2W6AA

X-ray structure of the dimeric git1 coiled-coil domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
63
structure length
61
Chain Sequence
GPLGDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRKLQREIHKLQAENLQLRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords ARF GTPASE-ACTIVATING PROTEIN GIT1
publication title Structures of Dimeric Git1 and Trimeric Beta-Pix and Implications for Git-Pix Complex Assembly.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 24
structure length 61
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2w6aA00
5AW9B 3T97A 3V5BA 2R5DA 2ZXEB 5AW6B 2WT7B 5AVVB 1A02F 1A02J 3HE5B 4M3LA 5AW0B 3O8ZA 5AW7B 5APSA 5APYA 4HYTB 5APWA 3MD0A 1CSBA 1CI6A 1JNMA 5AVZB 1GD2E 2ZFCA 3NMDA 3LIEA 1SLQA 1X8YA 3P8MC 3VMYA 1HJBA 2JJLA 1NWQA 1FOSF 3TYYA 3P32A 1CZQA 3M9HA 3IR9A 5AW3B 3NFQA 1DH3A 5AVWB 4XE5B 1OXZA 3SWFA 2IPPA 4LC1A 1GTWA 1GK4A 1MUUA 3TK1A 2VRSA 2N9BA 3KQGA 5AVUB 2WTYA 4I2LC 2YNYA 5APVA 5APXA 1CI6B 1OWAA 3M91A 3MGNA 1HBWA 3NXSA 3VMZA 3VYIA 4C7NA 3A2AA 1FAVA 1H89A 2BASA 3M0AA 3M06A 5AVYB 3P7KA 2Z5IA 4AYCA 2R5BA 2WPSA 4JYBA 3L35A 3A5TA 5AW4B 2YO3A 1S9KD 1GU4A 4DZOA 5AVQB 1IO4A 2WT7A 5AVSB 5AW1B 3HE5A 3M0DA 3LIDA 1H88A 2Q3IA 1G2CB 2XU6A 3TNUB 3NTNA 1GZLA 2WPRA 3A7OA 1GU5A 3KDPB 2Z5HA 3VN0A 2E42A 1MFZA 3B8EB 4GKGA 3HE4A 1JUNA 2WWWA 1T2KC 1H8AA 1SP4A 1J2JB 3OAKA 1MV8A 2R32A 4I6MC 2E43A 2H7HA 1YYCA 4AUWA 2P7JA 4JYCA 2XZRA 3L37A 3L36A 2Q7CA 5AW8B 4EOTA 5CMZA 5APQA 1KQLA 5AW2B 4KHXA 4C46A 4RESB 3UIAA 3M9BA 3A3YB 3HTKA 5AW5B 1S9KE 2W6AA 2R3CA 5APUA 2C9LY 5AVTB 1GK6A 2WPQA 3V4WA 3VTPC 1HWTC 4B86A 2P2UA 2C9NY 1FOSE 4AQRD 2Q5UA 5AVXB 1T2KD 3HE4B 2QM7A 2XV5A 2YO2A 2KP8A 2QM8A 1HUCA 4GT1A 5AVRB 4C7NB 3TNUA 5APTA 2P67A 3VMXA 3I5CA 2W27A 3V4QA 1NAFA
chains in the Genus database with same CATH superfamily
2WT7B 1J1DC 4H13B 1Q81Q 2AXTE 1AVYA 3B71A 2CPSA 4BWNA 3JC22 2A45H 2FYUE 1NWQA 1CZQA 3RK2C 1P84H 5AW3B 1DH3A 3L73D 3AEBC 4OWFA 3F5HA 1KB9E 3R4YA 5AVUB 1OVUA 2C0WA 3L70E 2A06G 3WMM0 4IFDK 3M0AA 2W83C 2R5BA 1PGQA 1NYHA 1SQXG 2PFXA 1T3JA 4BXLA 2WT7A 2E76D 2ZXXA 3MUDC 1K04A 2YMYA 1S72P 3NTNA 3L74G 5B66E 3KHUA 2H89C 2YIUC 3B8EB 4N3YB 4YTPC 4N78D 1URQA 2WWWA 2FKWB 2NZ2A 3WUVA 1H8AA 4ASVA 2ZVNB 4AUWA 2JWDA 2C0XA 3GF7A 4NPFX 4HKZH 5KAFE 1JMMA 3M9BA 2BCCJ 3H6PA 3V4WA 2WPQA 1NTZG 3L73G 1Q7YQ 2DW3A 4EYYQ 3AEDC 1FZEA 3AE1C 2P67A 3U1AA 2W27A 3CCMP 5KLVK 1N7SB 3O8ZA 2WSFH 4Y99C 1GL2C 2KZJA 2FXMA 1SQBK 2V7QJ 2E75B 2IDBA 2OYIC 1KD1Q 2Z4EA 2KLUA 1URQC 2XKMA 3B5NB 4PJ0E 3Q3DA 4D6TE 2B89A 3MHVA 1SQPD 1GTWA 1MUUA 1FZAA 1PPJD 3M91A 1HBWA 2ZYDA 5CCGA 1VQ4P 3CWBJ 3M06A 1EC5A 3L35A 1P84D 1BE3D 1LWUA 2QJKB 1DX7A 1N7SA 1AA0A 4U3FJ 1VDFA 2AEMA 3CPWO 2R32A 1D7MA 1X22A 3B5NA 1IFJA 1W2BO 2P7JA 1N86A 1FBMA 4HH2A 3TGUG 3CMAP 5KKZC 1VQPP 2XDJA 4W7ZA 1PV3A 2KYVA 2K9YA 3E1RA 3VTPC 1M1JA 2WMMA 5KTBA 1N73C 3U1CA 1SQXE 1IK7A 3B4SA 1EQ7A 5KLVJ 4C7NB 2JP3A 3L74E 1Y9BA 4GIFA 1SQBJ 3MD0A 1NTMG 2GA1A 2QA4P 4RKUJ 4DJGA 2BEZF 3LIEA 2WPVB 1AJYA 3MP7B 3TYYA 4A7PA 2FY8A 4BRYB 5GTHE 3RL0B 4LC1A 2Y9YA 1W2EA 2IYOA 3L4FA 2VRSA 1SQQE 2IBZD 2O01J 4C7NA 1OMIA 3OW2O 1KC8Q 2Z5IA 4N6JA 1IFMA 1J1EC 1K05A 2NRGA 3V2PA 1GDTA 1PL5A 4JF7A 1X9VA 4D6TJ 2E42A 1MFZA 4GODA 1T6AA 2LR2A 1ZMEC 1L0NK 1LTJC 1LT9B 5E79H 3AEFC 1YYCA 2ZT9B 3SFEC 1SQQK 1S1CX 1RF1C 3KPEA 3ABVC 2O3JA 2P10A 4B86A 2Y0DA 2BCCD 1YJNP 5AVRB 4RO0A 3BCCE 1RY3A 2FBWC 2KIKA 1JMBA 1A02J 1ZXGA 2B88A 1VL2A 3CCLP 3AE7C 1R5SA 1BCCE 1LT9A 2HPCB 1M57D 2G3AA 1HJBA 3FXDA 1L0LE 1QVFO 1BSHA 2O01H 3JCUH 1EZVD 1LNQA 3TGUE 1OVVA 1JCDA 2N1TD 3RK3B 5TJHA 1GK4A 2KUBA 1L4AB 5KJ7D 2PRRA 3ZDMA 3VYIA 1H89A 5AVYB 3H1HG 1FZCC 1JY2O 1NTKE 4W7YA 4DZOA 3CWBD 1L0NJ 2HYNA 1GZLA 1JB0J 1L0LK 3EFGA 2GM4A 2HPCA 5KLIB 3VN0A 4U3FD 1SQQJ 1RE3A 3L72J 1YQ3C 1NGMB 1L4AA 4PD4H 2KZIA 1VQ5P 1RH5B 2OYHB 2WITA 4WWIA 2QJPC 1NTKK 1EZVG 1ZLLA 2QEXP 1X79B 1XTCC 3PHLA 1JY3N 3D70A 5KLVD 3H25A 3L75E 3V4QA 1SFCD 4WY4C 1OFCX 3WU2H 4UB6E 1JNMA 3E1IA 1SQBD 3D6ZA 1JM0A 1KILD 1WRGA 1LTTC 4OH8B 2OYHA 4I7ZB 1M90Q 1CW5A 2N1TC 1M56D 2QJYB 5KJ7C 5APVA 1BSNA 1CI6B 3CCJP 3M0DC 1YTZI 2QE7H 1J1DB 1L0LJ 3WUTA 3P7KA 3H1JE 3RK2D 5AVQB 1FZGA 1FDMA 1NAYA 2YMKA 1KYOD 1ZW0A 1HVVA 4H0LC 4ZNCA 3MIWA 3C1LA 3FGAD 4D6TD 1JCCA 1VF5C 2HLOA 1Y8AA 5CHXA 3L71J 2H7HA 3A0HH 1YQ4C 1NTKJ 1UIXA 3HUSC 1ZOYC 2Q7CA 1RE4C 3CCRP 4IFFA 1FS0E 5APQA 3EWKA 1BGYE 3H1IE 3H1KJ 1RF0A 2C9NY 1HWTC 2P2UA 3H1HE 1UIIA 1QVGO 4YPCA 1YIJP 2QM8A 1FDOA 1U7JA 2YIUB 4PD4D 3CLQA 1CSBA 3GF3A 4OGQB 5AVZB 3CC4P 1SQVK 1X8YA 2WQYC 2E74B 2JJLA 3KZIH 1NU1G 4U7JA 3G3ZA 5GTIE 2Q1KA 5BU5A 4PV1C 2Q6QA 3L75J 3SWFA 2IPPA 4EIJA 3RK3E 3G9RA 3GHGB 3TK1A 1GL2D 2D2CC 4EI2A 1FDIA 4Y99B 2E5YA 1PP9G 1NH4A 1URQD 3H1LG 1IZNB 4UB8E 1L0ND 1N8RQ 1JUNA 2BEQD 2AXCA 1E79H 1SQQD 2LXBA 5H2FE 3H1JJ 1Z56A 3L72D 3AEEC 1VQ9P 2KB7P 5L8RJ 5AW8B 3GHGA 4L74A 5CMZA 2FYUK 1LGHB 3A3YB 1S9KE 2C9LY 5APUA 1EDLA 2E76B 1G1IA 1LTBC 1AQ5A 4H44C 2O1KA 2ZJSE 3VMAA 1Q82Q 3FX0A 4R4MA 3V6IA 2ZVOB 1SQVJ 2Y0CA 5AW7B 5E79E 1LT1A 2L91A 1BGYJ 4TLFA 2WSEJ 5KKZB 2OQQA 5AVWB 3D6YA 1WMKA 2N9YB 3AE9C 3SWYA 2PP6A 1RHZB 2N9BA 2ITAA 1MKMA 5APXA 2OTLP 2K3RA 2XNXA 2FYNB 4H13C 2E5TA 1S3JA 1T8ZA 1BCCD 5AVSB 1L0LD 2H88C 3LIDA 2QG4A 4IL6H 5TISH 2WPRA 3KDPB 1G1JA 1R8EA 3N7NA 1T2KC 1NU1E 1GMJA 4DT0A 3RL0g 2FYUJ 3CXHH 3L71D 1S5LH 1N2DC 4KJMA 1NTKD 1YHQP 2Q3EA 2JO1A 1ZRTE 1J1EB 3H1KD 5B5EH 3L70J 1QLED 2A45I 2FXPA 1PP9E 1P84I 3PH0A 4ZKUA 3H1LE 2OTKE 1SS1A 1IFPA 2KI7B 2I8DA 2A06E 4YXDC 3P8MC 3VOPA 4W80A 3CX5H 1YI2P 1USEA 3EFFK 5DJUB 1SQPG 1ZV8A 5KAIH 2V7QH 4RJTA 1KQFB 1PPJG 5CCGC 2A45G 2YXQB 2YKQA 3L75D 1LWUC 2YNYA 4I2LC 3SWKA 2K9JB 1BE3G 3FXEA 1N7SC 1L2PA 3GG2A 2H43A 4LGDE 2AXTH 1OIPA 1Y47A 2AEJA 2E75C 1PFIA 1MFTA 1SQXK 3W68A 3B5NC 1NTZE 3L73E 5CCHA 1KB9H 5BVZA 2Y0EA 2W8ZA 3P8CE 4K3AA 1PGPA 3M9QA 3N4XA 3A0BE 2RN0A 1HF9A 1M1JC 3H1JD 2I1KA 1KQLA 1KN7A 2QJKC 1HH0A 2K9JA 3AE4C 5CJ0A 3AE3C 3CMEP 2W6AA 1VQMP 5B66H 1YBKA 2XNDH 2JEEA 4BRYA 2HFED 2HODB 2PGDA 3CXHD 4N78E 3I5CA 1NAFA 1NTZK 2R5DA 3HE5B 1SQVD 1JOCA 3BASA 5KAFH 1BGYD 3H1ID 1FOSF 3BATA 3PTZA 1JY3P 4IL6X 1PZQA 4Y28J 1LTSC 2IBZG 4GOFA 4WY4D 1R5LA 3VP9A 3I56P 2WTYA 3CI9A 2R44A 3VMZA 2FFDB 3CX5D 3SFDC 1S5LX 1ZR4A 1SQXJ 1ZP0C 3HE5A 1FE6A 1KYOH 3L74J 3T97B 2G8YA 2O1JA 3FWLA 4PJ0H 3RL0C 1ZR2A 2M5AB 1X0TA 1SQPE 2N1TB 2QRXA 1VQ8P 1PIXA 2ZYGA 1EZVI 1K73Q 1PPJE 2FYUD 4EOTA 4H0LD 1NTME 2BCCG 1P84E 1FZFA 5AW5B 2WVRA 2Q5UA 5AVXB 3PP5A 3HE4B 1NTZJ 1KB9D 1TU3F 1VF5D 1OZHA 1OW6A 1OW8A 1Q86Q 3RBXA 3L70D 2KSEA 3Q5PA 2JWAA 1LT9C 3II6A 3T97A 1KQGB 5AW6B 1DD4A 4WBAA 5APSA 1U7MA 2ZT9C 3BVHA 3BRVB 2MJZA 3KXDA 1SLQA 2YXRB 3P32A 1RQVA 2W6JH 1Q2NA 1NTMK 1NVOA 1PGJA 3HD7B 3KQGA 3LW5J 2NPSB 4WB4A 3CCEP 4I1LA 3AEAC 3CWBG 2KS1B 1SFCB 1OW7A 3AE8C 2JDIH 3CD6P 5AW4B 2YO3A 3PLNA 1JEKA 3S9OA 4PV1D 4U3FG 2SPZA 3BCCJ 1KILB 1RE3C 5GTHH 1VPCA 2D2CD 2UWJE 3L70G 1NO4A 1BCCJ 4NPEA 3RK3C 3QH9A 1L4AC 1KTMA 2O01N 3HD7A 3TGUJ 2NPSA 3UIAA 3RK2B 3U59A 1SFCA 1M8OB 2XV5A 4DOJA 1ZN5A 5KLVG 3I55P 1JY3O 1YJ9P 1FC2C 2CK3H 1M7LA 1KILA 1FJPA 5AW9B 1SQBG 1LTAC 1KYOI 2R3SA 1CI6A 1M1KQ 5EFWB 5C39A 1NTMJ 1AV1A 1DEBA 2OYHC 4H44D 1K9MQ 3NFQA 3PJSK 2HR3A 5B5EE 2RKLA 1IFDA 3CCVP 2OARA 1LP1B 1OVRA 3HTKB 4K35A 3A2AA 2A06D 5AW1B 1FU1A 1SQXD 5M1BA 4D6TG 2AEFA 4PD4I 3MUDA 1EZVE 3L74D 4H13D 3OAKA 2QJYC 1HTLC 2M8RA 4I6MC 1GL2B 1RF0C 2FYZA 4KHXA 4C46A 1LP1A 1EDJA 2YKPA 1YTZT 3HTKA 4IOIH 1KORA 1VQKP 3CWBE 2IX7C 2OYIB 1HGVA 4DCKA 1T2KD 1URQB 3AE6C 3TDKA 4HJGH 2KP8A 1NTZD 3VMXA 2WSFJ 4U3FE 3P8CD 1DD3A 2ZXEB 2P1JA 1GL2A 3IR9A 3O6QB 3K5BA 2J5UA 5DJTB 1EXIA 2OYIA 3TF5A 2OGUA 2YKOA 3H1IJ 5BU8B 2ZAEB 5KLVE 3NXSA 4UB6H 5K5GB 1S4XA 3A5TA 3H1HJ 2HG5D 4OGQC 1AQTA 2E74C 1L0NG 1SQBE 2P58A 1H88A 3A7OA 2W90A 1KILE 5CCGD 1N73B 4R4LA 3BCCD 1SQQG 1BDDA 1BDCA 1N7SD 3O6QA 3L72G 1HGZA 1VQLP 1MV8A 3GHGC 1AVOA 5CBNA 4JBZA 1LWUB 5CJ4A 3GMAA 2KNCB 3JCUE 2E75D 3TGUD 2W6BA 3B5ND 1GK6A 1FOSE 3V2QA 1KYOE 3QWOC 1JO5A 2IZ0A 2K1AA 4Z1MH 1N73A 1T3UA 3G71P 4YXWH 1MZ9A 1JTHB 5APYA 4HYTB 5APWA 2LXCB 3MTUE 1K8AQ 3VMYA 3MZWB 1M1JB 1YITP 1NTMD 2WSEH 2E76C 3BCCG 4L73A 2M0BA 2KNCA 3FWNA 1KMIZ 1LTJB 3Q1MA 1NU1K 2Q9IA 1VQNP 1LTIC 1BCCG 2KOGA 3OA7A 1L0LG 1FAVA 1DEEG 1RF1B 2WPSA 4PD4E 1IK9A 1JY2P 3V2NA 1JTHA 2L5GB 5CCHD 5GTIH 2QSIA 2WSSH 2J59M 1SP4A 3L71G 2QVAA 4TT3H 2Y9ZA 3WU2E 2E43A 1NTKG 3AE5C 4XA4A 2FYNC 3L37A 1LTJA 3F89A 3CC2P 1QX8A 3AEGC 2FXOA 4RESB 3H1KG 4O9BA 1Q90D 1RF1A 3RL0D 4UB8H 2ZYAA 1LTGC 2IYPA 4GT1A 1L0NE 4KT0J 5APTA 2RH0A 3PRJA 5AVVB 4M3LA 5H2FH 3TSIA 3GLMA 2KSJA 1FZCB 2LKMA 1N7LA 2ZFCA 3L72E 3IF4A 2IBZI 3CL3D 3SSUA 3M9HA 1NU1J 1KFNA 2RMZA 3KYQA 2POHA 3L75G 1VQOP 3G4SP 1KV4A 2WSCJ 4OVNF 1PGOA 1EDKA 2ZT9D 2JKVA 1IC2A 1NKNA 3A0HE 4AYCA 2H8PD 1AFOA 1JY2N 2QJPB 1FJKA 3C9IA 3H1HD 3CXHI 1PP9J 1FZCA 4NPDA 3JSVC 5CCHC 2Z5HA 3H1LJ 3Q5RA 4GOEA 2M3BA 2HODA 4WY4B 3AE2C 4QMAA 2OTJP 3H1JG 4JYCA 3L36A 2MKVA 5AW2B 3ITKA 2B9BA 3KZIE 2V4HA 3CCUP 2J58A 2WZ7A 2R3CA 4MN4C 1H0TB 4CPGA 3CC7P 3RK3D 1IFNA 2QIWA 1GW3A 1L4AD 3CX5I 4EDFA 1FZBA 1SQVG 1A02F 3S4RA 4L75A 2CPBA 1BGYG 3R2PA 1QGKB 3H1IG 2WSCH 1GD2E 1BE3E 2FFDA 2B87B 4WY4A 3L71E 4ASWA 3L73J 3IN6A 3Q5SA 3VP8A 4H0LB 1NHLA 4XE5B 1RQUA 3H1KE 1EDIA 3IAOA 1OXZA 1VQ7P 1VF5B 1EXJA 1H0TA 3BRTB 4XFJA 1U57A 1SQPK 1KZUB 3HUSB 2M5AA 2IFMA 2KK7A 2N1TA 2BASA 1GU4A 4JYBA 1KB9I 5KJ7A 1S9KD 3V2RA 1SVFA 3M0DA 3RBZA 3TNUB 1G2CB 1DIPA 3C8VA 3S1KA 3USSA 1GU5A 1QL1A 4JQ0D 1KQSO 2B87A 3H32B 3HE4A 2KXPB 3CCQP 1J2JB 3HD7D 2FYUG 2NPSD 1VQ6P 2K37A 4ZMDA 1GW4A 2XZRA 4LLHA 2FFDC 2JR8A 3G6EP 3HUSA 1RE4A 4AQRD 2QM7A 4PV1B 2GUSA 3Q2YA 2I1JA 1HUCA 4JPZB 3TNUA 1G2CA 3WUUA 4HB1A 2D2CB 2IBZE 2GUVA 3V5BA 3H32A 5AW0B 1IJDB 2OYOA 1USDA 3A0BH 2KS1A 3RGUA 3NMDA 3W67A 3IFMA 4IL6E 5KLIC 5TISE 1KFMA 3HRNA 3EQ2A 1IFIA 1SQPJ 1NU1D 4GDOA 3CCSP 3CXHE 1OWAA 3MGNA 2M3EA 1W5CE 1BE3J 1S5LE 3LW5H 3OJAB 4IFMA 1SQVE 1IO4A 4L76A 1ZRTD 1HJ0A 2Q3IA 2XU6A 2KLVA 5CBOA 1QL2A 3D71A 4H44B 2BCCE 1PP9D 4GKGA 3H1LD 1LJ2A 2PAJA 2IZ1A 1S2EA 3HD7C 1YJWP 4WVZA 2NPSC 4OGQD 2K88A 2E74D 1SFCC 1NOHA 1NKZB 3CX5E 3E7KA 4C7RA 3GW6A 1XTGB 5AVTB 1OX3A 1WT6A 4I7ZC 5KAIE 1QEXA 1KILC 2IFNA 1NJIQ 4ZKPA 2YO2A 1E5WA 3AECC
chains in the Genus database with same CATH topology
1NTZK 2R5DA 4WY4C 2WT7B 1J1DC 1MZ9A 3HE5B 1JTHB 5APYA 4HYTB 5APWA 1JNMA 3E1IA 1JOCA 3MTUE 2CPSA 3BASA 3VMYA 2A45H 1KILD 1NWQA 1FOSF 1M1JB 1CZQA 3BATA 2WSEH 3RK2C 1WRGA 5AW3B 1JY3P 1DH3A 1LTSC 1LTTC 4OH8B 2OYHA 4WY4D 1CW5A 3VP9A 1LTJB 2N1TC 1NU1K 2Q9IA 5AVUB 1LTIC 5KJ7C 2WTYA 5APVA 2C0WA 1CI6B 3CI9A 3VMZA 3M0DC 1YTZI 2KOGA 3OA7A 2FFDB 3WMM0 1FAVA 1J1DB 4IFDK 3M0AA 3P7KA 1RF1B 2R5BA 2WPSA 3RK2D 1ZR4A 1IK9A 1JY2P 5AVQB 1T3JA 3V2NA 2WT7A 1FZGA 3HE5A 1JTHA 1FDMA 2YMYA 3NTNA 2L5GB 5CCHD 1HVVA 3MIWA 3B8EB 4N3YB 2O1JA 4N78D 1URQA 2J59M 2WWWA 2FKWB 1H8AA 3RL0C 1JCCA 1SP4A 2HLOA 5CHXA 1ZR2A 2E43A 2H7HA 2N1TB 4AUWA 4XA4A 2C0XA 3HUSC 3L37A 2Q7CA 1LTJA 1RE4C 4IFFA 4EOTA 5APQA 4RESB 1JMMA 3M9BA 4O9BA 1RF0A 1FZFA 5AW5B 3H6PA 3V4WA 2WPQA 1HWTC 2C9NY 2P2UA 1RF1A 2Q5UA 5AVXB 3PP5A 3RL0D 3HE4B 1LTGC 1FZEA 2QM8A 4GT1A 5APTA 2P67A 3U1AA 2W27A 1LT9C 3II6A 3T97A 5AW6B 5AVVB 4M3LA 4WBAA 1N7SB 3O8ZA 5KLVK 3TSIA 5APSA 2WSFH 3BVHA 3BRVB 2KSJA 2MJZA 3CLQA 4Y99C 1GL2C 1CSBA 1FZCB 2LKMA 1N7LA 5AVZB 1SQVK 2FXMA 2ZFCA 1SLQA 1X8YA 2JJLA 3CL3D 1SQBK 3P32A 3M9HA 1KFNA 3G3ZA 3KYQA 2OYIC 1NTMK 2Z4EA 2POHA 5BU5A 1URQC 2XKMA 3B5NB 3SWFA 2IPPA 4EIJA 1GTWA 1IC2A 3HD7B 3GHGB 1MUUA 3TK1A 1GL2D 3KQGA 1NKNA 2NPSB 4WB4A 1FZAA 3M91A 1HBWA 4I1LA 5CCGA 1SFCB 3M06A 4AYCA 2H8PD 3L35A 5AW4B 2YO3A 1AFOA 4Y99B 1LWUA 1DX7A 1JY2N 1N7SA 1FJKA 1NH4A 1URQD 3C9IA 1FZCA 1KILB 5CCHC 1RE3C 1VDFA 2Z5HA 1VPCA 2M3BA 1JUNA 1NO4A 3RK3C 2HODA 4WY4B 2R32A 1L4AC 3B5NA 1IFJA 2P7JA 1Z56A 1N86A 1FBMA 4JYCA 2KB7P 3L36A 4HH2A 3HD7A 5AW8B 3GHGA 5CMZA 5AW2B 2NPSA 3UIAA 2FYUK 2XDJA 1LGHB 3RK2B 3A3YB 2J58A 1S9KE 2WZ7A 4W7ZA 1SFCA 3U59A 2R3CA 5APUA 2C9LY 2KYVA 3VTPC 1M1JA 1G1IA 1LTBC 5KTBA 1N73C 2XV5A 4DOJA 1ZN5A 1AQ5A 3U1CA 3RK3D 1IFNA 1JY3O 1EQ7A 1GW3A 1L4AD 2O1KA 4C7NB 1FZBA 1M7LA 1KILA 1FJPA 4GIFA 5AW9B 1A02F 5AW7B 1LTAC 2CPBA 3MD0A 3R2PA 1CI6A 2WSCH 1GD2E 2FFDA 3LIEA 4WY4A 1DEBA 2OYHC 3TYYA 3VP8A 4N78E 3NFQA 5AVWB 1NHLA 4XE5B 1OXZA 3RL0B 1IFDA 4LC1A 1W2EA 3SWYA 2PP6A 3BRTB 3L4FA 2VRSA 2N9BA 2OARA 5APXA 1SQPK 1KZUB 2XNXA 3HTKB 3HUSB 4C7NA 3A2AA 2IFMA 1T8ZA 2N1TA 2BASA 2Z5IA 1GU4A 4JYBA 5KJ7A 1S9KD 4N6JA 3V2RA 1SVFA 1IFMA 5AVSB 5AW1B 3M0DA 1J1EC 3LIDA 3TNUB 1G2CB 1FU1A 2WPRA 3V2PA 1GU5A 1QL1A 1GDTA 3KDPB 1G1JA 4JF7A 3H32B 1X9VA 2E42A 1MFZA 3MUDA 3HE4A 1L0NK 3N7NA 1T2KC 1J2JB 1LTJC 1LT9B 3HD7D 3OAKA 1HTLC 2M8RA 4I6MC 2NPSD 1YYCA 1GW4A 1GL2B 1RF0C 1SQQK 2XZRA 4LLHA 2FFDC 1N2DC 2FYZA 1RF1C 4KHXA 3KPEA 4C46A 2YKPA 1YTZT 3HTKA 3HUSA 1RE4A 2IX7C 4B86A 2OYIB 1J1EB 1HGVA 4AQRD 1T2KD 1URQB 2QM7A 2KP8A 2GUSA 2I1JA 2A45I 1HUCA 5AVRB 3TNUA 1G2CA 3VMXA 1RY3A 4ZKUA 3P8CD 2GUVA 3V5BA 2ZXEB 3H32A 1A02J 5AW0B 1IJDB 2P1JA 2HPCB 1LT9A 3NMDA 3P8MC 3VOPA 1HJBA 4W80A 3IFMA 1GL2A 2O01H 3IR9A 1KFMA 1ZV8A 3HRNA 3EQ2A 1IFIA 1JCDA 5CCGC 2N1TD 2A45G 3RK3B 1GK4A 2YKQA 2OYIA 1L4AB 5KJ7D 1LWUC 2YKOA 2YNYA 4I2LC 1OWAA 5BU8B 3MGNA 3NXSA 3VYIA 1N7SC 2H43A 3LW5H 3OJAB 4LGDE 1H89A 5AVYB 1FZCC 3A5TA 1JY2O 4IFMA 2HG5D 4W7YA 4DZOA 1IO4A 1H88A 2HYNA 2Q3IA 2XU6A 2KLVA 1GZLA 3A7OA 1QL2A 1L0LK 5CCGD 3EFGA 2GM4A 1N73B 2HPCA 3VN0A 1PFIA 1SQXK 4GKGA 3B5NC 1SFCD 2PAJA 1N7SD 5CCHA 5BVZA 1RE3A 1HGZA 1MV8A 3HD7C 3GHGC 3P8CE 2NPSC 3M9QA 3N4XA 1LWUB 1SFCC 1NOHA 5CJ4A 1NKZB 1M1JC 1L4AA 1KQLA 2I1KA 4C7RA 2OYHB 1HH0A 2WITA 5CJ0A 1XTGB 1NTKK 2W6AA 1ZLLA 2W6BA 5AVTB 3B5ND 1GK6A 1WT6A 1X79B 1FOSE 3V2QA 1KILC 1XTCC 2IFNA 4ZKPA 2YO2A 2JEEA 2HFED 1E5WA 1JO5A 2HODB 1JY3N 3I5CA 1N73A 3V4QA 1NAFA 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW9 B;  3T97 A;  3V5B A;  2R5D A;  2ZXE B;  5AW6 B;  2WT7 B;  5AVV B;  1A02 F;  1A02 J;  3HE5 B;  4M3L A;  5AW0 B;  3O8Z A;  5AW7 B;  5APS A;  5APY A;  4HYT B;  5APW A;  3MD0 A;  1CSB A;  1CI6 A;  1JNM A;  5AVZ B;  1GD2 E;  2ZFC A;  3NMD A;  3LIE A;  1SLQ A;  1X8Y A;  3P8M C;  3VMY A;  1HJB A;  2JJL A;  1NWQ A;  1FOS F;  3TYY A;  3P32 A;  1CZQ A;  3M9H A;  3IR9 A;  5AW3 B;  3NFQ A;  1DH3 A;  5AVW B;  4XE5 B;  1OXZ A;  3SWF A;  2IPP A;  4LC1 A;  1GTW A;  1GK4 A;  1MUU A;  3TK1 A;  2VRS A;  2N9B A;  3KQG A;  5AVU B;  2WTY A;  4I2L C;  2YNY A;  5APV A;  5APX A;  1CI6 B;  1OWA A;  3M91 A;  3MGN A;  1HBW A;  3NXS A;  3VMZ A;  3VYI A;  4C7N A;  3A2A A;  1FAV A;  1H89 A;  2BAS A;  3M0A A;  3M06 A;  5AVY B;  3P7K A;  2Z5I A;  4AYC A;  2R5B A;  2WPS A;  4JYB A;  3L35 A;  3A5T A;  5AW4 B;  2YO3 A;  1S9K D;  1GU4 A;  4DZO A;  5AVQ B;  1IO4 A;  2WT7 A;  5AVS B;  5AW1 B;  3HE5 A;  3M0D A;  3LID A;  1H88 A;  2Q3I A;  1G2C B;  2XU6 A;  3TNU B;  3NTN A;  1GZL A;  2WPR A;  3A7O A;  1GU5 A;  3KDP B;  2Z5H A;  3VN0 A;  2E42 A;  1MFZ A;  3B8E B;  4GKG A;  3HE4 A;  1JUN A;  2WWW A;  1T2K C;  1H8A A;  1SP4 A;  1J2J B;  3OAK A;  1MV8 A;  2R32 A;  4I6M C;  2E43 A;  2H7H A;  1YYC A;  4AUW A;  2P7J A;  4JYC A;  2XZR A;  3L37 A;  3L36 A;  2Q7C A;  5AW8 B;  4EOT A;  5CMZ A;  5APQ A;  1KQL A;  5AW2 B;  4KHX A;  4C46 A;  4RES B;  3UIA A;  3M9B A;  3A3Y B;  3HTK A;  5AW5 B;  1S9K E;  2W6A A;  2R3C A;  5APU A;  2C9L Y;  5AVT B;  1GK6 A;  2WPQ A;  3V4W A;  3VTP C;  1HWT C;  4B86 A;  2P2U A;  2C9N Y;  1FOS E;  4AQR D;  2Q5U A;  5AVX B;  1T2K D;  3HE4 B;  2QM7 A;  2XV5 A;  2YO2 A;  2KP8 A;  2QM8 A;  1HUC A;  4GT1 A;  5AVR B;  4C7N B;  3TNU A;  5APT A;  2P67 A;  3VMX A;  3I5C A;  2W27 A;  3V4Q A;  1NAF A; 
#chains in the Genus database with same CATH topology
 2WT7 B;  1J1D C;  4H13 B;  1Q81 Q;  2AXT E;  1AVY A;  3B71 A;  2CPS A;  4BWN A;  3JC2 2;  2A45 H;  2FYU E;  1NWQ A;  1CZQ A;  3RK2 C;  1P84 H;  5AW3 B;  1DH3 A;  3L73 D;  3AEB C;  4OWF A;  3F5H A;  1KB9 E;  3R4Y A;  5AVU B;  1OVU A;  2C0W A;  3L70 E;  2A06 G;  3WMM 0;  4IFD K;  3M0A A;  2W83 C;  2R5B A;  1PGQ A;  1NYH A;  1SQX G;  2PFX A;  1T3J A;  4BXL A;  2WT7 A;  2E76 D;  2ZXX A;  3MUD C;  1K04 A;  2YMY A;  1S72 P;  3NTN A;  3L74 G;  5B66 E;  3KHU A;  2H89 C;  2YIU C;  3B8E B;  4N3Y B;  4YTP C;  4N78 D;  1URQ A;  2WWW A;  2FKW B;  2NZ2 A;  3WUV A;  1H8A A;  4ASV A;  2ZVN B;  4AUW A;  2JWD A;  2C0X A;  3GF7 A;  4NPF X;  4HKZ H;  5KAF E;  1JMM A;  3M9B A;  2BCC J;  3H6P A;  3V4W A;  2WPQ A;  1NTZ G;  3L73 G;  1Q7Y Q;  2DW3 A;  4EYY Q;  3AED C;  1FZE A;  3AE1 C;  2P67 A;  3U1A A;  2W27 A;  3CCM P;  5KLV K;  1N7S B;  3O8Z A;  2WSF H;  4Y99 C;  1GL2 C;  2KZJ A;  2FXM A;  1SQB K;  2V7Q J;  2E75 B;  2IDB A;  2OYI C;  1KD1 Q;  2Z4E A;  2KLU A;  1URQ C;  2XKM A;  3B5N B;  4PJ0 E;  3Q3D A;  4D6T E;  2B89 A;  3MHV A;  1SQP D;  1GTW A;  1MUU A;  1FZA A;  1PPJ D;  3M91 A;  1HBW A;  2ZYD A;  5CCG A;  1VQ4 P;  3CWB J;  3M06 A;  1EC5 A;  3L35 A;  1P84 D;  1BE3 D;  1LWU A;  2QJK B;  1DX7 A;  1N7S A;  1AA0 A;  4U3F J;  1VDF A;  2AEM A;  3CPW O;  2R32 A;  1D7M A;  1X22 A;  3B5N A;  1IFJ A;  1W2B O;  2P7J A;  1N86 A;  1FBM A;  4HH2 A;  3TGU G;  3CMA P;  5KKZ C;  1VQP P;  2XDJ A;  4W7Z A;  1PV3 A;  2KYV A;  2K9Y A;  3E1R A;  3VTP C;  1M1J A;  2WMM A;  5KTB A;  1N73 C;  3U1C A;  1SQX E;  1IK7 A;  3B4S A;  1EQ7 A;  5KLV J;  4C7N B;  2JP3 A;  3L74 E;  1Y9B A;  4GIF A;  1SQB J;  3MD0 A;  1NTM G;  2GA1 A;  2QA4 P;  4RKU J;  4DJG A;  2BEZ F;  3LIE A;  2WPV B;  1AJY A;  3MP7 B;  3TYY A;  4A7P A;  2FY8 A;  4BRY B;  5GTH E;  3RL0 B;  4LC1 A;  2Y9Y A;  1W2E A;  2IYO A;  3L4F A;  2VRS A;  1SQQ E;  2IBZ D;  2O01 J;  4C7N A;  1OMI A;  3OW2 O;  1KC8 Q;  2Z5I A;  4N6J A;  1IFM A;  1J1E C;  1K05 A;  2NRG A;  3V2P A;  1GDT A;  1PL5 A;  4JF7 A;  1X9V A;  4D6T J;  2E42 A;  1MFZ A;  4GOD A;  1T6A A;  2LR2 A;  1ZME C;  1L0N K;  1LTJ C;  1LT9 B;  5E79 H;  3AEF C;  1YYC A;  2ZT9 B;  3SFE C;  1SQQ K;  1S1C X;  1RF1 C;  3KPE A;  3ABV C;  2O3J A;  2P10 A;  4B86 A;  2Y0D A;  2BCC D;  1YJN P;  5AVR B;  4RO0 A;  3BCC E;  1RY3 A;  2FBW C;  2KIK A;  1JMB A;  1A02 J;  1ZXG A;  2B88 A;  1VL2 A;  3CCL P;  3AE7 C;  1R5S A;  1BCC E;  1LT9 A;  2HPC B;  1M57 D;  2G3A A;  1HJB A;  3FXD A;  1L0L E;  1QVF O;  1BSH A;  2O01 H;  3JCU H;  1EZV D;  1LNQ A;  3TGU E;  1OVV A;  1JCD A;  2N1T D;  3RK3 B;  5TJH A;  1GK4 A;  2KUB A;  1L4A B;  5KJ7 D;  2PRR A;  3ZDM A;  3VYI A;  1H89 A;  5AVY B;  3H1H G;  1FZC C;  1JY2 O;  1NTK E;  4W7Y A;  4DZO A;  3CWB D;  1L0N J;  2HYN A;  1GZL A;  1JB0 J;  1L0L K;  3EFG A;  2GM4 A;  2HPC A;  5KLI B;  3VN0 A;  4U3F D;  1SQQ J;  1RE3 A;  3L72 J;  1YQ3 C;  1NGM B;  1L4A A;  4PD4 H;  2KZI A;  1VQ5 P;  1RH5 B;  2OYH B;  2WIT A;  4WWI A;  2QJP C;  1NTK K;  1EZV G;  1ZLL A;  2QEX P;  1X79 B;  1XTC C;  3PHL A;  1JY3 N;  3D70 A;  5KLV D;  3H25 A;  3L75 E;  3V4Q A;  1SFC D;  4WY4 C;  1OFC X;  3WU2 H;  4UB6 E;  1JNM A;  3E1I A;  1SQB D;  3D6Z A;  1JM0 A;  1KIL D;  1WRG A;  1LTT C;  4OH8 B;  2OYH A;  4I7Z B;  1M90 Q;  1CW5 A;  2N1T C;  1M56 D;  2QJY B;  5KJ7 C;  5APV A;  1BSN A;  1CI6 B;  3CCJ P;  3M0D C;  1YTZ I;  2QE7 H;  1J1D B;  1L0L J;  3WUT A;  3P7K A;  3H1J E;  3RK2 D;  5AVQ B;  1FZG A;  1FDM A;  1NAY A;  2YMK A;  1KYO D;  1ZW0 A;  1HVV A;  4H0L C;  4ZNC A;  3MIW A;  3C1L A;  3FGA D;  4D6T D;  1JCC A;  1VF5 C;  2HLO A;  1Y8A A;  5CHX A;  3L71 J;  2H7H A;  3A0H H;  1YQ4 C;  1NTK J;  1UIX A;  3HUS C;  1ZOY C;  2Q7C A;  1RE4 C;  3CCR P;  4IFF A;  1FS0 E;  5APQ A;  3EWK A;  1BGY E;  3H1I E;  3H1K J;  1RF0 A;  2C9N Y;  1HWT C;  2P2U A;  3H1H E;  1UII A;  1QVG O;  4YPC A;  1YIJ P;  2QM8 A;  1FDO A;  1U7J A;  2YIU B;  4PD4 D;  3CLQ A;  1CSB A;  3GF3 A;  4OGQ B;  5AVZ B;  3CC4 P;  1SQV K;  1X8Y A;  2WQY C;  2E74 B;  2JJL A;  3KZI H;  1NU1 G;  4U7J A;  3G3Z A;  5GTI E;  2Q1K A;  5BU5 A;  4PV1 C;  2Q6Q A;  3L75 J;  3SWF A;  2IPP A;  4EIJ A;  3RK3 E;  3G9R A;  3GHG B;  3TK1 A;  1GL2 D;  2D2C C;  4EI2 A;  1FDI A;  4Y99 B;  2E5Y A;  1PP9 G;  1NH4 A;  1URQ D;  3H1L G;  1IZN B;  4UB8 E;  1L0N D;  1N8R Q;  1JUN A;  2BEQ D;  2AXC A;  1E79 H;  1SQQ D;  2LXB A;  5H2F E;  3H1J J;  1Z56 A;  3L72 D;  3AEE C;  1VQ9 P;  2KB7 P;  5L8R J;  5AW8 B;  3GHG A;  4L74 A;  5CMZ A;  2FYU K;  1LGH B;  3A3Y B;  1S9K E;  2C9L Y;  5APU A;  1EDL A;  2E76 B;  1G1I A;  1LTB C;  1AQ5 A;  4H44 C;  2O1K A;  2ZJS E;  3VMA A;  1Q82 Q;  3FX0 A;  4R4M A;  3V6I A;  2ZVO B;  1SQV J;  2Y0C A;  5AW7 B;  5E79 E;  1LT1 A;  2L91 A;  1BGY J;  4TLF A;  2WSE J;  5KKZ B;  2OQQ A;  5AVW B;  3D6Y A;  1WMK A;  2N9Y B;  3AE9 C;  3SWY A;  2PP6 A;  1RHZ B;  2N9B A;  2ITA A;  1MKM A;  5APX A;  2OTL P;  2K3R A;  2XNX A;  2FYN B;  4H13 C;  2E5T A;  1S3J A;  1T8Z A;  1BCC D;  5AVS B;  1L0L D;  2H88 C;  3LID A;  2QG4 A;  4IL6 H;  5TIS H;  2WPR A;  3KDP B;  1G1J A;  1R8E A;  3N7N A;  1T2K C;  1NU1 E;  1GMJ A;  4DT0 A;  3RL0 g;  2FYU J;  3CXH H;  3L71 D;  1S5L H;  1N2D C;  4KJM A;  1NTK D;  1YHQ P;  2Q3E A;  2JO1 A;  1ZRT E;  1J1E B;  3H1K D;  5B5E H;  3L70 J;  1QLE D;  2A45 I;  2FXP A;  1PP9 E;  1P84 I;  3PH0 A;  4ZKU A;  3H1L E;  2OTK E;  1SS1 A;  1IFP A;  2KI7 B;  2I8D A;  2A06 E;  4YXD C;  3P8M C;  3VOP A;  4W80 A;  3CX5 H;  1YI2 P;  1USE A;  3EFF K;  5DJU B;  1SQP G;  1ZV8 A;  5KAI H;  2V7Q H;  4RJT A;  1KQF B;  1PPJ G;  5CCG C;  2A45 G;  2YXQ B;  2YKQ A;  3L75 D;  1LWU C;  2YNY A;  4I2L C;  3SWK A;  2K9J B;  1BE3 G;  3FXE A;  1N7S C;  1L2P A;  3GG2 A;  2H43 A;  4LGD E;  2AXT H;  1OIP A;  1Y47 A;  2AEJ A;  2E75 C;  1PFI A;  1MFT A;  1SQX K;  3W68 A;  3B5N C;  1NTZ E;  3L73 E;  5CCH A;  1KB9 H;  5BVZ A;  2Y0E A;  2W8Z A;  3P8C E;  4K3A A;  1PGP A;  3M9Q A;  3N4X A;  3A0B E;  2RN0 A;  1HF9 A;  1M1J C;  3H1J D;  2I1K A;  1KQL A;  1KN7 A;  2QJK C;  1HH0 A;  2K9J A;  3AE4 C;  5CJ0 A;  3AE3 C;  3CME P;  2W6A A;  1VQM P;  5B66 H;  1YBK A;  2XND H;  2JEE A;  4BRY A;  2HFE D;  2HOD B;  2PGD A;  3CXH D;  4N78 E;  3I5C A;  1NAF A;  1NTZ K;  2R5D A;  3HE5 B;  1SQV D;  1JOC A;  3BAS A;  5KAF H;  1BGY D;  3H1I D;  1FOS F;  3BAT A;  3PTZ A;  1JY3 P;  4IL6 X;  1PZQ A;  4Y28 J;  1LTS C;  2IBZ G;  4GOF A;  4WY4 D;  1R5L A;  3VP9 A;  3I56 P;  2WTY A;  3CI9 A;  2R44 A;  3VMZ A;  2FFD B;  3CX5 D;  3SFD C;  1S5L X;  1ZR4 A;  1SQX J;  1ZP0 C;  3HE5 A;  1FE6 A;  1KYO H;  3L74 J;  3T97 B;  2G8Y A;  2O1J A;  3FWL A;  4PJ0 H;  3RL0 C;  1ZR2 A;  2M5A B;  1X0T A;  1SQP E;  2N1T B;  2QRX A;  1VQ8 P;  1PIX A;  2ZYG A;  1EZV I;  1K73 Q;  1PPJ E;  2FYU D;  4EOT A;  4H0L D;  1NTM E;  2BCC G;  1P84 E;  1FZF A;  5AW5 B;  2WVR A;  2Q5U A;  5AVX B;  3PP5 A;  3HE4 B;  1NTZ J;  1KB9 D;  1TU3 F;  1VF5 D;  1OZH A;  1OW6 A;  1OW8 A;  1Q86 Q;  3RBX A;  3L70 D;  2KSE A;  3Q5P A;  2JWA A;  1LT9 C;  3II6 A;  3T97 A;  1KQG B;  5AW6 B;  1DD4 A;  4WBA A;  5APS A;  1U7M A;  2ZT9 C;  3BVH A;  3BRV B;  2MJZ A;  3KXD A;  1SLQ A;  2YXR B;  3P32 A;  1RQV A;  2W6J H;  1Q2N A;  1NTM K;  1NVO A;  1PGJ A;  3HD7 B;  3KQG A;  3LW5 J;  2NPS B;  4WB4 A;  3CCE P;  4I1L A;  3AEA C;  3CWB G;  2KS1 B;  1SFC B;  1OW7 A;  3AE8 C;  2JDI H;  3CD6 P;  5AW4 B;  2YO3 A;  3PLN A;  1JEK A;  3S9O A;  4PV1 D;  4U3F G;  2SPZ A;  3BCC J;  1KIL B;  1RE3 C;  5GTH H;  1VPC A;  2D2C D;  2UWJ E;  3L70 G;  1NO4 A;  1BCC J;  4NPE A;  3RK3 C;  3QH9 A;  1L4A C;  1KTM A;  2O01 N;  3HD7 A;  3TGU J;  2NPS A;  3UIA A;  3RK2 B;  3U59 A;  1SFC A;  1M8O B;  2XV5 A;  4DOJ A;  1ZN5 A;  5KLV G;  3I55 P;  1JY3 O;  1YJ9 P;  1FC2 C;  2CK3 H;  1M7L A;  1KIL A;  1FJP A;  5AW9 B;  1SQB G;  1LTA C;  1KYO I;  2R3S A;  1CI6 A;  1M1K Q;  5EFW B;  5C39 A;  1NTM J;  1AV1 A;  1DEB A;  2OYH C;  4H44 D;  1K9M Q;  3NFQ A;  3PJS K;  2HR3 A;  5B5E E;  2RKL A;  1IFD A;  3CCV P;  2OAR A;  1LP1 B;  1OVR A;  3HTK B;  4K35 A;  3A2A A;  2A06 D;  5AW1 B;  1FU1 A;  1SQX D;  5M1B A;  4D6T G;  2AEF A;  4PD4 I;  3MUD A;  1EZV E;  3L74 D;  4H13 D;  3OAK A;  2QJY C;  1HTL C;  2M8R A;  4I6M C;  1GL2 B;  1RF0 C;  2FYZ A;  4KHX A;  4C46 A;  1LP1 A;  1EDJ A;  2YKP A;  1YTZ T;  3HTK A;  4IOI H;  1KOR A;  1VQK P;  3CWB E;  2IX7 C;  2OYI B;  1HGV A;  4DCK A;  1T2K D;  1URQ B;  3AE6 C;  3TDK A;  4HJG H;  2KP8 A;  1NTZ D;  3VMX A;  2WSF J;  4U3F E;  3P8C D;  1DD3 A;  2ZXE B;  2P1J A;  1GL2 A;  3IR9 A;  3O6Q B;  3K5B A;  2J5U A;  5DJT B;  1EXI A;  2OYI A;  3TF5 A;  2OGU A;  2YKO A;  3H1I J;  5BU8 B;  2ZAE B;  5KLV E;  3NXS A;  4UB6 H;  5K5G B;  1S4X A;  3A5T A;  3H1H J;  2HG5 D;  4OGQ C;  1AQT A;  2E74 C;  1L0N G;  1SQB E;  2P58 A;  1H88 A;  3A7O A;  2W90 A;  1KIL E;  5CCG D;  1N73 B;  4R4L A;  3BCC D;  1SQQ G;  1BDD A;  1BDC A;  1N7S D;  3O6Q A;  3L72 G;  1HGZ A;  1VQL P;  1MV8 A;  3GHG C;  1AVO A;  5CBN A;  4JBZ A;  1LWU B;  5CJ4 A;  3GMA A;  2KNC B;  3JCU E;  2E75 D;  3TGU D;  2W6B A;  3B5N D;  1GK6 A;  1FOS E;  3V2Q A;  1KYO E;  3QWO C;  1JO5 A;  2IZ0 A;  2K1A A;  4Z1M H;  1N73 A;  1T3U A;  3G71 P;  4YXW H;  1MZ9 A;  1JTH B;  5APY A;  4HYT B;  5APW A;  2LXC B;  3MTU E;  1K8A Q;  3VMY A;  3MZW B;  1M1J B;  1YIT P;  1NTM D;  2WSE H;  2E76 C;  3BCC G;  4L73 A;  2M0B A;  2KNC A;  3FWN A;  1KMI Z;  1LTJ B;  3Q1M A;  1NU1 K;  2Q9I A;  1VQN P;  1LTI C;  1BCC G;  2KOG A;  3OA7 A;  1L0L G;  1FAV A;  1DEE G;  1RF1 B;  2WPS A;  4PD4 E;  1IK9 A;  1JY2 P;  3V2N A;  1JTH A;  2L5G B;  5CCH D;  5GTI H;  2QSI A;  2WSS H;  2J59 M;  1SP4 A;  3L71 G;  2QVA A;  4TT3 H;  2Y9Z A;  3WU2 E;  2E43 A;  1NTK G;  3AE5 C;  4XA4 A;  2FYN C;  3L37 A;  1LTJ A;  3F89 A;  3CC2 P;  1QX8 A;  3AEG C;  2FXO A;  4RES B;  3H1K G;  4O9B A;  1Q90 D;  1RF1 A;  3RL0 D;  4UB8 H;  2ZYA A;  1LTG C;  2IYP A;  4GT1 A;  1L0N E;  4KT0 J;  5APT A;  2RH0 A;  3PRJ A;  5AVV B;  4M3L A;  5H2F H;  3TSI A;  3GLM A;  2KSJ A;  1FZC B;  2LKM A;  1N7L A;  2ZFC A;  3L72 E;  3IF4 A;  2IBZ I;  3CL3 D;  3SSU A;  3M9H A;  1NU1 J;  1KFN A;  2RMZ A;  3KYQ A;  2POH A;  3L75 G;  1VQO P;  3G4S P;  1KV4 A;  2WSC J;  4OVN F;  1PGO A;  1EDK A;  2ZT9 D;  2JKV A;  1IC2 A;  1NKN A;  3A0H E;  4AYC A;  2H8P D;  1AFO A;  1JY2 N;  2QJP B;  1FJK A;  3C9I A;  3H1H D;  3CXH I;  1PP9 J;  1FZC A;  4NPD A;  3JSV C;  5CCH C;  2Z5H A;  3H1L J;  3Q5R A;  4GOE A;  2M3B A;  2HOD A;  4WY4 B;  3AE2 C;  4QMA A;  2OTJ P;  3H1J G;  4JYC A;  3L36 A;  2MKV A;  5AW2 B;  3ITK A;  2B9B A;  3KZI E;  2V4H A;  3CCU P;  2J58 A;  2WZ7 A;  2R3C A;  4MN4 C;  1H0T B;  4CPG A;  3CC7 P;  3RK3 D;  1IFN A;  2QIW A;  1GW3 A;  1L4A D;  3CX5 I;  4EDF A;  1FZB A;  1SQV G;  1A02 F;  3S4R A;  4L75 A;  2CPB A;  1BGY G;  3R2P A;  1QGK B;  3H1I G;  2WSC H;  1GD2 E;  1BE3 E;  2FFD A;  2B87 B;  4WY4 A;  3L71 E;  4ASW A;  3L73 J;  3IN6 A;  3Q5S A;  3VP8 A;  4H0L B;  1NHL A;  4XE5 B;  1RQU A;  3H1K E;  1EDI A;  3IAO A;  1OXZ A;  1VQ7 P;  1VF5 B;  1EXJ A;  1H0T A;  3BRT B;  4XFJ A;  1U57 A;  1SQP K;  1KZU B;  3HUS B;  2M5A A;  2IFM A;  2KK7 A;  2N1T A;  2BAS A;  1GU4 A;  4JYB A;  1KB9 I;  5KJ7 A;  1S9K D;  3V2R A;  1SVF A;  3M0D A;  3RBZ A;  3TNU B;  1G2C B;  1DIP A;  3C8V A;  3S1K A;  3USS A;  1GU5 A;  1QL1 A;  4JQ0 D;  1KQS O;  2B87 A;  3H32 B;  3HE4 A;  2KXP B;  3CCQ P;  1J2J B;  3HD7 D;  2FYU G;  2NPS D;  1VQ6 P;  2K37 A;  4ZMD A;  1GW4 A;  2XZR A;  4LLH A;  2FFD C;  2JR8 A;  3G6E P;  3HUS A;  1RE4 A;  4AQR D;  2QM7 A;  4PV1 B;  2GUS A;  3Q2Y A;  2I1J A;  1HUC A;  4JPZ B;  3TNU A;  1G2C A;  3WUU A;  4HB1 A;  2D2C B;  2IBZ E;  2GUV A;  3V5B A;  3H32 A;  5AW0 B;  1IJD B;  2OYO A;  1USD A;  3A0B H;  2KS1 A;  3RGU A;  3NMD A;  3W67 A;  3IFM A;  4IL6 E;  5KLI C;  5TIS E;  1KFM A;  3HRN A;  3EQ2 A;  1IFI A;  1SQP J;  1NU1 D;  4GDO A;  3CCS P;  3CXH E;  1OWA A;  3MGN A;  2M3E A;  1W5C E;  1BE3 J;  1S5L E;  3LW5 H;  3OJA B;  4IFM A;  1SQV E;  1IO4 A;  4L76 A;  1ZRT D;  1HJ0 A;  2Q3I A;  2XU6 A;  2KLV A;  5CBO A;  1QL2 A;  3D71 A;  4H44 B;  2BCC E;  1PP9 D;  4GKG A;  3H1L D;  1LJ2 A;  2PAJ A;  2IZ1 A;  1S2E A;  3HD7 C;  1YJW P;  4WVZ A;  2NPS C;  4OGQ D;  2K88 A;  2E74 D;  1SFC C;  1NOH A;  1NKZ B;  3CX5 E;  3E7K A;  4C7R A;  3GW6 A;  1XTG B;  5AVT B;  1OX3 A;  1WT6 A;  4I7Z C;  5KAI E;  1QEX A;  1KIL C;  2IFN A;  1NJI Q;  4ZKP A;  2YO2 A;  1E5W A;  3AEC C; 
#chains in the Genus database with same CATH homology
 1NTZ K;  2R5D A;  4WY4 C;  2WT7 B;  1J1D C;  1MZ9 A;  3HE5 B;  1JTH B;  5APY A;  4HYT B;  5APW A;  1JNM A;  3E1I A;  1JOC A;  3MTU E;  2CPS A;  3BAS A;  3VMY A;  2A45 H;  1KIL D;  1NWQ A;  1FOS F;  1M1J B;  1CZQ A;  3BAT A;  2WSE H;  3RK2 C;  1WRG A;  5AW3 B;  1JY3 P;  1DH3 A;  1LTS C;  1LTT C;  4OH8 B;  2OYH A;  4WY4 D;  1CW5 A;  3VP9 A;  1LTJ B;  2N1T C;  1NU1 K;  2Q9I A;  5AVU B;  1LTI C;  5KJ7 C;  2WTY A;  5APV A;  2C0W A;  1CI6 B;  3CI9 A;  3VMZ A;  3M0D C;  1YTZ I;  2KOG A;  3OA7 A;  2FFD B;  3WMM 0;  1FAV A;  1J1D B;  4IFD K;  3M0A A;  3P7K A;  1RF1 B;  2R5B A;  2WPS A;  3RK2 D;  1ZR4 A;  1IK9 A;  1JY2 P;  5AVQ B;  1T3J A;  3V2N A;  2WT7 A;  1FZG A;  3HE5 A;  1JTH A;  1FDM A;  2YMY A;  3NTN A;  2L5G B;  5CCH D;  1HVV A;  3MIW A;  3B8E B;  4N3Y B;  2O1J A;  4N78 D;  1URQ A;  2J59 M;  2WWW A;  2FKW B;  1H8A A;  3RL0 C;  1JCC A;  1SP4 A;  2HLO A;  5CHX A;  1ZR2 A;  2E43 A;  2H7H A;  2N1T B;  4AUW A;  4XA4 A;  2C0X A;  3HUS C;  3L37 A;  2Q7C A;  1LTJ A;  1RE4 C;  4IFF A;  4EOT A;  5APQ A;  4RES B;  1JMM A;  3M9B A;  4O9B A;  1RF0 A;  1FZF A;  5AW5 B;  3H6P A;  3V4W A;  2WPQ A;  1HWT C;  2C9N Y;  2P2U A;  1RF1 A;  2Q5U A;  5AVX B;  3PP5 A;  3RL0 D;  3HE4 B;  1LTG C;  1FZE A;  2QM8 A;  4GT1 A;  5APT A;  2P67 A;  3U1A A;  2W27 A;  1LT9 C;  3II6 A;  3T97 A;  5AW6 B;  5AVV B;  4M3L A;  4WBA A;  1N7S B;  3O8Z A;  5KLV K;  3TSI A;  5APS A;  2WSF H;  3BVH A;  3BRV B;  2KSJ A;  2MJZ A;  3CLQ A;  4Y99 C;  1GL2 C;  1CSB A;  1FZC B;  2LKM A;  1N7L A;  5AVZ B;  1SQV K;  2FXM A;  2ZFC A;  1SLQ A;  1X8Y A;  2JJL A;  3CL3 D;  1SQB K;  3P32 A;  3M9H A;  1KFN A;  3G3Z A;  3KYQ A;  2OYI C;  1NTM K;  2Z4E A;  2POH A;  5BU5 A;  1URQ C;  2XKM A;  3B5N B;  3SWF A;  2IPP A;  4EIJ A;  1GTW A;  1IC2 A;  3HD7 B;  3GHG B;  1MUU A;  3TK1 A;  1GL2 D;  3KQG A;  1NKN A;  2NPS B;  4WB4 A;  1FZA A;  3M91 A;  1HBW A;  4I1L A;  5CCG A;  1SFC B;  3M06 A;  4AYC A;  2H8P D;  3L35 A;  5AW4 B;  2YO3 A;  1AFO A;  4Y99 B;  1LWU A;  1DX7 A;  1JY2 N;  1N7S A;  1FJK A;  1NH4 A;  1URQ D;  3C9I A;  1FZC A;  1KIL B;  5CCH C;  1RE3 C;  1VDF A;  2Z5H A;  1VPC A;  2M3B A;  1JUN A;  1NO4 A;  3RK3 C;  2HOD A;  4WY4 B;  2R32 A;  1L4A C;  3B5N A;  1IFJ A;  2P7J A;  1Z56 A;  1N86 A;  1FBM A;  4JYC A;  2KB7 P;  3L36 A;  4HH2 A;  3HD7 A;  5AW8 B;  3GHG A;  5CMZ A;  5AW2 B;  2NPS A;  3UIA A;  2FYU K;  2XDJ A;  1LGH B;  3RK2 B;  3A3Y B;  2J58 A;  1S9K E;  2WZ7 A;  4W7Z A;  1SFC A;  3U59 A;  2R3C A;  5APU A;  2C9L Y;  2KYV A;  3VTP C;  1M1J A;  1G1I A;  1LTB C;  5KTB A;  1N73 C;  2XV5 A;  4DOJ A;  1ZN5 A;  1AQ5 A;  3U1C A;  3RK3 D;  1IFN A;  1JY3 O;  1EQ7 A;  1GW3 A;  1L4A D;  2O1K A;  4C7N B;  1FZB A;  1M7L A;  1KIL A;  1FJP A;  4GIF A;  5AW9 B;  1A02 F;  5AW7 B;  1LTA C;  2CPB A;  3MD0 A;  3R2P A;  1CI6 A;  2WSC H;  1GD2 E;  2FFD A;  3LIE A;  4WY4 A;  1DEB A;  2OYH C;  3TYY A;  3VP8 A;  4N78 E;  3NFQ A;  5AVW B;  1NHL A;  4XE5 B;  1OXZ A;  3RL0 B;  1IFD A;  4LC1 A;  1W2E A;  3SWY A;  2PP6 A;  3BRT B;  3L4F A;  2VRS A;  2N9B A;  2OAR A;  5APX A;  1SQP K;  1KZU B;  2XNX A;  3HTK B;  3HUS B;  4C7N A;  3A2A A;  2IFM A;  1T8Z A;  2N1T A;  2BAS A;  2Z5I A;  1GU4 A;  4JYB A;  5KJ7 A;  1S9K D;  4N6J A;  3V2R A;  1SVF A;  1IFM A;  5AVS B;  5AW1 B;  3M0D A;  1J1E C;  3LID A;  3TNU B;  1G2C B;  1FU1 A;  2WPR A;  3V2P A;  1GU5 A;  1QL1 A;  1GDT A;  3KDP B;  1G1J A;  4JF7 A;  3H32 B;  1X9V A;  2E42 A;  1MFZ A;  3MUD A;  3HE4 A;  1L0N K;  3N7N A;  1T2K C;  1J2J B;  1LTJ C;  1LT9 B;  3HD7 D;  3OAK A;  1HTL C;  2M8R A;  4I6M C;  2NPS D;  1YYC A;  1GW4 A;  1GL2 B;  1RF0 C;  1SQQ K;  2XZR A;  4LLH A;  2FFD C;  1N2D C;  2FYZ A;  1RF1 C;  4KHX A;  3KPE A;  4C46 A;  2YKP A;  1YTZ T;  3HTK A;  3HUS A;  1RE4 A;  2IX7 C;  4B86 A;  2OYI B;  1J1E B;  1HGV A;  4AQR D;  1T2K D;  1URQ B;  2QM7 A;  2KP8 A;  2GUS A;  2I1J A;  2A45 I;  1HUC A;  5AVR B;  3TNU A;  1G2C A;  3VMX A;  1RY3 A;  4ZKU A;  3P8C D;  2GUV A;  3V5B A;  2ZXE B;  3H32 A;  1A02 J;  5AW0 B;  1IJD B;  2P1J A;  2HPC B;  1LT9 A;  3NMD A;  3P8M C;  3VOP A;  1HJB A;  4W80 A;  3IFM A;  1GL2 A;  2O01 H;  3IR9 A;  1KFM A;  1ZV8 A;  3HRN A;  3EQ2 A;  1IFI A;  1JCD A;  5CCG C;  2N1T D;  2A45 G;  3RK3 B;  1GK4 A;  2YKQ A;  2OYI A;  1L4A B;  5KJ7 D;  1LWU C;  2YKO A;  2YNY A;  4I2L C;  1OWA A;  5BU8 B;  3MGN A;  3NXS A;  3VYI A;  1N7S C;  2H43 A;  3LW5 H;  3OJA B;  4LGD E;  1H89 A;  5AVY B;  1FZC C;  3A5T A;  1JY2 O;  4IFM A;  2HG5 D;  4W7Y A;  4DZO A;  1IO4 A;  1H88 A;  2HYN A;  2Q3I A;  2XU6 A;  2KLV A;  1GZL A;  3A7O A;  1QL2 A;  1L0L K;  5CCG D;  3EFG A;  2GM4 A;  1N73 B;  2HPC A;  3VN0 A;  1PFI A;  1SQX K;  4GKG A;  3B5N C;  1SFC D;  2PAJ A;  1N7S D;  5CCH A;  5BVZ A;  1RE3 A;  1HGZ A;  1MV8 A;  3HD7 C;  3GHG C;  3P8C E;  2NPS C;  3M9Q A;  3N4X A;  1LWU B;  1SFC C;  1NOH A;  5CJ4 A;  1NKZ B;  1M1J C;  1L4A A;  1KQL A;  2I1K A;  4C7R A;  2OYH B;  1HH0 A;  2WIT A;  5CJ0 A;  1XTG B;  1NTK K;  2W6A A;  1ZLL A;  2W6B A;  5AVT B;  3B5N D;  1GK6 A;  1WT6 A;  1X79 B;  1FOS E;  3V2Q A;  1KIL C;  1XTC C;  2IFN A;  4ZKP A;  2YO2 A;  2JEE A;  2HFE D;  1E5W A;  1JO5 A;  2HOD B;  1JY3 N;  3I5C A;  1N73 A;  3V4Q A;  1NAF A;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...