1FBMA

Assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title All-trans retinol, vitamin D and other hydrophobic compounds bind in the axial pore of the five-stranded coiled-coil domain of cartilage oligomeric matrix protein.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
molecule keywords PROTEIN (CARTILAGE OLIGOMERIC MATRIX PROTEIN)
total genus 17
structure length 46
sequence length 46
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2000-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11598 COMP Cartilage oligomeric matrix protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fbmA00
3V2PA 1DEBA 1MZ9A 1VDFA 3V2NA 3V2QA 1FBMA 3V2RA
chains in the Genus database with same CATH superfamily
1L0NK 2WSCH 1NTKD 5EFWB 5H2FE 4ASWA 4IOIH 1U7MA 3H1ID 5AVSB 1QL2A 1RE4C 2RMZA 2Z5IA 3VMXA 1LGHB 4RESB 1BE3G 5KJ7C 1YQ4C 1RF1C 3AEBC 1L4AA 4ZMDA 1L4AB 2Q3EA 2PGDA 4RJTA 1CW5A 1P84D 3LIEA 3SWYA 3HE5B 1ZW0A 3PTZA 2E75D 1KILC 1JY3N 2FYNB 2ZXXA 2JDIH 4WBAA 2AEJA 1M1KQ 1NTMD 4W80A 5AW6B 3RK3E 2WTYA 2D2CD 3CWBG 1HVVA 2N1TA 3L72D 1FDIA 2FFDB 1KILA 4PV1B 1JTHA 3WUUA 1FZCC 1GW4A 3TDKA 1KB9I 4I6MC 2BEZF 5AVRB 4BRYB 1H0TA 4BRYA 3CCJP 5CCGA 5AW3B 5AW4B 3L73J 5KJ7A 1M1JA 1SQPE 1JY2P 1RF1A 1PIXA 2WSEH 3CCEP 1FZCA 3IAOA 1GW3A 3H25A 5AW9B 3B71A 2FXMA 1FOSE 2NPSC 2E76B 3L73G 5APXA 4HJGH 3SFDC 2H88C 1N2DC 1NYHA 2HPCB 4IL6E 5KKZB 1CZQA 3CWBJ 1SQBJ 2I1KA 3H1JD 2DW3A 3LW5H 3QWOC 3CPWO 1HJBA 1NTZK 1D7MA 1RE3A 1PZQA 3JCUH 1JMMA 4QMAA 4H13B 3RK2B 1YJWP 1T8ZA 5APVA 2PAJA 1PP9D 2NPSD 1SQXD 2WITA 2OYIC 1PV3A 2WWWA 3L72E 1PPJD 1ZP0C 1EXIA 4YXDC 1N7SD 3L75J 2QM8A 2B9BA 5B66E 3L70J 2P2UA 1NH4A 2KYVA 1YJNP 2IYPA 1ZRTE 1EDIA 3II6A 4JYCA 4LLHA 5TJHA 3LIDA 1ZMEC 1SQBG 1Q81Q 3Q1MA 1IFNA 1SQVG 4IL6H 1VL2A 3AE6C 3CL3D 3TF5A 3MP7B 1M90Q 1KMIZ 2ZJSE 1KB9D 2Y0EA 3AE1C 3IFMA 1IO4A 4W7ZA 3U1CA 5B5EE 1NTMK 3CCQP 3EWKA 3L71J 1LP1B 1N73A 4K35A 2CPSA 1X79B 2KZIA 2W27A 3USSA 3VMYA 3MZWB 5CCHD 4RO0A 1S5LX 3TYYA 3L73D 3G71P 2HODA 2FBWC 2ZVOB 1ZR2A 5DJTB 2HODB 1BCCE 1NAYA 5B66H 1FS0E 4HYTB 3B4SA 4Y28J 1M1JC 2UWJE 2W6AA 3TNUB 3V5BA 2C9NY 3FGAD 2BCCJ 2KS1B 1S1CX 2PP6A 3C9IA 4UB8E 3SSUA 2KB7P 4GT1A 1FBMA 3KHUA 4NPFX 1AA0A 1XTGB 4R4LA 2YO3A 1KQFB 5AVVB 2W90A 3A5TA 3RK2D 3CCUP 3M9QA 4KJMA 4WY4C 2HLOA 2IDBA 4H44D 4Y99B 4H0LD 5AW1B 5B5EH 2KLUA 2ZT9B 3V4WA 5GTIE 3TGUE 3Q3DA 2FFDC 3ZDMA 3KPEA 1N7SB 1NU1G 2Y0CA 1FC2C 1NU1E 2GUVA 4DOJA 2CPBA 1DD3A 3HD7C 1K05A 1BGYJ 3HD7B 3KXDA 1MFZA 1S72P 3WMM0 2WPQA 3GF3A 3PH0A 1LNQA 3W67A 3I56P 4N3YB 3D71A 1RQUA 1JEKA 1Q90D 2A06D 2KUBA 2NPSA 1VQOP 1Q86Q 1KQSO 1SFCC 2P1JA 5APYA 3RGUA 2FYUE 2AEFA 2Y9ZA 3V2PA 4C7NB 4L73A 5BVZA 2HPCA 2QJKC 4ZKUA 5GTIH 1IFJA 1SQVJ 2C9LY 1HUCA 3A2AA 5CCGC 2CK3H 1JY3P 1ZV8A 4JF7A 1S2EA 1KFMA 3EFFK 3OA7A 1BE3D 3T97A 3Q5RA 2N9BA 2HFED 5DJUB 2WSEJ 3AE8C 3CXHH 3V2QA 4LC1A 4U3FD 1E79H 3L72J 2B87B 2WSSH 2QEXP 3BATA 2WSFJ 3AE5C 4N78D 1HBWA 3ABVC 2YNYA 1MKMA 4I7ZC 4CPGA 2GM4A 3AE3C 1SQVE 1GD2E 1FJKA 4C46A 4EI2A 3H1KJ 3N7NA 4D6TE 1DEBA 1ZR4A 1PFIA 2YKOA 3L37A 3WU2H 5E79H 1AVYA 3MUDC 2H7HA 1N7LA 1KFNA 3H1HE 3CCRP 1YITP 1NTZE 3U1AA 5KLIC 1L0LK 2POHA 3PP5A 4PD4E 1BSHA 1BGYE 1ZOYC 2KK7A 3CXHE 1FJPA 1KN7A 2AXCA 1KQGB 1NKNA 2KI7B 3L73E 3FXDA 2WT7A 1GU4A 2C0XA 4W7YA 1NU1J 2M3BA 3KDPB 1EC5A 1FE6A 2JEEA 1PPJE 3GHGA 3K5BA 3QH9A 4D6TD 2M5AA 1YIJP 3L74G 1T2KD 1X9VA 3MHVA 1WRGA 2NZ2A 2P58A 3P8CD 3L70G 1RE3C 3HRNA 2D2CB 4OWFA 3VTPC 5AVQB 3WUVA 5KLVD 1VQPP 4PV1D 1VF5D 3H1JE 1PGJA 1SQBD 1GL2C 4OH8B 1NO4A 3MD0A 5KKZC 1SQVD 2YXRB 5E79E 5AW5B 1USEA 2AEMA 2IBZG 3Q5SA 1PGOA 1KQLA 3PJSK 4WY4B 3H6PA 4Y99C 4DCKA 2QJPC 3HD7D 1OFCX 1LT1A 1SQBK 3KQGA 4HH2A 3NFQA 3V2NA 1OW7A 1SQVK 3CX5H 3CI9A 1W5CE 2E76D 2PRRA 3HUSB 3M9BA 1KC8Q 1Y9BA 2Y0DA 2YXQB 3IR9A 5KLVE 3AEEC 2KOGA 3CMEP 1EDLA 3L70D 1KV4A 4I7ZB 3VP8A 1W2EA 3B8EB 1RY3A 3L72G 2K9JB 4EDFA 2HG5D 2P10A 3SWKA 1HWTC 1CI6A 1N8RQ 2NPSB 1J1EB 1CI6B 2Q7CA 3O6QA 5AVWB 1SFCB 1G2CA 5AW8B 4NPDA 2Y9YA 3E1RA 1SQQJ 3G9RA 4OVNF 1IFMA 1NTKK 2FXOA 4KT0J 1ZN5A 2HYNA 3S4RA 4DJGA 5AW0B 1IFIA 3CXHI 3IN6A 5K5GB 3B5NC 3CX5E 2O01N 3L74D 4L74A 1RE4A 4PD4I 3L70E 1GK4A 2JKVA 2KP8A 4EYYQ 1W2BO 1URQA 2KLVA 1SVFA 2FKWB 3M91A 1URQB 1YI2P 1L0NJ 3H1KG 1L2PA 2BEQD 1LT9B 1S5LH 1AVOA 2E76C 3EQ2A 3VN0A 2OQQA 1SQPK 1BGYG 3BCCG 1OZHA 5AVYB 1U57A 1NJIQ 3F89A 5APTA 5KTBA 3VMAA 1YHQP 1BDCA 2E74B 5KAIH 2R3SA 1SQQG 1LTGC 3CWBE 4WY4D 1KILB 2KZJA 4OGQB 4BWNA 2O3JA 2PFXA 3IF4A 1H0TB 2GUSA 1TU3F 4IL6X 2ZT9C 1PP9E 2RN0A 2V7QH 3AE7C 4PV1C 5C39A 1KYOH 2KSJA 2ZYDA 1ZXGA 4TLFA 1GZLA 3L74J 1RQVA 5APWA 3RBZA 2XDJA 3V4QA 1H88A 2WZ7A 1LWUC 4GOFA 4C7RA 2W8ZA 3BCCJ 1GU5A 1JMBA 1S5LE 1VQNP 3FWNA 3M06A 1Q82Q 3GHGB 5AVUB 1PGPA 1OX3A 1H8AA 2M5AB 2OYHB 4U3FE 4U7JA 3Q5PA 2K37A 2LKMA 3G6EP 2QIWA 1SFCD 2FXPA 2QE7H 3RBXA 3G4SP 3H32B 1EDJA 2I8DA 2LR2A 2JWAA 3H1JJ 3CD6P 2E74C 1KTMA 3WU2E 1N73C 1LTSC 2Q6QA 1L4AD 3GF7A 1VQ5P 1R8EA 2QJPB 3O8ZA 3TGUD 2N1TB 3CC4P 1G1JA 2W6JH 3CLQA 1FAVA 1JTHB 4PD4H 4PJ0E 1QVGO 1A02J 2YIUB 1VQ9P 3BCCE 1URQD 2YMKA 1Q2NA 1MUUA 4JQ0D 4R4MA 1LJ2A 2KNCA 1M1JB 3A0HH 1RF1B 4AYCA 2D2CC 3CX5D 3L74E 1SQXG 1NTZJ 2K3RA 1NOHA 1CSBA 3H1HJ 3HE4A 3L71D 1SP4A 2XV5A 4JBZA 1GK6A 2L5GB 3HE4B 2QA4P 2E5TA 2WPSA 5M1BA 3AEGC 1L0NG 1BCCD 3S9OA 2Q9IA 2JO1A 3L36A 2ZYAA 2BCCG 2J59M 1A02F 3RL0D 3H1KE 3NXSA 1J1EC 4D6TJ 2OYIA 3FXEA 1IFDA 3O6QB 1NTKE 1BCCG 1XTCC 2P7JA 2IPPA 3A3YB 2O1KA 2OYIB 3HUSC 4JYBA 3KZIH 1G1IA 5L8RJ 2ZFCA 4D6TG 3L75D 1S9KE 4XA4A 5CJ4A 2JWDA 5CCHC 3H1LE 1NTZG 2FY8A 3UIAA 2XU6A 2KS1A 3A0HE 2RH0A 3GHGC 1SQQD 2MKVA 4N78E 5BU8B 1OWAA 1X0TA 3ITKA 2R44A 3M0AA 3PLNA 2IBZD 3RL0g 1OVVA 4BXLA 1DX7A 1MFTA 1KB9E 2FYUJ 4JPZB 4YXWH 2OTLP 1JO5A 4GOEA 1K04A 2OTJP 5KLVG 3D70A 4UB6H 1SS1A 3MIWA 3RK2C 1N86A 2E75C 1YTZT 2A45G 1HJ0A 1Y47A 2WPVB 2E5YA 4GIFA 3H1JG 2YIUC 5BU5A 1N7SC 3PRJA 2V4HA 3GMAA 1JCCA 3H1IE 3M0DC 1JY2O 3A7OA 5AVXB 2OTKE 5KJ7D 5KLIB 1LT9C 5KLVJ 2JJLA 3B5ND 1S4XA 2IBZE 3VOPA 1NTKG 2SPZA 1NTMG 4GODA 1KYOD 2XNDH 2XZRA 4AQRD 3D6ZA 1X8YA 3M0DA 1FOSF 1OMIA 2WPRA 3TGUJ 2FYUG 4C7NA 1K9MQ 3RL0B 1T6AA 3RL0C 1OW6A 3S1KA 1EZVD 1UIXA 3BRTB 3EFGA 3SFEC 5KAIE 1GTWA 2OYHA 1VQ6P 1NTMJ 1EQ7A 1UIIA 1SQXE 2WVRA 3HE5A 4UB6E 2M0BA 2QJKB 1SQPG 1IFPA 1FZEA 2BCCE 1NVOA 1VF5B 1LWUA 2H89C 3AECC 2R32A 3JC22 1RF0C 3KYQA 1KYOE 2B87A 3H1KD 4M3LA 2FFDA 2OARA 1BCCJ 3I5CA 1JM0A 4I1LA 2N9YB 3OJAB 4H44B 1OXZA 1JNMA 1M8OB 2Q1KA 1LTBC 5CCHA 3HD7A 3L71E 3A0BH 5AW7B 1EZVG 3MGNA 1KORA 1WMKA 2E74D 1FZCB 1NAFA 1JCDA 2IYOA 3H1LD 4I2LC 1HF9A 1QEXA 1KILD 1VQ4P 5KAFH 2G8YA 1YQ3C 1EDKA 2IZ0A 3JSVC 1GMJA 1MV8A 1L0LD 1LTJB 3VP9A 2QM7A 2C0WA 4N6JA 1LTJA 2WQYC 3AE9C 3U59A 4EIJA 1NTZD 4O9BA 1OW8A 4ZKPA 2VRSA 1QL1A 5TISH 1M56D 1VQ8P 2GA1A 4PJ0H 1OVUA 1U7JA 1LTIC 1JB0J 1WT6A 1PP9G 2IZ1A 3B5NB 3V6IA 3CCSP 3B5NA 3FX0A 2I1JA 1BE3E 3TNUA 3CMAP 2IBZI 1GDTA 2MJZA 1HGVA 1VQMP 1AQ5A 1OIPA 2HR3A 1M57D 3NMDA 2ZYGA 4DZOA 1FZGA 4IFFA 3BRVB 4DT0A 1R5SA 1SQXJ 1L0LE 3AEFC 1BSNA 1LTAC 1NU1K 3Q2YA 1OVRA 4RKUJ 4WY4A 1IK9A 1SQBE 5KAFE 3RK3D 5CHXA 2ZXEB 4GDOA 1AQTA 1KILE 3SWFA 2ITAA 1NHLA 1VQLP 1S3JA 1QX8A 2QJYC 3BVHA 1JOCA 2QVAA 3HUSA 3I55P 1VQ7P 1ZRTD 3KZIE 1BDDA 2WSFH 1K8AQ 1FZBA 1E5WA 2AXTE 3H1IJ 3R4YA 1SQPJ 1USDA 5GTHH 1RF0A 2R5BA 3TGUG 2FYZA 1J1DB 4PD4D 1EZVI 2WSCJ 5CCGD 2R3CA 2K88A 3P32A 1YYCA 3CCMP 1L0LG 4H13D 1GL2B 1G2CB 3AE4C 1J2JB 1DIPA 1IK7A 4KHXA 2P67A 2OYHC 2KXPB 1QVFO 1KB9H 2IX7C 3G3ZA 3MUDA 1HH0A 1LTJC 1L0LJ 3V2RA 5CBNA 3T97B 3VYIA 1JY3O 1NGMB 2ZAEB 3H1IG 5APQA 4ZNCA 2B88A 2JP3A 1VDFA 3H1HD 2M3EA 3H1LJ 1BE3J 2AXTH 1LWUB 1FU1A 2A06G 2H8PD 2N1TC 3AEDC 3CXHD 3PHLA 1N7SA 4HB1A 2QRXA 4OGQC 1P84E 5KLVK 1SQPD 2J58A 4TT3H 1AV1A 1URQC 2L91A 4L75A 4H0LC 1PGQA 2K1AA 3M9HA 4H44C 2H43A 1NTKJ 1YBKA 3RK3C 2KIKA 2XKMA 1L4AC 5AW2B 1GL2D 2FYUD 4XE5B 4YTPC 1Q7YQ 4Z1MH 2LXCB 2A45H 3CWBD 4WVZA 1NU1D 2W6BA 1BGYD 1NKZB 1JY2N 3N4XA 2A45I 2FYUK 1MZ9A 1IJDB 3NTNA 1KZUB 2QG4A 2O01J 2WT7B 3GW6A 5APSA 2KSEA 1T2KC 4XFJA 4IFDK 3C8VA 1QLED 1P84H 3L75E 3AEAC 1S9KD 2YKQA 1FZAA 1HTLC 2V7QJ 1X22A 1Y8AA 1YJ9P 3CCLP 3A0BE 1JUNA 1LT9A 4GKGA 2OGUA 2FYNC 2NRGA 2ZT9D 4H0LB 1AFOA 1NWQA 3CC7P 2Q5UA 3H1HG 4A7PA 1NTME 1AJYA 3GLMA 3GG2A 3TSIA 3JCUE 4U3FJ 1SLQA 1P84I 1L0ND 2QSIA 2R5DA 2YO2A 3C1LA 3D6YA 1DEEG 4ASVA 3R2PA 2QJYB 2OYOA 2IFNA 1PL5A 2ZVNB 4OGQD 5TISE 2KNCB 2RKLA 3CCVP 1YTZI 4IFMA 3MTUE 1HGZA 5CBOA 3BCCD 3HTKA 3FWLA 2IFMA 3HTKB 4AUWA 4HKZH 1PP9J 1J1DC 2K9JA 2O01H 2A06E 2G3AA 1VPCA 2Z4EA 3F5HA 4B86A 1LTTC 3CX5I 3OAKA 1T3UA 3CC2P 4U3FG 1GL2A 3VMZA 3OW2O 1FZFA 3LW5J 2BASA 1IC2A 1EZVE 1PPJG 1Z56A 5AVZB 2B89A 4H13C 3L71G 4NPEA 2E75B 4WWIA 3H1LG 3H32A 3L35A 4YPCA 4WB4A 2Z5HA 1DD4A 1T3JA 2W83C 2XNXA 3P8MC 4L76A 4LGDE 5APUA 2E43A 1L0NE 2O1JA 2BCCD 2YMYA 1R5LA 2J5UA 3E1IA 1FDMA 5CMZA 5H2FH 1M7LA 5CJ0A 1H89A 3TK1A 3P7KA 1IZNB 1QGKB 1SQQK 2YKPA 5GTHE 1DH3A 2E42A 2K9YA 3E7KA 2Q3IA 5AVTB 1KD1Q 1ZLLA 2N1TD 3P8CE 3L4FA 2WMMA 1SQQE 3AE2C 4UB8H 3L75G 2JR8A 3RK3B 3W68A 1KYOI 1VQKP 4EOTA 3WUTA 1K73Q 3BASA 4K3AA 1FDOA 1RH5B 2M8RA 1SQXK 1LP1A 1N73B 1EXJA 1RHZB 1VF5C 1SFCA 4MN4C 2LXBA
chains in the Genus database with same CATH topology
1L0NK 2WSCH 5AVSB 1QL2A 1RE4C 3VMXA 2Z5IA 1LGHB 4RESB 5KJ7C 1RF1C 1L4AA 1L4AB 1CW5A 3LIEA 3SWYA 3HE5B 1KILC 1JY3N 4WBAA 4W80A 5AW6B 2WTYA 1HVVA 2N1TA 2FFDB 1KILA 1JTHA 1FZCC 1GW4A 4I6MC 5AVRB 5CCGA 5AW3B 5AW4B 5KJ7A 1M1JA 1JY2P 1RF1A 2WSEH 1FZCA 1GW3A 5AW9B 2FXMA 1FOSE 2NPSC 5APXA 1N2DC 2HPCB 1CZQA 2I1KA 3LW5H 1HJBA 1NTZK 1RE3A 3RK2B 1JMMA 1T8ZA 5APVA 2PAJA 2NPSD 2WITA 2OYIC 2WWWA 1N7SD 2QM8A 2P2UA 1NH4A 2KYVA 3II6A 4LLHA 4JYCA 3LIDA 1IFNA 3CL3D 3IFMA 1IO4A 4W7ZA 3U1CA 1NTMK 1N73A 2CPSA 1X79B 3VMYA 2W27A 5CCHD 3TYYA 1ZR2A 2HODA 2HODB 4HYTB 1M1JC 2W6AA 3V5BA 3TNUB 2C9NY 3C9IA 2PP6A 2KB7P 4GT1A 1FBMA 1XTGB 2YO3A 5AVVB 3A5TA 3RK2D 3M9QA 4WY4C 4Y99B 2HLOA 5AW1B 2FFDC 3KPEA 1N7SB 2GUVA 4DOJA 2CPBA 3HD7C 3HD7B 1MFZA 3WMM0 2WPQA 4N3YB 2NPSA 1SFCC 2P1JA 5APYA 3V2PA 4C7NB 5BVZA 2HPCA 4ZKUA 1IFJA 2C9LY 1HUCA 3A2AA 5CCGC 1JY3P 1ZV8A 4JF7A 3OA7A 1KFMA 3T97A 2N9BA 2HFED 3V2QA 4LC1A 3BATA 4N78D 1HBWA 2YNYA 2GM4A 1GD2E 1FJKA 4C46A 3N7NA 1DEBA 1ZR4A 1PFIA 2YKOA 3L37A 2H7HA 1N7LA 1KFNA 3U1AA 1L0LK 2POHA 3PP5A 1FJPA 1NKNA 1GU4A 2WT7A 2C0XA 4W7YA 2M3BA 3KDPB 2JEEA 3GHGA 1T2KD 1X9VA 1WRGA 3P8CD 1RE3C 3HRNA 3VTPC 5AVQB 1GL2C 4OH8B 1NO4A 3MD0A 5AW5B 1KQLA 4WY4B 4Y99C 3H6PA 3HD7D 4HH2A 1SQBK 3KQGA 3NFQA 3V2NA 1SQVK 3CI9A 3HUSB 3M9BA 3IR9A 2KOGA 3VP8A 1W2EA 3B8EB 1RY3A 2HG5D 1CI6A 2NPSB 1J1EB 1CI6B 2Q7CA 5AVWB 5AW8B 1SFCB 1G2CA 1HWTC 1IFMA 1NTKK 1ZN5A 2HYNA 1IFIA 3B5NC 1RE4A 1GK4A 2KP8A 1URQA 2KLVA 1SVFA 2FKWB 3M91A 1URQB 1LT9B 3EQ2A 3VN0A 1SQPK 5AVYB 5APTA 5KTBA 1LTGC 4WY4D 1KILB 2GUSA 2KSJA 5APWA 1GZLA 2XDJA 3V4QA 1H88A 2WZ7A 1LWUC 4C7RA 1GU5A 3M06A 3GHGB 5AVUB 1H8AA 2OYHB 2LKMA 1SFCD 3H32B 1N73C 1LTSC 1L4AD 3O8ZA 2N1TB 1G1JA 3CLQA 1A02J 1FAVA 1JTHB 1URQD 1MUUA 1M1JB 1RF1B 4AYCA 3V4WA 1NOHA 1CSBA 3HE4A 1SP4A 2XV5A 1GK6A 2L5GB 3HE4B 2WPSA 2Q9IA 3L36A 2J59M 1A02F 3RL0D 3NXSA 1J1EC 2OYIA 1IFDA 1XTCC 2P7JA 2OYIB 2IPPA 3A3YB 2O1KA 3HUSC 4JYBA 1G1IA 2ZFCA 1S9KE 4XA4A 5CJ4A 5CCHC 3UIAA 2XU6A 3GHGC 4N78E 5BU8B 1OWAA 3M0AA 1DX7A 1JO5A 3RK2C 3MIWA 1N86A 1YTZT 2A45G 4GIFA 5BU5A 1N7SC 4ZKPA 3M0DC 1JCCA 5AVXB 1FZCB 1JY2O 3A7OA 5KJ7D 1LT9C 2JJLA 3B5ND 3VOPA 4AQRD 2XZRA 1X8YA 3M0DA 1FOSF 2WPRA 4C7NA 3RL0B 3RL0C 1GTWA 3BRTB 2OYHA 3EFGA 1EQ7A 3HE5A 1FZEA 1LWUA 5AW0B 2R32A 4M3LA 1RF0C 3KYQA 2FFDA 2OARA 3I5CA 4I1LA 3OJAB 1JNMA 1OXZA 5CCHA 1LTBC 3HD7A 5AW7B 3MGNA 1NAFA 1JCDA 4I2LC 1KILD 1MV8A 3VP9A 1LTJB 2QM7A 2C0WA 4N6JA 1LTJA 3U59A 4EIJA 4O9BA 2VRSA 1QL1A 1LTIC 3B5NB 1WT6A 3B5NA 3TNUA 2I1JA 1GDTA 2MJZA 1HGVA 1AQ5A 3NMDA 4DZOA 1FZGA 4IFFA 3BRVB 1LTAC 1NU1K 4WY4A 1IK9A 3RK3D 5CHXA 2ZXEB 3SWFA 1NHLA 3BVHA 1JOCA 3HUSA 2WSFH 1FZBA 1E5WA 1FZFA 1RF0A 2R5BA 2FYZA 1J1DB 5CCGD 2R3CA 3P32A 1YYCA 1GL2B 1G2CB 1J2JB 4KHXA 2P67A 2OYHC 3G3ZA 2IX7C 3MUDA 1HH0A 1LTJC 3V2RA 3VYIA 1JY3O 5APQA 1VDFA 1LWUB 1FU1A 2H8PD 2N1TC 1N7SA 5KLVK 2J58A 1URQC 3M9HA 2H43A 3RK3C 2XKMA 1L4AC 5AW2B 1GL2D 4XE5B 2A45H 2W6BA 3N4XA 1NKZB 1JY2N 2A45I 2FYUK 1MZ9A 1IJDB 3NTNA 1KZUB 2WT7B 5APSA 1T2KC 4IFDK 1S9KD 2YKQA 1FZAA 1HTLC 1JUNA 1LT9A 4GKGA 1AFOA 1NWQA 2Q5UA 3TSIA 1SLQA 2YO2A 2R5DA 3R2PA 2IFNA 1YTZI 4IFMA 3MTUE 1HGZA 3HTKA 2IFMA 3HTKB 4AUWA 1J1DC 2O01H 1VPCA 2Z4EA 4B86A 1LTTC 3OAKA 1T3UA 1GL2A 3VMZA 2BASA 1IC2A 1Z56A 5AVZB 3H32A 3L35A 4WB4A 2Z5HA 1T3JA 3P8MC 2XNXA 4LGDE 5APUA 2E43A 2O1JA 1FDMA 2YMYA 3E1IA 5CMZA 1M7LA 5CJ0A 1H89A 3TK1A 3P7KA 2E42A 1SQQK 2YKPA 1DH3A 2Q3IA 5AVTB 1ZLLA 2N1TD 3P8CE 3L4FA 3RK3B 4EOTA 3BASA 2M8RA 1SQXK 1N73B 1SFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2P A;  1DEB A;  1MZ9 A;  1VDF A;  3V2N A;  3V2Q A;  1FBM A;  3V2R A; 
#chains in the Genus database with same CATH topology
 1L0N K;  2WSC H;  1NTK D;  5EFW B;  5H2F E;  4ASW A;  4IOI H;  1U7M A;  3H1I D;  5AVS B;  1QL2 A;  1RE4 C;  2RMZ A;  2Z5I A;  3VMX A;  1LGH B;  4RES B;  1BE3 G;  5KJ7 C;  1YQ4 C;  1RF1 C;  3AEB C;  1L4A A;  4ZMD A;  1L4A B;  2Q3E A;  2PGD A;  4RJT A;  1CW5 A;  1P84 D;  3LIE A;  3SWY A;  3HE5 B;  1ZW0 A;  3PTZ A;  2E75 D;  1KIL C;  1JY3 N;  2FYN B;  2ZXX A;  2JDI H;  4WBA A;  2AEJ A;  1M1K Q;  1NTM D;  4W80 A;  5AW6 B;  3RK3 E;  2WTY A;  2D2C D;  3CWB G;  1HVV A;  2N1T A;  3L72 D;  1FDI A;  2FFD B;  1KIL A;  4PV1 B;  1JTH A;  3WUU A;  1FZC C;  1GW4 A;  3TDK A;  1KB9 I;  4I6M C;  2BEZ F;  5AVR B;  4BRY B;  1H0T A;  4BRY A;  3CCJ P;  5CCG A;  5AW3 B;  5AW4 B;  3L73 J;  5KJ7 A;  1M1J A;  1SQP E;  1JY2 P;  1RF1 A;  1PIX A;  2WSE H;  3CCE P;  1FZC A;  3IAO A;  1GW3 A;  3H25 A;  5AW9 B;  3B71 A;  2FXM A;  1FOS E;  2NPS C;  2E76 B;  3L73 G;  5APX A;  4HJG H;  3SFD C;  2H88 C;  1N2D C;  1NYH A;  2HPC B;  4IL6 E;  5KKZ B;  1CZQ A;  3CWB J;  1SQB J;  2I1K A;  3H1J D;  2DW3 A;  3LW5 H;  3QWO C;  3CPW O;  1HJB A;  1NTZ K;  1D7M A;  1RE3 A;  1PZQ A;  3JCU H;  1JMM A;  4QMA A;  4H13 B;  3RK2 B;  1YJW P;  1T8Z A;  5APV A;  2PAJ A;  1PP9 D;  2NPS D;  1SQX D;  2WIT A;  2OYI C;  1PV3 A;  2WWW A;  3L72 E;  1PPJ D;  1ZP0 C;  1EXI A;  4YXD C;  1N7S D;  3L75 J;  2QM8 A;  2B9B A;  5B66 E;  3L70 J;  2P2U A;  1NH4 A;  2KYV A;  1YJN P;  2IYP A;  1ZRT E;  1EDI A;  3II6 A;  4JYC A;  4LLH A;  5TJH A;  3LID A;  1ZME C;  1SQB G;  1Q81 Q;  3Q1M A;  1IFN A;  1SQV G;  4IL6 H;  1VL2 A;  3AE6 C;  3CL3 D;  3TF5 A;  3MP7 B;  1M90 Q;  1KMI Z;  2ZJS E;  1KB9 D;  2Y0E A;  3AE1 C;  3IFM A;  1IO4 A;  4W7Z A;  3U1C A;  5B5E E;  1NTM K;  3CCQ P;  3EWK A;  3L71 J;  1LP1 B;  1N73 A;  4K35 A;  2CPS A;  1X79 B;  2KZI A;  2W27 A;  3USS A;  3VMY A;  3MZW B;  5CCH D;  4RO0 A;  1S5L X;  3TYY A;  3L73 D;  3G71 P;  2HOD A;  2FBW C;  2ZVO B;  1ZR2 A;  5DJT B;  2HOD B;  1BCC E;  1NAY A;  5B66 H;  1FS0 E;  4HYT B;  3B4S A;  4Y28 J;  1M1J C;  2UWJ E;  2W6A A;  3TNU B;  3V5B A;  2C9N Y;  3FGA D;  2BCC J;  2KS1 B;  1S1C X;  2PP6 A;  3C9I A;  4UB8 E;  3SSU A;  2KB7 P;  4GT1 A;  1FBM A;  3KHU A;  4NPF X;  1AA0 A;  1XTG B;  4R4L A;  2YO3 A;  1KQF B;  5AVV B;  2W90 A;  3A5T A;  3RK2 D;  3CCU P;  3M9Q A;  4KJM A;  4WY4 C;  2HLO A;  2IDB A;  4H44 D;  4Y99 B;  4H0L D;  5AW1 B;  5B5E H;  2KLU A;  2ZT9 B;  3V4W A;  5GTI E;  3TGU E;  3Q3D A;  2FFD C;  3ZDM A;  3KPE A;  1N7S B;  1NU1 G;  2Y0C A;  1FC2 C;  1NU1 E;  2GUV A;  4DOJ A;  2CPB A;  1DD3 A;  3HD7 C;  1K05 A;  1BGY J;  3HD7 B;  3KXD A;  1MFZ A;  1S72 P;  3WMM 0;  2WPQ A;  3GF3 A;  3PH0 A;  1LNQ A;  3W67 A;  3I56 P;  4N3Y B;  3D71 A;  1RQU A;  1JEK A;  1Q90 D;  2A06 D;  2KUB A;  2NPS A;  1VQO P;  1Q86 Q;  1KQS O;  1SFC C;  2P1J A;  5APY A;  3RGU A;  2FYU E;  2AEF A;  2Y9Z A;  3V2P A;  4C7N B;  4L73 A;  5BVZ A;  2HPC A;  2QJK C;  4ZKU A;  5GTI H;  1IFJ A;  1SQV J;  2C9L Y;  1HUC A;  3A2A A;  5CCG C;  2CK3 H;  1JY3 P;  1ZV8 A;  4JF7 A;  1S2E A;  1KFM A;  3EFF K;  3OA7 A;  1BE3 D;  3T97 A;  3Q5R A;  2N9B A;  2HFE D;  5DJU B;  2WSE J;  3AE8 C;  3CXH H;  3V2Q A;  4LC1 A;  4U3F D;  1E79 H;  3L72 J;  2B87 B;  2WSS H;  2QEX P;  3BAT A;  2WSF J;  3AE5 C;  4N78 D;  1HBW A;  3ABV C;  2YNY A;  1MKM A;  4I7Z C;  4CPG A;  2GM4 A;  3AE3 C;  1SQV E;  1GD2 E;  1FJK A;  4C46 A;  4EI2 A;  3H1K J;  3N7N A;  4D6T E;  1DEB A;  1ZR4 A;  1PFI A;  2YKO A;  3L37 A;  3WU2 H;  5E79 H;  1AVY A;  3MUD C;  2H7H A;  1N7L A;  1KFN A;  3H1H E;  3CCR P;  1YIT P;  1NTZ E;  3U1A A;  5KLI C;  1L0L K;  2POH A;  3PP5 A;  4PD4 E;  1BSH A;  1BGY E;  1ZOY C;  2KK7 A;  3CXH E;  1FJP A;  1KN7 A;  2AXC A;  1KQG B;  1NKN A;  2KI7 B;  3L73 E;  3FXD A;  2WT7 A;  1GU4 A;  2C0X A;  4W7Y A;  1NU1 J;  2M3B A;  3KDP B;  1EC5 A;  1FE6 A;  2JEE A;  1PPJ E;  3GHG A;  3K5B A;  3QH9 A;  4D6T D;  2M5A A;  1YIJ P;  3L74 G;  1T2K D;  1X9V A;  3MHV A;  1WRG A;  2NZ2 A;  2P58 A;  3P8C D;  3L70 G;  1RE3 C;  3HRN A;  2D2C B;  4OWF A;  3VTP C;  5AVQ B;  3WUV A;  5KLV D;  1VQP P;  4PV1 D;  1VF5 D;  3H1J E;  1PGJ A;  1SQB D;  1GL2 C;  4OH8 B;  1NO4 A;  3MD0 A;  5KKZ C;  1SQV D;  2YXR B;  5E79 E;  5AW5 B;  1USE A;  2AEM A;  2IBZ G;  3Q5S A;  1PGO A;  1KQL A;  3PJS K;  4WY4 B;  3H6P A;  4Y99 C;  4DCK A;  2QJP C;  3HD7 D;  1OFC X;  1LT1 A;  1SQB K;  3KQG A;  4HH2 A;  3NFQ A;  3V2N A;  1OW7 A;  1SQV K;  3CX5 H;  3CI9 A;  1W5C E;  2E76 D;  2PRR A;  3HUS B;  3M9B A;  1KC8 Q;  1Y9B A;  2Y0D A;  2YXQ B;  3IR9 A;  5KLV E;  3AEE C;  2KOG A;  3CME P;  1EDL A;  3L70 D;  1KV4 A;  4I7Z B;  3VP8 A;  1W2E A;  3B8E B;  1RY3 A;  3L72 G;  2K9J B;  4EDF A;  2HG5 D;  2P10 A;  3SWK A;  1HWT C;  1CI6 A;  1N8R Q;  2NPS B;  1J1E B;  1CI6 B;  2Q7C A;  3O6Q A;  5AVW B;  1SFC B;  1G2C A;  5AW8 B;  4NPD A;  2Y9Y A;  3E1R A;  1SQQ J;  3G9R A;  4OVN F;  1IFM A;  1NTK K;  2FXO A;  4KT0 J;  1ZN5 A;  2HYN A;  3S4R A;  4DJG A;  5AW0 B;  1IFI A;  3CXH I;  3IN6 A;  5K5G B;  3B5N C;  3CX5 E;  2O01 N;  3L74 D;  4L74 A;  1RE4 A;  4PD4 I;  3L70 E;  1GK4 A;  2JKV A;  2KP8 A;  4EYY Q;  1W2B O;  1URQ A;  2KLV A;  1SVF A;  2FKW B;  3M91 A;  1URQ B;  1YI2 P;  1L0N J;  3H1K G;  1L2P A;  2BEQ D;  1LT9 B;  1S5L H;  1AVO A;  2E76 C;  3EQ2 A;  3VN0 A;  2OQQ A;  1SQP K;  1BGY G;  3BCC G;  1OZH A;  5AVY B;  1U57 A;  1NJI Q;  3F89 A;  5APT A;  5KTB A;  3VMA A;  1YHQ P;  1BDC A;  2E74 B;  5KAI H;  2R3S A;  1SQQ G;  1LTG C;  3CWB E;  4WY4 D;  1KIL B;  2KZJ A;  4OGQ B;  4BWN A;  2O3J A;  2PFX A;  3IF4 A;  1H0T B;  2GUS A;  1TU3 F;  4IL6 X;  2ZT9 C;  1PP9 E;  2RN0 A;  2V7Q H;  3AE7 C;  4PV1 C;  5C39 A;  1KYO H;  2KSJ A;  2ZYD A;  1ZXG A;  4TLF A;  1GZL A;  3L74 J;  1RQV A;  5APW A;  3RBZ A;  2XDJ A;  3V4Q A;  1H88 A;  2WZ7 A;  1LWU C;  4GOF A;  4C7R A;  2W8Z A;  3BCC J;  1GU5 A;  1JMB A;  1S5L E;  1VQN P;  3FWN A;  3M06 A;  1Q82 Q;  3GHG B;  5AVU B;  1PGP A;  1OX3 A;  1H8A A;  2M5A B;  2OYH B;  4U3F E;  4U7J A;  3Q5P A;  2K37 A;  2LKM A;  3G6E P;  2QIW A;  1SFC D;  2FXP A;  2QE7 H;  3RBX A;  3G4S P;  3H32 B;  1EDJ A;  2I8D A;  2LR2 A;  2JWA A;  3H1J J;  3CD6 P;  2E74 C;  1KTM A;  3WU2 E;  1N73 C;  1LTS C;  2Q6Q A;  1L4A D;  3GF7 A;  1VQ5 P;  1R8E A;  2QJP B;  3O8Z A;  3TGU D;  2N1T B;  3CC4 P;  1G1J A;  2W6J H;  3CLQ A;  1FAV A;  1JTH B;  4PD4 H;  4PJ0 E;  1QVG O;  1A02 J;  2YIU B;  1VQ9 P;  3BCC E;  1URQ D;  2YMK A;  1Q2N A;  1MUU A;  4JQ0 D;  4R4M A;  1LJ2 A;  2KNC A;  1M1J B;  3A0H H;  1RF1 B;  4AYC A;  2D2C C;  3CX5 D;  3L74 E;  1SQX G;  1NTZ J;  2K3R A;  1NOH A;  1CSB A;  3H1H J;  3HE4 A;  3L71 D;  1SP4 A;  2XV5 A;  4JBZ A;  1GK6 A;  2L5G B;  3HE4 B;  2QA4 P;  2E5T A;  2WPS A;  5M1B A;  3AEG C;  1L0N G;  1BCC D;  3S9O A;  2Q9I A;  2JO1 A;  3L36 A;  2ZYA A;  2BCC G;  2J59 M;  1A02 F;  3RL0 D;  3H1K E;  3NXS A;  1J1E C;  4D6T J;  2OYI A;  3FXE A;  1IFD A;  3O6Q B;  1NTK E;  1BCC G;  1XTC C;  2P7J A;  2IPP A;  3A3Y B;  2O1K A;  2OYI B;  3HUS C;  4JYB A;  3KZI H;  1G1I A;  5L8R J;  2ZFC A;  4D6T G;  3L75 D;  1S9K E;  4XA4 A;  5CJ4 A;  2JWD A;  5CCH C;  3H1L E;  1NTZ G;  2FY8 A;  3UIA A;  2XU6 A;  2KS1 A;  3A0H E;  2RH0 A;  3GHG C;  1SQQ D;  2MKV A;  4N78 E;  5BU8 B;  1OWA A;  1X0T A;  3ITK A;  2R44 A;  3M0A A;  3PLN A;  2IBZ D;  3RL0 g;  1OVV A;  4BXL A;  1DX7 A;  1MFT A;  1KB9 E;  2FYU J;  4JPZ B;  4YXW H;  2OTL P;  1JO5 A;  4GOE A;  1K04 A;  2OTJ P;  5KLV G;  3D70 A;  4UB6 H;  1SS1 A;  3MIW A;  3RK2 C;  1N86 A;  2E75 C;  1YTZ T;  2A45 G;  1HJ0 A;  1Y47 A;  2WPV B;  2E5Y A;  4GIF A;  3H1J G;  2YIU C;  5BU5 A;  1N7S C;  3PRJ A;  2V4H A;  3GMA A;  1JCC A;  3H1I E;  3M0D C;  1JY2 O;  3A7O A;  5AVX B;  2OTK E;  5KJ7 D;  5KLI B;  1LT9 C;  5KLV J;  2JJL A;  3B5N D;  1S4X A;  2IBZ E;  3VOP A;  1NTK G;  2SPZ A;  1NTM G;  4GOD A;  1KYO D;  2XND H;  2XZR A;  4AQR D;  3D6Z A;  1X8Y A;  3M0D A;  1FOS F;  1OMI A;  2WPR A;  3TGU J;  2FYU G;  4C7N A;  1K9M Q;  3RL0 B;  1T6A A;  3RL0 C;  1OW6 A;  3S1K A;  1EZV D;  1UIX A;  3BRT B;  3EFG A;  3SFE C;  5KAI E;  1GTW A;  2OYH A;  1VQ6 P;  1NTM J;  1EQ7 A;  1UII A;  1SQX E;  2WVR A;  3HE5 A;  4UB6 E;  2M0B A;  2QJK B;  1SQP G;  1IFP A;  1FZE A;  2BCC E;  1NVO A;  1VF5 B;  1LWU A;  2H89 C;  3AEC C;  2R32 A;  3JC2 2;  1RF0 C;  3KYQ A;  1KYO E;  2B87 A;  3H1K D;  4M3L A;  2FFD A;  2OAR A;  1BCC J;  3I5C A;  1JM0 A;  4I1L A;  2N9Y B;  3OJA B;  4H44 B;  1OXZ A;  1JNM A;  1M8O B;  2Q1K A;  1LTB C;  5CCH A;  3HD7 A;  3L71 E;  3A0B H;  5AW7 B;  1EZV G;  3MGN A;  1KOR A;  1WMK A;  2E74 D;  1FZC B;  1NAF A;  1JCD A;  2IYO A;  3H1L D;  4I2L C;  1HF9 A;  1QEX A;  1KIL D;  1VQ4 P;  5KAF H;  2G8Y A;  1YQ3 C;  1EDK A;  2IZ0 A;  3JSV C;  1GMJ A;  1MV8 A;  1L0L D;  1LTJ B;  3VP9 A;  2QM7 A;  2C0W A;  4N6J A;  1LTJ A;  2WQY C;  3AE9 C;  3U59 A;  4EIJ A;  1NTZ D;  4O9B A;  1OW8 A;  4ZKP A;  2VRS A;  1QL1 A;  5TIS H;  1M56 D;  1VQ8 P;  2GA1 A;  4PJ0 H;  1OVU A;  1U7J A;  1LTI C;  1JB0 J;  1WT6 A;  1PP9 G;  2IZ1 A;  3B5N B;  3V6I A;  3CCS P;  3B5N A;  3FX0 A;  2I1J A;  1BE3 E;  3TNU A;  3CMA P;  2IBZ I;  1GDT A;  2MJZ A;  1HGV A;  1VQM P;  1AQ5 A;  1OIP A;  2HR3 A;  1M57 D;  3NMD A;  2ZYG A;  4DZO A;  1FZG A;  4IFF A;  3BRV B;  4DT0 A;  1R5S A;  1SQX J;  1L0L E;  3AEF C;  1BSN A;  1LTA C;  1NU1 K;  3Q2Y A;  1OVR A;  4RKU J;  4WY4 A;  1IK9 A;  1SQB E;  5KAF E;  3RK3 D;  5CHX A;  2ZXE B;  4GDO A;  1AQT A;  1KIL E;  3SWF A;  2ITA A;  1NHL A;  1VQL P;  1S3J A;  1QX8 A;  2QJY C;  3BVH A;  1JOC A;  2QVA A;  3HUS A;  3I55 P;  1VQ7 P;  1ZRT D;  3KZI E;  1BDD A;  2WSF H;  1K8A Q;  1FZB A;  1E5W A;  2AXT E;  3H1I J;  3R4Y A;  1SQP J;  1USD A;  5GTH H;  1RF0 A;  2R5B A;  3TGU G;  2FYZ A;  1J1D B;  4PD4 D;  1EZV I;  2WSC J;  5CCG D;  2R3C A;  2K88 A;  3P32 A;  1YYC A;  3CCM P;  1L0L G;  4H13 D;  1GL2 B;  1G2C B;  3AE4 C;  1J2J B;  1DIP A;  1IK7 A;  4KHX A;  2P67 A;  2OYH C;  2KXP B;  1QVF O;  1KB9 H;  2IX7 C;  3G3Z A;  3MUD A;  1HH0 A;  1LTJ C;  1L0L J;  3V2R A;  5CBN A;  3T97 B;  3VYI A;  1JY3 O;  1NGM B;  2ZAE B;  3H1I G;  5APQ A;  4ZNC A;  2B88 A;  2JP3 A;  1VDF A;  3H1H D;  2M3E A;  3H1L J;  1BE3 J;  2AXT H;  1LWU B;  1FU1 A;  2A06 G;  2H8P D;  2N1T C;  3AED C;  3CXH D;  3PHL A;  1N7S A;  4HB1 A;  2QRX A;  4OGQ C;  1P84 E;  5KLV K;  1SQP D;  2J58 A;  4TT3 H;  1AV1 A;  1URQ C;  2L91 A;  4L75 A;  4H0L C;  1PGQ A;  2K1A A;  3M9H A;  4H44 C;  2H43 A;  1NTK J;  1YBK A;  3RK3 C;  2KIK A;  2XKM A;  1L4A C;  5AW2 B;  1GL2 D;  2FYU D;  4XE5 B;  4YTP C;  1Q7Y Q;  4Z1M H;  2LXC B;  2A45 H;  3CWB D;  4WVZ A;  1NU1 D;  2W6B A;  1BGY D;  1NKZ B;  1JY2 N;  3N4X A;  2A45 I;  2FYU K;  1MZ9 A;  1IJD B;  3NTN A;  1KZU B;  2QG4 A;  2O01 J;  2WT7 B;  3GW6 A;  5APS A;  2KSE A;  1T2K C;  4XFJ A;  4IFD K;  3C8V A;  1QLE D;  1P84 H;  3L75 E;  3AEA C;  1S9K D;  2YKQ A;  1FZA A;  1HTL C;  2V7Q J;  1X22 A;  1Y8A A;  1YJ9 P;  3CCL P;  3A0B E;  1JUN A;  1LT9 A;  4GKG A;  2OGU A;  2FYN C;  2NRG A;  2ZT9 D;  4H0L B;  1AFO A;  1NWQ A;  3CC7 P;  2Q5U A;  3H1H G;  4A7P A;  1NTM E;  1AJY A;  3GLM A;  3GG2 A;  3TSI A;  3JCU E;  4U3F J;  1SLQ A;  1P84 I;  1L0N D;  2QSI A;  2R5D A;  2YO2 A;  3C1L A;  3D6Y A;  1DEE G;  4ASV A;  3R2P A;  2QJY B;  2OYO A;  2IFN A;  1PL5 A;  2ZVN B;  4OGQ D;  5TIS E;  2KNC B;  2RKL A;  3CCV P;  1YTZ I;  4IFM A;  3MTU E;  1HGZ A;  5CBO A;  3BCC D;  3HTK A;  3FWL A;  2IFM A;  3HTK B;  4AUW A;  4HKZ H;  1PP9 J;  1J1D C;  2K9J A;  2O01 H;  2A06 E;  2G3A A;  1VPC A;  2Z4E A;  3F5H A;  4B86 A;  1LTT C;  3CX5 I;  3OAK A;  1T3U A;  3CC2 P;  4U3F G;  1GL2 A;  3VMZ A;  3OW2 O;  1FZF A;  3LW5 J;  2BAS A;  1IC2 A;  1EZV E;  1PPJ G;  1Z56 A;  5AVZ B;  2B89 A;  4H13 C;  3L71 G;  4NPE A;  2E75 B;  4WWI A;  3H1L G;  3H32 A;  3L35 A;  4YPC A;  4WB4 A;  2Z5H A;  1DD4 A;  1T3J A;  2W83 C;  2XNX A;  3P8M C;  4L76 A;  4LGD E;  5APU A;  2E43 A;  1L0N E;  2O1J A;  2BCC D;  2YMY A;  1R5L A;  2J5U A;  3E1I A;  1FDM A;  5CMZ A;  5H2F H;  1M7L A;  5CJ0 A;  1H89 A;  3TK1 A;  3P7K A;  1IZN B;  1QGK B;  1SQQ K;  2YKP A;  5GTH E;  1DH3 A;  2E42 A;  2K9Y A;  3E7K A;  2Q3I A;  5AVT B;  1KD1 Q;  1ZLL A;  2N1T D;  3P8C E;  3L4F A;  2WMM A;  1SQQ E;  3AE2 C;  4UB8 H;  3L75 G;  2JR8 A;  3RK3 B;  3W68 A;  1KYO I;  1VQK P;  4EOT A;  3WUT A;  1K73 Q;  3BAS A;  4K3A A;  1FDO A;  1RH5 B;  2M8R A;  1SQX K;  1LP1 A;  1N73 B;  1EXJ A;  1RHZ B;  1VF5 C;  1SFC A;  4MN4 C;  2LXB A; 
#chains in the Genus database with same CATH homology
 1L0N K;  2WSC H;  5AVS B;  1QL2 A;  1RE4 C;  3VMX A;  2Z5I A;  1LGH B;  4RES B;  5KJ7 C;  1RF1 C;  1L4A A;  1L4A B;  1CW5 A;  3LIE A;  3SWY A;  3HE5 B;  1KIL C;  1JY3 N;  4WBA A;  4W80 A;  5AW6 B;  2WTY A;  1HVV A;  2N1T A;  2FFD B;  1KIL A;  1JTH A;  1FZC C;  1GW4 A;  4I6M C;  5AVR B;  5CCG A;  5AW3 B;  5AW4 B;  5KJ7 A;  1M1J A;  1JY2 P;  1RF1 A;  2WSE H;  1FZC A;  1GW3 A;  5AW9 B;  2FXM A;  1FOS E;  2NPS C;  5APX A;  1N2D C;  2HPC B;  1CZQ A;  2I1K A;  3LW5 H;  1HJB A;  1NTZ K;  1RE3 A;  3RK2 B;  1JMM A;  1T8Z A;  5APV A;  2PAJ A;  2NPS D;  2WIT A;  2OYI C;  2WWW A;  1N7S D;  2QM8 A;  2P2U A;  1NH4 A;  2KYV A;  3II6 A;  4LLH A;  4JYC A;  3LID A;  1IFN A;  3CL3 D;  3IFM A;  1IO4 A;  4W7Z A;  3U1C A;  1NTM K;  1N73 A;  2CPS A;  1X79 B;  3VMY A;  2W27 A;  5CCH D;  3TYY A;  1ZR2 A;  2HOD A;  2HOD B;  4HYT B;  1M1J C;  2W6A A;  3V5B A;  3TNU B;  2C9N Y;  3C9I A;  2PP6 A;  2KB7 P;  4GT1 A;  1FBM A;  1XTG B;  2YO3 A;  5AVV B;  3A5T A;  3RK2 D;  3M9Q A;  4WY4 C;  4Y99 B;  2HLO A;  5AW1 B;  2FFD C;  3KPE A;  1N7S B;  2GUV A;  4DOJ A;  2CPB A;  3HD7 C;  3HD7 B;  1MFZ A;  3WMM 0;  2WPQ A;  4N3Y B;  2NPS A;  1SFC C;  2P1J A;  5APY A;  3V2P A;  4C7N B;  5BVZ A;  2HPC A;  4ZKU A;  1IFJ A;  2C9L Y;  1HUC A;  3A2A A;  5CCG C;  1JY3 P;  1ZV8 A;  4JF7 A;  3OA7 A;  1KFM A;  3T97 A;  2N9B A;  2HFE D;  3V2Q A;  4LC1 A;  3BAT A;  4N78 D;  1HBW A;  2YNY A;  2GM4 A;  1GD2 E;  1FJK A;  4C46 A;  3N7N A;  1DEB A;  1ZR4 A;  1PFI A;  2YKO A;  3L37 A;  2H7H A;  1N7L A;  1KFN A;  3U1A A;  1L0L K;  2POH A;  3PP5 A;  1FJP A;  1NKN A;  1GU4 A;  2WT7 A;  2C0X A;  4W7Y A;  2M3B A;  3KDP B;  2JEE A;  3GHG A;  1T2K D;  1X9V A;  1WRG A;  3P8C D;  1RE3 C;  3HRN A;  3VTP C;  5AVQ B;  1GL2 C;  4OH8 B;  1NO4 A;  3MD0 A;  5AW5 B;  1KQL A;  4WY4 B;  4Y99 C;  3H6P A;  3HD7 D;  4HH2 A;  1SQB K;  3KQG A;  3NFQ A;  3V2N A;  1SQV K;  3CI9 A;  3HUS B;  3M9B A;  3IR9 A;  2KOG A;  3VP8 A;  1W2E A;  3B8E B;  1RY3 A;  2HG5 D;  1CI6 A;  2NPS B;  1J1E B;  1CI6 B;  2Q7C A;  5AVW B;  5AW8 B;  1SFC B;  1G2C A;  1HWT C;  1IFM A;  1NTK K;  1ZN5 A;  2HYN A;  1IFI A;  3B5N C;  1RE4 A;  1GK4 A;  2KP8 A;  1URQ A;  2KLV A;  1SVF A;  2FKW B;  3M91 A;  1URQ B;  1LT9 B;  3EQ2 A;  3VN0 A;  1SQP K;  5AVY B;  5APT A;  5KTB A;  1LTG C;  4WY4 D;  1KIL B;  2GUS A;  2KSJ A;  5APW A;  1GZL A;  2XDJ A;  3V4Q A;  1H88 A;  2WZ7 A;  1LWU C;  4C7R A;  1GU5 A;  3M06 A;  3GHG B;  5AVU B;  1H8A A;  2OYH B;  2LKM A;  1SFC D;  3H32 B;  1N73 C;  1LTS C;  1L4A D;  3O8Z A;  2N1T B;  1G1J A;  3CLQ A;  1A02 J;  1FAV A;  1JTH B;  1URQ D;  1MUU A;  1M1J B;  1RF1 B;  4AYC A;  3V4W A;  1NOH A;  1CSB A;  3HE4 A;  1SP4 A;  2XV5 A;  1GK6 A;  2L5G B;  3HE4 B;  2WPS A;  2Q9I A;  3L36 A;  2J59 M;  1A02 F;  3RL0 D;  3NXS A;  1J1E C;  2OYI A;  1IFD A;  1XTC C;  2P7J A;  2OYI B;  2IPP A;  3A3Y B;  2O1K A;  3HUS C;  4JYB A;  1G1I A;  2ZFC A;  1S9K E;  4XA4 A;  5CJ4 A;  5CCH C;  3UIA A;  2XU6 A;  3GHG C;  4N78 E;  5BU8 B;  1OWA A;  3M0A A;  1DX7 A;  1JO5 A;  3RK2 C;  3MIW A;  1N86 A;  1YTZ T;  2A45 G;  4GIF A;  5BU5 A;  1N7S C;  4ZKP A;  3M0D C;  1JCC A;  5AVX B;  1FZC B;  1JY2 O;  3A7O A;  5KJ7 D;  1LT9 C;  2JJL A;  3B5N D;  3VOP A;  4AQR D;  2XZR A;  1X8Y A;  3M0D A;  1FOS F;  2WPR A;  4C7N A;  3RL0 B;  3RL0 C;  1GTW A;  3BRT B;  2OYH A;  3EFG A;  1EQ7 A;  3HE5 A;  1FZE A;  1LWU A;  5AW0 B;  2R32 A;  4M3L A;  1RF0 C;  3KYQ A;  2FFD A;  2OAR A;  3I5C A;  4I1L A;  3OJA B;  1JNM A;  1OXZ A;  5CCH A;  1LTB C;  3HD7 A;  5AW7 B;  3MGN A;  1NAF A;  1JCD A;  4I2L C;  1KIL D;  1MV8 A;  3VP9 A;  1LTJ B;  2QM7 A;  2C0W A;  4N6J A;  1LTJ A;  3U59 A;  4EIJ A;  4O9B A;  2VRS A;  1QL1 A;  1LTI C;  3B5N B;  1WT6 A;  3B5N A;  3TNU A;  2I1J A;  1GDT A;  2MJZ A;  1HGV A;  1AQ5 A;  3NMD A;  4DZO A;  1FZG A;  4IFF A;  3BRV B;  1LTA C;  1NU1 K;  4WY4 A;  1IK9 A;  3RK3 D;  5CHX A;  2ZXE B;  3SWF A;  1NHL A;  3BVH A;  1JOC A;  3HUS A;  2WSF H;  1FZB A;  1E5W A;  1FZF A;  1RF0 A;  2R5B A;  2FYZ A;  1J1D B;  5CCG D;  2R3C A;  3P32 A;  1YYC A;  1GL2 B;  1G2C B;  1J2J B;  4KHX A;  2P67 A;  2OYH C;  3G3Z A;  2IX7 C;  3MUD A;  1HH0 A;  1LTJ C;  3V2R A;  3VYI A;  1JY3 O;  5APQ A;  1VDF A;  1LWU B;  1FU1 A;  2H8P D;  2N1T C;  1N7S A;  5KLV K;  2J58 A;  1URQ C;  3M9H A;  2H43 A;  3RK3 C;  2XKM A;  1L4A C;  5AW2 B;  1GL2 D;  4XE5 B;  2A45 H;  2W6B A;  3N4X A;  1NKZ B;  1JY2 N;  2A45 I;  2FYU K;  1MZ9 A;  1IJD B;  3NTN A;  1KZU B;  2WT7 B;  5APS A;  1T2K C;  4IFD K;  1S9K D;  2YKQ A;  1FZA A;  1HTL C;  1JUN A;  1LT9 A;  4GKG A;  1AFO A;  1NWQ A;  2Q5U A;  3TSI A;  1SLQ A;  2YO2 A;  2R5D A;  3R2P A;  2IFN A;  1YTZ I;  4IFM A;  3MTU E;  1HGZ A;  3HTK A;  2IFM A;  3HTK B;  4AUW A;  1J1D C;  2O01 H;  1VPC A;  2Z4E A;  4B86 A;  1LTT C;  3OAK A;  1T3U A;  1GL2 A;  3VMZ A;  2BAS A;  1IC2 A;  1Z56 A;  5AVZ B;  3H32 A;  3L35 A;  4WB4 A;  2Z5H A;  1T3J A;  3P8M C;  2XNX A;  4LGD E;  5APU A;  2E43 A;  2O1J A;  1FDM A;  2YMY A;  3E1I A;  5CMZ A;  1M7L A;  5CJ0 A;  1H89 A;  3TK1 A;  3P7K A;  2E42 A;  1SQQ K;  2YKP A;  1DH3 A;  2Q3I A;  5AVT B;  1ZLL A;  2N1T D;  3P8C E;  3L4F A;  3RK3 B;  4EOT A;  3BAS A;  2M8R A;  1SQX K;  1N73 B;  1SFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...