4WY4D

Crystal structure of autophagic snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
64
Chain Sequence
b'HLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKVRQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 8
molecule tags Membrane protein
source organism Homo sapiens
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
total genus 32
structure length 64
sequence length 65
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4D00
1N7SC 1N7SD 3RL0C 5CCHA 4LGDE 1N7SA 3RK2C 5CCGC 1URQC 2N1TD 1NHLA 3B5NB 4JF7A 2N1TA 1L4AC 3B5NA 3TSIA 2H8PD 1KILC 1GL2C 2PP6A 2WZ7A 1KILD 5CCHC 1KILA 1GL2B 4WY4A 2NPSC 5KJ7C 1L4AB 2YMYA 1KILB 4OH8B 3RK3C 1JTHA 5CCGD 2HG5D 4W80A 3RL0D 1JTHB 1GL2D 2NPSB 1T3JA 2KOGA 1HVVA 1SFCB 3HD7D 3HD7C 4W7ZA 1URQD 2N1TC 1L4AD 4WY4C 3RK3B 3RK2D 4W7YA 4N78E 2XDJA 2NPSA 4WY4D 3RL0B 3M0DC 5KJ7A 1SFCA 5CCGA 3HD7A 5CCHD 2M8RA 2NPSD 1URQA 1XTGB 5KJ7D 1SFCD 3HD7B 1N7SB 3KYQA 1URQB 3VOPA 3P8CE 3B5NC 3RK3D 3RK2B 1L4AA 1SFCC 3HTKB 2N1TB 1GL2A 4WY4B 3PP5A 3B5ND 2HFED
chains in the Genus database with same CATH superfamily
1VQ9P 4U3FE 3KQGA 3L70G 4IL6X 2A45I 1M1JA 5APWA 5AW9B 1HJ0A 4D6TE 2QJPB 4BXLA 2FYNC 5H2FE 2O3JA 4DOJA 2Z5HA 1NTZJ 1VQMP 3L75D 3V6IA 4YXDC 1QLED 1L0LK 3E1RA 3HUSA 1N7SA 1EDKA 2FYUJ 2I1JA 4OGQD 5CCGC 3CCEP 4OGQC 2HPCB 1U7MA 1Y8AA 4JPZB 3CCMP 1PV3A 1WMKA 2NZ2A 3JSVC 1RF1A 2OYHC 2YIUB 3GF7A 4M3LA 1FZCC 3H1ID 2VRSA 2KB7P 4BRYA 5EFWB 5CBNA 4JF7A 2SPZA 1MKMA 1ZV8A 3FGAD 1SQXK 2O1JA 2FFDC 1PP9E 3H1KJ 1SP4A 3VMXA 2R5DA 1ZLLA 1LTSC 2FYNB 1GZLA 3CX5H 1Y9BA 3H1LJ 3TSIA 5CJ4A 4EI2A 4TLFA 1FZFA 1EDJA 1GL2C 1KTMA 1T6AA 3V2PA 2OYHA 5APVA 2LXCB 1M56D 4OGQB 3M06A 1EC5A 4WB4A 1KQFB 5B66H 1BGYE 1N73A 1SQXJ 3L71J 4L75A 2W6BA 5KLVK 1LTJC 3AE6C 3L70D 4KHXA 4DCKA 2OYIC 4H0LC 2E43A 1SQQE 3IR9A 1BE3J 4WVZA 2FXMA 5AVWB 2CK3H 3L74J 2AEMA 1KILA 5AVYB 2H43A 2N9BA 3GG2A 1GDTA 3CMEP 1CI6B 3H1JJ 1J2JB 1HGZA 1H89A 1T3UA 1N8RQ 2FYUG 2GUVA 1OW7A 5AVRB 1IFNA 5M1BA 3VTPC 1N7LA 1SQBE 3CXHE 1T2KD 1AV1A 2Z5IA 3AE3C 4JYCA 5KJ7C 2RMZA 1OFCX 1VPCA 1BCCE 3E7KA 2G3AA 1KYOH 1L4AB 1MFTA 3V4WA 2JP3A 2JO1A 2AEFA 4A7PA 5KKZC 1M8OB 3AE7C 1KZUB 4MN4C 1NU1G 2R32A 3A0BH 4HJGH 1U7JA 3RK3C 1KQLA 1JTHA 2Q3EA 1J1DB 1EZVE 2WQYC 2O01H 1SQPG 1MUUA 4LC1A 1LT9A 2FYUE 1SQQK 2M3EA 1DEEG 1JTHB 3LIEA 3LIDA 3MTUE 1FJKA 1SQBK 5KTBA 2E42A 1LWUB 1X9VA 1LP1B 2B88A 1YTZI 2M5AB 2PRRA 1NTKK 3KPEA 1RE3C 3L71G 5KAIH 1HVVA 1N73B 4N6JA 2IBZG 1AA0A 2KUBA 1K05A 1L4AD 3CWBJ 1J1EB 2RKLA 3NFQA 3MP7B 3OAKA 1BE3G 3AE5C 4HYTB 1YHQP 1KB9I 5KAFH 2K9YA 2OGUA 3HE4A 3M0DA 3RK3B 1FAVA 1EDIA 1PP9J 4IL6E 4BRYB 1CW5A 2BCCJ 4W7YA 2QE7H 4OVNF 4NPDA 2WSEJ 4D6TJ 3P8MC 2QJPC 1S9KD 1LWUC 3VMZA 1P84H 5DJTB 3RGUA 1BGYD 3SWYA 1LTJA 1RH5B 2BCCD 3V2RA 1VL2A 1PIXA 1BGYJ 5KJ7D 1N73C 3MIWA 1FZCA 2KNCB 2YO2A 2A45G 1R5LA 1GK6A 1NU1D 1QX8A 1JM0A 3CXHD 1NU1J 3SFDC 4UB8H 1FZCB 3AECC 1IFJA 3B5NC 4WWIA 3RK3D 3H1JE 5KLVE 2QJYB 4PJ0H 3L4FA 3M0AA 1SFCC 3Q5PA 4GOFA 2XNXA 4LLHA 3BRVB 3CCUP 1DIPA 2WSFH 1L0NK 2YIUC 1VF5D 2KIKA 3A0HE 3PRJA 1PZQA 5KLIC 3T97A 3W68A 1QVGO 5E79H 1S5LE 1OIPA 2YMKA 3KXDA 1KORA 2FY8A 3CC7P 3EWKA 5CCHA 1PP9G 3CPWO 2R3CA 1AVYA 1RY3A 3B4SA 2OYIB 3FWNA 1JMMA 1SQQJ 4NPEA 1SQXD 3FXEA 4I6MC 2B87A 3CX5E 1Q86Q 1XTCC 2AXTE 3R2PA 3E1IA 3CMAP 3LW5H 4YTPC 1ZMEC 1VDFA 1LTJB 1VF5B 3H1IE 1RE4C 2QEXP 3O6QA 1L0NE 2IBZD 2KZIA 3CL3D 1USEA 2FXOA 1VQ8P 2YKPA 1BE3D 3KDPB 3HRNA 5CJ0A 3BVHA 1X79B 2L5GB 1IZNB 1L4AC 1LTAC 3L73E 1P84I 2BCCE 3TNUB 3WUUA 1K9MQ 2OTJP 1KILC 3L71D 4I7ZB 5E79E 5AW5B 1D7MA 2POHA 1SQXG 3SWFA 4AUWA 1IC2A 2K1AA 4JYBA 2I1KA 2K37A 2LKMA 5AW6B 1SQBG 5C39A 3H1HG 1HJBA 4R4MA 1Q2NA 1S4XA 2AXCA 2JWAA 3V5BA 1KB9H 3H1JD 2J59M 4EYYQ 1NTMG 2JDIH 3I55P 3ZDMA 3G3ZA 3WU2H 3H6PA 3HUSC 4PD4D 4RO0A 1L2PA 2O1KA 1N86A 1EQ7A 3EFFK 1EZVG 4ZKPA 1IK9A 2WPVB 4ASVA 3TGUD 4AYCA 2OYIA 4PJ0E 1LTIC 5H2FH 2HYNA 3B8EB 2IYPA 5KLVJ 3LW5J 4WY4A 3BCCE 2JEEA 2CPBA 1NTKD 2A06D 2GUSA 2GA1A 1LGHB 2FXPA 1AVOA 2R5BA 3II6A 3RBZA 3L35A 3WMM0 3GF3A 1KD1Q 1S72P 5AVUB 3L75J 3H1LD 1CZQA 1GTWA 1J1EC 4ZMDA 2M3BA 5TISH 4HKZH 4OH8B 4L76A 1ZP0C 4IL6H 2ZT9C 2QG4A 1SQVD 3F89A 1MV8A 2HG5D 2WSSH 3HUSB 1RQUA 1S2EA 1NTZD 1W5CE 3NTNA 3I56P 1A02J 4NPFX 4I1LA 4Z1MH 3IFMA 2HPCA 1KYOI 1YITP 1OMIA 1PGOA 3TGUJ 3L73D 3CXHH 1JOCA 1X22A 2KOGA 2QVAA 3L74D 3MUDC 4RKUJ 2Q3IA 5AVQB 3GMAA 3HD7D 5K5GB 1H88A 3HD7C 4C7NA 3AE4C 1FBMA 4WY4C 4YPCA 2FKWB 1LTBC 2WPQA 1AQ5A 1JO5A 2L91A 2W83C 3AE9C 3L73J 1LTGC 5KLIB 2KP8A 1SQVK 1MZ9A 5AVTB 1EXJA 1LNQA 2QJYC 2WT7A 1PPJD 2O01J 4N78D 3CCLP 3C8VA 3CXHI 2H89C 3BATA 3EFGA 1VQ6P 2NPSA 2JWDA 2B89A 3OA7A 1A02F 3RK3E 4K3AA 3FWLA 1ZR2A 1SFCA 3CLQA 2P7JA 3O8ZA 3OJAB 4Y99B 3HD7A 4ZNCA 5AVSB 5CCGA 5CCHD 1BCCJ 3KZIE 1M90Q 3JC22 3L75G 1BCCD 1XTGB 3NXSA 1AJYA 5KKZB 1PGQA 3HD7B 2PGDA 3L70J 1UIIA 1LWUA 3VP9A 3KYQA 1LTTC 1M1JB 4YXWH 1VF5C 1NTZG 1SS1A 2E76B 2KSJA 1IJDB 2ZYGA 4QMAA 3U1AA 1YJNP 4UB6E 2W6JH 2FYUD 1M1KQ 2RN0A 2KYVA 3V2QA 5TJHA 1JNMA 1KQSO 2A06G 3SSUA 1KB9E 2N1TB 3BCCJ 3HE4B 1GL2A 2IPPA 4GIFA 3PP5A 1ZXGA 2XKMA 3TDKA 3GHGA 1NU1K 3L75E 1KILE 2P10A 1YTZT 1LJ2A 4UB8E 1M57D 2Z4EA 1L0NG 1NH4A 1QGKB 1ZRTE 2Y0EA 1FDOA 3JCUH 2ZVOB 3QH9A 2D2CD 2XNDH 4PV1C 1EXIA 3CC4P 3RL0C 3L74E 3CCVP 3I5CA 3Q1MA 3CC2P 1SQVJ 2KNCA 2E76D 3A7OA 2A45H 3RK2C 1KYOD 1G1IA 1LP1A 3A3YB 3VMAA 3CWBD 1K8AQ 1FZBA 3A0HH 2OTLP 1NTKJ 1NAYA 3H32B 1NTMD 3QWOC 1GU5A 1IFMA 3NMDA 1URQC 1BCCG 2N1TD 2QRXA 5AW4B 1PPJG 3BRTB 5B5EE 4GODA 2QJKB 4XE5B 2IFMA 3L72D 1WT6A 1NU1E 4H13C 2P2UA 3L74G 4Y28J 2W6AA 2LXBA 3N4XA 2D2CB 1SQBD 3B5NA 3T97B 2WITA 2Y0DA 1CI6A 3MD0A 2H88C 3KHUA 5BVZA 1ZN5A 1JY3O 1YQ4C 1L0LG 4D6TD 2RH0A 2ZT9B 1YBKA 3BCCG 1J1DC 2C0XA 1OW8A 1QL2A 3V4QA 1BSNA 5L8RJ 2YXQB 4H44C 1FC2C 1RE3A 1L0ND 2IBZE 1CSBA 1S5LX 2BEQD 3CX5I 4U3FG 4GOEA 3VYIA 1NGMB 2YKQA 1IK7A 1OVVA 3PH0A 3W67A 2AEJA 5KAIE 1YJWP 1YYCA 1W2BO 1JCDA 5APTA 1NTMK 3A2AA 1SQVG 1EDLA 3H1KD 3TF5A 1OX3A 1Q81Q 1H0TA 2DW3A 2NPSC 1PP9D 3AEBC 3AEGC 2ZT9D 3K5BA 1BSHA 2QIWA 1HBWA 2CPSA 1VQKP 4H44B 1NVOA 4JQ0D 2QA4P 3UIAA 2HODA 2K9JB 2YMYA 3WU2E 2KI7B 3M91A 4IFFA 1FZGA 3WUTA 4BWNA 1S9KE 2IX7C 3FX0A 4C7NB 1VQOP 2BASA 3H1HD 1JB0J 2E5YA 2ZJSE 1S3JA 5CCGD 1SQVE 1HUCA 5DJUB 3H1JG 1G2CA 2BCCG 3AEDC 2E75B 2V7QJ 4W80A 3CX5D 3RL0D 3TGUG 1KYOE 1NTKE 2WVRA 3MGNA 2FYUK 3USSA 3JCUE 4Y99C 3FXDA 2E76C 4H0LB 1YIJP 3IF4A 1NYHA 2NPSB 1HH0A 1T3JA 2JR8A 3C9IA 4XA4A 1IFDA 5APUA 5AW7B 3Q3DA 1SFCB 1BGYG 1VQ4P 2V7QH 2HLOA 3PTZA 4U3FD 4H44D 1JY2P 1URQD 2N1TC 4U3FJ 1Q82Q 1YJ9P 3RL0g 1WRGA 1M1JC 3ABVC 3ITKA 2WWWA 1JMBA 3S9OA 1RF1C 1VQNP 1EZVI 3TNUA 3TYYA 2UWJE 3RK2D 1NTZE 3F5HA 3VP8A 3P32A 4C7RA 3CCJP 3BASA 3HE5A 4N78E 1Q7YQ 3CD6P 4HH2A 3MUDA 1HGVA 1NO4A 2E75D 2FBWC 1GD2E 1NOHA 2ZFCA 3M0DC 3RL0B 1JY2O 3G6EP 1E79H 1ZOYC 2A06E 2Q9IA 1FOSE 1AQTA 3M9BA 2ZXEB 4H0LD 2M8RA 2J58A 3A5TA 2NPSD 4R4LA 1N2DC 1FJPA 1URQA 2ZYDA 1JUNA 3WUVA 2OTKE 1SFCD 3SFEC 3Q2YA 1IFPA 1N7SB 1QL1A 2V4HA 1URQB 3VOPA 2KXPB 3AE1C 1TU3F 2W8ZA 1JY2N 2OQQA 1RF1B 1VQPP 1OVRA 5GTIE 2QSIA 1NTMJ 1SVFA 4IFMA 4XFJA 1HWTC 1SQPE 3RK2B 2FFDA 1DD4A 2K88A 3GHGB 3TK1A 1FDIA 4H13B 5KAFE 1RHZB 1IO4A 1EZVD 2D2CC 3M9QA 1NTZK 3H1HE 4CPGA 3GLMA 3EQ2A 2WT7B 4PD4H 3B5ND 2GM4A 2HFED 2QJKC 1K73Q 3L71E 1NTME 1S5LH 4DJGA 4IOIH 2WSCH 2YNYA 1H0TB 2W90A 1SQPJ 1KMIZ 5CBOA 3O6QB 2WPSA 3PJSK 1N7SC 4KJMA 1N7SD 4GDOA 1R8EA 2K3RA 3H1KG 1OWAA 3S4RA 4RJTA 3H32A 4LGDE 5BU8B 1UIXA 1Y47A 3C1LA 1NKNA 2HR3A 2MKVA 1LT9B 2QM7A 4L73A 1NJIQ 3PLNA 4EDFA 1ZW0A 3MZWB 4H13D 2YKOA 3AEAC 3IN6A 1GW3A 1OXZA 1ZR4A 1R5SA 1PGJA 1NAFA 2BEZF 2OYOA 1G2CB 1K04A 1M7LA 1NHLA 1JCCA 1JY3N 3Q5RA 2P67A 3B5NB 3L70E 2OARA 2JJLA 3R4YA 5GTHH 2N1TA 1L0LD 1P84D 4D6TG 3GW6A 5GTIH 1PGPA 2LR2A 3AE8C 1L0LJ 2J5UA 2KSEA 4JBZA 4O9BA 1X8YA 5TISE 4AQRD 2PFXA 3L36A 5AW0B 2H8PD 2KLVA 3H25A 2I8DA 1OW6A 1KN7A 2QM8A 1W2EA 2KK7A 2PP6A 2ZYAA 4C46A 5APQA 5KLVG 5CHXA 2IZ0A 1PFIA 1DD3A 1FZAA 2YO3A 4GT1A 5GTHE 4PD4E 2Y0CA 2WZ7A 1GK4A 2E75C 2WSCJ 1USDA 5AW2B 2Y9ZA 3D70A 1DX7A 3VN0A 1KC8Q 2IZ1A 1KILD 1S1CX 1YQ3C 3P7KA 2Q5UA 3A0BE 4K35A 5CCHC 4KT0J 1DEBA 1KFNA 4PD4I 1HF9A 2ZXXA 1YI2P 2W27A 2N9YB 2IFNA 2WPRA 3S1KA 3OW2O 2OYHB 4EIJA 1KV4A 2O01N 1Z56A 3Q5SA 2Q7CA 1GW4A 1GL2B 1T2KC 2HODB 2K9JA 2R44A 3L72J 1KQGB 2IYOA 2MJZA 3H1HJ 1FOSF 1VQ7P 2E74D 1RE4A 4EOTA 3H1IJ 1OZHA 1SLQA 5AVZB 2FFDB 1PPJE 3SWKA 1NKZB 1SQQD 5APYA 1SQPK 2FYZA 3V2NA 1QVFO 1KILB 4I7ZC 1SQQG 2AXTH 3N7NA 3CCSP 1E5WA 1FE6A 2G8YA 5AW1B 1VQ5P 4ASWA 4B86A 2YXRB 2KS1A 4PV1D 4WBAA 2IDBA 3PHLA 2IBZI 3CWBE 1H8AA 1FU1A 4DZOA 1LT1A 2ZAEB 1QEXA 1SQXE 2KS1B 2NRGA 2XV5A 5AW8B 1GU4A 3VMYA 2B87B 2E5TA 3G4SP 1GL2D 3P8CD 3U1CA 3MHVA 3CCQP 1FZEA 3G71P 1IFIA 3CCRP 1FS0E 3GHGC 1ZRTD 2WSFJ 1X0TA 3U59A 5CMZA 2E74B 2C9NY 4W7ZA 2Q1KA 3AEFC 5AW3B 3BCCD 3CI9A 3HE5B 4I2LC 2H7HA 4IFDK 1JEKA 5B66E 2P58A 1DH3A 1KB9D 1G1JA 1BDCA 1AFOA 3D6ZA 1MFZA 1SQBJ 3CWBG 3H1LE 3L37A 2KZJA 1PL5A 4PV1B 5KLVD 2XDJA 4HB1A 4U7JA 1U57A 2M5AA 2R3SA 4WY4D 3M9HA 1SQPD 5KJ7A 2ZVNB 3L72G 5BU5A 3D71A 1VQLP 4TT3H 3D6YA 2P1JA 2WMMA 1Q90D 1RF0A 4DT0A 2KLUA 2B9BA 3H1IG 4UB6H 4N3YB 1BDDA 1KFMA 1LT9C 4ZKUA 2XU6A 2WSEH 2E74C 1L0NJ 4GKGA 1BE3E 1T8ZA 2M0BA 4L74A 3AEEC 1FDMA 1JY3P 5APSA 3P8CE 1RQVA 3L73G 2ITAA 2JKVA 2Y9YA 5AVVB 3H1KE 3H1LG 2C9LY 3KZIH 5B5EH 1HTLC 3TGUE 2XZRA 1L4AA 5APXA 1L0LE 1P84E 2C0WA 1RF0C 4OWFA 3L72E 1GMJA 1NTKG 3IAOA 2Q6QA 3G9RA 3HTKB 5AVXB 4WY4B 3RBXA 4RESB 2WTYA 1NWQA 2PAJA 3B71A 3HTKA 1OVUA 3AE2C
chains in the Genus database with same CATH topology
3KQGA 2A45I 1M1JA 5APWA 5AW9B 4DOJA 2Z5HA 1L0LK 3HUSA 1N7SA 2I1JA 5CCGC 2OYHC 4M3LA 1FZCC 2VRSA 2KB7P 4JF7A 1ZV8A 1SQXK 2O1JA 2FFDC 1SP4A 3VMXA 2R5DA 1ZLLA 1LTSC 1GZLA 5CJ4A 3TSIA 1FZFA 1GL2C 3V2PA 2OYHA 5APVA 3M06A 4WB4A 1N73A 5KLVK 2W6BA 1LTJC 4KHXA 2OYIC 2E43A 3IR9A 5AVWB 2FXMA 5AVYB 1KILA 2H43A 2N9BA 1GDTA 1CI6B 1J2JB 1HGZA 1H89A 1T3UA 2GUVA 5AVRB 3VTPC 1IFNA 1T2KD 1N7LA 5KJ7C 2Z5IA 4JYCA 1VPCA 3V4WA 1L4AB 1KZUB 2R32A 3RK3C 1KQLA 1JTHA 1J1DB 2O01H 4LC1A 1MUUA 1LT9A 1SQQK 3LIEA 1JTHB 3LIDA 3MTUE 1FJKA 1SQBK 5KTBA 2E42A 1LWUB 1X9VA 1YTZI 1NTKK 3KPEA 1RE3C 1N73B 1HVVA 4N6JA 2C9NY 3OAKA 1L4AD 1J1EB 3NFQA 4HYTB 3HE4A 3M0DA 3RK3B 1FAVA 1CW5A 4W7YA 3P8MC 1S9KD 1LWUC 3VMZA 3SWYA 1LTJA 3V2RA 5KJ7D 1N73C 3MIWA 1FZCA 2YO2A 2A45G 1GK6A 1FZCB 1IFJA 3B5NC 3RK3D 3L4FA 3M0AA 1SFCC 2XNXA 4LLHA 3BRVB 2WSFH 1L0NK 3T97A 5CCHA 2R3CA 1RY3A 2OYIB 1JMMA 4I6MC 1XTCC 3R2PA 3E1IA 3LW5H 1VDFA 1LTJB 1RE4C 3CL3D 2YKPA 5CJ0A 3KDPB 3HRNA 3BVHA 1X79B 2L5GB 1L4AC 1LTAC 3TNUB 1KILC 5AW5B 2POHA 3SWFA 4AUWA 1IC2A 4JYBA 2I1KA 1HJBA 2LKMA 5AW6B 3V5BA 2J59M 3G3ZA 3H6PA 3HUSC 2O1KA 4ZKPA 1N86A 1EQ7A 2OYIA 1IK9A 4AYCA 1LTIC 2HYNA 3B8EB 4WY4A 2JEEA 2CPBA 2GUSA 1LGHB 2R5BA 3II6A 3L35A 3WMM0 5AVUB 1CZQA 1GTWA 1J1EC 2M3BA 4OH8B 3HUSB 4AQRD 1MV8A 2HG5D 3NTNA 1A02J 4I1LA 3IFMA 2HPCA 1DH3A 1JOCA 2KOGA 5AVQB 1GU4A 1H88A 2Q3IA 3HD7D 3HD7C 4C7NA 1FBMA 4WY4C 2FKWB 1LTBC 2WPQA 1AQ5A 1JO5A 1LTGC 2KP8A 1SQVK 1MZ9A 5AVTB 2WT7A 4N78D 3BATA 3EFGA 2NPSA 3OA7A 1A02F 1ZR2A 1SFCA 3CLQA 2P7JA 3O8ZA 3OJAB 4Y99B 3HD7A 5CCGA 5AVSB 5CCHD 3NXSA 1XTGB 3HD7B 1LWUA 3VP9A 3KYQA 1LTTC 1M1JB 2KSJA 1IJDB 3U1AA 2KYVA 3V2QA 2N1TB 3HE4B 1GL2A 2IPPA 4GIFA 3PP5A 2XKMA 3GHGA 1NU1K 1YTZT 2Z4EA 1NH4A 1RF1A 3RL0C 3I5CA 3A7OA 2A45H 3RK2C 1G1IA 3A3YB 1FZBA 3H32B 1GU5A 1IFMA 3NMDA 1URQC 2N1TD 5AW4B 3BRTB 4XE5B 2IFMA 1WT6A 2P2UA 2W6AA 3B5NA 2WITA 1CI6A 3MD0A 5BVZA 1ZN5A 1JY3O 1J1DC 2C0XA 1QL2A 3V4QA 1RE3A 1CSBA 3VYIA 2YKQA 1YYCA 1JCDA 5APTA 1NTMK 3A2AA 2NPSC 1HBWA 2CPSA 3UIAA 2HODA 2YMYA 3M91A 4IFFA 1FZGA 1S9KE 2IX7C 4C7NB 2BASA 5CCGD 2HPCB 1HUCA 1G2CA 4W80A 3RL0D 3MGNA 2FYUK 4Y99C 2NPSB 4XA4A 1HH0A 1T3JA 3C9IA 5APUA 1IFDA 5AW7B 1SFCB 2HLOA 1JY2P 1URQD 2N1TC 1WRGA 1M1JC 2WWWA 1RF1C 3TNUA 3TYYA 3RK2D 3VP8A 4C7RA 3P32A 3BASA 3HE5A 4N78E 4HH2A 3MUDA 1HGVA 1NO4A 1GD2E 1NOHA 2ZFCA 3M0DC 3RL0B 1JY2O 1FOSE 2Q9IA 3M9BA 2ZXEB 2M8RA 2J58A 3A5TA 2NPSD 1FJPA 1N2DC 1URQA 1JUNA 1SFCD 1N7SB 1QL1A 1URQB 3VOPA 1RF1B 1JY2N 1SVFA 4IFMA 1HWTC 2FFDA 3RK2B 3TK1A 3GHGB 1IO4A 3M9QA 1NTZK 3EQ2A 2WT7B 2GM4A 3B5ND 2HFED 2WSCH 2YNYA 2WPSA 1N7SC 1N7SD 1OWAA 3H32A 4LGDE 5BU8B 1NKNA 2QM7A 1LT9B 2YKOA 1GW3A 1OXZA 1ZR4A 1NAFA 1G2CB 1NHLA 1M7LA 1JCCA 1JY3N 2P67A 3B5NB 2OARA 2JJLA 2N1TA 2C9LY 4O9BA 1X8YA 3L36A 5AW0B 2H8PD 2KLVA 2QM8A 1W2EA 2PP6A 4C46A 5APQA 5CHXA 1FZAA 2YO3A 4GT1A 2WZ7A 1GK4A 5AW2B 1DX7A 3VN0A 1KILD 3P7KA 2Q5UA 5CCHC 1DEBA 1KFNA 2W27A 2IFNA 2WPRA 2OYHB 4EIJA 1Z56A 2Q7CA 1GW4A 1GL2B 1T2KC 2HODB 2MJZA 1FOSF 1RE4A 4EOTA 2FFDB 1SLQA 5AVZB 1NKZB 5APYA 1SQPK 2FYZA 3V2NA 1KILB 3N7NA 1E5WA 5AW1B 4B86A 4WBAA 1H8AA 1FU1A 4DZOA 5AW8B 2XV5A 3VMYA 1JNMA 1GL2D 3P8CD 3U1CA 1FZEA 1IFIA 3GHGC 3U59A 5CMZA 4W7ZA 5AW3B 3CI9A 3HE5B 4I2LC 2H7HA 4IFDK 1G1JA 1AFOA 1MFZA 3L37A 1PFIA 2XDJA 4WY4D 3M9HA 5KJ7A 5BU5A 2P1JA 1RF0A 4ZKUA 4N3YB 1KFMA 1LT9C 2XU6A 2WSEH 4GKGA 1T8ZA 1FDMA 1JY3P 5APSA 3P8CE 5AVVB 1HTLC 2XZRA 1L4AA 5APXA 2C0WA 1RF0C 5AVXB 2WTYA 3HTKB 4WY4B 4RESB 1NWQA 2PAJA 3HTKA 3N4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S C;  1N7S D;  3RL0 C;  5CCH A;  4LGD E;  1N7S A;  3RK2 C;  5CCG C;  1URQ C;  2N1T D;  1NHL A;  3B5N B;  4JF7 A;  2N1T A;  1L4A C;  3B5N A;  3TSI A;  2H8P D;  1KIL C;  1GL2 C;  2PP6 A;  2WZ7 A;  1KIL D;  5CCH C;  1KIL A;  1GL2 B;  4WY4 A;  2NPS C;  5KJ7 C;  1L4A B;  2YMY A;  1KIL B;  4OH8 B;  3RK3 C;  1JTH A;  5CCG D;  2HG5 D;  4W80 A;  3RL0 D;  1JTH B;  1GL2 D;  2NPS B;  1T3J A;  2KOG A;  1HVV A;  1SFC B;  3HD7 D;  3HD7 C;  4W7Z A;  1URQ D;  2N1T C;  1L4A D;  4WY4 C;  3RK3 B;  3RK2 D;  4W7Y A;  4N78 E;  2XDJ A;  2NPS A;  4WY4 D;  3RL0 B;  3M0D C;  5KJ7 A;  1SFC A;  5CCG A;  3HD7 A;  5CCH D;  2M8R A;  2NPS D;  1URQ A;  1XTG B;  5KJ7 D;  1SFC D;  3HD7 B;  1N7S B;  3KYQ A;  1URQ B;  3VOP A;  3P8C E;  3B5N C;  3RK3 D;  3RK2 B;  1L4A A;  1SFC C;  3HTK B;  2N1T B;  1GL2 A;  4WY4 B;  3PP5 A;  3B5N D;  2HFE D; 
#chains in the Genus database with same CATH topology
 1VQ9 P;  4U3F E;  3KQG A;  3L70 G;  4IL6 X;  2A45 I;  1M1J A;  5APW A;  5AW9 B;  1HJ0 A;  4D6T E;  2QJP B;  4BXL A;  2FYN C;  5H2F E;  2O3J A;  4DOJ A;  2Z5H A;  1NTZ J;  1VQM P;  3L75 D;  3V6I A;  4YXD C;  1QLE D;  1L0L K;  3E1R A;  3HUS A;  1N7S A;  1EDK A;  2FYU J;  2I1J A;  4OGQ D;  5CCG C;  3CCE P;  4OGQ C;  2HPC B;  1U7M A;  1Y8A A;  4JPZ B;  3CCM P;  1PV3 A;  1WMK A;  2NZ2 A;  3JSV C;  1RF1 A;  2OYH C;  2YIU B;  3GF7 A;  4M3L A;  1FZC C;  3H1I D;  2VRS A;  2KB7 P;  4BRY A;  5EFW B;  5CBN A;  4JF7 A;  2SPZ A;  1MKM A;  1ZV8 A;  3FGA D;  1SQX K;  2O1J A;  2FFD C;  1PP9 E;  3H1K J;  1SP4 A;  3VMX A;  2R5D A;  1ZLL A;  1LTS C;  2FYN B;  1GZL A;  3CX5 H;  1Y9B A;  3H1L J;  3TSI A;  5CJ4 A;  4EI2 A;  4TLF A;  1FZF A;  1EDJ A;  1GL2 C;  1KTM A;  1T6A A;  3V2P A;  2OYH A;  5APV A;  2LXC B;  1M56 D;  4OGQ B;  3M06 A;  1EC5 A;  4WB4 A;  1KQF B;  5B66 H;  1BGY E;  1N73 A;  1SQX J;  3L71 J;  4L75 A;  2W6B A;  5KLV K;  1LTJ C;  3AE6 C;  3L70 D;  4KHX A;  4DCK A;  2OYI C;  4H0L C;  2E43 A;  1SQQ E;  3IR9 A;  1BE3 J;  4WVZ A;  2FXM A;  5AVW B;  2CK3 H;  3L74 J;  2AEM A;  1KIL A;  5AVY B;  2H43 A;  2N9B A;  3GG2 A;  1GDT A;  3CME P;  1CI6 B;  3H1J J;  1J2J B;  1HGZ A;  1H89 A;  1T3U A;  1N8R Q;  2FYU G;  2GUV A;  1OW7 A;  5AVR B;  1IFN A;  5M1B A;  3VTP C;  1N7L A;  1SQB E;  3CXH E;  1T2K D;  1AV1 A;  2Z5I A;  3AE3 C;  4JYC A;  5KJ7 C;  2RMZ A;  1OFC X;  1VPC A;  1BCC E;  3E7K A;  2G3A A;  1KYO H;  1L4A B;  1MFT A;  3V4W A;  2JP3 A;  2JO1 A;  2AEF A;  4A7P A;  5KKZ C;  1M8O B;  3AE7 C;  1KZU B;  4MN4 C;  1NU1 G;  2R32 A;  3A0B H;  4HJG H;  1U7J A;  3RK3 C;  1KQL A;  1JTH A;  2Q3E A;  1J1D B;  1EZV E;  2WQY C;  2O01 H;  1SQP G;  1MUU A;  4LC1 A;  1LT9 A;  2FYU E;  1SQQ K;  2M3E A;  1DEE G;  1JTH B;  3LIE A;  3LID A;  3MTU E;  1FJK A;  1SQB K;  5KTB A;  2E42 A;  1LWU B;  1X9V A;  1LP1 B;  2B88 A;  1YTZ I;  2M5A B;  2PRR A;  1NTK K;  3KPE A;  1RE3 C;  3L71 G;  5KAI H;  1HVV A;  1N73 B;  4N6J A;  2IBZ G;  1AA0 A;  2KUB A;  1K05 A;  1L4A D;  3CWB J;  1J1E B;  2RKL A;  3NFQ A;  3MP7 B;  3OAK A;  1BE3 G;  3AE5 C;  4HYT B;  1YHQ P;  1KB9 I;  5KAF H;  2K9Y A;  2OGU A;  3HE4 A;  3M0D A;  3RK3 B;  1FAV A;  1EDI A;  1PP9 J;  4IL6 E;  4BRY B;  1CW5 A;  2BCC J;  4W7Y A;  2QE7 H;  4OVN F;  4NPD A;  2WSE J;  4D6T J;  3P8M C;  2QJP C;  1S9K D;  1LWU C;  3VMZ A;  1P84 H;  5DJT B;  3RGU A;  1BGY D;  3SWY A;  1LTJ A;  1RH5 B;  2BCC D;  3V2R A;  1VL2 A;  1PIX A;  1BGY J;  5KJ7 D;  1N73 C;  3MIW A;  1FZC A;  2KNC B;  2YO2 A;  2A45 G;  1R5L A;  1GK6 A;  1NU1 D;  1QX8 A;  1JM0 A;  3CXH D;  1NU1 J;  3SFD C;  4UB8 H;  1FZC B;  3AEC C;  1IFJ A;  3B5N C;  4WWI A;  3RK3 D;  3H1J E;  5KLV E;  2QJY B;  4PJ0 H;  3L4F A;  3M0A A;  1SFC C;  3Q5P A;  4GOF A;  2XNX A;  4LLH A;  3BRV B;  3CCU P;  1DIP A;  2WSF H;  1L0N K;  2YIU C;  1VF5 D;  2KIK A;  3A0H E;  3PRJ A;  1PZQ A;  5KLI C;  3T97 A;  3W68 A;  1QVG O;  5E79 H;  1S5L E;  1OIP A;  2YMK A;  3KXD A;  1KOR A;  2FY8 A;  3CC7 P;  3EWK A;  5CCH A;  1PP9 G;  3CPW O;  2R3C A;  1AVY A;  1RY3 A;  3B4S A;  2OYI B;  3FWN A;  1JMM A;  1SQQ J;  4NPE A;  1SQX D;  3FXE A;  4I6M C;  2B87 A;  3CX5 E;  1Q86 Q;  1XTC C;  2AXT E;  3R2P A;  3E1I A;  3CMA P;  3LW5 H;  4YTP C;  1ZME C;  1VDF A;  1LTJ B;  1VF5 B;  3H1I E;  1RE4 C;  2QEX P;  3O6Q A;  1L0N E;  2IBZ D;  2KZI A;  3CL3 D;  1USE A;  2FXO A;  1VQ8 P;  2YKP A;  1BE3 D;  3KDP B;  3HRN A;  5CJ0 A;  3BVH A;  1X79 B;  2L5G B;  1IZN B;  1L4A C;  1LTA C;  3L73 E;  1P84 I;  2BCC E;  3TNU B;  3WUU A;  1K9M Q;  2OTJ P;  1KIL C;  3L71 D;  4I7Z B;  5E79 E;  5AW5 B;  1D7M A;  2POH A;  1SQX G;  3SWF A;  4AUW A;  1IC2 A;  2K1A A;  4JYB A;  2I1K A;  2K37 A;  2LKM A;  5AW6 B;  1SQB G;  5C39 A;  3H1H G;  1HJB A;  4R4M A;  1Q2N A;  1S4X A;  2AXC A;  2JWA A;  3V5B A;  1KB9 H;  3H1J D;  2J59 M;  4EYY Q;  1NTM G;  2JDI H;  3I55 P;  3ZDM A;  3G3Z A;  3WU2 H;  3H6P A;  3HUS C;  4PD4 D;  4RO0 A;  1L2P A;  2O1K A;  1N86 A;  1EQ7 A;  3EFF K;  1EZV G;  4ZKP A;  1IK9 A;  2WPV B;  4ASV A;  3TGU D;  4AYC A;  2OYI A;  4PJ0 E;  1LTI C;  5H2F H;  2HYN A;  3B8E B;  2IYP A;  5KLV J;  3LW5 J;  4WY4 A;  3BCC E;  2JEE A;  2CPB A;  1NTK D;  2A06 D;  2GUS A;  2GA1 A;  1LGH B;  2FXP A;  1AVO A;  2R5B A;  3II6 A;  3RBZ A;  3L35 A;  3WMM 0;  3GF3 A;  1KD1 Q;  1S72 P;  5AVU B;  3L75 J;  3H1L D;  1CZQ A;  1GTW A;  1J1E C;  4ZMD A;  2M3B A;  5TIS H;  4HKZ H;  4OH8 B;  4L76 A;  1ZP0 C;  4IL6 H;  2ZT9 C;  2QG4 A;  1SQV D;  3F89 A;  1MV8 A;  2HG5 D;  2WSS H;  3HUS B;  1RQU A;  1S2E A;  1NTZ D;  1W5C E;  3NTN A;  3I56 P;  1A02 J;  4NPF X;  4I1L A;  4Z1M H;  3IFM A;  2HPC A;  1KYO I;  1YIT P;  1OMI A;  1PGO A;  3TGU J;  3L73 D;  3CXH H;  1JOC A;  1X22 A;  2KOG A;  2QVA A;  3L74 D;  3MUD C;  4RKU J;  2Q3I A;  5AVQ B;  3GMA A;  3HD7 D;  5K5G B;  1H88 A;  3HD7 C;  4C7N A;  3AE4 C;  1FBM A;  4WY4 C;  4YPC A;  2FKW B;  1LTB C;  2WPQ A;  1AQ5 A;  1JO5 A;  2L91 A;  2W83 C;  3AE9 C;  3L73 J;  1LTG C;  5KLI B;  2KP8 A;  1SQV K;  1MZ9 A;  5AVT B;  1EXJ A;  1LNQ A;  2QJY C;  2WT7 A;  1PPJ D;  2O01 J;  4N78 D;  3CCL P;  3C8V A;  3CXH I;  2H89 C;  3BAT A;  3EFG A;  1VQ6 P;  2NPS A;  2JWD A;  2B89 A;  3OA7 A;  1A02 F;  3RK3 E;  4K3A A;  3FWL A;  1ZR2 A;  1SFC A;  3CLQ A;  2P7J A;  3O8Z A;  3OJA B;  4Y99 B;  3HD7 A;  4ZNC A;  5AVS B;  5CCG A;  5CCH D;  1BCC J;  3KZI E;  1M90 Q;  3JC2 2;  3L75 G;  1BCC D;  1XTG B;  3NXS A;  1AJY A;  5KKZ B;  1PGQ A;  3HD7 B;  2PGD A;  3L70 J;  1UII A;  1LWU A;  3VP9 A;  3KYQ A;  1LTT C;  1M1J B;  4YXW H;  1VF5 C;  1NTZ G;  1SS1 A;  2E76 B;  2KSJ A;  1IJD B;  2ZYG A;  4QMA A;  3U1A A;  1YJN P;  4UB6 E;  2W6J H;  2FYU D;  1M1K Q;  2RN0 A;  2KYV A;  3V2Q A;  5TJH A;  1JNM A;  1KQS O;  2A06 G;  3SSU A;  1KB9 E;  2N1T B;  3BCC J;  3HE4 B;  1GL2 A;  2IPP A;  4GIF A;  3PP5 A;  1ZXG A;  2XKM A;  3TDK A;  3GHG A;  1NU1 K;  3L75 E;  1KIL E;  2P10 A;  1YTZ T;  1LJ2 A;  4UB8 E;  1M57 D;  2Z4E A;  1L0N G;  1NH4 A;  1QGK B;  1ZRT E;  2Y0E A;  1FDO A;  3JCU H;  2ZVO B;  3QH9 A;  2D2C D;  2XND H;  4PV1 C;  1EXI A;  3CC4 P;  3RL0 C;  3L74 E;  3CCV P;  3I5C A;  3Q1M A;  3CC2 P;  1SQV J;  2KNC A;  2E76 D;  3A7O A;  2A45 H;  3RK2 C;  1KYO D;  1G1I A;  1LP1 A;  3A3Y B;  3VMA A;  3CWB D;  1K8A Q;  1FZB A;  3A0H H;  2OTL P;  1NTK J;  1NAY A;  3H32 B;  1NTM D;  3QWO C;  1GU5 A;  1IFM A;  3NMD A;  1URQ C;  1BCC G;  2N1T D;  2QRX A;  5AW4 B;  1PPJ G;  3BRT B;  5B5E E;  4GOD A;  2QJK B;  4XE5 B;  2IFM A;  3L72 D;  1WT6 A;  1NU1 E;  4H13 C;  2P2U A;  3L74 G;  4Y28 J;  2W6A A;  2LXB A;  3N4X A;  2D2C B;  1SQB D;  3B5N A;  3T97 B;  2WIT A;  2Y0D A;  1CI6 A;  3MD0 A;  2H88 C;  3KHU A;  5BVZ A;  1ZN5 A;  1JY3 O;  1YQ4 C;  1L0L G;  4D6T D;  2RH0 A;  2ZT9 B;  1YBK A;  3BCC G;  1J1D C;  2C0X A;  1OW8 A;  1QL2 A;  3V4Q A;  1BSN A;  5L8R J;  2YXQ B;  4H44 C;  1FC2 C;  1RE3 A;  1L0N D;  2IBZ E;  1CSB A;  1S5L X;  2BEQ D;  3CX5 I;  4U3F G;  4GOE A;  3VYI A;  1NGM B;  2YKQ A;  1IK7 A;  1OVV A;  3PH0 A;  3W67 A;  2AEJ A;  5KAI E;  1YJW P;  1YYC A;  1W2B O;  1JCD A;  5APT A;  1NTM K;  3A2A A;  1SQV G;  1EDL A;  3H1K D;  3TF5 A;  1OX3 A;  1Q81 Q;  1H0T A;  2DW3 A;  2NPS C;  1PP9 D;  3AEB C;  3AEG C;  2ZT9 D;  3K5B A;  1BSH A;  2QIW A;  1HBW A;  2CPS A;  1VQK P;  4H44 B;  1NVO A;  4JQ0 D;  2QA4 P;  3UIA A;  2HOD A;  2K9J B;  2YMY A;  3WU2 E;  2KI7 B;  3M91 A;  4IFF A;  1FZG A;  3WUT A;  4BWN A;  1S9K E;  2IX7 C;  3FX0 A;  4C7N B;  1VQO P;  2BAS A;  3H1H D;  1JB0 J;  2E5Y A;  2ZJS E;  1S3J A;  5CCG D;  1SQV E;  1HUC A;  5DJU B;  3H1J G;  1G2C A;  2BCC G;  3AED C;  2E75 B;  2V7Q J;  4W80 A;  3CX5 D;  3RL0 D;  3TGU G;  1KYO E;  1NTK E;  2WVR A;  3MGN A;  2FYU K;  3USS A;  3JCU E;  4Y99 C;  3FXD A;  2E76 C;  4H0L B;  1YIJ P;  3IF4 A;  1NYH A;  2NPS B;  1HH0 A;  1T3J A;  2JR8 A;  3C9I A;  4XA4 A;  1IFD A;  5APU A;  5AW7 B;  3Q3D A;  1SFC B;  1BGY G;  1VQ4 P;  2V7Q H;  2HLO A;  3PTZ A;  4U3F D;  4H44 D;  1JY2 P;  1URQ D;  2N1T C;  4U3F J;  1Q82 Q;  1YJ9 P;  3RL0 g;  1WRG A;  1M1J C;  3ABV C;  3ITK A;  2WWW A;  1JMB A;  3S9O A;  1RF1 C;  1VQN P;  1EZV I;  3TNU A;  3TYY A;  2UWJ E;  3RK2 D;  1NTZ E;  3F5H A;  3VP8 A;  3P32 A;  4C7R A;  3CCJ P;  3BAS A;  3HE5 A;  4N78 E;  1Q7Y Q;  3CD6 P;  4HH2 A;  3MUD A;  1HGV A;  1NO4 A;  2E75 D;  2FBW C;  1GD2 E;  1NOH A;  2ZFC A;  3M0D C;  3RL0 B;  1JY2 O;  3G6E P;  1E79 H;  1ZOY C;  2A06 E;  2Q9I A;  1FOS E;  1AQT A;  3M9B A;  2ZXE B;  4H0L D;  2M8R A;  2J58 A;  3A5T A;  2NPS D;  4R4L A;  1N2D C;  1FJP A;  1URQ A;  2ZYD A;  1JUN A;  3WUV A;  2OTK E;  1SFC D;  3SFE C;  3Q2Y A;  1IFP A;  1N7S B;  1QL1 A;  2V4H A;  1URQ B;  3VOP A;  2KXP B;  3AE1 C;  1TU3 F;  2W8Z A;  1JY2 N;  2OQQ A;  1RF1 B;  1VQP P;  1OVR A;  5GTI E;  2QSI A;  1NTM J;  1SVF A;  4IFM A;  4XFJ A;  1HWT C;  1SQP E;  3RK2 B;  2FFD A;  1DD4 A;  2K88 A;  3GHG B;  3TK1 A;  1FDI A;  4H13 B;  5KAF E;  1RHZ B;  1IO4 A;  1EZV D;  2D2C C;  3M9Q A;  1NTZ K;  3H1H E;  4CPG A;  3GLM A;  3EQ2 A;  2WT7 B;  4PD4 H;  3B5N D;  2GM4 A;  2HFE D;  2QJK C;  1K73 Q;  3L71 E;  1NTM E;  1S5L H;  4DJG A;  4IOI H;  2WSC H;  2YNY A;  1H0T B;  2W90 A;  1SQP J;  1KMI Z;  5CBO A;  3O6Q B;  2WPS A;  3PJS K;  1N7S C;  4KJM A;  1N7S D;  4GDO A;  1R8E A;  2K3R A;  3H1K G;  1OWA A;  3S4R A;  4RJT A;  3H32 A;  4LGD E;  5BU8 B;  1UIX A;  1Y47 A;  3C1L A;  1NKN A;  2HR3 A;  2MKV A;  1LT9 B;  2QM7 A;  4L73 A;  1NJI Q;  3PLN A;  4EDF A;  1ZW0 A;  3MZW B;  4H13 D;  2YKO A;  3AEA C;  3IN6 A;  1GW3 A;  1OXZ A;  1ZR4 A;  1R5S A;  1PGJ A;  1NAF A;  2BEZ F;  2OYO A;  1G2C B;  1K04 A;  1M7L A;  1NHL A;  1JCC A;  1JY3 N;  3Q5R A;  2P67 A;  3B5N B;  3L70 E;  2OAR A;  2JJL A;  3R4Y A;  5GTH H;  2N1T A;  1L0L D;  1P84 D;  4D6T G;  3GW6 A;  5GTI H;  1PGP A;  2LR2 A;  3AE8 C;  1L0L J;  2J5U A;  2KSE A;  4JBZ A;  4O9B A;  1X8Y A;  5TIS E;  4AQR D;  2PFX A;  3L36 A;  5AW0 B;  2H8P D;  2KLV A;  3H25 A;  2I8D A;  1OW6 A;  1KN7 A;  2QM8 A;  1W2E A;  2KK7 A;  2PP6 A;  2ZYA A;  4C46 A;  5APQ A;  5KLV G;  5CHX A;  2IZ0 A;  1PFI A;  1DD3 A;  1FZA A;  2YO3 A;  4GT1 A;  5GTH E;  4PD4 E;  2Y0C A;  2WZ7 A;  1GK4 A;  2E75 C;  2WSC J;  1USD A;  5AW2 B;  2Y9Z A;  3D70 A;  1DX7 A;  3VN0 A;  1KC8 Q;  2IZ1 A;  1KIL D;  1S1C X;  1YQ3 C;  3P7K A;  2Q5U A;  3A0B E;  4K35 A;  5CCH C;  4KT0 J;  1DEB A;  1KFN A;  4PD4 I;  1HF9 A;  2ZXX A;  1YI2 P;  2W27 A;  2N9Y B;  2IFN A;  2WPR A;  3S1K A;  3OW2 O;  2OYH B;  4EIJ A;  1KV4 A;  2O01 N;  1Z56 A;  3Q5S A;  2Q7C A;  1GW4 A;  1GL2 B;  1T2K C;  2HOD B;  2K9J A;  2R44 A;  3L72 J;  1KQG B;  2IYO A;  2MJZ A;  3H1H J;  1FOS F;  1VQ7 P;  2E74 D;  1RE4 A;  4EOT A;  3H1I J;  1OZH A;  1SLQ A;  5AVZ B;  2FFD B;  1PPJ E;  3SWK A;  1NKZ B;  1SQQ D;  5APY A;  1SQP K;  2FYZ A;  3V2N A;  1QVF O;  1KIL B;  4I7Z C;  1SQQ G;  2AXT H;  3N7N A;  3CCS P;  1E5W A;  1FE6 A;  2G8Y A;  5AW1 B;  1VQ5 P;  4ASW A;  4B86 A;  2YXR B;  2KS1 A;  4PV1 D;  4WBA A;  2IDB A;  3PHL A;  2IBZ I;  3CWB E;  1H8A A;  1FU1 A;  4DZO A;  1LT1 A;  2ZAE B;  1QEX A;  1SQX E;  2KS1 B;  2NRG A;  2XV5 A;  5AW8 B;  1GU4 A;  3VMY A;  2B87 B;  2E5T A;  3G4S P;  1GL2 D;  3P8C D;  3U1C A;  3MHV A;  3CCQ P;  1FZE A;  3G71 P;  1IFI A;  3CCR P;  1FS0 E;  3GHG C;  1ZRT D;  2WSF J;  1X0T A;  3U59 A;  5CMZ A;  2E74 B;  2C9N Y;  4W7Z A;  2Q1K A;  3AEF C;  5AW3 B;  3BCC D;  3CI9 A;  3HE5 B;  4I2L C;  2H7H A;  4IFD K;  1JEK A;  5B66 E;  2P58 A;  1DH3 A;  1KB9 D;  1G1J A;  1BDC A;  1AFO A;  3D6Z A;  1MFZ A;  1SQB J;  3CWB G;  3H1L E;  3L37 A;  2KZJ A;  1PL5 A;  4PV1 B;  5KLV D;  2XDJ A;  4HB1 A;  4U7J A;  1U57 A;  2M5A A;  2R3S A;  4WY4 D;  3M9H A;  1SQP D;  5KJ7 A;  2ZVN B;  3L72 G;  5BU5 A;  3D71 A;  1VQL P;  4TT3 H;  3D6Y A;  2P1J A;  2WMM A;  1Q90 D;  1RF0 A;  4DT0 A;  2KLU A;  2B9B A;  3H1I G;  4UB6 H;  4N3Y B;  1BDD A;  1KFM A;  1LT9 C;  4ZKU A;  2XU6 A;  2WSE H;  2E74 C;  1L0N J;  4GKG A;  1BE3 E;  1T8Z A;  2M0B A;  4L74 A;  3AEE C;  1FDM A;  1JY3 P;  5APS A;  3P8C E;  1RQV A;  3L73 G;  2ITA A;  2JKV A;  2Y9Y A;  5AVV B;  3H1K E;  3H1L G;  2C9L Y;  3KZI H;  5B5E H;  1HTL C;  3TGU E;  2XZR A;  1L4A A;  5APX A;  1L0L E;  1P84 E;  2C0W A;  1RF0 C;  4OWF A;  3L72 E;  1GMJ A;  1NTK G;  3IAO A;  2Q6Q A;  3G9R A;  3HTK B;  5AVX B;  4WY4 B;  3RBX A;  4RES B;  2WTY A;  1NWQ A;  2PAJ A;  3B71 A;  3HTK A;  1OVU A;  3AE2 C; 
#chains in the Genus database with same CATH homology
 3KQG A;  2A45 I;  1M1J A;  5APW A;  5AW9 B;  4DOJ A;  2Z5H A;  1L0L K;  3HUS A;  1N7S A;  2I1J A;  5CCG C;  2OYH C;  4M3L A;  1FZC C;  2VRS A;  2KB7 P;  4JF7 A;  1ZV8 A;  1SQX K;  2O1J A;  2FFD C;  1SP4 A;  3VMX A;  2R5D A;  1ZLL A;  1LTS C;  1GZL A;  5CJ4 A;  3TSI A;  1FZF A;  1GL2 C;  3V2P A;  2OYH A;  5APV A;  3M06 A;  4WB4 A;  1N73 A;  5KLV K;  2W6B A;  1LTJ C;  4KHX A;  2OYI C;  2E43 A;  3IR9 A;  5AVW B;  2FXM A;  5AVY B;  1KIL A;  2H43 A;  2N9B A;  1GDT A;  1CI6 B;  1J2J B;  1HGZ A;  1H89 A;  1T3U A;  2GUV A;  5AVR B;  3VTP C;  1IFN A;  1T2K D;  1N7L A;  5KJ7 C;  2Z5I A;  4JYC A;  1VPC A;  3V4W A;  1L4A B;  1KZU B;  2R32 A;  3RK3 C;  1KQL A;  1JTH A;  1J1D B;  2O01 H;  4LC1 A;  1MUU A;  1LT9 A;  1SQQ K;  3LIE A;  1JTH B;  3LID A;  3MTU E;  1FJK A;  1SQB K;  5KTB A;  2E42 A;  1LWU B;  1X9V A;  1YTZ I;  1NTK K;  3KPE A;  1RE3 C;  1N73 B;  1HVV A;  4N6J A;  2C9N Y;  3OAK A;  1L4A D;  1J1E B;  3NFQ A;  4HYT B;  3HE4 A;  3M0D A;  3RK3 B;  1FAV A;  1CW5 A;  4W7Y A;  3P8M C;  1S9K D;  1LWU C;  3VMZ A;  3SWY A;  1LTJ A;  3V2R A;  5KJ7 D;  1N73 C;  3MIW A;  1FZC A;  2YO2 A;  2A45 G;  1GK6 A;  1FZC B;  1IFJ A;  3B5N C;  3RK3 D;  3L4F A;  3M0A A;  1SFC C;  2XNX A;  4LLH A;  3BRV B;  2WSF H;  1L0N K;  3T97 A;  5CCH A;  2R3C A;  1RY3 A;  2OYI B;  1JMM A;  4I6M C;  1XTC C;  3R2P A;  3E1I A;  3LW5 H;  1VDF A;  1LTJ B;  1RE4 C;  3CL3 D;  2YKP A;  5CJ0 A;  3KDP B;  3HRN A;  3BVH A;  1X79 B;  2L5G B;  1L4A C;  1LTA C;  3TNU B;  1KIL C;  5AW5 B;  2POH A;  3SWF A;  4AUW A;  1IC2 A;  4JYB A;  2I1K A;  1HJB A;  2LKM A;  5AW6 B;  3V5B A;  2J59 M;  3G3Z A;  3H6P A;  3HUS C;  2O1K A;  4ZKP A;  1N86 A;  1EQ7 A;  2OYI A;  1IK9 A;  4AYC A;  1LTI C;  2HYN A;  3B8E B;  4WY4 A;  2JEE A;  2CPB A;  2GUS A;  1LGH B;  2R5B A;  3II6 A;  3L35 A;  3WMM 0;  5AVU B;  1CZQ A;  1GTW A;  1J1E C;  2M3B A;  4OH8 B;  3HUS B;  4AQR D;  1MV8 A;  2HG5 D;  3NTN A;  1A02 J;  4I1L A;  3IFM A;  2HPC A;  1DH3 A;  1JOC A;  2KOG A;  5AVQ B;  1GU4 A;  1H88 A;  2Q3I A;  3HD7 D;  3HD7 C;  4C7N A;  1FBM A;  4WY4 C;  2FKW B;  1LTB C;  2WPQ A;  1AQ5 A;  1JO5 A;  1LTG C;  2KP8 A;  1SQV K;  1MZ9 A;  5AVT B;  2WT7 A;  4N78 D;  3BAT A;  3EFG A;  2NPS A;  3OA7 A;  1A02 F;  1ZR2 A;  1SFC A;  3CLQ A;  2P7J A;  3O8Z A;  3OJA B;  4Y99 B;  3HD7 A;  5CCG A;  5AVS B;  5CCH D;  3NXS A;  1XTG B;  3HD7 B;  1LWU A;  3VP9 A;  3KYQ A;  1LTT C;  1M1J B;  2KSJ A;  1IJD B;  3U1A A;  2KYV A;  3V2Q A;  2N1T B;  3HE4 B;  1GL2 A;  2IPP A;  4GIF A;  3PP5 A;  2XKM A;  3GHG A;  1NU1 K;  1YTZ T;  2Z4E A;  1NH4 A;  1RF1 A;  3RL0 C;  3I5C A;  3A7O A;  2A45 H;  3RK2 C;  1G1I A;  3A3Y B;  1FZB A;  3H32 B;  1GU5 A;  1IFM A;  3NMD A;  1URQ C;  2N1T D;  5AW4 B;  3BRT B;  4XE5 B;  2IFM A;  1WT6 A;  2P2U A;  2W6A A;  3B5N A;  2WIT A;  1CI6 A;  3MD0 A;  5BVZ A;  1ZN5 A;  1JY3 O;  1J1D C;  2C0X A;  1QL2 A;  3V4Q A;  1RE3 A;  1CSB A;  3VYI A;  2YKQ A;  1YYC A;  1JCD A;  5APT A;  1NTM K;  3A2A A;  2NPS C;  1HBW A;  2CPS A;  3UIA A;  2HOD A;  2YMY A;  3M91 A;  4IFF A;  1FZG A;  1S9K E;  2IX7 C;  4C7N B;  2BAS A;  5CCG D;  2HPC B;  1HUC A;  1G2C A;  4W80 A;  3RL0 D;  3MGN A;  2FYU K;  4Y99 C;  2NPS B;  4XA4 A;  1HH0 A;  1T3J A;  3C9I A;  5APU A;  1IFD A;  5AW7 B;  1SFC B;  2HLO A;  1JY2 P;  1URQ D;  2N1T C;  1WRG A;  1M1J C;  2WWW A;  1RF1 C;  3TNU A;  3TYY A;  3RK2 D;  3VP8 A;  4C7R A;  3P32 A;  3BAS A;  3HE5 A;  4N78 E;  4HH2 A;  3MUD A;  1HGV A;  1NO4 A;  1GD2 E;  1NOH A;  2ZFC A;  3M0D C;  3RL0 B;  1JY2 O;  1FOS E;  2Q9I A;  3M9B A;  2ZXE B;  2M8R A;  2J58 A;  3A5T A;  2NPS D;  1FJP A;  1N2D C;  1URQ A;  1JUN A;  1SFC D;  1N7S B;  1QL1 A;  1URQ B;  3VOP A;  1RF1 B;  1JY2 N;  1SVF A;  4IFM A;  1HWT C;  2FFD A;  3RK2 B;  3TK1 A;  3GHG B;  1IO4 A;  3M9Q A;  1NTZ K;  3EQ2 A;  2WT7 B;  2GM4 A;  3B5N D;  2HFE D;  2WSC H;  2YNY A;  2WPS A;  1N7S C;  1N7S D;  1OWA A;  3H32 A;  4LGD E;  5BU8 B;  1NKN A;  2QM7 A;  1LT9 B;  2YKO A;  1GW3 A;  1OXZ A;  1ZR4 A;  1NAF A;  1G2C B;  1NHL A;  1M7L A;  1JCC A;  1JY3 N;  2P67 A;  3B5N B;  2OAR A;  2JJL A;  2N1T A;  2C9L Y;  4O9B A;  1X8Y A;  3L36 A;  5AW0 B;  2H8P D;  2KLV A;  2QM8 A;  1W2E A;  2PP6 A;  4C46 A;  5APQ A;  5CHX A;  1FZA A;  2YO3 A;  4GT1 A;  2WZ7 A;  1GK4 A;  5AW2 B;  1DX7 A;  3VN0 A;  1KIL D;  3P7K A;  2Q5U A;  5CCH C;  1DEB A;  1KFN A;  2W27 A;  2IFN A;  2WPR A;  2OYH B;  4EIJ A;  1Z56 A;  2Q7C A;  1GW4 A;  1GL2 B;  1T2K C;  2HOD B;  2MJZ A;  1FOS F;  1RE4 A;  4EOT A;  2FFD B;  1SLQ A;  5AVZ B;  1NKZ B;  5APY A;  1SQP K;  2FYZ A;  3V2N A;  1KIL B;  3N7N A;  1E5W A;  5AW1 B;  4B86 A;  4WBA A;  1H8A A;  1FU1 A;  4DZO A;  5AW8 B;  2XV5 A;  3VMY A;  1JNM A;  1GL2 D;  3P8C D;  3U1C A;  1FZE A;  1IFI A;  3GHG C;  3U59 A;  5CMZ A;  4W7Z A;  5AW3 B;  3CI9 A;  3HE5 B;  4I2L C;  2H7H A;  4IFD K;  1G1J A;  1AFO A;  1MFZ A;  3L37 A;  1PFI A;  2XDJ A;  4WY4 D;  3M9H A;  5KJ7 A;  5BU5 A;  2P1J A;  1RF0 A;  4ZKU A;  4N3Y B;  1KFM A;  1LT9 C;  2XU6 A;  2WSE H;  4GKG A;  1T8Z A;  1FDM A;  1JY3 P;  5APS A;  3P8C E;  5AVV B;  1HTL C;  2XZR A;  1L4A A;  5APX A;  2C0W A;  1RF0 C;  5AVX B;  2WTY A;  3HTK B;  4WY4 B;  4RES B;  1NWQ A;  2PAJ A;  3HTK A;  3N4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...