4WY4D

Crystal structure of autophagic snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
64
Chain Sequence
b'HLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKVRQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 32
structure length 64
sequence length 65
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4D00
3M0DC 1SFCB 5CCGA 3RK2C 1N7SB 2HFED 4W7ZA 4WY4C 1L4AD 2HG5D 2YMYA 3B5ND 3RK3D 1SFCD 5CCGC 1N7SD 3RL0C 5CCHA 1URQB 2PP6A 1KILB 3KYQA 5CCHC 1URQD 4W80A 2NPSA 1KILD 5KJ7A 3HTKB 3HD7B 2NPSC 1JTHA 5KJ7C 2N1TB 3HD7D 1SFCC 2H8PD 2M8RA 1GL2B 1N7SC 1NHLA 2N1TD 2XDJA 3RK2B 4WY4B 3P8CE 1GL2D 3VOPA 3RK2D 1URQC 3RL0B 4WY4D 1L4AA 5CCGD 3B5NA 1SFCA 3RL0D 3TSIA 1N7SA 1L4AC 4W7YA 4JF7A 3B5NC 1XTGB 3RK3C 4OH8B 5CCHD 3PP5A 2NPSB 1URQA 1KILA 4N78E 2WZ7A 1T3JA 1JTHB 2NPSD 5KJ7D 1KILC 3HD7A 2N1TA 3HD7C 2N1TC 1GL2A 4LGDE 1HVVA 4WY4A 1L4AB 2KOGA 1GL2C 3B5NB 3RK3B
chains in the Genus database with same CATH superfamily
1H89A 1CI6A 4GOFA 5AW7B 1K04A 2A06D 1P84H 3V2NA 2IBZE 3GHGA 3H1LG 1IJDB 1WRGA 1RE4A 1OFCX 3ZDMA 1IFIA 4ZMDA 1DX7A 2P10A 2QJPB 1NWQA 3H1KJ 2Y9ZA 2E76D 1H88A 3L70D 2ZAEB 3CX5E 3HD7D 3FXEA 1IFPA 1SQQD 1N7SC 1U7JA 1MFZA 1Y47A 1YTZT 2JWAA 1GL2D 5KLVJ 2Y0EA 2IBZG 3RK2D 1EDLA 1KILE 1SQVK 2UWJE 1K8AQ 2WPVB 2E74B 2QJYC 3GMAA 2FYUE 1L4AC 4PV1B 1WMKA 1JEKA 3FXDA 5AW9B 2ZYGA 5AVRB 2OGUA 1NTME 3R2PA 2BASA 1Z56A 3U59A 1T6AA 2E75B 2KI7B 2WPQA 2DW3A 3SSUA 1BGYE 1HH0A 1YJWP 3JSVC 5KJ7D 3M91A 1BE3E 3WU2H 1KQGB 5AVSB 2IYOA 4IL6H 2P7JA 3V6IA 3H1ID 1X9VA 1DIPA 3O6QB 5E79H 2D2CC 1L0LK 1SFCB 4PD4D 1OMIA 4Y99B 4W7ZA 1NTMG 1NJIQ 2IYPA 4U3FD 2JWDA 1S9KD 3V2RA 1YBKA 3KYQA 1GD2E 1EC5A 1EDKA 1BE3G 1U7MA 1GU4A 1PV3A 1N73A 1PIXA 3V4QA 2HR3A 3L36A 1NKNA 4WVZA 1SQBE 2N1TD 1M8OB 2R32A 2O1KA 3D71A 4WY4B 1IZNB 3OW2O 1KTMA 3II6A 2W83C 1SQQK 2CK3H 1JOCA 1L0ND 1SQPK 3B5NA 2WSCH 4IL6X 2YKOA 1JY3O 2HPCB 1ZW0A 1BCCJ 3PHLA 2G3AA 2Q5UA 1MKMA 3CL3D 3KDPB 5KAFE 1HBWA 2BCCD 1OW8A 1GDTA 2GM4A 3CWBG 2RKLA 2YIUB 1KFMA 2QJKB 3TNUA 1KYOD 1LT9A 2ZT9B 1VQMP 3LW5H 1W5CE 1SQXK 1HVVA 2YXQB 3CCRP 3KXDA 3CCLP 5CCGA 1GMJA 3BRTB 5BU5A 2YMYA 3RK3D 5AVTB 3AEEC 3L35A 1M1KQ 1T8ZA 4LC1A 2FFDA 1AQ5A 4JBZA 5CCHC 5AVZB 3AEBC 1QLED 1G1IA 1MUUA 1JCDA 3PJSK 3V4WA 2NPSC 1S72P 1D7MA 3B4SA 1J1EB 3A2AA 2WSCJ 1LTBC 4HKZH 2KYVA 1NU1D 2XDJA 1NTZK 3KPEA 3L73E 3WMM0 1VQ6P 1VPCA 1H8AA 3H32A 1ZMEC 4K35A 1N2DC 3SWYA 1N7SA 2O01N 1FDOA 1RF1B 4OH8B 4N6JA 1PP9G 1IFMA 3PP5A 3LIDA 5TISE 2OYHC 1FZCC 1Y9BA 2FYUK 1LTIC 1AQTA 1EQ7A 3LW5J 1PPJD 2E42A 2BEQD 1KILC 1IK7A 3H1KE 3G4SP 4ASVA 1J1DC 4U3FJ 4OGQB 1KQFB 4JQ0D 4XA4A 5AW5B 2OARA 1LT1A 4UB8E 5KLVE 4R4LA 2WPSA 3L74D 1LTJC 4K3AA 2KLUA 4XE5B 1JCCA 3CCMP 3BVHA 1FC2C 2YO3A 3FGAD 3L75D 4NPEA 1S5LH 1YJNP 2W6JH 3IR9A 1RE4C 3N7NA 4I6MC 3H1KG 2IZ0A 3H1JD 1OVVA 1L0NJ 2KSEA 3H25A 1K9MQ 1VF5D 2B9BA 2B88A 1ZV8A 2W27A 5KLVG 4U7JA 3TGUD 3QWOC 1P84E 2A45I 3G9RA 1KFNA 4AYCA 4H13C 4JYBA 1M1JA 3P8MC 1FZBA 4NPDA 2LXBA 1SQBK 5GTIH 1GW3A 4YPCA 2AXTH 1NU1K 1NTKJ 3A0HH 3MTUE 2GUVA 2QSIA 3CPWO 2ITAA 3H1HJ 1S1CX 1AV1A 4XFJA 2Q3IA 3F89A 1ZXGA 3V2QA 1ZR4A 5APXA 3HUSA 2BEZF 1CSBA 1BSHA 3HD7A 2QM7A 1UIXA 4RESB 4OVNF 1KB9I 4C7NA 1FOSE 1GL2A 3WUUA 4IOIH 4LGDE 2C9NY 1Q82Q 3TDKA 1HUCA 4BRYB 1LWUA 1SQVG 2H88C 3HE5A 2HG5D 2WMMA 3P32A 5APSA 5AW2B 3CXHE 1YHQP 1URQB 1BCCE 1LTAC 3WU2E 2R3CA 2WTYA 1K73Q 2CPBA 5KJ7A 2AXCA 1VQ9P 2A06E 5E79E 4OWFA 3S1KA 1G1JA 2OYOA 2XNXA 2QVAA 1PGJA 1N73C 3M06A 3L72E 4NPFX 2LKMA 3S9OA 1OW6A 1M90Q 4DZOA 2CPSA 3TK1A 3RL0B 1VF5B 1L0LG 3L70E 4KJMA 1TU3F 3B5NC 2E74D 3ABVC 1SQQE 1VDFA 4PV1D 3CC2P 2A45H 3E1IA 2A06G 1SVFA 3L74J 1S3JA 1OX3A 3Q3DA 2E75D 2OQQA 3L72G 3ITKA 5AW1B 3T97A 4LLHA 2B87A 2N1TA 4A7PA 3L75J 2KNCA 3RBXA 2JDIH 4EI2A 3PLNA 5GTHE 1LT9C 2QG4A 3L70G 1A02J 2KOGA 1PGOA 1AFOA 3H1JJ 2KSJA 2OYIB 1SQQG 1CZQA 1SQPG 4I7ZC 1SFCD 5CCGC 5KLVK 3HE4B 3TGUJ 1VQ4P 3BCCJ 4R4MA 1QX8A 2PP6A 2M3BA 2V7QJ 2Q6QA 3A3YB 3H1IE 1KB9H 2FFDC 5TJHA 4TT3H 3FWNA 5AVVB 1IO4A 4PD4E 2I1JA 1R8EA 1JTHA 1GTWA 3VMXA 3S4RA 1RHZB 1X22A 2Y0CA 1T3UA 4DOJA 1J2JB 4ZNCA 4U3FE 2KZIA 1KZUB 1S9KE 2FBWC 5EFWB 2LR2A 1HWTC 3L71J 2WT7B 1SQXG 2K9JB 4WY4D 1JY2O 1Q90D 2R44A 1EZVG 2P1JA 1NTZE 4WWIA 2AEJA 3H1IG 4L74A 2C9LY 1ZRTD 3GF7A 1DEEG 1IK9A 3G6EP 2J58A 1YITP 3E1RA 1DH3A 2B89A 3FWLA 3U1AA 1L0NE 3O8ZA 2R5DA 1ZLLA 2ZVNB 1USEA 3GLMA 2QJYB 3Q5PA 2ZT9D 1L4AB 1NTZG 2BCCE 3E7KA 3C9IA 1JNMA 3CCJP 1KYOE 3MUDA 5AW8B 3H1LD 1FJKA 2IBZI 3Q5RA 1OVRA 3SFDC 2FYUG 1R5LA 1RF0C 1FE6A 2AEMA 2POHA 3RK3E 4EYYQ 1L2PA 1SFCC 2W8ZA 2D2CB 4Y99C 2Y9YA 1HTLC 2BCCG 1VQLP 5AVXB 1BGYG 5B66H 3CX5I 4AUWA 3AEGC 1M1JC 1Q7YQ 2KS1B 3BATA 3A5TA 4IFFA 3C1LA 2IZ1A 4KT0J 1VQ5P 1NU1E 2FYNC 2Z5HA 3MIWA 4UB6E 2M0BA 5H2FE 2I8DA 2E76C 1QGKB 1U57A 3HUSC 5GTIE 4ZKUA 3HD7C 4Y28J 1HJBA 3A0HE 3M0DA 4OGQD 2P2UA 1KC8Q 4KHXA 1GL2C 3RGUA 4GOEA 1PPJE 3RK2C 2HODB 4O9BA 1SQBG 5CJ0A 1NTKD 1LWUC 1NU1G 1VQ7P 4YXWH 1AVYA 2OTKE 2YIUC 4L76A 1S2EA 1OXZA 2GUSA 3H1HD 3PH0A 1NTMD 1RQUA 4PJ0E 3A0BE 1R5SA 3FX0A 3L74E 1LP1A 1AJYA 3HTKB 1VQPP 1JO5A 4N3YB 5KJ7C 3OAKA 1LTSC 1SLQA 4HYTB 3L75E 1K05A 1NH4A 1LNQA 1PPJG 5CBNA 3H1JE 3I55P 1LTGC 3TGUE 3PRJA 1KV4A 3CCUP 2NPSB 3IFMA 5KTBA 5APTA 1HJ0A 4DCKA 5CBOA 3CX5H 3B8EB 1E79H 2E43A 4IFMA 4WB4A 2YNYA 3MZWB 3NMDA 4GIFA 3CWBD 3WUTA 3GG2A 3SWFA 1ZR2A 3H1LJ 2JEEA 1G2CB 1L0NK 1RY3A 2N1TC 3H1JG 3IN6A 2WPRA 5BVZA 2C0XA 4H44B 2FYZA 3KZIE 1M56D 1BSNA 3TGUG 2WSFH 4DT0A 2OYHB 1FZCB 3V5BA 2FXOA 5B5EH 2O1JA 1OIPA 3L73G 1KILB 3VN0A 3Q5SA 1NTKK 1URQD 5AVYB 1J1DB 2R3SA 1VQNP 3BRVB 4Z1MH 1FZGA 2M8RA 1LTJB 2ZXXA 3VMYA 4YTPC 1JY3P 3HRNA 2QRXA 4HB1A 2KB7P 1SP4A 1CI6B 1VQ8P 1RF0A 3JCUH 5KAIH 3GHGB 3F5HA 3O6QA 2K3RA 1SFCA 3RL0D 3G71P 4W7YA 4JF7A 2KZJA 3RK3C 2XNDH 1JY3N 3BCCD 5AW6B 4L73A 5KLIC 1AVOA 1PP9D 2Z4EA 1VQOP 1GU5A 5KKZC 3SFEC 3KQGA 4EDFA 3Q1MA 4H13B 2OTLP 1FJPA 1NTMJ 2FKWB 1BDCA 1RQVA 4D6TD 3L71D 4H0LB 4WY4A 1FU1A 2PAJA 1BE3J 2JKVA 3AE9C 3NXSA 5KAFH 2JO1A 4GDOA 3VTPC 3GW6A 2HPCA 3MUDC 2C0WA 1M57D 2ZYDA 1FZAA 1LJ2A 1USDA 3TF5A 1ZN5A 1FOSF 2ZXEB 4I1LA 2SPZA 2H43A 4N78D 4IL6E 1URQC 2M3EA 1P84I 2R5BA 1KB9D 3OJAB 2WITA 3CWBJ 3VMAA 4IFDK 2IX7C 2ZFCA 5L8RJ 1EDJA 3AEAC 2G8YA 1EDIA 1JMMA 3M9HA 2ZVOB 1BCCG 1VF5C 4L75A 1ZRTE 1DD4A 2XU6A 3B5NB 3M0DC 1ZOYC 3N4XA 1L4AD 1Y8AA 3RL0g 2WVRA 1SQVD 2KK7A 1CW5A 1NVOA 1YJ9P 2W6BA 3P8CD 1RF1A 2H7HA 3CXHI 1RE3A 1GK4A 2QIWA 3TNUB 4RJTA 1LT9B 3C8VA 3D6ZA 3H1LE 2KIKA 3GF3A 1EXIA 2D2CD 4I7ZB 3MGNA 1PP9J 1WT6A 2W90A 2RN0A 3WUVA 5CHXA 1L0LD 2FFDB 1PFIA 4DJGA 4TLFA 3PTZA 2I1KA 4D6TJ 2IDBA 1JM0A 2HYNA 1FDMA 2QJPC 3L72D 1YIJP 1RH5B 2PFXA 3H32B 1YTZI 4MN4C 3M0AA 1N7SB 3AEFC 1KORA 2M5AB 4U3FG 3TYYA 4RKUJ 3VMZA 1M7LA 1SQPD 2E74C 1LGHB 1HGZA 1OVUA 4PV1C 2JR8A 1KN7A 5AW0B 1EZVI 1YYCA 1IFNA 3CI9A 1H0TB 1NTKE 2E75C 1QEXA 4PD4I 3H1HE 3W68A 2WWWA 1L0NG 3LIEA 3VOPA 5B5EE 3CCQP 1HGVA 4EIJA 3SWKA 1NGMB 3D70A 3CXHH 5K5GB 3I56P 1SQXD 1MZ9A 4BRYA 5AVUB 1XTGB 2AEFA 1EZVD 1DEBA 2ZYAA 5CCHD 1GZLA 3USSA 2WQYC 3KHUA 1URQA 1Q86Q 2WZ7A 1NTKG 1T2KD 2NPSD 3JC22 1S5LE 3M9BA 4M3LA 3CCVP 4QMAA 2WSEH 3CLQA 2IBZD 4YXDC 1N8RQ 3H1HG 3JCUE 5KAIE 1SQVJ 1X0TA 3L4FA 1M1JB 2Y0DA 2V4HA 3CMAP 1JB0J 2PGDA 4B86A 1JUNA 3MP7B 3L37A 4H44D 2NZ2A 4WY4C 1NTZD 3CX5D 3CWBE 1HF9A 2FYNB 1FZFA 5APVA 2AXTE 1FZEA 1E5WA 2E76B 1KYOI 1KILD 3HUSB 1S4XA 3HD7B 5CJ4A 2FYUD 1JY2P 3CMEP 1L0LJ 3VP8A 5GTHH 4C7NB 2QM8A 1GL2B 2N9YB 3RK2B 1QL1A 1QVFO 2QJKC 4C7RA 3AEDC 1LWUB 2IPPA 3H6PA 3OA7A 1FDIA 3HE5B 2OTJP 1BGYD 2NRGA 2ZT9C 5APUA 1JY2N 3AE5C 1BE3D 2LXCB 3MHVA 3TSIA 2OYIA 3B71A 1ZP0C 3P7KA 2WSEJ 1SS1A 1IFDA 3L72J 1OW7A 3HE4A 4PD4H 1T3JA 1FBMA 3AE2C 2K1AA 1AA0A 3L70J 4HJGH 3G3ZA 1XTCC 1SQQJ 4H13D 1SQPJ 2W6AA 3L74G 3BCCE 1A02F 1PL5A 2K88A 3AE4C 1J1EC 1PP9E 1UIIA 2WT7A 2QEXP 1T2KC 4H0LD 2K9JA 3L75G 4RO0A 3NFQA 1YQ3C 1IFJA 2MKVA 1SQBD 2K37A 4ZKPA 2L5GB 4D6TE 3MD0A 2Z5IA 3L71E 1RF1C 5CMZA 2O01H 4H44C 4EOTA 1SQXJ 3T97B 2B87B 2N1TB 3BCCG 1RE3C 2KNCB 2M5AA 3CCEP 2H8PD 1NHLA 2O3JA 3AE6C 5AW3B 1IC2A 3VYIA 3H1IJ 3AE1C 3EQ2A 1EXJA 2RMZA 1W2EA 4OGQC 1KYOH 1L4AA 2E5YA 1NTMK 1YQ4C 1PGQA 3Q2YA 1H0TA 4D6TG 1OWAA 3L71G 1Q2NA 1NYHA 2A45G 2YKPA 4N78E 1JTHB 2L91A 2K9YA 2IFMA 1KB9E 1NTZJ 3AE8C 3A7OA 3GHGC 1GW4A 3NTNA 2JP3A 1GK6A 3U1CA 1JMBA 5BU8B 2QE7H 1YI2P 2KXPB 3RK3B 2YO2A 1PGPA 2HFED 2N9BA 3EWKA 2KS1A 3B5ND 2GA1A 2FYUJ 4ASWA 1FAVA 5KLIB 2O01J 2WSFJ 5KKZB 4UB6H 1NKZB 1N86A 5H2FH 3L73D 4BXLA 2BCCJ 3IF4A 1BGYJ 1Q81Q 2YKQA 4JPZB 4I2LC 4H0LC 4HH2A 1VL2A 5APYA 1X8YA 1SQVE 3V2PA 1QL2A 4AQRD 2Q9IA 3P8CE 5AW4B 1X79B 1KMIZ 3D6YA 1KQLA 3AECC 2RH0A 2ZJSE 3H1KD 2KLVA 5CCGD 1S5LX 5C39A 3CC7P 4GT1A 2HODA 4PJ0H 3M9QA 3A0BH 1DD3A 3UIAA 3QH9A 1N7LA 2H89C 2IFNA 5DJUB 3CCSP 5KLVD 2Q7CA 4BWNA 3AE7C 3CC4P 2XKMA 5M1BA 4JYCA 1FS0E 3HTKA 3CD6P 1L0LE 2XZRA 3R4YA 1SQBJ 3K5BA 1NU1J 1MV8A 1NOHA 2MJZA 1MFTA 1PZQA 5AVQB 1N73B 5B66E 2KP8A 2V7QH 2QA4P 1N7SD 3RL0C 1QVGO 1P84D 5CCHA 2JJLA 1VQKP 2FXPA 2E5TA 3AE3C 1NAFA 3EFFK 4W80A 2NPSA 2VRSA 1OZHA 4WBAA 5DJTB 3W67A 2J59M 3RBZA 4C46A 1KD1Q 5TISH 2J5UA 1W2BO 2FY8A 1SQPE 3KZIH 2WSSH 1G2CA 2KUBA 2Q3EA 2P67A 5AVWB 5APQA 2P58A 5APWA 1NO4A 4UB8H 1KQSO 2OYIC 2OYHA 1FZCA 4CPGA 4GODA 1LP1B 2YMKA 4GKGA 3IAOA 1KILA 1BDDA 2HLOA 3I5CA 1SQXE 2XV5A 3CXHD 1NAYA 2PRRA 3BASA 1EZVE 1BCCD 1LTTC 3EFGA 2YXRB 2FXMA 1LTJA 3L73J 3VP9A 2Q1KA
chains in the Genus database with same CATH topology
1H89A 3L37A 1CI6A 1HUCA 1LWUA 5AW7B 3HE5A 4WY4C 2WSFH 3V2NA 2HG5D 3GHGA 1IJDB 3P32A 2OYHB 1FZCB 1WRGA 5APSA 3V5BA 5AW2B 1RE4A 1FZFA 2O1JA 5APVA 1URQB 1LTAC 1FZEA 1KILB 3VN0A 1IFIA 1E5WA 2R3CA 1NTKK 1URQD 2WTYA 1KILD 3HUSB 1DX7A 2CPBA 5AVYB 5KJ7A 1J1DB 1NWQA 3HD7B 5CJ4A 1H88A 3BRVB 1JY2P 1G1JA 3VP8A 3HD7D 2XNXA 1FZGA 4C7NB 2QM8A 2M8RA 1N73C 1GL2B 1N7SC 3M06A 1LTJB 3VMYA 2LKMA 1MFZA 3RK2B 1YTZT 1JY3P 3HRNA 1QL1A 1GL2D 4DZOA 2KB7P 2CPSA 1SP4A 1CI6B 4C7RA 1LWUB 3TK1A 2IPPA 3H6PA 3OA7A 3RK2D 3HE5B 3RL0B 1RF0A 1SQVK 3GHGB 5APUA 1JY2N 1SFCA 2OYIA 3RL0D 3TSIA 1L4AC 4W7YA 4JF7A 3B5NC 3P7KA 3RK3C 1IFDA 1JY3N 5AW9B 5AVRB 1VDFA 3HE4A 2A45H 5AW6B 3R2PA 2BASA 1Z56A 3E1IA 3U59A 1SVFA 2WPQA 1T3JA 2Z4EA 1HH0A 1GU5A 5KJ7D 3KQGA 1FBMA 3G3ZA 3M91A 5AW1B 1XTCC 3T97A 4LLHA 5AVSB 2N1TA 2P7JA 1FJPA 2W6AA 1A02F 2FKWB 1X9VA 1J1EC 1LT9C 1A02J 4WY4A 2KOGA 1L0LK 1AFOA 1FU1A 1SFCB 2OYIB 2KSJA 2WT7A 1T2KC 4Y99B 2PAJA 4W7ZA 1CZQA 1SFCD 5CCGC 3NFQA 5KLVK 1IFJA 3HE4B 3NXSA 1S9KD 3V2RA 3VTPC 2PP6A 4ZKPA 2HPCA 2M3BA 3KYQA 2L5GB 3A3YB 2C0WA 1GD2E 2FFDC 3MD0A 2Z5IA 1FZAA 5AVVB 1RF1C 1IO4A 5CMZA 2I1JA 1GU4A 2O01H 4EOTA 1JTHA 1GTWA 3VMXA 2N1TB 1N73A 1ZN5A 1RE3C 3V4QA 3L36A 1FOSF 1T3UA 2ZXEB 1NKNA 4DOJA 1J2JB 4I1LA 2H8PD 1NHLA 2N1TD 5AW3B 1KZUB 1S9KE 1IC2A 2R32A 3VYIA 2O1KA 4WY4B 2H43A 3EQ2A 1HWTC 2WT7B 1W2EA 4N78D 3II6A 1URQC 4WY4D 1SQQK 2R5BA 1JY2O 1JOCA 1SQPK 1L4AA 3B5NA 2WSCH 1NTMK 3OJAB 2P1JA 2WITA 2YKOA 1JY3O 1OWAA 2HPCB 2C9LY 4IFDK 1IK9A 2IX7C 2J58A 2A45G 2ZFCA 2Q5UA 2YKPA 3CL3D 3KDPB 1DH3A 1HBWA 4N78E 1JTHB 1GDTA 3U1AA 2GM4A 1JMMA 3O8ZA 1KFMA 2IFMA 2R5DA 3M9HA 1ZLLA 3A7OA 3GHGC 1GW4A 3TNUA 3NTNA 1GK6A 1LT9A 3U1CA 5BU8B 3LW5H 1SQXK 1HVVA 1L4AB 2XU6A 3B5NB 3RK3B 2YO2A 3M0DC 3N4XA 5CCGA 2HFED 2N9BA 1L4AD 3BRTB 2YMYA 5BU5A 3B5ND 3RK3D 3C9IA 5AVTB 3L35A 1JNMA 1T8ZA 1FAVA 4LC1A 3MUDA 5AW8B 1FJKA 2FFDA 1CW5A 1AQ5A 2W6BA 1NKZB 3P8CD 1N86A 1RF1A 5CCHC 5AVZB 1G1IA 1MUUA 1JCDA 2H7HA 1RE3A 1GK4A 3V4WA 1RF0C 2NPSC 2YKQA 3TNUB 4I2LC 2POHA 4HH2A 1J1EB 3A2AA 1LT9B 5APYA 1SFCC 1X8YA 4Y99C 3V2PA 1HTLC 1QL2A 4AQRD 1LTBC 5AVXB 2Q9IA 2KYVA 2XDJA 3P8CE 5AW4B 4AUWA 1NTZK 3KPEA 3WMM0 3MGNA 1X79B 1M1JC 1VPCA 1WT6A 1H8AA 1KQLA 3H32A 2KLVA 5CCGD 3BATA 3A5TA 1N2DC 3SWYA 5CHXA 4IFFA 1N7SA 4GT1A 2FFDB 2HODA 1PFIA 3M9QA 3UIAA 1RF1B 4OH8B 4N6JA 1N7LA 1IFMA 2IFNA 3PP5A 2I1KA 3LIDA 2OYHC 1FZCC 2Q7CA 2FYUK 1LTIC 2Z5HA 3MIWA 1EQ7A 2XKMA 2E42A 4JYCA 1KILC 2HYNA 3HTKA 1FDMA 2XZRA 3HUSC 1J1DC 4ZKUA 3HD7C 4XA4A 1MV8A 1HJBA 5AW5B 2OARA 3M0DA 1NOHA 3H32B 2WPSA 2MJZA 2P2UA 4KHXA 1GL2C 1YTZI 5AVQB 1LTJC 3M0AA 4XE5B 3RK2C 1N73B 1JCCA 1N7SB 2HODB 4O9BA 5CJ0A 3BVHA 2KP8A 1LWUC 3TYYA 1N7SD 3RL0C 3VMZA 2YO3A 1M7LA 5CCHA 1OXZA 2JJLA 2GUSA 3IR9A 1LGHB 1RE4C 3N7NA 1HGZA 4I6MC 1NAFA 4W80A 2NPSA 2VRSA 4WBAA 5AW0B 3HTKB 1YYCA 1IFNA 1JO5A 2J59M 4N3YB 5KJ7C 3CI9A 3OAKA 1LTSC 4C46A 1SLQA 4HYTB 1ZV8A 2W27A 2A45I 1NH4A 1KFNA 4AYCA 4JYBA 1M1JA 2WWWA 3LIEA 1G2CA 3VOPA 3P8MC 1FZBA 1HGVA 4EIJA 2P67A 1SQBK 1GW3A 5AVWB 5APQA 1NU1K 1MZ9A 3MTUE 5APWA 5AVUB 1NO4A 2GUVA 1XTGB 2OYIC 1LTGC 2OYHA 1FZCA 1DEBA 5CCHD 1GZLA 2NPSB 1URQA 3IFMA 4GKGA 5KTBA 5APTA 1KILA 2WZ7A 2Q3IA 2NPSD 3M9BA 4M3LA 1T2KD 2HLOA 3V2QA 3I5CA 3B8EB 1ZR4A 2WSEH 5APXA 4IFMA 4WB4A 2E43A 3HUSA 3CLQA 1CSBA 2YNYA 4GIFA 3HD7A 3NMDA 2XV5A 3SWFA 2QM7A 3L4FA 1M1JB 4RESB 3BASA 1ZR2A 2JEEA 1LTTC 1G2CB 1L0NK 1RY3A 3EFGA 4C7NA 2N1TC 2FXMA 1FOSE 1GL2A 2WPRA 2C0XA 5BVZA 1LTJA 4LGDE 2FYZA 3VP9A 4B86A 2C9NY 1JUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0D C;  1SFC B;  5CCG A;  3RK2 C;  1N7S B;  2HFE D;  4W7Z A;  4WY4 C;  1L4A D;  2HG5 D;  2YMY A;  3B5N D;  3RK3 D;  1SFC D;  5CCG C;  1N7S D;  3RL0 C;  5CCH A;  1URQ B;  2PP6 A;  1KIL B;  3KYQ A;  5CCH C;  1URQ D;  4W80 A;  2NPS A;  1KIL D;  5KJ7 A;  3HTK B;  3HD7 B;  2NPS C;  1JTH A;  5KJ7 C;  2N1T B;  3HD7 D;  1SFC C;  2H8P D;  2M8R A;  1GL2 B;  1N7S C;  1NHL A;  2N1T D;  2XDJ A;  3RK2 B;  4WY4 B;  3P8C E;  1GL2 D;  3VOP A;  3RK2 D;  1URQ C;  3RL0 B;  4WY4 D;  1L4A A;  5CCG D;  3B5N A;  1SFC A;  3RL0 D;  3TSI A;  1N7S A;  1L4A C;  4W7Y A;  4JF7 A;  3B5N C;  1XTG B;  3RK3 C;  4OH8 B;  5CCH D;  3PP5 A;  2NPS B;  1URQ A;  1KIL A;  4N78 E;  2WZ7 A;  1T3J A;  1JTH B;  2NPS D;  5KJ7 D;  1KIL C;  3HD7 A;  2N1T A;  3HD7 C;  2N1T C;  1GL2 A;  4LGD E;  1HVV A;  4WY4 A;  1L4A B;  2KOG A;  1GL2 C;  3B5N B;  3RK3 B; 
#chains in the Genus database with same CATH topology
 1H89 A;  1CI6 A;  4GOF A;  5AW7 B;  1K04 A;  2A06 D;  1P84 H;  3V2N A;  2IBZ E;  3GHG A;  3H1L G;  1IJD B;  1WRG A;  1RE4 A;  1OFC X;  3ZDM A;  1IFI A;  4ZMD A;  1DX7 A;  2P10 A;  2QJP B;  1NWQ A;  3H1K J;  2Y9Z A;  2E76 D;  1H88 A;  3L70 D;  2ZAE B;  3CX5 E;  3HD7 D;  3FXE A;  1IFP A;  1SQQ D;  1N7S C;  1U7J A;  1MFZ A;  1Y47 A;  1YTZ T;  2JWA A;  1GL2 D;  5KLV J;  2Y0E A;  2IBZ G;  3RK2 D;  1EDL A;  1KIL E;  1SQV K;  2UWJ E;  1K8A Q;  2WPV B;  2E74 B;  2QJY C;  3GMA A;  2FYU E;  1L4A C;  4PV1 B;  1WMK A;  1JEK A;  3FXD A;  5AW9 B;  2ZYG A;  5AVR B;  2OGU A;  1NTM E;  3R2P A;  2BAS A;  1Z56 A;  3U59 A;  1T6A A;  2E75 B;  2KI7 B;  2WPQ A;  2DW3 A;  3SSU A;  1BGY E;  1HH0 A;  1YJW P;  3JSV C;  5KJ7 D;  3M91 A;  1BE3 E;  3WU2 H;  1KQG B;  5AVS B;  2IYO A;  4IL6 H;  2P7J A;  3V6I A;  3H1I D;  1X9V A;  1DIP A;  3O6Q B;  5E79 H;  2D2C C;  1L0L K;  1SFC B;  4PD4 D;  1OMI A;  4Y99 B;  4W7Z A;  1NTM G;  1NJI Q;  2IYP A;  4U3F D;  2JWD A;  1S9K D;  3V2R A;  1YBK A;  3KYQ A;  1GD2 E;  1EC5 A;  1EDK A;  1BE3 G;  1U7M A;  1GU4 A;  1PV3 A;  1N73 A;  1PIX A;  3V4Q A;  2HR3 A;  3L36 A;  1NKN A;  4WVZ A;  1SQB E;  2N1T D;  1M8O B;  2R32 A;  2O1K A;  3D71 A;  4WY4 B;  1IZN B;  3OW2 O;  1KTM A;  3II6 A;  2W83 C;  1SQQ K;  2CK3 H;  1JOC A;  1L0N D;  1SQP K;  3B5N A;  2WSC H;  4IL6 X;  2YKO A;  1JY3 O;  2HPC B;  1ZW0 A;  1BCC J;  3PHL A;  2G3A A;  2Q5U A;  1MKM A;  3CL3 D;  3KDP B;  5KAF E;  1HBW A;  2BCC D;  1OW8 A;  1GDT A;  2GM4 A;  3CWB G;  2RKL A;  2YIU B;  1KFM A;  2QJK B;  3TNU A;  1KYO D;  1LT9 A;  2ZT9 B;  1VQM P;  3LW5 H;  1W5C E;  1SQX K;  1HVV A;  2YXQ B;  3CCR P;  3KXD A;  3CCL P;  5CCG A;  1GMJ A;  3BRT B;  5BU5 A;  2YMY A;  3RK3 D;  5AVT B;  3AEE C;  3L35 A;  1M1K Q;  1T8Z A;  4LC1 A;  2FFD A;  1AQ5 A;  4JBZ A;  5CCH C;  5AVZ B;  3AEB C;  1QLE D;  1G1I A;  1MUU A;  1JCD A;  3PJS K;  3V4W A;  2NPS C;  1S72 P;  1D7M A;  3B4S A;  1J1E B;  3A2A A;  2WSC J;  1LTB C;  4HKZ H;  2KYV A;  1NU1 D;  2XDJ A;  1NTZ K;  3KPE A;  3L73 E;  3WMM 0;  1VQ6 P;  1VPC A;  1H8A A;  3H32 A;  1ZME C;  4K35 A;  1N2D C;  3SWY A;  1N7S A;  2O01 N;  1FDO A;  1RF1 B;  4OH8 B;  4N6J A;  1PP9 G;  1IFM A;  3PP5 A;  3LID A;  5TIS E;  2OYH C;  1FZC C;  1Y9B A;  2FYU K;  1LTI C;  1AQT A;  1EQ7 A;  3LW5 J;  1PPJ D;  2E42 A;  2BEQ D;  1KIL C;  1IK7 A;  3H1K E;  3G4S P;  4ASV A;  1J1D C;  4U3F J;  4OGQ B;  1KQF B;  4JQ0 D;  4XA4 A;  5AW5 B;  2OAR A;  1LT1 A;  4UB8 E;  5KLV E;  4R4L A;  2WPS A;  3L74 D;  1LTJ C;  4K3A A;  2KLU A;  4XE5 B;  1JCC A;  3CCM P;  3BVH A;  1FC2 C;  2YO3 A;  3FGA D;  3L75 D;  4NPE A;  1S5L H;  1YJN P;  2W6J H;  3IR9 A;  1RE4 C;  3N7N A;  4I6M C;  3H1K G;  2IZ0 A;  3H1J D;  1OVV A;  1L0N J;  2KSE A;  3H25 A;  1K9M Q;  1VF5 D;  2B9B A;  2B88 A;  1ZV8 A;  2W27 A;  5KLV G;  4U7J A;  3TGU D;  3QWO C;  1P84 E;  2A45 I;  3G9R A;  1KFN A;  4AYC A;  4H13 C;  4JYB A;  1M1J A;  3P8M C;  1FZB A;  4NPD A;  2LXB A;  1SQB K;  5GTI H;  1GW3 A;  4YPC A;  2AXT H;  1NU1 K;  1NTK J;  3A0H H;  3MTU E;  2GUV A;  2QSI A;  3CPW O;  2ITA A;  3H1H J;  1S1C X;  1AV1 A;  4XFJ A;  2Q3I A;  3F89 A;  1ZXG A;  3V2Q A;  1ZR4 A;  5APX A;  3HUS A;  2BEZ F;  1CSB A;  1BSH A;  3HD7 A;  2QM7 A;  1UIX A;  4RES B;  4OVN F;  1KB9 I;  4C7N A;  1FOS E;  1GL2 A;  3WUU A;  4IOI H;  4LGD E;  2C9N Y;  1Q82 Q;  3TDK A;  1HUC A;  4BRY B;  1LWU A;  1SQV G;  2H88 C;  3HE5 A;  2HG5 D;  2WMM A;  3P32 A;  5APS A;  5AW2 B;  3CXH E;  1YHQ P;  1URQ B;  1BCC E;  1LTA C;  3WU2 E;  2R3C A;  2WTY A;  1K73 Q;  2CPB A;  5KJ7 A;  2AXC A;  1VQ9 P;  2A06 E;  5E79 E;  4OWF A;  3S1K A;  1G1J A;  2OYO A;  2XNX A;  2QVA A;  1PGJ A;  1N73 C;  3M06 A;  3L72 E;  4NPF X;  2LKM A;  3S9O A;  1OW6 A;  1M90 Q;  4DZO A;  2CPS A;  3TK1 A;  3RL0 B;  1VF5 B;  1L0L G;  3L70 E;  4KJM A;  1TU3 F;  3B5N C;  2E74 D;  3ABV C;  1SQQ E;  1VDF A;  4PV1 D;  3CC2 P;  2A45 H;  3E1I A;  2A06 G;  1SVF A;  3L74 J;  1S3J A;  1OX3 A;  3Q3D A;  2E75 D;  2OQQ A;  3L72 G;  3ITK A;  5AW1 B;  3T97 A;  4LLH A;  2B87 A;  2N1T A;  4A7P A;  3L75 J;  2KNC A;  3RBX A;  2JDI H;  4EI2 A;  3PLN A;  5GTH E;  1LT9 C;  2QG4 A;  3L70 G;  1A02 J;  2KOG A;  1PGO A;  1AFO A;  3H1J J;  2KSJ A;  2OYI B;  1SQQ G;  1CZQ A;  1SQP G;  4I7Z C;  1SFC D;  5CCG C;  5KLV K;  3HE4 B;  3TGU J;  1VQ4 P;  3BCC J;  4R4M A;  1QX8 A;  2PP6 A;  2M3B A;  2V7Q J;  2Q6Q A;  3A3Y B;  3H1I E;  1KB9 H;  2FFD C;  5TJH A;  4TT3 H;  3FWN A;  5AVV B;  1IO4 A;  4PD4 E;  2I1J A;  1R8E A;  1JTH A;  1GTW A;  3VMX A;  3S4R A;  1RHZ B;  1X22 A;  2Y0C A;  1T3U A;  4DOJ A;  1J2J B;  4ZNC A;  4U3F E;  2KZI A;  1KZU B;  1S9K E;  2FBW C;  5EFW B;  2LR2 A;  1HWT C;  3L71 J;  2WT7 B;  1SQX G;  2K9J B;  4WY4 D;  1JY2 O;  1Q90 D;  2R44 A;  1EZV G;  2P1J A;  1NTZ E;  4WWI A;  2AEJ A;  3H1I G;  4L74 A;  2C9L Y;  1ZRT D;  3GF7 A;  1DEE G;  1IK9 A;  3G6E P;  2J58 A;  1YIT P;  3E1R A;  1DH3 A;  2B89 A;  3FWL A;  3U1A A;  1L0N E;  3O8Z A;  2R5D A;  1ZLL A;  2ZVN B;  1USE A;  3GLM A;  2QJY B;  3Q5P A;  2ZT9 D;  1L4A B;  1NTZ G;  2BCC E;  3E7K A;  3C9I A;  1JNM A;  3CCJ P;  1KYO E;  3MUD A;  5AW8 B;  3H1L D;  1FJK A;  2IBZ I;  3Q5R A;  1OVR A;  3SFD C;  2FYU G;  1R5L A;  1RF0 C;  1FE6 A;  2AEM A;  2POH A;  3RK3 E;  4EYY Q;  1L2P A;  1SFC C;  2W8Z A;  2D2C B;  4Y99 C;  2Y9Y A;  1HTL C;  2BCC G;  1VQL P;  5AVX B;  1BGY G;  5B66 H;  3CX5 I;  4AUW A;  3AEG C;  1M1J C;  1Q7Y Q;  2KS1 B;  3BAT A;  3A5T A;  4IFF A;  3C1L A;  2IZ1 A;  4KT0 J;  1VQ5 P;  1NU1 E;  2FYN C;  2Z5H A;  3MIW A;  4UB6 E;  2M0B A;  5H2F E;  2I8D A;  2E76 C;  1QGK B;  1U57 A;  3HUS C;  5GTI E;  4ZKU A;  3HD7 C;  4Y28 J;  1HJB A;  3A0H E;  3M0D A;  4OGQ D;  2P2U A;  1KC8 Q;  4KHX A;  1GL2 C;  3RGU A;  4GOE A;  1PPJ E;  3RK2 C;  2HOD B;  4O9B A;  1SQB G;  5CJ0 A;  1NTK D;  1LWU C;  1NU1 G;  1VQ7 P;  4YXW H;  1AVY A;  2OTK E;  2YIU C;  4L76 A;  1S2E A;  1OXZ A;  2GUS A;  3H1H D;  3PH0 A;  1NTM D;  1RQU A;  4PJ0 E;  3A0B E;  1R5S A;  3FX0 A;  3L74 E;  1LP1 A;  1AJY A;  3HTK B;  1VQP P;  1JO5 A;  4N3Y B;  5KJ7 C;  3OAK A;  1LTS C;  1SLQ A;  4HYT B;  3L75 E;  1K05 A;  1NH4 A;  1LNQ A;  1PPJ G;  5CBN A;  3H1J E;  3I55 P;  1LTG C;  3TGU E;  3PRJ A;  1KV4 A;  3CCU P;  2NPS B;  3IFM A;  5KTB A;  5APT A;  1HJ0 A;  4DCK A;  5CBO A;  3CX5 H;  3B8E B;  1E79 H;  2E43 A;  4IFM A;  4WB4 A;  2YNY A;  3MZW B;  3NMD A;  4GIF A;  3CWB D;  3WUT A;  3GG2 A;  3SWF A;  1ZR2 A;  3H1L J;  2JEE A;  1G2C B;  1L0N K;  1RY3 A;  2N1T C;  3H1J G;  3IN6 A;  2WPR A;  5BVZ A;  2C0X A;  4H44 B;  2FYZ A;  3KZI E;  1M56 D;  1BSN A;  3TGU G;  2WSF H;  4DT0 A;  2OYH B;  1FZC B;  3V5B A;  2FXO A;  5B5E H;  2O1J A;  1OIP A;  3L73 G;  1KIL B;  3VN0 A;  3Q5S A;  1NTK K;  1URQ D;  5AVY B;  1J1D B;  2R3S A;  1VQN P;  3BRV B;  4Z1M H;  1FZG A;  2M8R A;  1LTJ B;  2ZXX A;  3VMY A;  4YTP C;  1JY3 P;  3HRN A;  2QRX A;  4HB1 A;  2KB7 P;  1SP4 A;  1CI6 B;  1VQ8 P;  1RF0 A;  3JCU H;  5KAI H;  3GHG B;  3F5H A;  3O6Q A;  2K3R A;  1SFC A;  3RL0 D;  3G71 P;  4W7Y A;  4JF7 A;  2KZJ A;  3RK3 C;  2XND H;  1JY3 N;  3BCC D;  5AW6 B;  4L73 A;  5KLI C;  1AVO A;  1PP9 D;  2Z4E A;  1VQO P;  1GU5 A;  5KKZ C;  3SFE C;  3KQG A;  4EDF A;  3Q1M A;  4H13 B;  2OTL P;  1FJP A;  1NTM J;  2FKW B;  1BDC A;  1RQV A;  4D6T D;  3L71 D;  4H0L B;  4WY4 A;  1FU1 A;  2PAJ A;  1BE3 J;  2JKV A;  3AE9 C;  3NXS A;  5KAF H;  2JO1 A;  4GDO A;  3VTP C;  3GW6 A;  2HPC A;  3MUD C;  2C0W A;  1M57 D;  2ZYD A;  1FZA A;  1LJ2 A;  1USD A;  3TF5 A;  1ZN5 A;  1FOS F;  2ZXE B;  4I1L A;  2SPZ A;  2H43 A;  4N78 D;  4IL6 E;  1URQ C;  2M3E A;  1P84 I;  2R5B A;  1KB9 D;  3OJA B;  2WIT A;  3CWB J;  3VMA A;  4IFD K;  2IX7 C;  2ZFC A;  5L8R J;  1EDJ A;  3AEA C;  2G8Y A;  1EDI A;  1JMM A;  3M9H A;  2ZVO B;  1BCC G;  1VF5 C;  4L75 A;  1ZRT E;  1DD4 A;  2XU6 A;  3B5N B;  3M0D C;  1ZOY C;  3N4X A;  1L4A D;  1Y8A A;  3RL0 g;  2WVR A;  1SQV D;  2KK7 A;  1CW5 A;  1NVO A;  1YJ9 P;  2W6B A;  3P8C D;  1RF1 A;  2H7H A;  3CXH I;  1RE3 A;  1GK4 A;  2QIW A;  3TNU B;  4RJT A;  1LT9 B;  3C8V A;  3D6Z A;  3H1L E;  2KIK A;  3GF3 A;  1EXI A;  2D2C D;  4I7Z B;  3MGN A;  1PP9 J;  1WT6 A;  2W90 A;  2RN0 A;  3WUV A;  5CHX A;  1L0L D;  2FFD B;  1PFI A;  4DJG A;  4TLF A;  3PTZ A;  2I1K A;  4D6T J;  2IDB A;  1JM0 A;  2HYN A;  1FDM A;  2QJP C;  3L72 D;  1YIJ P;  1RH5 B;  2PFX A;  3H32 B;  1YTZ I;  4MN4 C;  3M0A A;  1N7S B;  3AEF C;  1KOR A;  2M5A B;  4U3F G;  3TYY A;  4RKU J;  3VMZ A;  1M7L A;  1SQP D;  2E74 C;  1LGH B;  1HGZ A;  1OVU A;  4PV1 C;  2JR8 A;  1KN7 A;  5AW0 B;  1EZV I;  1YYC A;  1IFN A;  3CI9 A;  1H0T B;  1NTK E;  2E75 C;  1QEX A;  4PD4 I;  3H1H E;  3W68 A;  2WWW A;  1L0N G;  3LIE A;  3VOP A;  5B5E E;  3CCQ P;  1HGV A;  4EIJ A;  3SWK A;  1NGM B;  3D70 A;  3CXH H;  5K5G B;  3I56 P;  1SQX D;  1MZ9 A;  4BRY A;  5AVU B;  1XTG B;  2AEF A;  1EZV D;  1DEB A;  2ZYA A;  5CCH D;  1GZL A;  3USS A;  2WQY C;  3KHU A;  1URQ A;  1Q86 Q;  2WZ7 A;  1NTK G;  1T2K D;  2NPS D;  3JC2 2;  1S5L E;  3M9B A;  4M3L A;  3CCV P;  4QMA A;  2WSE H;  3CLQ A;  2IBZ D;  4YXD C;  1N8R Q;  3H1H G;  3JCU E;  5KAI E;  1SQV J;  1X0T A;  3L4F A;  1M1J B;  2Y0D A;  2V4H A;  3CMA P;  1JB0 J;  2PGD A;  4B86 A;  1JUN A;  3MP7 B;  3L37 A;  4H44 D;  2NZ2 A;  4WY4 C;  1NTZ D;  3CX5 D;  3CWB E;  1HF9 A;  2FYN B;  1FZF A;  5APV A;  2AXT E;  1FZE A;  1E5W A;  2E76 B;  1KYO I;  1KIL D;  3HUS B;  1S4X A;  3HD7 B;  5CJ4 A;  2FYU D;  1JY2 P;  3CME P;  1L0L J;  3VP8 A;  5GTH H;  4C7N B;  2QM8 A;  1GL2 B;  2N9Y B;  3RK2 B;  1QL1 A;  1QVF O;  2QJK C;  4C7R A;  3AED C;  1LWU B;  2IPP A;  3H6P A;  3OA7 A;  1FDI A;  3HE5 B;  2OTJ P;  1BGY D;  2NRG A;  2ZT9 C;  5APU A;  1JY2 N;  3AE5 C;  1BE3 D;  2LXC B;  3MHV A;  3TSI A;  2OYI A;  3B71 A;  1ZP0 C;  3P7K A;  2WSE J;  1SS1 A;  1IFD A;  3L72 J;  1OW7 A;  3HE4 A;  4PD4 H;  1T3J A;  1FBM A;  3AE2 C;  2K1A A;  1AA0 A;  3L70 J;  4HJG H;  3G3Z A;  1XTC C;  1SQQ J;  4H13 D;  1SQP J;  2W6A A;  3L74 G;  3BCC E;  1A02 F;  1PL5 A;  2K88 A;  3AE4 C;  1J1E C;  1PP9 E;  1UII A;  2WT7 A;  2QEX P;  1T2K C;  4H0L D;  2K9J A;  3L75 G;  4RO0 A;  3NFQ A;  1YQ3 C;  1IFJ A;  2MKV A;  1SQB D;  2K37 A;  4ZKP A;  2L5G B;  4D6T E;  3MD0 A;  2Z5I A;  3L71 E;  1RF1 C;  5CMZ A;  2O01 H;  4H44 C;  4EOT A;  1SQX J;  3T97 B;  2B87 B;  2N1T B;  3BCC G;  1RE3 C;  2KNC B;  2M5A A;  3CCE P;  2H8P D;  1NHL A;  2O3J A;  3AE6 C;  5AW3 B;  1IC2 A;  3VYI A;  3H1I J;  3AE1 C;  3EQ2 A;  1EXJ A;  2RMZ A;  1W2E A;  4OGQ C;  1KYO H;  1L4A A;  2E5Y A;  1NTM K;  1YQ4 C;  1PGQ A;  3Q2Y A;  1H0T A;  4D6T G;  1OWA A;  3L71 G;  1Q2N A;  1NYH A;  2A45 G;  2YKP A;  4N78 E;  1JTH B;  2L91 A;  2K9Y A;  2IFM A;  1KB9 E;  1NTZ J;  3AE8 C;  3A7O A;  3GHG C;  1GW4 A;  3NTN A;  2JP3 A;  1GK6 A;  3U1C A;  1JMB A;  5BU8 B;  2QE7 H;  1YI2 P;  2KXP B;  3RK3 B;  2YO2 A;  1PGP A;  2HFE D;  2N9B A;  3EWK A;  2KS1 A;  3B5N D;  2GA1 A;  2FYU J;  4ASW A;  1FAV A;  5KLI B;  2O01 J;  2WSF J;  5KKZ B;  4UB6 H;  1NKZ B;  1N86 A;  5H2F H;  3L73 D;  4BXL A;  2BCC J;  3IF4 A;  1BGY J;  1Q81 Q;  2YKQ A;  4JPZ B;  4I2L C;  4H0L C;  4HH2 A;  1VL2 A;  5APY A;  1X8Y A;  1SQV E;  3V2P A;  1QL2 A;  4AQR D;  2Q9I A;  3P8C E;  5AW4 B;  1X79 B;  1KMI Z;  3D6Y A;  1KQL A;  3AEC C;  2RH0 A;  2ZJS E;  3H1K D;  2KLV A;  5CCG D;  1S5L X;  5C39 A;  3CC7 P;  4GT1 A;  2HOD A;  4PJ0 H;  3M9Q A;  3A0B H;  1DD3 A;  3UIA A;  3QH9 A;  1N7L A;  2H89 C;  2IFN A;  5DJU B;  3CCS P;  5KLV D;  2Q7C A;  4BWN A;  3AE7 C;  3CC4 P;  2XKM A;  5M1B A;  4JYC A;  1FS0 E;  3HTK A;  3CD6 P;  1L0L E;  2XZR A;  3R4Y A;  1SQB J;  3K5B A;  1NU1 J;  1MV8 A;  1NOH A;  2MJZ A;  1MFT A;  1PZQ A;  5AVQ B;  1N73 B;  5B66 E;  2KP8 A;  2V7Q H;  2QA4 P;  1N7S D;  3RL0 C;  1QVG O;  1P84 D;  5CCH A;  2JJL A;  1VQK P;  2FXP A;  2E5T A;  3AE3 C;  1NAF A;  3EFF K;  4W80 A;  2NPS A;  2VRS A;  1OZH A;  4WBA A;  5DJT B;  3W67 A;  2J59 M;  3RBZ A;  4C46 A;  1KD1 Q;  5TIS H;  2J5U A;  1W2B O;  2FY8 A;  1SQP E;  3KZI H;  2WSS H;  1G2C A;  2KUB A;  2Q3E A;  2P67 A;  5AVW B;  5APQ A;  2P58 A;  5APW A;  1NO4 A;  4UB8 H;  1KQS O;  2OYI C;  2OYH A;  1FZC A;  4CPG A;  4GOD A;  1LP1 B;  2YMK A;  4GKG A;  3IAO A;  1KIL A;  1BDD A;  2HLO A;  3I5C A;  1SQX E;  2XV5 A;  3CXH D;  1NAY A;  2PRR A;  3BAS A;  1EZV E;  1BCC D;  1LTT C;  3EFG A;  2YXR B;  2FXM A;  1LTJ A;  3L73 J;  3VP9 A;  2Q1K A; 
#chains in the Genus database with same CATH homology
 1H89 A;  3L37 A;  1CI6 A;  1HUC A;  1LWU A;  5AW7 B;  3HE5 A;  4WY4 C;  2WSF H;  3V2N A;  2HG5 D;  3GHG A;  1IJD B;  3P32 A;  2OYH B;  1FZC B;  1WRG A;  5APS A;  3V5B A;  5AW2 B;  1RE4 A;  1FZF A;  2O1J A;  5APV A;  1URQ B;  1LTA C;  1FZE A;  1KIL B;  3VN0 A;  1IFI A;  1E5W A;  2R3C A;  1NTK K;  1URQ D;  2WTY A;  1KIL D;  3HUS B;  1DX7 A;  2CPB A;  5AVY B;  5KJ7 A;  1J1D B;  1NWQ A;  3HD7 B;  5CJ4 A;  1H88 A;  3BRV B;  1JY2 P;  1G1J A;  3VP8 A;  3HD7 D;  2XNX A;  1FZG A;  4C7N B;  2QM8 A;  2M8R A;  1N73 C;  1GL2 B;  1N7S C;  3M06 A;  1LTJ B;  3VMY A;  2LKM A;  1MFZ A;  3RK2 B;  1YTZ T;  1JY3 P;  3HRN A;  1QL1 A;  1GL2 D;  4DZO A;  2KB7 P;  2CPS A;  1SP4 A;  1CI6 B;  4C7R A;  1LWU B;  3TK1 A;  2IPP A;  3H6P A;  3OA7 A;  3RK2 D;  3HE5 B;  3RL0 B;  1RF0 A;  1SQV K;  3GHG B;  5APU A;  1JY2 N;  1SFC A;  2OYI A;  3RL0 D;  3TSI A;  1L4A C;  4W7Y A;  4JF7 A;  3B5N C;  3P7K A;  3RK3 C;  1IFD A;  1JY3 N;  5AW9 B;  5AVR B;  1VDF A;  3HE4 A;  2A45 H;  5AW6 B;  3R2P A;  2BAS A;  1Z56 A;  3E1I A;  3U59 A;  1SVF A;  2WPQ A;  1T3J A;  2Z4E A;  1HH0 A;  1GU5 A;  5KJ7 D;  3KQG A;  1FBM A;  3G3Z A;  3M91 A;  5AW1 B;  1XTC C;  3T97 A;  4LLH A;  5AVS B;  2N1T A;  2P7J A;  1FJP A;  2W6A A;  1A02 F;  2FKW B;  1X9V A;  1J1E C;  1LT9 C;  1A02 J;  4WY4 A;  2KOG A;  1L0L K;  1AFO A;  1FU1 A;  1SFC B;  2OYI B;  2KSJ A;  2WT7 A;  1T2K C;  4Y99 B;  2PAJ A;  4W7Z A;  1CZQ A;  1SFC D;  5CCG C;  3NFQ A;  5KLV K;  1IFJ A;  3HE4 B;  3NXS A;  1S9K D;  3V2R A;  3VTP C;  2PP6 A;  4ZKP A;  2HPC A;  2M3B A;  3KYQ A;  2L5G B;  3A3Y B;  2C0W A;  1GD2 E;  2FFD C;  3MD0 A;  2Z5I A;  1FZA A;  5AVV B;  1RF1 C;  1IO4 A;  5CMZ A;  2I1J A;  1GU4 A;  2O01 H;  4EOT A;  1JTH A;  1GTW A;  3VMX A;  2N1T B;  1N73 A;  1ZN5 A;  1RE3 C;  3V4Q A;  3L36 A;  1FOS F;  1T3U A;  2ZXE B;  1NKN A;  4DOJ A;  1J2J B;  4I1L A;  2H8P D;  1NHL A;  2N1T D;  5AW3 B;  1KZU B;  1S9K E;  1IC2 A;  2R32 A;  3VYI A;  2O1K A;  4WY4 B;  2H43 A;  3EQ2 A;  1HWT C;  2WT7 B;  1W2E A;  4N78 D;  3II6 A;  1URQ C;  4WY4 D;  1SQQ K;  2R5B A;  1JY2 O;  1JOC A;  1SQP K;  1L4A A;  3B5N A;  2WSC H;  1NTM K;  3OJA B;  2P1J A;  2WIT A;  2YKO A;  1JY3 O;  1OWA A;  2HPC B;  2C9L Y;  4IFD K;  1IK9 A;  2IX7 C;  2J58 A;  2A45 G;  2ZFC A;  2Q5U A;  2YKP A;  3CL3 D;  3KDP B;  1DH3 A;  1HBW A;  4N78 E;  1JTH B;  1GDT A;  3U1A A;  2GM4 A;  1JMM A;  3O8Z A;  1KFM A;  2IFM A;  2R5D A;  3M9H A;  1ZLL A;  3A7O A;  3GHG C;  1GW4 A;  3TNU A;  3NTN A;  1GK6 A;  1LT9 A;  3U1C A;  5BU8 B;  3LW5 H;  1SQX K;  1HVV A;  1L4A B;  2XU6 A;  3B5N B;  3RK3 B;  2YO2 A;  3M0D C;  3N4X A;  5CCG A;  2HFE D;  2N9B A;  1L4A D;  3BRT B;  2YMY A;  5BU5 A;  3B5N D;  3RK3 D;  3C9I A;  5AVT B;  3L35 A;  1JNM A;  1T8Z A;  1FAV A;  4LC1 A;  3MUD A;  5AW8 B;  1FJK A;  2FFD A;  1CW5 A;  1AQ5 A;  2W6B A;  1NKZ B;  3P8C D;  1N86 A;  1RF1 A;  5CCH C;  5AVZ B;  1G1I A;  1MUU A;  1JCD A;  2H7H A;  1RE3 A;  1GK4 A;  3V4W A;  1RF0 C;  2NPS C;  2YKQ A;  3TNU B;  4I2L C;  2POH A;  4HH2 A;  1J1E B;  3A2A A;  1LT9 B;  5APY A;  1SFC C;  1X8Y A;  4Y99 C;  3V2P A;  1HTL C;  1QL2 A;  4AQR D;  1LTB C;  5AVX B;  2Q9I A;  2KYV A;  2XDJ A;  3P8C E;  5AW4 B;  4AUW A;  1NTZ K;  3KPE A;  3WMM 0;  3MGN A;  1X79 B;  1M1J C;  1VPC A;  1WT6 A;  1H8A A;  1KQL A;  3H32 A;  2KLV A;  5CCG D;  3BAT A;  3A5T A;  1N2D C;  3SWY A;  5CHX A;  4IFF A;  1N7S A;  4GT1 A;  2FFD B;  2HOD A;  1PFI A;  3M9Q A;  3UIA A;  1RF1 B;  4OH8 B;  4N6J A;  1N7L A;  1IFM A;  2IFN A;  3PP5 A;  2I1K A;  3LID A;  2OYH C;  1FZC C;  2Q7C A;  2FYU K;  1LTI C;  2Z5H A;  3MIW A;  1EQ7 A;  2XKM A;  2E42 A;  4JYC A;  1KIL C;  2HYN A;  3HTK A;  1FDM A;  2XZR A;  3HUS C;  1J1D C;  4ZKU A;  3HD7 C;  4XA4 A;  1MV8 A;  1HJB A;  5AW5 B;  2OAR A;  3M0D A;  1NOH A;  3H32 B;  2WPS A;  2MJZ A;  2P2U A;  4KHX A;  1GL2 C;  1YTZ I;  5AVQ B;  1LTJ C;  3M0A A;  4XE5 B;  3RK2 C;  1N73 B;  1JCC A;  1N7S B;  2HOD B;  4O9B A;  5CJ0 A;  3BVH A;  2KP8 A;  1LWU C;  3TYY A;  1N7S D;  3RL0 C;  3VMZ A;  2YO3 A;  1M7L A;  5CCH A;  1OXZ A;  2JJL A;  2GUS A;  3IR9 A;  1LGH B;  1RE4 C;  3N7N A;  1HGZ A;  4I6M C;  1NAF A;  4W80 A;  2NPS A;  2VRS A;  4WBA A;  5AW0 B;  3HTK B;  1YYC A;  1IFN A;  1JO5 A;  2J59 M;  4N3Y B;  5KJ7 C;  3CI9 A;  3OAK A;  1LTS C;  4C46 A;  1SLQ A;  4HYT B;  1ZV8 A;  2W27 A;  2A45 I;  1NH4 A;  1KFN A;  4AYC A;  4JYB A;  1M1J A;  2WWW A;  3LIE A;  1G2C A;  3VOP A;  3P8M C;  1FZB A;  1HGV A;  4EIJ A;  2P67 A;  1SQB K;  1GW3 A;  5AVW B;  5APQ A;  1NU1 K;  1MZ9 A;  3MTU E;  5APW A;  5AVU B;  1NO4 A;  2GUV A;  1XTG B;  2OYI C;  1LTG C;  2OYH A;  1FZC A;  1DEB A;  5CCH D;  1GZL A;  2NPS B;  1URQ A;  3IFM A;  4GKG A;  5KTB A;  5APT A;  1KIL A;  2WZ7 A;  2Q3I A;  2NPS D;  3M9B A;  4M3L A;  1T2K D;  2HLO A;  3V2Q A;  3I5C A;  3B8E B;  1ZR4 A;  2WSE H;  5APX A;  4IFM A;  4WB4 A;  2E43 A;  3HUS A;  3CLQ A;  1CSB A;  2YNY A;  4GIF A;  3HD7 A;  3NMD A;  2XV5 A;  3SWF A;  2QM7 A;  3L4F A;  1M1J B;  4RES B;  3BAS A;  1ZR2 A;  2JEE A;  1LTT C;  1G2C B;  1L0N K;  1RY3 A;  3EFG A;  4C7N A;  2N1T C;  2FXM A;  1FOS E;  1GL2 A;  2WPR A;  2C0X A;  5BVZ A;  1LTJ A;  4LGD E;  2FYZ A;  3VP9 A;  4B86 A;  2C9N Y;  1JUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...