2W6AA

X-ray structure of the dimeric git1 coiled-coil domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
63
structure length
61
Chain Sequence
b'GPLGDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRKLQREIHKLQAENLQLRQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ARF GTPASE-ACTIVATING PROTEIN GIT1
publication title Structures of Dimeric Git1 and Trimeric Beta-Pix and Implications for Git-Pix Complex Assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 24
structure length 61
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2w6aA00
2IPPA 1YYCA 1CSBA 3A5TA 5AVZB 1HJBA 3LIEA 3P7KA 1FOSE 3VYIA 1H89A 2VRSA 2XZRA 3M9BA 3NFQA 4LC1A 2XU6A 3A2AA 1FAVA 2W6AA 3T97A 3VMXA 2WT7A 1GK6A 1SLQA 5CMZA 5APUA 4AUWA 4XE5B 5AW7B 2YNYA 2WTYA 2Q3IA 3V5BA 2W27A 3VN0A 3M91A 4C7NA 3IR9A 5APXA 5APTA 3HE5B 5AVTB 5AW3B 4GT1A 3UIAA 2WPSA 3VTPC 1H8AA 1A02F 1IO4A 3M0DA 1GK4A 3NXSA 2N9BA 5AVSB 5AVWB 3KQGA 4M3LA 2C9NY 4RESB 1HBWA 1CI6B 2QM8A 3HE4A 4GKGA 2YO2A 1SP4A 3L35A 4EOTA 2R5DA 3SWFA 5APWA 1GD2E 1S9KE 1NWQA 4AYCA 4JYCA 4I6MC 2BASA 1T2KC 3KDPB 2R32A 2R3CA 3TYYA 4B86A 5APYA 1H88A 1GU5A 2QM7A 1T2KD 3TNUB 5AW4B 3HTKA 2ZXEB 3LIDA 1GTWA 1JUNA 2Q5UA 1NAFA 3NMDA 2P2UA 2E43A 3O8ZA 3M0AA 2Z5IA 3A7OA 5AW8B 1S9KD 4I2LC 4DZOA 3MD0A 2WPRA 3VMZA 1A02J 2WT7B 2E42A 1MV8A 3L36A 4C46A 3L37A 2WPQA 3V4WA 3VMYA 3I5CA 1MFZA 3M06A 5APVA 4KHXA 4C7NB 5AVUB 1CZQA 1GZLA 2YO3A 5AW0B 5AVQB 1FOSF 5AW6B 2P7JA 2R5BA 1HUCA 1MUUA 3P8MC 3OAKA 2ZFCA 3NTNA 1OXZA 5AW1B 2WWWA 1DH3A 5AW2B 1HWTC 5APSA 5AVXB 1G2CB 2Z5HA 4AQRD 5AW5B 1CI6A 5AVYB 5AW9B 2P67A 3P32A 3HE4B 3V4QA 1JNMA 4JYBA 2JJLA 2Q7CA 1GU4A 3M9HA 5AVVB 1X8YA 5APQA 3TNUA 2XV5A 4HYTB 5AVRB 3B8EB 3A3YB 1OWAA 3HE5A 2KP8A 3TK1A 1J2JB 2H7HA 2C9LY 1KQLA 3MGNA
chains in the Genus database with same CATH superfamily
3A0HH 3LIEA 3PHLA 2Y0EA 4U3FG 3V5BA 5CBOA 1IK9A 1BCCD 1RQVA 1NU1G 3WUUA 1YQ4C 4GT1A 2QJYC 5K5GB 3RGUA 1URQB 2N9BA 4WY4C 3CX5H 3HUSC 1NU1E 1N7LA 3CCRP 1VQLP 2GUSA 5CCGD 1KILE 1Q86Q 1R8EA 3ZDMA 3A0HE 2Y9YA 4C7NB 1M7LA 2NPSC 3R4YA 1BDCA 3TF5A 1T8ZA 3PTZA 1DEEG 2H89C 5AW1B 1DH3A 1G2CB 2DW3A 5AW9B 3HRNA 4BWNA 1HGZA 3LW5J 2P67A 2IBZG 2QA4P 5GTHE 2J59M 3B5NC 3CX5E 1W5CE 3B8EB 3H32A 3PP5A 4OVNF 5KLVJ 3TGUG 1Q2NA 1BGYE 4BRYB 2JP3A 4HKZH 1JY2P 4XA4A 1HH0A 4EIJA 1H89A 2WT7A 3CCVP 1QX8A 3W67A 1RF1B 1T6AA 2Q3IA 1L0LD 2N1TC 3RBZA 3TGUE 3GHGA 1L4AD 1LT9A 1N7SC 3AE8C 1USEA 4GIFA 1A02F 2M3BA 2OYHA 2IYOA 3D70A 1IFNA 1N8RQ 1USDA 4GODA 2AEMA 1NWQA 1FZCB 3W68A 1NYHA 1Q90D 2JR8A 1SQVG 2K1AA 4C7RA 3V2PA 1GTWA 3USSA 4XFJA 1OZHA 5CCGA 4W7ZA 4H44B 1QGKB 4I7ZB 2WPRA 2M5AA 1VQ7P 2E5TA 3FWNA 4DCKA 3U1CA 1DIPA 3TDKA 5AVQB 2QIWA 1FOSF 3VOPA 3GF3A 1EDLA 3RL0C 4PD4D 2Z4EA 2Z5HA 1URQD 1AVOA 2OYIC 1M57D 1ZR2A 3HE4B 3GG2A 3V4QA 1L0NE 3G3ZA 2QEXP 3L71E 2JO1A 4N6JA 2POHA 2B88A 2H7HA 2C9LY 1JOCA 4LC1A 4XE5B 3EWKA 3V2RA 3GHGC 3RK3B 1EZVG 2K3RA 4LGDE 3SFDC 1JY2O 5KJ7D 2NRGA 1IO4A 4DOJA 1FZAA 2J58A 4RKUJ 4U3FJ 1YJNP 1EZVE 1NU1J 1S9KE 1Q7YQ 1NJIQ 1SQBD 3IAOA 3C9IA 4Y99C 4IOIH 2IBZI 1LT1A 2YIUB 1P84H 3NMDA 1ZR4A 4ASWA 1FJKA 3L72D 5KAFH 3L70D 2WSEJ 1W2BO 5APVA 4GOFA 5TISH 1PP9G 1T3JA 5KLIC 3H1LD 2Y0CA 2IFNA 3D71A 1JNMA 2FYUG 1PP9E 2KK7A 1JO5A 2FFDB 4HYTB 2MKVA 1OVUA 2KP8A 1LP1B 1FE6A 2L91A 3Q5RA 4WVZA 1P84E 4H44D 4KJMA 3Q5PA 1YTZT 1NH4A 1NTZD 5KAFE 1L4AC 4C7NA 1U57A 3TGUJ 4Z1MH 2O3JA 3S4RA 4TT3H 5APTA 2E5YA 4ASVA 1LTTC 5TISE 4PD4I 4A7PA 1G2CA 4L75A 1HF9A 1ZV8A 1QVGO 4RESB 3IN6A 2AEJA 1SQPG 3FXEA 2R3CA 4K35A 3TNUB 1S4XA 1K9MQ 1NTKK 2PAJA 4BRYA 3H1KG 3A7OA 1SQPE 2C0WA 1M1JA 1Z56A 2D2CB 1RF1A 2A45H 2OYIB 1MV8A 3AE2C 3L37A 2E75B 2I8DA 1JY3P 3I5CA 3M06A 3RK3D 3HD7C 2FYZA 3I55P 1GW3A 3G6EP 5CBNA 1URQC 2ZFCA 1IFJA 3G9RA 1KTMA 2G3AA 4JYBA 2Q7CA 1KB9D 2RN0A 2ZXXA 2A06G 2BEQD 5AVRB 3BCCE 1SQXG 3HE5A 2KI7B 3CCQP 1X0TA 2ZJSE 2A45G 2WVRA 3PJSK 3FX0A 4U7JA 2HPCB 2VRSA 2A06E 1SQQE 3EQ2A 1E79H 2RMZA 1SQXE 2HYNA 2H88C 2YKQA 5KLVD 5KJ7C 4Y99B 4DT0A 1KILB 4IL6X 1YI2P 1X79B 1RE4C 2ZVOB 2QM8A 3HE4A 2E74D 1HGVA 3CWBG 3GW6A 1Q82Q 1KQGB 1VF5D 3OW2O 1QL1A 1PGPA 1E5WA 5EFWB 1RY3A 2Z5IA 5KLIB 3CWBE 1QLED 2OGUA 3U59A 1OVVA 1RF1C 4WY4A 3L36A 3HUSA 1IK7A 4KHXA 3A0BH 3AEAC 5AW6B 1PPJD 3BASA 2Q1KA 2V4HA 1EDJA 3AECC 1G1IA 1VQ8P 3AE6C 5CJ0A 1FZCC 1PP9J 1GU4A 1X8YA 3SSUA 2CK3H 2Y9ZA 3E7KA 2JWAA 1DD3A 2NPSA 4PV1C 1S72P 4BXLA 4H44C 3GLMA 1YYCA 1NTMG 1FDOA 1FJPA 4CPGA 1AFOA 3NFQA 2I1JA 2D2CD 1YHQP 1N86A 2KOGA 3AE7C 2IZ1A 1LTGC 2XNDH 1BSNA 2E75D 3B5NA 4D6TG 2W83C 3Q5SA 1NTME 2WSSH 1ZW0A 3RBXA 1ZXGA 5DJTB 3A0BE 2HR3A 2WSFH 1X22A 2PGDA 3C8VA 4L73A 4D6TE 4IFDK 1KMIZ 4W7YA 2R32A 5B66H 1VL2A 4JF7A 4N78E 1KB9I 1H88A 2N1TA 5AW4B 1S5LX 3L75G 4U3FD 1NAFA 1LP1A 1N7SA 2YKOA 3HD7B 1OX3A 1SQPJ 1NU1D 1NOHA 1NO4A 2JDIH 1IFDA 3CC7P 3RK3C 3L75E 2NZ2A 3H1KJ 1KD1Q 1ZLLA 1FDMA 1EDIA 1KILD 3H1JG 1WRGA 2QG4A 2K9JB 1N73B 2XKMA 3TNUA 3VP9A 2YIUC 1JB0J 3BCCJ 2W8ZA 3H1JE 3P8CE 5B66E 1OWAA 1J2JB 1KORA 3CMAP 2IPPA 5AVZB 1FOSE 3JSVC 4H13B 2XU6A 2OYIA 1SQQJ 2O01H 3CX5D 2N9YB 2WITA 1BGYG 5AW7B 1SQXJ 3ITKA 5M1BA 1VPCA 5H2FH 2IBZD 2CPSA 3CCUP 1IFIA 2B9BA 5CHXA 1GK4A 2E74C 1AV1A 1KYOH 4M3LA 4OGQC 1CI6B 2K9YA 2FBWC 4HJGH 2M0BA 3TGUD 1KFNA 1GD2E 4AYCA 1GMJA 3PLNA 4YXDC 1VF5C 2FFDC 1JY2N 1LWUB 2M8RA 1T2KD 3Q1MA 3F89A 3CWBJ 3KPEA 4YTPC 1M8OB 2CPBA 3D6YA 2HPCA 2FYNB 1K8AQ 2L5GB 2HODA 3L4FA 4QMAA 1J1EB 2OTKE 5H2FE 2YKPA 1VQ5P 4PV1B 1SQVD 5AVXB 4EYYQ 1L0LK 1KYOE 1HVVA 1EDKA 3CCJP 1L0NG 3H1IG 2JWDA 1K05A 3L71G 3HD7D 3I56P 2D2CC 3VYIA 5BVZA 1FC2C 2W6AA 5CMZA 2E75C 5APUA 3PH0A 3H1IE 1VDFA 1SQVK 1NTMJ 3CPWO 5AVTB 2WPSA 1L2PA 4Y28J 4WWIA 1YJWP 2C9NY 1PGOA 2PP6A 3T97B 3SWFA 4D6TJ 3KHUA 1LTSC 1YTZI 1PGQA 3CC2P 1L4AA 2BEZF 5BU5A 3AEBC 2LXBA 1EZVD 3AEFC 1S9KD 1TU3F 1AQTA 3VMZA 3FXDA 1A02J 4H13D 2AXTH 2MJZA 3CX5I 4MN4C 4C46A 2LKMA 3PRJA 3L75J 2WPQA 5CJ4A 3IFMA 1GZLA 3L73G 1KILC 4GOEA 2WWWA 4YXWH 3U1AA 3H25A 2BCCE 4H0LB 4WBAA 2WSCH 4L74A 1MKMA 3L73E 2WSFJ 1MFTA 3M9HA 2YMYA 2WZ7A 1BDDA 3R2PA 2XV5A 3A3YB 4HB1A 3H1JJ 1FDIA 1LTJC 1QVFO 3HD7A 4JQ0D 2ZT9B 1URQA 1PV3A 3L74G 1PP9D 1HJBA 2E74B 1SQBK 4OGQB 1J1DC 4IFMA 1JMMA 1H0TB 5CCHD 1VF5B 2AXTE 2FYUD 1JEKA 3CXHD 3L74E 4RJTA 4PV1D 1BGYJ 5AVWB 1KQSO 3GMAA 2B87B 3CD6P 4GKGA 2K9JA 4EDFA 1EQ7A 1T2KC 3N7NA 5APYA 4OWFA 2RH0A 2I1KA 4JPZB 1IZNB 3AE1C 1NTKG 3BRTB 5KJ7A 1OW7A 3CCSP 3MD0A 1RE4A 1PFIA 2ZYAA 2FYUK 1LJ2A 1NTKE 1XTCC 2O01J 1UIIA 4HH2A 3AE5C 1HTLC 1SQPD 2YXQB 2O1JA 1LNQA 1NTZK 5AW2B 5AW5B 1CI6A 3RL0g 3KZIH 1S3JA 3H1KD 2W6JH 4N3YB 1ZMEC 1BE3E 1LWUA 5APQA 3CL3D 3HTKB 2GUVA 4EI2A 1JY3N 3MGNA 3BCCG 1EZVI 2O1KA 3VMAA 2E42A 1WT6A 2OTJP 3A2AA 2AEFA 1LTBC 1L0NJ 2YNYA 3H1IJ 1FZCA 1SQPK 1FS0E 3CI9A 3L71J 3QH9A 1SQQG 5GTIH 2QE7H 2Y0DA 3H32B 1YJ9P 2KNCB 2A06D 1SQXD 4IFFA 4O9BA 4H0LD 4JYCA 1N73C 1K73Q 1NVOA 3KDPB 4KT0J 3KZIE 2QM7A 2HFED 2JEEA 2O01N 2Q5UA 5L8RJ 1YIJP 2OYHB 3EFFK 2ZT9D 1WMKA 1RHZB 1SFCD 4H13C 1VQNP 3H1HG 2AXCA 3H6PA 3KXDA 2IFMA 4OGQD 1QL2A 2ZYGA 1N2DC 3VMYA 2Q3EA 2K37A 4TLFA 5AW0B 3MUDC 3CWBD 2P7JA 3CXHI 1P84I 3H1HE 5GTIE 1KQFB 1LTJB 2ZVNB 4I1LA 1RQUA 2BCCJ 1ZP0C 2M5AB 5KLVK 3L73J 2IZ0A 1LWUC 1ZRTE 1J1DB 1KFMA 5KTBA 3OA7A 3TK1A 5KAIH 1KQLA 1U7MA 1HWTC 2YMKA 3A5TA 3E1RA 2FYNC 1JY3O 3WMM0 1GK6A 2OYOA 5CCHC 3B4SA 4K3AA 3IR9A 1J1EC 3L74J 1Q81Q 3UIAA 1UIXA 4NPFX 2OQQA 1FZBA 2QJPB 2WPVB 4EOTA 5C39A 3Q3DA 1NTMD 3AE3C 3TYYA 2LXCB 3V6IA 1RF0A 2WSCJ 2ZYDA 2GM4A 1KC8Q 2HG5D 1RE3C 3F5HA 4D6TD 4L76A 5KAIE 3MTUE 2P1JA 2W6BA 2SPZA 1NTKJ 3D6ZA 1H0TA 1MFZA 2FFDA 1OFCX 1CZQA 3V2NA 1KN7A 3KYQA 2H43A 5APSA 1NKZB 2B87A 1BCCG 1NTMK 2QVAA 2JKVA 3L75D 1VQ4P 1IJDB 2JJLA 2A45I 3JCUH 4ZNCA 5AVVB 1BE3J 2KUBA 2KYVA 4GDOA 1BCCE 3M0DC 1Y9BA 4U3FE 2IDBA 5GTHH 2XZRA 3M9BA 1FAVA 1DD4A 1SLQA 1CW5A 3WU2H 2WTYA 3H1JD 3P8CD 3CMEP 1VQMP 3SFEC 1SS1A 5B5EH 2KSJA 2W90A 2PFXA 2GA1A 2KLVA 1NU1K 3M9QA 1AQ5A 1PGJA 3NXSA 1HBWA 1AVYA 4H0LC 1SP4A 4NPEA 1HJ0A 1RF0C 3HTKA 3JCUE 3LIDA 1BGYD 2ZT9C 1SFCC 2P2UA 3G4SP 2ZAEB 3CLQA 5AW8B 5TJHA 3AEEC 2QJKB 5AVUB 3WU2E 1GL2C 4ZMDA 2IBZE 5B5EE 2KNCA 5DJUB 3H1HJ 1M1JB 1L0LG 4IL6H 4RO0A 4R4LA 3SWKA 2Q6QA 1JMBA 3K5BA 1L0LE 4PD4H 1KILA 2E76C 1KYOD 2HLOA 4AUWA 1FBMA 3WUVA 1YBKA 3V2QA 3RK2B 3HE5B 3GF7A 1H8AA 2XDJA 1LTJA 1FZEA 2RKLA 1AA0A 5AVSB 1L0ND 3KQGA 4WB4A 1VQOP 3H1ID 5KKZB 1OMIA 1SQVE 3L35A 2G8YA 1OW6A 4LLHA 3L71D 2FXOA 4IL6E 3CCMP 1NGMB 1LGHB 1JUNA 2UWJE 3QWOC 4PD4E 3CC4P 3E1IA 5E79H 3JC22 1M56D 3VP8A 1IC2A 2ITAA 3OJAB 1L0NK 4R4MA 1HUCA 3OAKA 3WUTA 2QJYB 1AJYA 3CCLP 2K88A 4JBZA 5AVYB 2J5UA 2KLUA 4WY4B 4ZKUA 4YPCA 2QRXA 3HUSB 3EFGA 2BCCG 1LT9C 1BCCJ 2OYHC 2BCCD 1LTAC 1SQBG 1KV4A 1S5LH 3L73D 1JTHB 3Q2YA 2WQYC 5E79E 2FXPA 5APXA 3CXHH 3L72G 1JCDA 1SQBE 2NPSB 5AW3B 3L70G 1R5LA 4OH8B 5CCGC 2KS1B 3O6QB 2KSEA 1K04A 2XNXA 1SFCB 1NKNA 2V7QH 2YO2A 5APWA 1R5SA 3L72E 4I6MC 3H1LG 3L74D 3AEGC 3L70E 4W80A 3B5NB 2ZXEB 1P84D 1GL2B 3O8ZA 2P10A 2H8PD 3H1LE 1BSHA 4I2LC 3MZWB 1KYOI 2OTLP 1S5LE 3BATA 1DEBA 3MHVA 1N73A 2KIKA 2N1TB 3RK2D 2B89A 2R5BA 2WMMA 1MUUA 3FWLA 1NTZG 1N7SB 2FYUE 3II6A 3CXHE 3IF4A 2QJPC 1NAYA 4AQRD 1NTKD 2E76B 3AE9C 1FZFA 1M90Q 3CCEP 1NTZE 3C1LA 1L0LJ 1EXIA 3MUDA 1BE3G 4UB6H 3P7KA 4ZKPA 1T3UA 3S1KA 2R3SA 1BE3D 3N4XA 1KB9H 3M91A 3BRVB 1YITP 1SVFA 2KXPB 3LW5H 3RL0B 1S2EA 1PZQA 1SQVJ 2R44A 2R5DA 5BU8B 4WY4D 1M1KQ 1VQ9P 4DJGA 1OVRA 3BCCD 5CCHA 1D7MA 1OW8A 1GU5A 3H1KE 2M3EA 3B71A 2FKWB 4UB8H 2E43A 3RK3E 3M0AA 1RH5B 1VQ6P 1SQQD 1Y8AA 3TSIA 4DZOA 2FY8A 2C0XA 4UB6E 1LTIC 2WT7B 1XTGB 2YXRB 1GDTA 4PJ0H 3GHGB 1KB9E 1LT9B 2NPSD 3NTNA 1OXZA 1NHLA 1RE3A 2IX7C 3P32A 5KLVG 1IFPA 1VQPP 1DX7A 3AEDC 1OIPA 2HODB 3H1HD 3B5ND 3ABVC 1SQQK 1PL5A 1S1CX 1SQXK 5KLVE 2KZIA 1GL2D 1CSBA 4UB8E 1G1JA 1ZRTD 1U7JA 3VMXA 3T97A 2W27A 2QJKC 3VN0A 3G71P 1JCCA 1X9VA 2N1TD 1FZGA 1SQBJ 2PRRA 3VTPC 4PJ0E 3M0DA 1N7SD 1M1JC 3BVHA 3S9OA 2E76D 3L72J 1PPJG 2BASA 2FXMA 3L70J 1KZUB 2QSIA 4B86A 2P58A 1GW4A 3AE4C 1QEXA 3FGAD 1ZOYC 2KZJA 1JM0A 1PPJE 3H1LJ 1JTHA 1Y47A 2IYPA 3RK2C 3V4WA 1VQKP 1ZN5A 1L4AB 2YO3A 3MP7B 3SWYA 2KS1A 3O6QA 3P8MC 1W2EA 1YQ3C 2FYUJ 3RL0D 1SFCA 4I7ZC 5KKZC 3MIWA 2KB7P 1PIXA 2OARA 1EXJA 4NPDA 2Q9IA 4N78D 2V7QJ 1NTZJ 1EC5A 1MZ9A 1GL2A 1IFMA 2LR2A 1FU1A 2WSEH
chains in the Genus database with same CATH topology
2HLOA 1HJBA 3LIEA 1SQBK 2HPCB 2VRSA 4AUWA 1J1DC 3EQ2A 1FBMA 2HYNA 4IFMA 3V5BA 1JMMA 1IK9A 2YKQA 3V2QA 5CCHD 3RK2B 5KJ7C 3HE5B 4Y99B 4GT1A 1H8AA 1KILB 2XDJA 1URQB 1LTJA 1FZEA 1X79B 5AVWB 2N9BA 5AVSB 1RE4C 3KQGA 4WB4A 4WY4C 2QM8A 3HE4A 4GKGA 3L35A 3HUSC 1HGVA 4LLHA 1EQ7A 1T2KC 3N7NA 5APYA 1N7LA 1QL1A 2I1KA 1LGHB 1E5WA 1JUNA 3BRTB 5KJ7A 1RY3A 2GUSA 2Z5IA 5CCGD 3E1IA 3U59A 3MD0A 1RE4A 1RF1C 1PFIA 4WY4A 3L36A 2FYUK 3VP8A 1XTCC 3HUSA 1IC2A 4KHXA 4C7NB 1M7LA 2NPSC 4HH2A 3OJAB 1L0NK 5AW6B 1HTLC 3BASA 1HUCA 1T8ZA 3OAKA 2O1JA 5AW1B 1NTZK 5AW2B 1DH3A 1G2CB 5AW5B 1CI6A 5AVYB 5AW9B 3HRNA 1HGZA 1G1IA 2P67A 4WY4B 4ZKUA 5CJ0A 1FZCC 1GU4A 3HUSB 2J59M 4N3YB 3B5NC 1LWUA 3EFGA 1X8YA 5APQA 1LT9C 3B8EB 3CL3D 3HTKB 2GUVA 2NPSA 2OYHC 3H32A 3PP5A 1JY3N 1LTAC 3MGNA 1YYCA 1JY2P 1FJPA 1JTHB 2O1KA 1HH0A 4XA4A 4EIJA 1H89A 2E42A 3NFQA 1WT6A 2WT7A 1AFOA 2I1JA 3A2AA 1N86A 2KOGA 1LTBC 1RF1B 2YNYA 2Q3IA 1FZCA 1LTGC 1SQPK 2N1TC 3CI9A 3GHGA 3B5NA 5APXA 1L4AD 1LT9A 1JCDA 1N7SC 2NPSB 5AW3B 3H32B 4OH8B 5CCGC 4GIFA 1A02F 2M3BA 2OYHA 1IFNA 2XNXA 1SFCB 1NKNA 4IFFA 2WSFH 2YO2A 4O9BA 5APWA 1NWQA 4JYCA 1N73C 4I6MC 4IFDK 4W7YA 3KDPB 1FZCB 2R32A 4JF7A 4N78E 4W80A 1H88A 2QM7A 3B5NB 2HFED 2N1TA 5AW4B 4C7RA 2JEEA 2ZXEB 3V2PA 1GTWA 2Q5UA 1NAFA 1N7SA 2YKOA 1GL2B 2OYHB 3HD7B 3O8ZA 5CCGA 4W7ZA 2H8PD 1SFCD 4I2LC 1NOHA 2WPRA 3H6PA 1NO4A 3BATA 2IFMA 1QL2A 1DEBA 1IFDA 1N2DC 3RK3C 3U1CA 3VMYA 1N73A 2N1TB 5AW0B 3RK2D 5AVQB 1FOSF 1ZLLA 1FDMA 3VOPA 2P7JA 2R5BA 3RL0C 1MUUA 1N7SB 2Z4EA 3II6A 1KILD 1LTJB 2Z5HA 1URQD 4I1LA 4AQRD 1WRGA 2OYIC 1ZR2A 3HE4B 1FZFA 3V4QA 5KLVK 3G3ZA 1LWUC 1J1DB 1N73B 2XKMA 1KFMA 3TNUA 3VP9A 5KTBA 4N6JA 3OA7A 2POHA 3P8CE 1OWAA 3TK1A 1J2JB 3MUDA 2H7HA 2C9LY 1KQLA 1HWTC 2IPPA 3A5TA 5AVZB 3P7KA 1JOCA 4ZKPA 1FOSE 1T3UA 1JY3O 4LC1A 3WMM0 2XU6A 2OYIA 2O01H 3N4XA 1GK6A 2WITA 4XE5B 5AW7B 5CCHC 3V2RA 1VPCA 3M91A 3GHGC 3RK3B 3BRVB 3IR9A 1J1EC 2CPSA 4LGDE 1SVFA 1JY2O 3UIAA 1IFIA 5KJ7D 1IO4A 3LW5H 3RL0B 4DOJA 5CHXA 1GK4A 1FZAA 2J58A 4M3LA 1FZBA 1CI6B 4EOTA 2R5DA 5BU8B 4WY4D 1KFNA 1GD2E 1S9KE 4AYCA 2FFDC 1JY2N 3TYYA 5CCHA 1RF0A 3C9IA 1GU5A 1LWUB 2M8RA 4Y99C 1T2KD 2GM4A 2FKWB 2HG5D 3NMDA 2E43A 1ZR4A 3M0AA 1RE3C 3KPEA 1FJKA 2CPBA 3TSIA 4DZOA 2HPCA 2C0XA 3MTUE 2WT7B 1LTIC 2P1JA 1XTGB 2W6BA 2L5GB 2HODA 1MFZA 5APVA 1GDTA 2FFDA 3L4FA 3GHGB 1CZQA 1T3JA 1J1EB 1LT9B 2YKPA 3V2NA 2NPSD 3NTNA 1OXZA 3KYQA 2H43A 5APSA 5AVXB 1NKZB 1NHLA 1RE3A 2IX7C 1NTMK 2IFNA 3P32A 1IJDB 1L0LK 1JNMA 2JJLA 2A45I 1HVVA 1DX7A 5AVVB 2HODB 1JO5A 2FFDB 4HYTB 2KYVA 3B5ND 1SQQK 2KP8A 3M0DC 1SQXK 1GL2D 3HD7D 1CSBA 1G1JA 1YTZT 3VYIA 1NH4A 2XZRA 3M9BA 3VMXA 3T97A 5BVZA 1FAVA 2W6AA 1SLQA 5CMZA 5APUA 1CW5A 2WTYA 2W27A 3P8CD 3VN0A 1L4AC 1VDFA 4C7NA 1JCCA 1X9VA 2KSJA 1SQVK 2N1TD 5APTA 5AVTB 1FZGA 2KLVA 1NU1K 3M9QA 3VTPC 2WPSA 1LTTC 3M0DA 1AQ5A 1N7SD 1M1JC 1G2CA 3BVHA 3NXSA 1ZV8A 2C9NY 1HBWA 4RESB 2PP6A 1SP4A 3SWFA 2BASA 2FXMA 1RF0C 2R3CA 1KZUB 4B86A 1LTSC 1YTZI 3TNUB 1GW4A 1L4AA 3HTKA 3LIDA 1NTKK 1SFCC 2P2UA 5BU5A 2PAJA 3CLQA 3A7OA 5AW8B 2C0WA 1S9KD 1M1JA 1JTHA 1Z56A 3VMZA 1A02J 1RF1A 2A45H 2OYIB 1MV8A 2MJZA 4C46A 3L37A 2LKMA 3RK2C 2WPQA 3V4WA 1JY3P 3I5CA 3M06A 5CJ4A 5AVUB 1ZN5A 3IFMA 3RK3D 1L4AB 1GZLA 2YO3A 1GL2C 3HD7C 2FYZA 1KILC 3SWYA 1GW3A 1URQC 1W2EA 3P8MC 2ZFCA 2WWWA 1IFJA 3RL0D 1SFCA 3U1AA 1M1JB 3MIWA 2KB7P 2OARA 2Q9IA 4N78D 4JYBA 4WBAA 2WSCH 2Q7CA 3M9HA 2YMYA 2WZ7A 3R2PA 2XV5A 5AVRB 3A3YB 3HE5A 1MZ9A 1GL2A 1LTJC 3HD7A 1IFMA 1KILA 1FU1A 2A45G 2WSEH 1URQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPP A;  1YYC A;  1CSB A;  3A5T A;  5AVZ B;  1HJB A;  3LIE A;  3P7K A;  1FOS E;  3VYI A;  1H89 A;  2VRS A;  2XZR A;  3M9B A;  3NFQ A;  4LC1 A;  2XU6 A;  3A2A A;  1FAV A;  2W6A A;  3T97 A;  3VMX A;  2WT7 A;  1GK6 A;  1SLQ A;  5CMZ A;  5APU A;  4AUW A;  4XE5 B;  5AW7 B;  2YNY A;  2WTY A;  2Q3I A;  3V5B A;  2W27 A;  3VN0 A;  3M91 A;  4C7N A;  3IR9 A;  5APX A;  5APT A;  3HE5 B;  5AVT B;  5AW3 B;  4GT1 A;  3UIA A;  2WPS A;  3VTP C;  1H8A A;  1A02 F;  1IO4 A;  3M0D A;  1GK4 A;  3NXS A;  2N9B A;  5AVS B;  5AVW B;  3KQG A;  4M3L A;  2C9N Y;  4RES B;  1HBW A;  1CI6 B;  2QM8 A;  3HE4 A;  4GKG A;  2YO2 A;  1SP4 A;  3L35 A;  4EOT A;  2R5D A;  3SWF A;  5APW A;  1GD2 E;  1S9K E;  1NWQ A;  4AYC A;  4JYC A;  4I6M C;  2BAS A;  1T2K C;  3KDP B;  2R32 A;  2R3C A;  3TYY A;  4B86 A;  5APY A;  1H88 A;  1GU5 A;  2QM7 A;  1T2K D;  3TNU B;  5AW4 B;  3HTK A;  2ZXE B;  3LID A;  1GTW A;  1JUN A;  2Q5U A;  1NAF A;  3NMD A;  2P2U A;  2E43 A;  3O8Z A;  3M0A A;  2Z5I A;  3A7O A;  5AW8 B;  1S9K D;  4I2L C;  4DZO A;  3MD0 A;  2WPR A;  3VMZ A;  1A02 J;  2WT7 B;  2E42 A;  1MV8 A;  3L36 A;  4C46 A;  3L37 A;  2WPQ A;  3V4W A;  3VMY A;  3I5C A;  1MFZ A;  3M06 A;  5APV A;  4KHX A;  4C7N B;  5AVU B;  1CZQ A;  1GZL A;  2YO3 A;  5AW0 B;  5AVQ B;  1FOS F;  5AW6 B;  2P7J A;  2R5B A;  1HUC A;  1MUU A;  3P8M C;  3OAK A;  2ZFC A;  3NTN A;  1OXZ A;  5AW1 B;  2WWW A;  1DH3 A;  5AW2 B;  1HWT C;  5APS A;  5AVX B;  1G2C B;  2Z5H A;  4AQR D;  5AW5 B;  1CI6 A;  5AVY B;  5AW9 B;  2P67 A;  3P32 A;  3HE4 B;  3V4Q A;  1JNM A;  4JYB A;  2JJL A;  2Q7C A;  1GU4 A;  3M9H A;  5AVV B;  1X8Y A;  5APQ A;  3TNU A;  2XV5 A;  4HYT B;  5AVR B;  3B8E B;  3A3Y B;  1OWA A;  3HE5 A;  2KP8 A;  3TK1 A;  1J2J B;  2H7H A;  2C9L Y;  1KQL A;  3MGN A; 
#chains in the Genus database with same CATH topology
 3A0H H;  3LIE A;  3PHL A;  2Y0E A;  4U3F G;  3V5B A;  5CBO A;  1IK9 A;  1BCC D;  1RQV A;  1NU1 G;  3WUU A;  1YQ4 C;  4GT1 A;  2QJY C;  5K5G B;  3RGU A;  1URQ B;  2N9B A;  4WY4 C;  3CX5 H;  3HUS C;  1NU1 E;  1N7L A;  3CCR P;  1VQL P;  2GUS A;  5CCG D;  1KIL E;  1Q86 Q;  1R8E A;  3ZDM A;  3A0H E;  2Y9Y A;  4C7N B;  1M7L A;  2NPS C;  3R4Y A;  1BDC A;  3TF5 A;  1T8Z A;  3PTZ A;  1DEE G;  2H89 C;  5AW1 B;  1DH3 A;  1G2C B;  2DW3 A;  5AW9 B;  3HRN A;  4BWN A;  1HGZ A;  3LW5 J;  2P67 A;  2IBZ G;  2QA4 P;  5GTH E;  2J59 M;  3B5N C;  3CX5 E;  1W5C E;  3B8E B;  3H32 A;  3PP5 A;  4OVN F;  5KLV J;  3TGU G;  1Q2N A;  1BGY E;  4BRY B;  2JP3 A;  4HKZ H;  1JY2 P;  4XA4 A;  1HH0 A;  4EIJ A;  1H89 A;  2WT7 A;  3CCV P;  1QX8 A;  3W67 A;  1RF1 B;  1T6A A;  2Q3I A;  1L0L D;  2N1T C;  3RBZ A;  3TGU E;  3GHG A;  1L4A D;  1LT9 A;  1N7S C;  3AE8 C;  1USE A;  4GIF A;  1A02 F;  2M3B A;  2OYH A;  2IYO A;  3D70 A;  1IFN A;  1N8R Q;  1USD A;  4GOD A;  2AEM A;  1NWQ A;  1FZC B;  3W68 A;  1NYH A;  1Q90 D;  2JR8 A;  1SQV G;  2K1A A;  4C7R A;  3V2P A;  1GTW A;  3USS A;  4XFJ A;  1OZH A;  5CCG A;  4W7Z A;  4H44 B;  1QGK B;  4I7Z B;  2WPR A;  2M5A A;  1VQ7 P;  2E5T A;  3FWN A;  4DCK A;  3U1C A;  1DIP A;  3TDK A;  5AVQ B;  2QIW A;  1FOS F;  3VOP A;  3GF3 A;  1EDL A;  3RL0 C;  4PD4 D;  2Z4E A;  2Z5H A;  1URQ D;  1AVO A;  2OYI C;  1M57 D;  1ZR2 A;  3HE4 B;  3GG2 A;  3V4Q A;  1L0N E;  3G3Z A;  2QEX P;  3L71 E;  2JO1 A;  4N6J A;  2POH A;  2B88 A;  2H7H A;  2C9L Y;  1JOC A;  4LC1 A;  4XE5 B;  3EWK A;  3V2R A;  3GHG C;  3RK3 B;  1EZV G;  2K3R A;  4LGD E;  3SFD C;  1JY2 O;  5KJ7 D;  2NRG A;  1IO4 A;  4DOJ A;  1FZA A;  2J58 A;  4RKU J;  4U3F J;  1YJN P;  1EZV E;  1NU1 J;  1S9K E;  1Q7Y Q;  1NJI Q;  1SQB D;  3IAO A;  3C9I A;  4Y99 C;  4IOI H;  2IBZ I;  1LT1 A;  2YIU B;  1P84 H;  3NMD A;  1ZR4 A;  4ASW A;  1FJK A;  3L72 D;  5KAF H;  3L70 D;  2WSE J;  1W2B O;  5APV A;  4GOF A;  5TIS H;  1PP9 G;  1T3J A;  5KLI C;  3H1L D;  2Y0C A;  2IFN A;  3D71 A;  1JNM A;  2FYU G;  1PP9 E;  2KK7 A;  1JO5 A;  2FFD B;  4HYT B;  2MKV A;  1OVU A;  2KP8 A;  1LP1 B;  1FE6 A;  2L91 A;  3Q5R A;  4WVZ A;  1P84 E;  4H44 D;  4KJM A;  3Q5P A;  1YTZ T;  1NH4 A;  1NTZ D;  5KAF E;  1L4A C;  4C7N A;  1U57 A;  3TGU J;  4Z1M H;  2O3J A;  3S4R A;  4TT3 H;  5APT A;  2E5Y A;  4ASV A;  1LTT C;  5TIS E;  4PD4 I;  4A7P A;  1G2C A;  4L75 A;  1HF9 A;  1ZV8 A;  1QVG O;  4RES B;  3IN6 A;  2AEJ A;  1SQP G;  3FXE A;  2R3C A;  4K35 A;  3TNU B;  1S4X A;  1K9M Q;  1NTK K;  2PAJ A;  4BRY A;  3H1K G;  3A7O A;  1SQP E;  2C0W A;  1M1J A;  1Z56 A;  2D2C B;  1RF1 A;  2A45 H;  2OYI B;  1MV8 A;  3AE2 C;  3L37 A;  2E75 B;  2I8D A;  1JY3 P;  3I5C A;  3M06 A;  3RK3 D;  3HD7 C;  2FYZ A;  3I55 P;  1GW3 A;  3G6E P;  5CBN A;  1URQ C;  2ZFC A;  1IFJ A;  3G9R A;  1KTM A;  2G3A A;  4JYB A;  2Q7C A;  1KB9 D;  2RN0 A;  2ZXX A;  2A06 G;  2BEQ D;  5AVR B;  3BCC E;  1SQX G;  3HE5 A;  2KI7 B;  3CCQ P;  1X0T A;  2ZJS E;  2A45 G;  2WVR A;  3PJS K;  3FX0 A;  4U7J A;  2HPC B;  2VRS A;  2A06 E;  1SQQ E;  3EQ2 A;  1E79 H;  2RMZ A;  1SQX E;  2HYN A;  2H88 C;  2YKQ A;  5KLV D;  5KJ7 C;  4Y99 B;  4DT0 A;  1KIL B;  4IL6 X;  1YI2 P;  1X79 B;  1RE4 C;  2ZVO B;  2QM8 A;  3HE4 A;  2E74 D;  1HGV A;  3CWB G;  3GW6 A;  1Q82 Q;  1KQG B;  1VF5 D;  3OW2 O;  1QL1 A;  1PGP A;  1E5W A;  5EFW B;  1RY3 A;  2Z5I A;  5KLI B;  3CWB E;  1QLE D;  2OGU A;  3U59 A;  1OVV A;  1RF1 C;  4WY4 A;  3L36 A;  3HUS A;  1IK7 A;  4KHX A;  3A0B H;  3AEA C;  5AW6 B;  1PPJ D;  3BAS A;  2Q1K A;  2V4H A;  1EDJ A;  3AEC C;  1G1I A;  1VQ8 P;  3AE6 C;  5CJ0 A;  1FZC C;  1PP9 J;  1GU4 A;  1X8Y A;  3SSU A;  2CK3 H;  2Y9Z A;  3E7K A;  2JWA A;  1DD3 A;  2NPS A;  4PV1 C;  1S72 P;  4BXL A;  4H44 C;  3GLM A;  1YYC A;  1NTM G;  1FDO A;  1FJP A;  4CPG A;  1AFO A;  3NFQ A;  2I1J A;  2D2C D;  1YHQ P;  1N86 A;  2KOG A;  3AE7 C;  2IZ1 A;  1LTG C;  2XND H;  1BSN A;  2E75 D;  3B5N A;  4D6T G;  2W83 C;  3Q5S A;  1NTM E;  2WSS H;  1ZW0 A;  3RBX A;  1ZXG A;  5DJT B;  3A0B E;  2HR3 A;  2WSF H;  1X22 A;  2PGD A;  3C8V A;  4L73 A;  4D6T E;  4IFD K;  1KMI Z;  4W7Y A;  2R32 A;  5B66 H;  1VL2 A;  4JF7 A;  4N78 E;  1KB9 I;  1H88 A;  2N1T A;  5AW4 B;  1S5L X;  3L75 G;  4U3F D;  1NAF A;  1LP1 A;  1N7S A;  2YKO A;  3HD7 B;  1OX3 A;  1SQP J;  1NU1 D;  1NOH A;  1NO4 A;  2JDI H;  1IFD A;  3CC7 P;  3RK3 C;  3L75 E;  2NZ2 A;  3H1K J;  1KD1 Q;  1ZLL A;  1FDM A;  1EDI A;  1KIL D;  3H1J G;  1WRG A;  2QG4 A;  2K9J B;  1N73 B;  2XKM A;  3TNU A;  3VP9 A;  2YIU C;  1JB0 J;  3BCC J;  2W8Z A;  3H1J E;  3P8C E;  5B66 E;  1OWA A;  1J2J B;  1KOR A;  3CMA P;  2IPP A;  5AVZ B;  1FOS E;  3JSV C;  4H13 B;  2XU6 A;  2OYI A;  1SQQ J;  2O01 H;  3CX5 D;  2N9Y B;  2WIT A;  1BGY G;  5AW7 B;  1SQX J;  3ITK A;  5M1B A;  1VPC A;  5H2F H;  2IBZ D;  2CPS A;  3CCU P;  1IFI A;  2B9B A;  5CHX A;  1GK4 A;  2E74 C;  1AV1 A;  1KYO H;  4M3L A;  4OGQ C;  1CI6 B;  2K9Y A;  2FBW C;  4HJG H;  2M0B A;  3TGU D;  1KFN A;  1GD2 E;  4AYC A;  1GMJ A;  3PLN A;  4YXD C;  1VF5 C;  2FFD C;  1JY2 N;  1LWU B;  2M8R A;  1T2K D;  3Q1M A;  3F89 A;  3CWB J;  3KPE A;  4YTP C;  1M8O B;  2CPB A;  3D6Y A;  2HPC A;  2FYN B;  1K8A Q;  2L5G B;  2HOD A;  3L4F A;  4QMA A;  1J1E B;  2OTK E;  5H2F E;  2YKP A;  1VQ5 P;  4PV1 B;  1SQV D;  5AVX B;  4EYY Q;  1L0L K;  1KYO E;  1HVV A;  1EDK A;  3CCJ P;  1L0N G;  3H1I G;  2JWD A;  1K05 A;  3L71 G;  3HD7 D;  3I56 P;  2D2C C;  3VYI A;  5BVZ A;  1FC2 C;  2W6A A;  5CMZ A;  2E75 C;  5APU A;  3PH0 A;  3H1I E;  1VDF A;  1SQV K;  1NTM J;  3CPW O;  5AVT B;  2WPS A;  1L2P A;  4Y28 J;  4WWI A;  1YJW P;  2C9N Y;  1PGO A;  2PP6 A;  3T97 B;  3SWF A;  4D6T J;  3KHU A;  1LTS C;  1YTZ I;  1PGQ A;  3CC2 P;  1L4A A;  2BEZ F;  5BU5 A;  3AEB C;  2LXB A;  1EZV D;  3AEF C;  1S9K D;  1TU3 F;  1AQT A;  3VMZ A;  3FXD A;  1A02 J;  4H13 D;  2AXT H;  2MJZ A;  3CX5 I;  4MN4 C;  4C46 A;  2LKM A;  3PRJ A;  3L75 J;  2WPQ A;  5CJ4 A;  3IFM A;  1GZL A;  3L73 G;  1KIL C;  4GOE A;  2WWW A;  4YXW H;  3U1A A;  3H25 A;  2BCC E;  4H0L B;  4WBA A;  2WSC H;  4L74 A;  1MKM A;  3L73 E;  2WSF J;  1MFT A;  3M9H A;  2YMY A;  2WZ7 A;  1BDD A;  3R2P A;  2XV5 A;  3A3Y B;  4HB1 A;  3H1J J;  1FDI A;  1LTJ C;  1QVF O;  3HD7 A;  4JQ0 D;  2ZT9 B;  1URQ A;  1PV3 A;  3L74 G;  1PP9 D;  1HJB A;  2E74 B;  1SQB K;  4OGQ B;  1J1D C;  4IFM A;  1JMM A;  1H0T B;  5CCH D;  1VF5 B;  2AXT E;  2FYU D;  1JEK A;  3CXH D;  3L74 E;  4RJT A;  4PV1 D;  1BGY J;  5AVW B;  1KQS O;  3GMA A;  2B87 B;  3CD6 P;  4GKG A;  2K9J A;  4EDF A;  1EQ7 A;  1T2K C;  3N7N A;  5APY A;  4OWF A;  2RH0 A;  2I1K A;  4JPZ B;  1IZN B;  3AE1 C;  1NTK G;  3BRT B;  5KJ7 A;  1OW7 A;  3CCS P;  3MD0 A;  1RE4 A;  1PFI A;  2ZYA A;  2FYU K;  1LJ2 A;  1NTK E;  1XTC C;  2O01 J;  1UII A;  4HH2 A;  3AE5 C;  1HTL C;  1SQP D;  2YXQ B;  2O1J A;  1LNQ A;  1NTZ K;  5AW2 B;  5AW5 B;  1CI6 A;  3RL0 g;  3KZI H;  1S3J A;  3H1K D;  2W6J H;  4N3Y B;  1ZME C;  1BE3 E;  1LWU A;  5APQ A;  3CL3 D;  3HTK B;  2GUV A;  4EI2 A;  1JY3 N;  3MGN A;  3BCC G;  1EZV I;  2O1K A;  3VMA A;  2E42 A;  1WT6 A;  2OTJ P;  3A2A A;  2AEF A;  1LTB C;  1L0N J;  2YNY A;  3H1I J;  1FZC A;  1SQP K;  1FS0 E;  3CI9 A;  3L71 J;  3QH9 A;  1SQQ G;  5GTI H;  2QE7 H;  2Y0D A;  3H32 B;  1YJ9 P;  2KNC B;  2A06 D;  1SQX D;  4IFF A;  4O9B A;  4H0L D;  4JYC A;  1N73 C;  1K73 Q;  1NVO A;  3KDP B;  4KT0 J;  3KZI E;  2QM7 A;  2HFE D;  2JEE A;  2O01 N;  2Q5U A;  5L8R J;  1YIJ P;  2OYH B;  3EFF K;  2ZT9 D;  1WMK A;  1RHZ B;  1SFC D;  4H13 C;  1VQN P;  3H1H G;  2AXC A;  3H6P A;  3KXD A;  2IFM A;  4OGQ D;  1QL2 A;  2ZYG A;  1N2D C;  3VMY A;  2Q3E A;  2K37 A;  4TLF A;  5AW0 B;  3MUD C;  3CWB D;  2P7J A;  3CXH I;  1P84 I;  3H1H E;  5GTI E;  1KQF B;  1LTJ B;  2ZVN B;  4I1L A;  1RQU A;  2BCC J;  1ZP0 C;  2M5A B;  5KLV K;  3L73 J;  2IZ0 A;  1LWU C;  1ZRT E;  1J1D B;  1KFM A;  5KTB A;  3OA7 A;  3TK1 A;  5KAI H;  1KQL A;  1U7M A;  1HWT C;  2YMK A;  3A5T A;  3E1R A;  2FYN C;  1JY3 O;  3WMM 0;  1GK6 A;  2OYO A;  5CCH C;  3B4S A;  4K3A A;  3IR9 A;  1J1E C;  3L74 J;  1Q81 Q;  3UIA A;  1UIX A;  4NPF X;  2OQQ A;  1FZB A;  2QJP B;  2WPV B;  4EOT A;  5C39 A;  3Q3D A;  1NTM D;  3AE3 C;  3TYY A;  2LXC B;  3V6I A;  1RF0 A;  2WSC J;  2ZYD A;  2GM4 A;  1KC8 Q;  2HG5 D;  1RE3 C;  3F5H A;  4D6T D;  4L76 A;  5KAI E;  3MTU E;  2P1J A;  2W6B A;  2SPZ A;  1NTK J;  3D6Z A;  1H0T A;  1MFZ A;  2FFD A;  1OFC X;  1CZQ A;  3V2N A;  1KN7 A;  3KYQ A;  2H43 A;  5APS A;  1NKZ B;  2B87 A;  1BCC G;  1NTM K;  2QVA A;  2JKV A;  3L75 D;  1VQ4 P;  1IJD B;  2JJL A;  2A45 I;  3JCU H;  4ZNC A;  5AVV B;  1BE3 J;  2KUB A;  2KYV A;  4GDO A;  1BCC E;  3M0D C;  1Y9B A;  4U3F E;  2IDB A;  5GTH H;  2XZR A;  3M9B A;  1FAV A;  1DD4 A;  1SLQ A;  1CW5 A;  3WU2 H;  2WTY A;  3H1J D;  3P8C D;  3CME P;  1VQM P;  3SFE C;  1SS1 A;  5B5E H;  2KSJ A;  2W90 A;  2PFX A;  2GA1 A;  2KLV A;  1NU1 K;  3M9Q A;  1AQ5 A;  1PGJ A;  3NXS A;  1HBW A;  1AVY A;  4H0L C;  1SP4 A;  4NPE A;  1HJ0 A;  1RF0 C;  3HTK A;  3JCU E;  3LID A;  1BGY D;  2ZT9 C;  1SFC C;  2P2U A;  3G4S P;  2ZAE B;  3CLQ A;  5AW8 B;  5TJH A;  3AEE C;  2QJK B;  5AVU B;  3WU2 E;  1GL2 C;  4ZMD A;  2IBZ E;  5B5E E;  2KNC A;  5DJU B;  3H1H J;  1M1J B;  1L0L G;  4IL6 H;  4RO0 A;  4R4L A;  3SWK A;  2Q6Q A;  1JMB A;  3K5B A;  1L0L E;  4PD4 H;  1KIL A;  2E76 C;  1KYO D;  2HLO A;  4AUW A;  1FBM A;  3WUV A;  1YBK A;  3V2Q A;  3RK2 B;  3HE5 B;  3GF7 A;  1H8A A;  2XDJ A;  1LTJ A;  1FZE A;  2RKL A;  1AA0 A;  5AVS B;  1L0N D;  3KQG A;  4WB4 A;  1VQO P;  3H1I D;  5KKZ B;  1OMI A;  1SQV E;  3L35 A;  2G8Y A;  1OW6 A;  4LLH A;  3L71 D;  2FXO A;  4IL6 E;  3CCM P;  1NGM B;  1LGH B;  1JUN A;  2UWJ E;  3QWO C;  4PD4 E;  3CC4 P;  3E1I A;  5E79 H;  3JC2 2;  1M56 D;  3VP8 A;  1IC2 A;  2ITA A;  3OJA B;  1L0N K;  4R4M A;  1HUC A;  3OAK A;  3WUT A;  2QJY B;  1AJY A;  3CCL P;  2K88 A;  4JBZ A;  5AVY B;  2J5U A;  2KLU A;  4WY4 B;  4ZKU A;  4YPC A;  2QRX A;  3HUS B;  3EFG A;  2BCC G;  1LT9 C;  1BCC J;  2OYH C;  2BCC D;  1LTA C;  1SQB G;  1KV4 A;  1S5L H;  3L73 D;  1JTH B;  3Q2Y A;  2WQY C;  5E79 E;  2FXP A;  5APX A;  3CXH H;  3L72 G;  1JCD A;  1SQB E;  2NPS B;  5AW3 B;  3L70 G;  1R5L A;  4OH8 B;  5CCG C;  2KS1 B;  3O6Q B;  2KSE A;  1K04 A;  2XNX A;  1SFC B;  1NKN A;  2V7Q H;  2YO2 A;  5APW A;  1R5S A;  3L72 E;  4I6M C;  3H1L G;  3L74 D;  3AEG C;  3L70 E;  4W80 A;  3B5N B;  2ZXE B;  1P84 D;  1GL2 B;  3O8Z A;  2P10 A;  2H8P D;  3H1L E;  1BSH A;  4I2L C;  3MZW B;  1KYO I;  2OTL P;  1S5L E;  3BAT A;  1DEB A;  3MHV A;  1N73 A;  2KIK A;  2N1T B;  3RK2 D;  2B89 A;  2R5B A;  2WMM A;  1MUU A;  3FWL A;  1NTZ G;  1N7S B;  2FYU E;  3II6 A;  3CXH E;  3IF4 A;  2QJP C;  1NAY A;  4AQR D;  1NTK D;  2E76 B;  3AE9 C;  1FZF A;  1M90 Q;  3CCE P;  1NTZ E;  3C1L A;  1L0L J;  1EXI A;  3MUD A;  1BE3 G;  4UB6 H;  3P7K A;  4ZKP A;  1T3U A;  3S1K A;  2R3S A;  1BE3 D;  3N4X A;  1KB9 H;  3M91 A;  3BRV B;  1YIT P;  1SVF A;  2KXP B;  3LW5 H;  3RL0 B;  1S2E A;  1PZQ A;  1SQV J;  2R44 A;  2R5D A;  5BU8 B;  4WY4 D;  1M1K Q;  1VQ9 P;  4DJG A;  1OVR A;  3BCC D;  5CCH A;  1D7M A;  1OW8 A;  1GU5 A;  3H1K E;  2M3E A;  3B71 A;  2FKW B;  4UB8 H;  2E43 A;  3RK3 E;  3M0A A;  1RH5 B;  1VQ6 P;  1SQQ D;  1Y8A A;  3TSI A;  4DZO A;  2FY8 A;  2C0X A;  4UB6 E;  1LTI C;  2WT7 B;  1XTG B;  2YXR B;  1GDT A;  4PJ0 H;  3GHG B;  1KB9 E;  1LT9 B;  2NPS D;  3NTN A;  1OXZ A;  1NHL A;  1RE3 A;  2IX7 C;  3P32 A;  5KLV G;  1IFP A;  1VQP P;  1DX7 A;  3AED C;  1OIP A;  2HOD B;  3H1H D;  3B5N D;  3ABV C;  1SQQ K;  1PL5 A;  1S1C X;  1SQX K;  5KLV E;  2KZI A;  1GL2 D;  1CSB A;  4UB8 E;  1G1J A;  1ZRT D;  1U7J A;  3VMX A;  3T97 A;  2W27 A;  2QJK C;  3VN0 A;  3G71 P;  1JCC A;  1X9V A;  2N1T D;  1FZG A;  1SQB J;  2PRR A;  3VTP C;  4PJ0 E;  3M0D A;  1N7S D;  1M1J C;  3BVH A;  3S9O A;  2E76 D;  3L72 J;  1PPJ G;  2BAS A;  2FXM A;  3L70 J;  1KZU B;  2QSI A;  4B86 A;  2P58 A;  1GW4 A;  3AE4 C;  1QEX A;  3FGA D;  1ZOY C;  2KZJ A;  1JM0 A;  1PPJ E;  3H1L J;  1JTH A;  1Y47 A;  2IYP A;  3RK2 C;  3V4W A;  1VQK P;  1ZN5 A;  1L4A B;  2YO3 A;  3MP7 B;  3SWY A;  2KS1 A;  3O6Q A;  3P8M C;  1W2E A;  1YQ3 C;  2FYU J;  3RL0 D;  1SFC A;  4I7Z C;  5KKZ C;  3MIW A;  2KB7 P;  1PIX A;  2OAR A;  1EXJ A;  4NPD A;  2Q9I A;  4N78 D;  2V7Q J;  1NTZ J;  1EC5 A;  1MZ9 A;  1GL2 A;  1IFM A;  2LR2 A;  1FU1 A;  2WSE H; 
#chains in the Genus database with same CATH homology
 2HLO A;  1HJB A;  3LIE A;  1SQB K;  2HPC B;  2VRS A;  4AUW A;  1J1D C;  3EQ2 A;  1FBM A;  2HYN A;  4IFM A;  3V5B A;  1JMM A;  1IK9 A;  2YKQ A;  3V2Q A;  5CCH D;  3RK2 B;  5KJ7 C;  3HE5 B;  4Y99 B;  4GT1 A;  1H8A A;  1KIL B;  2XDJ A;  1URQ B;  1LTJ A;  1FZE A;  1X79 B;  5AVW B;  2N9B A;  5AVS B;  1RE4 C;  3KQG A;  4WB4 A;  4WY4 C;  2QM8 A;  3HE4 A;  4GKG A;  3L35 A;  3HUS C;  1HGV A;  4LLH A;  1EQ7 A;  1T2K C;  3N7N A;  5APY A;  1N7L A;  1QL1 A;  2I1K A;  1LGH B;  1E5W A;  1JUN A;  3BRT B;  5KJ7 A;  1RY3 A;  2GUS A;  2Z5I A;  5CCG D;  3E1I A;  3U59 A;  3MD0 A;  1RE4 A;  1RF1 C;  1PFI A;  4WY4 A;  3L36 A;  2FYU K;  3VP8 A;  1XTC C;  3HUS A;  1IC2 A;  4KHX A;  4C7N B;  1M7L A;  2NPS C;  4HH2 A;  3OJA B;  1L0N K;  5AW6 B;  1HTL C;  3BAS A;  1HUC A;  1T8Z A;  3OAK A;  2O1J A;  5AW1 B;  1NTZ K;  5AW2 B;  1DH3 A;  1G2C B;  5AW5 B;  1CI6 A;  5AVY B;  5AW9 B;  3HRN A;  1HGZ A;  1G1I A;  2P67 A;  4WY4 B;  4ZKU A;  5CJ0 A;  1FZC C;  1GU4 A;  3HUS B;  2J59 M;  4N3Y B;  3B5N C;  1LWU A;  3EFG A;  1X8Y A;  5APQ A;  1LT9 C;  3B8E B;  3CL3 D;  3HTK B;  2GUV A;  2NPS A;  2OYH C;  3H32 A;  3PP5 A;  1JY3 N;  1LTA C;  3MGN A;  1YYC A;  1JY2 P;  1FJP A;  1JTH B;  2O1K A;  1HH0 A;  4XA4 A;  4EIJ A;  1H89 A;  2E42 A;  3NFQ A;  1WT6 A;  2WT7 A;  1AFO A;  2I1J A;  3A2A A;  1N86 A;  2KOG A;  1LTB C;  1RF1 B;  2YNY A;  2Q3I A;  1FZC A;  1LTG C;  1SQP K;  2N1T C;  3CI9 A;  3GHG A;  3B5N A;  5APX A;  1L4A D;  1LT9 A;  1JCD A;  1N7S C;  2NPS B;  5AW3 B;  3H32 B;  4OH8 B;  5CCG C;  4GIF A;  1A02 F;  2M3B A;  2OYH A;  1IFN A;  2XNX A;  1SFC B;  1NKN A;  4IFF A;  2WSF H;  2YO2 A;  4O9B A;  5APW A;  1NWQ A;  4JYC A;  1N73 C;  4I6M C;  4IFD K;  4W7Y A;  3KDP B;  1FZC B;  2R32 A;  4JF7 A;  4N78 E;  4W80 A;  1H88 A;  2QM7 A;  3B5N B;  2HFE D;  2N1T A;  5AW4 B;  4C7R A;  2JEE A;  2ZXE B;  3V2P A;  1GTW A;  2Q5U A;  1NAF A;  1N7S A;  2YKO A;  1GL2 B;  2OYH B;  3HD7 B;  3O8Z A;  5CCG A;  4W7Z A;  2H8P D;  1SFC D;  4I2L C;  1NOH A;  2WPR A;  3H6P A;  1NO4 A;  3BAT A;  2IFM A;  1QL2 A;  1DEB A;  1IFD A;  1N2D C;  3RK3 C;  3U1C A;  3VMY A;  1N73 A;  2N1T B;  5AW0 B;  3RK2 D;  5AVQ B;  1FOS F;  1ZLL A;  1FDM A;  3VOP A;  2P7J A;  2R5B A;  3RL0 C;  1MUU A;  1N7S B;  2Z4E A;  3II6 A;  1KIL D;  1LTJ B;  2Z5H A;  1URQ D;  4I1L A;  4AQR D;  1WRG A;  2OYI C;  1ZR2 A;  3HE4 B;  1FZF A;  3V4Q A;  5KLV K;  3G3Z A;  1LWU C;  1J1D B;  1N73 B;  2XKM A;  1KFM A;  3TNU A;  3VP9 A;  5KTB A;  4N6J A;  3OA7 A;  2POH A;  3P8C E;  1OWA A;  3TK1 A;  1J2J B;  3MUD A;  2H7H A;  2C9L Y;  1KQL A;  1HWT C;  2IPP A;  3A5T A;  5AVZ B;  3P7K A;  1JOC A;  4ZKP A;  1FOS E;  1T3U A;  1JY3 O;  4LC1 A;  3WMM 0;  2XU6 A;  2OYI A;  2O01 H;  3N4X A;  1GK6 A;  2WIT A;  4XE5 B;  5AW7 B;  5CCH C;  3V2R A;  1VPC A;  3M91 A;  3GHG C;  3RK3 B;  3BRV B;  3IR9 A;  1J1E C;  2CPS A;  4LGD E;  1SVF A;  1JY2 O;  3UIA A;  1IFI A;  5KJ7 D;  1IO4 A;  3LW5 H;  3RL0 B;  4DOJ A;  5CHX A;  1GK4 A;  1FZA A;  2J58 A;  4M3L A;  1FZB A;  1CI6 B;  4EOT A;  2R5D A;  5BU8 B;  4WY4 D;  1KFN A;  1GD2 E;  1S9K E;  4AYC A;  2FFD C;  1JY2 N;  3TYY A;  5CCH A;  1RF0 A;  3C9I A;  1GU5 A;  1LWU B;  2M8R A;  4Y99 C;  1T2K D;  2GM4 A;  2FKW B;  2HG5 D;  3NMD A;  2E43 A;  1ZR4 A;  3M0A A;  1RE3 C;  3KPE A;  1FJK A;  2CPB A;  3TSI A;  4DZO A;  2HPC A;  2C0X A;  3MTU E;  2WT7 B;  1LTI C;  2P1J A;  1XTG B;  2W6B A;  2L5G B;  2HOD A;  1MFZ A;  5APV A;  1GDT A;  2FFD A;  3L4F A;  3GHG B;  1CZQ A;  1T3J A;  1J1E B;  1LT9 B;  2YKP A;  3V2N A;  2NPS D;  3NTN A;  1OXZ A;  3KYQ A;  2H43 A;  5APS A;  5AVX B;  1NKZ B;  1NHL A;  1RE3 A;  2IX7 C;  1NTM K;  2IFN A;  3P32 A;  1IJD B;  1L0L K;  1JNM A;  2JJL A;  2A45 I;  1HVV A;  1DX7 A;  5AVV B;  2HOD B;  1JO5 A;  2FFD B;  4HYT B;  2KYV A;  3B5N D;  1SQQ K;  2KP8 A;  3M0D C;  1SQX K;  1GL2 D;  3HD7 D;  1CSB A;  1G1J A;  1YTZ T;  3VYI A;  1NH4 A;  2XZR A;  3M9B A;  3VMX A;  3T97 A;  5BVZ A;  1FAV A;  2W6A A;  1SLQ A;  5CMZ A;  5APU A;  1CW5 A;  2WTY A;  2W27 A;  3P8C D;  3VN0 A;  1L4A C;  1VDF A;  4C7N A;  1JCC A;  1X9V A;  2KSJ A;  1SQV K;  2N1T D;  5APT A;  5AVT B;  1FZG A;  2KLV A;  1NU1 K;  3M9Q A;  3VTP C;  2WPS A;  1LTT C;  3M0D A;  1AQ5 A;  1N7S D;  1M1J C;  1G2C A;  3BVH A;  3NXS A;  1ZV8 A;  2C9N Y;  1HBW A;  4RES B;  2PP6 A;  1SP4 A;  3SWF A;  2BAS A;  2FXM A;  1RF0 C;  2R3C A;  1KZU B;  4B86 A;  1LTS C;  1YTZ I;  3TNU B;  1GW4 A;  1L4A A;  3HTK A;  3LID A;  1NTK K;  1SFC C;  2P2U A;  5BU5 A;  2PAJ A;  3CLQ A;  3A7O A;  5AW8 B;  2C0W A;  1S9K D;  1M1J A;  1JTH A;  1Z56 A;  3VMZ A;  1A02 J;  1RF1 A;  2A45 H;  2OYI B;  1MV8 A;  2MJZ A;  4C46 A;  3L37 A;  2LKM A;  3RK2 C;  2WPQ A;  3V4W A;  1JY3 P;  3I5C A;  3M06 A;  5CJ4 A;  5AVU B;  1ZN5 A;  3IFM A;  3RK3 D;  1L4A B;  1GZL A;  2YO3 A;  1GL2 C;  3HD7 C;  2FYZ A;  1KIL C;  3SWY A;  1GW3 A;  1URQ C;  1W2E A;  3P8M C;  2ZFC A;  2WWW A;  1IFJ A;  3RL0 D;  1SFC A;  3U1A A;  1M1J B;  3MIW A;  2KB7 P;  2OAR A;  2Q9I A;  4N78 D;  4JYB A;  4WBA A;  2WSC H;  2Q7C A;  3M9H A;  2YMY A;  2WZ7 A;  3R2P A;  2XV5 A;  5AVR B;  3A3Y B;  3HE5 A;  1MZ9 A;  1GL2 A;  1LTJ C;  3HD7 A;  1IFM A;  1KIL A;  1FU1 A;  2A45 G;  2WSE H;  1URQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...