2W6AA

X-ray structure of the dimeric git1 coiled-coil domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
63
structure length
61
Chain Sequence
GPLGDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRKLQREIHKLQAENLQLRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ARF GTPASE-ACTIVATING PROTEIN GIT1
publication title Structures of Dimeric Git1 and Trimeric Beta-Pix and Implications for Git-Pix Complex Assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 24
structure length 61
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2w6aA00
5APYA 3TNUA 1MFZA 3M0AA 5AW9B 3VTPC 2E42A 4B86A 3A7OA 3VMZA 3NTNA 4GKGA 2W6AA 3VYIA 3V5BA 2N9BA 1GD2E 4I6MC 5AVSB 3A2AA 4JYBA 5AVQB 2Q7CA 1A02J 5APQA 3A3YB 5CMZA 5AW1B 2Z5IA 2R5BA 3TYYA 5AW6B 4AQRD 1FOSE 1GK4A 4C7NB 2R5DA 1S9KE 5APUA 2YO3A 2P67A 1CI6A 4EOTA 5AVWB 3TNUB 2C9NY 1CZQA 1KQLA 1GU5A 3V4WA 3T97A 4RESB 4AYCA 2WPRA 1YYCA 2ZFCA 3IR9A 1MUUA 5APXA 3HE4B 1FOSF 5AW8B 2KP8A 2QM8A 5AW5B 1T2KC 2ZXEB 1JNMA 4DZOA 2Q5UA 5APVA 3UIAA 3HE5A 3M9BA 1HWTC 2P2UA 3M06A 1H89A 1HJBA 1GU4A 5AW0B 4C46A 2WTYA 1FAVA 3I5CA 3LIDA 5AVTB 1S9KD 1SP4A 2JJLA 3P32A 1CI6B 5APSA 5APTA 5AVVB 2Q3IA 3SWFA 1OXZA 5APWA 1H88A 4HYTB 2YO2A 3MGNA 5AW4B 3M0DA 2Z5HA 5AVZB 1IO4A 1G2CB 3HTKA 3TK1A 5AW7B 1H8AA 3NXSA 1GTWA 2H7HA 2WPSA 4GT1A 1DH3A 3OAKA 2XU6A 1J2JB 2IPPA 4XE5B 1SLQA 3A5TA 4M3LA 1T2KD 2R32A 1MV8A 5AVRB 3NMDA 1HUCA 4LC1A 3VMYA 3M9HA 3KDPB 2WT7A 2XZRA 1CSBA 2WWWA 5AW3B 3L36A 3L35A 3VMXA 3NFQA 4JYCA 5AVUB 3KQGA 2R3CA 2VRSA 2QM7A 1JUNA 3LIEA 1A02F 3HE5B 3HE4A 1OWAA 3M91A 2C9LY 2W27A 3MD0A 1X8YA 2WPQA 3P7KA 3VN0A 1GZLA 4KHXA 2WT7B 3L37A 2XV5A 3O8ZA 2E43A 5AVYB 1NAFA 4AUWA 1GK6A 2BASA 5AVXB 2P7JA 3P8MC 5AW2B 3V4QA 4C7NA 4I2LC 1HBWA 3B8EB 2YNYA 1NWQA
chains in the Genus database with same CATH superfamily
1MFZA 4K35A 2RN0A 1KB9H 3V2QA 1WT6A 2WPVB 3CXHH 1FU1A 2Q7CA 2Z5IA 3FGAD 1PGJA 1NOHA 3D70A 3AE6C 3H1HJ 1JNMA 4UB8H 3G71P 3M06A 2H8PD 2JO1A 1RY3A 2FYUD 2KUBA 3P32A 2FXMA 3G4SP 5AVVB 1K73Q 1IFPA 2N1TD 5AW4B 3QH9A 1QL2A 1G2CB 2D2CC 1GL2A 2KS1B 2WPSA 2E74C 3ABVC 3C9IA 3OAKA 5GTIE 1FZCA 1JTHB 1L0NG 2AEMA 3AEEC 1GL2C 3AE4C 3GLMA 2IFMA 4GODA 2Y9ZA 3EFFK 1JUNA 2YMYA 1FZCC 3GG2A 1SQPG 3HE4A 3LW5J 1WMKA 4PV1C 3AE7C 4OGQB 1Y8AA 1S5LX 2O1KA 4I2LC 3RK2D 2K3RA 1JOCA 2YMKA 1IFIA 1J1DB 3CCQP 3CI9A 3VYIA 2G3AA 2OYIA 1EDKA 1Y47A 1KORA 1GW4A 3H1HG 1S9KE 3B71A 1HVVA 3H1JJ 2OYIC 1NO4A 2IYPA 3MHVA 3MZWB 5APVA 3AE2C 4PD4E 3L75E 4YPCA 3SSUA 1YHQP 1S9KD 3Q1MA 3E1IA 2IBZI 5C39A 2BCCE 1JB0J 3T97B 1FZBA 2Z5HA 2QEXP 1K8AQ 5BVZA 3H1JE 3P8CE 3VP8A 3WUUA 4PD4D 3B5NB 3L75D 1NTMK 2QE7H 1N7SB 2AEJA 2BCCD 1SQQE 3D6YA 1N73A 3V2NA 3H1IJ 4U3FJ 2VRSA 3A0HE 2W6BA 2KOGA 1XTGB 4IFMA 1OFCX 3MD0A 2WSCJ 1N73C 1SQQD 2WT7B 3AEGC 4UB6E 2KZJA 5E79H 2GUVA 1DEBA 2BASA 1KYOE 2P7JA 1YQ4C 1L4AB 2XKMA 1L0LK 4N6JA 4ZNCA 1R5LA 2O1JA 1USDA 1YTZI 2WVRA 5AVQB 3H1JG 2RKLA 1AV1A 3S1KA 1VF5C 2FYNC 3L72E 1KYOD 1KMIZ 1AVYA 1PFIA 3E7KA 1KILA 3AEDC 1CZQA 5CJ0A 4WVZA 1YYCA 3CPWO 2KP8A 2ZXEB 2Q5UA 3CWBJ 3AEFC 1NU1J 2WTYA 3L72D 1RF1B 1PGQA 1KILC 2SPZA 3S9OA 3LW5H 5KAFE 1J1EC 4R4LA 3M0DA 1PPJE 2PFXA 2ITAA 3AE3C 3SFDC 2GA1A 4GIFA 4BWNA 1E79H 1JY2O 1CW5A 3H1IG 4U3FG 3FWLA 1MV8A 3M0DC 3M9HA 2E76B 2XZRA 5AW3B 3HTKB 3L71J 1IK9A 1JY3O 1SQBJ 1KB9I 4WY4B 1VDFA 4QMAA 3CXHI 3CCVP 1ZRTE 2XNDH 2IBZD 1FS0E 4R4MA 1RF0A 1YBKA 1SVFA 3Q5PA 1AVOA 1NTZJ 4AUWA 3II6A 1JY2N 3TNUA 1YJNP 1ZMEC 1NTMJ 1NAYA 4GKGA 2K37A 1RF0C 2N9BA 3Q3DA 1JY3N 1KQFB 3TGUE 1SQVK 3RL0C 1ZR4A 4OGQD 2QA4P 3CWBG 2OTJP 1NU1G 1X22A 1FOSF 3JSVC 3TGUD 3UIAA 1P84I 2PAJA 1OMIA 3L73E 3PTZA 3SWFA 5APWA 1NTKE 2WSCH 4HYTB 2WSEJ 1M1KQ 3CCJP 1RH5B 4OVNF 4Z1MH 3IAOA 5KKZB 2D2CB 2KLUA 1X0TA 2KYVA 3L71G 1VQ4P 1SQBG 2Z4EA 3NMDA 2ZJSE 3L73D 4LC1A 1NTKD 3KDPB 1IJDB 3L36A 1JCCA 4MN4C 1L0LD 3N7NA 5DJTB 2Y0CA 5KAFH 5B66H 2BEQD 1VQ7P 1FZCB 1WRGA 1NTZG 4IFFA 3B5ND 5KLVD 2O01N 4ZKPA 2H88C 4PV1B 1N7SD 3GF3A 2FYUK 1NTMG 3FWNA 4W7YA 4PJ0E 3AE1C 4WBAA 1FDOA 5GTHH 1KB9E 3QWOC 3JC22 1DD3A 1U57A 3CXHE 3AECC 2E42A 4ASWA 4DCKA 1LTSC 3NTNA 2WMMA 3BRTB 3HD7D 1N7LA 1M1JA 2HR3A 2K88A 3TYYA 4AQRD 1FOSE 1KB9D 4IL6H 3CXHD 2QSIA 2I8DA 1L4AD 2OYIB 1X79B 1K9MQ 1SQXE 2MJZA 1M1JC 5AW0B 3L70J 1M90Q 3LIDA 2JJLA 5APSA 2Q3IA 1OXZA 4DJGA 3CCEP 1BCCE 1SQXD 1LTJA 1EZVE 5KLIB 2JEEA 2RMZA 2Y0EA 2OYHA 2CPSA 2NPSA 1EDIA 4IL6X 5B5EH 2QIWA 1LTJC 1BCCD 1BGYJ 3SWYA 1EZVD 3MUDA 3IF4A 1VQ8P 2OYHC 3RK3C 2I1JA 1ZN5A 3HE5B 2NPSC 4WWIA 2FYZA 1JY2P 3VN0A 4YXDC 1SQVD 3E1RA 3GW6A 3MUDC 4HKZH 2NZ2A 1NKZB 3ITKA 3O8ZA 1NAFA 2OGUA 1HBWA 1JY3P 2E76D 2B89A 5APYA 4B86A 1KQSO 4WY4D 5AVSB 1NGMB 1S4XA 2WSEH 2KZIA 3CMAP 2BEZF 2R44A 3L70G 1BDCA 1M8OB 4PJ0H 2AXTE 1AQTA 1L0NE 1ZOYC 1GU4A 2FYUJ 4PD4I 1SQQK 2E5YA 1OIPA 2LR2A 2FKWB 1SQPE 1T8ZA 2M5AB 2HYNA 1J1EB 1KTMA 1IO4A 1LTIC 1GTWA 1L0ND 4GT1A 1BGYG 3GHGA 4JQ0D 5K5GB 1N86A 1S72P 3AEAC 1SQPD 1FE6A 3WU2H 1R5SA 1S5LH 1L2PA 4H0LB 3GHGC 1NYHA 1IFNA 2QJPC 3M91A 1LP1B 3H1HE 2D2CD 2WSSH 5E79E 3I55P 2E74D 2B87A 5BU8B 1QVFO 2J5UA 4Y28J 1H0TB 1URQA 1NHLA 1KYOI 3VTPC 2YKOA 1GL2D 2OTLP 3H1HD 3FXEA 1IZNB 1Q81Q 3A2AA 1VQPP 1A02J 2A45G 2L5GB 5CMZA 5AW1B 4GOFA 3MIWA 1URQC 1FZAA 4PV1D 3V2PA 1CI6A 3TNUB 4RO0A 3V4WA 4RESB 2FYUG 1MUUA 4OWFA 5APXA 1KFMA 1VL2A 5KJ7A 2HPCA 2YIUB 4U7JA 3RK2C 1FDIA 2HFED 3VP9A 5KJ7C 1H88A 5CCGA 5CCHA 1FJKA 1PGPA 1KV4A 1HJ0A 1VQNP 3IFMA 2GUSA 2AXTH 2HG5D 2YKQA 4WB4A 3VMYA 5CHXA 5CCGC 3VMXA 5CCHC 5CJ4A 1W5CE 1EC5A 4A7PA 2M8RA 1OWAA 1USEA 3CC2P 2XDJA 3JCUH 2A45H 4KHXA 4EDFA 2FFDA 1ZR2A 1FJPA 4C7NA 3H1JD 3P8CD 5KAIH 4C7RA 4RJTA 3HRNA 4O9BA 2KNCA 1YJWP 1UIIA 3HUSA 3HD7B 1AJYA 2FFDC 4KT0J 2KI7B 3M9QA 2C0XA 2WITA 2L91A 2YO3A 1NTKK 1M57D 2IX7C 3HUSC 1Q82Q 2UWJE 1FZFA 2ZFCA 3IR9A 3H1LJ 2FY8A 3H1IE 4U3FE 1LT1A 1T2KC 3V2RA 2IDBA 4K3AA 1LT9A 1H89A 2E75B 1SS1A 3F5HA 5AVTB 2H43A 3D71A 5KLVK 3I56P 3KZIH 1DD4A 1RE3A 1VF5D 1BDDA 1LT9C 3H1ID 4U3FD 1KILE 2FBWC 3K5BA 2KIKA 2H7HA 3R4YA 1SFCA 1DH3A 3TDKA 1J2JB 1SLQA 4M3LA 1RE3C 2ZAEB 1HUCA 3CD6P 3D6ZA 3OW2O 3L35A 1NJIQ 1KILD 1LTJB 2O3JA 5B66E 3W67A 3KQGA 1OVRA 1JM0A 1SFCC 3RK3B 3L4FA 1YI2P 2Q6QA 4EIJA 3OA7A 5GTHE 2ZT9C 3CWBE 1NU1E 5CBOA 2P10A 2JKVA 5L8RJ 1N2DC 1GK6A 1PPJD 1LGHB 3BRVB 4OH8B 3FXDA 1ZP0C 1SQXK 2Q1KA 2Q9IA 3PRJA 4I7ZC 3U1AA 4H0LD 4I6MC 3PH0A 2KS1A 3C1LA 1QLED 3CWBD 4L75A 5KTBA 1NU1D 3A3YB 4IL6E 4D6TJ 3H1LG 2KB7P 3PHLA 4H44C 5APUA 3G6EP 3OJAB 1JTHA 4JF7A 4EOTA 4AYCA 3L71E 1ZRTD 1SQBE 1EDJA 1D7MA 2K9YA 1RE4A 1R8EA 3WUVA 1HH0A 3RL0D 1SQBD 1NTZE 3VMAA 1S2EA 1EZVI 3F89A 4YXWH 5B5EE 1NTME 1VQ9P 1RE4C 1YJ9P 1K04A 2R32A 1AQ5A 1VQKP 4EI2A 4HJGH 2GM4A 1NTZD 1L0LJ 1IFJA 5AVUB 2R3CA 1J1DC 2A06G 1W2EA 3GHGB 2QJPB 2WPQA 3GF7A 1GDTA 2E74B 3AE8C 2XV5A 2IFNA 3V4QA 2YNYA 2M3BA 1NWQA 1GL2B 4KJMA 3M0AA 4D6TG 2H89C 1BSNA 4W80A 5TJHA 1L0NK 2B87B 5APQA 1N7SA 5AW6B 2R3SA 3H6PA 2R5DA 3L74J 4LLHA 1SQPK 2AXCA 1DX7A 3KYQA 2NRGA 3MP7B 3HE4B 5CBNA 4NPFX 1N7SC 4DZOA 1HJBA 1W2BO 2P1JA 1FAVA 3C8VA 3I5CA 4IFDK 1CI6B 1DEEG 2YO2A 1ZLLA 3IN6A 2HPCB 3A0BH 1EQ7A 3NXSA 2JWAA 3BCCJ 2A45I 3AE9C 4DT0A 1BE3J 3WU2E 3A5TA 1L0LG 1OZHA 1PP9J 2XU6A 2HODA 2E75D 1S5LE 1HTLC 2K9JA 1KQGB 2Y0DA 3CCRP 1HGZA 3H1KJ 4H13C 3W68A 2FXPA 1SQVJ 2KLVA 1TU3F 3EWKA 3BCCE 1Q90D 2LKMA 4JBZA 1QVGO 3RK3E 1EXJA 1RF1A 2QJYC 3L70E 5AVYB 3CC7P 3Q5RA 1IFMA 2E5TA 2W6AA 4LGDE 1RF1C 3L74G 3RK3D 1U7JA 2FFDB 2NPSD 1N73B 2R5BA 4C7NB 3CX5E 3RL0g 2WPRA 1BGYE 2PRRA 1T3UA 3M9BA 2XNXA 2W90A 4L74A 1VF5B 2FYNB 3BCCG 1BE3G 1BGYD 1PP9G 1EXIA 1VPCA 2WQYC 1LT9B 5AW7B 2Y9YA 1UIXA 2J58A 3H1KG 4Y99C 1KILB 3RBZA 2WWWA 4DOJA 3H32A 3WMM0 1PZQA 1LWUA 1SQVG 2QG4A 4JYCA 5EFWB 1A02F 1SFCB 3JCUE 3PP5A 1LWUC 2FYUE 5KAIE 2ZT9B 2M0BA 2N1TA 3V6IA 1QL1A 2ZYDA 1PGOA 3R2PA 1AA0A 2WZ7A 4L73A 2B9BA 1GD2E 1JEKA 4I7ZB 2YKPA 1U7MA 2N1TC 1FZEA 1NKNA 2JR8A 1LNQA 4H44B 1KQLA 1GU5A 1AFOA 5KKZC 3CLQA 4IOIH 3KZIE 1G1JA 1P84H 5TISH 1YQ3C 1LTAC 3RL0B 1OVUA 3U1CA 1GW3A 1URQD 3TK1A 3CX5H 2PP6A 2AEFA 4ZMDA 1LJ2A 1NU1K 2QRXA 2O01J 2CK3H 3LIEA 2KSJA 5KJ7D 3L75J 3MTUE 1IFDA 1X8YA 2BCCJ 1T6AA 2YXQB 2V7QJ 3H25A 3AE5C 3P8MC 4YTPC 3B8EB 1X9VA 1ZW0A 3KPEA 1SQBK 5CCGD 5CCHD 2IYOA 4BRYA 1SQQJ 1HF9A 1RQVA 5H2FE 2JP3A 4CPGA 1PL5A 3TF5A 4RKUJ 1GK4A 2LXBA 3CC4P 1HGVA 1NTZK 5KLIC 1Y9BA 5AW8B 3ZDMA 2QM8A 5AW5B 3HE5A 2ZXXA 3O6QA 2IZ1A 2LXCB 2N9YB 1OW6A 3CL3D 1PV3A 1FDMA 2OARA 1EDLA 1JO5A 3L72J 1M1JB 1T2KD 4BXLA 5GTIH 1GMJA 2QJKC 1CSBA 3L75G 3NFQA 1KFNA 4HH2A 3KXDA 1FZGA 2BCCG 4JPZB 3BATA 3RBXA 1OW8A 4H13B 3H1LE 2HODB 3GMAA 2V4HA 1VQLP 2K9JB 2ZVNB 2E43A 5DJUB 3TSIA 1ZV8A 2Q3EA 2QJYB 5AW2B 2OTKE 1SQQG 2G8YA 1YTZT 2M5AA 3H1LD 2OYHB 1YITP 1SFCD 2NPSB 4GDOA 2ZYGA 1OX3A 4I1LA 1IK7A 1LTTC 2QVAA 2POHA 1DIPA 2P67A 5AVWB 2PGDA 2ZT9D 1Q7YQ 3S4RA 2I1KA 4TT3H 1JCDA 2KSEA 1G2CA 2OQQA 2P2UA 2O01H 1LP1A 3CCUP 2IBZE 4N78E 2ZVOB 4PD4H 2A06E 2RH0A 5H2FH 3A0BE 4XA4A 4H0LC 3L72G 1KC8Q 1H0TA 4H44D 1H8AA 2V7QH 3TGUJ 2ZYAA 3BASA 3CCLP 2FXOA 2K1AA 4N78D 1JMMA 3U59A 2IPPA 1YIJP 2A06D 3SWKA 2YXRB 1E5WA 4Y99B 4D6TE 1PIXA 1QX8A 1VQOP 2J59M 3L71D 4XFJA 2C9LY 2W27A 1QGKB 3A0HH 4OGQC 1PPJG 3KHUA 1QEXA 4D6TD 3L73J 1NTKJ 3H32B 2M3EA 2CPBA 4HB1A 1LWUB 4UB6H 3CCSP 2IBZG 3Q2YA 2YIUC 1KYOH 3A7OA 1NTMD 1G1IA 2KK7A 4JYBA 5KLVJ 1OVVA 2WSFJ 1Q86Q 2W83C 2N1TB 5BU5A 1K05A 2DW3A 3T97A 3CX5I 1Z56A 1L0LE 1VQ6P 2MKVA 4ASVA 3B5NA 4C46A 1BSHA 5KLVE 3G9RA 1SP4A 2HLOA 3TGUG 1URQB 1LTGC 5AVZB 3B5NC 1S1CX 1Q2NA 2B88A 2JDIH 3HD7A 4L76A 4XE5B 1MZ9A 3RK2B 2WT7A 3CMEP 1NH4A 1SQXJ 3L74E 1L4AA 3HD7C 3L73G 1NTKG 1OW7A 3P7KA 3PLNA 2IZ0A 3L37A 3N4XA 2KXPB 1L4AC 1BCCJ 4NPDA 3L74D 2JWDA 5AVXB 3CCMP 5KLVG 4UB8E 1XTCC 5AW9B 3VMZA 2E75C 1MFTA 3V5BA 1T3JA 4H13D 1S3JA 1IC2A 2P58A 1BE3E 2C0WA 3RGUA 1PP9E 1FC2C 1ZXGA 2C9NY 3FX0A 4GOEA 1N8RQ 4ZKUA 4BRYB 4EYYQ 3H1KE 5M1BA 1P84E 5TISE 1VQMP 3BCCD 1HWTC 1BE3D 2W6JH 1M56D 1PP9D 4N3YB 3L70D 1SQVE 3G3ZA 1VQ5P 5APTA 1JMBA 3MGNA 3B4SA 3EQ2A 2KNCB 3HTKA 3H1KD 1P84D 3HUSB 2OYOA 1LTBC 3O6QB 4WY4A 3SFEC 4TLFA 1RQUA 1SQXG 5AVRB 2E76C 1NVOA 1KZUB 3CX5D 3WUTA 3VOPA 3Q5SA 1M7LA 1MKMA 2QJKB 4WY4C 2QM7A 2WSFH 4W7ZA 1L0NJ 3PJSK 3USSA 1BCCG 3AEBC 1EZVG 3BVHA 1GZLA 1SQPJ 1KD1Q 1RHZB 1FBMA 3EFGA 1KN7A 2W8ZA 4NPEA
chains in the Genus database with same CATH topology
1MFZA 3KPEA 1SQBK 5CCGD 2E42A 1LTSC 3NTNA 1SQXK 5CCHD 2Q9IA 3V2QA 1WT6A 3U1AA 4I6MC 1FU1A 3BRTB 1N7LA 3HD7D 2Q7CA 5KTBA 3A3YB 1M1JA 2Z5IA 3TYYA 4AQRD 1FOSE 2KB7P 1GK4A 5APUA 3OJAB 1NOHA 1JTHA 4JF7A 4EOTA 1HGVA 1NTZK 4AYCA 1L4AD 5AW8B 2OYIB 1X79B 2QM8A 5AW5B 1JNMA 2MJZA 1M1JC 3HE5A 3M06A 2H8PD 5AW0B 3LIDA 1RY3A 2JJLA 3P32A 2FXMA 5APSA 1RE4A 5AVVB 2Q3IA 2N1TD 1OXZA 1HH0A 3RL0D 3CL3D 5AW4B 1QL2A 1G2CB 1LTJA 1GL2A 2JEEA 1FDMA 2WPSA 2OARA 2OYHA 3C9IA 1RE4C 1JO5A 3OAKA 1FZCA 2CPSA 1M1JB 1T2KD 2NPSA 2R32A 1AQ5A 1JTHB 1LTJC 2GM4A 1CSBA 1GL2C 3SWYA 2IFMA 3NFQA 3MUDA 1IFJA 1KFNA 4HH2A 5AVUB 2R3CA 1FZGA 1J1DC 1W2EA 2OYHC 3RK3C 1JUNA 2I1JA 1ZN5A 2YMYA 3BATA 1FZCC 3HE5B 3HE4A 2NPSC 3GHGB 2HODB 2WPQA 2FYZA 1JY2P 3VN0A 1GDTA 1NKZB 2XV5A 2O1KA 3O8ZA 2E43A 3TSIA 1ZV8A 2IFNA 1NAFA 3V4QA 5AW2B 1HBWA 4I2LC 3RK2D 1JY3P 2YNYA 2M3BA 1NWQA 5APYA 1GL2B 1YTZT 3M0AA 1JOCA 4B86A 1IFIA 1J1DB 2OYHB 3CI9A 4W80A 3VYIA 4WY4D 2OYIA 1SFCD 1L0NK 5AVSB 2NPSB 2WSEH 5APQA 1N7SA 4I1LA 1GW4A 1LTTC 5AW6B 3H6PA 2POHA 2R5DA 1S9KE 2P67A 4LLHA 1SQPK 5AVWB 1HVVA 1DX7A 3KYQA 2I1KA 2OYIC 3HE4B 1NO4A 1JCDA 1G2CA 1N7SC 4DZOA 5APVA 2P2UA 2O01H 1HJBA 1GU4A 2P1JA 1FAVA 3I5CA 1SQQK 1S9KD 4N78E 3E1IA 4IFDK 1CI6B 2FKWB 1FZBA 1T8ZA 4XA4A 2YO2A 2HYNA 1J1EB 2Z5HA 1ZLLA 1IO4A 5BVZA 3VP8A 3P8CE 2HPCB 1H8AA 1EQ7A 1LTIC 3NXSA 1GTWA 3B5NB 2A45I 4GT1A 3BASA 1NTMK 4N78D 1N7SB 1JMMA 2XU6A 3GHGA 2IPPA 3U59A 3A5TA 2HODA 1N86A 1E5WA 1N73A 1HTLC 3V2NA 4Y99B 1HGZA 2J59M 2VRSA 2W6BA 2KOGA 3GHGC 1XTGB 1IFNA 4IFMA 3M91A 2C9LY 2W27A 3MD0A 2KLVA 1N73C 2LKMA 2WT7B 1RF1A 5BU8B 3H32B 2CPBA 5AVYB 1LWUB 2GUVA 1DEBA 2BASA 2P7JA 1L4AB 2XKMA 1URQA 1NHLA 1L0LK 4N6JA 3VTPC 2YKOA 3A7OA 1GL2D 1IFMA 2W6AA 4LGDE 1G1IA 2O1JA 1RF1C 3RK3D 3A2AA 1YTZI 4JYBA 5AVQB 1A02J 2FFDB 2A45G 2L5GB 2NPSD 5CMZA 5AW1B 1N73B 2R5BA 3MIWA 2N1TB 1URQC 5BU5A 4C7NB 1FZAA 1PFIA 3V2PA 1CI6A 3TNUB 1KILA 1CZQA 3V4WA 5CJ0A 3T97A 4RESB 2WPRA 1YYCA 1Z56A 5APXA 1MUUA 1KFMA 2KP8A 5KJ7A 2ZXEB 2Q5UA 2HPCA 1T3UA 3M9BA 3B5NA 4C46A 2WTYA 3RK2C 1RF1B 1KILC 1SP4A 2HLOA 2XNXA 2HFED 3LW5H 3VP9A 1URQB 1J1EC 5KJ7C 1H88A 3M0DA 1LTGC 5AVZB 1VPCA 1LT9B 5AW7B 5CCGA 3B5NC 5CCHA 1FJKA 4GIFA 3IFMA 2GUSA 2J58A 1JY2O 3HD7A 1CW5A 2HG5D 4XE5B 1MZ9A 1MV8A 2YKQA 4Y99C 4WB4A 3M0DC 3VMYA 3M9HA 3RK2B 2WT7A 1KILB 2XZRA 5CHXA 2WWWA 5AW3B 5CCGC 3HTKB 3VMXA 4DOJA 5CCHC 3H32A 5CJ4A 1IK9A 1JY3O 3WMM0 4JYCA 1LWUA 1NH4A 4WY4B 1L4AA 1VDFA 3HD7C 1A02F 1SFCB 2M8RA 1OWAA 3PP5A 3P7KA 2XDJA 2A45H 4KHXA 1RF0A 1SVFA 3L37A 1LWUC 2FFDA 3N4XA 1L4AC 2N1TA 1ZR2A 4AUWA 5AVXB 3II6A 1JY2N 1FJPA 4C7NA 1QL1A 3R2PA 3P8CD 2WZ7A 1XTCC 3TNUA 4C7RA 3HRNA 5AW9B 4O9BA 3VMZA 4GKGA 3HUSA 3V5BA 1RF0C 2N9BA 3HD7B 1T3JA 1GD2E 1JY3N 2FFDC 2YKPA 1IC2A 2N1TC 1SQVK 3RL0C 2C0WA 1ZR4A 1FZEA 2C0XA 2WITA 3M9QA 1NKNA 2YO3A 2C9NY 1NTKK 1KQLA 1GU5A 2IX7C 3HUSC 4ZKUA 1FZFA 1AFOA 2ZFCA 3IR9A 1FOSF 3CLQA 1T2KC 3V2RA 1LT9A 3UIAA 1HWTC 1H89A 1G1JA 4N3YB 2PAJA 5AVTB 2H43A 5KLVK 3G3ZA 5APTA 1LTAC 3RL0B 3SWFA 5APWA 3U1CA 2WSCH 1GW3A 1RE3A 3MGNA 4HYTB 3EQ2A 1LT9C 1URQD 3HTKA 3TK1A 3HUSB 2H7HA 1LTBC 2PP6A 4WY4A 1SFCA 2KYVA 1DH3A 1J2JB 1SLQA 4M3LA 2Z4EA 1RE3C 1NU1K 5AVRB 3NMDA 1HUCA 4LC1A 1KZUB 3KDPB 3VOPA 1IJDB 3L36A 1JCCA 1M7LA 3L35A 1KILD 1LTJB 4WY4C 3KQGA 3N7NA 1SFCC 2QM7A 2WSFH 3LIEA 2KSJA 4W7ZA 3RK3B 3L4FA 5KJ7D 1FZCB 3MTUE 1IFDA 1WRGA 1X8YA 4IFFA 4EIJA 3BVHA 3B5ND 3OA7A 1GZLA 4ZKPA 1N7SD 2FYUK 4W7YA 1FBMA 4WBAA 1N2DC 1GK6A 3P8MC 3EFGA 1LGHB 3B8EB 3BRVB 1X9VA 4OH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APY A;  3TNU A;  1MFZ A;  3M0A A;  5AW9 B;  3VTP C;  2E42 A;  4B86 A;  3A7O A;  3VMZ A;  3NTN A;  4GKG A;  2W6A A;  3VYI A;  3V5B A;  2N9B A;  1GD2 E;  4I6M C;  5AVS B;  3A2A A;  4JYB A;  5AVQ B;  2Q7C A;  1A02 J;  5APQ A;  3A3Y B;  5CMZ A;  5AW1 B;  2Z5I A;  2R5B A;  3TYY A;  5AW6 B;  4AQR D;  1FOS E;  1GK4 A;  4C7N B;  2R5D A;  1S9K E;  5APU A;  2YO3 A;  2P67 A;  1CI6 A;  4EOT A;  5AVW B;  3TNU B;  2C9N Y;  1CZQ A;  1KQL A;  1GU5 A;  3V4W A;  3T97 A;  4RES B;  4AYC A;  2WPR A;  1YYC A;  2ZFC A;  3IR9 A;  1MUU A;  5APX A;  3HE4 B;  1FOS F;  5AW8 B;  2KP8 A;  2QM8 A;  5AW5 B;  1T2K C;  2ZXE B;  1JNM A;  4DZO A;  2Q5U A;  5APV A;  3UIA A;  3HE5 A;  3M9B A;  1HWT C;  2P2U A;  3M06 A;  1H89 A;  1HJB A;  1GU4 A;  5AW0 B;  4C46 A;  2WTY A;  1FAV A;  3I5C A;  3LID A;  5AVT B;  1S9K D;  1SP4 A;  2JJL A;  3P32 A;  1CI6 B;  5APS A;  5APT A;  5AVV B;  2Q3I A;  3SWF A;  1OXZ A;  5APW A;  1H88 A;  4HYT B;  2YO2 A;  3MGN A;  5AW4 B;  3M0D A;  2Z5H A;  5AVZ B;  1IO4 A;  1G2C B;  3HTK A;  3TK1 A;  5AW7 B;  1H8A A;  3NXS A;  1GTW A;  2H7H A;  2WPS A;  4GT1 A;  1DH3 A;  3OAK A;  2XU6 A;  1J2J B;  2IPP A;  4XE5 B;  1SLQ A;  3A5T A;  4M3L A;  1T2K D;  2R32 A;  1MV8 A;  5AVR B;  3NMD A;  1HUC A;  4LC1 A;  3VMY A;  3M9H A;  3KDP B;  2WT7 A;  2XZR A;  1CSB A;  2WWW A;  5AW3 B;  3L36 A;  3L35 A;  3VMX A;  3NFQ A;  4JYC A;  5AVU B;  3KQG A;  2R3C A;  2VRS A;  2QM7 A;  1JUN A;  3LIE A;  1A02 F;  3HE5 B;  3HE4 A;  1OWA A;  3M91 A;  2C9L Y;  2W27 A;  3MD0 A;  1X8Y A;  2WPQ A;  3P7K A;  3VN0 A;  1GZL A;  4KHX A;  2WT7 B;  3L37 A;  2XV5 A;  3O8Z A;  2E43 A;  5AVY B;  1NAF A;  4AUW A;  1GK6 A;  2BAS A;  5AVX B;  2P7J A;  3P8M C;  5AW2 B;  3V4Q A;  4C7N A;  4I2L C;  1HBW A;  3B8E B;  2YNY A;  1NWQ A; 
#chains in the Genus database with same CATH topology
 1MFZ A;  4K35 A;  2RN0 A;  1KB9 H;  3V2Q A;  1WT6 A;  2WPV B;  3CXH H;  1FU1 A;  2Q7C A;  2Z5I A;  3FGA D;  1PGJ A;  1NOH A;  3D70 A;  3AE6 C;  3H1H J;  1JNM A;  4UB8 H;  3G71 P;  3M06 A;  2H8P D;  2JO1 A;  1RY3 A;  2FYU D;  2KUB A;  3P32 A;  2FXM A;  3G4S P;  5AVV B;  1K73 Q;  1IFP A;  2N1T D;  5AW4 B;  3QH9 A;  1QL2 A;  1G2C B;  2D2C C;  1GL2 A;  2KS1 B;  2WPS A;  2E74 C;  3ABV C;  3C9I A;  3OAK A;  5GTI E;  1FZC A;  1JTH B;  1L0N G;  2AEM A;  3AEE C;  1GL2 C;  3AE4 C;  3GLM A;  2IFM A;  4GOD A;  2Y9Z A;  3EFF K;  1JUN A;  2YMY A;  1FZC C;  3GG2 A;  1SQP G;  3HE4 A;  3LW5 J;  1WMK A;  4PV1 C;  3AE7 C;  4OGQ B;  1Y8A A;  1S5L X;  2O1K A;  4I2L C;  3RK2 D;  2K3R A;  1JOC A;  2YMK A;  1IFI A;  1J1D B;  3CCQ P;  3CI9 A;  3VYI A;  2G3A A;  2OYI A;  1EDK A;  1Y47 A;  1KOR A;  1GW4 A;  3H1H G;  1S9K E;  3B71 A;  1HVV A;  3H1J J;  2OYI C;  1NO4 A;  2IYP A;  3MHV A;  3MZW B;  5APV A;  3AE2 C;  4PD4 E;  3L75 E;  4YPC A;  3SSU A;  1YHQ P;  1S9K D;  3Q1M A;  3E1I A;  2IBZ I;  5C39 A;  2BCC E;  1JB0 J;  3T97 B;  1FZB A;  2Z5H A;  2QEX P;  1K8A Q;  5BVZ A;  3H1J E;  3P8C E;  3VP8 A;  3WUU A;  4PD4 D;  3B5N B;  3L75 D;  1NTM K;  2QE7 H;  1N7S B;  2AEJ A;  2BCC D;  1SQQ E;  3D6Y A;  1N73 A;  3V2N A;  3H1I J;  4U3F J;  2VRS A;  3A0H E;  2W6B A;  2KOG A;  1XTG B;  4IFM A;  1OFC X;  3MD0 A;  2WSC J;  1N73 C;  1SQQ D;  2WT7 B;  3AEG C;  4UB6 E;  2KZJ A;  5E79 H;  2GUV A;  1DEB A;  2BAS A;  1KYO E;  2P7J A;  1YQ4 C;  1L4A B;  2XKM A;  1L0L K;  4N6J A;  4ZNC A;  1R5L A;  2O1J A;  1USD A;  1YTZ I;  2WVR A;  5AVQ B;  3H1J G;  2RKL A;  1AV1 A;  3S1K A;  1VF5 C;  2FYN C;  3L72 E;  1KYO D;  1KMI Z;  1AVY A;  1PFI A;  3E7K A;  1KIL A;  3AED C;  1CZQ A;  5CJ0 A;  4WVZ A;  1YYC A;  3CPW O;  2KP8 A;  2ZXE B;  2Q5U A;  3CWB J;  3AEF C;  1NU1 J;  2WTY A;  3L72 D;  1RF1 B;  1PGQ A;  1KIL C;  2SPZ A;  3S9O A;  3LW5 H;  5KAF E;  1J1E C;  4R4L A;  3M0D A;  1PPJ E;  2PFX A;  2ITA A;  3AE3 C;  3SFD C;  2GA1 A;  4GIF A;  4BWN A;  1E79 H;  1JY2 O;  1CW5 A;  3H1I G;  4U3F G;  3FWL A;  1MV8 A;  3M0D C;  3M9H A;  2E76 B;  2XZR A;  5AW3 B;  3HTK B;  3L71 J;  1IK9 A;  1JY3 O;  1SQB J;  1KB9 I;  4WY4 B;  1VDF A;  4QMA A;  3CXH I;  3CCV P;  1ZRT E;  2XND H;  2IBZ D;  1FS0 E;  4R4M A;  1RF0 A;  1YBK A;  1SVF A;  3Q5P A;  1AVO A;  1NTZ J;  4AUW A;  3II6 A;  1JY2 N;  3TNU A;  1YJN P;  1ZME C;  1NTM J;  1NAY A;  4GKG A;  2K37 A;  1RF0 C;  2N9B A;  3Q3D A;  1JY3 N;  1KQF B;  3TGU E;  1SQV K;  3RL0 C;  1ZR4 A;  4OGQ D;  2QA4 P;  3CWB G;  2OTJ P;  1NU1 G;  1X22 A;  1FOS F;  3JSV C;  3TGU D;  3UIA A;  1P84 I;  2PAJ A;  1OMI A;  3L73 E;  3PTZ A;  3SWF A;  5APW A;  1NTK E;  2WSC H;  4HYT B;  2WSE J;  1M1K Q;  3CCJ P;  1RH5 B;  4OVN F;  4Z1M H;  3IAO A;  5KKZ B;  2D2C B;  2KLU A;  1X0T A;  2KYV A;  3L71 G;  1VQ4 P;  1SQB G;  2Z4E A;  3NMD A;  2ZJS E;  3L73 D;  4LC1 A;  1NTK D;  3KDP B;  1IJD B;  3L36 A;  1JCC A;  4MN4 C;  1L0L D;  3N7N A;  5DJT B;  2Y0C A;  5KAF H;  5B66 H;  2BEQ D;  1VQ7 P;  1FZC B;  1WRG A;  1NTZ G;  4IFF A;  3B5N D;  5KLV D;  2O01 N;  4ZKP A;  2H88 C;  4PV1 B;  1N7S D;  3GF3 A;  2FYU K;  1NTM G;  3FWN A;  4W7Y A;  4PJ0 E;  3AE1 C;  4WBA A;  1FDO A;  5GTH H;  1KB9 E;  3QWO C;  3JC2 2;  1DD3 A;  1U57 A;  3CXH E;  3AEC C;  2E42 A;  4ASW A;  4DCK A;  1LTS C;  3NTN A;  2WMM A;  3BRT B;  3HD7 D;  1N7L A;  1M1J A;  2HR3 A;  2K88 A;  3TYY A;  4AQR D;  1FOS E;  1KB9 D;  4IL6 H;  3CXH D;  2QSI A;  2I8D A;  1L4A D;  2OYI B;  1X79 B;  1K9M Q;  1SQX E;  2MJZ A;  1M1J C;  5AW0 B;  3L70 J;  1M90 Q;  3LID A;  2JJL A;  5APS A;  2Q3I A;  1OXZ A;  4DJG A;  3CCE P;  1BCC E;  1SQX D;  1LTJ A;  1EZV E;  5KLI B;  2JEE A;  2RMZ A;  2Y0E A;  2OYH A;  2CPS A;  2NPS A;  1EDI A;  4IL6 X;  5B5E H;  2QIW A;  1LTJ C;  1BCC D;  1BGY J;  3SWY A;  1EZV D;  3MUD A;  3IF4 A;  1VQ8 P;  2OYH C;  3RK3 C;  2I1J A;  1ZN5 A;  3HE5 B;  2NPS C;  4WWI A;  2FYZ A;  1JY2 P;  3VN0 A;  4YXD C;  1SQV D;  3E1R A;  3GW6 A;  3MUD C;  4HKZ H;  2NZ2 A;  1NKZ B;  3ITK A;  3O8Z A;  1NAF A;  2OGU A;  1HBW A;  1JY3 P;  2E76 D;  2B89 A;  5APY A;  4B86 A;  1KQS O;  4WY4 D;  5AVS B;  1NGM B;  1S4X A;  2WSE H;  2KZI A;  3CMA P;  2BEZ F;  2R44 A;  3L70 G;  1BDC A;  1M8O B;  4PJ0 H;  2AXT E;  1AQT A;  1L0N E;  1ZOY C;  1GU4 A;  2FYU J;  4PD4 I;  1SQQ K;  2E5Y A;  1OIP A;  2LR2 A;  2FKW B;  1SQP E;  1T8Z A;  2M5A B;  2HYN A;  1J1E B;  1KTM A;  1IO4 A;  1LTI C;  1GTW A;  1L0N D;  4GT1 A;  1BGY G;  3GHG A;  4JQ0 D;  5K5G B;  1N86 A;  1S72 P;  3AEA C;  1SQP D;  1FE6 A;  3WU2 H;  1R5S A;  1S5L H;  1L2P A;  4H0L B;  3GHG C;  1NYH A;  1IFN A;  2QJP C;  3M91 A;  1LP1 B;  3H1H E;  2D2C D;  2WSS H;  5E79 E;  3I55 P;  2E74 D;  2B87 A;  5BU8 B;  1QVF O;  2J5U A;  4Y28 J;  1H0T B;  1URQ A;  1NHL A;  1KYO I;  3VTP C;  2YKO A;  1GL2 D;  2OTL P;  3H1H D;  3FXE A;  1IZN B;  1Q81 Q;  3A2A A;  1VQP P;  1A02 J;  2A45 G;  2L5G B;  5CMZ A;  5AW1 B;  4GOF A;  3MIW A;  1URQ C;  1FZA A;  4PV1 D;  3V2P A;  1CI6 A;  3TNU B;  4RO0 A;  3V4W A;  4RES B;  2FYU G;  1MUU A;  4OWF A;  5APX A;  1KFM A;  1VL2 A;  5KJ7 A;  2HPC A;  2YIU B;  4U7J A;  3RK2 C;  1FDI A;  2HFE D;  3VP9 A;  5KJ7 C;  1H88 A;  5CCG A;  5CCH A;  1FJK A;  1PGP A;  1KV4 A;  1HJ0 A;  1VQN P;  3IFM A;  2GUS A;  2AXT H;  2HG5 D;  2YKQ A;  4WB4 A;  3VMY A;  5CHX A;  5CCG C;  3VMX A;  5CCH C;  5CJ4 A;  1W5C E;  1EC5 A;  4A7P A;  2M8R A;  1OWA A;  1USE A;  3CC2 P;  2XDJ A;  3JCU H;  2A45 H;  4KHX A;  4EDF A;  2FFD A;  1ZR2 A;  1FJP A;  4C7N A;  3H1J D;  3P8C D;  5KAI H;  4C7R A;  4RJT A;  3HRN A;  4O9B A;  2KNC A;  1YJW P;  1UII A;  3HUS A;  3HD7 B;  1AJY A;  2FFD C;  4KT0 J;  2KI7 B;  3M9Q A;  2C0X A;  2WIT A;  2L91 A;  2YO3 A;  1NTK K;  1M57 D;  2IX7 C;  3HUS C;  1Q82 Q;  2UWJ E;  1FZF A;  2ZFC A;  3IR9 A;  3H1L J;  2FY8 A;  3H1I E;  4U3F E;  1LT1 A;  1T2K C;  3V2R A;  2IDB A;  4K3A A;  1LT9 A;  1H89 A;  2E75 B;  1SS1 A;  3F5H A;  5AVT B;  2H43 A;  3D71 A;  5KLV K;  3I56 P;  3KZI H;  1DD4 A;  1RE3 A;  1VF5 D;  1BDD A;  1LT9 C;  3H1I D;  4U3F D;  1KIL E;  2FBW C;  3K5B A;  2KIK A;  2H7H A;  3R4Y A;  1SFC A;  1DH3 A;  3TDK A;  1J2J B;  1SLQ A;  4M3L A;  1RE3 C;  2ZAE B;  1HUC A;  3CD6 P;  3D6Z A;  3OW2 O;  3L35 A;  1NJI Q;  1KIL D;  1LTJ B;  2O3J A;  5B66 E;  3W67 A;  3KQG A;  1OVR A;  1JM0 A;  1SFC C;  3RK3 B;  3L4F A;  1YI2 P;  2Q6Q A;  4EIJ A;  3OA7 A;  5GTH E;  2ZT9 C;  3CWB E;  1NU1 E;  5CBO A;  2P10 A;  2JKV A;  5L8R J;  1N2D C;  1GK6 A;  1PPJ D;  1LGH B;  3BRV B;  4OH8 B;  3FXD A;  1ZP0 C;  1SQX K;  2Q1K A;  2Q9I A;  3PRJ A;  4I7Z C;  3U1A A;  4H0L D;  4I6M C;  3PH0 A;  2KS1 A;  3C1L A;  1QLE D;  3CWB D;  4L75 A;  5KTB A;  1NU1 D;  3A3Y B;  4IL6 E;  4D6T J;  3H1L G;  2KB7 P;  3PHL A;  4H44 C;  5APU A;  3G6E P;  3OJA B;  1JTH A;  4JF7 A;  4EOT A;  4AYC A;  3L71 E;  1ZRT D;  1SQB E;  1EDJ A;  1D7M A;  2K9Y A;  1RE4 A;  1R8E A;  3WUV A;  1HH0 A;  3RL0 D;  1SQB D;  1NTZ E;  3VMA A;  1S2E A;  1EZV I;  3F89 A;  4YXW H;  5B5E E;  1NTM E;  1VQ9 P;  1RE4 C;  1YJ9 P;  1K04 A;  2R32 A;  1AQ5 A;  1VQK P;  4EI2 A;  4HJG H;  2GM4 A;  1NTZ D;  1L0L J;  1IFJ A;  5AVU B;  2R3C A;  1J1D C;  2A06 G;  1W2E A;  3GHG B;  2QJP B;  2WPQ A;  3GF7 A;  1GDT A;  2E74 B;  3AE8 C;  2XV5 A;  2IFN A;  3V4Q A;  2YNY A;  2M3B A;  1NWQ A;  1GL2 B;  4KJM A;  3M0A A;  4D6T G;  2H89 C;  1BSN A;  4W80 A;  5TJH A;  1L0N K;  2B87 B;  5APQ A;  1N7S A;  5AW6 B;  2R3S A;  3H6P A;  2R5D A;  3L74 J;  4LLH A;  1SQP K;  2AXC A;  1DX7 A;  3KYQ A;  2NRG A;  3MP7 B;  3HE4 B;  5CBN A;  4NPF X;  1N7S C;  4DZO A;  1HJB A;  1W2B O;  2P1J A;  1FAV A;  3C8V A;  3I5C A;  4IFD K;  1CI6 B;  1DEE G;  2YO2 A;  1ZLL A;  3IN6 A;  2HPC B;  3A0B H;  1EQ7 A;  3NXS A;  2JWA A;  3BCC J;  2A45 I;  3AE9 C;  4DT0 A;  1BE3 J;  3WU2 E;  3A5T A;  1L0L G;  1OZH A;  1PP9 J;  2XU6 A;  2HOD A;  2E75 D;  1S5L E;  1HTL C;  2K9J A;  1KQG B;  2Y0D A;  3CCR P;  1HGZ A;  3H1K J;  4H13 C;  3W68 A;  2FXP A;  1SQV J;  2KLV A;  1TU3 F;  3EWK A;  3BCC E;  1Q90 D;  2LKM A;  4JBZ A;  1QVG O;  3RK3 E;  1EXJ A;  1RF1 A;  2QJY C;  3L70 E;  5AVY B;  3CC7 P;  3Q5R A;  1IFM A;  2E5T A;  2W6A A;  4LGD E;  1RF1 C;  3L74 G;  3RK3 D;  1U7J A;  2FFD B;  2NPS D;  1N73 B;  2R5B A;  4C7N B;  3CX5 E;  3RL0 g;  2WPR A;  1BGY E;  2PRR A;  1T3U A;  3M9B A;  2XNX A;  2W90 A;  4L74 A;  1VF5 B;  2FYN B;  3BCC G;  1BE3 G;  1BGY D;  1PP9 G;  1EXI A;  1VPC A;  2WQY C;  1LT9 B;  5AW7 B;  2Y9Y A;  1UIX A;  2J58 A;  3H1K G;  4Y99 C;  1KIL B;  3RBZ A;  2WWW A;  4DOJ A;  3H32 A;  3WMM 0;  1PZQ A;  1LWU A;  1SQV G;  2QG4 A;  4JYC A;  5EFW B;  1A02 F;  1SFC B;  3JCU E;  3PP5 A;  1LWU C;  2FYU E;  5KAI E;  2ZT9 B;  2M0B A;  2N1T A;  3V6I A;  1QL1 A;  2ZYD A;  1PGO A;  3R2P A;  1AA0 A;  2WZ7 A;  4L73 A;  2B9B A;  1GD2 E;  1JEK A;  4I7Z B;  2YKP A;  1U7M A;  2N1T C;  1FZE A;  1NKN A;  2JR8 A;  1LNQ A;  4H44 B;  1KQL A;  1GU5 A;  1AFO A;  5KKZ C;  3CLQ A;  4IOI H;  3KZI E;  1G1J A;  1P84 H;  5TIS H;  1YQ3 C;  1LTA C;  3RL0 B;  1OVU A;  3U1C A;  1GW3 A;  1URQ D;  3TK1 A;  3CX5 H;  2PP6 A;  2AEF A;  4ZMD A;  1LJ2 A;  1NU1 K;  2QRX A;  2O01 J;  2CK3 H;  3LIE A;  2KSJ A;  5KJ7 D;  3L75 J;  3MTU E;  1IFD A;  1X8Y A;  2BCC J;  1T6A A;  2YXQ B;  2V7Q J;  3H25 A;  3AE5 C;  3P8M C;  4YTP C;  3B8E B;  1X9V A;  1ZW0 A;  3KPE A;  1SQB K;  5CCG D;  5CCH D;  2IYO A;  4BRY A;  1SQQ J;  1HF9 A;  1RQV A;  5H2F E;  2JP3 A;  4CPG A;  1PL5 A;  3TF5 A;  4RKU J;  1GK4 A;  2LXB A;  3CC4 P;  1HGV A;  1NTZ K;  5KLI C;  1Y9B A;  5AW8 B;  3ZDM A;  2QM8 A;  5AW5 B;  3HE5 A;  2ZXX A;  3O6Q A;  2IZ1 A;  2LXC B;  2N9Y B;  1OW6 A;  3CL3 D;  1PV3 A;  1FDM A;  2OAR A;  1EDL A;  1JO5 A;  3L72 J;  1M1J B;  1T2K D;  4BXL A;  5GTI H;  1GMJ A;  2QJK C;  1CSB A;  3L75 G;  3NFQ A;  1KFN A;  4HH2 A;  3KXD A;  1FZG A;  2BCC G;  4JPZ B;  3BAT A;  3RBX A;  1OW8 A;  4H13 B;  3H1L E;  2HOD B;  3GMA A;  2V4H A;  1VQL P;  2K9J B;  2ZVN B;  2E43 A;  5DJU B;  3TSI A;  1ZV8 A;  2Q3E A;  2QJY B;  5AW2 B;  2OTK E;  1SQQ G;  2G8Y A;  1YTZ T;  2M5A A;  3H1L D;  2OYH B;  1YIT P;  1SFC D;  2NPS B;  4GDO A;  2ZYG A;  1OX3 A;  4I1L A;  1IK7 A;  1LTT C;  2QVA A;  2POH A;  1DIP A;  2P67 A;  5AVW B;  2PGD A;  2ZT9 D;  1Q7Y Q;  3S4R A;  2I1K A;  4TT3 H;  1JCD A;  2KSE A;  1G2C A;  2OQQ A;  2P2U A;  2O01 H;  1LP1 A;  3CCU P;  2IBZ E;  4N78 E;  2ZVO B;  4PD4 H;  2A06 E;  2RH0 A;  5H2F H;  3A0B E;  4XA4 A;  4H0L C;  3L72 G;  1KC8 Q;  1H0T A;  4H44 D;  1H8A A;  2V7Q H;  3TGU J;  2ZYA A;  3BAS A;  3CCL P;  2FXO A;  2K1A A;  4N78 D;  1JMM A;  3U59 A;  2IPP A;  1YIJ P;  2A06 D;  3SWK A;  2YXR B;  1E5W A;  4Y99 B;  4D6T E;  1PIX A;  1QX8 A;  1VQO P;  2J59 M;  3L71 D;  4XFJ A;  2C9L Y;  2W27 A;  1QGK B;  3A0H H;  4OGQ C;  1PPJ G;  3KHU A;  1QEX A;  4D6T D;  3L73 J;  1NTK J;  3H32 B;  2M3E A;  2CPB A;  4HB1 A;  1LWU B;  4UB6 H;  3CCS P;  2IBZ G;  3Q2Y A;  2YIU C;  1KYO H;  3A7O A;  1NTM D;  1G1I A;  2KK7 A;  4JYB A;  5KLV J;  1OVV A;  2WSF J;  1Q86 Q;  2W83 C;  2N1T B;  5BU5 A;  1K05 A;  2DW3 A;  3T97 A;  3CX5 I;  1Z56 A;  1L0L E;  1VQ6 P;  2MKV A;  4ASV A;  3B5N A;  4C46 A;  1BSH A;  5KLV E;  3G9R A;  1SP4 A;  2HLO A;  3TGU G;  1URQ B;  1LTG C;  5AVZ B;  3B5N C;  1S1C X;  1Q2N A;  2B88 A;  2JDI H;  3HD7 A;  4L76 A;  4XE5 B;  1MZ9 A;  3RK2 B;  2WT7 A;  3CME P;  1NH4 A;  1SQX J;  3L74 E;  1L4A A;  3HD7 C;  3L73 G;  1NTK G;  1OW7 A;  3P7K A;  3PLN A;  2IZ0 A;  3L37 A;  3N4X A;  2KXP B;  1L4A C;  1BCC J;  4NPD A;  3L74 D;  2JWD A;  5AVX B;  3CCM P;  5KLV G;  4UB8 E;  1XTC C;  5AW9 B;  3VMZ A;  2E75 C;  1MFT A;  3V5B A;  1T3J A;  4H13 D;  1S3J A;  1IC2 A;  2P58 A;  1BE3 E;  2C0W A;  3RGU A;  1PP9 E;  1FC2 C;  1ZXG A;  2C9N Y;  3FX0 A;  4GOE A;  1N8R Q;  4ZKU A;  4BRY B;  4EYY Q;  3H1K E;  5M1B A;  1P84 E;  5TIS E;  1VQM P;  3BCC D;  1HWT C;  1BE3 D;  2W6J H;  1M56 D;  1PP9 D;  4N3Y B;  3L70 D;  1SQV E;  3G3Z A;  1VQ5 P;  5APT A;  1JMB A;  3MGN A;  3B4S A;  3EQ2 A;  2KNC B;  3HTK A;  3H1K D;  1P84 D;  3HUS B;  2OYO A;  1LTB C;  3O6Q B;  4WY4 A;  3SFE C;  4TLF A;  1RQU A;  1SQX G;  5AVR B;  2E76 C;  1NVO A;  1KZU B;  3CX5 D;  3WUT A;  3VOP A;  3Q5S A;  1M7L A;  1MKM A;  2QJK B;  4WY4 C;  2QM7 A;  2WSF H;  4W7Z A;  1L0N J;  3PJS K;  3USS A;  1BCC G;  3AEB C;  1EZV G;  3BVH A;  1GZL A;  1SQP J;  1KD1 Q;  1RHZ B;  1FBM A;  3EFG A;  1KN7 A;  2W8Z A;  4NPE A; 
#chains in the Genus database with same CATH homology
 1MFZ A;  3KPE A;  1SQB K;  5CCG D;  2E42 A;  1LTS C;  3NTN A;  1SQX K;  5CCH D;  2Q9I A;  3V2Q A;  1WT6 A;  3U1A A;  4I6M C;  1FU1 A;  3BRT B;  1N7L A;  3HD7 D;  2Q7C A;  5KTB A;  3A3Y B;  1M1J A;  2Z5I A;  3TYY A;  4AQR D;  1FOS E;  2KB7 P;  1GK4 A;  5APU A;  3OJA B;  1NOH A;  1JTH A;  4JF7 A;  4EOT A;  1HGV A;  1NTZ K;  4AYC A;  1L4A D;  5AW8 B;  2OYI B;  1X79 B;  2QM8 A;  5AW5 B;  1JNM A;  2MJZ A;  1M1J C;  3HE5 A;  3M06 A;  2H8P D;  5AW0 B;  3LID A;  1RY3 A;  2JJL A;  3P32 A;  2FXM A;  5APS A;  1RE4 A;  5AVV B;  2Q3I A;  2N1T D;  1OXZ A;  1HH0 A;  3RL0 D;  3CL3 D;  5AW4 B;  1QL2 A;  1G2C B;  1LTJ A;  1GL2 A;  2JEE A;  1FDM A;  2WPS A;  2OAR A;  2OYH A;  3C9I A;  1RE4 C;  1JO5 A;  3OAK A;  1FZC A;  2CPS A;  1M1J B;  1T2K D;  2NPS A;  2R32 A;  1AQ5 A;  1JTH B;  1LTJ C;  2GM4 A;  1CSB A;  1GL2 C;  3SWY A;  2IFM A;  3NFQ A;  3MUD A;  1IFJ A;  1KFN A;  4HH2 A;  5AVU B;  2R3C A;  1FZG A;  1J1D C;  1W2E A;  2OYH C;  3RK3 C;  1JUN A;  2I1J A;  1ZN5 A;  2YMY A;  3BAT A;  1FZC C;  3HE5 B;  3HE4 A;  2NPS C;  3GHG B;  2HOD B;  2WPQ A;  2FYZ A;  1JY2 P;  3VN0 A;  1GDT A;  1NKZ B;  2XV5 A;  2O1K A;  3O8Z A;  2E43 A;  3TSI A;  1ZV8 A;  2IFN A;  1NAF A;  3V4Q A;  5AW2 B;  1HBW A;  4I2L C;  3RK2 D;  1JY3 P;  2YNY A;  2M3B A;  1NWQ A;  5APY A;  1GL2 B;  1YTZ T;  3M0A A;  1JOC A;  4B86 A;  1IFI A;  1J1D B;  2OYH B;  3CI9 A;  4W80 A;  3VYI A;  4WY4 D;  2OYI A;  1SFC D;  1L0N K;  5AVS B;  2NPS B;  2WSE H;  5APQ A;  1N7S A;  4I1L A;  1GW4 A;  1LTT C;  5AW6 B;  3H6P A;  2POH A;  2R5D A;  1S9K E;  2P67 A;  4LLH A;  1SQP K;  5AVW B;  1HVV A;  1DX7 A;  3KYQ A;  2I1K A;  2OYI C;  3HE4 B;  1NO4 A;  1JCD A;  1G2C A;  1N7S C;  4DZO A;  5APV A;  2P2U A;  2O01 H;  1HJB A;  1GU4 A;  2P1J A;  1FAV A;  3I5C A;  1SQQ K;  1S9K D;  4N78 E;  3E1I A;  4IFD K;  1CI6 B;  2FKW B;  1FZB A;  1T8Z A;  4XA4 A;  2YO2 A;  2HYN A;  1J1E B;  2Z5H A;  1ZLL A;  1IO4 A;  5BVZ A;  3VP8 A;  3P8C E;  2HPC B;  1H8A A;  1EQ7 A;  1LTI C;  3NXS A;  1GTW A;  3B5N B;  2A45 I;  4GT1 A;  3BAS A;  1NTM K;  4N78 D;  1N7S B;  1JMM A;  2XU6 A;  3GHG A;  2IPP A;  3U59 A;  3A5T A;  2HOD A;  1N86 A;  1E5W A;  1N73 A;  1HTL C;  3V2N A;  4Y99 B;  1HGZ A;  2J59 M;  2VRS A;  2W6B A;  2KOG A;  3GHG C;  1XTG B;  1IFN A;  4IFM A;  3M91 A;  2C9L Y;  2W27 A;  3MD0 A;  2KLV A;  1N73 C;  2LKM A;  2WT7 B;  1RF1 A;  5BU8 B;  3H32 B;  2CPB A;  5AVY B;  1LWU B;  2GUV A;  1DEB A;  2BAS A;  2P7J A;  1L4A B;  2XKM A;  1URQ A;  1NHL A;  1L0L K;  4N6J A;  3VTP C;  2YKO A;  3A7O A;  1GL2 D;  1IFM A;  2W6A A;  4LGD E;  1G1I A;  2O1J A;  1RF1 C;  3RK3 D;  3A2A A;  1YTZ I;  4JYB A;  5AVQ B;  1A02 J;  2FFD B;  2A45 G;  2L5G B;  2NPS D;  5CMZ A;  5AW1 B;  1N73 B;  2R5B A;  3MIW A;  2N1T B;  1URQ C;  5BU5 A;  4C7N B;  1FZA A;  1PFI A;  3V2P A;  1CI6 A;  3TNU B;  1KIL A;  1CZQ A;  3V4W A;  5CJ0 A;  3T97 A;  4RES B;  2WPR A;  1YYC A;  1Z56 A;  5APX A;  1MUU A;  1KFM A;  2KP8 A;  5KJ7 A;  2ZXE B;  2Q5U A;  2HPC A;  1T3U A;  3M9B A;  3B5N A;  4C46 A;  2WTY A;  3RK2 C;  1RF1 B;  1KIL C;  1SP4 A;  2HLO A;  2XNX A;  2HFE D;  3LW5 H;  3VP9 A;  1URQ B;  1J1E C;  5KJ7 C;  1H88 A;  3M0D A;  1LTG C;  5AVZ B;  1VPC A;  1LT9 B;  5AW7 B;  5CCG A;  3B5N C;  5CCH A;  1FJK A;  4GIF A;  3IFM A;  2GUS A;  2J58 A;  1JY2 O;  3HD7 A;  1CW5 A;  2HG5 D;  4XE5 B;  1MZ9 A;  1MV8 A;  2YKQ A;  4Y99 C;  4WB4 A;  3M0D C;  3VMY A;  3M9H A;  3RK2 B;  2WT7 A;  1KIL B;  2XZR A;  5CHX A;  2WWW A;  5AW3 B;  5CCG C;  3HTK B;  3VMX A;  4DOJ A;  5CCH C;  3H32 A;  5CJ4 A;  1IK9 A;  1JY3 O;  3WMM 0;  4JYC A;  1LWU A;  1NH4 A;  4WY4 B;  1L4A A;  1VDF A;  3HD7 C;  1A02 F;  1SFC B;  2M8R A;  1OWA A;  3PP5 A;  3P7K A;  2XDJ A;  2A45 H;  4KHX A;  1RF0 A;  1SVF A;  3L37 A;  1LWU C;  2FFD A;  3N4X A;  1L4A C;  2N1T A;  1ZR2 A;  4AUW A;  5AVX B;  3II6 A;  1JY2 N;  1FJP A;  4C7N A;  1QL1 A;  3R2P A;  3P8C D;  2WZ7 A;  1XTC C;  3TNU A;  4C7R A;  3HRN A;  5AW9 B;  4O9B A;  3VMZ A;  4GKG A;  3HUS A;  3V5B A;  1RF0 C;  2N9B A;  3HD7 B;  1T3J A;  1GD2 E;  1JY3 N;  2FFD C;  2YKP A;  1IC2 A;  2N1T C;  1SQV K;  3RL0 C;  2C0W A;  1ZR4 A;  1FZE A;  2C0X A;  2WIT A;  3M9Q A;  1NKN A;  2YO3 A;  2C9N Y;  1NTK K;  1KQL A;  1GU5 A;  2IX7 C;  3HUS C;  4ZKU A;  1FZF A;  1AFO A;  2ZFC A;  3IR9 A;  1FOS F;  3CLQ A;  1T2K C;  3V2R A;  1LT9 A;  3UIA A;  1HWT C;  1H89 A;  1G1J A;  4N3Y B;  2PAJ A;  5AVT B;  2H43 A;  5KLV K;  3G3Z A;  5APT A;  1LTA C;  3RL0 B;  3SWF A;  5APW A;  3U1C A;  2WSC H;  1GW3 A;  1RE3 A;  3MGN A;  4HYT B;  3EQ2 A;  1LT9 C;  1URQ D;  3HTK A;  3TK1 A;  3HUS B;  2H7H A;  1LTB C;  2PP6 A;  4WY4 A;  1SFC A;  2KYV A;  1DH3 A;  1J2J B;  1SLQ A;  4M3L A;  2Z4E A;  1RE3 C;  1NU1 K;  5AVR B;  3NMD A;  1HUC A;  4LC1 A;  1KZU B;  3KDP B;  3VOP A;  1IJD B;  3L36 A;  1JCC A;  1M7L A;  3L35 A;  1KIL D;  1LTJ B;  4WY4 C;  3KQG A;  3N7N A;  1SFC C;  2QM7 A;  2WSF H;  3LIE A;  2KSJ A;  4W7Z A;  3RK3 B;  3L4F A;  5KJ7 D;  1FZC B;  3MTU E;  1IFD A;  1WRG A;  1X8Y A;  4IFF A;  4EIJ A;  3BVH A;  3B5N D;  3OA7 A;  1GZL A;  4ZKP A;  1N7S D;  2FYU K;  4W7Y A;  1FBM A;  4WBA A;  1N2D C;  1GK6 A;  3P8M C;  3EFG A;  1LGH B;  3B8E B;  3BRV B;  1X9V A;  4OH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...