1FBMA

Assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CARTILAGE OLIGOMERIC MATRIX PROTEIN)
publication title All-trans retinol, vitamin D and other hydrophobic compounds bind in the axial pore of the five-stranded coiled-coil domain of cartilage oligomeric matrix protein.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 17
structure length 46
sequence length 46
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2000-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11598 COMP Cartilage oligomeric matrix protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fbmA00
1DEBA 1FBMA 3V2RA 3V2NA 3V2PA 1VDFA 3V2QA 1MZ9A
chains in the Genus database with same CATH superfamily
2B89A 2RMZA 1JTHA 1EDJA 1G2CB 3OJAB 3OW2O 3HUSC 3RBZA 1FS0E 2O1KA 3PRJA 1N7SA 3BCCD 1ZMEC 5CBOA 2HODA 2P10A 2LXBA 5L8RJ 1GL2A 1SQVE 3B71A 2HFED 5KLVJ 3RK2C 2FYUK 1SQXG 2WWWA 3TNUA 1NH4A 3UIAA 2KOGA 2IZ0A 4L73A 4M3LA 5AW9B 2KLUA 2N1TB 1URQC 4TT3H 3M9BA 5AVRB 2KIKA 1EXIA 2QM7A 4WY4C 2IZ1A 1P84D 2OYHB 1L4AC 2M5AA 4OGQD 2J59M 2P58A 2R3SA 1IJDB 1NWQA 4PV1C 1SP4A 2QJPB 2NPSA 1SQXE 1OIPA 2W90A 4WWIA 4XE5B 2UWJE 4GOFA 1VQPP 1IK9A 5C39A 3L73D 1HTLC 3U59A 2Q1KA 2QVAA 4I7ZC 4KHXA 4YPCA 5BVZA 3H1KG 3IFMA 5CBNA 3O6QA 1X8YA 2BCCG 1SQPJ 2SPZA 5CJ0A 1YQ3C 2ZT9C 5BU8B 3P8CD 3WUVA 2WQYC 4H44B 3RK3D 1NU1D 2WMMA 3IF4A 1QL2A 1NTMG 2JR8A 2KXPB 1KILB 2Z5HA 1SQVK 2B88A 3HTKB 1IC2A 3PLNA 4C7RA 3H1KE 1AJYA 1IFPA 2BCCE 3L75E 4WVZA 3MTUE 4YXWH 3E7KA 1IFDA 3SFEC 5AVQB 4H13B 3L74J 1XTCC 3A0BE 2NZ2A 3TGUJ 1HJBA 1T3UA 1DEBA 1RQVA 3CXHI 1NTME 2E75B 1LGHB 3CCEP 1PPJE 1BCCG 5KLVD 3H1IJ 3H6PA 3A3YB 3D71A 3WU2H 3L72G 2P2UA 3FGAD 3EQ2A 1SQXK 5CJ4A 1JMBA 2O01J 2FFDB 1Q90D 3H1HE 1T3JA 4JF7A 2R5DA 4R4MA 5APVA 3WMM0 3PP5A 4GOEA 5AVVB 2QIWA 1NTKJ 2KYVA 2BEQD 1KYOE 3H1LG 2Q9IA 1BCCE 1EQ7A 1GDTA 5GTHH 1AQ5A 2H89C 1N2DC 1RQUA 3E1RA 1JUNA 1J1DC 3BVHA 1J1EC 5TISH 4O9BA 1RE4A 3CCVP 3CLQA 2XDJA 1Q2NA 2ZAEB 1N86A 2CPBA 1R5LA 1BGYE 1LT9B 1RF1B 1SQPD 3H1LE 3GHGA 1S5LH 2CPSA 2XKMA 5AVWB 1AV1A 1X22A 1BDDA 2FKWB 4KT0J 2Y0CA 1URQD 2RKLA 2O01H 1DEEG 4WY4D 1VDFA 2OYHC 1L4AD 3BCCG 1EZVG 3S9OA 1OVUA 1NTMK 1U7JA 1PGOA 3AE8C 4W80A 1NAYA 2QJPC 2E76B 3Q5SA 1N73B 3AE3C 1M57D 3G9RA 5KKZC 1ZRTE 2XV5A 1GK6A 3QH9A 3MHVA 2WSSH 2KS1B 3L74D 2A45I 3V4WA 1SFCB 1RF0C 1G1IA 1ZN5A 2K37A 4DJGA 1GU4A 1CZQA 3TGUD 2K9YA 2M8RA 3BCCE 1LTJB 5CCHD 4U3FG 5AW4B 1LP1A 3H1ID 2ZT9D 3CWBJ 2GUVA 3HD7B 3KZIE 3VMAA 3V2RA 5E79E 1LT1A 3NMDA 1JTHB 3BRTB 2PFXA 3KDPB 3L73G 2ZJSE 1NTKD 1RH5B 3ITKA 1X0TA 2Q3IA 1N7SB 1BDCA 2K9JB 1P84E 4H13C 4EDFA 5CCGA 1SQQJ 1GL2B 2PGDA 5APUA 1L0NJ 1RY3A 4NPDA 1Y9BA 1S2EA 2C9NY 1E5WA 2E75C 1ZOYC 2K88A 3CX5I 5AW6B 3B5NC 1N7LA 3VOPA 3L73E 5APYA 2WT7B 2LR2A 2OYOA 2PAJA 3JCUH 2K3RA 1ZXGA 3G3ZA 1IO4A 2Y0EA 3AE9C 1M1JC 3BASA 1JY3N 3RK3E 4IL6H 1NU1E 2NPSB 2XU6A 2HYNA 3SWYA 1RE3A 2OYIA 4OGQC 2YKPA 3FXDA 4HB1A 1QLED 1BE3J 3II6A 3S1KA 1QVGO 2I8DA 3H25A 3M9HA 1LTTC 4D6TJ 1Q82Q 4W7YA 4C7NA 1LT9C 2ZYAA 1RF1C 5H2FH 1T2KC 4DOJA 1T8ZA 3H32A 1NKNA 2M3BA 1JM0A 5B5EH 3LW5J 5KLVE 3CWBD 1VQ7P 1VQKP 3R2PA 2AEMA 3NTNA 3CXHH 3M0DA 1S4XA 3S4RA 1YIJP 1GZLA 2OTLP 2E76C 4GDOA 5AW3B 2FXPA 3L37A 4BXLA 4WBAA 2FXMA 3OAKA 4RO0A 2MKVA 2LXCB 1A02J 1VQ6P 1SQQD 5TJHA 1SFCC 2PRRA 4PJ0E 1OW7A 1L0ND 1MFZA 3CCLP 1AVYA 3F5HA 2QG4A 2Y9ZA 1M8OB 1LTJC 1NU1K 4Y99B 4TLFA 1OZHA 1FZCB 1OW8A 2E74B 1MFTA 4BRYA 2WPQA 1PGPA 1JMMA 1KILD 4I2LC 3LW5H 3WUUA 1ZLLA 4AQRD 3V4QA 1SQBD 2WTYA 4RKUJ 2WSEJ 1ZV8A 2H43A 1FZEA 3TGUG 1LTIC 3AE2C 1KMIZ 3M91A 1VQ9P 2HLOA 2ZVOB 4H13D 3GF3A 1BE3D 5KLVK 3AEFC 1Y47A 1HF9A 2E75D 1BSHA 4ZKPA 4UB8H 4D6TD 4N6JA 3B5ND 3GHGB 2B87A 1VPCA 1EC5A 3CL3D 3MD0A 3RL0B 2HPCA 1PGQA 3FXEA 3TGUE 3MIWA 2A45H 4ZKUA 4OH8B 3CC7P 3P7KA 3HUSA 5AVUB 4UB6E 1KQSO 2LKMA 2C9LY 5B66E 3VP9A 1CI6A 2R3CA 3ABVC 2MJZA 5EFWB 2QJKB 5CMZA 2E42A 2IFMA 2Z4EA 2WSEH 3HE4A 5BU5A 2VRSA 1JY2O 1MUUA 4BWNA 3KXDA 1XTGB 1SQPK 2IYPA 1URQA 1VQ8P 4OVNF 3Q5PA 3HE5B 1IFMA 2R5BA 1KD1Q 3L71J 1JY3O 4WY4A 1T2KD 3ZDMA 1L4AA 2W27A 3L75G 1FDOA 3I55P 5CCHC 2YO2A 1OX3A 1PGJA 4Z1MH 1DD3A 3CMAP 4N78D 3L4FA 2QM8A 3CX5H 3R4YA 5AW2B 1KYOI 3AE5C 5AW7B 2P67A 3IR9A 3TSIA 1FC2C 1KQGB 1PPJG 3AE1C 2E76D 1QL1A 4GIFA 1H0TA 2PP6A 3JC22 1X79B 1GW3A 3H1HG 3NFQA 1SFCD 1VF5C 1LTAC 4PD4E 2ITAA 2JKVA 1FZCC 2AEFA 1W2BO 3IN6A 3Q1MA 2ZVNB 4XA4A 1KB9E 4YXDC 3HD7D 1R5SA 1LTSC 3CX5D 4U7JA 5KAFH 1S5LX 5GTIE 2ZXXA 1L0LJ 3V2QA 2JWAA 4GODA 3JCUE 2GUSA 2KNCB 1BGYG 3EFGA 3GLMA 1N7SD 4H0LB 1LJ2A 1GL2D 1NAFA 1SVFA 3SWKA 3W68A 2IBZG 1YITP 4HKZH 3F89A 1Y8AA 3V2PA 1EZVI 3CCMP 2P1JA 2N9BA 5AW8B 3PHLA 2G3AA 4W7ZA 2HG5D 2WSCH 1ZP0C 3L71D 1MV8A 1WRGA 1SQQE 1L0NE 3RL0C 1A02F 1SQBG 1IZNB 1LWUA 1JNMA 1K8AQ 3CD6P 1NTZJ 1DH3A 2N1TC 3A0HE 3MUDC 2V4HA 2YXRB 1NKZB 2IBZE 3MGNA 1BE3G 4HYTB 2NPSD 5B5EE 1KQFB 3B4SA 3KQGA 4JYBA 2QJKC 5APXA 2KSEA 1KILE 4IOIH 1YJ9P 3H1KJ 2BCCJ 1QX8A 3W67A 2Z5IA 2WSFJ 1SQBE 3P32A 2WVRA 3CPWO 2R44A 4ASWA 1GW4A 2FBWC 1KQLA 3VYIA 2JWDA 2YKQA 1BE3E 2OYHA 2FY8A 3G71P 1USDA 2KB7P 2O3JA 3B8EB 5APTA 5M1BA 1S3JA 3E1IA 4H44C 4HJGH 4D6TE 4I1LA 3FX0A 1EDKA 4B86A 5KJ7C 1S1CX 2WPRA 1KILC 1NHLA 5CHXA 1L0LD 4L74A 1RF0A 2WPSA 3CCUP 1S9KD 1CW5A 1SQQK 1L0NK 2O01N 4Y28J 4IL6X 4LC1A 2OTKE 4WB4A 1BCCJ 2HODB 2Q7CA 1FZBA 3L70J 1VF5D 3L72J 1S72P 1FJKA 2WSFH 2B87B 3CI9A 2W6BA 2KLVA 1NU1G 3TNUB 4HH2A 3CCQP 3PTZA 3HTKA 1HH0A 2HPCB 2J58A 2YKOA 4JPZB 1FU1A 3A0BH 5AW1B 2E74D 2ZYDA 3HUSB 2FFDC 1FDIA 4GKGA 3U1AA 1SQBK 1NTZD 3H1JJ 1VQLP 2ZYGA 2M5AB 2B9BA 1NGMB 3P8CE 3RK2B 4YTPC 1M7LA 1FBMA 4IFMA 5AVZB 4H0LC 1YTZT 1AQTA 1PP9J 3B5NA 1L2PA 2ZFCA 3AEDC 3H1KD 1ZR2A 1GK4A 5KLVG 3D70A 2BCCD 1URQB 2HR3A 2IFNA 2J5UA 1JY2P 3CC2P 3O6QB 1L4AB 5K5GB 1EDIA 2OGUA 1USEA 1HGZA 1M1JA 1ZR4A 4PV1B 1QVFO 4RJTA 3RL0D 3N7NA 2QE7H 4NPEA 2KZJA 3SWFA 1KC8Q 1TU3F 2N1TD 3PJSK 1M90Q 4I7ZB 1FDMA 1HVVA 1GMJA 3EFFK 3Q3DA 1OW6A 1LTGC 1W5CE 1EDLA 1H0TB 3A7OA 1RHZB 3KHUA 4EI2A 1N73C 1RF1A 1WMKA 3L35A 1HUCA 4U3FJ 5KAIH 1BCCD 3GG2A 1U7MA 2KI7B 1IK7A 1SQPG 3L70D 1OVRA 2FYNB 3L72D 5DJUB 4OWFA 5AW0B 1T6AA 2Y0DA 4K3AA 3TDKA 1HJ0A 1DD4A 4H44D 3HD7C 3CXHD 3WU2E 2QSIA 3H1JD 4EIJA 1Z56A 5KJ7D 1SQPE 2QEXP 2W8ZA 2QA4P 1SFCA 3BATA 2ZXEB 3L74G 1LTJA 5E79H 1IFNA 3V2NA 1FJPA 1PP9D 1N7SC 2WITA 4LLHA 1GTWA 1FOSF 3SSUA 2D2CB 2YNYA 1GL2C 3H1IG 4AYCA 2E43A 1YJWP 5GTHE 2JP3A 3LIDA 1ZRTD 4NPFX 2G8YA 3LIEA 5TISE 1LWUB 2IPPA 1L0LG 3L74E 4GT1A 5APQA 3IAOA 1EZVD 2K9JA 1Q86Q 1NTKG 1J1DB 1CSBA 1J1EB 2L91A 1S5LE 3H1IE 5APSA 2JDIH 3CMEP 2NPSC 1OVVA 1VQNP 1U57A 3VN0A 4H0LD 5AVSB 3U1CA 2BASA 1JOCA 2K1AA 1YHQP 1FZGA 2KZIA 1L0LE 4ZMDA 2FYUJ 3V6IA 2WT7A 3VMXA 4U3FD 1NTKE 1S9KE 1N8RQ 4PD4I 4R4LA 3C1LA 3KPEA 2W83C 3T97A 1JCDA 1NTZG 1LP1B 2Q5UA 2KP8A 1QEXA 1KB9I 5AW5B 1FAVA 3NXSA 4DCKA 1NYHA 3FWLA 1GD2E 3QWOC 5KKZB 3M0AA 1JO5A 2A06D 3Q2YA 2JO1A 3MZWB 2KSJA 2M0BA 1LNQA 1NTZE 5KLIB 1OWAA 1FOSE 2AEJA 2NRGA 1E79H 5CCHA 3VTPC 1AVOA 4DT0A 1UIIA 2FYNC 3AEGC 2XNXA 1PFIA 2WSCJ 2C0WA 3CWBG 4Y99C 1KORA 3CCJP 4PJ0H 1NJIQ 1SQVJ 1Q7YQ 1L0LK 1OFCX 2E74C 1K9MQ 2POHA 2IBZI 1MZ9A 2M3EA 1NTKK 3AEBC 1PV3A 2AXTH 3N4XA 3D6ZA 3A5TA 3B5NB 2OYIB 3L70G 3A2AA 1JB0J 4JQ0D 1SQQG 1UIXA 1VQMP 3CWBE 1L0NG 3O8ZA 1KN7A 2KK7A 1FZCA 4IL6E 2D2CC 3USSA 4MN4C 1MKMA 2FYUD 3AECC 1RE4C 4ZNCA 1SQXJ 3RBXA 3MP7B 4JYCA 1NVOA 1QGKB 1PZQA 1AA0A 1M1JB 1HGVA 2GA1A 4C7NB 2N9YB 3GHGC 1LWUC 3H1JG 3H32B 4OGQB 1VQ4P 1NTZK 3L70E 3L72E 3D6YA 3AEAC 4I6MC 3I5CA 1M56D 3GW6A 2JEEA 1G2CA 5H2FE 1PP9G 3SFDC 1YYCA 3RK2D 1SLQA 1WT6A 4XFJA 4AUWA 4DZOA 1DIPA 3CXHE 2YIUB 3RGUA 4EOTA 1P84I 3G4SP 3H1JE 4UB6H 2IX7C 4D6TG 2IDBA 5B66H 1W2EA 3RK3B 1OMIA 3L75J 2C0XA 1PP9E 2CK3H 2N1TA 3MUDA 5KAIE 2Y9YA 3AE4C 4CPGA 2WZ7A 4PV1D 1IFJA 1X9VA 3M9QA 4C46A 2W6JH 2GM4A 3AE6C 2KUBA 1NTMJ 3EWKA 1SQVD 3GMAA 3AE7C 4BRYB 2OQQA 2QRXA 2QJYB 1NOHA 3H1HJ 2FYZA 3C9IA 3VMZA 1EZVE 2OARA 3HE5A 5KLIC 2V7QJ 2FXOA 5DJTB 4JBZA 5APWA 2I1KA 3G6EP 1YI2P 3CC4P 5CCGC 1EXJA 4LGDE 3L36A 3FWNA 1FZAA 1SQXD 2A45G 1KTMA 2DW3A 3CCRP 3OA7A 1HBWA 5KJ7A 1KILA 1KFNA 2A06G 4U3FE 1VQ5P 1FE6A 1JCCA 4UB8E 3Q5RA 1AFOA 4EYYQ 1BGYJ 4PD4H 2W6AA 4IFFA 4KJMA 3H1LJ 2H8PD 2BEZF 1CI6B 1KB9H 1RE3C 2E5TA 2OYIC 1YQ4C 2YMKA 1KV4A 3HRNA 2JJLA 4N78E 2A06E 3KYQA 3HE4B 5GTIH 3CCSP 2V7QH 5AVTB 2D2CD 1JEKA 2Q6QA 3TYYA 2H88C 1JY2N 3TF5A 4N3YB 1KYOH 3T97B 2FFDA 2P7JA 3P8MC 3L75D 1OXZA 1SQBJ 3RL0g 2OTJP 3WUTA 4WY4B 3GF7A 1H89A 4K35A 3V5BA 2KNCA 1JY3P 1ZW0A 3TK1A 3BRVB 2R32A 4PD4D 1NTMD 3BCCJ 3M0DC 2YMYA 1PPJD 1K73Q 1NO4A 3AEEC 2L5GB 2Q3EA 2E5YA 1YBKA 1KB9D 1Q81Q 2FYUG 3H1HD 4QMAA 3VMYA 2RH0A 2YIUC 3CX5E 3A0HH 1R8EA 3PH0A 3VP8A 2YXQB 1LT9A 2ZT9B 1KZUB 1KYOD 3RK3C 3L71G 1FZFA 5AVYB 1GU5A 2FYUE 2AXCA 3C8VA 3K5BA 1LTBC 1KFMA 4A7PA 1DX7A 1G1JA 1BSNA 1IFIA 1VL2A 1N73A 2O1JA 3L73J 1BGYD 2QJYC 1K04A 3M06A 1VF5B 3L71E 3H1LD 1PL5A 1H88A 4ASVA 1K05A 5KTBA 4L75A 4IFDK 2KS1A 5AVXB 5KAFE 1VQOP 1M1KQ 2AXTE 2XNDH 2IBZD 2I1JA 2WPVB 3KZIH 5CCGD 1PIXA 1SS1A 4L76A 2RN0A 1NU1J 1J2JB 1H8AA 3JSVC 2IYOA 2XZRA 1YJNP 1YTZI 3I56P 1HWTC 1SQVG 1D7MA 2YO3A 3HD7A 4RESB 2H7HA 1P84H
chains in the Genus database with same CATH topology
2YKPA 3P32A 1JTHA 1GW4A 3II6A 2C0WA 1G2CB 3OJAB 4Y99C 1KQLA 3HUSC 3VYIA 2O1KA 2YKQA 1N7SA 3M9HA 1LTTC 2OYHA 2HODA 1L0LK 2KB7P 4W7YA 2POHA 4C7NA 1LT9C 3B8EB 1MZ9A 1GL2A 5APTA 1RF1C 1T2KC 3E1IA 1NTKK 2HFED 4DOJA 4I1LA 3RK2C 1T8ZA 3N4XA 3H32A 3A5TA 2FYUK 2WWWA 3TNUA 1NH4A 3UIAA 1NKNA 2KOGA 2M3BA 3B5NB 2OYIB 3A2AA 4B86A 5KJ7C 2WPRA 3R2PA 1KILC 1NHLA 3NTNA 5CHXA 4M3LA 3M0DA 1GZLA 5AW9B 1RF0A 2WPSA 3O8ZA 2N1TB 1URQC 3M9BA 1FZCA 1S9KD 5AVRB 1CW5A 1SQQK 1L0NK 1RE4C 2QM7A 4WY4C 2OYHB 1L4AC 4LC1A 4JYCA 4WB4A 2HODB 1M1JB 2Q7CA 2J59M 1FZBA 1HGVA 5AW3B 4C7NB 1IJDB 1NWQA 3L37A 1SP4A 1FJKA 2NPSA 2WSFH 4WBAA 2FXMA 3GHGC 3CI9A 3OAKA 2W6BA 1LWUC 1A02J 4XE5B 2KLVA 3H32B 1NTZK 1SFCC 3TNUB 4HH2A 1MFZA 3HTKA 1HH0A 4I6MC 2HPCB 3I5CA 1IK9A 2J58A 1HTLC 2YKOA 3U59A 1FU1A 1LTJC 2JEEA 4KHXA 1G2CA 1NU1K 4Y99B 5AW1B 3HUSB 5BVZA 3IFMA 2FFDC 1X8YA 4GKGA 1FZCB 1YYCA 3RK2D 3U1AA 1SLQA 1SQBK 1WT6A 5CJ0A 4AUWA 4DZOA 5BU8B 3P8CD 2WPQA 3P8CE 3RK2B 4EOTA 3RK3D 1JMMA 1KILD 1M7LA 4I2LC 1FBMA 4IFMA 5AVZB 3LW5H 1YTZT 2IX7C 1ZLLA 1QL2A 3B5NA 4AQRD 1W2EA 3V4QA 3RK3B 2WTYA 1KILB 2C0XA 2Z5HA 2ZFCA 1SQVK 1ZR2A 1ZV8A 3HTKB 2H43A 1FZEA 1IC2A 1GK4A 4C7RA 1LTIC 1URQB 3M91A 2N1TA 2HLOA 3MUDA 2IFNA 1JY2P 2WZ7A 3MTUE 1IFJA 1X9VA 3M9QA 4C46A 5KLVK 1IFDA 1L4AB 2GM4A 5AVQB 1HGZA 1M1JA 1ZR4A 4ZKPA 1XTCC 3RL0D 4N6JA 3B5ND 3GHGB 3N7NA 1HJBA 1T3UA 1DEBA 1VPCA 1NOHA 1LGHB 3SWFA 3CL3D 2N1TD 3MD0A 3RL0B 3H6PA 3A3YB 2HPCA 2FYZA 3C9IA 3VMZA 3MIWA 1FDMA 1HVVA 2A45H 4ZKUA 2P2UA 2OARA 3HE5A 3P7KA 3EQ2A 4OH8B 1SQXK 1LTGC 5CJ4A 3HUSA 2FFDB 5APWA 1T3JA 2I1KA 4JF7A 2R5DA 5AVUB 5CCGC 5APVA 3A7OA 4LGDE 3L36A 2LKMA 3WMM0 3PP5A 2C9LY 3VP9A 1CI6A 2R3CA 1N73C 1RF1A 2MJZA 5AVVB 3L35A 2KYVA 1FZAA 1HUCA 2A45G 5CMZA 2E42A 2IFMA 2Q9IA 2Z4EA 2WSEH 3HE4A 3OA7A 1EQ7A 1GDTA 1HBWA 5KJ7A 1AQ5A 5BU5A 2VRSA 1KILA 1N2DC 1KFNA 5AW0B 1JY2O 1MUUA 1XTGB 1SQPK 1JCCA 1URQA 1JUNA 1J1DC 3HE5B 1IFMA 2R5BA 3BVHA 1AFOA 1JY3O 2W6AA 1J1EC 4IFFA 4O9BA 1RE4A 4WY4A 3CLQA 2XDJA 1T2KD 1L4AA 2W27A 2H8PD 1N86A 2CPBA 5CCHC 3HD7C 1LT9B 1CI6B 2YO2A 1RE3C 1RF1B 2OYIC 3GHGA 4EIJA 1Z56A 5KJ7D 3HRNA 4N78D 3L4FA 2QM8A 1SFCA 2CPSA 2XKMA 2JJLA 5AVWB 5AW2B 2FKWB 3BATA 4N78E 3KYQA 1URQD 3HE4B 5AW7B 2ZXEB 2P67A 3IR9A 2O01H 5AVTB 3TSIA 1LTJA 3TYYA 1JY2N 1IFNA 3V2NA 1FJPA 1QL1A 1N7SC 1VDFA 2WITA 4LLHA 4N3YB 4WY4D 1GTWA 2OYHC 1FOSF 1L4AD 4GIFA 2FFDA 2P7JA 1NTMK 2PP6A 3P8MC 1OXZA 2YNYA 1X79B 4W80A 1GW3A 1GL2C 4AYCA 3NFQA 4WY4B 1H89A 2E43A 1N73B 3LIDA 3V5BA 1JY3P 1SFCD 3TK1A 3BRVB 2R32A 2XV5A 1GK6A 1LTAC 3LIEA 1LWUB 2IPPA 2A45I 3M0DC 2YMYA 3V4WA 1SFCB 1RF0C 1G1IA 1NO4A 1ZN5A 4GT1A 1GU4A 1CZQA 2L5GB 5APQA 1FZCC 2M8RA 1J1DB 1LTJB 4XA4A 5CCHD 5AW4B 1CSBA 3HD7D 1J1EB 3VMYA 1LTSC 5APSA 2GUVA 3HD7B 2NPSC 3VP8A 3V2QA 3VN0A 1LT9A 1KZUB 3V2RA 2GUSA 5AVSB 3RK3C 2BASA 3U1CA 1JOCA 3EFGA 1FZGA 3NMDA 1JTHB 1FZFA 5AVYB 3BRTB 1N7SD 3KDPB 2WT7A 3VMXA 1S9KE 1GL2D 2Q3IA 1NAFA 1GU5A 3KPEA 1N7SB 1SVFA 3T97A 1JCDA 3V2PA 5CCGA 2Q5UA 1GL2B 2KP8A 5APUA 2P1JA 1LTBC 2N9BA 5AW8B 1KFMA 1RY3A 1DX7A 1G1JA 4W7ZA 5AW5B 1IFIA 2HG5D 1FAVA 3NXSA 1N73A 2C9NY 2O1JA 2WSCH 1E5WA 1MV8A 1WRGA 3M06A 1GD2E 3RL0C 3M0AA 5AW6B 3B5NC 1A02F 1H88A 1N7LA 5KTBA 3VOPA 4IFDK 1LWUA 1JNMA 1JO5A 5AVXB 5APYA 1DH3A 2N1TC 2WT7B 2I1JA 2PAJA 1NKZB 5CCGD 2KSJA 3MGNA 4HYTB 2NPSD 1J2JB 1OWAA 3G3ZA 1FOSE 3KQGA 1IO4A 1H8AA 2XZRA 1M1JC 4JYBA 3BASA 5APXA 1JY3N 1YTZI 1HWTC 5CCHA 3VTPC 2NPSB 2XU6A 2YO3A 3HD7A 2HYNA 3SWYA 1RE3A 2OYIA 4RESB 2XNXA 2H7HA 2Z5IA 1PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEB A;  1FBM A;  3V2R A;  3V2N A;  3V2P A;  1VDF A;  3V2Q A;  1MZ9 A; 
#chains in the Genus database with same CATH topology
 2B89 A;  2RMZ A;  1JTH A;  1EDJ A;  1G2C B;  3OJA B;  3OW2 O;  3HUS C;  3RBZ A;  1FS0 E;  2O1K A;  3PRJ A;  1N7S A;  3BCC D;  1ZME C;  5CBO A;  2HOD A;  2P10 A;  2LXB A;  5L8R J;  1GL2 A;  1SQV E;  3B71 A;  2HFE D;  5KLV J;  3RK2 C;  2FYU K;  1SQX G;  2WWW A;  3TNU A;  1NH4 A;  3UIA A;  2KOG A;  2IZ0 A;  4L73 A;  4M3L A;  5AW9 B;  2KLU A;  2N1T B;  1URQ C;  4TT3 H;  3M9B A;  5AVR B;  2KIK A;  1EXI A;  2QM7 A;  4WY4 C;  2IZ1 A;  1P84 D;  2OYH B;  1L4A C;  2M5A A;  4OGQ D;  2J59 M;  2P58 A;  2R3S A;  1IJD B;  1NWQ A;  4PV1 C;  1SP4 A;  2QJP B;  2NPS A;  1SQX E;  1OIP A;  2W90 A;  4WWI A;  4XE5 B;  2UWJ E;  4GOF A;  1VQP P;  1IK9 A;  5C39 A;  3L73 D;  1HTL C;  3U59 A;  2Q1K A;  2QVA A;  4I7Z C;  4KHX A;  4YPC A;  5BVZ A;  3H1K G;  3IFM A;  5CBN A;  3O6Q A;  1X8Y A;  2BCC G;  1SQP J;  2SPZ A;  5CJ0 A;  1YQ3 C;  2ZT9 C;  5BU8 B;  3P8C D;  3WUV A;  2WQY C;  4H44 B;  3RK3 D;  1NU1 D;  2WMM A;  3IF4 A;  1QL2 A;  1NTM G;  2JR8 A;  2KXP B;  1KIL B;  2Z5H A;  1SQV K;  2B88 A;  3HTK B;  1IC2 A;  3PLN A;  4C7R A;  3H1K E;  1AJY A;  1IFP A;  2BCC E;  3L75 E;  4WVZ A;  3MTU E;  4YXW H;  3E7K A;  1IFD A;  3SFE C;  5AVQ B;  4H13 B;  3L74 J;  1XTC C;  3A0B E;  2NZ2 A;  3TGU J;  1HJB A;  1T3U A;  1DEB A;  1RQV A;  3CXH I;  1NTM E;  2E75 B;  1LGH B;  3CCE P;  1PPJ E;  1BCC G;  5KLV D;  3H1I J;  3H6P A;  3A3Y B;  3D71 A;  3WU2 H;  3L72 G;  2P2U A;  3FGA D;  3EQ2 A;  1SQX K;  5CJ4 A;  1JMB A;  2O01 J;  2FFD B;  1Q90 D;  3H1H E;  1T3J A;  4JF7 A;  2R5D A;  4R4M A;  5APV A;  3WMM 0;  3PP5 A;  4GOE A;  5AVV B;  2QIW A;  1NTK J;  2KYV A;  2BEQ D;  1KYO E;  3H1L G;  2Q9I A;  1BCC E;  1EQ7 A;  1GDT A;  5GTH H;  1AQ5 A;  2H89 C;  1N2D C;  1RQU A;  3E1R A;  1JUN A;  1J1D C;  3BVH A;  1J1E C;  5TIS H;  4O9B A;  1RE4 A;  3CCV P;  3CLQ A;  2XDJ A;  1Q2N A;  2ZAE B;  1N86 A;  2CPB A;  1R5L A;  1BGY E;  1LT9 B;  1RF1 B;  1SQP D;  3H1L E;  3GHG A;  1S5L H;  2CPS A;  2XKM A;  5AVW B;  1AV1 A;  1X22 A;  1BDD A;  2FKW B;  4KT0 J;  2Y0C A;  1URQ D;  2RKL A;  2O01 H;  1DEE G;  4WY4 D;  1VDF A;  2OYH C;  1L4A D;  3BCC G;  1EZV G;  3S9O A;  1OVU A;  1NTM K;  1U7J A;  1PGO A;  3AE8 C;  4W80 A;  1NAY A;  2QJP C;  2E76 B;  3Q5S A;  1N73 B;  3AE3 C;  1M57 D;  3G9R A;  5KKZ C;  1ZRT E;  2XV5 A;  1GK6 A;  3QH9 A;  3MHV A;  2WSS H;  2KS1 B;  3L74 D;  2A45 I;  3V4W A;  1SFC B;  1RF0 C;  1G1I A;  1ZN5 A;  2K37 A;  4DJG A;  1GU4 A;  1CZQ A;  3TGU D;  2K9Y A;  2M8R A;  3BCC E;  1LTJ B;  5CCH D;  4U3F G;  5AW4 B;  1LP1 A;  3H1I D;  2ZT9 D;  3CWB J;  2GUV A;  3HD7 B;  3KZI E;  3VMA A;  3V2R A;  5E79 E;  1LT1 A;  3NMD A;  1JTH B;  3BRT B;  2PFX A;  3KDP B;  3L73 G;  2ZJS E;  1NTK D;  1RH5 B;  3ITK A;  1X0T A;  2Q3I A;  1N7S B;  1BDC A;  2K9J B;  1P84 E;  4H13 C;  4EDF A;  5CCG A;  1SQQ J;  1GL2 B;  2PGD A;  5APU A;  1L0N J;  1RY3 A;  4NPD A;  1Y9B A;  1S2E A;  2C9N Y;  1E5W A;  2E75 C;  1ZOY C;  2K88 A;  3CX5 I;  5AW6 B;  3B5N C;  1N7L A;  3VOP A;  3L73 E;  5APY A;  2WT7 B;  2LR2 A;  2OYO A;  2PAJ A;  3JCU H;  2K3R A;  1ZXG A;  3G3Z A;  1IO4 A;  2Y0E A;  3AE9 C;  1M1J C;  3BAS A;  1JY3 N;  3RK3 E;  4IL6 H;  1NU1 E;  2NPS B;  2XU6 A;  2HYN A;  3SWY A;  1RE3 A;  2OYI A;  4OGQ C;  2YKP A;  3FXD A;  4HB1 A;  1QLE D;  1BE3 J;  3II6 A;  3S1K A;  1QVG O;  2I8D A;  3H25 A;  3M9H A;  1LTT C;  4D6T J;  1Q82 Q;  4W7Y A;  4C7N A;  1LT9 C;  2ZYA A;  1RF1 C;  5H2F H;  1T2K C;  4DOJ A;  1T8Z A;  3H32 A;  1NKN A;  2M3B A;  1JM0 A;  5B5E H;  3LW5 J;  5KLV E;  3CWB D;  1VQ7 P;  1VQK P;  3R2P A;  2AEM A;  3NTN A;  3CXH H;  3M0D A;  1S4X A;  3S4R A;  1YIJ P;  1GZL A;  2OTL P;  2E76 C;  4GDO A;  5AW3 B;  2FXP A;  3L37 A;  4BXL A;  4WBA A;  2FXM A;  3OAK A;  4RO0 A;  2MKV A;  2LXC B;  1A02 J;  1VQ6 P;  1SQQ D;  5TJH A;  1SFC C;  2PRR A;  4PJ0 E;  1OW7 A;  1L0N D;  1MFZ A;  3CCL P;  1AVY A;  3F5H A;  2QG4 A;  2Y9Z A;  1M8O B;  1LTJ C;  1NU1 K;  4Y99 B;  4TLF A;  1OZH A;  1FZC B;  1OW8 A;  2E74 B;  1MFT A;  4BRY A;  2WPQ A;  1PGP A;  1JMM A;  1KIL D;  4I2L C;  3LW5 H;  3WUU A;  1ZLL A;  4AQR D;  3V4Q A;  1SQB D;  2WTY A;  4RKU J;  2WSE J;  1ZV8 A;  2H43 A;  1FZE A;  3TGU G;  1LTI C;  3AE2 C;  1KMI Z;  3M91 A;  1VQ9 P;  2HLO A;  2ZVO B;  4H13 D;  3GF3 A;  1BE3 D;  5KLV K;  3AEF C;  1Y47 A;  1HF9 A;  2E75 D;  1BSH A;  4ZKP A;  4UB8 H;  4D6T D;  4N6J A;  3B5N D;  3GHG B;  2B87 A;  1VPC A;  1EC5 A;  3CL3 D;  3MD0 A;  3RL0 B;  2HPC A;  1PGQ A;  3FXE A;  3TGU E;  3MIW A;  2A45 H;  4ZKU A;  4OH8 B;  3CC7 P;  3P7K A;  3HUS A;  5AVU B;  4UB6 E;  1KQS O;  2LKM A;  2C9L Y;  5B66 E;  3VP9 A;  1CI6 A;  2R3C A;  3ABV C;  2MJZ A;  5EFW B;  2QJK B;  5CMZ A;  2E42 A;  2IFM A;  2Z4E A;  2WSE H;  3HE4 A;  5BU5 A;  2VRS A;  1JY2 O;  1MUU A;  4BWN A;  3KXD A;  1XTG B;  1SQP K;  2IYP A;  1URQ A;  1VQ8 P;  4OVN F;  3Q5P A;  3HE5 B;  1IFM A;  2R5B A;  1KD1 Q;  3L71 J;  1JY3 O;  4WY4 A;  1T2K D;  3ZDM A;  1L4A A;  2W27 A;  3L75 G;  1FDO A;  3I55 P;  5CCH C;  2YO2 A;  1OX3 A;  1PGJ A;  4Z1M H;  1DD3 A;  3CMA P;  4N78 D;  3L4F A;  2QM8 A;  3CX5 H;  3R4Y A;  5AW2 B;  1KYO I;  3AE5 C;  5AW7 B;  2P67 A;  3IR9 A;  3TSI A;  1FC2 C;  1KQG B;  1PPJ G;  3AE1 C;  2E76 D;  1QL1 A;  4GIF A;  1H0T A;  2PP6 A;  3JC2 2;  1X79 B;  1GW3 A;  3H1H G;  3NFQ A;  1SFC D;  1VF5 C;  1LTA C;  4PD4 E;  2ITA A;  2JKV A;  1FZC C;  2AEF A;  1W2B O;  3IN6 A;  3Q1M A;  2ZVN B;  4XA4 A;  1KB9 E;  4YXD C;  3HD7 D;  1R5S A;  1LTS C;  3CX5 D;  4U7J A;  5KAF H;  1S5L X;  5GTI E;  2ZXX A;  1L0L J;  3V2Q A;  2JWA A;  4GOD A;  3JCU E;  2GUS A;  2KNC B;  1BGY G;  3EFG A;  3GLM A;  1N7S D;  4H0L B;  1LJ2 A;  1GL2 D;  1NAF A;  1SVF A;  3SWK A;  3W68 A;  2IBZ G;  1YIT P;  4HKZ H;  3F89 A;  1Y8A A;  3V2P A;  1EZV I;  3CCM P;  2P1J A;  2N9B A;  5AW8 B;  3PHL A;  2G3A A;  4W7Z A;  2HG5 D;  2WSC H;  1ZP0 C;  3L71 D;  1MV8 A;  1WRG A;  1SQQ E;  1L0N E;  3RL0 C;  1A02 F;  1SQB G;  1IZN B;  1LWU A;  1JNM A;  1K8A Q;  3CD6 P;  1NTZ J;  1DH3 A;  2N1T C;  3A0H E;  3MUD C;  2V4H A;  2YXR B;  1NKZ B;  2IBZ E;  3MGN A;  1BE3 G;  4HYT B;  2NPS D;  5B5E E;  1KQF B;  3B4S A;  3KQG A;  4JYB A;  2QJK C;  5APX A;  2KSE A;  1KIL E;  4IOI H;  1YJ9 P;  3H1K J;  2BCC J;  1QX8 A;  3W67 A;  2Z5I A;  2WSF J;  1SQB E;  3P32 A;  2WVR A;  3CPW O;  2R44 A;  4ASW A;  1GW4 A;  2FBW C;  1KQL A;  3VYI A;  2JWD A;  2YKQ A;  1BE3 E;  2OYH A;  2FY8 A;  3G71 P;  1USD A;  2KB7 P;  2O3J A;  3B8E B;  5APT A;  5M1B A;  1S3J A;  3E1I A;  4H44 C;  4HJG H;  4D6T E;  4I1L A;  3FX0 A;  1EDK A;  4B86 A;  5KJ7 C;  1S1C X;  2WPR A;  1KIL C;  1NHL A;  5CHX A;  1L0L D;  4L74 A;  1RF0 A;  2WPS A;  3CCU P;  1S9K D;  1CW5 A;  1SQQ K;  1L0N K;  2O01 N;  4Y28 J;  4IL6 X;  4LC1 A;  2OTK E;  4WB4 A;  1BCC J;  2HOD B;  2Q7C A;  1FZB A;  3L70 J;  1VF5 D;  3L72 J;  1S72 P;  1FJK A;  2WSF H;  2B87 B;  3CI9 A;  2W6B A;  2KLV A;  1NU1 G;  3TNU B;  4HH2 A;  3CCQ P;  3PTZ A;  3HTK A;  1HH0 A;  2HPC B;  2J58 A;  2YKO A;  4JPZ B;  1FU1 A;  3A0B H;  5AW1 B;  2E74 D;  2ZYD A;  3HUS B;  2FFD C;  1FDI A;  4GKG A;  3U1A A;  1SQB K;  1NTZ D;  3H1J J;  1VQL P;  2ZYG A;  2M5A B;  2B9B A;  1NGM B;  3P8C E;  3RK2 B;  4YTP C;  1M7L A;  1FBM A;  4IFM A;  5AVZ B;  4H0L C;  1YTZ T;  1AQT A;  1PP9 J;  3B5N A;  1L2P A;  2ZFC A;  3AED C;  3H1K D;  1ZR2 A;  1GK4 A;  5KLV G;  3D70 A;  2BCC D;  1URQ B;  2HR3 A;  2IFN A;  2J5U A;  1JY2 P;  3CC2 P;  3O6Q B;  1L4A B;  5K5G B;  1EDI A;  2OGU A;  1USE A;  1HGZ A;  1M1J A;  1ZR4 A;  4PV1 B;  1QVF O;  4RJT A;  3RL0 D;  3N7N A;  2QE7 H;  4NPE A;  2KZJ A;  3SWF A;  1KC8 Q;  1TU3 F;  2N1T D;  3PJS K;  1M90 Q;  4I7Z B;  1FDM A;  1HVV A;  1GMJ A;  3EFF K;  3Q3D A;  1OW6 A;  1LTG C;  1W5C E;  1EDL A;  1H0T B;  3A7O A;  1RHZ B;  3KHU A;  4EI2 A;  1N73 C;  1RF1 A;  1WMK A;  3L35 A;  1HUC A;  4U3F J;  5KAI H;  1BCC D;  3GG2 A;  1U7M A;  2KI7 B;  1IK7 A;  1SQP G;  3L70 D;  1OVR A;  2FYN B;  3L72 D;  5DJU B;  4OWF A;  5AW0 B;  1T6A A;  2Y0D A;  4K3A A;  3TDK A;  1HJ0 A;  1DD4 A;  4H44 D;  3HD7 C;  3CXH D;  3WU2 E;  2QSI A;  3H1J D;  4EIJ A;  1Z56 A;  5KJ7 D;  1SQP E;  2QEX P;  2W8Z A;  2QA4 P;  1SFC A;  3BAT A;  2ZXE B;  3L74 G;  1LTJ A;  5E79 H;  1IFN A;  3V2N A;  1FJP A;  1PP9 D;  1N7S C;  2WIT A;  4LLH A;  1GTW A;  1FOS F;  3SSU A;  2D2C B;  2YNY A;  1GL2 C;  3H1I G;  4AYC A;  2E43 A;  1YJW P;  5GTH E;  2JP3 A;  3LID A;  1ZRT D;  4NPF X;  2G8Y A;  3LIE A;  5TIS E;  1LWU B;  2IPP A;  1L0L G;  3L74 E;  4GT1 A;  5APQ A;  3IAO A;  1EZV D;  2K9J A;  1Q86 Q;  1NTK G;  1J1D B;  1CSB A;  1J1E B;  2L91 A;  1S5L E;  3H1I E;  5APS A;  2JDI H;  3CME P;  2NPS C;  1OVV A;  1VQN P;  1U57 A;  3VN0 A;  4H0L D;  5AVS B;  3U1C A;  2BAS A;  1JOC A;  2K1A A;  1YHQ P;  1FZG A;  2KZI A;  1L0L E;  4ZMD A;  2FYU J;  3V6I A;  2WT7 A;  3VMX A;  4U3F D;  1NTK E;  1S9K E;  1N8R Q;  4PD4 I;  4R4L A;  3C1L A;  3KPE A;  2W83 C;  3T97 A;  1JCD A;  1NTZ G;  1LP1 B;  2Q5U A;  2KP8 A;  1QEX A;  1KB9 I;  5AW5 B;  1FAV A;  3NXS A;  4DCK A;  1NYH A;  3FWL A;  1GD2 E;  3QWO C;  5KKZ B;  3M0A A;  1JO5 A;  2A06 D;  3Q2Y A;  2JO1 A;  3MZW B;  2KSJ A;  2M0B A;  1LNQ A;  1NTZ E;  5KLI B;  1OWA A;  1FOS E;  2AEJ A;  2NRG A;  1E79 H;  5CCH A;  3VTP C;  1AVO A;  4DT0 A;  1UII A;  2FYN C;  3AEG C;  2XNX A;  1PFI A;  2WSC J;  2C0W A;  3CWB G;  4Y99 C;  1KOR A;  3CCJ P;  4PJ0 H;  1NJI Q;  1SQV J;  1Q7Y Q;  1L0L K;  1OFC X;  2E74 C;  1K9M Q;  2POH A;  2IBZ I;  1MZ9 A;  2M3E A;  1NTK K;  3AEB C;  1PV3 A;  2AXT H;  3N4X A;  3D6Z A;  3A5T A;  3B5N B;  2OYI B;  3L70 G;  3A2A A;  1JB0 J;  4JQ0 D;  1SQQ G;  1UIX A;  1VQM P;  3CWB E;  1L0N G;  3O8Z A;  1KN7 A;  2KK7 A;  1FZC A;  4IL6 E;  2D2C C;  3USS A;  4MN4 C;  1MKM A;  2FYU D;  3AEC C;  1RE4 C;  4ZNC A;  1SQX J;  3RBX A;  3MP7 B;  4JYC A;  1NVO A;  1QGK B;  1PZQ A;  1AA0 A;  1M1J B;  1HGV A;  2GA1 A;  4C7N B;  2N9Y B;  3GHG C;  1LWU C;  3H1J G;  3H32 B;  4OGQ B;  1VQ4 P;  1NTZ K;  3L70 E;  3L72 E;  3D6Y A;  3AEA C;  4I6M C;  3I5C A;  1M56 D;  3GW6 A;  2JEE A;  1G2C A;  5H2F E;  1PP9 G;  3SFD C;  1YYC A;  3RK2 D;  1SLQ A;  1WT6 A;  4XFJ A;  4AUW A;  4DZO A;  1DIP A;  3CXH E;  2YIU B;  3RGU A;  4EOT A;  1P84 I;  3G4S P;  3H1J E;  4UB6 H;  2IX7 C;  4D6T G;  2IDB A;  5B66 H;  1W2E A;  3RK3 B;  1OMI A;  3L75 J;  2C0X A;  1PP9 E;  2CK3 H;  2N1T A;  3MUD A;  5KAI E;  2Y9Y A;  3AE4 C;  4CPG A;  2WZ7 A;  4PV1 D;  1IFJ A;  1X9V A;  3M9Q A;  4C46 A;  2W6J H;  2GM4 A;  3AE6 C;  2KUB A;  1NTM J;  3EWK A;  1SQV D;  3GMA A;  3AE7 C;  4BRY B;  2OQQ A;  2QRX A;  2QJY B;  1NOH A;  3H1H J;  2FYZ A;  3C9I A;  3VMZ A;  1EZV E;  2OAR A;  3HE5 A;  5KLI C;  2V7Q J;  2FXO A;  5DJT B;  4JBZ A;  5APW A;  2I1K A;  3G6E P;  1YI2 P;  3CC4 P;  5CCG C;  1EXJ A;  4LGD E;  3L36 A;  3FWN A;  1FZA A;  1SQX D;  2A45 G;  1KTM A;  2DW3 A;  3CCR P;  3OA7 A;  1HBW A;  5KJ7 A;  1KIL A;  1KFN A;  2A06 G;  4U3F E;  1VQ5 P;  1FE6 A;  1JCC A;  4UB8 E;  3Q5R A;  1AFO A;  4EYY Q;  1BGY J;  4PD4 H;  2W6A A;  4IFF A;  4KJM A;  3H1L J;  2H8P D;  2BEZ F;  1CI6 B;  1KB9 H;  1RE3 C;  2E5T A;  2OYI C;  1YQ4 C;  2YMK A;  1KV4 A;  3HRN A;  2JJL A;  4N78 E;  2A06 E;  3KYQ A;  3HE4 B;  5GTI H;  3CCS P;  2V7Q H;  5AVT B;  2D2C D;  1JEK A;  2Q6Q A;  3TYY A;  2H88 C;  1JY2 N;  3TF5 A;  4N3Y B;  1KYO H;  3T97 B;  2FFD A;  2P7J A;  3P8M C;  3L75 D;  1OXZ A;  1SQB J;  3RL0 g;  2OTJ P;  3WUT A;  4WY4 B;  3GF7 A;  1H89 A;  4K35 A;  3V5B A;  2KNC A;  1JY3 P;  1ZW0 A;  3TK1 A;  3BRV B;  2R32 A;  4PD4 D;  1NTM D;  3BCC J;  3M0D C;  2YMY A;  1PPJ D;  1K73 Q;  1NO4 A;  3AEE C;  2L5G B;  2Q3E A;  2E5Y A;  1YBK A;  1KB9 D;  1Q81 Q;  2FYU G;  3H1H D;  4QMA A;  3VMY A;  2RH0 A;  2YIU C;  3CX5 E;  3A0H H;  1R8E A;  3PH0 A;  3VP8 A;  2YXQ B;  1LT9 A;  2ZT9 B;  1KZU B;  1KYO D;  3RK3 C;  3L71 G;  1FZF A;  5AVY B;  1GU5 A;  2FYU E;  2AXC A;  3C8V A;  3K5B A;  1LTB C;  1KFM A;  4A7P A;  1DX7 A;  1G1J A;  1BSN A;  1IFI A;  1VL2 A;  1N73 A;  2O1J A;  3L73 J;  1BGY D;  2QJY C;  1K04 A;  3M06 A;  1VF5 B;  3L71 E;  3H1L D;  1PL5 A;  1H88 A;  4ASV A;  1K05 A;  5KTB A;  4L75 A;  4IFD K;  2KS1 A;  5AVX B;  5KAF E;  1VQO P;  1M1K Q;  2AXT E;  2XND H;  2IBZ D;  2I1J A;  2WPV B;  3KZI H;  5CCG D;  1PIX A;  1SS1 A;  4L76 A;  2RN0 A;  1NU1 J;  1J2J B;  1H8A A;  3JSV C;  2IYO A;  2XZR A;  1YJN P;  1YTZ I;  3I56 P;  1HWT C;  1SQV G;  1D7M A;  2YO3 A;  3HD7 A;  4RES B;  2H7H A;  1P84 H; 
#chains in the Genus database with same CATH homology
 2YKP A;  3P32 A;  1JTH A;  1GW4 A;  3II6 A;  2C0W A;  1G2C B;  3OJA B;  4Y99 C;  1KQL A;  3HUS C;  3VYI A;  2O1K A;  2YKQ A;  1N7S A;  3M9H A;  1LTT C;  2OYH A;  2HOD A;  1L0L K;  2KB7 P;  4W7Y A;  2POH A;  4C7N A;  1LT9 C;  3B8E B;  1MZ9 A;  1GL2 A;  5APT A;  1RF1 C;  1T2K C;  3E1I A;  1NTK K;  2HFE D;  4DOJ A;  4I1L A;  3RK2 C;  1T8Z A;  3N4X A;  3H32 A;  3A5T A;  2FYU K;  2WWW A;  3TNU A;  1NH4 A;  3UIA A;  1NKN A;  2KOG A;  2M3B A;  3B5N B;  2OYI B;  3A2A A;  4B86 A;  5KJ7 C;  2WPR A;  3R2P A;  1KIL C;  1NHL A;  3NTN A;  5CHX A;  4M3L A;  3M0D A;  1GZL A;  5AW9 B;  1RF0 A;  2WPS A;  3O8Z A;  2N1T B;  1URQ C;  3M9B A;  1FZC A;  1S9K D;  5AVR B;  1CW5 A;  1SQQ K;  1L0N K;  1RE4 C;  2QM7 A;  4WY4 C;  2OYH B;  1L4A C;  4LC1 A;  4JYC A;  4WB4 A;  2HOD B;  1M1J B;  2Q7C A;  2J59 M;  1FZB A;  1HGV A;  5AW3 B;  4C7N B;  1IJD B;  1NWQ A;  3L37 A;  1SP4 A;  1FJK A;  2NPS A;  2WSF H;  4WBA A;  2FXM A;  3GHG C;  3CI9 A;  3OAK A;  2W6B A;  1LWU C;  1A02 J;  4XE5 B;  2KLV A;  3H32 B;  1NTZ K;  1SFC C;  3TNU B;  4HH2 A;  1MFZ A;  3HTK A;  1HH0 A;  4I6M C;  2HPC B;  3I5C A;  1IK9 A;  2J58 A;  1HTL C;  2YKO A;  3U59 A;  1FU1 A;  1LTJ C;  2JEE A;  4KHX A;  1G2C A;  1NU1 K;  4Y99 B;  5AW1 B;  3HUS B;  5BVZ A;  3IFM A;  2FFD C;  1X8Y A;  4GKG A;  1FZC B;  1YYC A;  3RK2 D;  3U1A A;  1SLQ A;  1SQB K;  1WT6 A;  5CJ0 A;  4AUW A;  4DZO A;  5BU8 B;  3P8C D;  2WPQ A;  3P8C E;  3RK2 B;  4EOT A;  3RK3 D;  1JMM A;  1KIL D;  1M7L A;  4I2L C;  1FBM A;  4IFM A;  5AVZ B;  3LW5 H;  1YTZ T;  2IX7 C;  1ZLL A;  1QL2 A;  3B5N A;  4AQR D;  1W2E A;  3V4Q A;  3RK3 B;  2WTY A;  1KIL B;  2C0X A;  2Z5H A;  2ZFC A;  1SQV K;  1ZR2 A;  1ZV8 A;  3HTK B;  2H43 A;  1FZE A;  1IC2 A;  1GK4 A;  4C7R A;  1LTI C;  1URQ B;  3M91 A;  2N1T A;  2HLO A;  3MUD A;  2IFN A;  1JY2 P;  2WZ7 A;  3MTU E;  1IFJ A;  1X9V A;  3M9Q A;  4C46 A;  5KLV K;  1IFD A;  1L4A B;  2GM4 A;  5AVQ B;  1HGZ A;  1M1J A;  1ZR4 A;  4ZKP A;  1XTC C;  3RL0 D;  4N6J A;  3B5N D;  3GHG B;  3N7N A;  1HJB A;  1T3U A;  1DEB A;  1VPC A;  1NOH A;  1LGH B;  3SWF A;  3CL3 D;  2N1T D;  3MD0 A;  3RL0 B;  3H6P A;  3A3Y B;  2HPC A;  2FYZ A;  3C9I A;  3VMZ A;  3MIW A;  1FDM A;  1HVV A;  2A45 H;  4ZKU A;  2P2U A;  2OAR A;  3HE5 A;  3P7K A;  3EQ2 A;  4OH8 B;  1SQX K;  1LTG C;  5CJ4 A;  3HUS A;  2FFD B;  5APW A;  1T3J A;  2I1K A;  4JF7 A;  2R5D A;  5AVU B;  5CCG C;  5APV A;  3A7O A;  4LGD E;  3L36 A;  2LKM A;  3WMM 0;  3PP5 A;  2C9L Y;  3VP9 A;  1CI6 A;  2R3C A;  1N73 C;  1RF1 A;  2MJZ A;  5AVV B;  3L35 A;  2KYV A;  1FZA A;  1HUC A;  2A45 G;  5CMZ A;  2E42 A;  2IFM A;  2Q9I A;  2Z4E A;  2WSE H;  3HE4 A;  3OA7 A;  1EQ7 A;  1GDT A;  1HBW A;  5KJ7 A;  1AQ5 A;  5BU5 A;  2VRS A;  1KIL A;  1N2D C;  1KFN A;  5AW0 B;  1JY2 O;  1MUU A;  1XTG B;  1SQP K;  1JCC A;  1URQ A;  1JUN A;  1J1D C;  3HE5 B;  1IFM A;  2R5B A;  3BVH A;  1AFO A;  1JY3 O;  2W6A A;  1J1E C;  4IFF A;  4O9B A;  1RE4 A;  4WY4 A;  3CLQ A;  2XDJ A;  1T2K D;  1L4A A;  2W27 A;  2H8P D;  1N86 A;  2CPB A;  5CCH C;  3HD7 C;  1LT9 B;  1CI6 B;  2YO2 A;  1RE3 C;  1RF1 B;  2OYI C;  3GHG A;  4EIJ A;  1Z56 A;  5KJ7 D;  3HRN A;  4N78 D;  3L4F A;  2QM8 A;  1SFC A;  2CPS A;  2XKM A;  2JJL A;  5AVW B;  5AW2 B;  2FKW B;  3BAT A;  4N78 E;  3KYQ A;  1URQ D;  3HE4 B;  5AW7 B;  2ZXE B;  2P67 A;  3IR9 A;  2O01 H;  5AVT B;  3TSI A;  1LTJ A;  3TYY A;  1JY2 N;  1IFN A;  3V2N A;  1FJP A;  1QL1 A;  1N7S C;  1VDF A;  2WIT A;  4LLH A;  4N3Y B;  4WY4 D;  1GTW A;  2OYH C;  1FOS F;  1L4A D;  4GIF A;  2FFD A;  2P7J A;  1NTM K;  2PP6 A;  3P8M C;  1OXZ A;  2YNY A;  1X79 B;  4W80 A;  1GW3 A;  1GL2 C;  4AYC A;  3NFQ A;  4WY4 B;  1H89 A;  2E43 A;  1N73 B;  3LID A;  3V5B A;  1JY3 P;  1SFC D;  3TK1 A;  3BRV B;  2R32 A;  2XV5 A;  1GK6 A;  1LTA C;  3LIE A;  1LWU B;  2IPP A;  2A45 I;  3M0D C;  2YMY A;  3V4W A;  1SFC B;  1RF0 C;  1G1I A;  1NO4 A;  1ZN5 A;  4GT1 A;  1GU4 A;  1CZQ A;  2L5G B;  5APQ A;  1FZC C;  2M8R A;  1J1D B;  1LTJ B;  4XA4 A;  5CCH D;  5AW4 B;  1CSB A;  3HD7 D;  1J1E B;  3VMY A;  1LTS C;  5APS A;  2GUV A;  3HD7 B;  2NPS C;  3VP8 A;  3V2Q A;  3VN0 A;  1LT9 A;  1KZU B;  3V2R A;  2GUS A;  5AVS B;  3RK3 C;  2BAS A;  3U1C A;  1JOC A;  3EFG A;  1FZG A;  3NMD A;  1JTH B;  1FZF A;  5AVY B;  3BRT B;  1N7S D;  3KDP B;  2WT7 A;  3VMX A;  1S9K E;  1GL2 D;  2Q3I A;  1NAF A;  1GU5 A;  3KPE A;  1N7S B;  1SVF A;  3T97 A;  1JCD A;  3V2P A;  5CCG A;  2Q5U A;  1GL2 B;  2KP8 A;  5APU A;  2P1J A;  1LTB C;  2N9B A;  5AW8 B;  1KFM A;  1RY3 A;  1DX7 A;  1G1J A;  4W7Z A;  5AW5 B;  1IFI A;  2HG5 D;  1FAV A;  3NXS A;  1N73 A;  2C9N Y;  2O1J A;  2WSC H;  1E5W A;  1MV8 A;  1WRG A;  3M06 A;  1GD2 E;  3RL0 C;  3M0A A;  5AW6 B;  3B5N C;  1A02 F;  1H88 A;  1N7L A;  5KTB A;  3VOP A;  4IFD K;  1LWU A;  1JNM A;  1JO5 A;  5AVX B;  5APY A;  1DH3 A;  2N1T C;  2WT7 B;  2I1J A;  2PAJ A;  1NKZ B;  5CCG D;  2KSJ A;  3MGN A;  4HYT B;  2NPS D;  1J2J B;  1OWA A;  3G3Z A;  1FOS E;  3KQG A;  1IO4 A;  1H8A A;  2XZR A;  1M1J C;  4JYB A;  3BAS A;  5APX A;  1JY3 N;  1YTZ I;  1HWT C;  5CCH A;  3VTP C;  2NPS B;  2XU6 A;  2YO3 A;  3HD7 A;  2HYN A;  3SWY A;  1RE3 A;  2OYI A;  4RES B;  2XNX A;  2H7H A;  2Z5I A;  1PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...