4WY4D

Crystal structure of autophagic snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
64
Chain Sequence
HLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKVRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 64
sequence length 65
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4D00
3VOPA 1GL2D 3RK2B 3RK2C 4OH8B 3B5ND 1KILD 2XDJA 2KOGA 2WZ7A 3RK2D 4W80A 2N1TB 1L4AB 3HTKB 2YMYA 2N1TA 2N1TC 1L4AA 1L4AC 3P8CE 5CCGA 1JTHB 3HD7A 3HD7C 5CCGC 1JTHA 2HFED 1T3JA 1SFCB 3M0DC 2N1TD 4WY4B 1L4AD 3RK3B 1HVVA 5CCGD 3HD7D 4W7YA 3RK3C 1N7SB 1N7SA 1N7SC 2H8PD 2M8RA 3TSIA 3RK3D 2NPSB 3RL0B 1XTGB 1N7SD 1URQB 5KJ7A 5KJ7C 1SFCA 1SFCC 2PP6A 4WY4A 4WY4C 5CCHA 5CCHC 3B5NB 5KJ7D 4JF7A 1SFCD 4WY4D 5CCHD 4W7ZA 2HG5D 2NPSA 2NPSC 3RL0C 3KYQA 1URQA 1URQC 4N78E 1GL2B 1GL2A 1GL2C 2NPSD 1NHLA 4LGDE 3RL0D 3PP5A 3HD7B 1KILB 1URQD 3B5NA 3B5NC 1KILA 1KILC
chains in the Genus database with same CATH superfamily
1L0LE 3QWOC 1L0LG 3H1JD 4A7PA 1K8AQ 3Q5SA 3CCVP 3KHUA 3H1HG 1FZFA 2K9YA 3CCLP 2FYUE 2FYUG 3W67A 1FC2C 4WWIA 1Y47A 1PPJE 3A3YB 1PPJG 1TU3F 3B8EB 4WY4B 1SVFA 2QJKC 3R2PA 3I5CA 1M56D 1ZR4A 3H1KD 3H1ID 1BDCA 1R5LA 5B5EH 2IBZD 2KLUA 1VQ5P 1ZXGA 1VQPP 4C46A 5KLIC 3O6QA 3V6IA 2B87B 2C0XA 2AEMA 2E75D 1NTMD 1NKNA 2CPBA 1GL2B 1QGKB 3WMM0 1FJPA 2IFMA 2WT7B 1ZN5A 2KK7A 5AVWB 3GLMA 4H13D 1T8ZA 3B5NA 3B5NC 2H7HA 1SQQG 3CD6P 1SQXK 1X9VA 1N7LA 1Q90D 4XFJA 1M8OB 2D2CB 3USSA 3BATA 2FFDB 2FYNC 3H1LG 1L0ND 3HE5A 2GA1A 4JPZB 2MJZA 4JQ0D 1PV3A 2BEZF 1W5CE 1FDMA 1JTHA 1S3JA 3RGUA 1FOSE 4M3LA 3CL3D 4L75A 4DZOA 2IYOA 1PP9J 1HVVA 3UIAA 1YITP 3VP9A 2OTLP 2IYPA 4H44D 2P67A 1FDOA 1JCDA 1E5WA 2A06D 1G1JA 3L73J 5KAIH 4IL6X 1XTGB 4GIFA 5AVXB 3VP8A 2YMKA 5B5EE 5AW5B 2H88C 2WPQA 2W27A 1PP9E 1PP9G 1IFPA 3OAKA 4LC1A 3BCCJ 4JF7A 1SFCD 2C9NY 2OQQA 2POHA 5CCHD 2WQYC 2RKLA 3AE6C 3ITKA 2LKMA 1W2BO 5KKZC 2KLVA 4ZNCA 2LXBA 3L73D 3MZWB 3L73E 1KILE 1KB9I 1SQBJ 1SQVK 3CX5D 1BCCJ 4LGDE 3L71J 5AW3B 3RL0D 1PGPA 3BCCD 3BCCE 1YJNP 1SQPJ 3RBZA 1HTLC 2E74C 4EOTA 2K88A 4GOFA 4N78D 1SQXG 2KYVA 5BVZA 1J1EB 1SQBE 1SQBG 5L8RJ 3L70D 3CWBG 1BCCE 2N1TA 2N1TC 1BCCG 2QJPC 3L71G 5AVZB 2ZYGA 2FXMA 1ZMEC 1OZHA 5BU8B 2SPZA 1SQPE 2AXTH 3M0DA 2YNYA 3M0DC 1SQPG 1X22A 4U3FJ 4EIJA 2B9BA 3CCUP 3P8MC 3CMEP 3IN6A 5AW6B 1EXIA 1NOHA 2QM7A 2Y9ZA 3Q2YA 2FY8A 1IK7A 1PGJA 1Y8AA 4HKZH 3TYYA 2FXOA 2Q9IA 3OJAB 3BVHA 3CC7P 4U3FE 4U3FG 2IFNA 2UWJE 3L35A 2C9LY 2Y0EA 5APXA 1AQTA 2Z4EA 1YHQP 1BE3D 3NXSA 1U7JA 1WMKA 3T97A 2HG5D 1RF1A 1RF1C 1YJWP 1KV4A 2WSEH 4C7NA 5AVTB 2NPSD 1S5LH 2ZVOB 4I7ZC 2N9YB 4YPCA 2V7QH 2GUVA 4Y99C 3NFQA 2H89C 1GL2D 2FYZA 2E76B 4EDFA 4OH8B 1VF5C 1XTCC 3L37A 2BEQD 4RO0A 1OVUA 1NAYA 1P84D 3IR9A 2CK3H 2D2CD 3L72J 1LTGC 3C1LA 1RE4A 1RE4C 1YBKA 2WVRA 3O6QB 1YQ4C 5E79H 4KT0J 3HD7D 1FZBA 2AXTE 1MFZA 1HWTC 4I6MC 2WSFH 3A5TA 5AVSB 1IFMA 3WUUA 3U1AA 5AW9B 3L72E 3TNUA 1HUCA 3L72G 2P58A 2RMZA 4ASWA 3MGNA 2WSEJ 3E1IA 2Q5UA 3B5NB 2ITAA 5KJ7D 3SFEC 3M9HA 2V7QJ 2W90A 2Z5IA 3KYQA 1URQA 1URQC 3HE5B 4L76A 1ZV8A 1LTJA 1LTJC 1S72P 1NTZK 2RN0A 1M7LA 1S5LE 2L91A 2NZ2A 5KAFH 1VQ8P 3LIDA 3CXHI 1QL1A 1CW5A 1YIJP 3KXDA 2WZ7A 1E79H 1AV1A 1Q7YQ 3G71P 4UB8H 4H0LD 1KQFB 1N2DC 1DD4A 2P1JA 1L4AB 2YMYA 1K73Q 4NPEA 1NU1J 2ZYDA 1NTKK 2ZJSE 2HFED 2WSFJ 1T3JA 2ZAEB 1T6AA 3RK3B 4PJ0H 5E79E 1JOCA 2QVAA 2QJYC 3TSIA 1NJIQ 1RE3A 1RE3C 1NU1E 2M3BA 1HGZA 1NU1G 5AW2B 1KYOH 3V2RA 1QVFO 2QEXP 1T2KD 3N4XA 1YI2P 1Y9BA 4KJMA 3AE5C 1S9KD 1FZEA 3L4FA 4Z1MH 4OGQC 3TGUD 4YXWH 2GM4A 2WTYA 1KILB 1A02J 3EWKA 2OYOA 5H2FE 4JBZA 4N3YB 3V4WA 3L74J 3LIEA 4GKGA 4U7JA 1S5LX 3H1HJ 3GF3A 3S4RA 2E76D 2ZFCA 5KLVD 3M91A 3KDPB 1NTMK 5KLVE 1IFJA 3N7NA 1WT6A 1L0LD 1M1KQ 3AEGC 4UB8E 3AEAC 1JUNA 1LJ2A 3Q5PA 1ZR2A 3L74E 2M5AB 3L74G 1NO4A 1AA0A 5APWA 2KUBA 1U57A 3L75J 1IJDB 3H1HE 2QA4P 3H25A 2IPPA 1N7SA 1N7SC 2H8PD 1Q81Q 2FYUD 4UB6H 3T97B 3I55P 5K5GB 1NAFA 1PPJD 1L0NK 2Z5HA 4PJ0E 3AE4C 4C7NB 4D6TG 5CJ4A 1KQLA 1GTWA 2OYIB 5CHXA 2LR2A 3JCUH 3WU2E 4I7ZB 1MZ9A 3L75E 1HJBA 1AFOA 1KYOE 3L75G 2XZRA 5AW7B 1VF5B 5DJTB 4R4LA 2ZXXA 2I1KA 3NMDA 1IFDA 2W6BA 1M57D 3K5BA 4HH2A 1S2EA 4PD4I 4BWNA 3IAOA 3RL0g 1SQQJ 2E43A 3V2QA 1NWQA 3PP5A 4ZMDA 3Q5RA 1X8YA 3C8VA 2IZ1A 1T3UA 2IBZG 1EDKA 4AYCA 3H1LJ 1AVYA 1NVOA 2M3EA 4GODA 2K37A 1RF0A 1RF0C 3KZIH 2K1AA 2O1KA 4CPGA 1SQQE 2QIWA 2O01H 1VQ6P 1VQKP 3MUDA 3MUDC 3TNUB 5AVUB 1NTMG 1DX7A 1FE6A 1SS1A 2XV5A 1L4AD 3H1LD 5CCGD 3JC22 5B66H 3H1LE 3C9IA 1KFMA 4WB4A 3GHGA 1NYHA 3GHGC 4DOJA 4HB1A 1N73B 1VQOP 1FZGA 3RK3D 2NRGA 2YO2A 3RK3E 3CXHH 3PTZA 1URQB 4UB6E 1PZQA 2FBWC 2E75C 1LTJB 1H0TA 2ZXEB 3JCUE 1KN7A 1Z56A 2WPRA 4H13C 3BRTB 4N6JA 5CMZA 4JYCA 1J1DC 1PP9D 1NHLA 4PV1D 3AEDC 4ZKPA 3A2AA 3RK2B 1SLQA 3HUSB 2B88A 1H8AA 4O9BA 2O01J 1SQXJ 4BXLA 3II6A 3VMZA 4RESB 1EZVI 1KILD 3FX0A 5C39A 2WITA 4KHXA 1FJKA 2IZ0A 1VDFA 2HPCA 2A45G 3CWBJ 2K9JA 1YQ3C 4IFDK 4NPDA 2ZT9D 3KZIE 1QLED 4H44C 1D7MA 2YKOA 5APYA 5AVRB 2HODA 1SQXE 1YTZT 2P10A 3CC2P 3H6PA 1OXZA 2QE7H 1SQBD 2QM8A 3CWBD 3V5BA 3CWBE 1BCCD 5B66E 3L71D 4NPFX 3L71E 3HTKA 5KTBA 2IX7C 4Y28J 1SQPD 1KMIZ 2YIUB 1SFCA 1SFCC 1EDJA 5CCHA 5CCHC 2OYHA 2OYHC 2PFXA 2Q6QA 2WPSA 4WY4D 2OTJP 4TLFA 1HJ0A 2IBZI 3RL0C 1FZCB 4LLHA 1LT9B 4U3FD 5KAIE 1BSHA 1SQVJ 2E5TA 3U59A 3VOPA 3HRNA 1GK6A 1GDTA 1GD2E 1M1JA 1M1JC 1S1CX 2YKQA 3A7OA 3V4QA 1KFNA 5BU5A 3G6EP 3EFFK 1GU4A 1SQVE 1SQVG 1BE3G 3BRVB 2HYNA 4R4MA 1G2CA 4PD4H 2QJKB 1KZUB 1OX3A 3VMYA 3E1RA 3RBXA 2JEEA 2J59M 2KSEA 1KC8Q 1L2PA 1M90Q 1OVVA 2KIKA 3ABVC 5KLIB 2PP6A 4I2LC 1RHZB 1JEKA 2B87A 1ZW0A 1FAVA 3D71A 3CC4P 1OW6A 3MHVA 2NPSA 2NPSC 3L72D 3AEFC 1BSNA 1GL2A 1GL2C 1USDA 2A45I 1EC5A 3VMXA 5CBNA 1K05A 2BCCJ 3KPEA 1OFCX 3SWFA 1RQVA 3AE8C 2FYNB 1Q2NA 2D2CC 2FFDA 2FFDC 1JM0A 2XDJA 3CX5I 3GHGB 1GZLA 3OA7A 3V2NA 3M9QA 3RK2D 1A02F 2KSJA 2RH0A 2YKPA 2JWDA 1JTHB 3HD7A 3HD7C 3A0BH 1JO5A 2P7JA 2BCCE 1KQSO 2BCCG 2R5DA 4JYBA 1GU5A 3CCRP 1VPCA 1FZAA 4GT1A 4PD4E 2Y0CA 3VYIA 1JY2N 2G3AA 2Y0DA 2OGUA 1OW7A 3HE4A 1KB9H 4H13B 5KJ7A 5KJ7C 1MKMA 5KLVK 3M06A 3Q3DA 1L0LK 1GW4A 3EFGA 4XE5B 3GW6A 3SSUA 1KTMA 3CCJP 1JY2P 5KKZB 1QL2A 3GG2A 2B89A 1NU1D 1BGYJ 3R4YA 3AE7C 3PJSK 2FYUK 2HPCB 1R8EA 2DW3A 1LP1A 2Q3IA 3CCSP 5GTHH 1QEXA 4HYTB 1J2JB 1VQMP 1LTIC 4MN4C 1NTZJ 3A0HH 2E74B 4WBAA 2HODB 4H0LC 2FXPA 1W2EA 2GUSA 3MD0A 3CCEP 3PRJA 1BGYE 4IL6H 2M0BA 1BGYG 1DIPA 3VMAA 2N1TB 4HJGH 2QJPB 3HTKB 3P8CD 2BASA 3P8CE 1EXJA 2V4HA 1DEEG 1NTZE 1NTZG 1SFCB 1DEBA 1LTTC 2WSSH 3A0BE 1P84I 3FWNA 4IOIH 2N9BA 5KAFE 1FOSF 1NGMB 1LGHB 3H1JJ 2K3RA 2L5GB 3KQGA 1T2KC 2PRRA 2KB7P 3RL0B 1H89A 4D6TJ 1JMMA 4B86A 2P2UA 3L74D 3CLQA 1EZVE 3AE1C 4DT0A 4AUWA 1KB9D 1EZVG 2KS1A 3D6YA 1NTKG 1KB9E 3H1HD 3GMAA 2I1JA 4QMAA 1OMIA 5CBOA 3PH0A 3FWLA 3M0AA 1HBWA 1RQUA 1M1JB 1RF1B 4I1LA 3H1JE 3TDKA 3H1JG 3AECC 2QG4A 4D6TD 3D70A 4D6TE 2OARA 3SFDC 3I56P 3H1KJ 3H1IJ 3O8ZA 2Q7CA 3L75D 1KYOD 4WVZA 4Y99B 1X79B 3FXEA 1G2CB 4C7RA 1FU1A 2E76C 2KNCA 5GTHE 3B5ND 5APTA 2H43A 1YJ9P 3A0HE 1JY3N 2G8YA 1K04A 2W8ZA 2W83C 1USEA 3H1KE 3H1IE 4IL6E 3H1KG 3H1IG 3BASA 1NTMJ 1IC2A 2IBZE 2A45H 2R32A 2KXPB 4L74A 1GK4A 3FXDA 1JY3P 5GTIH 1NKZB 3S1KA 1LNQA 1GW3A 1SQQD 2NPSB 2ZVNB 3CX5H 1NTME 1OWAA 1PGOA 2O01N 4AQRD 1L0NJ 2CPSA 1PFIA 3H32A 4YXDC 1LWUA 1LWUC 1N8RQ 2Q3EA 2JJLA 2YO3A 3VTPC 1SQBK 1PGQA 1L0NE 1L0NG 1ZLLA 3EQ2A 2R3CA 3ZDMA 1ZOYC 3MTUE 3HD7B 1SQPK 4GDOA 3OW2O 1QX8A 3IFMA 1Q82Q 3V2PA 3SWYA 2YXQB 2E74D 2W6AA 5EFWB 1X0TA 1IO4A 3AE3C 2A06E 1L4AA 1L4AC 1HH0A 2JR8A 5CCGA 2A06G 5CCGC 3HE4B 1YYCA 1OVRA 2I8DA 3AE2C 2AEJA 2KZIA 2N1TD 3MP7B 3CI9A 3RK3C 1HGVA 3M9BA 1QVGO 3G9RA 5APUA 5APVA 2QJYB 1AJYA 4YTPC 1CI6A 1U7MA 3W68A 1GMJA 5GTIE 2AXCA 3L73G 2J58A 1EDIA 1SQXD 1LTSC 2WMMA 3AEBC 3S9OA 1LP1B 3CX5E 2JDIH 3L70J 2W6JH 5TJHA 3BCCG 4H0LB 1P84H 2QSIA 3LW5H 4OGQB 4PV1C 4N78E 3CXHD 2FKWB 3CXHE 3P7KA 1KYOI 1SP4A 3L70E 1H88A 3L70G 1KILA 1KILC 1WRGA 2KI7B 4BRYA 3P32A 1R5SA 2KOGA 3QH9A 2ZT9C 2Q1KA 2MKVA 1VF5D 2WPVB 1G1IA 1KQGB 1BE3J 1AVOA 3CCMP 5AW0B 1IK9A 4OVNF 5DJUB 2KP8A 3PHLA 2WSCH 2KS1B 2M5AA 4W7YA 2C0WA 3NTNA 1N7SB 1VQLP 2M8RA 1SQVD 2XKMA 1OW8A 1BE3E 2J5UA 2JO1A 1KORA 4EYYQ 3LW5J 3B71A 4WY4C 2WWWA 4WY4A 2OYIA 2OYIC 5TISH 3SWKA 4RKUJ 3AE9C 2XNDH 3GF7A 4IFFA 5AW8B 1PL5A 1CSBA 1FDIA 1JY2O 4W7ZA 2KNCB 2JWAA 1JCCA 2KZJA 5AVQB 1KD1Q 1FS0E 1S4XA 3PLNA 3L36A 1EDLA 1ZRTD 1P84E 1PIXA 1ZRTE 1URQD 2HLOA 2YXRB 4DJGA 4ASVA 3TK1A 5AW1B 4W80A 2WSCJ 1JB0J 3CCQP 3D6ZA 2WT7A 1NU1K 5APQA 3Q1MA 1VQ7P 3G3ZA 5M1BA 5CJ0A 3H32B 1FBMA 1OIPA 1LTAC 1LWUB 3CPWO 2QRXA 1ZP0C 1N73A 1JNMA 1N73C 1VQ9P 1RY3A 4L73A 4XA4A 1VL2A 3FGAD 3U1CA 1VQ4P 2Y9YA 2BCCD 1UIXA 2E42A 2PGDA 3MIWA 2E75B 5H2FH 1H0TB 4PD4D 1MV8A 5AW4B 1RH5B 1CZQA 2VRSA 5TISE 2R44A 4TT3H 2JP3A 3WUVA 1J1DB 2ZYAA 1DD3A 2R5BA 4K3AA 4ZKUA 2XNXA 4OGQD 1IFNA 1N86A 1UIIA 4RJTA 4DCKA 2O3JA 1IFIA 3HUSA 3HUSC 3RK2C 2XU6A 3G4SP 4K35A 2OTKE 2JKVA 1Q86Q 5AVVB 1MUUA 2K9JB 2HR3A 3F5HA 3JSVC 3IF4A 1CI6B 2O1JA 2LXCB 3WU2H 4H44B 1JMBA 1BGYD 3TGUJ 3VN0A 4EI2A 1IZNB 2R3SA 1LTBC 1JY3O 1J1EC 3CMAP 4IFMA 1DH3A 1S9KE 4OWFA 1VQNP 1NTZD 1MFTA 1HF9A 1YTZI 4PV1B 1N7SD 1NTKJ 1BDDA 2YIUC 1LT1A 5KLVJ 2OYHB 3TGUE 3TGUG 1NH4A 3B4SA 1EQ7A 1L0LJ 5AVYB 1K9MQ 4BRYB 2E5YA 3WUTA 2PAJA 3F89A 3E7KA 2AEFA 1FZCA 1FZCC 1EZVD 1LT9A 1LT9C 1NTKD 3AEEC 2ZT9B 1NTKE 1SQQK 2IDBA 2FYUJ 1AQ5A 5KLVG 5APSA 3TF5A 4GOEA
chains in the Genus database with same CATH topology
3VOPA 1M7LA 3HRNA 3IFMA 1GK6A 1GDTA 1GD2E 1M1JA 1M1JC 3V2PA 3LIDA 1QL1A 1CW5A 3SWYA 2YKQA 3A7OA 2WZ7A 3V4QA 1KFNA 2W6AA 1N2DC 1FZFA 5BU5A 1GU4A 2P1JA 1L4AB 1IO4A 2YMYA 1L4AA 1L4AC 1HH0A 5CCGA 5CCGC 3HE4B 3BRVB 2HYNA 1YYCA 1NTKK 3A3YB 1G2CA 2HFED 1T3JA 3B8EB 2N1TD 4WY4B 3RK3B 1SVFA 1KZUB 3RK3C 3CI9A 3R2PA 1HGVA 3M9BA 3VMYA 3I5CA 5APUA 5APVA 1ZR4A 1JOCA 1CI6A 2JEEA 3TSIA 2J59M 1RE3A 1RE3C 2M3BA 1HGZA 4C46A 2J58A 5AW2B 2PP6A 3V2RA 1LTSC 4I2LC 1T2KD 3N4XA 2C0XA 1S9KD 1FZEA 3L4FA 1FAVA 2NPSA 2NPSC 3LW5H 1NKNA 4N78E 2CPBA 1GL2B 2FKWB 3WMM0 1GL2A 1GL2C 1FJPA 3P7KA 2IFMA 2A45I 2GM4A 2WT7B 1SP4A 1ZN5A 5AVWB 3VMXA 2WTYA 1H88A 1KILB 1A02J 1T8ZA 3B5NA 3B5NC 2H7HA 1KILA 1KILC 3KPEA 1WRGA 1SQXK 4N3YB 3SWFA 1X9VA 1N7LA 3V4WA 3P32A 3LIEA 4GKGA 3BATA 2FFDB 2FFDA 2FFDC 2XDJA 3GHGB 3OA7A 1GZLA 2KOGA 3HE5A 3V2NA 3M9QA 3RK2D 1A02F 2ZFCA 2KSJA 3M91A 3KDPB 1NTMK 1G1IA 2MJZA 2YKPA 1IFJA 3N7NA 1WT6A 1JTHB 3HD7A 3HD7C 5AW0B 1IK9A 1FDMA 1JTHA 2P7JA 1JO5A 1FOSE 4M3LA 2R5DA 2KP8A 1JUNA 3CL3D 4JYBA 4DZOA 1GU5A 1ZR2A 2WSCH 3UIAA 1HVVA 1NO4A 1VPCA 4W7YA 5APWA 1FZAA 2C0WA 1IJDB 3VP9A 3NTNA 4GT1A 1N7SB 2P67A 2IPPA 1N7SA 1N7SC 2H8PD 2M8RA 1JCDA 1E5WA 2XKMA 3VYIA 1JY2N 1G1JA 3HE4A 1NAFA 1L0NK 2Z5HA 1XTGB 4GIFA 5AVXB 3VP8A 5KJ7A 5KJ7C 4C7NB 5KLVK 5AW5B 5CJ4A 1KQLA 1GTWA 2OYIB 3M06A 4WY4A 4WY4C 2WWWA 5CHXA 2WPQA 2OYIA 2W27A 1L0LK 2OYIC 1GW4A 3EFGA 4XE5B 1MZ9A 1HJBA 1AFOA 4LC1A 3OAKA 4IFFA 4JF7A 1SFCD 2XZRA 2C9NY 2POHA 5AW8B 1CSBA 1JY2P 5CCHD 1JY2O 1QL2A 4W7ZA 5AW7B 2LKMA 2KLVA 1JCCA 5AVQB 2I1KA 3NMDA 2FYUK 1IFDA 2HPCB 2W6BA 1SQVK 3L36A 4HH2A 4LGDE 5AW3B 3RL0D 2E43A 3V2QA 2Q3IA 1NWQA 3PP5A 1URQD 4HYTB 1J2JB 2HLOA 1LTIC 1X8YA 4WBAA 1T3UA 1HTLC 4EOTA 2HODB 4AYCA 1W2EA 2GUSA 3MD0A 4N78D 2KYVA 3TK1A 5AW1B 5BVZA 1J1EB 4W80A 1RF0A 1RF0C 2O1KA 2WT7A 1NU1K 2N1TB 3HTKB 3P8CD 2N1TA 2BASA 2N1TC 3P8CE 5APQA 2O01H 5AVZB 3MUDA 2FXMA 3TNUB 5AVUB 5BU8B 1DX7A 3G3ZA 3M0DA 1SFCB 1DEBA 2YNYA 3M0DC 1LTTC 2XV5A 1L4AD 3H32B 5CJ0A 4EIJA 5CCGD 1FBMA 3C9IA 1KFMA 3P8MC 1LTAC 4WB4A 1LWUB 3GHGA 3GHGC 4DOJA 1N73B 5AW6B 1FZGA 1JNMA 1N73A 1N73C 2N9BA 1FOSF 1RY3A 1LGHB 1NOHA 2QM7A 4XA4A 3RK3D 2YO2A 2L5GB 3U1CA 3KQGA 1T2KC 2KB7P 3RL0B 1H89A 1JMMA 1URQB 4B86A 2P2UA 2E42A 3MIWA 3TYYA 3CLQA 2Q9IA 3OJAB 4AUWA 3BVHA 1LTJB 2IFNA 2I1JA 1MV8A 2ZXEB 5AW4B 3L35A 1CZQA 2C9LY 5APXA 2Z4EA 1Z56A 2VRSA 3M0AA 3NXSA 1HBWA 1M1JB 3T97A 1RF1B 2WPRA 4I1LA 2HG5D 1RF1A 1RF1C 3BRTB 4N6JA 5CMZA 2OARA 2WSEH 1J1DB 4C7NA 4JYCA 1J1DC 2R5BA 4ZKUA 3O8ZA 5AVTB 2NPSD 2XNXA 2Q7CA 1NHLA 4Y99B 1IFNA 1N86A 2GUVA 1X79B 4Y99C 4ZKPA 3NFQA 1GL2D 1IFIA 3A2AA 3RK2B 1SLQA 3HUSB 1G2CB 2FYZA 1H8AA 3HUSA 3HUSC 3RK2C 1FU1A 2XU6A 4C7RA 4O9BA 4OH8B 1XTCC 3II6A 3L37A 3VMZA 3B5ND 4RESB 5APTA 1KILD 2H43A 2WITA 4KHXA 5AVVB 1FJKA 1JY3N 1MUUA 1VDFA 2HPCA 2A45G 3IR9A 1CI6B 2O1JA 3BASA 4IFDK 1IC2A 1LTGC 1RE4A 1RE4C 2A45H 2R32A 2YKOA 5APYA 5AVRB 2HODA 3VN0A 1YTZT 3HD7D 1GK4A 3H6PA 1OXZA 1LTBC 1JY3P 1JY3O 1FZBA 1NKZB 1J1EC 2QM8A 1MFZA 3V5BA 4IFMA 1HWTC 4I6MC 1DH3A 1S9KE 1GW3A 2WSFH 3HTKA 3A5TA 5AVSB 1IFMA 5KTBA 2NPSB 3U1AA 5AW9B 2IX7C 1YTZI 1HUCA 3TNUA 1N7SD 1OWAA 4AQRD 1SFCA 1SFCC 2CPSA 1PFIA 3H32A 5CCHA 5CCHC 2OYHB 3MGNA 2OYHA 2OYHC 3E1IA 1NH4A 2Q5UA 1LWUA 1LWUC 3B5NB 1EQ7A 5KJ7D 5AVYB 2JJLA 2WPSA 2YO3A 4WY4D 3M9HA 2PAJA 3VTPC 1SQBK 3RL0C 1FZCB 4LLHA 2Z5IA 3KYQA 1URQA 1URQC 1LT9B 3HE5B 1FZCA 1FZCC 1LT9A 1LT9C 1SQQK 1ZV8A 1ZLLA 3EQ2A 2R3CA 1LTJA 1LTJC 1AQ5A 3MTUE 1NTZK 3HD7B 1SQPK 5APSA 3U59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOP A;  1GL2 D;  3RK2 B;  3RK2 C;  4OH8 B;  3B5N D;  1KIL D;  2XDJ A;  2KOG A;  2WZ7 A;  3RK2 D;  4W80 A;  2N1T B;  1L4A B;  3HTK B;  2YMY A;  2N1T A;  2N1T C;  1L4A A;  1L4A C;  3P8C E;  5CCG A;  1JTH B;  3HD7 A;  3HD7 C;  5CCG C;  1JTH A;  2HFE D;  1T3J A;  1SFC B;  3M0D C;  2N1T D;  4WY4 B;  1L4A D;  3RK3 B;  1HVV A;  5CCG D;  3HD7 D;  4W7Y A;  3RK3 C;  1N7S B;  1N7S A;  1N7S C;  2H8P D;  2M8R A;  3TSI A;  3RK3 D;  2NPS B;  3RL0 B;  1XTG B;  1N7S D;  1URQ B;  5KJ7 A;  5KJ7 C;  1SFC A;  1SFC C;  2PP6 A;  4WY4 A;  4WY4 C;  5CCH A;  5CCH C;  3B5N B;  5KJ7 D;  4JF7 A;  1SFC D;  4WY4 D;  5CCH D;  4W7Z A;  2HG5 D;  2NPS A;  2NPS C;  3RL0 C;  3KYQ A;  1URQ A;  1URQ C;  4N78 E;  1GL2 B;  1GL2 A;  1GL2 C;  2NPS D;  1NHL A;  4LGD E;  3RL0 D;  3PP5 A;  3HD7 B;  1KIL B;  1URQ D;  3B5N A;  3B5N C;  1KIL A;  1KIL C; 
#chains in the Genus database with same CATH topology
 1L0L E;  3QWO C;  1L0L G;  3H1J D;  4A7P A;  1K8A Q;  3Q5S A;  3CCV P;  3KHU A;  3H1H G;  1FZF A;  2K9Y A;  3CCL P;  2FYU E;  2FYU G;  3W67 A;  1FC2 C;  4WWI A;  1Y47 A;  1PPJ E;  3A3Y B;  1PPJ G;  1TU3 F;  3B8E B;  4WY4 B;  1SVF A;  2QJK C;  3R2P A;  3I5C A;  1M56 D;  1ZR4 A;  3H1K D;  3H1I D;  1BDC A;  1R5L A;  5B5E H;  2IBZ D;  2KLU A;  1VQ5 P;  1ZXG A;  1VQP P;  4C46 A;  5KLI C;  3O6Q A;  3V6I A;  2B87 B;  2C0X A;  2AEM A;  2E75 D;  1NTM D;  1NKN A;  2CPB A;  1GL2 B;  1QGK B;  3WMM 0;  1FJP A;  2IFM A;  2WT7 B;  1ZN5 A;  2KK7 A;  5AVW B;  3GLM A;  4H13 D;  1T8Z A;  3B5N A;  3B5N C;  2H7H A;  1SQQ G;  3CD6 P;  1SQX K;  1X9V A;  1N7L A;  1Q90 D;  4XFJ A;  1M8O B;  2D2C B;  3USS A;  3BAT A;  2FFD B;  2FYN C;  3H1L G;  1L0N D;  3HE5 A;  2GA1 A;  4JPZ B;  2MJZ A;  4JQ0 D;  1PV3 A;  2BEZ F;  1W5C E;  1FDM A;  1JTH A;  1S3J A;  3RGU A;  1FOS E;  4M3L A;  3CL3 D;  4L75 A;  4DZO A;  2IYO A;  1PP9 J;  1HVV A;  3UIA A;  1YIT P;  3VP9 A;  2OTL P;  2IYP A;  4H44 D;  2P67 A;  1FDO A;  1JCD A;  1E5W A;  2A06 D;  1G1J A;  3L73 J;  5KAI H;  4IL6 X;  1XTG B;  4GIF A;  5AVX B;  3VP8 A;  2YMK A;  5B5E E;  5AW5 B;  2H88 C;  2WPQ A;  2W27 A;  1PP9 E;  1PP9 G;  1IFP A;  3OAK A;  4LC1 A;  3BCC J;  4JF7 A;  1SFC D;  2C9N Y;  2OQQ A;  2POH A;  5CCH D;  2WQY C;  2RKL A;  3AE6 C;  3ITK A;  2LKM A;  1W2B O;  5KKZ C;  2KLV A;  4ZNC A;  2LXB A;  3L73 D;  3MZW B;  3L73 E;  1KIL E;  1KB9 I;  1SQB J;  1SQV K;  3CX5 D;  1BCC J;  4LGD E;  3L71 J;  5AW3 B;  3RL0 D;  1PGP A;  3BCC D;  3BCC E;  1YJN P;  1SQP J;  3RBZ A;  1HTL C;  2E74 C;  4EOT A;  2K88 A;  4GOF A;  4N78 D;  1SQX G;  2KYV A;  5BVZ A;  1J1E B;  1SQB E;  1SQB G;  5L8R J;  3L70 D;  3CWB G;  1BCC E;  2N1T A;  2N1T C;  1BCC G;  2QJP C;  3L71 G;  5AVZ B;  2ZYG A;  2FXM A;  1ZME C;  1OZH A;  5BU8 B;  2SPZ A;  1SQP E;  2AXT H;  3M0D A;  2YNY A;  3M0D C;  1SQP G;  1X22 A;  4U3F J;  4EIJ A;  2B9B A;  3CCU P;  3P8M C;  3CME P;  3IN6 A;  5AW6 B;  1EXI A;  1NOH A;  2QM7 A;  2Y9Z A;  3Q2Y A;  2FY8 A;  1IK7 A;  1PGJ A;  1Y8A A;  4HKZ H;  3TYY A;  2FXO A;  2Q9I A;  3OJA B;  3BVH A;  3CC7 P;  4U3F E;  4U3F G;  2IFN A;  2UWJ E;  3L35 A;  2C9L Y;  2Y0E A;  5APX A;  1AQT A;  2Z4E A;  1YHQ P;  1BE3 D;  3NXS A;  1U7J A;  1WMK A;  3T97 A;  2HG5 D;  1RF1 A;  1RF1 C;  1YJW P;  1KV4 A;  2WSE H;  4C7N A;  5AVT B;  2NPS D;  1S5L H;  2ZVO B;  4I7Z C;  2N9Y B;  4YPC A;  2V7Q H;  2GUV A;  4Y99 C;  3NFQ A;  2H89 C;  1GL2 D;  2FYZ A;  2E76 B;  4EDF A;  4OH8 B;  1VF5 C;  1XTC C;  3L37 A;  2BEQ D;  4RO0 A;  1OVU A;  1NAY A;  1P84 D;  3IR9 A;  2CK3 H;  2D2C D;  3L72 J;  1LTG C;  3C1L A;  1RE4 A;  1RE4 C;  1YBK A;  2WVR A;  3O6Q B;  1YQ4 C;  5E79 H;  4KT0 J;  3HD7 D;  1FZB A;  2AXT E;  1MFZ A;  1HWT C;  4I6M C;  2WSF H;  3A5T A;  5AVS B;  1IFM A;  3WUU A;  3U1A A;  5AW9 B;  3L72 E;  3TNU A;  1HUC A;  3L72 G;  2P58 A;  2RMZ A;  4ASW A;  3MGN A;  2WSE J;  3E1I A;  2Q5U A;  3B5N B;  2ITA A;  5KJ7 D;  3SFE C;  3M9H A;  2V7Q J;  2W90 A;  2Z5I A;  3KYQ A;  1URQ A;  1URQ C;  3HE5 B;  4L76 A;  1ZV8 A;  1LTJ A;  1LTJ C;  1S72 P;  1NTZ K;  2RN0 A;  1M7L A;  1S5L E;  2L91 A;  2NZ2 A;  5KAF H;  1VQ8 P;  3LID A;  3CXH I;  1QL1 A;  1CW5 A;  1YIJ P;  3KXD A;  2WZ7 A;  1E79 H;  1AV1 A;  1Q7Y Q;  3G71 P;  4UB8 H;  4H0L D;  1KQF B;  1N2D C;  1DD4 A;  2P1J A;  1L4A B;  2YMY A;  1K73 Q;  4NPE A;  1NU1 J;  2ZYD A;  1NTK K;  2ZJS E;  2HFE D;  2WSF J;  1T3J A;  2ZAE B;  1T6A A;  3RK3 B;  4PJ0 H;  5E79 E;  1JOC A;  2QVA A;  2QJY C;  3TSI A;  1NJI Q;  1RE3 A;  1RE3 C;  1NU1 E;  2M3B A;  1HGZ A;  1NU1 G;  5AW2 B;  1KYO H;  3V2R A;  1QVF O;  2QEX P;  1T2K D;  3N4X A;  1YI2 P;  1Y9B A;  4KJM A;  3AE5 C;  1S9K D;  1FZE A;  3L4F A;  4Z1M H;  4OGQ C;  3TGU D;  4YXW H;  2GM4 A;  2WTY A;  1KIL B;  1A02 J;  3EWK A;  2OYO A;  5H2F E;  4JBZ A;  4N3Y B;  3V4W A;  3L74 J;  3LIE A;  4GKG A;  4U7J A;  1S5L X;  3H1H J;  3GF3 A;  3S4R A;  2E76 D;  2ZFC A;  5KLV D;  3M91 A;  3KDP B;  1NTM K;  5KLV E;  1IFJ A;  3N7N A;  1WT6 A;  1L0L D;  1M1K Q;  3AEG C;  4UB8 E;  3AEA C;  1JUN A;  1LJ2 A;  3Q5P A;  1ZR2 A;  3L74 E;  2M5A B;  3L74 G;  1NO4 A;  1AA0 A;  5APW A;  2KUB A;  1U57 A;  3L75 J;  1IJD B;  3H1H E;  2QA4 P;  3H25 A;  2IPP A;  1N7S A;  1N7S C;  2H8P D;  1Q81 Q;  2FYU D;  4UB6 H;  3T97 B;  3I55 P;  5K5G B;  1NAF A;  1PPJ D;  1L0N K;  2Z5H A;  4PJ0 E;  3AE4 C;  4C7N B;  4D6T G;  5CJ4 A;  1KQL A;  1GTW A;  2OYI B;  5CHX A;  2LR2 A;  3JCU H;  3WU2 E;  4I7Z B;  1MZ9 A;  3L75 E;  1HJB A;  1AFO A;  1KYO E;  3L75 G;  2XZR A;  5AW7 B;  1VF5 B;  5DJT B;  4R4L A;  2ZXX A;  2I1K A;  3NMD A;  1IFD A;  2W6B A;  1M57 D;  3K5B A;  4HH2 A;  1S2E A;  4PD4 I;  4BWN A;  3IAO A;  3RL0 g;  1SQQ J;  2E43 A;  3V2Q A;  1NWQ A;  3PP5 A;  4ZMD A;  3Q5R A;  1X8Y A;  3C8V A;  2IZ1 A;  1T3U A;  2IBZ G;  1EDK A;  4AYC A;  3H1L J;  1AVY A;  1NVO A;  2M3E A;  4GOD A;  2K37 A;  1RF0 A;  1RF0 C;  3KZI H;  2K1A A;  2O1K A;  4CPG A;  1SQQ E;  2QIW A;  2O01 H;  1VQ6 P;  1VQK P;  3MUD A;  3MUD C;  3TNU B;  5AVU B;  1NTM G;  1DX7 A;  1FE6 A;  1SS1 A;  2XV5 A;  1L4A D;  3H1L D;  5CCG D;  3JC2 2;  5B66 H;  3H1L E;  3C9I A;  1KFM A;  4WB4 A;  3GHG A;  1NYH A;  3GHG C;  4DOJ A;  4HB1 A;  1N73 B;  1VQO P;  1FZG A;  3RK3 D;  2NRG A;  2YO2 A;  3RK3 E;  3CXH H;  3PTZ A;  1URQ B;  4UB6 E;  1PZQ A;  2FBW C;  2E75 C;  1LTJ B;  1H0T A;  2ZXE B;  3JCU E;  1KN7 A;  1Z56 A;  2WPR A;  4H13 C;  3BRT B;  4N6J A;  5CMZ A;  4JYC A;  1J1D C;  1PP9 D;  1NHL A;  4PV1 D;  3AED C;  4ZKP A;  3A2A A;  3RK2 B;  1SLQ A;  3HUS B;  2B88 A;  1H8A A;  4O9B A;  2O01 J;  1SQX J;  4BXL A;  3II6 A;  3VMZ A;  4RES B;  1EZV I;  1KIL D;  3FX0 A;  5C39 A;  2WIT A;  4KHX A;  1FJK A;  2IZ0 A;  1VDF A;  2HPC A;  2A45 G;  3CWB J;  2K9J A;  1YQ3 C;  4IFD K;  4NPD A;  2ZT9 D;  3KZI E;  1QLE D;  4H44 C;  1D7M A;  2YKO A;  5APY A;  5AVR B;  2HOD A;  1SQX E;  1YTZ T;  2P10 A;  3CC2 P;  3H6P A;  1OXZ A;  2QE7 H;  1SQB D;  2QM8 A;  3CWB D;  3V5B A;  3CWB E;  1BCC D;  5B66 E;  3L71 D;  4NPF X;  3L71 E;  3HTK A;  5KTB A;  2IX7 C;  4Y28 J;  1SQP D;  1KMI Z;  2YIU B;  1SFC A;  1SFC C;  1EDJ A;  5CCH A;  5CCH C;  2OYH A;  2OYH C;  2PFX A;  2Q6Q A;  2WPS A;  4WY4 D;  2OTJ P;  4TLF A;  1HJ0 A;  2IBZ I;  3RL0 C;  1FZC B;  4LLH A;  1LT9 B;  4U3F D;  5KAI E;  1BSH A;  1SQV J;  2E5T A;  3U59 A;  3VOP A;  3HRN A;  1GK6 A;  1GDT A;  1GD2 E;  1M1J A;  1M1J C;  1S1C X;  2YKQ A;  3A7O A;  3V4Q A;  1KFN A;  5BU5 A;  3G6E P;  3EFF K;  1GU4 A;  1SQV E;  1SQV G;  1BE3 G;  3BRV B;  2HYN A;  4R4M A;  1G2C A;  4PD4 H;  2QJK B;  1KZU B;  1OX3 A;  3VMY A;  3E1R A;  3RBX A;  2JEE A;  2J59 M;  2KSE A;  1KC8 Q;  1L2P A;  1M90 Q;  1OVV A;  2KIK A;  3ABV C;  5KLI B;  2PP6 A;  4I2L C;  1RHZ B;  1JEK A;  2B87 A;  1ZW0 A;  1FAV A;  3D71 A;  3CC4 P;  1OW6 A;  3MHV A;  2NPS A;  2NPS C;  3L72 D;  3AEF C;  1BSN A;  1GL2 A;  1GL2 C;  1USD A;  2A45 I;  1EC5 A;  3VMX A;  5CBN A;  1K05 A;  2BCC J;  3KPE A;  1OFC X;  3SWF A;  1RQV A;  3AE8 C;  2FYN B;  1Q2N A;  2D2C C;  2FFD A;  2FFD C;  1JM0 A;  2XDJ A;  3CX5 I;  3GHG B;  1GZL A;  3OA7 A;  3V2N A;  3M9Q A;  3RK2 D;  1A02 F;  2KSJ A;  2RH0 A;  2YKP A;  2JWD A;  1JTH B;  3HD7 A;  3HD7 C;  3A0B H;  1JO5 A;  2P7J A;  2BCC E;  1KQS O;  2BCC G;  2R5D A;  4JYB A;  1GU5 A;  3CCR P;  1VPC A;  1FZA A;  4GT1 A;  4PD4 E;  2Y0C A;  3VYI A;  1JY2 N;  2G3A A;  2Y0D A;  2OGU A;  1OW7 A;  3HE4 A;  1KB9 H;  4H13 B;  5KJ7 A;  5KJ7 C;  1MKM A;  5KLV K;  3M06 A;  3Q3D A;  1L0L K;  1GW4 A;  3EFG A;  4XE5 B;  3GW6 A;  3SSU A;  1KTM A;  3CCJ P;  1JY2 P;  5KKZ B;  1QL2 A;  3GG2 A;  2B89 A;  1NU1 D;  1BGY J;  3R4Y A;  3AE7 C;  3PJS K;  2FYU K;  2HPC B;  1R8E A;  2DW3 A;  1LP1 A;  2Q3I A;  3CCS P;  5GTH H;  1QEX A;  4HYT B;  1J2J B;  1VQM P;  1LTI C;  4MN4 C;  1NTZ J;  3A0H H;  2E74 B;  4WBA A;  2HOD B;  4H0L C;  2FXP A;  1W2E A;  2GUS A;  3MD0 A;  3CCE P;  3PRJ A;  1BGY E;  4IL6 H;  2M0B A;  1BGY G;  1DIP A;  3VMA A;  2N1T B;  4HJG H;  2QJP B;  3HTK B;  3P8C D;  2BAS A;  3P8C E;  1EXJ A;  2V4H A;  1DEE G;  1NTZ E;  1NTZ G;  1SFC B;  1DEB A;  1LTT C;  2WSS H;  3A0B E;  1P84 I;  3FWN A;  4IOI H;  2N9B A;  5KAF E;  1FOS F;  1NGM B;  1LGH B;  3H1J J;  2K3R A;  2L5G B;  3KQG A;  1T2K C;  2PRR A;  2KB7 P;  3RL0 B;  1H89 A;  4D6T J;  1JMM A;  4B86 A;  2P2U A;  3L74 D;  3CLQ A;  1EZV E;  3AE1 C;  4DT0 A;  4AUW A;  1KB9 D;  1EZV G;  2KS1 A;  3D6Y A;  1NTK G;  1KB9 E;  3H1H D;  3GMA A;  2I1J A;  4QMA A;  1OMI A;  5CBO A;  3PH0 A;  3FWL A;  3M0A A;  1HBW A;  1RQU A;  1M1J B;  1RF1 B;  4I1L A;  3H1J E;  3TDK A;  3H1J G;  3AEC C;  2QG4 A;  4D6T D;  3D70 A;  4D6T E;  2OAR A;  3SFD C;  3I56 P;  3H1K J;  3H1I J;  3O8Z A;  2Q7C A;  3L75 D;  1KYO D;  4WVZ A;  4Y99 B;  1X79 B;  3FXE A;  1G2C B;  4C7R A;  1FU1 A;  2E76 C;  2KNC A;  5GTH E;  3B5N D;  5APT A;  2H43 A;  1YJ9 P;  3A0H E;  1JY3 N;  2G8Y A;  1K04 A;  2W8Z A;  2W83 C;  1USE A;  3H1K E;  3H1I E;  4IL6 E;  3H1K G;  3H1I G;  3BAS A;  1NTM J;  1IC2 A;  2IBZ E;  2A45 H;  2R32 A;  2KXP B;  4L74 A;  1GK4 A;  3FXD A;  1JY3 P;  5GTI H;  1NKZ B;  3S1K A;  1LNQ A;  1GW3 A;  1SQQ D;  2NPS B;  2ZVN B;  3CX5 H;  1NTM E;  1OWA A;  1PGO A;  2O01 N;  4AQR D;  1L0N J;  2CPS A;  1PFI A;  3H32 A;  4YXD C;  1LWU A;  1LWU C;  1N8R Q;  2Q3E A;  2JJL A;  2YO3 A;  3VTP C;  1SQB K;  1PGQ A;  1L0N E;  1L0N G;  1ZLL A;  3EQ2 A;  2R3C A;  3ZDM A;  1ZOY C;  3MTU E;  3HD7 B;  1SQP K;  4GDO A;  3OW2 O;  1QX8 A;  3IFM A;  1Q82 Q;  3V2P A;  3SWY A;  2YXQ B;  2E74 D;  2W6A A;  5EFW B;  1X0T A;  1IO4 A;  3AE3 C;  2A06 E;  1L4A A;  1L4A C;  1HH0 A;  2JR8 A;  5CCG A;  2A06 G;  5CCG C;  3HE4 B;  1YYC A;  1OVR A;  2I8D A;  3AE2 C;  2AEJ A;  2KZI A;  2N1T D;  3MP7 B;  3CI9 A;  3RK3 C;  1HGV A;  3M9B A;  1QVG O;  3G9R A;  5APU A;  5APV A;  2QJY B;  1AJY A;  4YTP C;  1CI6 A;  1U7M A;  3W68 A;  1GMJ A;  5GTI E;  2AXC A;  3L73 G;  2J58 A;  1EDI A;  1SQX D;  1LTS C;  2WMM A;  3AEB C;  3S9O A;  1LP1 B;  3CX5 E;  2JDI H;  3L70 J;  2W6J H;  5TJH A;  3BCC G;  4H0L B;  1P84 H;  2QSI A;  3LW5 H;  4OGQ B;  4PV1 C;  4N78 E;  3CXH D;  2FKW B;  3CXH E;  3P7K A;  1KYO I;  1SP4 A;  3L70 E;  1H88 A;  3L70 G;  1KIL A;  1KIL C;  1WRG A;  2KI7 B;  4BRY A;  3P32 A;  1R5S A;  2KOG A;  3QH9 A;  2ZT9 C;  2Q1K A;  2MKV A;  1VF5 D;  2WPV B;  1G1I A;  1KQG B;  1BE3 J;  1AVO A;  3CCM P;  5AW0 B;  1IK9 A;  4OVN F;  5DJU B;  2KP8 A;  3PHL A;  2WSC H;  2KS1 B;  2M5A A;  4W7Y A;  2C0W A;  3NTN A;  1N7S B;  1VQL P;  2M8R A;  1SQV D;  2XKM A;  1OW8 A;  1BE3 E;  2J5U A;  2JO1 A;  1KOR A;  4EYY Q;  3LW5 J;  3B71 A;  4WY4 C;  2WWW A;  4WY4 A;  2OYI A;  2OYI C;  5TIS H;  3SWK A;  4RKU J;  3AE9 C;  2XND H;  3GF7 A;  4IFF A;  5AW8 B;  1PL5 A;  1CSB A;  1FDI A;  1JY2 O;  4W7Z A;  2KNC B;  2JWA A;  1JCC A;  2KZJ A;  5AVQ B;  1KD1 Q;  1FS0 E;  1S4X A;  3PLN A;  3L36 A;  1EDL A;  1ZRT D;  1P84 E;  1PIX A;  1ZRT E;  1URQ D;  2HLO A;  2YXR B;  4DJG A;  4ASV A;  3TK1 A;  5AW1 B;  4W80 A;  2WSC J;  1JB0 J;  3CCQ P;  3D6Z A;  2WT7 A;  1NU1 K;  5APQ A;  3Q1M A;  1VQ7 P;  3G3Z A;  5M1B A;  5CJ0 A;  3H32 B;  1FBM A;  1OIP A;  1LTA C;  1LWU B;  3CPW O;  2QRX A;  1ZP0 C;  1N73 A;  1JNM A;  1N73 C;  1VQ9 P;  1RY3 A;  4L73 A;  4XA4 A;  1VL2 A;  3FGA D;  3U1C A;  1VQ4 P;  2Y9Y A;  2BCC D;  1UIX A;  2E42 A;  2PGD A;  3MIW A;  2E75 B;  5H2F H;  1H0T B;  4PD4 D;  1MV8 A;  5AW4 B;  1RH5 B;  1CZQ A;  2VRS A;  5TIS E;  2R44 A;  4TT3 H;  2JP3 A;  3WUV A;  1J1D B;  2ZYA A;  1DD3 A;  2R5B A;  4K3A A;  4ZKU A;  2XNX A;  4OGQ D;  1IFN A;  1N86 A;  1UII A;  4RJT A;  4DCK A;  2O3J A;  1IFI A;  3HUS A;  3HUS C;  3RK2 C;  2XU6 A;  3G4S P;  4K35 A;  2OTK E;  2JKV A;  1Q86 Q;  5AVV B;  1MUU A;  2K9J B;  2HR3 A;  3F5H A;  3JSV C;  3IF4 A;  1CI6 B;  2O1J A;  2LXC B;  3WU2 H;  4H44 B;  1JMB A;  1BGY D;  3TGU J;  3VN0 A;  4EI2 A;  1IZN B;  2R3S A;  1LTB C;  1JY3 O;  1J1E C;  3CMA P;  4IFM A;  1DH3 A;  1S9K E;  4OWF A;  1VQN P;  1NTZ D;  1MFT A;  1HF9 A;  1YTZ I;  4PV1 B;  1N7S D;  1NTK J;  1BDD A;  2YIU C;  1LT1 A;  5KLV J;  2OYH B;  3TGU E;  3TGU G;  1NH4 A;  3B4S A;  1EQ7 A;  1L0L J;  5AVY B;  1K9M Q;  4BRY B;  2E5Y A;  3WUT A;  2PAJ A;  3F89 A;  3E7K A;  2AEF A;  1FZC A;  1FZC C;  1EZV D;  1LT9 A;  1LT9 C;  1NTK D;  3AEE C;  2ZT9 B;  1NTK E;  1SQQ K;  2IDB A;  2FYU J;  1AQ5 A;  5KLV G;  5APS A;  3TF5 A;  4GOE A; 
#chains in the Genus database with same CATH homology
 3VOP A;  1M7L A;  3HRN A;  3IFM A;  1GK6 A;  1GDT A;  1GD2 E;  1M1J A;  1M1J C;  3V2P A;  3LID A;  1QL1 A;  1CW5 A;  3SWY A;  2YKQ A;  3A7O A;  2WZ7 A;  3V4Q A;  1KFN A;  2W6A A;  1N2D C;  1FZF A;  5BU5 A;  1GU4 A;  2P1J A;  1L4A B;  1IO4 A;  2YMY A;  1L4A A;  1L4A C;  1HH0 A;  5CCG A;  5CCG C;  3HE4 B;  3BRV B;  2HYN A;  1YYC A;  1NTK K;  3A3Y B;  1G2C A;  2HFE D;  1T3J A;  3B8E B;  2N1T D;  4WY4 B;  3RK3 B;  1SVF A;  1KZU B;  3RK3 C;  3CI9 A;  3R2P A;  1HGV A;  3M9B A;  3VMY A;  3I5C A;  5APU A;  5APV A;  1ZR4 A;  1JOC A;  1CI6 A;  2JEE A;  3TSI A;  2J59 M;  1RE3 A;  1RE3 C;  2M3B A;  1HGZ A;  4C46 A;  2J58 A;  5AW2 B;  2PP6 A;  3V2R A;  1LTS C;  4I2L C;  1T2K D;  3N4X A;  2C0X A;  1S9K D;  1FZE A;  3L4F A;  1FAV A;  2NPS A;  2NPS C;  3LW5 H;  1NKN A;  4N78 E;  2CPB A;  1GL2 B;  2FKW B;  3WMM 0;  1GL2 A;  1GL2 C;  1FJP A;  3P7K A;  2IFM A;  2A45 I;  2GM4 A;  2WT7 B;  1SP4 A;  1ZN5 A;  5AVW B;  3VMX A;  2WTY A;  1H88 A;  1KIL B;  1A02 J;  1T8Z A;  3B5N A;  3B5N C;  2H7H A;  1KIL A;  1KIL C;  3KPE A;  1WRG A;  1SQX K;  4N3Y B;  3SWF A;  1X9V A;  1N7L A;  3V4W A;  3P32 A;  3LIE A;  4GKG A;  3BAT A;  2FFD B;  2FFD A;  2FFD C;  2XDJ A;  3GHG B;  3OA7 A;  1GZL A;  2KOG A;  3HE5 A;  3V2N A;  3M9Q A;  3RK2 D;  1A02 F;  2ZFC A;  2KSJ A;  3M91 A;  3KDP B;  1NTM K;  1G1I A;  2MJZ A;  2YKP A;  1IFJ A;  3N7N A;  1WT6 A;  1JTH B;  3HD7 A;  3HD7 C;  5AW0 B;  1IK9 A;  1FDM A;  1JTH A;  2P7J A;  1JO5 A;  1FOS E;  4M3L A;  2R5D A;  2KP8 A;  1JUN A;  3CL3 D;  4JYB A;  4DZO A;  1GU5 A;  1ZR2 A;  2WSC H;  3UIA A;  1HVV A;  1NO4 A;  1VPC A;  4W7Y A;  5APW A;  1FZA A;  2C0W A;  1IJD B;  3VP9 A;  3NTN A;  4GT1 A;  1N7S B;  2P67 A;  2IPP A;  1N7S A;  1N7S C;  2H8P D;  2M8R A;  1JCD A;  1E5W A;  2XKM A;  3VYI A;  1JY2 N;  1G1J A;  3HE4 A;  1NAF A;  1L0N K;  2Z5H A;  1XTG B;  4GIF A;  5AVX B;  3VP8 A;  5KJ7 A;  5KJ7 C;  4C7N B;  5KLV K;  5AW5 B;  5CJ4 A;  1KQL A;  1GTW A;  2OYI B;  3M06 A;  4WY4 A;  4WY4 C;  2WWW A;  5CHX A;  2WPQ A;  2OYI A;  2W27 A;  1L0L K;  2OYI C;  1GW4 A;  3EFG A;  4XE5 B;  1MZ9 A;  1HJB A;  1AFO A;  4LC1 A;  3OAK A;  4IFF A;  4JF7 A;  1SFC D;  2XZR A;  2C9N Y;  2POH A;  5AW8 B;  1CSB A;  1JY2 P;  5CCH D;  1JY2 O;  1QL2 A;  4W7Z A;  5AW7 B;  2LKM A;  2KLV A;  1JCC A;  5AVQ B;  2I1K A;  3NMD A;  2FYU K;  1IFD A;  2HPC B;  2W6B A;  1SQV K;  3L36 A;  4HH2 A;  4LGD E;  5AW3 B;  3RL0 D;  2E43 A;  3V2Q A;  2Q3I A;  1NWQ A;  3PP5 A;  1URQ D;  4HYT B;  1J2J B;  2HLO A;  1LTI C;  1X8Y A;  4WBA A;  1T3U A;  1HTL C;  4EOT A;  2HOD B;  4AYC A;  1W2E A;  2GUS A;  3MD0 A;  4N78 D;  2KYV A;  3TK1 A;  5AW1 B;  5BVZ A;  1J1E B;  4W80 A;  1RF0 A;  1RF0 C;  2O1K A;  2WT7 A;  1NU1 K;  2N1T B;  3HTK B;  3P8C D;  2N1T A;  2BAS A;  2N1T C;  3P8C E;  5APQ A;  2O01 H;  5AVZ B;  3MUD A;  2FXM A;  3TNU B;  5AVU B;  5BU8 B;  1DX7 A;  3G3Z A;  3M0D A;  1SFC B;  1DEB A;  2YNY A;  3M0D C;  1LTT C;  2XV5 A;  1L4A D;  3H32 B;  5CJ0 A;  4EIJ A;  5CCG D;  1FBM A;  3C9I A;  1KFM A;  3P8M C;  1LTA C;  4WB4 A;  1LWU B;  3GHG A;  3GHG C;  4DOJ A;  1N73 B;  5AW6 B;  1FZG A;  1JNM A;  1N73 A;  1N73 C;  2N9B A;  1FOS F;  1RY3 A;  1LGH B;  1NOH A;  2QM7 A;  4XA4 A;  3RK3 D;  2YO2 A;  2L5G B;  3U1C A;  3KQG A;  1T2K C;  2KB7 P;  3RL0 B;  1H89 A;  1JMM A;  1URQ B;  4B86 A;  2P2U A;  2E42 A;  3MIW A;  3TYY A;  3CLQ A;  2Q9I A;  3OJA B;  4AUW A;  3BVH A;  1LTJ B;  2IFN A;  2I1J A;  1MV8 A;  2ZXE B;  5AW4 B;  3L35 A;  1CZQ A;  2C9L Y;  5APX A;  2Z4E A;  1Z56 A;  2VRS A;  3M0A A;  3NXS A;  1HBW A;  1M1J B;  3T97 A;  1RF1 B;  2WPR A;  4I1L A;  2HG5 D;  1RF1 A;  1RF1 C;  3BRT B;  4N6J A;  5CMZ A;  2OAR A;  2WSE H;  1J1D B;  4C7N A;  4JYC A;  1J1D C;  2R5B A;  4ZKU A;  3O8Z A;  5AVT B;  2NPS D;  2XNX A;  2Q7C A;  1NHL A;  4Y99 B;  1IFN A;  1N86 A;  2GUV A;  1X79 B;  4Y99 C;  4ZKP A;  3NFQ A;  1GL2 D;  1IFI A;  3A2A A;  3RK2 B;  1SLQ A;  3HUS B;  1G2C B;  2FYZ A;  1H8A A;  3HUS A;  3HUS C;  3RK2 C;  1FU1 A;  2XU6 A;  4C7R A;  4O9B A;  4OH8 B;  1XTC C;  3II6 A;  3L37 A;  3VMZ A;  3B5N D;  4RES B;  5APT A;  1KIL D;  2H43 A;  2WIT A;  4KHX A;  5AVV B;  1FJK A;  1JY3 N;  1MUU A;  1VDF A;  2HPC A;  2A45 G;  3IR9 A;  1CI6 B;  2O1J A;  3BAS A;  4IFD K;  1IC2 A;  1LTG C;  1RE4 A;  1RE4 C;  2A45 H;  2R32 A;  2YKO A;  5APY A;  5AVR B;  2HOD A;  3VN0 A;  1YTZ T;  3HD7 D;  1GK4 A;  3H6P A;  1OXZ A;  1LTB C;  1JY3 P;  1JY3 O;  1FZB A;  1NKZ B;  1J1E C;  2QM8 A;  1MFZ A;  3V5B A;  4IFM A;  1HWT C;  4I6M C;  1DH3 A;  1S9K E;  1GW3 A;  2WSF H;  3HTK A;  3A5T A;  5AVS B;  1IFM A;  5KTB A;  2NPS B;  3U1A A;  5AW9 B;  2IX7 C;  1YTZ I;  1HUC A;  3TNU A;  1N7S D;  1OWA A;  4AQR D;  1SFC A;  1SFC C;  2CPS A;  1PFI A;  3H32 A;  5CCH A;  5CCH C;  2OYH B;  3MGN A;  2OYH A;  2OYH C;  3E1I A;  1NH4 A;  2Q5U A;  1LWU A;  1LWU C;  3B5N B;  1EQ7 A;  5KJ7 D;  5AVY B;  2JJL A;  2WPS A;  2YO3 A;  4WY4 D;  3M9H A;  2PAJ A;  3VTP C;  1SQB K;  3RL0 C;  1FZC B;  4LLH A;  2Z5I A;  3KYQ A;  1URQ A;  1URQ C;  1LT9 B;  3HE5 B;  1FZC A;  1FZC C;  1LT9 A;  1LT9 C;  1SQQ K;  1ZV8 A;  1ZLL A;  3EQ2 A;  2R3C A;  1LTJ A;  1LTJ C;  1AQ5 A;  3MTU E;  1NTZ K;  3HD7 B;  1SQP K;  5APS A;  3U59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...