2LQTA 2K9YA 4FFKA 2GUZA 1N7SD 3I5CA 4DW0A 4X9QA 4EEQA 3MHHC 5APTA 1AJYA 1LTJC 3TCUA 1S72V 1YJNV 1LTSC 2A06H 3OR7C 2D3OW 3T97B 1Y76B 1AR1B 4WB4A 2LGWA 4BR6A 1XQ8A 1OCRB 4IHJA 3OMIB 1FZEA 1KB9H 4JI6O 1YI2V 1JTHB 2KB7P 2DYSB 4NB5A 2Q0OC 4P9OA 3B40A 4J9ZB 3ZHVA 1R6NA 4A7PA 4WFFA 1EDLA 4KUMA 1WT6A 1ZR2A 1U57A 1FFXA 4C7RA 4PI0A 1QVGU 4PV1C 2YI9A 1DEBA 2QKSA 2YIBD 1OCRC 2C2AA 4RKUJ 1MSWD 5TISZ 3CI9A 3AECC 2OTJV 1IDSA 4UB8H 2DYSC 2JJLA 5CMUA 1IBKB 4GKKB 2Y0DA 1SFCB 4ZKPA 1MZ9A 1NHLA 4DZOA 4AYCA 1P84H 3GWOA 3SWYA 1Z2GA 2WVRA 5H2FH 1OCOB 5LHHA 2EIJC 4DT0A 3CMAV 2MW2B 2QWOB 3ASOB 1UIIA 2K9JB 2D2CB 5AVTB 3BRCA 2FYUD 1CEZA 5IYZB 4U3FE 5KLVK 1AV1A 5L3GA 2WMMA 1ZAUA 5AW4B 1SQXD 1QU7A 3H9VA 1JMMA 4PD4E 5KLVH 1ZTEA 2YS8A 4UB6E 3HKDA 1OCOC 1PV0A 1NR1A 2DOSA 5GTHH 4PD4F 3ASOC 2FBWC 4LFBO 2YIAA 1RSOA 3E83A 2NPSB 3H1JG 4JASA 4LP8A 1M57B 3CRCA 4KHPB 3RL0B 3O6QA 1VMGA 1YJWP 2FXPA 3HUSB 1FZCB 2YKOA 4E2LA 2OYHB 1N86A 2VQEB 3KDPB 4I55B 4IFMA 1MSDA 1PKXA 1XEQA 1N8RW 2Z5HA 3BASA 3CXHE 3H1IJ 4PDVA 1K33A 2YIUB 3FAVA 1U97A 1SA0A 2ZE6A 3CXHF 1PGQA 2A3QA 2NPSC 4LF4B 3HD7B 4CBCA 4UCSA 1EM1A 4DW1A 1KYOI 1NVOA 4Z1MH 3RL0C 1IZNB 2UXDB 4FLYA 1IURA 2HLOA 2IBZD 4OH8B 3HUSC 1FZCC 2OYHC 3K0DA 1H2NA 5TISH 3QTCA 4LFCO 4IIJB 3T1CA 1MFZA 3S1KA 1EXIA 1NI8A 2LW7A 3OMNB 2YIUC 2R3SA 5L3FA 3IC7A 1IK7A 2E5LO 4B86A 2I1KA 4J7JA 3HD7C 2WA4A 3BA8A 1QVFU 2X7RB 3CCJP 2H94A 4JI3B 2RMKB 5K1XA 4UCVA 4H0LB 4YXWH 3P8CE 3N2KA 3KKYA 3SGIA 1SQGA 4DR2O 1ZN5A 4HNAB 2ARHA 3CXHI 3L73D 3CWBD 4DV1B 2WLIB 3ETQA 4LF5O 1YQ3C 1BGYE 1R3KC 4OGQB 3JALB 1GM9A 2PY5A 3TGUG 5AVYB 3Q4HB 5DEDA 2F4VO 1XMOB 2FKXA 4EB6A 1YZBA 4H0LC 1OHHG 2Q4PA 3WUTA 4B7EA 4CH4A 4J11A 2ZCEA 3VQVA 1SQQK 5AW5B 1S5JA 2HFED 3HKBB 4OGQC 2BCCD 4CH5A 1OCCB 3FFQA 3KZIH 1MABG 5KMGB 5CA1A 1NVPB 3FXEA 1NKNA 1IFIA 3CCUV 1SQVJ 3ZMVA 4ICGA 4TQFA 1Q2NA 4TT3G 3CX5E 5B3SB 1IZ3A 2Z0AA 4TV9B 2QKCA 3M7MX 1PL4A 2ODMA 3CX5F 2FY8A 2B9ZA 4GT1A 1M56D 4J7KA 2M7WA 1OCCC 2V7QJ 2Y9ZA 5FPOA 5CBOA 3E89A 4R4LA 2DE0X 2JS3A 2RN9A 1NU1K 1U7JA 2KZIA 3CB2A 4D7TA 1BHBA 2PF4E 5B3SC 4D6TD 1O9GA 2PZSA 1RE4C 2KNCB 1H2GA 4I0XB 2YXHA 1Q82W 4JI2B 5CCHC 3A0BZ 3E86A 1L0NG 1SQXJ 3CC7P 4DR4B 3KXDA 1HJ0A 1Y9BA 1M5IA 2Q68A 3SPHA 4B3RB 1GL2B 1PPJE 1OZ0A 3RBXA 1LR1A 3EFFK 2IH1C 1LP1B 4RJTA 3E8GA 5GONB 2JRIA 4DOJA 1GH6A 3SWKA 4BIZA 5B66E 4X64B 3TK1A 1H2MA 1G1IA 1M9NA 1S5LZ 4NKGB 4MN4C 3B5ND 4U3JB 2YC0A 4HB1A 2KS1B 1VQMP 4J42A 3B77A 3JARA 1PP9D 1ZL8A 4UCOA 1G2CB 2YIDA 3RGBA 2C0XA 4FLZA 4W80A 2C9LY 3SJAC 3KCYA 2O3JA 4EDFA 1H0TB 1DK1A 3PP5A 3G6BA 4BIOA 2EBOA 2R32A 3CE2A 1L0LK 4DV2B 1COWG 3OW2O 4L8JA 1NTMD 1SQPD 3F7YC 1OZHA 5BU8B 2CTPA 4FLXA 1KN7A 1L0LH 3QVNA 5JCOC 3MIWA 1RF1B 1SQBH 1Q81W 2JWAA 3MGNA 3AE3C 3Q3DA 2HLDG 2OYQA 1R3LC 1UPGA 3H1KD 4JTDB 2ZAEB 1WAZA 3L75D 2WITA 3T4ZA 1M1JA 3GF3A 3G9RA 3A0BH 2QEXP 2LP7A 2A06E 2H88C 3RK3E 1J95A 2M5AB 5IYDO 1YTZI 3CWBJ 1RF1C 1EC5A 4O2AA 4XE5B 3RT3C 1JA8A 4JTAB 2WSEJ 4ASWA 4IGGA 1KB9F 4JZ2A 1JY3O 2C0WA 3MHVA 3D3IA 5LOVB 3DC6A 4LF9O 4NXNB 4O9BA 2FYUG 3AEIA 2B5UA 3FB5C 4MW8A 1XNRB 4UB8E 2P4VA 1SQXG 3WMM0 1LJ2A 1JO5A 2FXMA 5CA3A 3SSUA 1P84E 3P3PA 4WFEA 2GTAA 5H2FE 3A0RA 2K3RA 2UWJE 1GK9A 1YJWV 1P84F 1H8HG 1DD3A 2NZ2A 2WLHA 1ZRTD 2UUCO 5JWPA 4PV1D 4PDMA 3VN0A 4LF7O 1PGJA 1X22A 4OPHA 1KB9I 4UCRA 3LSUA 3C1LA 1K34A 1K97A 1TUEB 1KKDA 4X1YA 4ZOLA 1NR7A 2HODA 3N2GA 3M06A 5GTHE 3ZHTA 4JI0B 2B87A 5CCGC 2CGNA 2LKMA 3L70D 1CI6B 2L6LA 5IDJA 5C39A 2IBZG 3OAKA 2Y48A 1IBKO 1N34B 2KG7A 2HHHB 2O01N 2QIWA 2R70A 1KC8Q 3AE4C 4LNUA 3OTOO 5BMVB 3HTKB 3CCJV 3ZMSA 4AHCA 3UIAA 3ETGA 2YXQB 1P84I 3H1JH 1NGMB 3AG1B 4F6RB 2IM9A 1HR0O 4IFDK 2IW5A 3CJHB 3SJCC 2PYJA 2B89A 2KSEA 2CUGA 2EILB 2HR3A 3W67A 4JI8O 1AQ5A 4DV3O 2Y9YA 1XMQB 1A02J 1NU1D 3L73G 2PRRA 3CWBG 3LNMB 4LCUC 1YCIA 1KV4A 3AG1C 2UXBB 1FU1A 1URFA 3B4SA 5A2QN 2FXOA 1M8OB 2NPSD 1NTZD 2ZXWC 2OIGA 3CMEV 1D2DA 1NKZB 1SQPJ 2EILC 2KLUA 5IWAB 2CH7B 1L4AD 1NTKD 1ZP0C 3RL0D 5CMZA 1N7SB 1F7YA 1WLEA 3GLMA 4BWAA 5DM6V 2AEJA 2BCCG 2F1MA 4TLFA 1BCCJ 4EKWA 4I6MC 3U1CA 3L75J 1G1JA 4KHXA 2K1AA 3CRMA 4JI6B 3QO5A 2Q69A 3VP9A 1B04A 3CCRP 4NR1A 1N4CA 2JS5A 1R3JC 1N7SC 1NZ6A 2OYOA 2WZ7A 1IFPA 1OIPA 5AVSB 4B3TO 2ZDIA 3OE7G 2Q67A 4NYKA 3BEHA 3LUTB 3TGUH 1VQ9P 4TUYB 2J59M 3KZIE 3CRAA 4JI3O 1VPCA 3D36A 2PFXA 2WLLA 3CC7V 4D6TG 1JM0A 4H13B 4U7NA 3WFVA 4JI4B 4H0LD 1ZX3A 1CSBA 3CCQP 3I55P 3MTUE 3CHXA 1AI4A 2QSAA 4DV1O 3N7NA 1VP7A 2AXTZ 5ITZA 1EDIA 2VWKA 3PHLA 2O1JA 4OGQD 1RPOA 4FFBB 3IAYA 3HKEA 1XMOO 3ASNB 1LTBC 1JOYA 4TT3H 5APXA 4H13C 2N05A 2QWQB 3LW5H 3F7VC 3H1HD 3HKCB 2SPZA 3D70A 1WB8A 4O2BB 1VQMV 1NH2D 1KUQA 2RMZA 3ABTA 4U7JA 3KCXA 1AJNA 1M93A 3V4WA 4JAAA 3X2QB 3U1AA 1LWUA 3K06A 1WPXA 3ASNC 1OVUA 1L0NK 3II6A 3NFQA 4F4LA 3R2PA 4FLTA 2QM7A 2AXCA 4O4IA 2CK3G 4ZI7A 3CLQA 4LLHA 3KG2A 1DGSA 2P5OA 1FZAA 2Y0CA 2R3CA 5CCHD 2XAFA 1KYOH 3ZCCA 1NTMG 1SQPG 4WWIA 1KQSO 1W2BO 3VOPA 3O6QB 3C90A 3RL0g 1VDFA 1VF5D 3G71V 2ZNIA 3OGIB 2BOBC 2DWEC 4LFCB 4JAUA 5B5EH 2QEXV 1SA0B 1Q6IA 3H1KG 2WLMA 1BQZA 1AJPA 4DR4O 3GF7A 4X62O 3L75G 2E5LB 1SS3A 3TETA 4K8XA 1SZXA 3TNUA 4XDLA 4DR6O 1WPBA 1HNXB 2RDCA 2AXTH 2KI7B 1XBLA 1FFTB 2OGUA 2W6JG 1SQBE 2KUBA 1NTZJ 4YJ2A 2Q7CA 3STLC 4K8ZA 3PTZA 4DR2B 1U7MA 4X64O 1N32B 4FM0A 4HZ3A 3THOA 1GW3A 4LF5B 1S9KE 3A0BE 4L73A 4O4LA 4JF3A 3OFNG 4JYAO 3N2KB 3OJAB 1SQVK 2IFMA 4CZZA 4LH7A 3W7SA 4LGDE 2Q3IA 3CCMP 4IT5A 3W68A 1M1KQ 1HGVA 5KAIZ 1IX9A 3V2QA 2A7WA 2IU3A 2QWNB 3RWRD 4ASUG 2N9BA 1KBHA 1AA0A 3L4FA 3AE1C 4EB6B 4RAIA 4B3MO 1FZGA 1ZSPA 4NPEA 2FL4A 4BAYA 4BRYA 1KMIZ 1OV9A 1E1RG 5LHGA 2UUBO 2NRGA 1H89A 3CCLP 1QHTA 1V9PA 2E74B 2FYUK 2DWDC 3JSVC 5KJ7A 1Q82Q 1HP8A 2AZ2A 4C7NB 4CS4A 4ZHQB 1AB3A 2W8ZA 3L71D 1AR5A 3AE7C 1BL8A 5CA1B 5EYPB 1SQXK 2HPCA 1JCDA 1S4XA 3L70G 2FYUH 2ZYDA 4TWKA 1M4UA 5GTIZ 3GHGB 1GD2E 2B1GA 1BZKA 3UO3A 3P8MC 4G28B 2UUAB 4X88A 1B6QA 2E74C 4HYTB 3PH0A 5LXTB 3JCUH 3H1LJ 3HE4B 2P7JA 4B08A 3LSSA 1R5SA 4JV5O 2F66C 3G4SV 5KHJA 1KKCA 4I2LC 4GUNA 4K35A 1YJ9P 3GHGC 3N27A 3LIDA 5KKZB 1VQKP 1EN4A 2F93B 4R8CA 3RYCB 5AW9B 3FXDA 3AE5C 4JYBA 1NU1G 1JY3P 3V2NA 1PD3A 3B5NB 4DRXA 2KZJA 1Q8IA 3H1JE 5KAIH 1F4NA 1HW7A 1NTZG 1D7MA 2PTMA 1FBMA 1N0NA 1MUUA 2W6BA 2FFDA 3K5OA 5KKZC 1NTKG 1JFFA 2Q5ZA 2IJIA 4G27B 1Q81Q 3VQXA 1AR4A 5JJEB 3VMXA 4XDKA 2ZVNB 4GOEA 1ZV8A 3CC2V 1W2EA 3F5HA 3CCRV 3JARB 3ML0A 3UT5A 4IYHA 1ZL8B 3TJTA 3LIEA 4UV9A 1G8MA 5AVRB 3RN4A 4GZRB 3EQ2A 1GKFA 5AW0B 3JAKB 4AQRD 2BTQA 3H1ID 2HP8A 4WFBV 1XI1A 5GTIH 1Y74B 2MK3A 4GDOA 1L1FA 3ZHQA 5AW1B 1S0VA 3L73H 1RHZB 3RYHA 4PJ0Z 4DK1A 4MVOA 1QQCA 5CJ4A 2UXNA 1KZUB 1WMKA 3ZN1A 5AVQB 1YIJP 4GIFA 3ZBHA 2M8RA 3ABUA 2XNDH 4DK0A 1KU9A 4NPDA 1N73B 3HE5B 3ZMTA 2BCCH 3JASB 2RH0A 1UJWB 4FJCC 4O2AB 3TGUE 1D5AA 2JK5C 2QA4P 4UV8A 1B06A 3ITKA 3BAAA 5HFLA 3E8HA 4X20B 2R9RB 4PA7A 1QEXA 3H1HG 1N73C 3OEEG 2GTSA 2F43G 3NR7A 2XTAA 1HNZO 2RJZA 2KQXA 5EIBC 1K5SA 4PV1B 3L71J 3RBZA 3K03A 3SFDC 1LTIC 3VTPC 2UUCB 4D6TH 1N7LA 3O65A 3I56P 3OD4A 1RQVA 1BS3A 3RVZA 1NQTA 2X6BA 4LF7B 2E76B 1HVVA 1KFNA 3OGCC 4P2ZA 5C8YA 4KT0J 4X1KB 4E4EA 4UXNA 1GDTA 4RO0A 3IJ4A 2EIJB 4J7ZA 4A5UB 1SQVD 2Y0IA 3JAWA 4I5SA 2OIEA 1WRGA 1R8EA 4PJ0H 4DR1B 5BR8B 4D7SA 1E79G 1VIBA 5KAFE 2E76C 4LFAB 4JI4O 5F2VO 5JQGA 4X1YB 4H13D 4I9QA 1OX3A 2JGDA 1NT2B 1VF6A 2ZR2A 3OTOB 2HODB 3N2GB 4O4HA 1OW7A 1YXBA 4MVUA 1KYOE 1PGPA 1PP9H 2X6AA 1OWAA 1HR0B 2G38A 2KG7B 2QWRB 3ZHRA 1KYOF 5LP6A 1Y47A 4N78E 4UCUA 1NTMK 1SQPK 2WSFJ 1JX9A 2CK3H 1BDDA 2V4HA 5B5EE 2QM4A 2K9PA 4JI8B 1FS0G 4DV3B 3KYQA 4MVRA 3USSA 1AVMA 1NTMH 2AGAA 3IFMA 2Q9IA 3SWFA 1EFRG 4X89A 4X65O 1FE6A 2BTOA 3DTUB 2WSSG 1IXBA 1LTAC 1L4AB 3CCMV 1BGYD 4C46A 4UVAA 1AILA 5KHGA 1TA8A 1GW4A 3H1KH 1IFJA 2H8PC 5HFMA 1YBKA 1S5HC 2WTYA 2P90A 1UIXA 4PA3A 4OX9B 4X1IA 1QL2A 3CCLV 2GUVA 1Y8AA 5EC2C 4MS2A 1L4AC 4WY4A 2IJHA 2OARA 4DUZO 4MVZA 1JR9A 3BVOA 3BY6A 3H32B 1P7BA 2BSKB 3SYQA 3P7KA 1OXZA 3L71G 4B3TB 2YNYA 4KFMA 1HNXO 3E22A 2PGGA 1VQOV 3K5NA 1XL6A 2NN4A 3M99B 2A0LA 3CCEP 1HH0A 3BCCH 3UCSC 1TU3F 2IFNA 3L72H 3D3QA 3RW0A 1FZFA 1N2DC 4U7OA 1N32O 1MNGA 1SQFA 4HYOA 2OQQA 4U3FJ 4PHZA 3Q5SA 5E79Z 2N9YB 1YHQV 1TUBA 4R6ZA 5CN0A 3WB1A 3WB0A 2Q1KA 4DR7B 2IU0A 3IN6A 1PPJD 2QE7H 1NH2B 1FDOA 3ZN0A 3S3XA 1Y4MA 3JCUE 4O4JB 1DF5A 4F6EA 1SVFA 3BA9A 2W6AA 4ZKIA 3L70H 3D36C 2HG5D 4IL6X 2POHA 3L35A 1F23A 1R6KA 1RE3A 2P2UA 3AEEC 1SQQH 4JPZB 3GW6A 1BE3E 2V4DA 3AEAC 3FYIB 3JATA 1J1EB 5CBHA 5IJ0B 5CA0A 3CPWU 1WA8A 1M1KW 3RYFA 1VQ6P 2E74D 3BFRA 2Z5IA 2QKAA 1LWUB 4GKGA 1KILB 3IC9A 3AK3A 2JWDA 5BY1A 1TVKB 1TGOA 5IYBO 5KAIE 3FWLA 4AQYB 3Q5PA 1PM9A 1FXVA 1VF5B 1H2LA 1CW5A 2Q5UA 3JD2A 5LYJB 1J1EC 1UFIA 3H1IG 2UUAO 5AW8B 2UXXA 4O4IB 4ZI7B 1H38A 1HNWO 1V54B 3GVMA 1NTZK 1NU1H 2GA1A 1H2KA 1NAYA 1AI7A 5LBQA 1LWUC 3M91A 4X62B 1T5EA 2ZIOA 1K04A 1KILC 1NTKK 3TSIA 1YIJV 3RYIB 2EJRA 3SYCA 4AILC 2YEVA 1SLQA 1VF5C 5E79H 4DR6B 2Q7GA 5LHIA 2M3EA 1LNQA 3P3NA 3SPIA 1NYHA 2A06D 3PJSK 4LR3A 1GMJA 4IFFA
chains in the Genus database with same CATH topology
1OMIA 2WQYC 4GDOA 1ZP0C 4XFJA 1DD4A 3AE3C 1KTMA 3S9OA 4H0LB 3Q3DA 3AEBC 2K9YA 3GLMA 1UIXA 2JP3A 1HF9A 3GF3A 3Q2YA 1AJYA 3G9RA 1YQ3C 1MKMA 2H88C 1WMKA 3RK3E 4OGQB 2G8YA 3T97B 3D71A 3Q5RA 2WSEJ 4H0LC 2JO1A 2P10A 1KQFB 5KLIC 3AE1C 4OGQC 1U57A 1TU3F 4PV1C 3FGAD 4RKUJ 1KMIZ 2QJKC 4H13B 3B71A 2H89C 4H44B 2E74B 3AECC 2OQQA 3AE6C 3LW5J 4H0LD 1ZOYC 1S5LX 1OW8A 2D2CC 3Q5SA 2E75B 1Q90D 2WSCJ 3AE7C 3AEDC 2O01J 3IAOA 4PV1B 3SFDC 2FYNC 3D6YA 2V7QJ 4OGQD 2BEQD 1KORA 1DD3A 3C8VA 3IN6A 1RQVA 2NZ2A 2QJPC 3ABVC 2MKVA 2E76B 2BEZF 2D2CB 4PV1D 4R4LA 2WPVB 4TT3H 3D6ZA 3Q1MA 4H13C 1FDOA 4H44C 2E74C 5L8RJ 4KT0J 2E75C 2D2CD 3D70A 2QSIA 4U7JA 4IL6X 2ZT9B 1R8EA 1JB0J 3AEEC 1HJ0A 1K05A 1Y9BA 3AEAC 2FBWC 3EWKA 2E76C 1VL2A 1ZRTE 3AE5C 4H13D 3H25A 1ZMEC 4H44D 2E74D 2QIWA 3O6QA 2FXPA 1OW7A 3AE4C 2E75D 4R4MA 2IDBA 1PIXA 4I7ZB 3AEGC 2ZT9C 5M1BA 3Q5PA 2YMKA 3AE2C 1VF5B 1NGMB 1FDIA 2QJYC 2G3AA 5KKZC 1OW6A 1KQGB 2E76D 3AE8C 1VF5D 3RL0g 2J5UA 1RQUA 2WSFJ 4Z1MH 4YXDC 1PL5A 1YQ4C 4YTPC 1K04A 3AEFC 4Y28J 4I7ZC 3GF7A 1DIPA 1EXIA 1S1CX 2ZT9D 1VF5C 2YIUC 1EXJA 3AE9C 1PV3A 1IK7A 1NYHA 1KILE 3R4YA 3GMAA 3SFEC 1GMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJP C;  4I7Z B;  2E76 B;  2D2C B;  2WPV B;  1VF5 B;  5KLI C;  5L8R J;  4KT0 J;  2QJY C;  4H0L B;  2K9Y A;  5KKZ C;  2QSI A;  2WSF J;  4IL6 X;  2ZT9 B;  4RKU J;  1JB0 J;  2QJK C;  4H13 B;  4H44 B;  2E74 B;  3LW5 J;  1S5L X;  4OGQ B;  4Y28 J;  2E75 B;  1ZRT E;  1Q90 D;  2WSC J;  2YIU C;  2O01 J;  4PV1 B;  2QIW A;  2FYN C;  2WSE J;  3C8V A; 
#chains in the Genus database with same CATH topology
 1V54 C;  3SR2 C;  1BGY J;  4X66 O;  5GTI E;  4GX2 A;  3K57 A;  1LT9 A;  3VQW A;  5KX5 A;  3TDK A;  3L73 E;  3TNU B;  4R50 A;  1I94 O;  3L74 E;  5J2T A;  3RVY A;  3SPC A;  1IJD B;  2F95 B;  4JYA B;  3DC5 A;  5DJT B;  4YJ3 A;  2IBZ I;  5EFW B;  3M0D A;  2W83 C;  2FML A;  5B1N A;  3VYI A;  5EC1 C;  2F23 A;  3JAM N;  1Q86 W;  4HAM A;  1BE3 J;  3JD0 A;  2L5G B;  2GSM B;  2P10 A;  1VQL P;  2EIM B;  3J81 N;  2EX3 A;  3W7X A;  3K59 A;  2E5Y A;  4DV7 O;  4B3M B;  3ABM B;  1I7F A;  4C7U A;  3E8B A;  4N21 A;  2ZKO A;  2UUB B;  4H33 A;  1BCC D;  3VMA A;  2JGU A;  2H89 C;  4LC1 A;  3HR0 A;  1SQV G;  2KXP B;  2EIM C;  2AHY A;  1QVG O;  1IBM O;  2WSC J;  2YXR B;  1KQS U;  3IF4 A;  5APU A;  2O01 J;  1W2B U;  2VQF O;  1KB9 E;  4BRY B;  3FX7 A;  1R3I C;  3ABM C;  2IJJ A;  4EIJ A;  1BHA A;  3JSL A;  2V7Q G;  4JI1 B;  4Y99 B;  1CXZ B;  1AI6 A;  2WT7 A;  3JD4 A;  5B1A B;  2X6C A;  2ETN A;  4DUY O;  3BRT B;  2QM8 A;  4JV5 B;  3GB7 C;  2QSI A;  1KFM A;  1S5L H;  4PJ0 E;  5EIB D;  1QX8 A;  4EYY Q;  2BAS A;  1LTJ A;  3SYO A;  4EFE A;  1RF0 A;  5KJ7 C;  1K8A W;  3EXA A;  1QCE A;  4Y99 C;  1MZF A;  4UUJ C;  3L74 J;  3TXQ A;  2CGO A;  5B1A C;  1GN2 A;  3V4Q A;  1ZUQ A;  5L3D A;  1ZME C;  3LDE A;  5DJU B;  2Q7H A;  4JBZ A;  3CC4 P;  2IDB A;  2I1J A;  5AVV B;  4I7Z B;  3AEG C;  1GN3 A;  1PP9 E;  2ZQM A;  4FZ1 A;  2YMK A;  1BGY G;  3K5B A;  5TJH A;  1WB7 A;  1WN7 A;  5JH7 B;  3T97 A;  3OMA B;  1Y76 A;  1GK4 A;  1QLE D;  2E76 D;  1LUW A;  3K5M A;  2XNX A;  2ZR3 A;  1RQU A;  4DRX B;  4Z1V A;  5KLV E;  2QDO A;  2OYI B;  1JTH A;  1NAF A;  3CCV P;  4NPF X;  1NTM E;  1YTF B;  1EBO A;  4I7Z C;  4TV8 B;  4DR1 O;  5EZY B;  3M0A A;  1IXM A;  5BR8 O;  2FB5 A;  5FNV B;  4LFA O;  2R5D A;  3R4Y A;  2L35 A;  1NKD A;  1RH5 B;  2IYO A;  5JVD A;  3H1K E;  4FM2 A;  2JDI G;  2OYI C;  3LSQ A;  2AEM A;  1G6U A;  2ZFC A;  3IR9 A;  1DEE G;  1BSN A;  3QO8 A;  3TXS A;  1SFC A;  5CB4 B;  2JVD A;  1QVF O;  1JY2 N;  1NBM G;  4CH3 A;  4JQ0 D;  1FXK A;  2WLJ A;  2ZNJ A;  2ZXW B;  4CPG A;  2K37 A;  5EK0 A;  4GX5 A;  4FZ0 A;  1URQ A;  4WCE V;  5B1B B;  3MZW B;  5TIS E;  2NR5 A;  4BWN A;  1Y66 A;  5IYZ A;  1RY3 A;  4B3S B;  5JJJ B;  3Q5R A;  2H8P D;  3G6E P;  1P7G A;  4R7C A;  5CBN A;  3DSQ A;  4NTY A;  1MA1 A;  3WU2 Z;  1JCH A;  2N74 A;  4FLW A;  4I50 B;  4QE7 A;  4WBN B;  1PPJ G;  4MSW C;  3OM3 B;  5B1B C;  3BCC E;  3MDS A;  2NPS A;  1GAX A;  5L3C A;  3L72 E;  3BVH A;  1XDC A;  4RWU A;  3EHB B;  1HNZ B;  1K4C C;  3B2E E;  2L91 A;  2N1T A;  4I55 A;  4CC6 A;  4DYL A;  5IJ9 B;  4OX9 O;  1E1Q G;  2OT5 A;  1W0J G;  4XDJ A;  1BSH A;  2KYV A;  1VQ6 V;  5KLV J;  2GUZ B;  2LXC B;  3HD7 A;  1LT1 A;  3OAA G;  1IFM A;  2ZXX A;  4QPJ A;  3K79 A;  1PNK A;  4IIJ A;  1ZLL A;  3LDD A;  4IHJ B;  1VQ7 P;  1NWQ A;  2HVK C;  2Q8V A;  2IYP A;  1SQQ E;  2ZT9 B;  1IVS A;  3CXC U;  1HBW A;  2KK7 A;  5C8Y B;  1K73 W;  1LTT C;  2QJY B;  3K9A A;  3OR6 C;  4JGS A;  1FFX B;  5LMN O;  2PGD A;  5AVX B;  2P06 A;  5BZB A;  4YHH B;  5L3E A;  3JAW B;  1M7L A;  2DYR B;  1S3J A;  2RKL A;  3VMY A;  4DR5 B;  2RN0 A;  2W0F C;  4DR7 O;  2YMY A;  1BT8 A;  4HNA A;  2QG4 A;  3MHS C;  2A06 G;  5JQG B;  2ZT9 C;  2WLI A;  1GM8 A;  1USE A;  3H1L D;  1W0K G;  2JGD B;  3JAL A;  1FDI A;  2QJY C;  4PA4 A;  3H6P A;  3Q4H A;  1SET A;  1FDM A;  3JD1 A;  1NU1 E;  2DYR C;  1O9H A;  4DXW A;  1PL5 A;  3J80 N;  4JI5 O;  2Q73 A;  2GDS A;  3AEF C;  4MTF A;  4GOD A;  4X65 B;  3U10 A;  5LP6 B;  3A2F A;  3H1I H;  2BE3 A;  4LWS A;  1X8Y A;  3A7O A;  3HKB A;  2H43 A;  3ZX6 A;  1BDC A;  4XA4 A;  3IFX A;  4ZBM A;  3HKD B;  5KMG A;  1L0N H;  1FJG O;  1RSO B;  1SRY A;  3UM7 A;  1F51 A;  3ZRX A;  1KIL D;  4AQY O;  4ZMD A;  5LP6 C;  2ZYG A;  4J10 A;  3UKM A;  1HWT C;  3S3W A;  3KPE A;  1IFD A;  3Q2Y A;  4DUZ B;  1YJN P;  3ZMU A;  3FAV B;  2P1J A;  4WBA A;  1AFO A;  2LJ2 A;  1BCC G;  1VQ5 P;  1GO3 F;  2AZ0 A;  4YIP A;  1SER A;  3M9B A;  4X1I B;  1FPO A;  5AVW B;  4I0X A;  1YDX A;  2Y0P A;  4WFG A;  3I5D A;  4MVS A;  4L87 A;  4FK5 C;  1L0L E;  2I8D A;  1KQF B;  2WPS A;  1H8A A;  2Y4U A;  4MVQ A;  1LGH B;  2HYN A;  1GL2 A;  4MT8 A;  1JMB A;  4IYI A;  2JJ2 G;  1LP1 A;  3MUD A;  1VAR A;  2ZM6 B;  3B71 A;  4WY4 C;  2ZE8 A;  4LF8 B;  4YY3 O;  1PZQ A;  3LNN A;  4QIW F;  3T1H O;  2FKW B;  4I4T A;  4U3J A;  4Z2W A;  3CMA P;  4Z1M G;  1RM1 B;  2BEQ D;  3CC4 V;  2Q6A A;  1W59 A;  4G2K A;  1G2C A;  3Q1M A;  2BEZ F;  2WPV B;  1SQV H;  1H0T A;  5EBM C;  3JC2 2;  1JUN A;  1IC2 A;  3JD3 A;  1S5L E;  5LGT A;  2YO2 A;  1HTL C;  2VRZ A;  3CCV V;  1WNS A;  1RM1 C;  2V7Q H;  4BW9 A;  1N0J A;  2OTL P;  3APQ A;  4JI7 B;  1WP7 A;  4YXW G;  3FYE B;  1EN6 A;  2HG5 C;  4FMT A;  4GX1 A;  2KKW A;  2K88 A;  5AW2 B;  3A0H Z;  1EZV D;  4HBN A;  1KP2 A;  3JAT B;  3OUF A;  1T3U A;  1SQX H;  2DJV A;  2WLN A;  3RYF B;  1HNW B;  4JI1 O;  1I08 A;  5KJ7 D;  4BXL A;  1RFY A;  1KQG B;  3G80 A;  1VQ8 P;  1L0L J;  3CS5 A;  4QNH B;  1RE3 C;  4DV6 O;  3MP7 B;  3E1R A;  4ABM A;  1Q6H A;  1SQB J;  1KP3 A;  3E8F A;  4YTP C;  1I5X A;  1IFN A;  1QL1 A;  3RK3 B;  1DIP A;  5DEC A;  3AE9 C;  1PV3 A;  2YKQ A;  3VP8 A;  1K92 A;  4X66 B;  3BHP A;  5KA6 A;  1EDK A;  1GZL A;  1NJI W;  1OMI A;  1I0H A;  2Q0A A;  2YEV B;  1I94 B;  4H37 A;  1Q86 Q;  2CPB A;  3T1Y O;  3AG4 B;  3JSN A;  3RK3 C;  2IBZ H;  2LGQ A;  2YIC A;  1XTG B;  4K0K B;  1LT9 B;  5KX5 B;  2KLV A;  5CCG A;  2JDI H;  3V2P A;  2WLK A;  2O57 A;  1PFI A;  3QG5 A;  4LF6 B;  1ARO P;  1V55 B;  2QJK B;  2ZJS E;  3AG4 C;  3K08 A;  1YTF D;  3SYP A;  3A0H H;  2N04 A;  1IK9 A;  2JO1 A;  1DF4 A;  1FOS E;  1BSM A;  4DV7 B;  2HKO A;  4YPC A;  1XIL A;  1LT9 C;  2ZVO B;  1FOS F;  4QGP A;  2OCC B;  1CI6 A;  1VQ9 V;  3D8C A;  5H5N A;  1H2S B;  3CWB H;  3OUS A;  2XKM A;  4N3Y B;  1QR8 A;  3CCU P;  1V55 C;  3K58 A;  1LTG C;  2CPS A;  2QJK C;  2IZ0 A;  2ZXE B;  1NOH A;  4OVN F;  2WSE H;  4DV4 B;  1IBM B;  2AEF A;  3ABK B;  3WUV A;  4Q6G A;  3I55 V;  1PPJ H;  3CCQ V;  1Q43 A;  1GTW A;  3A8T A;  2VQF B;  2ADQ B;  1K8A Q;  2OCC C;  4F6R A;  1DH3 A;  1DLB A;  1S77 D;  2XAS A;  1M1J B;  2W90 A;  4B3S O;  1T6A A;  3ABV C;  4X8A A;  4QJF B;  4DUY B;  2OTK E;  5KHK A;  3FWN A;  3H01 A;  1BMF G;  3ABK C;  4JYC A;  1EDJ A;  3CD6 P;  1KYO D;  3H1L G;  2KP8 A;  2GM4 A;  4W4L A;  1VQN P;  1DTO A;  4J9Y B;  3WG7 B;  4U3F D;  1SF9 A;  1M1J C;  3H1J J;  4N78 D;  2GV9 A;  5H2F Z;  2CH7 A;  3WUU A;  4PD4 D;  1GTO A;  1N7S A;  2OWO A;  4OXS A;  3SJQ C;  1L2P A;  3APO A;  5IYC O;  1JEK A;  1QLE B;  3WG7 C;  1AQT A;  1XTC C;  1XNQ B;  5CJ0 A;  2LO1 A;  3S4R A;  5KHH A;  5BXZ A;  3OEH G;  3UO2 A;  3V5B A;  5AW6 B;  5GTH Z;  3CXH D;  3FB6 C;  3MAQ A;  1K5Q A;  3OW2 U;  5BVZ A;  1RF0 C;  3PN1 A;  5IT9 N;  1USD A;  5E1A C;  1ZLZ A;  1U96 A;  1VQ5 V;  3H1I E;  2IJK A;  1GRJ A;  1QLE C;  2ZT9 D;  5AVU B;  2YIB A;  1T8Z A;  4TUY A;  3O8Z A;  4ZOL B;  5KUK A;  1L0N E;  4YHH O;  1GK6 A;  2B87 B;  3CCS P;  4CC5 A;  4DR5 O;  1JNM A;  4HKZ H;  1X4T A;  5J2U A;  2GUS A;  1QBZ A;  4KP4 A;  2B88 A;  4EOT A;  2ADP A;  4RES B;  5JVD B;  1W5C E;  4LNU B;  4P30 A;  1N36 B;  4YIO A;  1OVR A;  4FFB A;  3EFG A;  3NTN A;  5D5P A;  1MKM A;  3TGU J;  2A9H A;  2G8Y A;  3P8C D;  4UCT A;  3BAT A;  1SQP H;  1FXK B;  3HKC A;  4O2B A;  2AXT E;  1URQ B;  3OA7 A;  5FPR A;  1D5N A;  2YSU B;  3CRQ A;  4GOF A;  3UQ8 A;  1PL0 A;  2R72 A;  4HH2 A;  1BCC H;  2CDY A;  3HRN A;  4N6J A;  1SFC C;  3L75 H;  2LR2 A;  1GU5 A;  2KB1 A;  3AK2 A;  1Z56 A;  2LXB A;  4PA9 A;  3SYA A;  1FXK C;  3K0G A;  1URQ C;  3LW5 J;  1IBL O;  2OTL V;  1OVV A;  2V1D A;  5LMU B;  1S5L X;  2YO3 A;  2D2C C;  2W6J H;  2E75 B;  1QNM A;  4TOI A;  2QJ1 A;  1K73 Q;  4I9W A;  1BE3 D;  3D6Y A;  3B09 A;  1R73 A;  1NO4 A;  3CX5 D;  2N1T B;  2KSD A;  3E35 A;  4NXM B;  1EZV G;  1SQV E;  2XHB A;  3KZI Z;  4AI8 A;  1ZWI C;  4WY4 D;  1WJZ A;  2E75 C;  1L0N J;  1AI5 A;  1M57 C;  2GHY A;  4M3L A;  2YDE A;  1VQ8 V;  3M9H A;  4QMA A;  2Z3Y A;  4KXR A;  4HJG H;  1N33 B;  4WF9 V;  2N1T C;  1YJ9 V;  5LMN B;  1P49 A;  1GN6 A;  5LL6 Y;  5LA6 A;  2ZM6 O;  4NVP A;  5CBF A;  1VQK V;  1Q3E A;  4LF8 O;  4GKJ B;  3CSX A;  2FYU E;  2WLL B;  2XU6 A;  4PD4 I;  2B9B A;  4DR3 O;  1S76 D;  2PP6 A;  1Q7Y Q;  3AG2 B;  1PIX A;  3L9D A;  1JOC A;  1SQX E;  3FX0 A;  1JY2 O;  4FIP C;  5IY5 B;  3TF5 A;  1YTZ T;  3ZRW A;  2ZDI C;  5APV A;  1M90 Q;  4MTX A;  5ITZ B;  1Y67 A;  3W7W A;  2XAJ A;  2GBO A;  4FM1 A;  4NTX A;  3ZED A;  4EFB A;  3HKE B;  1NS1 A;  4JI5 B;  2YKP A;  2RQ6 A;  4MW3 A;  3AG2 C;  2E43 A;  5KTB A;  3L74 D;  2WPR A;  3N4X A;  1X0T A;  1FC2 C;  5IY5 C;  1AP5 A;  1HJB A;  1XHX A;  4MTO A;  1JJ2 U;  4JI7 O;  4NTW A;  3GMA A;  1FJG B;  4K3A A;  3CME P;  2AW9 A;  1HWY A;  2P6J A;  4LWS B;  1VF7 A;  1OJH A;  1BQ0 A;  1DD4 A;  4C7N A;  4ZHQ A;  2IBZ E;  4W4K A;  1MMM A;  3AEB C;  1X9V A;  5EYP A;  1J1D B;  1VQ4 P;  2HVJ C;  3R65 A;  4FLV A;  1VEW A;  1JVM A;  2ATK C;  3GHG A;  1H88 A;  1FYJ A;  2P58 A;  4GLX A;  1NTZ H;  5LXT A;  2Y0E A;  3HE4 A;  4CS2 A;  3A0H E;  2ZIM A;  1NTK H;  5AW7 B;  3RK3 D;  1J1D C;  2R9I A;  3CP1 A;  1K7D A;  4OPA A;  2E42 A;  2KIK A;  2O1K A;  1KB9 D;  4L75 A;  2DMX A;  2FYU J;  3CWB E;  2AHZ A;  1QR9 A;  1J5E B;  1I5Y A;  3NMD A;  3V6I A;  3G67 A;  3RYC A;  3CD6 V;  2QA4 V;  2ITA A;  1VQN V;  1WP8 A;  2QJP B;  4RUF A;  1XL4 A;  2JEE A;  2JEX A;  3FGA D;  1KD1 Q;  1AP6 A;  1YVW A;  3ZRV A;  3QNE A;  2LFR A;  4YJ2 B;  4YY3 B;  4DV0 O;  4K0K O;  3B5N A;  4DV5 O;  3T1H B;  1ROP A;  1GN4 A;  4U3F G;  3AG3 B;  4RQF A;  1IO4 A;  4LF6 O;  1PNL A;  3CX5 I;  2BCC E;  4TSF G;  3I56 V;  2QJP C;  3RK2 D;  4O4L B;  4GX0 A;  1P84 D;  2Q7E A;  1GL2 C;  3EVK A;  4I4T B;  5H6R A;  3AG3 C;  2QWP B;  3G3Z A;  3F89 A;  5BU5 A;  2JEU A;  2XUM A;  1OFC X;  3MUD C;  1JB0 J;  2M6Y A;  2CAZ C;  1NH4 A;  1K05 A;  3JAK A;  1LUV A;  1MOF A;  2HJF C;  2YI8 A;  3BPZ A;  3SPG A;  1Y74 A;  2Q3E A;  5KLV D;  4DV4 O;  3E2E A;  1K4D C;  1T2K D;  4JF7 A;  3DXR A;  3A2A A;  1AVY A;  2RCV A;  1SQB K;  4JAV A;  3H1L H;  1HUC A;  4D6T E;  1Q5O A;  2JR8 A;  3H1H H;  3CCS V;  2QTO A;  2M0B A;  1MZE A;  3U0Z A;  2HJD A;  1L8D A;  4CH6 A;  1RPR A;  1NJI Q;  2HPC B;  2CTQ A;  3K04 A;  3ZIA G;  5B1O A;  4DV6 B;  3G71 P;  3QO7 A;  5L3B A;  2YXL A;  1N73 A;  2PUS A;  4YXD C;  3F5T A;  3HE5 A;  3JAS A;  2EJ7 A;  2YUA A;  1YQ4 C;  2QVA A;  1RP3 B;  3L73 J;  4L76 A;  4PDR A;  1EXJ A;  3FB7 C;  3RFR A;  2IPP A;  2UU9 O;  2XAG A;  3ETE A;  2XZR A;  3M8A A;  4X20 A;  5K5G B;  3BRV B;  4IL6 Z;  1QLN A;  1QGK B;  1CZQ A;  3C3S A;  2LFS A;  3T1Y B;  2P4K A;  1E79 H;  1FAF A;  3GWK C;  4WFA V;  1K9M Q;  2M3B A;  3U59 A;  1XNQ O;  2BCC J;  4W7Y A;  3VBB A;  2A45 I;  1A02 F;  2B1I A;  2K1E A;  2RNB A;  3BCC D;  3L37 A;  1XHZ A;  3L72 D;  1SQP E;  4WFH A;  3J7A U;  5APQ A;  2Y4T A;  4EI2 A;  2FFD B;  4X1K A;  1ZR4 A;  1JFF B;  1KEC A;  3OT7 A;  4GCZ A;  3D71 A;  1EQ7 A;  1S2E A;  2ZYA A;  3TYY A;  2XT9 A;  3E7K A;  1FD9 A;  2ITC C;  2R9A A;  1BE3 G;  3W7T A;  2WWW A;  1K3E A;  1BCC E;  3UT5 B;  3L75 E;  2WAM A;  2FYN B;  4D6T J;  3CCE V;  2Z5U A;  2FFD C;  3HB3 B;  4XBF A;  2WSS H;  1JQ0 A;  4ZIB A;  2BTQ B;  1EN5 A;  4H44 B;  1XOU A;  5GW7 A;  3AE6 C;  3B8E B;  1FJP A;  2DN9 A;  2VWJ A;  1N36 O;  2DW4 A;  2K9J A;  1CP9 A;  5AG2 A;  1SQQ D;  3RYH B;  4GKK O;  3C9I A;  3AED C;  1X79 B;  2UXC B;  2FYN C;  4UVB A;  1SES A;  1SFC D;  1KOR A;  4W7Z A;  1VQP P;  4IOI H;  3STZ C;  3CEI A;  2DW3 A;  5KUM A;  4IL6 H;  4H44 C;  1URQ D;  1F4M A;  2D2C D;  1JJO A;  2EUL A;  1MFT A;  3G4S P;  3OTF A;  3L71 H;  3B8N A;  1L4A A;  4RUE A;  1YF2 A;  1PP9 J;  1EZV H;  4TQD A;  4UFZ A;  3HUS A;  1FZC A;  4J41 A;  2OYH A;  4JTC B;  5FL7 G;  3L36 A;  1ZRT E;  5LMU O;  2YXY A;  2KSJ A;  2PYL A;  1PGO A;  3L74 G;  1GU4 A;  4KHP O;  1Z5W A;  3PRJ A;  2E75 D;  3CL3 D;  1M57 D;  1NTM J;  5M1B A;  3AE2 C;  3CPW O;  2VQE O;  3FB8 C;  4BIU A;  4NXM O;  3T4D A;  2P7T C;  2N1T D;  2XND G;  4JPR A;  5IE9 A;  3L70 E;  2JIZ G;  4ZKU A;  2XV5 A;  3H32 A;  1VQ4 V;  2BSK A;  2FYZ A;  1YSC A;  3H1K J;  4LF4 O;  2WA3 A;  5KA5 A;  5KAF Z;  1R6T A;  1Q6U A;  3HD7 D;  3CC2 P;  2UXD O;  2A45 G;  3VOU A;  1N33 O;  1MV8 A;  1S1C X;  3FKS G;  4QPK A;  1Z5V A;  1ZW0 A;  1P4R A;  3ZS8 C;  1FJK A;  3FD9 A;  4QE9 A;  1Y6X A;  4GKJ O;  2WSF H;  1TAE A;  2Q9L A;  3WU2 H;  2E3C A;  1KTM A;  3S9O A;  3P32 A;  1YIT P;  2ITD C;  1L0L D;  5B5E Z;  4O4H B;  2JP3 A;  4UB6 Z;  1SQB D;  1XUQ A;  5AW3 B;  4KL1 A;  5J2U B;  1A32 A;  5FLX N;  4RQE A;  3BCC J;  1US6 A;  1NTZ E;  5E79 E;  3L72 J;  4GYC B;  4O4J A;  1S9K D;  3WB2 A;  1Q7Y W;  1NTK E;  2R5B A;  1VF6 C;  2J58 A;  1JY2 P;  1VQL V;  2IH3 C;  1T3J A;  4PEL A;  1M90 W;  1EZJ A;  3E1I A;  3GG2 A;  5KHI A;  3JYC A;  1N8R Q;  4TV9 A;  4I1L A;  1RE4 A;  5IJ0 A;  1XRE A;  5APS A;  4N23 A;  4PDL A;  1AVO A;  5CCH A;  1JMK C;  1IBL B;  4LFB B;  1KIL A;  1PP9 G;  1S72 P;  1ZOY C;  1TVK A;  1OW8 A;  1NVP D;  1YYC A;  2W27 A;  5KAF H;  3L70 J;  1Q90 D;  3B8M A;  5CHX A;  5LYJ A;  3IAO A;  3ETD A;  2JJ1 G;  1SQQ J;  1YI2 P;  2NNU A;  2OCH A;  1FKA O;  2KNC A;  3ZMZ A;  2H3O A;  2PI4 A;  2KOG A;  5LGU A;  2W0X A;  4WY4 B;  5KLV G;  3X2Q C;  3D6Z A;  3A3Y B;  2WPD G;  4ZNC A;  4U3F H;  3K9S A;  3RYI A;  3QWO C;  2VS0 A;  1E5W A;  1G1X B;  1JY3 N;  1J5E O;  3VQY A;  3SPJ A;  3ZDM A;  3E22 B;  4JI2 O;  2QRX A;  3CYO A;  5GON A;  4PD4 H;  4UB6 H;  2OTJ P;  3ZJZ A;  2JKV A;  3EWK A;  3MD0 A;  2R44 A;  2Z4E A;  4JYY A;  1SC5 B;  4B3R O;  3VMZ A;  4LH6 A;  3H25 A;  4DR3 B;  1NU1 J;  3H1L E;  1GL2 D;  1ORQ C;  3H1H E;  2KS1 A;  5APW A;  3JCU Z;  5LA6 B;  1B3Q A;  3IGA C;  5JCO A;  3CXH H;  1TUB B;  5JJN B;  1HGZ A;  1NTK J;  2EIK B;  3ABL B;  1SP4 A;  2G3A A;  5H9C A;  3AE8 C;  1KD1 W;  1GM7 A;  1YEW A;  4MTG A;  2J5U A;  3ZRS A;  5AVZ B;  2PI5 A;  3F5W C;  5H6Q A;  3H1J D;  1G4Y B;  3ZRW B;  3ZHS A;  2XAH A;  2F4V B;  5C93 A;  3BCC G;  1RF1 A;  3RGU A;  3T2M A;  2EIK C;  3L72 G;  3ABL C;  1KIL E;  2IZ1 A;  4LBE C;  3KQG A;  3SFE C;  4DV2 O;  3HPL C;  2C9N Y;  5CA0 B;  4XFJ A;  1WA8 B;  2Q6Q A;  2M5A A;  2P22 C;  1JPX A;  2ZE5 A;  2QE7 G;  2XOK G;  1HF9 A;  3SDL A;  5KLI B;  1M56 B;  2HFE C;  2NLJ C;  3KHU A;  1H8E G;  3JCZ A;  3K3W A;  4P9P A;  3NXS A;  1OCZ B;  1BGY H;  1J2J B;  2QTS A;  2IX7 C;  5EBL C;  5LOV A;  1FZB A;  2Y69 B;  1CPY A;  3G6E V;  1SQQ G;  4WVZ A;  2EZP A;  1FS0 E;  1VQP V;  1KQL A;  4FVM A;  5B66 Z;  1VQO P;  5KLI C;  1M56 C;  2XAQ A;  3O9O A;  3CRR A;  2W6I G;  1ENV A;  3H1H J;  1OCZ C;  4Q20 A;  2CTW A;  2E5T A;  4OWF A;  2X0L A;  4ASV A;  2EIN B;  4NXN O;  4DCK A;  4DV0 B;  2LW1 A;  4PI2 A;  5LGN A;  2Y69 C;  3TGU D;  4DV5 B;  3P30 A;  1BE3 H;  5K1P A;  1FAV A;  2PAJ A;  4L74 A;  2A79 B;  1XNR O;  3CX5 H;  1YHQ P;  5J9P C;  2QGN A;  3PLN A;  3RK2 B;  3ZHU A;  5JH7 A;  3AG7 A;  3W7U A;  2WPQ A;  5APY A;  5J2T B;  1SKV A;  3C8V A;  5CBG A;  5D5Q A;  3AK1 A;  4B7K A;  2EIN C;  4YJ3 B;  2MKV A;  4IL6 E;  2OYI A;  1K9M W;  3A5T A;  3ICX A;  5L8R J;  3R66 A;  2CTR A;  5CCG D;  1SZT A;  4TV8 A;  5EZY A;  2H7H A;  2ILM A;  1VQ7 V;  1AJQ A;  2WSC H;  1JCC A;  3L71 E;  3RK2 C;  5FNV A;  2O01 H;  1EZV E;  4BW5 A;  3SJB C;  5EBW C;  3M9Q A;  3B5N C;  5BMV A;  2FTK A;  3HTK A;  4JI0 O;  1VL2 A;  4AUW A;  3C3T A;  3M0D C;  1THZ A;  2DQ0 A;  2VRS A;  1HDJ A;  4H44 D;  5A9G A;  1PNM A;  4DO2 A;  5CB4 A;  1GMG A;  1N34 O;  2HHH O;  4R4M A;  2UXC O;  4DJG A;  4JZG A;  3CJH A;  3U11 A;  3DGE A;  1R1B A;  1T2K C;  3DXR B;  1MG1 A;  5B66 H;  1ZXG A;  1L0N D;  1YIT V;  4UVC A;  1X59 A;  5DN6 G;  1OW6 A;  4RO2 A;  1FXH A;  3L74 H;  4FLU A;  3LDC A;  3QH9 A;  4MVM A;  4UB8 Z;  2ZE7 A;  2WT7 B;  1L0L G;  2DQ3 A;  2ZD9 A;  2P67 A;  3BAB A;  4J80 A;  4Y28 J;  2XDJ A;  4I50 A;  4WBN A;  2UU9 B;  1SQB G;  4CS3 A;  1KC8 W;  1DX7 A;  1SS1 A;  2EZO A;  1XMQ O;  3V2R A;  4PA6 A;  2HEP A;  1EZV I;  1LTJ B;  2UXB O;  2BOC C;  2ZIN A;  4FPP A;  3K5L A;  4LF9 B;  3WU2 E;  2WQY C;  2A45 H;  4KJM A;  2CE4 A;  2QR4 A;  5IJ9 A;  2MJZ A;  1R5L A;  5IWA O;  3QF7 A;  2LQT A;  2K9Y A;  4FFK A;  2GUZ A;  1N7S D;  3I5C A;  4DW0 A;  4X9Q A;  4EEQ A;  3MHH C;  5APT A;  1AJY A;  1LTJ C;  3TCU A;  1S72 V;  1YJN V;  1LTS C;  2A06 H;  3OR7 C;  2D3O W;  3T97 B;  1Y76 B;  1AR1 B;  4WB4 A;  2LGW A;  4BR6 A;  1XQ8 A;  1OCR B;  4IHJ A;  3OMI B;  1FZE A;  1KB9 H;  4JI6 O;  1YI2 V;  1JTH B;  2KB7 P;  2DYS B;  4NB5 A;  2Q0O C;  4P9O A;  3B40 A;  4J9Z B;  3ZHV A;  1R6N A;  4A7P A;  4WFF A;  1EDL A;  4KUM A;  1WT6 A;  1ZR2 A;  1U57 A;  1FFX A;  4C7R A;  4PI0 A;  1QVG U;  4PV1 C;  2YI9 A;  1DEB A;  2QKS A;  2YIB D;  1OCR C;  2C2A A;  4RKU J;  1MSW D;  5TIS Z;  3CI9 A;  3AEC C;  2OTJ V;  1IDS A;  4UB8 H;  2DYS C;  2JJL A;  5CMU A;  1IBK B;  4GKK B;  2Y0D A;  1SFC B;  4ZKP A;  1MZ9 A;  1NHL A;  4DZO A;  4AYC A;  1P84 H;  3GWO A;  3SWY A;  1Z2G A;  2WVR A;  5H2F H;  1OCO B;  5LHH A;  2EIJ C;  4DT0 A;  3CMA V;  2MW2 B;  2QWO B;  3ASO B;  1UII A;  2K9J B;  2D2C B;  5AVT B;  3BRC A;  2FYU D;  1CEZ A;  5IYZ B;  4U3F E;  5KLV K;  1AV1 A;  5L3G A;  2WMM A;  1ZAU A;  5AW4 B;  1SQX D;  1QU7 A;  3H9V A;  1JMM A;  4PD4 E;  5KLV H;  1ZTE A;  2YS8 A;  4UB6 E;  3HKD A;  1OCO C;  1PV0 A;  1NR1 A;  2DOS A;  5GTH H;  4PD4 F;  3ASO C;  2FBW C;  4LFB O;  2YIA A;  1RSO A;  3E83 A;  2NPS B;  3H1J G;  4JAS A;  4LP8 A;  1M57 B;  3CRC A;  4KHP B;  3RL0 B;  3O6Q A;  1VMG A;  1YJW P;  2FXP A;  3HUS B;  1FZC B;  2YKO A;  4E2L A;  2OYH B;  1N86 A;  2VQE B;  3KDP B;  4I55 B;  4IFM A;  1MSD A;  1PKX A;  1XEQ A;  1N8R W;  2Z5H A;  3BAS A;  3CXH E;  3H1I J;  4PDV A;  1K33 A;  2YIU B;  3FAV A;  1U97 A;  1SA0 A;  2ZE6 A;  3CXH F;  1PGQ A;  2A3Q A;  2NPS C;  4LF4 B;  3HD7 B;  4CBC A;  4UCS A;  1EM1 A;  4DW1 A;  1KYO I;  1NVO A;  4Z1M H;  3RL0 C;  1IZN B;  2UXD B;  4FLY A;  1IUR A;  2HLO A;  2IBZ D;  4OH8 B;  3HUS C;  1FZC C;  2OYH C;  3K0D A;  1H2N A;  5TIS H;  3QTC A;  4LFC O;  4IIJ B;  3T1C A;  1MFZ A;  3S1K A;  1EXI A;  1NI8 A;  2LW7 A;  3OMN B;  2YIU C;  2R3S A;  5L3F A;  3IC7 A;  1IK7 A;  2E5L O;  4B86 A;  2I1K A;  4J7J A;  3HD7 C;  2WA4 A;  3BA8 A;  1QVF U;  2X7R B;  3CCJ P;  2H94 A;  4JI3 B;  2RMK B;  5K1X A;  4UCV A;  4H0L B;  4YXW H;  3P8C E;  3N2K A;  3KKY A;  3SGI A;  1SQG A;  4DR2 O;  1ZN5 A;  4HNA B;  2ARH A;  3CXH I;  3L73 D;  3CWB D;  4DV1 B;  2WLI B;  3ETQ A;  4LF5 O;  1YQ3 C;  1BGY E;  1R3K C;  4OGQ B;  3JAL B;  1GM9 A;  2PY5 A;  3TGU G;  5AVY B;  3Q4H B;  5DED A;  2F4V O;  1XMO B;  2FKX A;  4EB6 A;  1YZB A;  4H0L C;  1OHH G;  2Q4P A;  3WUT A;  4B7E A;  4CH4 A;  4J11 A;  2ZCE A;  3VQV A;  1SQQ K;  5AW5 B;  1S5J A;  2HFE D;  3HKB B;  4OGQ C;  2BCC D;  4CH5 A;  1OCC B;  3FFQ A;  3KZI H;  1MAB G;  5KMG B;  5CA1 A;  1NVP B;  3FXE A;  1NKN A;  1IFI A;  3CCU V;  1SQV J;  3ZMV A;  4ICG A;  4TQF A;  1Q2N A;  4TT3 G;  3CX5 E;  5B3S B;  1IZ3 A;  2Z0A A;  4TV9 B;  2QKC A;  3M7M X;  1PL4 A;  2ODM A;  3CX5 F;  2FY8 A;  2B9Z A;  4GT1 A;  1M56 D;  4J7K A;  2M7W A;  1OCC C;  2V7Q J;  2Y9Z A;  5FPO A;  5CBO A;  3E89 A;  4R4L A;  2DE0 X;  2JS3 A;  2RN9 A;  1NU1 K;  1U7J A;  2KZI A;  3CB2 A;  4D7T A;  1BHB A;  2PF4 E;  5B3S C;  4D6T D;  1O9G A;  2PZS A;  1RE4 C;  2KNC B;  1H2G A;  4I0X B;  2YXH A;  1Q82 W;  4JI2 B;  5CCH C;  3A0B Z;  3E86 A;  1L0N G;  1SQX J;  3CC7 P;  4DR4 B;  3KXD A;  1HJ0 A;  1Y9B A;  1M5I A;  2Q68 A;  3SPH A;  4B3R B;  1GL2 B;  1PPJ E;  1OZ0 A;  3RBX A;  1LR1 A;  3EFF K;  2IH1 C;  1LP1 B;  4RJT A;  3E8G A;  5GON B;  2JRI A;  4DOJ A;  1GH6 A;  3SWK A;  4BIZ A;  5B66 E;  4X64 B;  3TK1 A;  1H2M A;  1G1I A;  1M9N A;  1S5L Z;  4NKG B;  4MN4 C;  3B5N D;  4U3J B;  2YC0 A;  4HB1 A;  2KS1 B;  1VQM P;  4J42 A;  3B77 A;  3JAR A;  1PP9 D;  1ZL8 A;  4UCO A;  1G2C B;  2YID A;  3RGB A;  2C0X A;  4FLZ A;  4W80 A;  2C9L Y;  3SJA C;  3KCY A;  2O3J A;  4EDF A;  1H0T B;  1DK1 A;  3PP5 A;  3G6B A;  4BIO A;  2EBO A;  2R32 A;  3CE2 A;  1L0L K;  4DV2 B;  1COW G;  3OW2 O;  4L8J A;  1NTM D;  1SQP D;  3F7Y C;  1OZH A;  5BU8 B;  2CTP A;  4FLX A;  1KN7 A;  1L0L H;  3QVN A;  5JCO C;  3MIW A;  1RF1 B;  1SQB H;  1Q81 W;  2JWA A;  3MGN A;  3AE3 C;  3Q3D A;  2HLD G;  2OYQ A;  1R3L C;  1UPG A;  3H1K D;  4JTD B;  2ZAE B;  1WAZ A;  3L75 D;  2WIT A;  3T4Z A;  1M1J A;  3GF3 A;  3G9R A;  3A0B H;  2QEX P;  2LP7 A;  2A06 E;  2H88 C;  3RK3 E;  1J95 A;  2M5A B;  5IYD O;  1YTZ I;  3CWB J;  1RF1 C;  1EC5 A;  4O2A A;  4XE5 B;  3RT3 C;  1JA8 A;  4JTA B;  2WSE J;  4ASW A;  4IGG A;  1KB9 F;  4JZ2 A;  1JY3 O;  2C0W A;  3MHV A;  3D3I A;  5LOV B;  3DC6 A;  4LF9 O;  4NXN B;  4O9B A;  2FYU G;  3AEI A;  2B5U A;  3FB5 C;  4MW8 A;  1XNR B;  4UB8 E;  2P4V A;  1SQX G;  3WMM 0;  1LJ2 A;  1JO5 A;  2FXM A;  5CA3 A;  3SSU A;  1P84 E;  3P3P A;  4WFE A;  2GTA A;  5H2F E;  3A0R A;  2K3R A;  2UWJ E;  1GK9 A;  1YJW V;  1P84 F;  1H8H G;  1DD3 A;  2NZ2 A;  2WLH A;  1ZRT D;  2UUC O;  5JWP A;  4PV1 D;  4PDM A;  3VN0 A;  4LF7 O;  1PGJ A;  1X22 A;  4OPH A;  1KB9 I;  4UCR A;  3LSU A;  3C1L A;  1K34 A;  1K97 A;  1TUE B;  1KKD A;  4X1Y A;  4ZOL A;  1NR7 A;  2HOD A;  3N2G A;  3M06 A;  5GTH E;  3ZHT A;  4JI0 B;  2B87 A;  5CCG C;  2CGN A;  2LKM A;  3L70 D;  1CI6 B;  2L6L A;  5IDJ A;  5C39 A;  2IBZ G;  3OAK A;  2Y48 A;  1IBK O;  1N34 B;  2KG7 A;  2HHH B;  2O01 N;  2QIW A;  2R70 A;  1KC8 Q;  3AE4 C;  4LNU A;  3OTO O;  5BMV B;  3HTK B;  3CCJ V;  3ZMS A;  4AHC A;  3UIA A;  3ETG A;  2YXQ B;  1P84 I;  3H1J H;  1NGM B;  3AG1 B;  4F6R B;  2IM9 A;  1HR0 O;  4IFD K;  2IW5 A;  3CJH B;  3SJC C;  2PYJ A;  2B89 A;  2KSE A;  2CUG A;  2EIL B;  2HR3 A;  3W67 A;  4JI8 O;  1AQ5 A;  4DV3 O;  2Y9Y A;  1XMQ B;  1A02 J;  1NU1 D;  3L73 G;  2PRR A;  3CWB G;  3LNM B;  4LCU C;  1YCI A;  1KV4 A;  3AG1 C;  2UXB B;  1FU1 A;  1URF A;  3B4S A;  5A2Q N;  2FXO A;  1M8O B;  2NPS D;  1NTZ D;  2ZXW C;  2OIG A;  3CME V;  1D2D A;  1NKZ B;  1SQP J;  2EIL C;  2KLU A;  5IWA B;  2CH7 B;  1L4A D;  1NTK D;  1ZP0 C;  3RL0 D;  5CMZ A;  1N7S B;  1F7Y A;  1WLE A;  3GLM A;  4BWA A;  5DM6 V;  2AEJ A;  2BCC G;  2F1M A;  4TLF A;  1BCC J;  4EKW A;  4I6M C;  3U1C A;  3L75 J;  1G1J A;  4KHX A;  2K1A A;  3CRM A;  4JI6 B;  3QO5 A;  2Q69 A;  3VP9 A;  1B04 A;  3CCR P;  4NR1 A;  1N4C A;  2JS5 A;  1R3J C;  1N7S C;  1NZ6 A;  2OYO A;  2WZ7 A;  1IFP A;  1OIP A;  5AVS B;  4B3T O;  2ZDI A;  3OE7 G;  2Q67 A;  4NYK A;  3BEH A;  3LUT B;  3TGU H;  1VQ9 P;  4TUY B;  2J59 M;  3KZI E;  3CRA A;  4JI3 O;  1VPC A;  3D36 A;  2PFX A;  2WLL A;  3CC7 V;  4D6T G;  1JM0 A;  4H13 B;  4U7N A;  3WFV A;  4JI4 B;  4H0L D;  1ZX3 A;  1CSB A;  3CCQ P;  3I55 P;  3MTU E;  3CHX A;  1AI4 A;  2QSA A;  4DV1 O;  3N7N A;  1VP7 A;  2AXT Z;  5ITZ A;  1EDI A;  2VWK A;  3PHL A;  2O1J A;  4OGQ D;  1RPO A;  4FFB B;  3IAY A;  3HKE A;  1XMO O;  3ASN B;  1LTB C;  1JOY A;  4TT3 H;  5APX A;  4H13 C;  2N05 A;  2QWQ B;  3LW5 H;  3F7V C;  3H1H D;  3HKC B;  2SPZ A;  3D70 A;  1WB8 A;  4O2B B;  1VQM V;  1NH2 D;  1KUQ A;  2RMZ A;  3ABT A;  4U7J A;  3KCX A;  1AJN A;  1M93 A;  3V4W A;  4JAA A;  3X2Q B;  3U1A A;  1LWU A;  3K06 A;  1WPX A;  3ASN C;  1OVU A;  1L0N K;  3II6 A;  3NFQ A;  4F4L A;  3R2P A;  4FLT A;  2QM7 A;  2AXC A;  4O4I A;  2CK3 G;  4ZI7 A;  3CLQ A;  4LLH A;  3KG2 A;  1DGS A;  2P5O A;  1FZA A;  2Y0C A;  2R3C A;  5CCH D;  2XAF A;  1KYO H;  3ZCC A;  1NTM G;  1SQP G;  4WWI A;  1KQS O;  1W2B O;  3VOP A;  3O6Q B;  3C90 A;  3RL0 g;  1VDF A;  1VF5 D;  3G71 V;  2ZNI A;  3OGI B;  2BOB C;  2DWE C;  4LFC B;  4JAU A;  5B5E H;  2QEX V;  1SA0 B;  1Q6I A;  3H1K G;  2WLM A;  1BQZ A;  1AJP A;  4DR4 O;  3GF7 A;  4X62 O;  3L75 G;  2E5L B;  1SS3 A;  3TET A;  4K8X A;  1SZX A;  3TNU A;  4XDL A;  4DR6 O;  1WPB A;  1HNX B;  2RDC A;  2AXT H;  2KI7 B;  1XBL A;  1FFT B;  2OGU A;  2W6J G;  1SQB E;  2KUB A;  1NTZ J;  4YJ2 A;  2Q7C A;  3STL C;  4K8Z A;  3PTZ A;  4DR2 B;  1U7M A;  4X64 O;  1N32 B;  4FM0 A;  4HZ3 A;  3THO A;  1GW3 A;  4LF5 B;  1S9K E;  3A0B E;  4L73 A;  4O4L A;  4JF3 A;  3OFN G;  4JYA O;  3N2K B;  3OJA B;  1SQV K;  2IFM A;  4CZZ A;  4LH7 A;  3W7S A;  4LGD E;  2Q3I A;  3CCM P;  4IT5 A;  3W68 A;  1M1K Q;  1HGV A;  5KAI Z;  1IX9 A;  3V2Q A;  2A7W A;  2IU3 A;  2QWN B;  3RWR D;  4ASU G;  2N9B A;  1KBH A;  1AA0 A;  3L4F A;  3AE1 C;  4EB6 B;  4RAI A;  4B3M O;  1FZG A;  1ZSP A;  4NPE A;  2FL4 A;  4BAY A;  4BRY A;  1KMI Z;  1OV9 A;  1E1R G;  5LHG A;  2UUB O;  2NRG A;  1H89 A;  3CCL P;  1QHT A;  1V9P A;  2E74 B;  2FYU K;  2DWD C;  3JSV C;  5KJ7 A;  1Q82 Q;  1HP8 A;  2AZ2 A;  4C7N B;  4CS4 A;  4ZHQ B;  1AB3 A;  2W8Z A;  3L71 D;  1AR5 A;  3AE7 C;  1BL8 A;  5CA1 B;  5EYP B;  1SQX K;  2HPC A;  1JCD A;  1S4X A;  3L70 G;  2FYU H;  2ZYD A;  4TWK A;  1M4U A;  5GTI Z;  3GHG B;  1GD2 E;  2B1G A;  1BZK A;  3UO3 A;  3P8M C;  4G28 B;  2UUA B;  4X88 A;  1B6Q A;  2E74 C;  4HYT B;  3PH0 A;  5LXT B;  3JCU H;  3H1L J;  3HE4 B;  2P7J A;  4B08 A;  3LSS A;  1R5S A;  4JV5 O;  2F66 C;  3G4S V;  5KHJ A;  1KKC A;  4I2L C;  4GUN A;  4K35 A;  1YJ9 P;  3GHG C;  3N27 A;  3LID A;  5KKZ B;  1VQK P;  1EN4 A;  2F93 B;  4R8C A;  3RYC B;  5AW9 B;  3FXD A;  3AE5 C;  4JYB A;  1NU1 G;  1JY3 P;  3V2N A;  1PD3 A;  3B5N B;  4DRX A;  2KZJ A;  1Q8I A;  3H1J E;  5KAI H;  1F4N A;  1HW7 A;  1NTZ G;  1D7M A;  2PTM A;  1FBM A;  1N0N A;  1MUU A;  2W6B A;  2FFD A;  3K5O A;  5KKZ C;  1NTK G;  1JFF A;  2Q5Z A;  2IJI A;  4G27 B;  1Q81 Q;  3VQX A;  1AR4 A;  5JJE B;  3VMX A;  4XDK A;  2ZVN B;  4GOE A;  1ZV8 A;  3CC2 V;  1W2E A;  3F5H A;  3CCR V;  3JAR B;  3ML0 A;  3UT5 A;  4IYH A;  1ZL8 B;  3TJT A;  3LIE A;  4UV9 A;  1G8M A;  5AVR B;  3RN4 A;  4GZR B;  3EQ2 A;  1GKF A;  5AW0 B;  3JAK B;  4AQR D;  2BTQ A;  3H1I D;  2HP8 A;  4WFB V;  1XI1 A;  5GTI H;  1Y74 B;  2MK3 A;  4GDO A;  1L1F A;  3ZHQ A;  5AW1 B;  1S0V A;  3L73 H;  1RHZ B;  3RYH A;  4PJ0 Z;  4DK1 A;  4MVO A;  1QQC A;  5CJ4 A;  2UXN A;  1KZU B;  1WMK A;  3ZN1 A;  5AVQ B;  1YIJ P;  4GIF A;  3ZBH A;  2M8R A;  3ABU A;  2XND H;  4DK0 A;  1KU9 A;  4NPD A;  1N73 B;  3HE5 B;  3ZMT A;  2BCC H;  3JAS B;  2RH0 A;  1UJW B;  4FJC C;  4O2A B;  3TGU E;  1D5A A;  2JK5 C;  2QA4 P;  4UV8 A;  1B06 A;  3ITK A;  3BAA A;  5HFL A;  3E8H A;  4X20 B;  2R9R B;  4PA7 A;  1QEX A;  3H1H G;  1N73 C;  3OEE G;  2GTS A;  2F43 G;  3NR7 A;  2XTA A;  1HNZ O;  2RJZ A;  2KQX A;  5EIB C;  1K5S A;  4PV1 B;  3L71 J;  3RBZ A;  3K03 A;  3SFD C;  1LTI C;  3VTP C;  2UUC B;  4D6T H;  1N7L A;  3O65 A;  3I56 P;  3OD4 A;  1RQV A;  1BS3 A;  3RVZ A;  1NQT A;  2X6B A;  4LF7 B;  2E76 B;  1HVV A;  1KFN A;  3OGC C;  4P2Z A;  5C8Y A;  4KT0 J;  4X1K B;  4E4E A;  4UXN A;  1GDT A;  4RO0 A;  3IJ4 A;  2EIJ B;  4J7Z A;  4A5U B;  1SQV D;  2Y0I A;  3JAW A;  4I5S A;  2OIE A;  1WRG A;  1R8E A;  4PJ0 H;  4DR1 B;  5BR8 B;  4D7S A;  1E79 G;  1VIB A;  5KAF E;  2E76 C;  4LFA B;  4JI4 O;  5F2V O;  5JQG A;  4X1Y B;  4H13 D;  4I9Q A;  1OX3 A;  2JGD A;  1NT2 B;  1VF6 A;  2ZR2 A;  3OTO B;  2HOD B;  3N2G B;  4O4H A;  1OW7 A;  1YXB A;  4MVU A;  1KYO E;  1PGP A;  1PP9 H;  2X6A A;  1OWA A;  1HR0 B;  2G38 A;  2KG7 B;  2QWR B;  3ZHR A;  1KYO F;  5LP6 A;  1Y47 A;  4N78 E;  4UCU A;  1NTM K;  1SQP K;  2WSF J;  1JX9 A;  2CK3 H;  1BDD A;  2V4H A;  5B5E E;  2QM4 A;  2K9P A;  4JI8 B;  1FS0 G;  4DV3 B;  3KYQ A;  4MVR A;  3USS A;  1AVM A;  1NTM H;  2AGA A;  3IFM A;  2Q9I A;  3SWF A;  1EFR G;  4X89 A;  4X65 O;  1FE6 A;  2BTO A;  3DTU B;  2WSS G;  1IXB A;  1LTA C;  1L4A B;  3CCM V;  1BGY D;  4C46 A;  4UVA A;  1AIL A;  5KHG A;  1TA8 A;  1GW4 A;  3H1K H;  1IFJ A;  2H8P C;  5HFM A;  1YBK A;  1S5H C;  2WTY A;  2P90 A;  1UIX A;  4PA3 A;  4OX9 B;  4X1I A;  1QL2 A;  3CCL V;  2GUV A;  1Y8A A;  5EC2 C;  4MS2 A;  1L4A C;  4WY4 A;  2IJH A;  2OAR A;  4DUZ O;  4MVZ A;  1JR9 A;  3BVO A;  3BY6 A;  3H32 B;  1P7B A;  2BSK B;  3SYQ A;  3P7K A;  1OXZ A;  3L71 G;  4B3T B;  2YNY A;  4KFM A;  1HNX O;  3E22 A;  2PGG A;  1VQO V;  3K5N A;  1XL6 A;  2NN4 A;  3M99 B;  2A0L A;  3CCE P;  1HH0 A;  3BCC H;  3UCS C;  1TU3 F;  2IFN A;  3L72 H;  3D3Q A;  3RW0 A;  1FZF A;  1N2D C;  4U7O A;  1N32 O;  1MNG A;  1SQF A;  4HYO A;  2OQQ A;  4U3F J;  4PHZ A;  3Q5S A;  5E79 Z;  2N9Y B;  1YHQ V;  1TUB A;  4R6Z A;  5CN0 A;  3WB1 A;  3WB0 A;  2Q1K A;  4DR7 B;  2IU0 A;  3IN6 A;  1PPJ D;  2QE7 H;  1NH2 B;  1FDO A;  3ZN0 A;  3S3X A;  1Y4M A;  3JCU E;  4O4J B;  1DF5 A;  4F6E A;  1SVF A;  3BA9 A;  2W6A A;  4ZKI A;  3L70 H;  3D36 C;  2HG5 D;  4IL6 X;  2POH A;  3L35 A;  1F23 A;  1R6K A;  1RE3 A;  2P2U A;  3AEE C;  1SQQ H;  4JPZ B;  3GW6 A;  1BE3 E;  2V4D A;  3AEA C;  3FYI B;  3JAT A;  1J1E B;  5CBH A;  5IJ0 B;  5CA0 A;  3CPW U;  1WA8 A;  1M1K W;  3RYF A;  1VQ6 P;  2E74 D;  3BFR A;  2Z5I A;  2QKA A;  1LWU B;  4GKG A;  1KIL B;  3IC9 A;  3AK3 A;  2JWD A;  5BY1 A;  1TVK B;  1TGO A;  5IYB O;  5KAI E;  3FWL A;  4AQY B;  3Q5P A;  1PM9 A;  1FXV A;  1VF5 B;  1H2L A;  1CW5 A;  2Q5U A;  3JD2 A;  5LYJ B;  1J1E C;  1UFI A;  3H1I G;  2UUA O;  5AW8 B;  2UXX A;  4O4I B;  4ZI7 B;  1H38 A;  1HNW O;  1V54 B;  3GVM A;  1NTZ K;  1NU1 H;  2GA1 A;  1H2K A;  1NAY A;  1AI7 A;  5LBQ A;  1LWU C;  3M91 A;  4X62 B;  1T5E A;  2ZIO A;  1K04 A;  1KIL C;  1NTK K;  3TSI A;  1YIJ V;  3RYI B;  2EJR A;  3SYC A;  4AIL C;  2YEV A;  1SLQ A;  1VF5 C;  5E79 H;  4DR6 B;  2Q7G A;  5LHI A;  2M3E A;  1LNQ A;  3P3N A;  3SPI A;  1NYH A;  2A06 D;  3PJS K;  4LR3 A;  1GMJ A;  4IFF A; 
#chains in the Genus database with same CATH homology
 1OMI A;  2WQY C;  4GDO A;  1ZP0 C;  4XFJ A;  1DD4 A;  3AE3 C;  1KTM A;  3S9O A;  4H0L B;  3Q3D A;  3AEB C;  2K9Y A;  3GLM A;  1UIX A;  2JP3 A;  1HF9 A;  3GF3 A;  3Q2Y A;  1AJY A;  3G9R A;  1YQ3 C;  1MKM A;  2H88 C;  1WMK A;  3RK3 E;  4OGQ B;  2G8Y A;  3T97 B;  3D71 A;  3Q5R A;  2WSE J;  4H0L C;  2JO1 A;  2P10 A;  1KQF B;  5KLI C;  3AE1 C;  4OGQ C;  1U57 A;  1TU3 F;  4PV1 C;  3FGA D;  4RKU J;  1KMI Z;  2QJK C;  4H13 B;  3B71 A;  2H89 C;  4H44 B;  2E74 B;  3AEC C;  2OQQ A;  3AE6 C;  3LW5 J;  4H0L D;  1ZOY C;  1S5L X;  1OW8 A;  2D2C C;  3Q5S A;  2E75 B;  1Q90 D;  2WSC J;  3AE7 C;  3AED C;  2O01 J;  3IAO A;  4PV1 B;  3SFD C;  2FYN C;  3D6Y A;  2V7Q J;  4OGQ D;  2BEQ D;  1KOR A;  1DD3 A;  3C8V A;  3IN6 A;  1RQV A;  2NZ2 A;  2QJP C;  3ABV C;  2MKV A;  2E76 B;  2BEZ F;  2D2C B;  4PV1 D;  4R4L A;  2WPV B;  4TT3 H;  3D6Z A;  3Q1M A;  4H13 C;  1FDO A;  4H44 C;  2E74 C;  5L8R J;  4KT0 J;  2E75 C;  2D2C D;  3D70 A;  2QSI A;  4U7J A;  4IL6 X;  2ZT9 B;  1R8E A;  1JB0 J;  3AEE C;  1HJ0 A;  1K05 A;  1Y9B A;  3AEA C;  2FBW C;  3EWK A;  2E76 C;  1VL2 A;  1ZRT E;  3AE5 C;  4H13 D;  3H25 A;  1ZME C;  4H44 D;  2E74 D;  2QIW A;  3O6Q A;  2FXP A;  1OW7 A;  3AE4 C;  2E75 D;  4R4M A;  2IDB A;  1PIX A;  4I7Z B;  3AEG C;  2ZT9 C;  5M1B A;  3Q5P A;  2YMK A;  3AE2 C;  1VF5 B;  1NGM B;  1FDI A;  2QJY C;  2G3A A;  5KKZ C;  1OW6 A;  1KQG B;  2E76 D;  3AE8 C;  1VF5 D;  3RL0 g;  2J5U A;  1RQU A;  2WSF J;  4Z1M H;  4YXD C;  1PL5 A;  1YQ4 C;  4YTP C;  1K04 A;  3AEF C;  4Y28 J;  4I7Z C;  3GF7 A;  1DIP A;  1EXI A;  1S1C X;  2ZT9 D;  1VF5 C;  2YIU C;  1EXJ A;  3AE9 C;  1PV3 A;  1IK7 A;  1NYH A;  1KIL E;  3R4Y A;  3GMA A;  3SFE C;  1GMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...