4WY4D

Crystal structure of autophagic snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
64
Chain Sequence
HLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKVRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 32
structure length 64
sequence length 65
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4D00
1N7SC 1NHLA 1URQB 2XDJA 3HD7A 5CCHA 3VOPA 5KJ7D 1URQD 2YMYA 3RL0C 2PP6A 2NPSC 1SFCA 3B5NC 2NPSB 3RK3B 4W7YA 1SFCC 3B5NB 1GL2A 1L4AA 2NPSD 4WY4D 1N7SB 3RK3D 2HG5D 2KOGA 3PP5A 5CCGD 1GL2C 1L4AC 3RK2C 3B5ND 3HD7C 5CCHC 1KILA 1N7SD 3RK2B 1JTHA 3HD7B 3RL0B 2N1TA 1KILC 3HTKB 4JF7A 1XTGB 3RK2D 2N1TC 3HD7D 3RL0D 1KILB 5CCHD 3KYQA 2N1TB 5KJ7A 1SFCB 1URQA 5KJ7C 1URQC 1GL2B 1L4AB 1SFCD 4LGDE 3P8CE 1GL2D 1L4AD 2HFED 2H8PD 2M8RA 1T3JA 2NPSA 2WZ7A 1JTHB 4WY4A 5CCGA 4W7ZA 3M0DC 1KILD 3B5NA 4OH8B 4N78E 1HVVA 4WY4C 3TSIA 3RK3C 5CCGC 1N7SA 2N1TD 4W80A 4WY4B
chains in the Genus database with same CATH superfamily
1NHLA 3GG2A 3Q3DA 2Y0DA 3S1KA 5AW3B 1GU4A 1PV3A 1J1DC 1PFIA 3CWBD 3L75J 2O3JA 3L75D 3TNUA 1H8AA 1Q7YQ 2RMZA 3CX5D 3JC22 1S1CX 1USDA 1N73B 2E43A 2FXOA 1KB9D 1J1EB 2YNYA 3MUDA 2IDBA 5CMZA 1YITP 2JEEA 1DX7A 3HE5A 3F89A 4JF7A 1K05A 4CPGA 5APXA 2IPPA 3E1RA 5H2FH 1NKZB 1W2BO 1R5SA 3OA7A 1BCCJ 1W2EA 3SFDC 5AVRB 1URQC 3OAKA 1EZVI 4LGDE 1NU1G 1KTMA 4OGQC 2OYHC 1LWUC 3CCMP 3JCUE 3MGNA 3SWYA 4PD4D 2IZ0A 3IFMA 3FWLA 5DJTB 2O01J 1Y8AA 1OWAA 2RH0A 3H1HG 1RE3A 2ZT9B 4WB4A 2M3BA 1X79B 5AVVB 3BCCG 1KD1Q 2O1JA 1RHZB 5AVXB 1SP4A 1X9VA 1EZVD 3EWKA 1QVGO 3CC7P 1GK4A 1L0LJ 2R5DA 1LT9C 2WSEJ 2DW3A 2W6AA 3A0BE 1BGYG 3AEBC 2KLUA 2HPCA 1VQ4P 1FBMA 1PP9J 3CX5H 1SQBD 5GTIH 3N4XA 3H1KE 1ZN5A 3LW5J 3RK2B 1ZW0A 1KB9H 3O6QB 1KILC 2Q9IA 1BE3G 1FZAA 2YKQA 4DJGA 1GL2B 4L73A 1YQ3C 1IK9A 3AE3C 1SQPG 1EXJA 3H1JG 1FZGA 3S4RA 1RF1B 1M57D 5AW6B 4N3YB 1T2KC 1H0TA 1EDKA 1LTSC 2MJZA 2K37A 2JP3A 4HJGH 1PL5A 4PD4H 3CCJP 2C0XA 1GU5A 1MZ9A 5CBOA 4Y99B 1N73C 2O01H 4NPFX 1J1EC 2AEJA 3Q5PA 1L0NJ 5KTBA 2JR8A 2KK7A 1HWTC 3CMEP 3WU2E 3VMZA 2YO3A 2D2CB 1HBWA 5AW8B 5KAIE 1K04A 2GUSA 3L75E 3AE5C 2JDIH 2WSEH 1N7SB 1NTKG 1S5LH 3AE8C 3L70G 2WVRA 1QL1A 5APUA 1QGKB 1ZRTD 1IFDA 4N78D 1JY2N 1DEBA 2WT7B 3FX0A 3M91A 1NTMG 3PTZA 4XA4A 1LTJB 2B88A 3PJSK 5CJ4A 3CXHI 3A0HH 3C1LA 4H44B 2K9YA 5AW5B 1KYOD 5GTHE 1NTZJ 1BCCE 1QL2A 4EOTA 1ZXGA 2WZ7A 4XE5B 2HYNA 2IBZD 3M0DC 3PRJA 5KKZC 5AW1B 2KS1A 3H25A 2C0WA 1M1JB 1FDOA 2OYOA 4EIJA 2FBWC 2YMKA 1JNMA 3A7OA 3O8ZA 3AE7C 2Y9YA 1M8OB 1BDDA 4LC1A 2JO1A 3BRVB 3HTKA 4IOIH 2H43A 4IL6X 2KSJA 3VTPC 1VQ6P 2AEMA 4Z1MH 1SQVJ 3ITKA 4MN4C 3GHGB 5CJ0A 1FDIA 1SFCA 3B5NC 2WPVB 3HRNA 1DD4A 1AV1A 1MKMA 1Q86Q 1P84I 1SQQJ 1YJWP 1SQXJ 1L0LE 4HYTB 3SSUA 1OVVA 3L72J 4EDFA 1H89A 1GL2C 1VPCA 1GDTA 5B66H 3HD7C 3RBZA 1G2CB 2WT7A 1PP9E 2KZJA 2YIUC 4IFDK 1RF1C 2Q6QA 3CCUP 4D6TG 2N1TC 1PZQA 2OYIB 4PJ0E 3L74J 1CI6B 1WMKA 2M5AB 1LP1B 2K9JB 1SS1A 3KQGA 4OVNF 1K8AQ 2GM4A 4GT1A 3H1IG 5AVZB 5APYA 1LTIC 1KYOH 2JKVA 3TGUJ 3NMDA 4A7PA 2BCCG 3TGUD 3BRTB 2D2CC 1EXIA 5K5GB 1YHQP 4PV1D 1U57A 3FXDA 2FY8A 1SQPK 1N7SC 4UB6H 4C7NB 2QRXA 5TJHA 2HR3A 3GHGA 1EDIA 3VN0A 3I5CA 3C9IA 1Y9BA 3AEAC 2ITAA 2L5GB 2NPSC 3AE2C 1L0NE 3L73G 4RESB 4U3FJ 1KILE 2AXCA 2N9BA 1RF0A 1M56D 2QJPB 1LTJC 1PPJG 3WMM0 2KI7B 5AW4B 2P67A 1JCCA 5CCHC 2OYIA 3L71G 2KLVA 1CI6A 2ZAEB 2PAJA 1AJYA 3L36A 5AW0B 1GZLA 1M1JC 3TNUB 4AYCA 2YKOA 3AEEC 5APQA 5TISH 1JEKA 3BASA 1J2JB 1SFCD 2BEQD 5AVQB 1U7JA 1VQPP 1FZCC 2CPBA 1XTCC 1NU1J 1L0LK 2A45H 2E74C 1NU1D 1NTMK 1T3JA 1BSNA 3KHUA 4H0LB 3HE5B 1VQLP 1Z56A 3H32A 4GDOA 3AE4C 1NTZE 2KSEA 2FYUJ 3TSIA 1VL2A 5KLVJ 2K3RA 2Z5IA 2IFMA 4EI2A 1Q81Q 2A06G 3P8MC 3H1HD 2KNCB 1PGQA 4Y28J 4U7JA 1JUNA 4L75A 3G9RA 3CX5I 1M1KQ 4I7ZC 3BCCD 2PP6A 4OWFA 1KMIZ 4KT0J 2OTJP 4DZOA 3W68A 1KC8Q 3CXHE 5DJUB 3EQ2A 1KB9I 5AW7B 3CCRP 1JO5A 1S9KD 1SQVE 1JMMA 3U1CA 1NH4A 3RK3D 2KOGA 1BGYD 1IFIA 2ZXEB 2FFDC 3B71A 2P1JA 3CWBJ 1OXZA 1T6AA 3B8EB 1SQQE 2WPSA 1SQXE 4UB8H 2Q3IA 2KIKA 2NZ2A 1EC5A 3L72E 5APTA 1FJKA 2XNDH 1ZMEC 3GF7A 5E79H 1BE3D 3KPEA 4PD4I 3SFEC 2HPCB 2UWJE 4HKZH 5AW2B 1L0NK 2ZVNB 3L74E 1OW8A 3P8CE 3W67A 3FWNA 5B5EE 2HFED 1P84E 3CCQP 3CD6P 3H6PA 2JWDA 3H1JJ 1A02J 1LT9A 1JY3O 1SQPD 5C39A 3H1JD 3CCVP 2KNCA 1KQLA 1PGJA 3H1KG 3SWKA 3M9QA 2IZ1A 2QJPC 1X0TA 2QA4P 3BVHA 5KAFH 2E75C 3USSA 1YI2P 1W5CE 4ZKUA 4EYYQ 3QWOC 2YXQB 4IFMA 3CC4P 1NJIQ 5BVZA 4IL6H 1H0TB 4GODA 1DH3A 2R44A 1AFOA 4BWNA 1GW3A 3U1AA 1CSBA 1HJBA 1KFNA 5AVTB 1OX3A 1NAYA 1K9MQ 4U3FE 1NTZK 3V5BA 1NTKD 2P58A 1RQVA 3MUDC 3L70D 4YXWH 1S2EA 1FC2C 3CMAP 1LTTC 1SQBJ 5KJ7A 2G3AA 1NGMB 3E1IA 2Q1KA 2B87B 2W8ZA 2K88A 1NTMD 4KHXA 1SQVK 3AEDC 2PFXA 1JMBA 2WPRA 1WT6A 1OVUA 1NWQA 2IX7C 4PV1B 1RY3A 4OH8B 5H2FE 1SQQK 1KV4A 1SQXK 2QJYB 4RKUJ 2OARA 2W27A 1YTZT 2G8YA 3M9HA 2I8DA 1RE3C 2XDJA 2FYUE 1UIIA 5KLVE 3HUSB 3R2PA 2FYNB 1PIXA 1Q2NA 3OW2O 4H0LD 3RBXA 1OVRA 2XNXA 3BATA 3H1LE 1VQMP 2WSFJ 1BCCG 2KS1B 2NRGA 4QMAA 1YJNP 2E76B 4AUWA 2SPZA 3GW6A 2OTLP 3IAOA 1JTHA 2ZJSE 3HTKB 3VMYA 1HF9A 3II6A 3CWBE 2B87A 4JPZB 3M0DA 2FXMA 3CLQA 1EQ7A 1KYOI 5KLIB 4D6TD 1WRGA 1DD3A 1U7MA 2V7QH 1SFCB 3CI9A 3CX5E 5GTIE 2IBZI 1RE4A 1KB9E 4IFFA 3F5HA 1LT1A 2H8PD 1KN7A 1L0LG 3L4FA 4JYBA 5CHXA 3H1ID 5CCGA 3B5NA 2ZT9C 2BCCJ 4JYCA 2XV5A 2BCCD 3HUSA 1PP9G 2WMMA 1VDFA 3HD7A 1EDLA 3M0AA 5KJ7D 2YMYA 2CPSA 3P32A 1HGZA 2YO2A 2FYZA 1VQ5P 2YKPA 3MHVA 4PD4E 2CK3H 4DCKA 2WSCH 3CL3D 3CCSP 4ZMDA 3RK3B 3TYYA 1QLED 1L4AA 4WWIA 2R3CA 4LLHA 1RQUA 3L73D 1IFJA 3RK2C 1FZEA 4K3AA 2YXRB 2Y0EA 2WSFH 1PPJD 2LR2A 2AXTH 1QEXA 1EZVE 1NOHA 3K5BA 2QJKB 3L71D 1S3JA 2FYUK 1JY2O 2A45I 2OQQA 5KLVK 2QJYC 4BRYA 2WWWA 3M06A 1T8ZA 1S5LE 2QIWA 2W90A 3KZIH 2QM8A 2V4HA 1LTBC 1YJ9P 1L0NG 1SQBE 5APVA 3V6IA 2FYNC 2NPSA 2JJLA 4I6MC 4Y99C 1LTAC 1YTZI 1TU3F 1E5WA 3KXDA 2M3EA 4WY4B 1ZR4A 3A0HE 2O01N 4L76A 5EFWB 2KB7P 3D6ZA 5CCHA 3NFQA 2A06D 1FZBA 2E5YA 3L37A 3A2AA 1J1DB 3V2RA 1YBKA 1SFCC 3H32B 1GW4A 5CCGD 3B5ND 3G6EP 3CC2P 1VQ8P 1LJ2A 3GMAA 4ZNCA 2H7HA 1NTZG 1JOCA 3A5TA 2IFNA 1L2PA 3IR9A 3AECC 3HD7D 1VF5D 3GF3A 3HE4B 1ZV8A 3G71P 3V2NA 1OZHA 3OJAB 4NPDA 1FAVA 4H44C 3V2QA 1N86A 1AQTA 3CCLP 5B66E 3AEFC 1JY3P 2E76D 1Q90D 3P7KA 1FDMA 3Q5RA 3L35A 1L4AD 3D6YA 4I2LC 3V4QA 2RKLA 4OGQB 1SQVG 2OYHB 2O1KA 4WY4A 1NO4A 1ZRTE 2ZYAA 4N78E 2N9YB 2KP8A 3RK3C 1SQQG 2KXPB 1SQXG 3A3YB 1S5LX 3L72G 2KYVA 3WUUA 4O9BA 1AQ5A 3H1KD 1N2DC 2OTKE 4ASVA 4C7RA 1KYOE 4BXLA 3GHGC 1HGVA 3CPWO 3JSVC 2QJKC 4GOFA 4KJMA 1SVFA 1SQBK 2IBZE 2LXBA 2P7JA 1LT9B 3L74G 3H1HJ 4UB6E 3AE9C 1R5LA 2NPSD 2C9NY 2KUBA 4YPCA 4C46A 5AW9B 3BCCJ 5AVSB 5APWA 1M7LA 3HE4A 2P2UA 2PRRA 2OYIC 3JCUH 3CCEP 4XFJA 3RL0D 1KILB 5CCHD 2I1JA 1UIXA 3KYQA 3EFGA 1BGYJ 1GMJA 1URQA 2IYOA 1Q82Q 2OYHA 4N6JA 3WUTA 1LWUA 3S9OA 3MIWA 2H88C 1S4XA 2ZYGA 3PH0A 1USEA 3PHLA 1VQKP 1BE3J 4H13D 4U3FG 2QE7H 2E74D 3A0BH 5TISE 2J5UA 2K1AA 5AVYB 2BASA 2ZFCA 3LIDA 1HH0A 4GOEA 1PGPA 4YXDC 5CBNA 3LIEA 1GD2E 2HODB 1SQPJ 4WBAA 2FXPA 2I1KA 1DIPA 1KQGB 3T97B 1X22A 2A06E 3TGUE 1D7MA 2IYPA 2OGUA 2KZIA 4WY4D 1AVOA 1KILA 1BCCD 1E79H 3E7KA 2QEXP 1XTGB 3G3ZA 1HTLC 3AE6C 3I56P 2FYUG 1EDJA 2E42A 1IJDB 1IFPA 2C9LY 2R32A 5KLVG 3TK1A 3C8VA 1NTKJ 4GKGA 3L70J 4UB8E 3EFFK 1A02F 2V7QJ 3FXEA 4H0LC 3H1LG 2LKMA 3FGAD 1JTHB 5E79E 3WU2H 2Q3EA 1L0LD 1NTMJ 1N73A 2HODA 3V4WA 5KAIH 1PGOA 5KKZB 1AVYA 2GUVA 1T3UA 1FOSE 1G1IA 3T97A 3CWBG 1PP9D 1URQD 3L75G 2H89C 3VMAA 4OGQD 4GIFA 2HLOA 2E75D 1NU1E 2WPQA 1YIJP 1KZUB 3QH9A 1HJ0A 3B5NB 1R8EA 5KAFE 4R4LA 3WUVA 2HG5D 2XZRA 1JY2P 2WITA 2WSCJ 1NKNA 1IO4A 2Z5HA 3H1HE 2RN0A 3HD7B 5GTHH 1VF5B 1LGHB 4DOJA 2QSIA 3BCCE 4IL6E 2YIUB 1SLQA 4K35A 1H88A 2N1TB 2BEZF 2E5TA 1S9KE 4ZKPA 2LXCB 4YTPC 2GA1A 5KJ7C 3RL0g 1L4AB 4HH2A 3RK3E 1BGYE 1LTGC 3PLNA 3RGUA 1HUCA 1MV8A 4JBZA 5BU5A 1YYCA 4D6TJ 1L0ND 1S72P 1DEEG 1KILD 1JM0A 2B9BA 5L8RJ 3VYIA 4L74A 1VQOP 1IFNA 1BE3E 3G4SP 4BRYB 1KFMA 1FS0E 2QM7A 1EZVG 1G1JA 2ZXXA 3O6QA 3R4YA 3H1IJ 1RH5B 3Q1MA 3GLMA 1CZQA 1FZFA 2NPSB 1T2KD 1SQPE 2W6BA 3H1JE 4PJ0H 1SQBG 3LW5H 1GL2A 2PGDA 3KDPB 5AVWB 1YQ4C 4RO0A 2ZVOB 1RF1A 1JCDA 2L91A 1Y47A 2WQYC 3RL0B 2N1TA 3I55P 2Y0CA 1QVFO 5M1BA 1NTZD 3L73J 3Q2YA 1KQFB 1MFTA 5AVUB 4RJTA 4WVZA 1NU1K 1OIPA 4TLFA 1OW7A 2M0BA 2FKWB 3L71J 5APSA 1FZCB 4PV1C 2WSSH 1RE4C 3MZWB 1NTKE 1QX8A 4H13B 3CXHD 3M9BA 1LNQA 3L70E 3N7NA 2E74B 4W7ZA 1VQ9P 1SQVD 1FJPA 2Q5UA 5CCGC 1N7SA 1IFMA 4W80A 2QVAA 2VRSA 3D70A 3HUSC 2W6JH 1SQQD 2ZT9D 1SQXD 1NVOA 3VP9A 3VOPA 1NTME 1NYHA 3L72D 1VF5C 4M3LA 2JWAA 1N8RQ 1CW5A 4I7ZB 1LTJA 4W7YA 2E76C 3VP8A 1OMIA 2J59M 1L4AC 3L74D 3UIAA 3P8CD 1KQSO 4AQRD 1P84D 2FFDB 5BU8B 1BDCA 4TT3H 1OFCX 3RK2D 1OW6A 5KLIC 1ZLLA 1M1JA 2W83C 2WTYA 2POHA 3AE1C 3TF5A 1FZCA 3Q5SA 1ZOYC 1VQNP 2AXTE 3NTNA 2IBZG 1GL2D 3MD0A 3IN6A 2P10A 2M8RA 1N7LA 2J58A 3IF4A 1GK6A 3ABVC 1HVVA 1FU1A 3TDKA 3MP7B 3CXHH 2Y9ZA 2N1TD 3MTUE 4D6TE 1KORA 3KZIE 1M90Q 1URQB 4U3FD 1G2CA 3D71A 1ZR2A 1MUUA 4B86A 2AEFA 2R3SA 1MFZA 2E75B 1LWUB 3RL0C 3ZDMA 1AA0A 1VQ7P 1IC2A 3H1IE 2R5BA 2M5AA 1LP1A 2K9JA 3H1KJ 1NTKK 2D2CD 2FFDA 1ZP0C 1X8YA 2XKMA 2BCCE 3PP5A 2ZYDA 1GTWA 3VMXA 3AEGC 1N7SD 4I1LA 3U59A 1FE6A 1IZNB 2XU6A 3NXSA 5B5EH 1P84H 4H13C 3V2PA 4DT0A 1K73Q 4C7NA 2A45G 4R4MA 1RF0C 1JB0J 3SWFA 2FYUD 3L73E 5KLVD 2MKVA 1BSHA 2B89A 3TGUG 4ASWA 4H44D 1FOSF 1PPJE 1NAFA 1JY3N 3H1LJ 4HB1A 3H1LD 3L71E 4WY4C 3B4SA 4JQ0D 2Q7CA 4NPEA 2QG4A 1IK7A 2Z4EA
chains in the Genus database with same CATH topology
1N7SC 1NHLA 2GUVA 4C7NB 1VDFA 1T3UA 1FOSE 3HD7A 1G1IA 3T97A 3GHGA 3VN0A 3M0AA 5KJ7D 5AW3B 1GU4A 1URQD 3I5CA 3C9IA 2YMYA 2CPSA 2L5GB 3P32A 1HGZA 1J1DC 2YO2A 2FYZA 2NPSC 4GIFA 1PFIA 2YKPA 2HLOA 3TNUA 2WPQA 1H8AA 2WSCH 3CL3D 1KZUB 4RESB 3RK3B 2N9BA 3TYYA 3B5NB 1L4AA 1RF0A 2R3CA 4LLHA 1LTJC 2HG5D 3WMM0 1N73B 1IFJA 2XZRA 1JY2P 3RK2C 2E43A 5AW4B 1FZEA 1J1EB 2WITA 2P67A 2YNYA 1NKNA 1JCCA 5CCHC 1IO4A 3MUDA 5CMZA 2OYIA 2WSFH 2Z5HA 2JEEA 1DX7A 2KLVA 3HD7B 3HE5A 1LGHB 4DOJA 4JF7A 1CI6A 2PAJA 1NOHA 5APXA 2FYUK 1JY2O 1SLQA 3L36A 2IPPA 1H88A 2A45I 5KLVK 5AW0B 2N1TB 2WWWA 1GZLA 1M1JC 1NKZB 3M06A 3TNUB 4AYCA 3OA7A 2YKOA 1T8ZA 1W2EA 1S9KE 4ZKPA 5APQA 5AVRB 5KJ7C 3BASA 1URQC 1J2JB 1L4AB 1SFCD 3OAKA 5AVQB 1FZCC 4LGDE 4HH2A 2QM8A 1LTGC 1LTBC 2OYHC 1HUCA 1MV8A 1LWUC 1XTCC 2CPBA 5APVA 1L0LK 3MGNA 5BU5A 3SWYA 2A45H 1YYCA 1NTMK 3IFMA 1T3JA 2NPSA 3HE5B 1Z56A 2JJLA 1KILD 3H32A 4I6MC 4Y99C 1LTAC 1YTZI 3VYIA 3TSIA 1E5WA 1IFNA 1OWAA 1RE3A 2Z5IA 4WY4B 4WB4A 1ZR4A 2M3BA 2IFMA 1KFMA 2QM7A 2KB7P 1X79B 3P8MC 5AVVB 2O1JA 1G1JA 5CCHA 3NFQA 5AVXB 1SP4A 1X9VA 1JUNA 2PP6A 1GK4A 1FZBA 2R5DA 3L37A 1LT9C 3A2AA 4DZOA 1CZQA 1FZFA 1J1DB 2NPSB 3EQ2A 2W6AA 1T2KD 2W6BA 5AW7B 3V2RA 1JO5A 2HPCA 1S9KD 1SFCC 3H32B 1JMMA 3LW5H 1GL2A 1FBMA 3U1CA 3KDPB 5AVWB 1NH4A 1GW4A 3RK3D 5CCGD 2KOGA 1IFIA 2ZXEB 2FFDC 3B5ND 2P1JA 1OXZA 3N4XA 3B8EB 1RF1A 1JCDA 2H7HA 1ZN5A 2WPSA 3RK2B 2Q3IA 3RL0B 2N1TA 1KILC 1JOCA 3A5TA 2IFNA 5APTA 2Q9IA 3IR9A 1FJKA 3HD7D 3HE4B 1ZV8A 3V2NA 5AVUB 3OJAB 3KPEA 1FAVA 1FZAA 1N86A 3V2QA 2YKQA 1NU1K 2HPCB 5AW2B 1JY3P 1GL2B 1L0NK 3P7KA 1FDMA 3L35A 1IK9A 2FKWB 3P8CE 5APSA 1L4AD 1FZCB 2HFED 4I2LC 3V4QA 1FZGA 1RF1B 1RE4C 2OYHB 5AW6B 3H6PA 4N3YB 1T2KC 2O1KA 3M9BA 1LTSC 2MJZA 4WY4A 3N7NA 1NO4A 1A02J 1LT9A 1JY3O 4W7ZA 4N78E 1FJPA 2KP8A 2Q5UA 3RK3C 5CCGC 2C0XA 1N7SA 1KQLA 1IFMA 4W80A 1GU5A 1MZ9A 4Y99B 3M9QA 3A3YB 2VRSA 3BVHA 1N73C 2KYVA 2O01H 4O9BA 3HUSC 1AQ5A 1J1EC 3VP9A 3VOPA 1N2DC 5KTBA 4C7RA 4ZKUA 3GHGC 1HGVA 1HWTC 4IFMA 4M3LA 3VMZA 1CW5A 2YO3A 5BVZA 1HBWA 1SVFA 1SQBK 5AW8B 1DH3A 1AFOA 2P7JA 1GW3A 3U1AA 1LT9B 1LTJA 4W7YA 2GUSA 1CSBA 2NPSD 2C9NY 3VP8A 1HJBA 2WSEH 1KFNA 1N7SB 2J59M 1L4AC 3UIAA 4C46A 5AVTB 5AW9B 3P8CD 5AVSB 5APWA 1NTZK 3V5BA 1M7LA 1QL1A 3HE4A 4AQRD 2P2UA 2FFDB 5APUA 5BU8B 2OYIC 3RK2D 1IFDA 4N78D 1JY2N 3RL0D 1KILB 1ZLLA 1M1JA 5CCHD 2I1JA 2POHA 2WTYA 1DEBA 2WT7B 3KYQA 3EFGA 1LTTC 3M91A 5KJ7A 1URQA 3E1IA 1FZCA 4XA4A 1LTJB 2OYHA 4N6JA 5CJ4A 1LWUA 3MIWA 5AW5B 4KHXA 3NTNA 1SQVK 1GL2D 3MD0A 1QL2A 2M8RA 4EOTA 1N7LA 2WPRA 2J58A 2WZ7A 1WT6A 4XE5B 2HYNA 2IX7C 1NWQA 1GK6A 1RY3A 3M0DC 4OH8B 1HVVA 1SQQK 1FU1A 1SQXK 5AW1B 2C0WA 2N1TD 1M1JB 2OARA 4EIJA 3MTUE 2W27A 1JNMA 5AVYB 3A7OA 1YTZT 3O8ZA 3M9HA 1URQB 2BASA 1G2CA 2ZFCA 4LC1A 1RE3C 2XDJA 3LIDA 1ZR2A 1MUUA 1HH0A 4B86A 3BRVB 3HTKA 3LIEA 2H43A 1GD2E 1MFZA 2HODB 2KSJA 3VTPC 1LWUB 4WBAA 3HUSB 3R2PA 3RL0C 2I1KA 3GHGB 5CJ0A 1IC2A 1SFCA 3B5NC 3HRNA 2R5BA 2XNXA 3BATA 1NTKK 2FFDA 4HYTB 1X8YA 4WY4D 2XKMA 3PP5A 1H89A 1GL2C 1VPCA 1GTWA 1GDTA 3VMXA 4AUWA 3HD7C 1KILA 1N7SD 1G2CB 2WT7A 4I1LA 1JTHA 3U59A 4IFDK 2XU6A 1RF1C 3HTKB 3NXSA 3VMYA 1XTGB 3G3ZA 1HTLC 3V2PA 2N1TC 3II6A 3M0DA 2OYIB 2FXMA 3CLQA 1EQ7A 1WRGA 2E42A 1IJDB 1CI6B 4C7NA 1SFCB 2A45G 2C9LY 2R32A 1RF0C 3CI9A 3TK1A 4GKGA 3SWFA 3KQGA 2GM4A 4GT1A 1RE4A 4IFFA 1A02F 5AVZB 5APYA 1FOSF 2H8PD 2LKMA 1LTIC 1NAFA 3L4FA 4JYBA 1JTHB 5CHXA 1JY3N 3NMDA 5CCGA 3BRTB 3B5NA 4WY4C 2Q7CA 1N73A 4JYCA 2XV5A 2HODA 3V4WA 2Z4EA 3HUSA 1SQPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S C;  1NHL A;  1URQ B;  2XDJ A;  3HD7 A;  5CCH A;  3VOP A;  5KJ7 D;  1URQ D;  2YMY A;  3RL0 C;  2PP6 A;  2NPS C;  1SFC A;  3B5N C;  2NPS B;  3RK3 B;  4W7Y A;  1SFC C;  3B5N B;  1GL2 A;  1L4A A;  2NPS D;  4WY4 D;  1N7S B;  3RK3 D;  2HG5 D;  2KOG A;  3PP5 A;  5CCG D;  1GL2 C;  1L4A C;  3RK2 C;  3B5N D;  3HD7 C;  5CCH C;  1KIL A;  1N7S D;  3RK2 B;  1JTH A;  3HD7 B;  3RL0 B;  2N1T A;  1KIL C;  3HTK B;  4JF7 A;  1XTG B;  3RK2 D;  2N1T C;  3HD7 D;  3RL0 D;  1KIL B;  5CCH D;  3KYQ A;  2N1T B;  5KJ7 A;  1SFC B;  1URQ A;  5KJ7 C;  1URQ C;  1GL2 B;  1L4A B;  1SFC D;  4LGD E;  3P8C E;  1GL2 D;  1L4A D;  2HFE D;  2H8P D;  2M8R A;  1T3J A;  2NPS A;  2WZ7 A;  1JTH B;  4WY4 A;  5CCG A;  4W7Z A;  3M0D C;  1KIL D;  3B5N A;  4OH8 B;  4N78 E;  1HVV A;  4WY4 C;  3TSI A;  3RK3 C;  5CCG C;  1N7S A;  2N1T D;  4W80 A;  4WY4 B; 
#chains in the Genus database with same CATH topology
 1NHL A;  3GG2 A;  3Q3D A;  2Y0D A;  3S1K A;  5AW3 B;  1GU4 A;  1PV3 A;  1J1D C;  1PFI A;  3CWB D;  3L75 J;  2O3J A;  3L75 D;  3TNU A;  1H8A A;  1Q7Y Q;  2RMZ A;  3CX5 D;  3JC2 2;  1S1C X;  1USD A;  1N73 B;  2E43 A;  2FXO A;  1KB9 D;  1J1E B;  2YNY A;  3MUD A;  2IDB A;  5CMZ A;  1YIT P;  2JEE A;  1DX7 A;  3HE5 A;  3F89 A;  4JF7 A;  1K05 A;  4CPG A;  5APX A;  2IPP A;  3E1R A;  5H2F H;  1NKZ B;  1W2B O;  1R5S A;  3OA7 A;  1BCC J;  1W2E A;  3SFD C;  5AVR B;  1URQ C;  3OAK A;  1EZV I;  4LGD E;  1NU1 G;  1KTM A;  4OGQ C;  2OYH C;  1LWU C;  3CCM P;  3JCU E;  3MGN A;  3SWY A;  4PD4 D;  2IZ0 A;  3IFM A;  3FWL A;  5DJT B;  2O01 J;  1Y8A A;  1OWA A;  2RH0 A;  3H1H G;  1RE3 A;  2ZT9 B;  4WB4 A;  2M3B A;  1X79 B;  5AVV B;  3BCC G;  1KD1 Q;  2O1J A;  1RHZ B;  5AVX B;  1SP4 A;  1X9V A;  1EZV D;  3EWK A;  1QVG O;  3CC7 P;  1GK4 A;  1L0L J;  2R5D A;  1LT9 C;  2WSE J;  2DW3 A;  2W6A A;  3A0B E;  1BGY G;  3AEB C;  2KLU A;  2HPC A;  1VQ4 P;  1FBM A;  1PP9 J;  3CX5 H;  1SQB D;  5GTI H;  3N4X A;  3H1K E;  1ZN5 A;  3LW5 J;  3RK2 B;  1ZW0 A;  1KB9 H;  3O6Q B;  1KIL C;  2Q9I A;  1BE3 G;  1FZA A;  2YKQ A;  4DJG A;  1GL2 B;  4L73 A;  1YQ3 C;  1IK9 A;  3AE3 C;  1SQP G;  1EXJ A;  3H1J G;  1FZG A;  3S4R A;  1RF1 B;  1M57 D;  5AW6 B;  4N3Y B;  1T2K C;  1H0T A;  1EDK A;  1LTS C;  2MJZ A;  2K37 A;  2JP3 A;  4HJG H;  1PL5 A;  4PD4 H;  3CCJ P;  2C0X A;  1GU5 A;  1MZ9 A;  5CBO A;  4Y99 B;  1N73 C;  2O01 H;  4NPF X;  1J1E C;  2AEJ A;  3Q5P A;  1L0N J;  5KTB A;  2JR8 A;  2KK7 A;  1HWT C;  3CME P;  3WU2 E;  3VMZ A;  2YO3 A;  2D2C B;  1HBW A;  5AW8 B;  5KAI E;  1K04 A;  2GUS A;  3L75 E;  3AE5 C;  2JDI H;  2WSE H;  1N7S B;  1NTK G;  1S5L H;  3AE8 C;  3L70 G;  2WVR A;  1QL1 A;  5APU A;  1QGK B;  1ZRT D;  1IFD A;  4N78 D;  1JY2 N;  1DEB A;  2WT7 B;  3FX0 A;  3M91 A;  1NTM G;  3PTZ A;  4XA4 A;  1LTJ B;  2B88 A;  3PJS K;  5CJ4 A;  3CXH I;  3A0H H;  3C1L A;  4H44 B;  2K9Y A;  5AW5 B;  1KYO D;  5GTH E;  1NTZ J;  1BCC E;  1QL2 A;  4EOT A;  1ZXG A;  2WZ7 A;  4XE5 B;  2HYN A;  2IBZ D;  3M0D C;  3PRJ A;  5KKZ C;  5AW1 B;  2KS1 A;  3H25 A;  2C0W A;  1M1J B;  1FDO A;  2OYO A;  4EIJ A;  2FBW C;  2YMK A;  1JNM A;  3A7O A;  3O8Z A;  3AE7 C;  2Y9Y A;  1M8O B;  1BDD A;  4LC1 A;  2JO1 A;  3BRV B;  3HTK A;  4IOI H;  2H43 A;  4IL6 X;  2KSJ A;  3VTP C;  1VQ6 P;  2AEM A;  4Z1M H;  1SQV J;  3ITK A;  4MN4 C;  3GHG B;  5CJ0 A;  1FDI A;  1SFC A;  3B5N C;  2WPV B;  3HRN A;  1DD4 A;  1AV1 A;  1MKM A;  1Q86 Q;  1P84 I;  1SQQ J;  1YJW P;  1SQX J;  1L0L E;  4HYT B;  3SSU A;  1OVV A;  3L72 J;  4EDF A;  1H89 A;  1GL2 C;  1VPC A;  1GDT A;  5B66 H;  3HD7 C;  3RBZ A;  1G2C B;  2WT7 A;  1PP9 E;  2KZJ A;  2YIU C;  4IFD K;  1RF1 C;  2Q6Q A;  3CCU P;  4D6T G;  2N1T C;  1PZQ A;  2OYI B;  4PJ0 E;  3L74 J;  1CI6 B;  1WMK A;  2M5A B;  1LP1 B;  2K9J B;  1SS1 A;  3KQG A;  4OVN F;  1K8A Q;  2GM4 A;  4GT1 A;  3H1I G;  5AVZ B;  5APY A;  1LTI C;  1KYO H;  2JKV A;  3TGU J;  3NMD A;  4A7P A;  2BCC G;  3TGU D;  3BRT B;  2D2C C;  1EXI A;  5K5G B;  1YHQ P;  4PV1 D;  1U57 A;  3FXD A;  2FY8 A;  1SQP K;  1N7S C;  4UB6 H;  4C7N B;  2QRX A;  5TJH A;  2HR3 A;  3GHG A;  1EDI A;  3VN0 A;  3I5C A;  3C9I A;  1Y9B A;  3AEA C;  2ITA A;  2L5G B;  2NPS C;  3AE2 C;  1L0N E;  3L73 G;  4RES B;  4U3F J;  1KIL E;  2AXC A;  2N9B A;  1RF0 A;  1M56 D;  2QJP B;  1LTJ C;  1PPJ G;  3WMM 0;  2KI7 B;  5AW4 B;  2P67 A;  1JCC A;  5CCH C;  2OYI A;  3L71 G;  2KLV A;  1CI6 A;  2ZAE B;  2PAJ A;  1AJY A;  3L36 A;  5AW0 B;  1GZL A;  1M1J C;  3TNU B;  4AYC A;  2YKO A;  3AEE C;  5APQ A;  5TIS H;  1JEK A;  3BAS A;  1J2J B;  1SFC D;  2BEQ D;  5AVQ B;  1U7J A;  1VQP P;  1FZC C;  2CPB A;  1XTC C;  1NU1 J;  1L0L K;  2A45 H;  2E74 C;  1NU1 D;  1NTM K;  1T3J A;  1BSN A;  3KHU A;  4H0L B;  3HE5 B;  1VQL P;  1Z56 A;  3H32 A;  4GDO A;  3AE4 C;  1NTZ E;  2KSE A;  2FYU J;  3TSI A;  1VL2 A;  5KLV J;  2K3R A;  2Z5I A;  2IFM A;  4EI2 A;  1Q81 Q;  2A06 G;  3P8M C;  3H1H D;  2KNC B;  1PGQ A;  4Y28 J;  4U7J A;  1JUN A;  4L75 A;  3G9R A;  3CX5 I;  1M1K Q;  4I7Z C;  3BCC D;  2PP6 A;  4OWF A;  1KMI Z;  4KT0 J;  2OTJ P;  4DZO A;  3W68 A;  1KC8 Q;  3CXH E;  5DJU B;  3EQ2 A;  1KB9 I;  5AW7 B;  3CCR P;  1JO5 A;  1S9K D;  1SQV E;  1JMM A;  3U1C A;  1NH4 A;  3RK3 D;  2KOG A;  1BGY D;  1IFI A;  2ZXE B;  2FFD C;  3B71 A;  2P1J A;  3CWB J;  1OXZ A;  1T6A A;  3B8E B;  1SQQ E;  2WPS A;  1SQX E;  4UB8 H;  2Q3I A;  2KIK A;  2NZ2 A;  1EC5 A;  3L72 E;  5APT A;  1FJK A;  2XND H;  1ZME C;  3GF7 A;  5E79 H;  1BE3 D;  3KPE A;  4PD4 I;  3SFE C;  2HPC B;  2UWJ E;  4HKZ H;  5AW2 B;  1L0N K;  2ZVN B;  3L74 E;  1OW8 A;  3P8C E;  3W67 A;  3FWN A;  5B5E E;  2HFE D;  1P84 E;  3CCQ P;  3CD6 P;  3H6P A;  2JWD A;  3H1J J;  1A02 J;  1LT9 A;  1JY3 O;  1SQP D;  5C39 A;  3H1J D;  3CCV P;  2KNC A;  1KQL A;  1PGJ A;  3H1K G;  3SWK A;  3M9Q A;  2IZ1 A;  2QJP C;  1X0T A;  2QA4 P;  3BVH A;  5KAF H;  2E75 C;  3USS A;  1YI2 P;  1W5C E;  4ZKU A;  4EYY Q;  3QWO C;  2YXQ B;  4IFM A;  3CC4 P;  1NJI Q;  5BVZ A;  4IL6 H;  1H0T B;  4GOD A;  1DH3 A;  2R44 A;  1AFO A;  4BWN A;  1GW3 A;  3U1A A;  1CSB A;  1HJB A;  1KFN A;  5AVT B;  1OX3 A;  1NAY A;  1K9M Q;  4U3F E;  1NTZ K;  3V5B A;  1NTK D;  2P58 A;  1RQV A;  3MUD C;  3L70 D;  4YXW H;  1S2E A;  1FC2 C;  3CMA P;  1LTT C;  1SQB J;  5KJ7 A;  2G3A A;  1NGM B;  3E1I A;  2Q1K A;  2B87 B;  2W8Z A;  2K88 A;  1NTM D;  4KHX A;  1SQV K;  3AED C;  2PFX A;  1JMB A;  2WPR A;  1WT6 A;  1OVU A;  1NWQ A;  2IX7 C;  4PV1 B;  1RY3 A;  4OH8 B;  5H2F E;  1SQQ K;  1KV4 A;  1SQX K;  2QJY B;  4RKU J;  2OAR A;  2W27 A;  1YTZ T;  2G8Y A;  3M9H A;  2I8D A;  1RE3 C;  2XDJ A;  2FYU E;  1UII A;  5KLV E;  3HUS B;  3R2P A;  2FYN B;  1PIX A;  1Q2N A;  3OW2 O;  4H0L D;  3RBX A;  1OVR A;  2XNX A;  3BAT A;  3H1L E;  1VQM P;  2WSF J;  1BCC G;  2KS1 B;  2NRG A;  4QMA A;  1YJN P;  2E76 B;  4AUW A;  2SPZ A;  3GW6 A;  2OTL P;  3IAO A;  1JTH A;  2ZJS E;  3HTK B;  3VMY A;  1HF9 A;  3II6 A;  3CWB E;  2B87 A;  4JPZ B;  3M0D A;  2FXM A;  3CLQ A;  1EQ7 A;  1KYO I;  5KLI B;  4D6T D;  1WRG A;  1DD3 A;  1U7M A;  2V7Q H;  1SFC B;  3CI9 A;  3CX5 E;  5GTI E;  2IBZ I;  1RE4 A;  1KB9 E;  4IFF A;  3F5H A;  1LT1 A;  2H8P D;  1KN7 A;  1L0L G;  3L4F A;  4JYB A;  5CHX A;  3H1I D;  5CCG A;  3B5N A;  2ZT9 C;  2BCC J;  4JYC A;  2XV5 A;  2BCC D;  3HUS A;  1PP9 G;  2WMM A;  1VDF A;  3HD7 A;  1EDL A;  3M0A A;  5KJ7 D;  2YMY A;  2CPS A;  3P32 A;  1HGZ A;  2YO2 A;  2FYZ A;  1VQ5 P;  2YKP A;  3MHV A;  4PD4 E;  2CK3 H;  4DCK A;  2WSC H;  3CL3 D;  3CCS P;  4ZMD A;  3RK3 B;  3TYY A;  1QLE D;  1L4A A;  4WWI A;  2R3C A;  4LLH A;  1RQU A;  3L73 D;  1IFJ A;  3RK2 C;  1FZE A;  4K3A A;  2YXR B;  2Y0E A;  2WSF H;  1PPJ D;  2LR2 A;  2AXT H;  1QEX A;  1EZV E;  1NOH A;  3K5B A;  2QJK B;  3L71 D;  1S3J A;  2FYU K;  1JY2 O;  2A45 I;  2OQQ A;  5KLV K;  2QJY C;  4BRY A;  2WWW A;  3M06 A;  1T8Z A;  1S5L E;  2QIW A;  2W90 A;  3KZI H;  2QM8 A;  2V4H A;  1LTB C;  1YJ9 P;  1L0N G;  1SQB E;  5APV A;  3V6I A;  2FYN C;  2NPS A;  2JJL A;  4I6M C;  4Y99 C;  1LTA C;  1YTZ I;  1TU3 F;  1E5W A;  3KXD A;  2M3E A;  4WY4 B;  1ZR4 A;  3A0H E;  2O01 N;  4L76 A;  5EFW B;  2KB7 P;  3D6Z A;  5CCH A;  3NFQ A;  2A06 D;  1FZB A;  2E5Y A;  3L37 A;  3A2A A;  1J1D B;  3V2R A;  1YBK A;  1SFC C;  3H32 B;  1GW4 A;  5CCG D;  3B5N D;  3G6E P;  3CC2 P;  1VQ8 P;  1LJ2 A;  3GMA A;  4ZNC A;  2H7H A;  1NTZ G;  1JOC A;  3A5T A;  2IFN A;  1L2P A;  3IR9 A;  3AEC C;  3HD7 D;  1VF5 D;  3GF3 A;  3HE4 B;  1ZV8 A;  3G71 P;  3V2N A;  1OZH A;  3OJA B;  4NPD A;  1FAV A;  4H44 C;  3V2Q A;  1N86 A;  1AQT A;  3CCL P;  5B66 E;  3AEF C;  1JY3 P;  2E76 D;  1Q90 D;  3P7K A;  1FDM A;  3Q5R A;  3L35 A;  1L4A D;  3D6Y A;  4I2L C;  3V4Q A;  2RKL A;  4OGQ B;  1SQV G;  2OYH B;  2O1K A;  4WY4 A;  1NO4 A;  1ZRT E;  2ZYA A;  4N78 E;  2N9Y B;  2KP8 A;  3RK3 C;  1SQQ G;  2KXP B;  1SQX G;  3A3Y B;  1S5L X;  3L72 G;  2KYV A;  3WUU A;  4O9B A;  1AQ5 A;  3H1K D;  1N2D C;  2OTK E;  4ASV A;  4C7R A;  1KYO E;  4BXL A;  3GHG C;  1HGV A;  3CPW O;  3JSV C;  2QJK C;  4GOF A;  4KJM A;  1SVF A;  1SQB K;  2IBZ E;  2LXB A;  2P7J A;  1LT9 B;  3L74 G;  3H1H J;  4UB6 E;  3AE9 C;  1R5L A;  2NPS D;  2C9N Y;  2KUB A;  4YPC A;  4C46 A;  5AW9 B;  3BCC J;  5AVS B;  5APW A;  1M7L A;  3HE4 A;  2P2U A;  2PRR A;  2OYI C;  3JCU H;  3CCE P;  4XFJ A;  3RL0 D;  1KIL B;  5CCH D;  2I1J A;  1UIX A;  3KYQ A;  3EFG A;  1BGY J;  1GMJ A;  1URQ A;  2IYO A;  1Q82 Q;  2OYH A;  4N6J A;  3WUT A;  1LWU A;  3S9O A;  3MIW A;  2H88 C;  1S4X A;  2ZYG A;  3PH0 A;  1USE A;  3PHL A;  1VQK P;  1BE3 J;  4H13 D;  4U3F G;  2QE7 H;  2E74 D;  3A0B H;  5TIS E;  2J5U A;  2K1A A;  5AVY B;  2BAS A;  2ZFC A;  3LID A;  1HH0 A;  4GOE A;  1PGP A;  4YXD C;  5CBN A;  3LIE A;  1GD2 E;  2HOD B;  1SQP J;  4WBA A;  2FXP A;  2I1K A;  1DIP A;  1KQG B;  3T97 B;  1X22 A;  2A06 E;  3TGU E;  1D7M A;  2IYP A;  2OGU A;  2KZI A;  4WY4 D;  1AVO A;  1KIL A;  1BCC D;  1E79 H;  3E7K A;  2QEX P;  1XTG B;  3G3Z A;  1HTL C;  3AE6 C;  3I56 P;  2FYU G;  1EDJ A;  2E42 A;  1IJD B;  1IFP A;  2C9L Y;  2R32 A;  5KLV G;  3TK1 A;  3C8V A;  1NTK J;  4GKG A;  3L70 J;  4UB8 E;  3EFF K;  1A02 F;  2V7Q J;  3FXE A;  4H0L C;  3H1L G;  2LKM A;  3FGA D;  1JTH B;  5E79 E;  3WU2 H;  2Q3E A;  1L0L D;  1NTM J;  1N73 A;  2HOD A;  3V4W A;  5KAI H;  1PGO A;  5KKZ B;  1AVY A;  2GUV A;  1T3U A;  1FOS E;  1G1I A;  3T97 A;  3CWB G;  1PP9 D;  1URQ D;  3L75 G;  2H89 C;  3VMA A;  4OGQ D;  4GIF A;  2HLO A;  2E75 D;  1NU1 E;  2WPQ A;  1YIJ P;  1KZU B;  3QH9 A;  1HJ0 A;  3B5N B;  1R8E A;  5KAF E;  4R4L A;  3WUV A;  2HG5 D;  2XZR A;  1JY2 P;  2WIT A;  2WSC J;  1NKN A;  1IO4 A;  2Z5H A;  3H1H E;  2RN0 A;  3HD7 B;  5GTH H;  1VF5 B;  1LGH B;  4DOJ A;  2QSI A;  3BCC E;  4IL6 E;  2YIU B;  1SLQ A;  4K35 A;  1H88 A;  2N1T B;  2BEZ F;  2E5T A;  1S9K E;  4ZKP A;  2LXC B;  4YTP C;  2GA1 A;  5KJ7 C;  3RL0 g;  1L4A B;  4HH2 A;  3RK3 E;  1BGY E;  1LTG C;  3PLN A;  3RGU A;  1HUC A;  1MV8 A;  4JBZ A;  5BU5 A;  1YYC A;  4D6T J;  1L0N D;  1S72 P;  1DEE G;  1KIL D;  1JM0 A;  2B9B A;  5L8R J;  3VYI A;  4L74 A;  1VQO P;  1IFN A;  1BE3 E;  3G4S P;  4BRY B;  1KFM A;  1FS0 E;  2QM7 A;  1EZV G;  1G1J A;  2ZXX A;  3O6Q A;  3R4Y A;  3H1I J;  1RH5 B;  3Q1M A;  3GLM A;  1CZQ A;  1FZF A;  2NPS B;  1T2K D;  1SQP E;  2W6B A;  3H1J E;  4PJ0 H;  1SQB G;  3LW5 H;  1GL2 A;  2PGD A;  3KDP B;  5AVW B;  1YQ4 C;  4RO0 A;  2ZVO B;  1RF1 A;  1JCD A;  2L91 A;  1Y47 A;  2WQY C;  3RL0 B;  2N1T A;  3I55 P;  2Y0C A;  1QVF O;  5M1B A;  1NTZ D;  3L73 J;  3Q2Y A;  1KQF B;  1MFT A;  5AVU B;  4RJT A;  4WVZ A;  1NU1 K;  1OIP A;  4TLF A;  1OW7 A;  2M0B A;  2FKW B;  3L71 J;  5APS A;  1FZC B;  4PV1 C;  2WSS H;  1RE4 C;  3MZW B;  1NTK E;  1QX8 A;  4H13 B;  3CXH D;  3M9B A;  1LNQ A;  3L70 E;  3N7N A;  2E74 B;  4W7Z A;  1VQ9 P;  1SQV D;  1FJP A;  2Q5U A;  5CCG C;  1N7S A;  1IFM A;  4W80 A;  2QVA A;  2VRS A;  3D70 A;  3HUS C;  2W6J H;  1SQQ D;  2ZT9 D;  1SQX D;  1NVO A;  3VP9 A;  3VOP A;  1NTM E;  1NYH A;  3L72 D;  1VF5 C;  4M3L A;  2JWA A;  1N8R Q;  1CW5 A;  4I7Z B;  1LTJ A;  4W7Y A;  2E76 C;  3VP8 A;  1OMI A;  2J59 M;  1L4A C;  3L74 D;  3UIA A;  3P8C D;  1KQS O;  4AQR D;  1P84 D;  2FFD B;  5BU8 B;  1BDC A;  4TT3 H;  1OFC X;  3RK2 D;  1OW6 A;  5KLI C;  1ZLL A;  1M1J A;  2W83 C;  2WTY A;  2POH A;  3AE1 C;  3TF5 A;  1FZC A;  3Q5S A;  1ZOY C;  1VQN P;  2AXT E;  3NTN A;  2IBZ G;  1GL2 D;  3MD0 A;  3IN6 A;  2P10 A;  2M8R A;  1N7L A;  2J58 A;  3IF4 A;  1GK6 A;  3ABV C;  1HVV A;  1FU1 A;  3TDK A;  3MP7 B;  3CXH H;  2Y9Z A;  2N1T D;  3MTU E;  4D6T E;  1KOR A;  3KZI E;  1M90 Q;  1URQ B;  4U3F D;  1G2C A;  3D71 A;  1ZR2 A;  1MUU A;  4B86 A;  2AEF A;  2R3S A;  1MFZ A;  2E75 B;  1LWU B;  3RL0 C;  3ZDM A;  1AA0 A;  1VQ7 P;  1IC2 A;  3H1I E;  2R5B A;  2M5A A;  1LP1 A;  2K9J A;  3H1K J;  1NTK K;  2D2C D;  2FFD A;  1ZP0 C;  1X8Y A;  2XKM A;  2BCC E;  3PP5 A;  2ZYD A;  1GTW A;  3VMX A;  3AEG C;  1N7S D;  4I1L A;  3U59 A;  1FE6 A;  1IZN B;  2XU6 A;  3NXS A;  5B5E H;  1P84 H;  4H13 C;  3V2P A;  4DT0 A;  1K73 Q;  4C7N A;  2A45 G;  4R4M A;  1RF0 C;  1JB0 J;  3SWF A;  2FYU D;  3L73 E;  5KLV D;  2MKV A;  1BSH A;  2B89 A;  3TGU G;  4ASW A;  4H44 D;  1FOS F;  1PPJ E;  1NAF A;  1JY3 N;  3H1L J;  4HB1 A;  3H1L D;  3L71 E;  4WY4 C;  3B4S A;  4JQ0 D;  2Q7C A;  4NPE A;  2QG4 A;  1IK7 A;  2Z4E A; 
#chains in the Genus database with same CATH homology
 1N7S C;  1NHL A;  2GUV A;  4C7N B;  1VDF A;  1T3U A;  1FOS E;  3HD7 A;  1G1I A;  3T97 A;  3GHG A;  3VN0 A;  3M0A A;  5KJ7 D;  5AW3 B;  1GU4 A;  1URQ D;  3I5C A;  3C9I A;  2YMY A;  2CPS A;  2L5G B;  3P32 A;  1HGZ A;  1J1D C;  2YO2 A;  2FYZ A;  2NPS C;  4GIF A;  1PFI A;  2YKP A;  2HLO A;  3TNU A;  2WPQ A;  1H8A A;  2WSC H;  3CL3 D;  1KZU B;  4RES B;  3RK3 B;  2N9B A;  3TYY A;  3B5N B;  1L4A A;  1RF0 A;  2R3C A;  4LLH A;  1LTJ C;  2HG5 D;  3WMM 0;  1N73 B;  1IFJ A;  2XZR A;  1JY2 P;  3RK2 C;  2E43 A;  5AW4 B;  1FZE A;  1J1E B;  2WIT A;  2P67 A;  2YNY A;  1NKN A;  1JCC A;  5CCH C;  1IO4 A;  3MUD A;  5CMZ A;  2OYI A;  2WSF H;  2Z5H A;  2JEE A;  1DX7 A;  2KLV A;  3HD7 B;  3HE5 A;  1LGH B;  4DOJ A;  4JF7 A;  1CI6 A;  2PAJ A;  1NOH A;  5APX A;  2FYU K;  1JY2 O;  1SLQ A;  3L36 A;  2IPP A;  1H88 A;  2A45 I;  5KLV K;  5AW0 B;  2N1T B;  2WWW A;  1GZL A;  1M1J C;  1NKZ B;  3M06 A;  3TNU B;  4AYC A;  3OA7 A;  2YKO A;  1T8Z A;  1W2E A;  1S9K E;  4ZKP A;  5APQ A;  5AVR B;  5KJ7 C;  3BAS A;  1URQ C;  1J2J B;  1L4A B;  1SFC D;  3OAK A;  5AVQ B;  1FZC C;  4LGD E;  4HH2 A;  2QM8 A;  1LTG C;  1LTB C;  2OYH C;  1HUC A;  1MV8 A;  1LWU C;  1XTC C;  2CPB A;  5APV A;  1L0L K;  3MGN A;  5BU5 A;  3SWY A;  2A45 H;  1YYC A;  1NTM K;  3IFM A;  1T3J A;  2NPS A;  3HE5 B;  1Z56 A;  2JJL A;  1KIL D;  3H32 A;  4I6M C;  4Y99 C;  1LTA C;  1YTZ I;  3VYI A;  3TSI A;  1E5W A;  1IFN A;  1OWA A;  1RE3 A;  2Z5I A;  4WY4 B;  4WB4 A;  1ZR4 A;  2M3B A;  2IFM A;  1KFM A;  2QM7 A;  2KB7 P;  1X79 B;  3P8M C;  5AVV B;  2O1J A;  1G1J A;  5CCH A;  3NFQ A;  5AVX B;  1SP4 A;  1X9V A;  1JUN A;  2PP6 A;  1GK4 A;  1FZB A;  2R5D A;  3L37 A;  1LT9 C;  3A2A A;  4DZO A;  1CZQ A;  1FZF A;  1J1D B;  2NPS B;  3EQ2 A;  2W6A A;  1T2K D;  2W6B A;  5AW7 B;  3V2R A;  1JO5 A;  2HPC A;  1S9K D;  1SFC C;  3H32 B;  1JMM A;  3LW5 H;  1GL2 A;  1FBM A;  3U1C A;  3KDP B;  5AVW B;  1NH4 A;  1GW4 A;  3RK3 D;  5CCG D;  2KOG A;  1IFI A;  2ZXE B;  2FFD C;  3B5N D;  2P1J A;  1OXZ A;  3N4X A;  3B8E B;  1RF1 A;  1JCD A;  2H7H A;  1ZN5 A;  2WPS A;  3RK2 B;  2Q3I A;  3RL0 B;  2N1T A;  1KIL C;  1JOC A;  3A5T A;  2IFN A;  5APT A;  2Q9I A;  3IR9 A;  1FJK A;  3HD7 D;  3HE4 B;  1ZV8 A;  3V2N A;  5AVU B;  3OJA B;  3KPE A;  1FAV A;  1FZA A;  1N86 A;  3V2Q A;  2YKQ A;  1NU1 K;  2HPC B;  5AW2 B;  1JY3 P;  1GL2 B;  1L0N K;  3P7K A;  1FDM A;  3L35 A;  1IK9 A;  2FKW B;  3P8C E;  5APS A;  1L4A D;  1FZC B;  2HFE D;  4I2L C;  3V4Q A;  1FZG A;  1RF1 B;  1RE4 C;  2OYH B;  5AW6 B;  3H6P A;  4N3Y B;  1T2K C;  2O1K A;  3M9B A;  1LTS C;  2MJZ A;  4WY4 A;  3N7N A;  1NO4 A;  1A02 J;  1LT9 A;  1JY3 O;  4W7Z A;  4N78 E;  1FJP A;  2KP8 A;  2Q5U A;  3RK3 C;  5CCG C;  2C0X A;  1N7S A;  1KQL A;  1IFM A;  4W80 A;  1GU5 A;  1MZ9 A;  4Y99 B;  3M9Q A;  3A3Y B;  2VRS A;  3BVH A;  1N73 C;  2KYV A;  2O01 H;  4O9B A;  3HUS C;  1AQ5 A;  1J1E C;  3VP9 A;  3VOP A;  1N2D C;  5KTB A;  4C7R A;  4ZKU A;  3GHG C;  1HGV A;  1HWT C;  4IFM A;  4M3L A;  3VMZ A;  1CW5 A;  2YO3 A;  5BVZ A;  1HBW A;  1SVF A;  1SQB K;  5AW8 B;  1DH3 A;  1AFO A;  2P7J A;  1GW3 A;  3U1A A;  1LT9 B;  1LTJ A;  4W7Y A;  2GUS A;  1CSB A;  2NPS D;  2C9N Y;  3VP8 A;  1HJB A;  2WSE H;  1KFN A;  1N7S B;  2J59 M;  1L4A C;  3UIA A;  4C46 A;  5AVT B;  5AW9 B;  3P8C D;  5AVS B;  5APW A;  1NTZ K;  3V5B A;  1M7L A;  1QL1 A;  3HE4 A;  4AQR D;  2P2U A;  2FFD B;  5APU A;  5BU8 B;  2OYI C;  3RK2 D;  1IFD A;  4N78 D;  1JY2 N;  3RL0 D;  1KIL B;  1ZLL A;  1M1J A;  5CCH D;  2I1J A;  2POH A;  2WTY A;  1DEB A;  2WT7 B;  3KYQ A;  3EFG A;  1LTT C;  3M91 A;  5KJ7 A;  1URQ A;  3E1I A;  1FZC A;  4XA4 A;  1LTJ B;  2OYH A;  4N6J A;  5CJ4 A;  1LWU A;  3MIW A;  5AW5 B;  4KHX A;  3NTN A;  1SQV K;  1GL2 D;  3MD0 A;  1QL2 A;  2M8R A;  4EOT A;  1N7L A;  2WPR A;  2J58 A;  2WZ7 A;  1WT6 A;  4XE5 B;  2HYN A;  2IX7 C;  1NWQ A;  1GK6 A;  1RY3 A;  3M0D C;  4OH8 B;  1HVV A;  1SQQ K;  1FU1 A;  1SQX K;  5AW1 B;  2C0W A;  2N1T D;  1M1J B;  2OAR A;  4EIJ A;  3MTU E;  2W27 A;  1JNM A;  5AVY B;  3A7O A;  1YTZ T;  3O8Z A;  3M9H A;  1URQ B;  2BAS A;  1G2C A;  2ZFC A;  4LC1 A;  1RE3 C;  2XDJ A;  3LID A;  1ZR2 A;  1MUU A;  1HH0 A;  4B86 A;  3BRV B;  3HTK A;  3LIE A;  2H43 A;  1GD2 E;  1MFZ A;  2HOD B;  2KSJ A;  3VTP C;  1LWU B;  4WBA A;  3HUS B;  3R2P A;  3RL0 C;  2I1K A;  3GHG B;  5CJ0 A;  1IC2 A;  1SFC A;  3B5N C;  3HRN A;  2R5B A;  2XNX A;  3BAT A;  1NTK K;  2FFD A;  4HYT B;  1X8Y A;  4WY4 D;  2XKM A;  3PP5 A;  1H89 A;  1GL2 C;  1VPC A;  1GTW A;  1GDT A;  3VMX A;  4AUW A;  3HD7 C;  1KIL A;  1N7S D;  1G2C B;  2WT7 A;  4I1L A;  1JTH A;  3U59 A;  4IFD K;  2XU6 A;  1RF1 C;  3HTK B;  3NXS A;  3VMY A;  1XTG B;  3G3Z A;  1HTL C;  3V2P A;  2N1T C;  3II6 A;  3M0D A;  2OYI B;  2FXM A;  3CLQ A;  1EQ7 A;  1WRG A;  2E42 A;  1IJD B;  1CI6 B;  4C7N A;  1SFC B;  2A45 G;  2C9L Y;  2R32 A;  1RF0 C;  3CI9 A;  3TK1 A;  4GKG A;  3SWF A;  3KQG A;  2GM4 A;  4GT1 A;  1RE4 A;  4IFF A;  1A02 F;  5AVZ B;  5APY A;  1FOS F;  2H8P D;  2LKM A;  1LTI C;  1NAF A;  3L4F A;  4JYB A;  1JTH B;  5CHX A;  1JY3 N;  3NMD A;  5CCG A;  3BRT B;  3B5N A;  4WY4 C;  2Q7C A;  1N73 A;  4JYC A;  2XV5 A;  2HOD A;  3V4W A;  2Z4E A;  3HUS A;  1SQP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...