1FBMA

Assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title All-trans retinol, vitamin D and other hydrophobic compounds bind in the axial pore of the five-stranded coiled-coil domain of cartilage oligomeric matrix protein.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
molecule keywords PROTEIN (CARTILAGE OLIGOMERIC MATRIX PROTEIN)
total genus 17
structure length 46
sequence length 46
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2000-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11598 COMP Cartilage oligomeric matrix protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fbmA00
3V2QA 1MZ9A 3V2RA 3V2NA 1DEBA 1VDFA 1FBMA 3V2PA
chains in the Genus database with same CATH superfamily
1KQLA 1N86A 1ZW0A 2JR8A 2A06G 3H1HJ 3AEBC 4H44C 4I6MC 1HF9A 1NKZB 3L74E 2ITAA 3RK2B 2M3EA 5CCHD 4OGQC 3D6ZA 1VQ7P 3V4QA 1FZCC 1BGYE 4GT1A 5AVZB 4PD4I 1OW7A 3N7NA 3JCUH 1NAYA 1BCCJ 3MP7B 1L0LK 1S2EA 2A06D 1HTLC 1JY2P 1N7SC 3FXDA 1MUUA 1PPJD 3KQGA 2QVAA 4YPCA 3H25A 3Q5SA 3RK2D 1SQBG 2ZVNB 1QL2A 1KV4A 3GHGC 2YXQB 3CPWO 1T2KC 2QJYC 1IK7A 3BCCE 1IO4A 1FS0E 2G8YA 1PGPA 2H89C 2JWDA 5AVWB 2XV5A 1NTKE 2RKLA 1M57D 1JOCA 5APXA 3R4YA 3O6QB 1EDIA 1NTZJ 1PP9G 4IL6X 4Y99C 3RBZA 3C9IA 3WMM0 3NXSA 2B89A 5C39A 1YJ9P 2NZ2A 2QM8A 1RE3A 3V2QA 1VF5C 4O9BA 5AVSB 1LP1B 2HR3A 3A0BH 3E7KA 2Z4EA 1KILD 1G2CA 1GL2D 1SQVG 2ZXXA 2C9LY 3EWKA 1Q2NA 2R44A 3RK2C 1DEEG 2A06E 2E5YA 1KB9D 2OTKE 1KQSO 1L0LJ 1YITP 1FZCB 2FXMA 1HVVA 5KLVK 2FKWB 2KOGA 2O01H 4B86A 2XZRA 1NTZD 1ZOYC 2JDIH 2M8RA 1FDOA 1LWUA 1TU3F 3T97B 1PP9D 4HH2A 3L73D 3CCJP 1NAFA 1IFDA 2KLVA 3L72J 2WZ7A 3V2NA 1URQC 4WY4C 3AE3C 4W7YA 1KZUB 2HLOA 2QRXA 1LTJB 2FYUG 5APSA 2QJYB 5AW1B 4ZKPA 5KLIC 1U7MA 3BVHA 3M9HA 1OVVA 5AVUB 1RHZB 1SQBD 2JO1A 1QL1A 2E75C 1AA0A 2L91A 2FXOA 3H1JG 1NKNA 3HUSA 3V4WA 2YIUC 4GOEA 1DX7A 1G2CB 1KORA 2R3SA 2R5DA 2GUVA 1FBMA 4PJ0E 5CCHC 3KDPB 4DOJA 3Q5PA 4QMAA 1USEA 1VQMP 3L71G 3M0AA 3O8ZA 3U59A 4RESB 3A0HE 3NMDA 2ZT9C 4H13D 3E1RA 4WBAA 3RL0D 2Y9ZA 2KZJA 3EFFK 1HJ0A 1FAVA 1X22A 1ZRTE 1S9KE 3S1KA 2H7HA 1LWUB 2HG5D 1NU1G 2E74C 1OMIA 2RH0A 4KJMA 1KB9H 2FYUK 1UIIA 1YIJP 2WMMA 2YO2A 4DCKA 5CMZA 5TJHA 2Y0EA 4BRYB 5CCGA 1LTJA 1M1JA 3V2RA 1L0LE 1OVUA 1E79H 1VQPP 1FDIA 1N7LA 2W90A 3RL0C 1L0NJ 1KYOE 2I8DA 4D6TG 2M0BA 5M1BA 1FDMA 2H43A 5KLIB 1IJDB 1J1DB 1EZVI 1GW3A 2Y9YA 1NO4A 1OZHA 3CX5H 3H1LD 3HUSB 5KJ7A 1BCCG 1L4AA 5APTA 4DT0A 1OX3A 2W83C 3BCCG 2E76B 4RJTA 3VOPA 1Q90D 2PP6A 1NTZE 3D71A 1QX8A 2N9BA 4H13C 5GTHE 1PFIA 1VQNP 1IFMA 2OYHA 2E43A 1JEKA 2NPSA 2O01N 3Q5RA 3B5NC 1GL2B 1R5SA 4RO0A 2K9YA 4OH8B 3HD7A 2RMZA 3L37A 1OFCX 3RK3B 1G1JA 1KILE 3L74G 2GM4A 3BATA 1SS1A 2WTYA 3CCQP 1J1EC 1M1JB 1OW8A 2KS1A 2LR2A 1P84I 3CXHI 2K37A 4UB6H 2IPPA 2K3RA 1BGYD 3TGUJ 1NGMB 1RE4A 1JY2O 5CJ4A 1LT9C 1CSBA 2E5TA 2N1TC 5DJTB 2QE7H 3FWLA 1JTHB 4R4MA 2AEMA 2KZIA 2ZVOB 3ZDMA 1A02F 2YKOA 4L76A 5EFWB 3RK3E 2WITA 3MTUE 1KILB 2POHA 3QWOC 5GTHH 3H1KJ 1N73B 4JYBA 1QVFO 3AE1C 3IF4A 4N3YB 1KYOD 3KXDA 3L72E 5KAFE 1SQQJ 3VMXA 3WUUA 3P8MC 4PV1D 2Z5HA 2HYNA 2XDJA 2XKMA 4IL6E 2YKQA 2OYHB 2Q1KA 2H88C 1X8YA 2BEQD 1SQVK 1IC2A 3PLNA 3RBXA 1PP9J 2V4HA 1EZVE 3JCUE 5APWA 1KN7A 1SQQK 3U1CA 3HTKB 1SQQE 2I1JA 3CX5D 1SFCD 3CCSP 2N1TD 1GU5A 4LLHA 2UWJE 4I1LA 1UIXA 1RF1A 4PV1C 2B87B 1L0NG 4MN4C 4U7JA 1FZFA 2KB7P 1FC2C 2C9NY 2OYIC 1HGZA 1L0LD 2WVRA 1SLQA 1LT1A 4XFJA 1QEXA 1S5LH 2HPCA 1XTGB 3L36A 1BSHA 2K9JB 2ZYDA 1VDFA 2YMYA 2WT7B 3G3ZA 3TGUE 2IZ0A 1KILA 1NU1J 1RY3A 2PGDA 1JNMA 1M90Q 2M3BA 3AE4C 2FFDA 3GLMA 4I2LC 1EDKA 3CCMP 1L4AD 4PJ0H 3SFEC 2P67A 1Q86Q 5AW5B 1N7SB 2XNDH 2NRGA 3H1KG 3KHUA 3LIEA 1JY3N 2CPBA 1OXZA 3VN0A 1VQ8P 1BE3E 1EZVD 2KSJA 2WSEH 3H1JE 3L75D 3QH9A 4H44D 4YXWH 1DD3A 3IAOA 1BSNA 5APYA 1NTKD 1NU1D 4HKZH 1KQFB 2B9BA 3SWKA 5BVZA 3W67A 1RF1B 1HUCA 2KXPB 4AUWA 3FWNA 1L0ND 3A3YB 2KP8A 4K3AA 1BDCA 1SFCB 1LP1A 2KUBA 4GKGA 4H0LB 3M9QA 5APUA 2AXTE 2HPCB 1DH3A 1M1KQ 2JWAA 2WWWA 1EXIA 2OTJP 3NTNA 2R5BA 1IFNA 2Q3IA 1IK9A 1NYHA 3CX5I 2FFDB 2V7QJ 1P84D 2C0WA 4GIFA 1FZCA 1ZV8A 2W27A 1KFMA 1L0LG 1NTKJ 2M5AB 3CL3D 1Z56A 2OARA 3D6YA 3CXHH 4U3FD 3Q2YA 1N7SA 2QJKB 2W6AA 3G9RA 3MZWB 1AJYA 1VQOP 1EQ7A 3BCCJ 5KLVD 1N73A 2E74D 4EI2A 1KYOI 1VF5D 3EQ2A 5KLVG 1T8ZA 3WU2H 1Q7YQ 3CD6P 1HGVA 1JUNA 1PGJA 2DW3A 3G6EP 3A5TA 2FY8A 3PH0A 4OWFA 1JMMA 2MJZA 2XNXA 1NTKG 1NTZG 3F89A 3CMEP 3NFQA 4UB8E 5TISE 1GD2E 1SFCA 2GA1A 1SQQG 1NHLA 1P84H 2O01J 1PGOA 1K04A 1EZVG 1T3UA 1RQUA 2HODB 4I7ZC 1RE3C 4IOIH 3BCCD 4LGDE 2E75B 5KAIH 1VQ9P 3MGNA 1MZ9A 3CXHD 4ASWA 3P32A 1H89A 1G1IA 4NPEA 2KK7A 3TYYA 5AVQB 1N7SD 2KYVA 4PD4E 2VRSA 3LW5J 2E74B 3WUVA 1VQ5P 1H0TB 1AVOA 4BXLA 4U3FE 1DD4A 2D2CC 2ZT9B 3CWBD 3CWBJ 3TGUG 2QIWA 3M06A 3VP9A 1SQPK 2E76D 1M8OB 2Q5UA 2QM7A 2P7JA 4OGQD 1CZQA 1LTGC 2G3AA 2P58A 3V2PA 4R4LA 1VL2A 2ZYGA 3SWFA 1LTBC 3L74D 2W8ZA 4ZKUA 1S5LX 3S4RA 3ABVC 1U7JA 3H1IE 5AVTB 5E79H 3D70A 3H1KE 3H1LE 2FXPA 3M0DC 2D2CD 4D6TD 2ZJSE 5KAFH 3GF7A 1PPJG 4N78E 4Y99B 2OGUA 4AQRD 1EDJA 2BCCE 1T2KD 1S3JA 3L72G 2IFNA 2FYZA 3HUSC 3C8VA 1LTAC 3CWBG 3TGUD 3I55P 3OAKA 2QSIA 2AEFA 1GL2C 4I7ZB 2E76C 3FGAD 2K88A 2A45I 3KZIH 4N78D 2ZFCA 2H8PD 2NPSB 3TNUB 3MUDA 3RK3C 4XA4A 1RF0C 4GDOA 4XE5B 2E42A 1NOHA 1FZEA 1NH4A 2IBZE 1S72P 1SQPJ 3HD7B 4JBZA 1SQVJ 2L5GB 5H2FH 3RGUA 1AQ5A 3ITKA 2O3JA 3A0BE 3SWYA 3OA7A 1YHQP 1T6AA 1XTCC 3FXEA 3MIWA 3P8CD 1GZLA 1RQVA 4DJGA 4OGQB 1A02J 5CCGC 5KKZB 4Y28J 5H2FE 1HBWA 1SQBE 1SQBK 2IBZI 2QJPB 5DJUB 4D6TE 3KYQA 5AVYB 1GTWA 3H1LJ 1LT9B 1FOSF 2YO3A 4EYYQ 1H88A 1SQVD 4KHXA 1GW4A 1SQPG 2R32A 3CCRP 1SQPD 2FYUE 2WPRA 3RK3D 1GU4A 3SSUA 1SQQD 1Y47A 3C1LA 1L4AC 1SQXE 3CX5E 1Q82Q 3K5BA 1NTMJ 1N2DC 2BCCG 2N9YB 1HJBA 1PP9E 3A7OA 3B5ND 5AW3B 3TNUA 5AW6B 3CCLP 1N8RQ 3AECC 4Z1MH 3R2PA 1Y9BA 2IX7C 3M9BA 2MKVA 2P10A 1BE3J 3L70D 2KIKA 1NTMK 1MFTA 2NPSC 3PHLA 4U3FJ 5L8RJ 4PV1B 3L71E 5E79E 1KB9I 2A45G 1IFJA 2J58A 3GMAA 3HD7C 1K73Q 4U3FG 1VF5B 3CXHE 1JCDA 1SQXK 1DIPA 1LJ2A 2B87A 3MHVA 2JEEA 4WVZA 4YTPC 3VMAA 3JSVC 1BGYG 2WPQA 3AE6C 1BDDA 2Q9IA 2K9JA 3L75G 1LT9A 2YNYA 2N1TA 2WT7A 2WSCH 1ZR4A 2JP3A 2Q7CA 2J59M 2AXTH 2JKVA 2Q6QA 3AE9C 4C7NA 3V6IA 3H1LG 3L35A 3VMZA 1ZN5A 3GHGA 1WRGA 3CI9A 2KLUA 2B88A 1YJNP 1AQTA 2E75D 1URQB 4WY4B 4H13B 3HE5A 3LIDA 1PZQA 1X9VA 3EFGA 3USSA 4L74A 1L0NK 3SFDC 3I5CA 1EXJA 1X0TA 2AXCA 3PP5A 3PTZA 5AW8B 3TK1A 3WUTA 3H1JD 1BCCD 1PGQA 2CK3H 3CC4P 5B5EE 1ZLLA 3A2AA 4H44B 5AW9B 1SQXJ 4H0LC 4DZOA 2BASA 2YIUB 3WU2E 3GW6A 4YXDC 3GG2A 4LC1A 2YMKA 1R8EA 1RF1C 1L0NE 3GF3A 3H1HD 3CC7P 4K35A 1MKMA 2N1TB 3B8EB 2OYIA 4PD4H 1LNQA 2YKPA 3KZIE 4GOFA 2R3CA 4EOTA 3U1AA 3S9OA 1HWTC 5KAIE 3GHGB 1LWUC 3L75E 3H1JJ 1KILC 3UIAA 3II6A 5KLVE 2WQYC 2ZAEB 1SQXD 2M5AA 3A0HH 1URQA 2BCCD 4WY4A 2FYNC 4JYCA 5AVVB 1SQPE 1YQ4C 2FYUD 3HE5B 3TSIA 2FFDC 1VQ4P 1GMJA 1JB0J 4HB1A 4H0LD 1AVYA 1PV3A 1IFPA 2Y0DA 3B71A 4UB8H 3RL0B 5TISH 3L73G 2Z5IA 2WSCJ 1BE3G 3L70G 1YI2P 1J1DC 1BCCE 2Q3EA 5KJ7D 1FOSE 1JY2N 4HJGH 1DEBA 3VYIA 3P8CE 1X79B 2C0XA 1D7MA 1QLED 1YQ3C 3AEEC 2V7QH 5CCHA 1PL5A 1KD1Q 4IFDK 3AE2C 1CW5A 2WSEJ 1NTMG 2BCCJ 3L73J 1M7LA 3HRNA 3L74J 2HODA 2IZ1A 2OYIB 3H1HE 4GODA 4L73A 2IBZG 2IBZD 3Q3DA 5K5GB 1FZBA 4PD4D 3BRVB 1KC8Q 3H1IJ 4NPFX 2WPSA 1H0TA 1VQKP 1ZXGA 1FU1A 4BWNA 2A45H 1KFNA 1LGHB 3CCUP 3I56P 1USDA 4UB6E 2QA4P 4OVNF 3M91A 3T97A 3OW2O 1LTJC 1M1JC 1H8AA 2ZT9D 5B5EH 2OQQA 2D2CB 1YTZT 2PRRA 2FYNB 4ZNCA 5KLVJ 1OWAA 2P2UA 1AV1A 2KI7B 5KJ7C 3L4FA 1EC5A 4D6TJ 3G71P 1SQBJ 1SQXG 1NU1K 1JM0A 2KSEA 3P7KA 1IFIA 2WSFJ 5APQA 3IN6A 1YTZI 2LXCB 3L73E 5CCGD 1K9MQ 2LXBA 4N6JA 4C46A 1R5LA 2LKMA 2RN0A 4L75A 4W80A 1M56D 1FE6A 1JY3O 3PJSK 5CHXA 1SFCC 1IZNB 2QEXP 2OYHC 5GTIH 3AE5C 3L72D 3CMAP 2HFED 4CPGA 1FZAA 2PFXA 2IFMA 2I1KA 1HH0A 1VPCA 2YXRB 3B5NA 4WB4A 5AVXB 2CPSA 2WSSH 4ZMDA 1FZGA 1JO5A 1MV8A 3BASA 2XU6A 1K05A 3CCEP 3L71D 3L71J 4JF7A 3CC2P 2BEZF 1RH5B 1KTMA 1LTSC 1FJPA 3PRJA 1OVRA 3VP8A 3CCVP 3BRTB 3Q1MA 1K8AQ 2ZXEB 1Q81Q 3L75J 1RE4C 1QVGO 4BRYA 2QJKC 3LW5H 2K1AA 2KNCA 1BGYJ 3H32B 1W2EA 1P84E 1SP4A 1URQD 1YBKA 3CLQA 3HE4A 1OW6A 1W5CE 3IR9A 4WY4D 4EDFA 2WPVB 1E5WA 5KTBA 3KPEA 1CI6A 1ZRTD 5CBNA 1YYCA 1BE3D 3L70J 1NWQA 4A7PA 2FYUJ 3V5BA 3AE7C 1T3JA 3AEDC 1L4AB 4IL6H 3AEGC 2J5UA 5KKZC 3M0DA 5APVA 3L70E 4EIJA 1PPJE 4IFMA 4AYCA 2QJPC 1NTMD 3MD0A 1JMBA 3B5NB 4KT0J 2IYOA 4TLFA 4HYTB 3VTPC 4C7RA 3N4XA 1LTIC 3AEFC 3H6PA 1S1CX 2JJLA 2W6BA 4WWIA 3G4SP 1VQ6P 1GL2A 5AW4B 3AEAC 3JC22 1SQVE 3E1IA 3MUDC 4RKUJ 3F5HA 1S9KD 1ZR2A 1JCCA 1MFZA 1NVOA 1RF0A 2SPZA 1NTKK 2KNCB 3H32A 1U57A 3H1ID 2KS1B 3OJAB 3HE4B 2PAJA 2QG4A 5AW7B 1LTTC 1GK4A 3AE8C 1CI6B 1NU1E 3TF5A 1J1EB 2GUSA 2AEJA 3IFMA 1OIPA 5B66H 1JTHA 1ZMEC 4JPZB 5GTIE 4IFFA 3B4SA 2IDBA 3H1IG 5AW2B 1L2PA 2O1KA 1YJWP 2IYPA 3FX0A 3TDKA 1Y8AA 1W2BO 4M3LA 1NJIQ 2ZYAA 1KQGB 1ZP0C 4C7NB 1EDLA 5BU5A 1WT6A 4W7ZA 1PIXA 2NPSD 3H1KD 1KMIZ 2WSFH 5AVRB 1JY3P 2FBWC 2OTLP 1N73C 2O1JA 3VMYA 1WMKA 5AW0B 4ASVA 2Y0CA 1GDTA 2W6JH 1QGKB 1S4XA 1GK6A 1KYOH 3HTKA 5B66E 1NTME 2P1JA 3CWBE 3HD7D 4JQ0D 3RL0g 1VQLP 1AFOA 2OYOA 1J2JB 3H1HG 5CJ0A 3W68A 5BU8B 1NTZK 1S5LE 3O6QA 4NPDA 1FJKA 1KB9E 4TT3H 5CBOA 1SVFA
chains in the Genus database with same CATH topology
1KQLA 1N86A 4I6MC 1NKZB 3RK2B 5CCHD 3V4QA 1FZCC 4GT1A 5AVZB 3N7NA 1L0LK 1HTLC 1JY2P 1N7SC 3KQGA 1MUUA 3RK2D 1QL2A 3GHGC 1T2KC 1IO4A 5AVWB 2XV5A 1JOCA 5APXA 4Y99C 3WMM0 3C9IA 3NXSA 2QM8A 1RE3A 3V2QA 4O9BA 5AVSB 2Z4EA 1KILD 1G2CA 1GL2D 2C9LY 3RK2C 1FZCB 2FXMA 1HVVA 2FKWB 2KOGA 2O01H 4B86A 2XZRA 2M8RA 1LWUA 4HH2A 1NAFA 1IFDA 2KLVA 2WZ7A 3V2NA 1URQC 4WY4C 4W7YA 1KZUB 2HLOA 1LTJB 5APSA 5AW1B 4ZKPA 3BVHA 3M9HA 5AVUB 1QL1A 3V4WA 3HUSA 1NKNA 1DX7A 1G2CB 1HWTC 2R5DA 2GUVA 1FBMA 5CCHC 3KDPB 4DOJA 3O8ZA 3M0AA 3U59A 4RESB 3NMDA 4WBAA 3RL0D 1FAVA 1S9KE 2H7HA 1LWUB 2HG5D 2FYUK 2YO2A 5CMZA 5CCGA 1LTJA 1M1JA 3V2RA 3RL0C 1N7LA 1FDMA 2H43A 1IJDB 1J1DB 1GW3A 3HUSB 5KJ7A 1NO4A 1L4AA 5APTA 3VOPA 2PP6A 2N9BA 1PFIA 1IFMA 2OYHA 2E43A 2NPSA 3B5NC 1GL2B 4OH8B 3HD7A 3L37A 3RK3B 1G1JA 2GM4A 3BATA 2WTYA 1J1EC 1M1JB 2IPPA 1RE4A 1JY2O 5CJ4A 1LT9C 1CSBA 2N1TC 1JTHB 1A02F 2YKOA 2WITA 3MTUE 1KILB 2POHA 1N73B 4JYBA 4N3YB 3VMXA 3P8MC 2Z5HA 2HYNA 2XDJA 2XKMA 2OYHB 2YKQA 1X8YA 1SQVK 1IC2A 5APWA 1SQQK 3U1CA 3HTKB 2I1JA 1SFCD 2N1TD 1GU5A 4LLHA 4I1LA 1RF1A 1FZFA 2KB7P 2C9NY 2OYIC 1HGZA 1SLQA 2HPCA 1XTGB 3L36A 1VDFA 2YMYA 2WT7B 3G3ZA 1KILA 1JNMA 1RY3A 2M3BA 2FFDA 4I2LC 1L4AD 2P67A 5AW5B 1N7SB 3LIEA 1JY3N 2CPBA 1OXZA 3VN0A 2KSJA 2WSEH 5APYA 5BVZA 1RF1B 1HUCA 4AUWA 3A3YB 2KP8A 1SFCB 4GKGA 5APUA 1DH3A 2HPCB 3M9QA 2WWWA 3NTNA 2R5BA 1IFNA 2Q3IA 1IK9A 2FFDB 1FZCA 2C0WA 4GIFA 1ZV8A 2W27A 1KFMA 3CL3D 1Z56A 2OARA 1N7SA 2W6AA 1EQ7A 3EQ2A 1T8ZA 1JUNA 1HGVA 3A5TA 1JMMA 2MJZA 2XNXA 3NFQA 1GD2E 1SFCA 1NHLA 2HODB 1T3UA 1RE3C 4LGDE 3MGNA 1MZ9A 1H89A 3P32A 1G1IA 3TYYA 5AVQB 1N7SD 2KYVA 2VRSA 3VP9A 3M06A 1SQPK 2Q5UA 2QM7A 2P7JA 1CZQA 1LTGC 3V2PA 3SWFA 1LTBC 4ZKUA 5AVTB 3M0DC 4Y99B 4N78E 4AQRD 1T2KD 2IFNA 2FYZA 3HUSC 1LTAC 3OAKA 1GL2C 4N78D 1A02J 2A45I 2ZFCA 2H8PD 2NPSB 3TNUB 3MUDA 3RK3C 4XA4A 1RF0C 2E42A 4XE5B 1NOHA 1FZEA 1NH4A 3HD7B 2L5GB 1AQ5A 3SWYA 3OA7A 1XTCC 3MIWA 3P8CD 1GZLA 5CCGC 1HBWA 1SQBK 3KYQA 5AVYB 1GTWA 1FOSF 1LT9B 2YO3A 1H88A 4KHXA 1GW4A 2R32A 1GU4A 2WPRA 3RK3D 1N73A 1L4AC 1N2DC 1HJBA 3A7OA 3B5ND 5AW3B 3TNUA 5AW6B 3R2PA 2IX7C 3M9BA 1NTMK 2NPSC 2A45G 1IFJA 2J58A 3HD7C 1JCDA 1SQXK 2JEEA 2WPQA 2Q9IA 1LT9A 2YNYA 2N1TA 2WT7A 2WSCH 1ZR4A 2Q7CA 2J59M 4C7NA 3L35A 3VMZA 1ZN5A 3GHGA 1WRGA 3CI9A 1URQB 4WY4B 3HE5A 3LIDA 1X9VA 3EFGA 1L0NK 3I5CA 5AW8B 3PP5A 3TK1A 1ZLLA 3A2AA 5AW9B 4DZOA 2BASA 4LC1A 1RF1C 2N1TB 3B8EB 2OYIA 2YKPA 2R3CA 4EOTA 3U1AA 3GHGB 1LWUC 1KILC 3UIAA 3II6A 1URQA 4WY4A 5AVVB 3TSIA 4JYCA 2FFDC 3HE5B 3RL0B 2Z5IA 1J1DC 5KJ7D 1FOSE 1JY2N 1DEBA 3VYIA 3P8CE 1X79B 2C0XA 4IFDK 5CCHA 1CW5A 1M7LA 3HRNA 2HODA 2OYIB 1FZBA 3BRVB 2WPSA 1FU1A 2A45H 1KFNA 1LGHB 3M91A 3T97A 1LTJC 1M1JC 1H8AA 1YTZT 1OWAA 2P2UA 5KJ7C 3L4FA 5AVXB 1NU1K 3P7KA 1IFIA 5APQA 1YTZI 5CCGD 4N6JA 4C46A 2LKMA 4W80A 1JY3O 5CHXA 1SFCC 2OYHC 2HFED 1FZAA 3B5NA 2IFMA 2I1KA 1HH0A 1VPCA 1JO5A 2CPSA 1FZGA 1MV8A 3BASA 2XU6A 4JF7A 1LTSC 1FJPA 3VP8A 3BRTB 2ZXEB 1RE4C 4WB4A 3LW5H 3H32B 5KLVK 1SP4A 1W2EA 1URQD 3CLQA 3HE4A 3IR9A 4WY4D 5KTBA 1E5WA 3KPEA 1CI6A 1YYCA 1NWQA 3V5BA 1T3JA 1L4AB 3M0DA 5APVA 4EIJA 4IFMA 4AYCA 3MD0A 3B5NB 4HYTB 3VTPC 4C7RA 3N4XA 1LTIC 3H6PA 2JJLA 2W6BA 1GL2A 5AW4B 3E1IA 1ZR2A 1S9KD 1JCCA 1MFZA 1RF0A 1NTKK 3H32A 3OJAB 3HE4B 2PAJA 5AW7B 1LTTC 1GK4A 1CI6B 1J1EB 2GUSA 3IFMA 1JTHA 4IFFA 5AW2B 2O1KA 4M3LA 4C7NB 5BU5A 1WT6A 4W7ZA 2NPSD 2WSFH 5AVRB 1JY3P 1N73C 2O1JA 3VMYA 5AW0B 1GDTA 1GK6A 3HTKA 2P1JA 3HD7D 1AFOA 1J2JB 5CJ0A 5BU8B 1NTZK 1FJKA 1SVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2Q A;  1MZ9 A;  3V2R A;  3V2N A;  1DEB A;  1VDF A;  1FBM A;  3V2P A; 
#chains in the Genus database with same CATH topology
 1KQL A;  1N86 A;  1ZW0 A;  2JR8 A;  2A06 G;  3H1H J;  3AEB C;  4H44 C;  4I6M C;  1HF9 A;  1NKZ B;  3L74 E;  2ITA A;  3RK2 B;  2M3E A;  5CCH D;  4OGQ C;  3D6Z A;  1VQ7 P;  3V4Q A;  1FZC C;  1BGY E;  4GT1 A;  5AVZ B;  4PD4 I;  1OW7 A;  3N7N A;  3JCU H;  1NAY A;  1BCC J;  3MP7 B;  1L0L K;  1S2E A;  2A06 D;  1HTL C;  1JY2 P;  1N7S C;  3FXD A;  1MUU A;  1PPJ D;  3KQG A;  2QVA A;  4YPC A;  3H25 A;  3Q5S A;  3RK2 D;  1SQB G;  2ZVN B;  1QL2 A;  1KV4 A;  3GHG C;  2YXQ B;  3CPW O;  1T2K C;  2QJY C;  1IK7 A;  3BCC E;  1IO4 A;  1FS0 E;  2G8Y A;  1PGP A;  2H89 C;  2JWD A;  5AVW B;  2XV5 A;  1NTK E;  2RKL A;  1M57 D;  1JOC A;  5APX A;  3R4Y A;  3O6Q B;  1EDI A;  1NTZ J;  1PP9 G;  4IL6 X;  4Y99 C;  3RBZ A;  3C9I A;  3WMM 0;  3NXS A;  2B89 A;  5C39 A;  1YJ9 P;  2NZ2 A;  2QM8 A;  1RE3 A;  3V2Q A;  1VF5 C;  4O9B A;  5AVS B;  1LP1 B;  2HR3 A;  3A0B H;  3E7K A;  2Z4E A;  1KIL D;  1G2C A;  1GL2 D;  1SQV G;  2ZXX A;  2C9L Y;  3EWK A;  1Q2N A;  2R44 A;  3RK2 C;  1DEE G;  2A06 E;  2E5Y A;  1KB9 D;  2OTK E;  1KQS O;  1L0L J;  1YIT P;  1FZC B;  2FXM A;  1HVV A;  5KLV K;  2FKW B;  2KOG A;  2O01 H;  4B86 A;  2XZR A;  1NTZ D;  1ZOY C;  2JDI H;  2M8R A;  1FDO A;  1LWU A;  1TU3 F;  3T97 B;  1PP9 D;  4HH2 A;  3L73 D;  3CCJ P;  1NAF A;  1IFD A;  2KLV A;  3L72 J;  2WZ7 A;  3V2N A;  1URQ C;  4WY4 C;  3AE3 C;  4W7Y A;  1KZU B;  2HLO A;  2QRX A;  1LTJ B;  2FYU G;  5APS A;  2QJY B;  5AW1 B;  4ZKP A;  5KLI C;  1U7M A;  3BVH A;  3M9H A;  1OVV A;  5AVU B;  1RHZ B;  1SQB D;  2JO1 A;  1QL1 A;  2E75 C;  1AA0 A;  2L91 A;  2FXO A;  3H1J G;  1NKN A;  3HUS A;  3V4W A;  2YIU C;  4GOE A;  1DX7 A;  1G2C B;  1KOR A;  2R3S A;  2R5D A;  2GUV A;  1FBM A;  4PJ0 E;  5CCH C;  3KDP B;  4DOJ A;  3Q5P A;  4QMA A;  1USE A;  1VQM P;  3L71 G;  3M0A A;  3O8Z A;  3U59 A;  4RES B;  3A0H E;  3NMD A;  2ZT9 C;  4H13 D;  3E1R A;  4WBA A;  3RL0 D;  2Y9Z A;  2KZJ A;  3EFF K;  1HJ0 A;  1FAV A;  1X22 A;  1ZRT E;  1S9K E;  3S1K A;  2H7H A;  1LWU B;  2HG5 D;  1NU1 G;  2E74 C;  1OMI A;  2RH0 A;  4KJM A;  1KB9 H;  2FYU K;  1UII A;  1YIJ P;  2WMM A;  2YO2 A;  4DCK A;  5CMZ A;  5TJH A;  2Y0E A;  4BRY B;  5CCG A;  1LTJ A;  1M1J A;  3V2R A;  1L0L E;  1OVU A;  1E79 H;  1VQP P;  1FDI A;  1N7L A;  2W90 A;  3RL0 C;  1L0N J;  1KYO E;  2I8D A;  4D6T G;  2M0B A;  5M1B A;  1FDM A;  2H43 A;  5KLI B;  1IJD B;  1J1D B;  1EZV I;  1GW3 A;  2Y9Y A;  1NO4 A;  1OZH A;  3CX5 H;  3H1L D;  3HUS B;  5KJ7 A;  1BCC G;  1L4A A;  5APT A;  4DT0 A;  1OX3 A;  2W83 C;  3BCC G;  2E76 B;  4RJT A;  3VOP A;  1Q90 D;  2PP6 A;  1NTZ E;  3D71 A;  1QX8 A;  2N9B A;  4H13 C;  5GTH E;  1PFI A;  1VQN P;  1IFM A;  2OYH A;  2E43 A;  1JEK A;  2NPS A;  2O01 N;  3Q5R A;  3B5N C;  1GL2 B;  1R5S A;  4RO0 A;  2K9Y A;  4OH8 B;  3HD7 A;  2RMZ A;  3L37 A;  1OFC X;  3RK3 B;  1G1J A;  1KIL E;  3L74 G;  2GM4 A;  3BAT A;  1SS1 A;  2WTY A;  3CCQ P;  1J1E C;  1M1J B;  1OW8 A;  2KS1 A;  2LR2 A;  1P84 I;  3CXH I;  2K37 A;  4UB6 H;  2IPP A;  2K3R A;  1BGY D;  3TGU J;  1NGM B;  1RE4 A;  1JY2 O;  5CJ4 A;  1LT9 C;  1CSB A;  2E5T A;  2N1T C;  5DJT B;  2QE7 H;  3FWL A;  1JTH B;  4R4M A;  2AEM A;  2KZI A;  2ZVO B;  3ZDM A;  1A02 F;  2YKO A;  4L76 A;  5EFW B;  3RK3 E;  2WIT A;  3MTU E;  1KIL B;  2POH A;  3QWO C;  5GTH H;  3H1K J;  1N73 B;  4JYB A;  1QVF O;  3AE1 C;  3IF4 A;  4N3Y B;  1KYO D;  3KXD A;  3L72 E;  5KAF E;  1SQQ J;  3VMX A;  3WUU A;  3P8M C;  4PV1 D;  2Z5H A;  2HYN A;  2XDJ A;  2XKM A;  4IL6 E;  2YKQ A;  2OYH B;  2Q1K A;  2H88 C;  1X8Y A;  2BEQ D;  1SQV K;  1IC2 A;  3PLN A;  3RBX A;  1PP9 J;  2V4H A;  1EZV E;  3JCU E;  5APW A;  1KN7 A;  1SQQ K;  3U1C A;  3HTK B;  1SQQ E;  2I1J A;  3CX5 D;  1SFC D;  3CCS P;  2N1T D;  1GU5 A;  4LLH A;  2UWJ E;  4I1L A;  1UIX A;  1RF1 A;  4PV1 C;  2B87 B;  1L0N G;  4MN4 C;  4U7J A;  1FZF A;  2KB7 P;  1FC2 C;  2C9N Y;  2OYI C;  1HGZ A;  1L0L D;  2WVR A;  1SLQ A;  1LT1 A;  4XFJ A;  1QEX A;  1S5L H;  2HPC A;  1XTG B;  3L36 A;  1BSH A;  2K9J B;  2ZYD A;  1VDF A;  2YMY A;  2WT7 B;  3G3Z A;  3TGU E;  2IZ0 A;  1KIL A;  1NU1 J;  1RY3 A;  2PGD A;  1JNM A;  1M90 Q;  2M3B A;  3AE4 C;  2FFD A;  3GLM A;  4I2L C;  1EDK A;  3CCM P;  1L4A D;  4PJ0 H;  3SFE C;  2P67 A;  1Q86 Q;  5AW5 B;  1N7S B;  2XND H;  2NRG A;  3H1K G;  3KHU A;  3LIE A;  1JY3 N;  2CPB A;  1OXZ A;  3VN0 A;  1VQ8 P;  1BE3 E;  1EZV D;  2KSJ A;  2WSE H;  3H1J E;  3L75 D;  3QH9 A;  4H44 D;  4YXW H;  1DD3 A;  3IAO A;  1BSN A;  5APY A;  1NTK D;  1NU1 D;  4HKZ H;  1KQF B;  2B9B A;  3SWK A;  5BVZ A;  3W67 A;  1RF1 B;  1HUC A;  2KXP B;  4AUW A;  3FWN A;  1L0N D;  3A3Y B;  2KP8 A;  4K3A A;  1BDC A;  1SFC B;  1LP1 A;  2KUB A;  4GKG A;  4H0L B;  3M9Q A;  5APU A;  2AXT E;  2HPC B;  1DH3 A;  1M1K Q;  2JWA A;  2WWW A;  1EXI A;  2OTJ P;  3NTN A;  2R5B A;  1IFN A;  2Q3I A;  1IK9 A;  1NYH A;  3CX5 I;  2FFD B;  2V7Q J;  1P84 D;  2C0W A;  4GIF A;  1FZC A;  1ZV8 A;  2W27 A;  1KFM A;  1L0L G;  1NTK J;  2M5A B;  3CL3 D;  1Z56 A;  2OAR A;  3D6Y A;  3CXH H;  4U3F D;  3Q2Y A;  1N7S A;  2QJK B;  2W6A A;  3G9R A;  3MZW B;  1AJY A;  1VQO P;  1EQ7 A;  3BCC J;  5KLV D;  1N73 A;  2E74 D;  4EI2 A;  1KYO I;  1VF5 D;  3EQ2 A;  5KLV G;  1T8Z A;  3WU2 H;  1Q7Y Q;  3CD6 P;  1HGV A;  1JUN A;  1PGJ A;  2DW3 A;  3G6E P;  3A5T A;  2FY8 A;  3PH0 A;  4OWF A;  1JMM A;  2MJZ A;  2XNX A;  1NTK G;  1NTZ G;  3F89 A;  3CME P;  3NFQ A;  4UB8 E;  5TIS E;  1GD2 E;  1SFC A;  2GA1 A;  1SQQ G;  1NHL A;  1P84 H;  2O01 J;  1PGO A;  1K04 A;  1EZV G;  1T3U A;  1RQU A;  2HOD B;  4I7Z C;  1RE3 C;  4IOI H;  3BCC D;  4LGD E;  2E75 B;  5KAI H;  1VQ9 P;  3MGN A;  1MZ9 A;  3CXH D;  4ASW A;  3P32 A;  1H89 A;  1G1I A;  4NPE A;  2KK7 A;  3TYY A;  5AVQ B;  1N7S D;  2KYV A;  4PD4 E;  2VRS A;  3LW5 J;  2E74 B;  3WUV A;  1VQ5 P;  1H0T B;  1AVO A;  4BXL A;  4U3F E;  1DD4 A;  2D2C C;  2ZT9 B;  3CWB D;  3CWB J;  3TGU G;  2QIW A;  3M06 A;  3VP9 A;  1SQP K;  2E76 D;  1M8O B;  2Q5U A;  2QM7 A;  2P7J A;  4OGQ D;  1CZQ A;  1LTG C;  2G3A A;  2P58 A;  3V2P A;  4R4L A;  1VL2 A;  2ZYG A;  3SWF A;  1LTB C;  3L74 D;  2W8Z A;  4ZKU A;  1S5L X;  3S4R A;  3ABV C;  1U7J A;  3H1I E;  5AVT B;  5E79 H;  3D70 A;  3H1K E;  3H1L E;  2FXP A;  3M0D C;  2D2C D;  4D6T D;  2ZJS E;  5KAF H;  3GF7 A;  1PPJ G;  4N78 E;  4Y99 B;  2OGU A;  4AQR D;  1EDJ A;  2BCC E;  1T2K D;  1S3J A;  3L72 G;  2IFN A;  2FYZ A;  3HUS C;  3C8V A;  1LTA C;  3CWB G;  3TGU D;  3I55 P;  3OAK A;  2QSI A;  2AEF A;  1GL2 C;  4I7Z B;  2E76 C;  3FGA D;  2K88 A;  2A45 I;  3KZI H;  4N78 D;  2ZFC A;  2H8P D;  2NPS B;  3TNU B;  3MUD A;  3RK3 C;  4XA4 A;  1RF0 C;  4GDO A;  4XE5 B;  2E42 A;  1NOH A;  1FZE A;  1NH4 A;  2IBZ E;  1S72 P;  1SQP J;  3HD7 B;  4JBZ A;  1SQV J;  2L5G B;  5H2F H;  3RGU A;  1AQ5 A;  3ITK A;  2O3J A;  3A0B E;  3SWY A;  3OA7 A;  1YHQ P;  1T6A A;  1XTC C;  3FXE A;  3MIW A;  3P8C D;  1GZL A;  1RQV A;  4DJG A;  4OGQ B;  1A02 J;  5CCG C;  5KKZ B;  4Y28 J;  5H2F E;  1HBW A;  1SQB E;  1SQB K;  2IBZ I;  2QJP B;  5DJU B;  4D6T E;  3KYQ A;  5AVY B;  1GTW A;  3H1L J;  1LT9 B;  1FOS F;  2YO3 A;  4EYY Q;  1H88 A;  1SQV D;  4KHX A;  1GW4 A;  1SQP G;  2R32 A;  3CCR P;  1SQP D;  2FYU E;  2WPR A;  3RK3 D;  1GU4 A;  3SSU A;  1SQQ D;  1Y47 A;  3C1L A;  1L4A C;  1SQX E;  3CX5 E;  1Q82 Q;  3K5B A;  1NTM J;  1N2D C;  2BCC G;  2N9Y B;  1HJB A;  1PP9 E;  3A7O A;  3B5N D;  5AW3 B;  3TNU A;  5AW6 B;  3CCL P;  1N8R Q;  3AEC C;  4Z1M H;  3R2P A;  1Y9B A;  2IX7 C;  3M9B A;  2MKV A;  2P10 A;  1BE3 J;  3L70 D;  2KIK A;  1NTM K;  1MFT A;  2NPS C;  3PHL A;  4U3F J;  5L8R J;  4PV1 B;  3L71 E;  5E79 E;  1KB9 I;  2A45 G;  1IFJ A;  2J58 A;  3GMA A;  3HD7 C;  1K73 Q;  4U3F G;  1VF5 B;  3CXH E;  1JCD A;  1SQX K;  1DIP A;  1LJ2 A;  2B87 A;  3MHV A;  2JEE A;  4WVZ A;  4YTP C;  3VMA A;  3JSV C;  1BGY G;  2WPQ A;  3AE6 C;  1BDD A;  2Q9I A;  2K9J A;  3L75 G;  1LT9 A;  2YNY A;  2N1T A;  2WT7 A;  2WSC H;  1ZR4 A;  2JP3 A;  2Q7C A;  2J59 M;  2AXT H;  2JKV A;  2Q6Q A;  3AE9 C;  4C7N A;  3V6I A;  3H1L G;  3L35 A;  3VMZ A;  1ZN5 A;  3GHG A;  1WRG A;  3CI9 A;  2KLU A;  2B88 A;  1YJN P;  1AQT A;  2E75 D;  1URQ B;  4WY4 B;  4H13 B;  3HE5 A;  3LID A;  1PZQ A;  1X9V A;  3EFG A;  3USS A;  4L74 A;  1L0N K;  3SFD C;  3I5C A;  1EXJ A;  1X0T A;  2AXC A;  3PP5 A;  3PTZ A;  5AW8 B;  3TK1 A;  3WUT A;  3H1J D;  1BCC D;  1PGQ A;  2CK3 H;  3CC4 P;  5B5E E;  1ZLL A;  3A2A A;  4H44 B;  5AW9 B;  1SQX J;  4H0L C;  4DZO A;  2BAS A;  2YIU B;  3WU2 E;  3GW6 A;  4YXD C;  3GG2 A;  4LC1 A;  2YMK A;  1R8E A;  1RF1 C;  1L0N E;  3GF3 A;  3H1H D;  3CC7 P;  4K35 A;  1MKM A;  2N1T B;  3B8E B;  2OYI A;  4PD4 H;  1LNQ A;  2YKP A;  3KZI E;  4GOF A;  2R3C A;  4EOT A;  3U1A A;  3S9O A;  1HWT C;  5KAI E;  3GHG B;  1LWU C;  3L75 E;  3H1J J;  1KIL C;  3UIA A;  3II6 A;  5KLV E;  2WQY C;  2ZAE B;  1SQX D;  2M5A A;  3A0H H;  1URQ A;  2BCC D;  4WY4 A;  2FYN C;  4JYC A;  5AVV B;  1SQP E;  1YQ4 C;  2FYU D;  3HE5 B;  3TSI A;  2FFD C;  1VQ4 P;  1GMJ A;  1JB0 J;  4HB1 A;  4H0L D;  1AVY A;  1PV3 A;  1IFP A;  2Y0D A;  3B71 A;  4UB8 H;  3RL0 B;  5TIS H;  3L73 G;  2Z5I A;  2WSC J;  1BE3 G;  3L70 G;  1YI2 P;  1J1D C;  1BCC E;  2Q3E A;  5KJ7 D;  1FOS E;  1JY2 N;  4HJG H;  1DEB A;  3VYI A;  3P8C E;  1X79 B;  2C0X A;  1D7M A;  1QLE D;  1YQ3 C;  3AEE C;  2V7Q H;  5CCH A;  1PL5 A;  1KD1 Q;  4IFD K;  3AE2 C;  1CW5 A;  2WSE J;  1NTM G;  2BCC J;  3L73 J;  1M7L A;  3HRN A;  3L74 J;  2HOD A;  2IZ1 A;  2OYI B;  3H1H E;  4GOD A;  4L73 A;  2IBZ G;  2IBZ D;  3Q3D A;  5K5G B;  1FZB A;  4PD4 D;  3BRV B;  1KC8 Q;  3H1I J;  4NPF X;  2WPS A;  1H0T A;  1VQK P;  1ZXG A;  1FU1 A;  4BWN A;  2A45 H;  1KFN A;  1LGH B;  3CCU P;  3I56 P;  1USD A;  4UB6 E;  2QA4 P;  4OVN F;  3M91 A;  3T97 A;  3OW2 O;  1LTJ C;  1M1J C;  1H8A A;  2ZT9 D;  5B5E H;  2OQQ A;  2D2C B;  1YTZ T;  2PRR A;  2FYN B;  4ZNC A;  5KLV J;  1OWA A;  2P2U A;  1AV1 A;  2KI7 B;  5KJ7 C;  3L4F A;  1EC5 A;  4D6T J;  3G71 P;  1SQB J;  1SQX G;  1NU1 K;  1JM0 A;  2KSE A;  3P7K A;  1IFI A;  2WSF J;  5APQ A;  3IN6 A;  1YTZ I;  2LXC B;  3L73 E;  5CCG D;  1K9M Q;  2LXB A;  4N6J A;  4C46 A;  1R5L A;  2LKM A;  2RN0 A;  4L75 A;  4W80 A;  1M56 D;  1FE6 A;  1JY3 O;  3PJS K;  5CHX A;  1SFC C;  1IZN B;  2QEX P;  2OYH C;  5GTI H;  3AE5 C;  3L72 D;  3CMA P;  2HFE D;  4CPG A;  1FZA A;  2PFX A;  2IFM A;  2I1K A;  1HH0 A;  1VPC A;  2YXR B;  3B5N A;  4WB4 A;  5AVX B;  2CPS A;  2WSS H;  4ZMD A;  1FZG A;  1JO5 A;  1MV8 A;  3BAS A;  2XU6 A;  1K05 A;  3CCE P;  3L71 D;  3L71 J;  4JF7 A;  3CC2 P;  2BEZ F;  1RH5 B;  1KTM A;  1LTS C;  1FJP A;  3PRJ A;  1OVR A;  3VP8 A;  3CCV P;  3BRT B;  3Q1M A;  1K8A Q;  2ZXE B;  1Q81 Q;  3L75 J;  1RE4 C;  1QVG O;  4BRY A;  2QJK C;  3LW5 H;  2K1A A;  2KNC A;  1BGY J;  3H32 B;  1W2E A;  1P84 E;  1SP4 A;  1URQ D;  1YBK A;  3CLQ A;  3HE4 A;  1OW6 A;  1W5C E;  3IR9 A;  4WY4 D;  4EDF A;  2WPV B;  1E5W A;  5KTB A;  3KPE A;  1CI6 A;  1ZRT D;  5CBN A;  1YYC A;  1BE3 D;  3L70 J;  1NWQ A;  4A7P A;  2FYU J;  3V5B A;  3AE7 C;  1T3J A;  3AED C;  1L4A B;  4IL6 H;  3AEG C;  2J5U A;  5KKZ C;  3M0D A;  5APV A;  3L70 E;  4EIJ A;  1PPJ E;  4IFM A;  4AYC A;  2QJP C;  1NTM D;  3MD0 A;  1JMB A;  3B5N B;  4KT0 J;  2IYO A;  4TLF A;  4HYT B;  3VTP C;  4C7R A;  3N4X A;  1LTI C;  3AEF C;  3H6P A;  1S1C X;  2JJL A;  2W6B A;  4WWI A;  3G4S P;  1VQ6 P;  1GL2 A;  5AW4 B;  3AEA C;  3JC2 2;  1SQV E;  3E1I A;  3MUD C;  4RKU J;  3F5H A;  1S9K D;  1ZR2 A;  1JCC A;  1MFZ A;  1NVO A;  1RF0 A;  2SPZ A;  1NTK K;  2KNC B;  3H32 A;  1U57 A;  3H1I D;  2KS1 B;  3OJA B;  3HE4 B;  2PAJ A;  2QG4 A;  5AW7 B;  1LTT C;  1GK4 A;  3AE8 C;  1CI6 B;  1NU1 E;  3TF5 A;  1J1E B;  2GUS A;  2AEJ A;  3IFM A;  1OIP A;  5B66 H;  1JTH A;  1ZME C;  4JPZ B;  5GTI E;  4IFF A;  3B4S A;  2IDB A;  3H1I G;  5AW2 B;  1L2P A;  2O1K A;  1YJW P;  2IYP A;  3FX0 A;  3TDK A;  1Y8A A;  1W2B O;  4M3L A;  1NJI Q;  2ZYA A;  1KQG B;  1ZP0 C;  4C7N B;  1EDL A;  5BU5 A;  1WT6 A;  4W7Z A;  1PIX A;  2NPS D;  3H1K D;  1KMI Z;  2WSF H;  5AVR B;  1JY3 P;  2FBW C;  2OTL P;  1N73 C;  2O1J A;  3VMY A;  1WMK A;  5AW0 B;  4ASV A;  2Y0C A;  1GDT A;  2W6J H;  1QGK B;  1S4X A;  1GK6 A;  1KYO H;  3HTK A;  5B66 E;  1NTM E;  2P1J A;  3CWB E;  3HD7 D;  4JQ0 D;  3RL0 g;  1VQL P;  1AFO A;  2OYO A;  1J2J B;  3H1H G;  5CJ0 A;  3W68 A;  5BU8 B;  1NTZ K;  1S5L E;  3O6Q A;  4NPD A;  1FJK A;  1KB9 E;  4TT3 H;  5CBO A;  1SVF A; 
#chains in the Genus database with same CATH homology
 1KQL A;  1N86 A;  4I6M C;  1NKZ B;  3RK2 B;  5CCH D;  3V4Q A;  1FZC C;  4GT1 A;  5AVZ B;  3N7N A;  1L0L K;  1HTL C;  1JY2 P;  1N7S C;  3KQG A;  1MUU A;  3RK2 D;  1QL2 A;  3GHG C;  1T2K C;  1IO4 A;  5AVW B;  2XV5 A;  1JOC A;  5APX A;  4Y99 C;  3WMM 0;  3C9I A;  3NXS A;  2QM8 A;  1RE3 A;  3V2Q A;  4O9B A;  5AVS B;  2Z4E A;  1KIL D;  1G2C A;  1GL2 D;  2C9L Y;  3RK2 C;  1FZC B;  2FXM A;  1HVV A;  2FKW B;  2KOG A;  2O01 H;  4B86 A;  2XZR A;  2M8R A;  1LWU A;  4HH2 A;  1NAF A;  1IFD A;  2KLV A;  2WZ7 A;  3V2N A;  1URQ C;  4WY4 C;  4W7Y A;  1KZU B;  2HLO A;  1LTJ B;  5APS A;  5AW1 B;  4ZKP A;  3BVH A;  3M9H A;  5AVU B;  1QL1 A;  3V4W A;  3HUS A;  1NKN A;  1DX7 A;  1G2C B;  1HWT C;  2R5D A;  2GUV A;  1FBM A;  5CCH C;  3KDP B;  4DOJ A;  3O8Z A;  3M0A A;  3U59 A;  4RES B;  3NMD A;  4WBA A;  3RL0 D;  1FAV A;  1S9K E;  2H7H A;  1LWU B;  2HG5 D;  2FYU K;  2YO2 A;  5CMZ A;  5CCG A;  1LTJ A;  1M1J A;  3V2R A;  3RL0 C;  1N7L A;  1FDM A;  2H43 A;  1IJD B;  1J1D B;  1GW3 A;  3HUS B;  5KJ7 A;  1NO4 A;  1L4A A;  5APT A;  3VOP A;  2PP6 A;  2N9B A;  1PFI A;  1IFM A;  2OYH A;  2E43 A;  2NPS A;  3B5N C;  1GL2 B;  4OH8 B;  3HD7 A;  3L37 A;  3RK3 B;  1G1J A;  2GM4 A;  3BAT A;  2WTY A;  1J1E C;  1M1J B;  2IPP A;  1RE4 A;  1JY2 O;  5CJ4 A;  1LT9 C;  1CSB A;  2N1T C;  1JTH B;  1A02 F;  2YKO A;  2WIT A;  3MTU E;  1KIL B;  2POH A;  1N73 B;  4JYB A;  4N3Y B;  3VMX A;  3P8M C;  2Z5H A;  2HYN A;  2XDJ A;  2XKM A;  2OYH B;  2YKQ A;  1X8Y A;  1SQV K;  1IC2 A;  5APW A;  1SQQ K;  3U1C A;  3HTK B;  2I1J A;  1SFC D;  2N1T D;  1GU5 A;  4LLH A;  4I1L A;  1RF1 A;  1FZF A;  2KB7 P;  2C9N Y;  2OYI C;  1HGZ A;  1SLQ A;  2HPC A;  1XTG B;  3L36 A;  1VDF A;  2YMY A;  2WT7 B;  3G3Z A;  1KIL A;  1JNM A;  1RY3 A;  2M3B A;  2FFD A;  4I2L C;  1L4A D;  2P67 A;  5AW5 B;  1N7S B;  3LIE A;  1JY3 N;  2CPB A;  1OXZ A;  3VN0 A;  2KSJ A;  2WSE H;  5APY A;  5BVZ A;  1RF1 B;  1HUC A;  4AUW A;  3A3Y B;  2KP8 A;  1SFC B;  4GKG A;  5APU A;  1DH3 A;  2HPC B;  3M9Q A;  2WWW A;  3NTN A;  2R5B A;  1IFN A;  2Q3I A;  1IK9 A;  2FFD B;  1FZC A;  2C0W A;  4GIF A;  1ZV8 A;  2W27 A;  1KFM A;  3CL3 D;  1Z56 A;  2OAR A;  1N7S A;  2W6A A;  1EQ7 A;  3EQ2 A;  1T8Z A;  1JUN A;  1HGV A;  3A5T A;  1JMM A;  2MJZ A;  2XNX A;  3NFQ A;  1GD2 E;  1SFC A;  1NHL A;  2HOD B;  1T3U A;  1RE3 C;  4LGD E;  3MGN A;  1MZ9 A;  1H89 A;  3P32 A;  1G1I A;  3TYY A;  5AVQ B;  1N7S D;  2KYV A;  2VRS A;  3VP9 A;  3M06 A;  1SQP K;  2Q5U A;  2QM7 A;  2P7J A;  1CZQ A;  1LTG C;  3V2P A;  3SWF A;  1LTB C;  4ZKU A;  5AVT B;  3M0D C;  4Y99 B;  4N78 E;  4AQR D;  1T2K D;  2IFN A;  2FYZ A;  3HUS C;  1LTA C;  3OAK A;  1GL2 C;  4N78 D;  1A02 J;  2A45 I;  2ZFC A;  2H8P D;  2NPS B;  3TNU B;  3MUD A;  3RK3 C;  4XA4 A;  1RF0 C;  2E42 A;  4XE5 B;  1NOH A;  1FZE A;  1NH4 A;  3HD7 B;  2L5G B;  1AQ5 A;  3SWY A;  3OA7 A;  1XTC C;  3MIW A;  3P8C D;  1GZL A;  5CCG C;  1HBW A;  1SQB K;  3KYQ A;  5AVY B;  1GTW A;  1FOS F;  1LT9 B;  2YO3 A;  1H88 A;  4KHX A;  1GW4 A;  2R32 A;  1GU4 A;  2WPR A;  3RK3 D;  1N73 A;  1L4A C;  1N2D C;  1HJB A;  3A7O A;  3B5N D;  5AW3 B;  3TNU A;  5AW6 B;  3R2P A;  2IX7 C;  3M9B A;  1NTM K;  2NPS C;  2A45 G;  1IFJ A;  2J58 A;  3HD7 C;  1JCD A;  1SQX K;  2JEE A;  2WPQ A;  2Q9I A;  1LT9 A;  2YNY A;  2N1T A;  2WT7 A;  2WSC H;  1ZR4 A;  2Q7C A;  2J59 M;  4C7N A;  3L35 A;  3VMZ A;  1ZN5 A;  3GHG A;  1WRG A;  3CI9 A;  1URQ B;  4WY4 B;  3HE5 A;  3LID A;  1X9V A;  3EFG A;  1L0N K;  3I5C A;  5AW8 B;  3PP5 A;  3TK1 A;  1ZLL A;  3A2A A;  5AW9 B;  4DZO A;  2BAS A;  4LC1 A;  1RF1 C;  2N1T B;  3B8E B;  2OYI A;  2YKP A;  2R3C A;  4EOT A;  3U1A A;  3GHG B;  1LWU C;  1KIL C;  3UIA A;  3II6 A;  1URQ A;  4WY4 A;  5AVV B;  3TSI A;  4JYC A;  2FFD C;  3HE5 B;  3RL0 B;  2Z5I A;  1J1D C;  5KJ7 D;  1FOS E;  1JY2 N;  1DEB A;  3VYI A;  3P8C E;  1X79 B;  2C0X A;  4IFD K;  5CCH A;  1CW5 A;  1M7L A;  3HRN A;  2HOD A;  2OYI B;  1FZB A;  3BRV B;  2WPS A;  1FU1 A;  2A45 H;  1KFN A;  1LGH B;  3M91 A;  3T97 A;  1LTJ C;  1M1J C;  1H8A A;  1YTZ T;  1OWA A;  2P2U A;  5KJ7 C;  3L4F A;  5AVX B;  1NU1 K;  3P7K A;  1IFI A;  5APQ A;  1YTZ I;  5CCG D;  4N6J A;  4C46 A;  2LKM A;  4W80 A;  1JY3 O;  5CHX A;  1SFC C;  2OYH C;  2HFE D;  1FZA A;  3B5N A;  2IFM A;  2I1K A;  1HH0 A;  1VPC A;  1JO5 A;  2CPS A;  1FZG A;  1MV8 A;  3BAS A;  2XU6 A;  4JF7 A;  1LTS C;  1FJP A;  3VP8 A;  3BRT B;  2ZXE B;  1RE4 C;  4WB4 A;  3LW5 H;  3H32 B;  5KLV K;  1SP4 A;  1W2E A;  1URQ D;  3CLQ A;  3HE4 A;  3IR9 A;  4WY4 D;  5KTB A;  1E5W A;  3KPE A;  1CI6 A;  1YYC A;  1NWQ A;  3V5B A;  1T3J A;  1L4A B;  3M0D A;  5APV A;  4EIJ A;  4IFM A;  4AYC A;  3MD0 A;  3B5N B;  4HYT B;  3VTP C;  4C7R A;  3N4X A;  1LTI C;  3H6P A;  2JJL A;  2W6B A;  1GL2 A;  5AW4 B;  3E1I A;  1ZR2 A;  1S9K D;  1JCC A;  1MFZ A;  1RF0 A;  1NTK K;  3H32 A;  3OJA B;  3HE4 B;  2PAJ A;  5AW7 B;  1LTT C;  1GK4 A;  1CI6 B;  1J1E B;  2GUS A;  3IFM A;  1JTH A;  4IFF A;  5AW2 B;  2O1K A;  4M3L A;  4C7N B;  5BU5 A;  1WT6 A;  4W7Z A;  2NPS D;  2WSF H;  5AVR B;  1JY3 P;  1N73 C;  2O1J A;  3VMY A;  5AW0 B;  1GDT A;  1GK6 A;  3HTK A;  2P1J A;  3HD7 D;  1AFO A;  1J2J B;  5CJ0 A;  5BU8 B;  1NTZ K;  1FJK A;  1SVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...