1FBMA

Assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
b'MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CARTILAGE OLIGOMERIC MATRIX PROTEIN)
molecule tags Cell adhesion
source organism Rattus norvegicus
publication title All-trans retinol, vitamin D and other hydrophobic compounds bind in the axial pore of the five-stranded coiled-coil domain of cartilage oligomeric matrix protein.
pubmed doi rcsb
total genus 17
structure length 46
sequence length 46
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2000-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11598 COMP Cartilage oligomeric matrix protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fbmA00
3V2PA 3V2RA 1DEBA 3V2QA 3V2NA 1MZ9A 1VDFA 1FBMA
chains in the Genus database with same CATH superfamily
1KB9D 1KILD 3V2RA 2IFMA 1RF0C 3QWOC 1BE3E 1H88A 3H1LG 2WPSA 1VF5D 1NTZG 5AW4B 1H89A 2E5TA 3CI9A 4UB6E 4ASVA 1PGOA 2KI7B 2QA4P 1RF0A 3L73G 1G2CB 1HGVA 4PD4I 1SP4A 1BE3G 2FY8A 1EC5A 1N2DC 1AQTA 2WWWA 1URQB 1ZP0C 3PH0A 4PD4H 3AE7C 2OYOA 1NU1D 2R5DA 2XDJA 3WUUA 3RL0B 2BCCG 1LWUA 2KSEA 3N7NA 2KLVA 5AW8B 2KUBA 1N7LA 2B88A 3U1AA 2ZYAA 1G2CA 1ZW0A 1NTMJ 2JP3A 1JUNA 1HUCA 3BRTB 3TGUE 1YYCA 1AA0A 1S2EA 1NTZJ 1KB9E 2R44A 3JSVC 3M9HA 1FAVA 5AVWB 3VP9A 4B86A 2BCCD 2QJPC 3EFFK 2FYZA 2KK7A 3EWKA 3RK2C 1YIJP 3RL0D 1NAYA 2ZYDA 1L4AA 5KAIE 1BGYJ 2IBZD 1SQXK 3L36A 5CHXA 4GKGA 1JTHA 1KB9I 4YPCA 2PFXA 3AEDC 3Q3DA 1S9KE 2YNYA 1SQPD 5AW0B 1PGPA 4H0LC 5APXA 1W5CE 1JTHB 1JY3P 2VRSA 4W7ZA 1YBKA 2E75B 3PRJA 4TT3H 1G1JA 5TJHA 1JOCA 4D6TG 3L71G 1NWQA 1VQKP 3RGUA 2QRXA 4ZNCA 1UIXA 2K37A 3AEFC 1L0LE 2K1AA 4OGQD 1S5LE 1ZXGA 1BGYG 2E75D 2V7QJ 2W83C 3H32A 3L74D 3MTUE 4EIJA 2IPPA 3CCQP 1N86A 2WSEJ 4L76A 3BCCG 5GTHH 2UWJE 4WVZA 3D71A 3H1LE 4I7ZB 1PGJA 1E79H 3H1IJ 1EDLA 1FZBA 1PPJG 1AJYA 4GODA 1URQD 3IF4A 3L71E 3WUVA 4JYBA 4Y99C 1K9MQ 2Y0DA 4IFDK 1RE3A 5BU8B 1OZHA 1DIPA 3USSA 4EDFA 1JY2O 1SQXG 4L74A 2WPQA 5CCGA 2K9JA 1SFCD 4DJGA 3O6QA 1ZV8A 3W67A 1KV4A 3BRVB 1T2KD 3WU2H 1MFZA 2Q1KA 4AYCA 1LP1A 3G6EP 2MKVA 2IX7C 1RE4C 2Z5IA 1KYOH 3G3ZA 1HJ0A 1LTGC 1SLQA 4W7YA 1SQBE 2KLUA 3BASA 5AVZB 4LGDE 1RQVA 1JMBA 2WSCH 3HD7B 3PHLA 4JF7A 3CCUP 4TLFA 1J1EC 2FYUJ 3B5NC 3V6IA 1BSNA 3TDKA 2K3RA 2C0XA 3IFMA 2CK3H 3H32B 5E79E 1Q82Q 1N7SD 3KDPB 1HH0A 4GOFA 1T3JA 2OYIA 1GZLA 2ZFCA 2FYUE 2YMKA 3BCCD 3VOPA 3WU2E 2BCCE 3W68A 2JR8A 5B5EE 4UB8H 1R5LA 2GUVA 3AE4C 1X22A 3GG2A 1T6AA 2KSJA 2KXPB 1GMJA 4JQ0D 3GMAA 1T2KC 5K5GB 1HGZA 3AE3C 3H6PA 4I2LC 4PD4E 3VTPC 3A0HH 2E42A 1KC8Q 1NTZE 2CPBA 3L70E 2FBWC 2HFED 3A7OA 3TGUJ 5AW3B 1NTME 1YQ4C 1Y8AA 1VL2A 3HTKB 4OH8B 3CWBJ 5APTA 1L4AB 2OGUA 2N1TA 2PP6A 1P84D 3V2QA 2KOGA 2FKWB 2POHA 1A02J 2WZ7A 2G3AA 5CBOA 2W6BA 3BATA 1FDOA 1VQPP 1LTSC 3M91A 2JO1A 3PTZA 1NTZD 2QEXP 4W80A 2B9BA 2H7HA 1YJNP 1GW3A 2OTJP 3AE9C 3OW2O 1FZFA 3KPEA 2C9NY 1BCCG 5AVRB 2A45G 4N6JA 1EDIA 3PJSK 2YMYA 4H0LD 3HRNA 1SQVK 4IOIH 1N73C 1KQLA 4PD4D 2IZ0A 2FFDA 1GU5A 2CPSA 3JCUH 5AW1B 1SQVD 1VQ5P 3QH9A 2NPSD 3A2AA 4QMAA 5AW2B 3TGUD 2OYHB 3GHGB 3H1JJ 1GD2E 2OQQA 1N7SC 5GTIH 3C9IA 3D6YA 1WT6A 3EFGA 3A0BH 1GL2A 3SFDC 1EZVD 1FZCB 2YXRB 2HODB 2HR3A 4Z1MH 3L74J 2ZVOB 3P8MC 3FX0A 4WY4A 1BDDA 4OWFA 2M8RA 1SQQD 2XU6A 4JYCA 1VQMP 3RK2B 1L0LG 1XTGB 1VQ4P 2ITAA 3MZWB 2WSFJ 4R4MA 5TISE 3WMM0 1FOSF 1MV8A 3KXDA 5KKZB 2WSCJ 2I1KA 1QL1A 3A0BE 4RKUJ 3V2PA 1VQLP 2IYPA 1H0TB 1S5LH 1BCCD 1D7MA 1DEEG 1SQBD 1L2PA 1M56D 3H1KD 3RK3C 2E74D 1ZR4A 1L0LD 1NO4A 2L91A 2A45H 5AW7B 1VQ6P 1FZGA 3I56P 2M3EA 1LTJA 3F5HA 4WWIA 3CXHH 1CSBA 1SQQJ 1Z56A 2ZJSE 5APYA 4IL6E 1M1JA 4NPEA 5AVVB 4YXDC 1VQNP 1Y9BA 1XTCC 2QJYB 2HYNA 1KQGB 1SQBK 1SQBG 2K9YA 2ZT9D 1BE3D 3LW5H 1NAFA 3FWNA 2WT7A 3VMXA 1PL5A 3VYIA 1PPJD 1IFJA 1LT1A 3M0DA 5BU5A 3R4YA 1S9KD 5H2FH 1AFOA 1NOHA 1KMIZ 1DH3A 3CX5E 4KJMA 1SQVJ 1IZNB 4U3FG 4BRYB 2YKPA 3CC7P 3HE5B 1AV1A 3KZIE 1VF5B 3CPWO 1H0TA 1W2BO 4I1LA 3H1KE 3KYQA 3LIEA 1OVUA 1SQQG 4UB6H 2AXTE 2J5UA 4PJ0E 4XE5B 2O1KA 1SQQK 1PPJE 1QL2A 3VMYA 1SQBJ 1FZCC 3C1LA 3GF3A 3MGNA 4DT0A 5L8RJ 3D70A 1JNMA 5H2FE 1FS0E 2OYHC 2AEMA 5AVQB 1A02F 3H1LD 3E1IA 4PV1D 5AW9B 4EYYQ 3H25A 1AVOA 1GL2B 4I6MC 3TF5A 3RL0g 3A3YB 3H1ID 3S4RA 1OIPA 5AW5B 1IFMA 2K88A 1Y47A 2LXCB 1K05A 2OTKE 1NVOA 3RK3E 3KQGA 1GU4A 2M3BA 1FU1A 1NU1G 4HYTB 2L5GB 5CCHA 1LT9A 2Y0CA 2WSFH 1ZRTE 3O6QB 1EZVE 1K04A 2QVAA 1EZVG 5APSA 2ZAEB 3H1LJ 4RESB 2FFDB 2D2CB 2KNCB 1FZAA 2YO3A 3AE8C 3KZIH 1KD1Q 4N3YB 5CCGC 4L75A 4U3FD 3C8VA 3Q1MA 1RF1A 1BE3J 4JBZA 2IBZE 2ZT9B 2WT7B 3SWKA 1EDKA 1VQ9P 1VQ8P 4Y28J 1RHZB 1KQFB 1RE4A 3AE1C 1QEXA 1AQ5A 1BDCA 1IFPA 3R2PA 2FXMA 2YKQA 2ZXXA 1FDIA 1FOSE 1QVFO 1IJDB 3E7KA 5CCGD 2N9BA 1DD4A 2Q6QA 1SQXD 1JY2P 2QIWA 4OGQB 1NKNA 5B66H 1L4AC 3ZDMA 2NZ2A 2WVRA 1OW7A 5APUA 2AEJA 4H44B 1JM0A 1DEBA 4AUWA 3RBXA 3HTKA 4D6TD 2KZIA 2WITA 2OYIB 2Y0EA 1M1KQ 3CCEP 1L0NG 1IC2A 4WY4B 2J59M 4U3FE 1OXZA 3S9OA 3VP8A 1EQ7A 4K35A 5AVSB 1FDMA 1FZCA 2Q9IA 1PFIA 1LNQA 3HD7A 3L4FA 3AE2C 5KAFH 1NKZB 4JPZB 1YITP 3CWBD 4WY4C 1K8AQ 4C46A 1GTWA 1J2JB 1Q90D 2IDBA 1OVVA 1SFCC 2J58A 3B8EB 3E1RA 3HD7C 1J1EB 1LP1B 1YTZT 3AEAC 3GHGA 2R5BA 1T3UA 2BEZF 2M5AA 2V4HA 3B5NB 1FJPA 1MZ9A 3CD6P 1KYOD 1LJ2A 2Z4EA 1ZN5A 2I8DA 1OMIA 1SFCA 3OJAB 3P8CE 4KT0J 1L0NJ 3GHGC 4L73A 4XA4A 4H13B 1URQC 2IYOA 2JWDA 2LXBA 5AW6B 1PV3A 2KIKA 1PP9G 3BCCJ 1OW8A 2QJYC 3NXSA 1GK6A 1HTLC 3B5ND 3H1JE 1VDFA 1S72P 1HWTC 1KILB 1IO4A 2N1TD 1BSHA 1UIIA 2Q3EA 3H1IG 5KLVD 5GTHE 3F89A 3M9BA 1EXJA 1IFDA 4O9BA 1RE3C 2FYUK 1ZOYC 2W6JH 1SFCB 2AXTH 3OA7A 5KLVJ 3I5CA 1YJWP 1EZVI 1NGMB 1LTAC 1SQXJ 2JEEA 2KS1A 3M0DC 4HJGH 4RO0A 4RJTA 1N8RQ 1NTKE 5KLVG 1S3JA 2P67A 2ZXEB 3T97B 2BEQD 1USDA 3H1JD 5KKZC 3I55P 1N73A 2FFDC 2N1TB 4A7PA 2G8YA 1DD3A 1PP9J 1R5SA 1AVYA 2XNXA 3MUDA 1M57D 1RQUA 3O8ZA 4H44D 1S5LX 1NTKG 2GA1A 3UIAA 3VMAA 4DOJA 1NTMK 2WSEH 3CCMP 3U1CA 4IFMA 1NTZK 2WSSH 2IFNA 3TYYA 1GL2C 4H44C 4ZKUA 1Q81Q 1KZUB 2P2UA 5B66E 1NHLA 3Q2YA 5KJ7D 2Z5HA 1OW6A 4DZOA 1YQ3C 2E75C 3TSIA 1KORA 2E76D 2OARA 1BCCE 2SPZA 3CX5H 3L70J 4OGQC 4LLHA 4WBAA 3T97A 1N73B 1SQPK 2O01N 4ZMDA 1EXIA 1X0TA 5BVZA 1P84I 5KJ7C 3A5TA 1VQ7P 1CI6B 4CPGA 2JWAA 3II6A 1FE6A 1JMMA 5B5EH 5GTIE 5AVYB 4GT1A 4NPDA 2QJKC 1HBWA 2A06D 2WTYA 1X79B 5KJ7A 2O1JA 1HF9A 2XNDH 1JY2N 2BCCJ 3WUTA 1HVVA 3L72E 1J1DB 2Q7CA 1PZQA 3BVHA 1IFNA 4LC1A 3Q5PA 1FZEA 1IK7A 3VMZA 1URQA 3GLMA 3VN0A 2QJKB 1NTMG 2WMMA 1OX3A 3CWBG 1NU1K 5CCHD 4ZKPA 4U7JA 4OVNF 2A06G 2KB7P 2H89C 2KNCA 2KS1B 3L70G 1K73Q 1RF1C 2IZ1A 2K9JB 1KILC 5APQA 2R3CA 3CCJP 2WQYC 3HD7D 1SS1A 4IFFA 3G4SP 3FXDA 1LWUB 2Y9ZA 3L75G 3MD0A 4YTPC 3H1HG 2A45I 2W6AA 1KILA 3MP7B 3CC4P 3S1KA 3L70D 3HUSC 3P8CD 1BCCJ 1U7MA 2KYVA 3LIDA 1R8EA 3RK3B 1J1DC 3AECC 1PIXA 1LTBC 3L72D 3TNUB 1DX7A 3IAOA 3ABVC 2FXOA 4EI2A 1CI6A 3V4WA 1KB9H 3B5NA 2A06E 2AXCA 3GF7A 4M3LA 1S4XA 2O01H 3L71J 1SVFA 2E74C 3IR9A 3RK3D 1Q7YQ 1H8AA 2P10A 2IBZI 2IBZG 2RN0A 3AEGC 3JCUE 1L4AD 1T8ZA 3AE5C 3G9RA 3H1JG 1RY3A 2QSIA 3L72G 3L75J 3H1HJ 1N7SB 3P32A 3V5BA 3CX5D 2PAJA 3HE5A 1JB0J 1SQPG 1QVGO 4GDOA 1OFCX 3HUSB 4HB1A 4C7NA 2O01J 3U59A 2BASA 3CMEP 3M0AA 1WRGA 2E5YA 3K5BA 5CCHC 2B87B 2H43A 4IL6H 2YIUC 2HPCB 1VPCA 3CXHI 3M06A 3A0HE 3CCLP 2P1JA 2Y9YA 1USEA 1LTTC 2FYNC 2RH0A 1L0NK 1KILE 1HJBA 1FJKA 1NTKK 3FXEA 1YI2P 5KLIB 3L72J 1MFTA 2FXPA 1MKMA 2FYUD 3BCCE 5CJ0A 5KAFE 4D6TJ 1M1JC 1SQPJ 4GIFA 1L0NE 1L0LK 5KLVK 1ZMEC 5KTBA 1OVRA 2GM4A 2P58A 5E79H 4BWNA 1ZLLA 1PP9D 1SQQE 3H1HE 2Q5UA 3EQ2A 4I7ZC 2FYUG 2H88C 1GL2D 1KYOI 1QLED 1WMKA 3AEBC 5KLVE 2V7QH 4HKZH 2N9YB 2FYNB 2XZRA 3CX5I 1FBMA 4H13C 4UB8E 3CC2P 3LW5J 1MUUA 3IN6A 2M5AB 3CCVP 1LT9B 1GW4A 2R3SA 3CWBE 4U3FJ 1OWAA 2W27A 1PGQA 1CW5A 5AVTB 4KHXA 2RKLA 2ZVNB 3L75D 3HE4B 2PGDA 2O3JA 2NPSB 2QM8A 1S1CX 4R4LA 1M8OB 2C0WA 2E74B 2I1JA 3TGUG 1NTKD 4N78D 1L0ND 1SQPE 4ASWA 5CBNA 2N1TC 1NU1E 3NTNA 3V2NA 3FGAD 1U7JA 2JJLA 3GW6A 1CZQA 1JY3O 4WB4A 3RBZA 3N4XA 1JO5A 3OAKA 3RL0C 3L73E 1ZR2A 5KAIH 1W2EA 1P84H 2R32A 1Q2NA 1KFNA 1U57A 3SFEC 1LWUC 4YXWH 1LTJC 4WY4D 3V4QA 4MN4C 3M9QA 2AEFA 3PP5A 4D6TE 3CCSP 3NFQA 1RF1B 3H1KG 3L75E 3CL3D 2ZT9C 4EOTA 2B87A 4HH2A 3Q5SA 1VQOP 4BXLA 1YHQP 1NTMD 1QX8A 3MUDC 4Y99B 3HUSA 1QGKB 4C7NB 2HODA 2E76C 2JKVA 2KZJA 1P84E 2GUSA 1NH4A 2NPSA 1N7SA 3B71A 3CCRP 1ZRTD 3HE4A 2NRGA 1GDTA 3H1IE 5DJUB 2LKMA 1VF5C 2B89A 1BGYD 1M7LA 4H13D 1KN7A 2NPSC 1PP9E 2JDIH 3L74G 2OYHA 1FC2C 3CLQA 1IFIA 3H1KJ 1TU3F 2OYIC 3L73D 1KTMA 3SSUA 1L0LJ 4GOEA 4XFJA 3TNUA 2QG4A 2ZYGA 2H8PD 5APWA 1SQXE 3P7KA 4C7RA 1SQVE 1G1IA 2HG5D 2Q3IA 4H0LB 5CMZA 3MIWA 3ITKA 5DJTB 3D6ZA 2YO2A 1LT9C 1X8YA 3CXHE 1M90Q 2M0BA 2E43A 2YXQB 5TISH 3G71P 2QJPB 2W8ZA 4BRYA 1NJIQ 5EFWB 4PV1B 1BGYE 1JCCA 1JY3N 1IK9A 4NPFX 4N78E 3SWFA 3B4SA 2D2CC 5AVXB 3AE6C 2P7JA 3L35A 5M1BA 1YJ9P 2PRRA 1KFMA 2HLOA 2WPVB 5KLIC 1LTIC 2LR2A 3NMDA 4PV1C 1M1JB 3JC22 2HPCA 1SQVG 3RK2D 1JEKA 3KHUA 1LTJB 1RH5B 2RMZA 2XV5A 3L37A 4PJ0H 2D2CD 1Q86Q 4AQRD 2YIUB 2MJZA 1NYHA 3CXHD 3SWYA 1X9VA 3MHVA 5APVA 2W90A 4IL6X 3L71D 3L74E 3FWLA 3CMAP 1KYOE 5C39A 2OTLP 5AVUB 2XKMA 3PLNA 4DCKA 3TK1A 2DW3A 3H1HD 1KQSO 2C9LY 1EDJA 3L73J 2WPRA 2QM7A 1GK4A 1JCDA 2YKOA 1NTKJ 5CJ4A 3Q5RA 1E5WA 2KP8A 1LGHB 4K3AA 1NU1J 2QE7H 2E76B 1YTZI 3AEEC
chains in the Genus database with same CATH topology
1KILD 3V2RA 2IFMA 1RF0C 1H88A 2WPSA 5AW4B 1H89A 3CI9A 1RF0A 1G2CB 1HGVA 1SP4A 1N2DC 2WWWA 1URQB 2R5DA 2XDJA 3RL0B 1LWUA 3N7NA 2KLVA 5AW8B 1N7LA 3U1AA 1G2CA 1HUCA 3BRTB 1YYCA 4B86A 3M9HA 5AVWB 3VP9A 1FAVA 2FYZA 3RK2C 3RL0D 1L4AA 1SQXK 3L36A 5CHXA 4GKGA 1JTHA 1S9KE 2YNYA 5AW0B 5APXA 1JTHB 1JY3P 2VRSA 4W7ZA 1G1JA 1JOCA 3MTUE 3H32A 4EIJA 2IPPA 1N86A 1FZBA 1URQD 4JYBA 4Y99C 4IFDK 1RE3A 5BU8B 1JY2O 5CCGA 2WPQA 1SFCD 1ZV8A 3BRVB 1T2KD 4AYCA 1MFZA 1GU5A 3G3ZA 2IX7C 1RE4C 2Z5IA 1LTGC 1SLQA 4W7YA 3BASA 5AVZB 4LGDE 2WSCH 3HD7B 4JF7A 1J1EC 3B5NC 2C0XA 3IFMA 3H32B 1N7SD 3KDPB 1HH0A 1T3JA 2OYIA 1GZLA 2ZFCA 3VOPA 2GUVA 2KSJA 1T2KC 1HGZA 3H6PA 4I2LC 3VTPC 2E42A 2CPBA 2HFED 3A7OA 5AW3B 3HTKB 4OH8B 5APTA 1L4AB 2N1TA 2PP6A 3V2QA 2KOGA 2FKWB 2POHA 1A02J 2WZ7A 2W6BA 3BATA 1LTSC 3M91A 4W80A 2H7HA 1GW3A 1FZFA 3KPEA 2C9NY 5AVRB 2A45G 4N6JA 2YMYA 3HRNA 1SQVK 1N73C 1KQLA 2FFDA 2CPSA 5AW1B 2NPSD 3A2AA 5AW2B 2OYHB 3GHGB 1GD2E 1N7SC 3C9IA 1WT6A 3EFGA 1GL2A 1FZCB 2HODB 3P8MC 4WY4A 1NWQA 2M8RA 2XU6A 4JYCA 3RK2B 1XTGB 3WMM0 1FOSF 1MV8A 2I1KA 1QL1A 3V2PA 3RK3C 1ZR4A 1NO4A 2A45H 5AW7B 1FZGA 1LTJA 1CSBA 1Z56A 5APYA 1M1JA 5AVVB 1XTCC 2HYNA 1SQBK 2WT7A 3LW5H 1NAFA 3VMXA 3VYIA 5BU5A 1IFJA 3M0DA 1S9KD 1AFOA 1NOHA 1DH3A 3HE5B 4I1LA 3KYQA 4XE5B 2O1KA 1SQQK 3VMYA 1QL2A 1FZCC 3MGNA 1JNMA 1A02F 2OYHC 5AVQB 3E1IA 5AW9B 1GL2B 4I6MC 3A3YB 5AW5B 1IFMA 1GU4A 3KQGA 2M3BA 1FU1A 4HYTB 2L5GB 5CCHA 1LT9A 2WSFH 5APSA 2FFDB 4RESB 2YO3A 1FZAA 4N3YB 5CCGC 1RF1A 2WT7B 1RE4A 1AQ5A 3R2PA 2FXMA 2YKQA 1JUNA 1IJDB 5CCGD 2N9BA 1JY2P 1NKNA 1L4AC 5APUA 1DEBA 4AUWA 3HTKA 2OYIB 2WITA 1IC2A 4WY4B 2J59M 1OXZA 3VP8A 1EQ7A 5AVSB 1FDMA 1FZCA 2Q9IA 1PFIA 3HD7A 3L4FA 1NKZB 4WY4C 4C46A 1GTWA 1J2JB 2J58A 1SFCC 3B8EB 3HD7C 1J1EB 1YTZT 3GHGA 1FJPA 2R5BA 1T3UA 3B5NB 1MZ9A 2Z4EA 1ZN5A 3OJAB 1SFCA 3P8CE 3GHGC 4XA4A 1URQC 5AW6B 3NXSA 1GK6A 1HTLC 3B5ND 1VDFA 1HWTC 1KILB 1IO4A 2N1TD 3M9BA 1IFDA 4O9BA 1RE3C 2FYUK 3OA7A 1SFCB 3I5CA 1LTAC 2JEEA 3M0DC 2P67A 2ZXEB 1N73A 2FFDC 2N1TB 2XNXA 3MUDA 3O8ZA 3UIAA 4DOJA 1NTMK 2WSEH 3U1CA 4IFMA 1NTZK 2IFNA 3TYYA 1GL2C 4ZKUA 1KZUB 2P2UA 1NHLA 5KJ7D 2Z5HA 4DZOA 3TSIA 1FOSE 2OARA 4WBAA 4LLHA 3T97A 1N73B 1SQPK 5BVZA 5KJ7C 1CI6B 3II6A 1JMMA 5AVYB 4GT1A 1HBWA 2WTYA 1X79B 5KJ7A 2O1JA 1JY2N 1HVVA 1J1DB 2Q7CA 3BVHA 1IFNA 4LC1A 1FZEA 3VMZA 1URQA 3VN0A 5CCHD 3A5TA 1NU1K 4ZKPA 2KB7P 1RF1C 1KILC 5APQA 2R3CA 3HD7D 4IFFA 1LWUB 3MD0A 2A45I 2W6AA 1KILA 3HUSC 3P8CD 2KYVA 3LIDA 3RK3B 1J1DC 1LTBC 3TNUB 1DX7A 1CI6A 3V4WA 4M3LA 3B5NA 5AVXB 2O01H 1SVFA 3IR9A 3RK3D 1H8AA 1L4AD 1T8ZA 1RY3A 3P32A 3V5BA 1N7SB 2PAJA 3HE5A 3HUSB 4C7NA 3U59A 2BASA 3M0AA 1WRGA 5CCHC 2H43A 2HPCB 1VPCA 3M06A 2P1JA 1LTTC 1L0NK 1HJBA 1FJKA 1NTKK 5CJ0A 1M1JC 4GIFA 1L0LK 5KLVK 5KTBA 2GM4A 1ZLLA 2Q5UA 3EQ2A 1GL2D 2XZRA 1FBMA 1MUUA 1LT9B 1GW4A 1OWAA 2W27A 1CW5A 5AVTB 4KHXA 3HE4B 2QM8A 2NPSB 2C0WA 2I1JA 4N78D 2N1TC 3NTNA 3V2NA 2JJLA 1CZQA 1JY3O 4WB4A 3N4XA 1JO5A 3OAKA 3RL0C 1ZR2A 1W2EA 2R32A 1KFNA 1LWUC 1LTJC 4WY4D 3V4QA 3M9QA 3PP5A 1RF1B 3NFQA 3CL3D 4EOTA 4HH2A 4Y99B 3HUSA 4C7NB 2HODA 2GUSA 1NH4A 2NPSA 1N7SA 1GDTA 3HE4A 2LKMA 1M7LA 2NPSC 2OYHA 3CLQA 1IFIA 2OYIC 3TNUA 2H8PD 5APWA 3P7KA 4C7RA 1G1IA 2HG5D 2Q3IA 5CMZA 3MIWA 2YO2A 1LT9C 1X8YA 2E43A 1JCCA 1JY3N 1IK9A 3SWFA 4N78E 2P7JA 3L35A 1KFMA 2HLOA 1LTIC 3NMDA 2HPCA 1M1JB 3RK2D 1LTJB 2XV5A 3L37A 4AQRD 2MJZA 3SWYA 1X9VA 5APVA 5AVUB 2XKMA 3TK1A 2C9LY 2WPRA 2QM7A 1GK4A 1JCDA 2YKOA 5CJ4A 1E5WA 2KP8A 1LGHB 2YKPA 1YTZI 3LIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2P A;  3V2R A;  1DEB A;  3V2Q A;  3V2N A;  1MZ9 A;  1VDF A;  1FBM A; 
#chains in the Genus database with same CATH topology
 1KB9 D;  1KIL D;  3V2R A;  2IFM A;  1RF0 C;  3QWO C;  1BE3 E;  1H88 A;  3H1L G;  2WPS A;  1VF5 D;  1NTZ G;  5AW4 B;  1H89 A;  2E5T A;  3CI9 A;  4UB6 E;  4ASV A;  1PGO A;  2KI7 B;  2QA4 P;  1RF0 A;  3L73 G;  1G2C B;  1HGV A;  4PD4 I;  1SP4 A;  1BE3 G;  2FY8 A;  1EC5 A;  1N2D C;  1AQT A;  2WWW A;  1URQ B;  1ZP0 C;  3PH0 A;  4PD4 H;  3AE7 C;  2OYO A;  1NU1 D;  2R5D A;  2XDJ A;  3WUU A;  3RL0 B;  2BCC G;  1LWU A;  2KSE A;  3N7N A;  2KLV A;  5AW8 B;  2KUB A;  1N7L A;  2B88 A;  3U1A A;  2ZYA A;  1G2C A;  1ZW0 A;  1NTM J;  2JP3 A;  1JUN A;  1HUC A;  3BRT B;  3TGU E;  1YYC A;  1AA0 A;  1S2E A;  1NTZ J;  1KB9 E;  2R44 A;  3JSV C;  3M9H A;  1FAV A;  5AVW B;  3VP9 A;  4B86 A;  2BCC D;  2QJP C;  3EFF K;  2FYZ A;  2KK7 A;  3EWK A;  3RK2 C;  1YIJ P;  3RL0 D;  1NAY A;  2ZYD A;  1L4A A;  5KAI E;  1BGY J;  2IBZ D;  1SQX K;  3L36 A;  5CHX A;  4GKG A;  1JTH A;  1KB9 I;  4YPC A;  2PFX A;  3AED C;  3Q3D A;  1S9K E;  2YNY A;  1SQP D;  5AW0 B;  1PGP A;  4H0L C;  5APX A;  1W5C E;  1JTH B;  1JY3 P;  2VRS A;  4W7Z A;  1YBK A;  2E75 B;  3PRJ A;  4TT3 H;  1G1J A;  5TJH A;  1JOC A;  4D6T G;  3L71 G;  1NWQ A;  1VQK P;  3RGU A;  2QRX A;  4ZNC A;  1UIX A;  2K37 A;  3AEF C;  1L0L E;  2K1A A;  4OGQ D;  1S5L E;  1ZXG A;  1BGY G;  2E75 D;  2V7Q J;  2W83 C;  3H32 A;  3L74 D;  3MTU E;  4EIJ A;  2IPP A;  3CCQ P;  1N86 A;  2WSE J;  4L76 A;  3BCC G;  5GTH H;  2UWJ E;  4WVZ A;  3D71 A;  3H1L E;  4I7Z B;  1PGJ A;  1E79 H;  3H1I J;  1EDL A;  1FZB A;  1PPJ G;  1AJY A;  4GOD A;  1URQ D;  3IF4 A;  3L71 E;  3WUV A;  4JYB A;  4Y99 C;  1K9M Q;  2Y0D A;  4IFD K;  1RE3 A;  5BU8 B;  1OZH A;  1DIP A;  3USS A;  4EDF A;  1JY2 O;  1SQX G;  4L74 A;  2WPQ A;  5CCG A;  2K9J A;  1SFC D;  4DJG A;  3O6Q A;  1ZV8 A;  3W67 A;  1KV4 A;  3BRV B;  1T2K D;  3WU2 H;  1MFZ A;  2Q1K A;  4AYC A;  1LP1 A;  3G6E P;  2MKV A;  2IX7 C;  1RE4 C;  2Z5I A;  1KYO H;  3G3Z A;  1HJ0 A;  1LTG C;  1SLQ A;  4W7Y A;  1SQB E;  2KLU A;  3BAS A;  5AVZ B;  4LGD E;  1RQV A;  1JMB A;  2WSC H;  3HD7 B;  3PHL A;  4JF7 A;  3CCU P;  4TLF A;  1J1E C;  2FYU J;  3B5N C;  3V6I A;  1BSN A;  3TDK A;  2K3R A;  2C0X A;  3IFM A;  2CK3 H;  3H32 B;  5E79 E;  1Q82 Q;  1N7S D;  3KDP B;  1HH0 A;  4GOF A;  1T3J A;  2OYI A;  1GZL A;  2ZFC A;  2FYU E;  2YMK A;  3BCC D;  3VOP A;  3WU2 E;  2BCC E;  3W68 A;  2JR8 A;  5B5E E;  4UB8 H;  1R5L A;  2GUV A;  3AE4 C;  1X22 A;  3GG2 A;  1T6A A;  2KSJ A;  2KXP B;  1GMJ A;  4JQ0 D;  3GMA A;  1T2K C;  5K5G B;  1HGZ A;  3AE3 C;  3H6P A;  4I2L C;  4PD4 E;  3VTP C;  3A0H H;  2E42 A;  1KC8 Q;  1NTZ E;  2CPB A;  3L70 E;  2FBW C;  2HFE D;  3A7O A;  3TGU J;  5AW3 B;  1NTM E;  1YQ4 C;  1Y8A A;  1VL2 A;  3HTK B;  4OH8 B;  3CWB J;  5APT A;  1L4A B;  2OGU A;  2N1T A;  2PP6 A;  1P84 D;  3V2Q A;  2KOG A;  2FKW B;  2POH A;  1A02 J;  2WZ7 A;  2G3A A;  5CBO A;  2W6B A;  3BAT A;  1FDO A;  1VQP P;  1LTS C;  3M91 A;  2JO1 A;  3PTZ A;  1NTZ D;  2QEX P;  4W80 A;  2B9B A;  2H7H A;  1YJN P;  1GW3 A;  2OTJ P;  3AE9 C;  3OW2 O;  1FZF A;  3KPE A;  2C9N Y;  1BCC G;  5AVR B;  2A45 G;  4N6J A;  1EDI A;  3PJS K;  2YMY A;  4H0L D;  3HRN A;  1SQV K;  4IOI H;  1N73 C;  1KQL A;  4PD4 D;  2IZ0 A;  2FFD A;  1GU5 A;  2CPS A;  3JCU H;  5AW1 B;  1SQV D;  1VQ5 P;  3QH9 A;  2NPS D;  3A2A A;  4QMA A;  5AW2 B;  3TGU D;  2OYH B;  3GHG B;  3H1J J;  1GD2 E;  2OQQ A;  1N7S C;  5GTI H;  3C9I A;  3D6Y A;  1WT6 A;  3EFG A;  3A0B H;  1GL2 A;  3SFD C;  1EZV D;  1FZC B;  2YXR B;  2HOD B;  2HR3 A;  4Z1M H;  3L74 J;  2ZVO B;  3P8M C;  3FX0 A;  4WY4 A;  1BDD A;  4OWF A;  2M8R A;  1SQQ D;  2XU6 A;  4JYC A;  1VQM P;  3RK2 B;  1L0L G;  1XTG B;  1VQ4 P;  2ITA A;  3MZW B;  2WSF J;  4R4M A;  5TIS E;  3WMM 0;  1FOS F;  1MV8 A;  3KXD A;  5KKZ B;  2WSC J;  2I1K A;  1QL1 A;  3A0B E;  4RKU J;  3V2P A;  1VQL P;  2IYP A;  1H0T B;  1S5L H;  1BCC D;  1D7M A;  1DEE G;  1SQB D;  1L2P A;  1M56 D;  3H1K D;  3RK3 C;  2E74 D;  1ZR4 A;  1L0L D;  1NO4 A;  2L91 A;  2A45 H;  5AW7 B;  1VQ6 P;  1FZG A;  3I56 P;  2M3E A;  1LTJ A;  3F5H A;  4WWI A;  3CXH H;  1CSB A;  1SQQ J;  1Z56 A;  2ZJS E;  5APY A;  4IL6 E;  1M1J A;  4NPE A;  5AVV B;  4YXD C;  1VQN P;  1Y9B A;  1XTC C;  2QJY B;  2HYN A;  1KQG B;  1SQB K;  1SQB G;  2K9Y A;  2ZT9 D;  1BE3 D;  3LW5 H;  1NAF A;  3FWN A;  2WT7 A;  3VMX A;  1PL5 A;  3VYI A;  1PPJ D;  1IFJ A;  1LT1 A;  3M0D A;  5BU5 A;  3R4Y A;  1S9K D;  5H2F H;  1AFO A;  1NOH A;  1KMI Z;  1DH3 A;  3CX5 E;  4KJM A;  1SQV J;  1IZN B;  4U3F G;  4BRY B;  2YKP A;  3CC7 P;  3HE5 B;  1AV1 A;  3KZI E;  1VF5 B;  3CPW O;  1H0T A;  1W2B O;  4I1L A;  3H1K E;  3KYQ A;  3LIE A;  1OVU A;  1SQQ G;  4UB6 H;  2AXT E;  2J5U A;  4PJ0 E;  4XE5 B;  2O1K A;  1SQQ K;  1PPJ E;  1QL2 A;  3VMY A;  1SQB J;  1FZC C;  3C1L A;  3GF3 A;  3MGN A;  4DT0 A;  5L8R J;  3D70 A;  1JNM A;  5H2F E;  1FS0 E;  2OYH C;  2AEM A;  5AVQ B;  1A02 F;  3H1L D;  3E1I A;  4PV1 D;  5AW9 B;  4EYY Q;  3H25 A;  1AVO A;  1GL2 B;  4I6M C;  3TF5 A;  3RL0 g;  3A3Y B;  3H1I D;  3S4R A;  1OIP A;  5AW5 B;  1IFM A;  2K88 A;  1Y47 A;  2LXC B;  1K05 A;  2OTK E;  1NVO A;  3RK3 E;  3KQG A;  1GU4 A;  2M3B A;  1FU1 A;  1NU1 G;  4HYT B;  2L5G B;  5CCH A;  1LT9 A;  2Y0C A;  2WSF H;  1ZRT E;  3O6Q B;  1EZV E;  1K04 A;  2QVA A;  1EZV G;  5APS A;  2ZAE B;  3H1L J;  4RES B;  2FFD B;  2D2C B;  2KNC B;  1FZA A;  2YO3 A;  3AE8 C;  3KZI H;  1KD1 Q;  4N3Y B;  5CCG C;  4L75 A;  4U3F D;  3C8V A;  3Q1M A;  1RF1 A;  1BE3 J;  4JBZ A;  2IBZ E;  2ZT9 B;  2WT7 B;  3SWK A;  1EDK A;  1VQ9 P;  1VQ8 P;  4Y28 J;  1RHZ B;  1KQF B;  1RE4 A;  3AE1 C;  1QEX A;  1AQ5 A;  1BDC A;  1IFP A;  3R2P A;  2FXM A;  2YKQ A;  2ZXX A;  1FDI A;  1FOS E;  1QVF O;  1IJD B;  3E7K A;  5CCG D;  2N9B A;  1DD4 A;  2Q6Q A;  1SQX D;  1JY2 P;  2QIW A;  4OGQ B;  1NKN A;  5B66 H;  1L4A C;  3ZDM A;  2NZ2 A;  2WVR A;  1OW7 A;  5APU A;  2AEJ A;  4H44 B;  1JM0 A;  1DEB A;  4AUW A;  3RBX A;  3HTK A;  4D6T D;  2KZI A;  2WIT A;  2OYI B;  2Y0E A;  1M1K Q;  3CCE P;  1L0N G;  1IC2 A;  4WY4 B;  2J59 M;  4U3F E;  1OXZ A;  3S9O A;  3VP8 A;  1EQ7 A;  4K35 A;  5AVS B;  1FDM A;  1FZC A;  2Q9I A;  1PFI A;  1LNQ A;  3HD7 A;  3L4F A;  3AE2 C;  5KAF H;  1NKZ B;  4JPZ B;  1YIT P;  3CWB D;  4WY4 C;  1K8A Q;  4C46 A;  1GTW A;  1J2J B;  1Q90 D;  2IDB A;  1OVV A;  1SFC C;  2J58 A;  3B8E B;  3E1R A;  3HD7 C;  1J1E B;  1LP1 B;  1YTZ T;  3AEA C;  3GHG A;  2R5B A;  1T3U A;  2BEZ F;  2M5A A;  2V4H A;  3B5N B;  1FJP A;  1MZ9 A;  3CD6 P;  1KYO D;  1LJ2 A;  2Z4E A;  1ZN5 A;  2I8D A;  1OMI A;  1SFC A;  3OJA B;  3P8C E;  4KT0 J;  1L0N J;  3GHG C;  4L73 A;  4XA4 A;  4H13 B;  1URQ C;  2IYO A;  2JWD A;  2LXB A;  5AW6 B;  1PV3 A;  2KIK A;  1PP9 G;  3BCC J;  1OW8 A;  2QJY C;  3NXS A;  1GK6 A;  1HTL C;  3B5N D;  3H1J E;  1VDF A;  1S72 P;  1HWT C;  1KIL B;  1IO4 A;  2N1T D;  1BSH A;  1UII A;  2Q3E A;  3H1I G;  5KLV D;  5GTH E;  3F89 A;  3M9B A;  1EXJ A;  1IFD A;  4O9B A;  1RE3 C;  2FYU K;  1ZOY C;  2W6J H;  1SFC B;  2AXT H;  3OA7 A;  5KLV J;  3I5C A;  1YJW P;  1EZV I;  1NGM B;  1LTA C;  1SQX J;  2JEE A;  2KS1 A;  3M0D C;  4HJG H;  4RO0 A;  4RJT A;  1N8R Q;  1NTK E;  5KLV G;  1S3J A;  2P67 A;  2ZXE B;  3T97 B;  2BEQ D;  1USD A;  3H1J D;  5KKZ C;  3I55 P;  1N73 A;  2FFD C;  2N1T B;  4A7P A;  2G8Y A;  1DD3 A;  1PP9 J;  1R5S A;  1AVY A;  2XNX A;  3MUD A;  1M57 D;  1RQU A;  3O8Z A;  4H44 D;  1S5L X;  1NTK G;  2GA1 A;  3UIA A;  3VMA A;  4DOJ A;  1NTM K;  2WSE H;  3CCM P;  3U1C A;  4IFM A;  1NTZ K;  2WSS H;  2IFN A;  3TYY A;  1GL2 C;  4H44 C;  4ZKU A;  1Q81 Q;  1KZU B;  2P2U A;  5B66 E;  1NHL A;  3Q2Y A;  5KJ7 D;  2Z5H A;  1OW6 A;  4DZO A;  1YQ3 C;  2E75 C;  3TSI A;  1KOR A;  2E76 D;  2OAR A;  1BCC E;  2SPZ A;  3CX5 H;  3L70 J;  4OGQ C;  4LLH A;  4WBA A;  3T97 A;  1N73 B;  1SQP K;  2O01 N;  4ZMD A;  1EXI A;  1X0T A;  5BVZ A;  1P84 I;  5KJ7 C;  3A5T A;  1VQ7 P;  1CI6 B;  4CPG A;  2JWA A;  3II6 A;  1FE6 A;  1JMM A;  5B5E H;  5GTI E;  5AVY B;  4GT1 A;  4NPD A;  2QJK C;  1HBW A;  2A06 D;  2WTY A;  1X79 B;  5KJ7 A;  2O1J A;  1HF9 A;  2XND H;  1JY2 N;  2BCC J;  3WUT A;  1HVV A;  3L72 E;  1J1D B;  2Q7C A;  1PZQ A;  3BVH A;  1IFN A;  4LC1 A;  3Q5P A;  1FZE A;  1IK7 A;  3VMZ A;  1URQ A;  3GLM A;  3VN0 A;  2QJK B;  1NTM G;  2WMM A;  1OX3 A;  3CWB G;  1NU1 K;  5CCH D;  4ZKP A;  4U7J A;  4OVN F;  2A06 G;  2KB7 P;  2H89 C;  2KNC A;  2KS1 B;  3L70 G;  1K73 Q;  1RF1 C;  2IZ1 A;  2K9J B;  1KIL C;  5APQ A;  2R3C A;  3CCJ P;  2WQY C;  3HD7 D;  1SS1 A;  4IFF A;  3G4S P;  3FXD A;  1LWU B;  2Y9Z A;  3L75 G;  3MD0 A;  4YTP C;  3H1H G;  2A45 I;  2W6A A;  1KIL A;  3MP7 B;  3CC4 P;  3S1K A;  3L70 D;  3HUS C;  3P8C D;  1BCC J;  1U7M A;  2KYV A;  3LID A;  1R8E A;  3RK3 B;  1J1D C;  3AEC C;  1PIX A;  1LTB C;  3L72 D;  3TNU B;  1DX7 A;  3IAO A;  3ABV C;  2FXO A;  4EI2 A;  1CI6 A;  3V4W A;  1KB9 H;  3B5N A;  2A06 E;  2AXC A;  3GF7 A;  4M3L A;  1S4X A;  2O01 H;  3L71 J;  1SVF A;  2E74 C;  3IR9 A;  3RK3 D;  1Q7Y Q;  1H8A A;  2P10 A;  2IBZ I;  2IBZ G;  2RN0 A;  3AEG C;  3JCU E;  1L4A D;  1T8Z A;  3AE5 C;  3G9R A;  3H1J G;  1RY3 A;  2QSI A;  3L72 G;  3L75 J;  3H1H J;  1N7S B;  3P32 A;  3V5B A;  3CX5 D;  2PAJ A;  3HE5 A;  1JB0 J;  1SQP G;  1QVG O;  4GDO A;  1OFC X;  3HUS B;  4HB1 A;  4C7N A;  2O01 J;  3U59 A;  2BAS A;  3CME P;  3M0A A;  1WRG A;  2E5Y A;  3K5B A;  5CCH C;  2B87 B;  2H43 A;  4IL6 H;  2YIU C;  2HPC B;  1VPC A;  3CXH I;  3M06 A;  3A0H E;  3CCL P;  2P1J A;  2Y9Y A;  1USE A;  1LTT C;  2FYN C;  2RH0 A;  1L0N K;  1KIL E;  1HJB A;  1FJK A;  1NTK K;  3FXE A;  1YI2 P;  5KLI B;  3L72 J;  1MFT A;  2FXP A;  1MKM A;  2FYU D;  3BCC E;  5CJ0 A;  5KAF E;  4D6T J;  1M1J C;  1SQP J;  4GIF A;  1L0N E;  1L0L K;  5KLV K;  1ZME C;  5KTB A;  1OVR A;  2GM4 A;  2P58 A;  5E79 H;  4BWN A;  1ZLL A;  1PP9 D;  1SQQ E;  3H1H E;  2Q5U A;  3EQ2 A;  4I7Z C;  2FYU G;  2H88 C;  1GL2 D;  1KYO I;  1QLE D;  1WMK A;  3AEB C;  5KLV E;  2V7Q H;  4HKZ H;  2N9Y B;  2FYN B;  2XZR A;  3CX5 I;  1FBM A;  4H13 C;  4UB8 E;  3CC2 P;  3LW5 J;  1MUU A;  3IN6 A;  2M5A B;  3CCV P;  1LT9 B;  1GW4 A;  2R3S A;  3CWB E;  4U3F J;  1OWA A;  2W27 A;  1PGQ A;  1CW5 A;  5AVT B;  4KHX A;  2RKL A;  2ZVN B;  3L75 D;  3HE4 B;  2PGD A;  2O3J A;  2NPS B;  2QM8 A;  1S1C X;  4R4L A;  1M8O B;  2C0W A;  2E74 B;  2I1J A;  3TGU G;  1NTK D;  4N78 D;  1L0N D;  1SQP E;  4ASW A;  5CBN A;  2N1T C;  1NU1 E;  3NTN A;  3V2N A;  3FGA D;  1U7J A;  2JJL A;  3GW6 A;  1CZQ A;  1JY3 O;  4WB4 A;  3RBZ A;  3N4X A;  1JO5 A;  3OAK A;  3RL0 C;  3L73 E;  1ZR2 A;  5KAI H;  1W2E A;  1P84 H;  2R32 A;  1Q2N A;  1KFN A;  1U57 A;  3SFE C;  1LWU C;  4YXW H;  1LTJ C;  4WY4 D;  3V4Q A;  4MN4 C;  3M9Q A;  2AEF A;  3PP5 A;  4D6T E;  3CCS P;  3NFQ A;  1RF1 B;  3H1K G;  3L75 E;  3CL3 D;  2ZT9 C;  4EOT A;  2B87 A;  4HH2 A;  3Q5S A;  1VQO P;  4BXL A;  1YHQ P;  1NTM D;  1QX8 A;  3MUD C;  4Y99 B;  3HUS A;  1QGK B;  4C7N B;  2HOD A;  2E76 C;  2JKV A;  2KZJ A;  1P84 E;  2GUS A;  1NH4 A;  2NPS A;  1N7S A;  3B71 A;  3CCR P;  1ZRT D;  3HE4 A;  2NRG A;  1GDT A;  3H1I E;  5DJU B;  2LKM A;  1VF5 C;  2B89 A;  1BGY D;  1M7L A;  4H13 D;  1KN7 A;  2NPS C;  1PP9 E;  2JDI H;  3L74 G;  2OYH A;  1FC2 C;  3CLQ A;  1IFI A;  3H1K J;  1TU3 F;  2OYI C;  3L73 D;  1KTM A;  3SSU A;  1L0L J;  4GOE A;  4XFJ A;  3TNU A;  2QG4 A;  2ZYG A;  2H8P D;  5APW A;  1SQX E;  3P7K A;  4C7R A;  1SQV E;  1G1I A;  2HG5 D;  2Q3I A;  4H0L B;  5CMZ A;  3MIW A;  3ITK A;  5DJT B;  3D6Z A;  2YO2 A;  1LT9 C;  1X8Y A;  3CXH E;  1M90 Q;  2M0B A;  2E43 A;  2YXQ B;  5TIS H;  3G71 P;  2QJP B;  2W8Z A;  4BRY A;  1NJI Q;  5EFW B;  4PV1 B;  1BGY E;  1JCC A;  1JY3 N;  1IK9 A;  4NPF X;  4N78 E;  3SWF A;  3B4S A;  2D2C C;  5AVX B;  3AE6 C;  2P7J A;  3L35 A;  5M1B A;  1YJ9 P;  2PRR A;  1KFM A;  2HLO A;  2WPV B;  5KLI C;  1LTI C;  2LR2 A;  3NMD A;  4PV1 C;  1M1J B;  3JC2 2;  2HPC A;  1SQV G;  3RK2 D;  1JEK A;  3KHU A;  1LTJ B;  1RH5 B;  2RMZ A;  2XV5 A;  3L37 A;  4PJ0 H;  2D2C D;  1Q86 Q;  4AQR D;  2YIU B;  2MJZ A;  1NYH A;  3CXH D;  3SWY A;  1X9V A;  3MHV A;  5APV A;  2W90 A;  4IL6 X;  3L71 D;  3L74 E;  3FWL A;  3CMA P;  1KYO E;  5C39 A;  2OTL P;  5AVU B;  2XKM A;  3PLN A;  4DCK A;  3TK1 A;  2DW3 A;  3H1H D;  1KQS O;  2C9L Y;  1EDJ A;  3L73 J;  2WPR A;  2QM7 A;  1GK4 A;  1JCD A;  2YKO A;  1NTK J;  5CJ4 A;  3Q5R A;  1E5W A;  2KP8 A;  1LGH B;  4K3A A;  1NU1 J;  2QE7 H;  2E76 B;  1YTZ I;  3AEE C; 
#chains in the Genus database with same CATH homology
 1KIL D;  3V2R A;  2IFM A;  1RF0 C;  1H88 A;  2WPS A;  5AW4 B;  1H89 A;  3CI9 A;  1RF0 A;  1G2C B;  1HGV A;  1SP4 A;  1N2D C;  2WWW A;  1URQ B;  2R5D A;  2XDJ A;  3RL0 B;  1LWU A;  3N7N A;  2KLV A;  5AW8 B;  1N7L A;  3U1A A;  1G2C A;  1HUC A;  3BRT B;  1YYC A;  4B86 A;  3M9H A;  5AVW B;  3VP9 A;  1FAV A;  2FYZ A;  3RK2 C;  3RL0 D;  1L4A A;  1SQX K;  3L36 A;  5CHX A;  4GKG A;  1JTH A;  1S9K E;  2YNY A;  5AW0 B;  5APX A;  1JTH B;  1JY3 P;  2VRS A;  4W7Z A;  1G1J A;  1JOC A;  3MTU E;  3H32 A;  4EIJ A;  2IPP A;  1N86 A;  1FZB A;  1URQ D;  4JYB A;  4Y99 C;  4IFD K;  1RE3 A;  5BU8 B;  1JY2 O;  5CCG A;  2WPQ A;  1SFC D;  1ZV8 A;  3BRV B;  1T2K D;  4AYC A;  1MFZ A;  1GU5 A;  3G3Z A;  2IX7 C;  1RE4 C;  2Z5I A;  1LTG C;  1SLQ A;  4W7Y A;  3BAS A;  5AVZ B;  4LGD E;  2WSC H;  3HD7 B;  4JF7 A;  1J1E C;  3B5N C;  2C0X A;  3IFM A;  3H32 B;  1N7S D;  3KDP B;  1HH0 A;  1T3J A;  2OYI A;  1GZL A;  2ZFC A;  3VOP A;  2GUV A;  2KSJ A;  1T2K C;  1HGZ A;  3H6P A;  4I2L C;  3VTP C;  2E42 A;  2CPB A;  2HFE D;  3A7O A;  5AW3 B;  3HTK B;  4OH8 B;  5APT A;  1L4A B;  2N1T A;  2PP6 A;  3V2Q A;  2KOG A;  2FKW B;  2POH A;  1A02 J;  2WZ7 A;  2W6B A;  3BAT A;  1LTS C;  3M91 A;  4W80 A;  2H7H A;  1GW3 A;  1FZF A;  3KPE A;  2C9N Y;  5AVR B;  2A45 G;  4N6J A;  2YMY A;  3HRN A;  1SQV K;  1N73 C;  1KQL A;  2FFD A;  2CPS A;  5AW1 B;  2NPS D;  3A2A A;  5AW2 B;  2OYH B;  3GHG B;  1GD2 E;  1N7S C;  3C9I A;  1WT6 A;  3EFG A;  1GL2 A;  1FZC B;  2HOD B;  3P8M C;  4WY4 A;  1NWQ A;  2M8R A;  2XU6 A;  4JYC A;  3RK2 B;  1XTG B;  3WMM 0;  1FOS F;  1MV8 A;  2I1K A;  1QL1 A;  3V2P A;  3RK3 C;  1ZR4 A;  1NO4 A;  2A45 H;  5AW7 B;  1FZG A;  1LTJ A;  1CSB A;  1Z56 A;  5APY A;  1M1J A;  5AVV B;  1XTC C;  2HYN A;  1SQB K;  2WT7 A;  3LW5 H;  1NAF A;  3VMX A;  3VYI A;  5BU5 A;  1IFJ A;  3M0D A;  1S9K D;  1AFO A;  1NOH A;  1DH3 A;  3HE5 B;  4I1L A;  3KYQ A;  4XE5 B;  2O1K A;  1SQQ K;  3VMY A;  1QL2 A;  1FZC C;  3MGN A;  1JNM A;  1A02 F;  2OYH C;  5AVQ B;  3E1I A;  5AW9 B;  1GL2 B;  4I6M C;  3A3Y B;  5AW5 B;  1IFM A;  1GU4 A;  3KQG A;  2M3B A;  1FU1 A;  4HYT B;  2L5G B;  5CCH A;  1LT9 A;  2WSF H;  5APS A;  2FFD B;  4RES B;  2YO3 A;  1FZA A;  4N3Y B;  5CCG C;  1RF1 A;  2WT7 B;  1RE4 A;  1AQ5 A;  3R2P A;  2FXM A;  2YKQ A;  1JUN A;  1IJD B;  5CCG D;  2N9B A;  1JY2 P;  1NKN A;  1L4A C;  5APU A;  1DEB A;  4AUW A;  3HTK A;  2OYI B;  2WIT A;  1IC2 A;  4WY4 B;  2J59 M;  1OXZ A;  3VP8 A;  1EQ7 A;  5AVS B;  1FDM A;  1FZC A;  2Q9I A;  1PFI A;  3HD7 A;  3L4F A;  1NKZ B;  4WY4 C;  4C46 A;  1GTW A;  1J2J B;  2J58 A;  1SFC C;  3B8E B;  3HD7 C;  1J1E B;  1YTZ T;  3GHG A;  1FJP A;  2R5B A;  1T3U A;  3B5N B;  1MZ9 A;  2Z4E A;  1ZN5 A;  3OJA B;  1SFC A;  3P8C E;  3GHG C;  4XA4 A;  1URQ C;  5AW6 B;  3NXS A;  1GK6 A;  1HTL C;  3B5N D;  1VDF A;  1HWT C;  1KIL B;  1IO4 A;  2N1T D;  3M9B A;  1IFD A;  4O9B A;  1RE3 C;  2FYU K;  3OA7 A;  1SFC B;  3I5C A;  1LTA C;  2JEE A;  3M0D C;  2P67 A;  2ZXE B;  1N73 A;  2FFD C;  2N1T B;  2XNX A;  3MUD A;  3O8Z A;  3UIA A;  4DOJ A;  1NTM K;  2WSE H;  3U1C A;  4IFM A;  1NTZ K;  2IFN A;  3TYY A;  1GL2 C;  4ZKU A;  1KZU B;  2P2U A;  1NHL A;  5KJ7 D;  2Z5H A;  4DZO A;  3TSI A;  1FOS E;  2OAR A;  4WBA A;  4LLH A;  3T97 A;  1N73 B;  1SQP K;  5BVZ A;  5KJ7 C;  1CI6 B;  3II6 A;  1JMM A;  5AVY B;  4GT1 A;  1HBW A;  2WTY A;  1X79 B;  5KJ7 A;  2O1J A;  1JY2 N;  1HVV A;  1J1D B;  2Q7C A;  3BVH A;  1IFN A;  4LC1 A;  1FZE A;  3VMZ A;  1URQ A;  3VN0 A;  5CCH D;  3A5T A;  1NU1 K;  4ZKP A;  2KB7 P;  1RF1 C;  1KIL C;  5APQ A;  2R3C A;  3HD7 D;  4IFF A;  1LWU B;  3MD0 A;  2A45 I;  2W6A A;  1KIL A;  3HUS C;  3P8C D;  2KYV A;  3LID A;  3RK3 B;  1J1D C;  1LTB C;  3TNU B;  1DX7 A;  1CI6 A;  3V4W A;  4M3L A;  3B5N A;  5AVX B;  2O01 H;  1SVF A;  3IR9 A;  3RK3 D;  1H8A A;  1L4A D;  1T8Z A;  1RY3 A;  3P32 A;  3V5B A;  1N7S B;  2PAJ A;  3HE5 A;  3HUS B;  4C7N A;  3U59 A;  2BAS A;  3M0A A;  1WRG A;  5CCH C;  2H43 A;  2HPC B;  1VPC A;  3M06 A;  2P1J A;  1LTT C;  1L0N K;  1HJB A;  1FJK A;  1NTK K;  5CJ0 A;  1M1J C;  4GIF A;  1L0L K;  5KLV K;  5KTB A;  2GM4 A;  1ZLL A;  2Q5U A;  3EQ2 A;  1GL2 D;  2XZR A;  1FBM A;  1MUU A;  1LT9 B;  1GW4 A;  1OWA A;  2W27 A;  1CW5 A;  5AVT B;  4KHX A;  3HE4 B;  2QM8 A;  2NPS B;  2C0W A;  2I1J A;  4N78 D;  2N1T C;  3NTN A;  3V2N A;  2JJL A;  1CZQ A;  1JY3 O;  4WB4 A;  3N4X A;  1JO5 A;  3OAK A;  3RL0 C;  1ZR2 A;  1W2E A;  2R32 A;  1KFN A;  1LWU C;  1LTJ C;  4WY4 D;  3V4Q A;  3M9Q A;  3PP5 A;  1RF1 B;  3NFQ A;  3CL3 D;  4EOT A;  4HH2 A;  4Y99 B;  3HUS A;  4C7N B;  2HOD A;  2GUS A;  1NH4 A;  2NPS A;  1N7S A;  1GDT A;  3HE4 A;  2LKM A;  1M7L A;  2NPS C;  2OYH A;  3CLQ A;  1IFI A;  2OYI C;  3TNU A;  2H8P D;  5APW A;  3P7K A;  4C7R A;  1G1I A;  2HG5 D;  2Q3I A;  5CMZ A;  3MIW A;  2YO2 A;  1LT9 C;  1X8Y A;  2E43 A;  1JCC A;  1JY3 N;  1IK9 A;  3SWF A;  4N78 E;  2P7J A;  3L35 A;  1KFM A;  2HLO A;  1LTI C;  3NMD A;  2HPC A;  1M1J B;  3RK2 D;  1LTJ B;  2XV5 A;  3L37 A;  4AQR D;  2MJZ A;  3SWY A;  1X9V A;  5APV A;  5AVU B;  2XKM A;  3TK1 A;  2C9L Y;  2WPR A;  2QM7 A;  1GK4 A;  1JCD A;  2YKO A;  5CJ4 A;  1E5W A;  2KP8 A;  1LGH B;  2YKP A;  1YTZ I;  3LIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...