4WY4D

Crystal structure of autophagic snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
64
Chain Sequence
HLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKVRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein 8
total genus 32
structure length 64
sequence length 65
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4D00
1GL2B 4W7ZA 1L4AD 1SFCD 1KILC 2N1TC 5KJ7C 4WY4B 3B5NB 3RK3D 5CCHA 5CCGC 3B5ND 3RK3B 2H8PD 1HVVA 1T3JA 1N7SC 3KYQA 2NPSA 2N1TB 1N7SB 2HG5D 3HD7C 4OH8B 2NPSB 3RK2B 2KOGA 3B5NC 5CCGA 1NHLA 4JF7A 3M0DC 1URQA 1N7SA 1KILA 2N1TD 1KILB 2N1TA 1KILD 2YMYA 2NPSC 5CCHD 3RL0C 1XTGB 2WZ7A 4LGDE 3RK2C 3HD7B 3HTKB 3TSIA 2XDJA 2HFED 4WY4C 4W80A 4WY4D 2M8RA 4WY4A 5CCGD 3RK3C 1JTHB 5KJ7D 5KJ7A 1GL2D 1L4AC 1SFCC 4N78E 3RL0D 1GL2A 2NPSD 5CCHC 1L4AB 1SFCB 1L4AA 1SFCA 1GL2C 3VOPA 3PP5A 1JTHA 3B5NA 3P8CE 1URQC 1URQD 1N7SD 1URQB 3RK2D 4W7YA 3HD7A 2PP6A 3HD7D 3RL0B
chains in the Genus database with same CATH superfamily
1QL1A 3AE8C 4C7NB 1GL2B 1PGOA 2LR2A 3AE1C 2IBZG 1G1JA 4IFMA 3M0DA 4R4MA 1SQBG 3L71D 3H6PA 1SQPG 4GOFA 1NTZE 4OGQC 4PD4H 4XA4A 1YHQP 1AVYA 2IX7C 5AVYB 1JY2O 1KTMA 1KQLA 1NTZK 1U7MA 3L73G 4WY4B 2M5AB 3B5NB 2QJYB 2HPCB 4PV1D 1SQXJ 1DD3A 1JY2P 1IFPA 1KB9H 1S4XA 4DZOA 2H8PD 3GHGC 1EDJA 1SP4A 1FZAA 1NTMK 2GUVA 3CI9A 2FYNC 4HJGH 3GHGA 3MIWA 3CXHD 1E5WA 1LP1A 1BGYE 3KYQA 2QJKB 3KPEA 5CBNA 4L74A 3Q5SA 2A45I 2QE7H 3C9IA 1GD2E 1SQBJ 3FGAD 3TDKA 1X8YA 1K73Q 5AVZB 3IN6A 1HBWA 1OW7A 1JY3N 1E79H 1JCCA 1NKZB 1ZN5A 3L73J 3VMYA 2A06D 3OA7A 3L70E 2KYVA 5AW0B 4BRYB 2JP3A 4D6TE 4R4LA 3B4SA 1GMJA 1LT9A 1VF5B 2JKVA 3H1JD 3Q1MA 2Q5UA 1HGVA 1EDKA 3HD7C 4OH8B 1LTTC 1M56D 2LXCB 3L75G 4N6JA 3U1AA 3W68A 1RF1B 2QRXA 2E42A 4HKZH 2RH0A 1H88A 1EQ7A 1L0NK 1FOSF 1YQ3C 1SQXE 1YTZI 2V7QJ 5H2FH 3L74D 4C46A 2GM4A 2IYOA 5L8RJ 3M91A 3O8ZA 3H1JJ 4OGQB 4U3FJ 1KQSO 1LP1B 3G9RA 2IZ1A 3H1IE 3FXDA 3GHGB 3JSVC 1OMIA 2IFMA 3GLMA 5AW6B 2AXTE 5KAIH 3B5NC 1MFTA 1NHLA 2W83C 2WSEH 1L0NJ 3HE5B 3VMAA 1S72P 1SQQK 2I1JA 1IK9A 2QIWA 2BEZF 1J1EB 1NVOA 2N1TD 2YKQA 1S5LX 1SS1A 3GMAA 3IR9A 5AVVB 2M3BA 3V2NA 1RF1C 4HYTB 2HR3A 3V2RA 1VQ7P 4LLHA 4ZMDA 2YXQB 2ZT9B 1JMBA 4EDFA 4L73A 1X22A 2WPSA 4U3FG 1GW4A 3OJAB 1L0ND 4PJ0E 1M8OB 5GTIH 5KLVE 5AVRB 4C7RA 1WT6A 2A45G 3AEFC 3G3ZA 2KNCA 1RF0A 2E74B 3HD7B 1RE4C 2A45H 4H44C 1P84H 3TSIA 3LW5H 5AVWB 3CLQA 2K9YA 3P8CD 5AW7B 4EIJA 3H1LJ 4ZKUA 2Z5HA 4EOTA 1BE3J 3L75D 1FU1A 2Z4EA 1BDCA 2HPCA 2G8YA 3CCRP 1KB9I 1ZRTE 4WY4A 5GTHE 1PIXA 4GDOA 1EZVE 1MV8A 2VRSA 3FWLA 1KYOE 3U59A 1AFOA 3TGUJ 3RBXA 4K35A 5KJ7A 4RO0A 2CPBA 4HH2A 4H44B 2GA1A 1AV1A 1GL2A 2NPSD 3VP9A 3WUVA 5CCHC 1VQOP 2B87B 1L4AB 1SFCB 4JBZA 4JQ0D 1PGJA 3NXSA 5TJHA 5K5GB 2Y9ZA 1IZNB 3H32B 3L72D 2KP8A 1GL2C 1T2KD 1QLED 4H0LD 2ITAA 2XV5A 1Y47A 2Y0DA 1FZEA 2NRGA 2J58A 2M0BA 2B88A 2OTLP 1KMIZ 2E43A 3ZDMA 2IYPA 1KV4A 1P84D 3W67A 2L91A 5TISH 3HE5A 1RF0C 5APVA 2HODA 2W27A 3RK3E 2CK3H 1M7LA 1NTKD 2BCCD 3RK2D 1HF9A 3CC7P 1EZVI 4W7YA 1S3JA 2Y9YA 1KQGB 1L0LG 2PP6A 3PLNA 3AE9C 3TGUE 1OFCX 1KYOI 2OGUA 2Q1KA 2B87A 3HD7D 3RL0B 3V6IA 4ZKPA 1YI2P 4GODA 1LTGC 2MKVA 3CPWO 1N7LA 4W7ZA 2LKMA 4GOEA 1GDTA 3FXEA 3U1CA 1EXIA 2FYUJ 1K04A 1RF1A 2AEJA 2KS1A 3A0HH 5KJ7C 1USEA 1KN7A 3TNUA 5BVZA 4UB8E 1JCDA 4I7ZC 3RK3D 2ZVNB 5CCHA 3CCSP 5CCGC 2XNDH 4PD4I 3RK3B 3VYIA 1HVVA 2IBZE 3D70A 2ZXEB 4KT0J 3AE2C 1N7SC 3VN0A 2JWDA 2QVAA 1NTZG 2YIUC 3T97A 1PP9D 1LGHB 2FYUD 1BE3D 1JY3O 3EWKA 3HUSC 3L75J 2E76C 3K5BA 2K37A 1RE4A 1HJ0A 1S5LH 2R3CA 3HUSB 4JYBA 1OIPA 1Y9BA 2ZJSE 3E1RA 4H13B 2KSJA 4UB8H 3CCLP 2K1AA 3HUSA 1H0TA 1H0TB 5KAFE 1Y8AA 4BWNA 2O1JA 1NAYA 1LT9C 4Y28J 4EI2A 1YITP 3AEBC 3BATA 4AUWA 4I7ZB 3L72E 2E5TA 3IF4A 3KDPB 1BGYG 3F89A 3II6A 3L36A 3MUDC 1CI6B 3AEDC 3VMXA 1FZCB 4WWIA 4YXDC 2MJZA 4N78D 1NWQA 2H7HA 2V4HA 3EFGA 1SQQE 3IAOA 1NU1J 2A06E 2SPZA 2PFXA 1GTWA 2FFDB 1N8RQ 1OXZA 3HE4A 3L70G 1UIIA 1KD1Q 2IFNA 4C7NA 1KFMA 1BCCG 2POHA 3QH9A 2C0XA 1DIPA 1HGZA 2BASA 1OVRA 2FYUK 1FOSE 3L75E 1N86A 3PHLA 4RJTA 1NJIQ 4UB6E 1ZMEC 1EZVD 1G2CA 1NU1K 2HODB 3AE4C 2V7QH 5CCGA 1SQXG 4TLFA 3CD6P 1PGQA 4H44D 4WB4A 2KIKA 3S1KA 2KZIA 5AVSB 3CXHH 4I1LA 1N7SA 1KILA 3OW2O 4IFDK 2P7JA 3CX5H 4U3FD 1YJNP 2N1TA 2WSFH 3AE3C 3R2PA 2RN0A 3L70J 3P7KA 4KJMA 1NTMD 4D6TJ 3M9HA 1M57D 2Z5IA 1FZBA 1XTGB 3MZWB 2Q3IA 4LGDE 3CX5E 3BCCJ 2QM8A 2YIUB 4RKUJ 1NU1E 2IPPA 4PD4D 1A02J 1FDMA 3CXHE 5E79E 2YKOA 2K9JB 2R5DA 3CL3D 4N3YB 3P32A 3HE4B 3HTKB 5AW8B 4ZNCA 2XDJA 3Q3DA 1M90Q 1MFZA 1ZW0A 2HFED 2QJYC 2E76D 2WWWA 4WY4C 3H1JE 4U3FE 1JEKA 2B9BA 1KQFB 1QGKB 3H1IJ 4W80A 1Q2NA 1SQVD 5AVTB 2OYHA 2JEEA 2M8RA 2KZJA 2WQYC 1P84E 3Q2YA 1J1DB 2CPSA 3LW5J 2H43A 5C39A 1ZLLA 3CX5D 2AEFA 4NPFX 1OW8A 4IL6H 1JB0J 5EFWB 3VMZA 2W90A 3JC22 3CCEP 1SQXK 4N78E 3H1HG 3KHUA 1U7JA 2IDBA 1SQXD 1ZXGA 3WU2H 1PGPA 3M06A 5KLVJ 1LT1A 1D7MA 1USDA 2JWAA 2KI7B 4QMAA 1RQVA 3BCCE 4Y99C 2Q7CA 2FY8A 1GU4A 3F5HA 2XZRA 3AE7C 3CCQP 1JOCA 2YKPA 3USSA 1U57A 2W6JH 3WMM0 3C1LA 5KLIB 5CMZA 1S5LE 1SQPD 4YTPC 2K3RA 1NYHA 1PPJD 1BE3E 1JY3P 1URQC 2G3AA 4LC1A 2O01H 5AW2B 1VQLP 1L0LK 2E74D 2B89A 2QA4P 3A3YB 3CWBJ 4NPEA 2J5UA 1LTJC 3GF7A 1FAVA 1VDFA 5APYA 4ASVA 3HTKA 1RE3A 1YBKA 2QSIA 1PV3A 2P10A 4H0LC 1YTZT 1NTME 1PFIA 3A7OA 1LJ2A 1X79B 3H1LG 1LTAC 1NAFA 2R32A 1L2PA 1X9VA 3LIEA 1L4AD 1SFCD 3H1KJ 3L74J 1KILC 2I8DA 3TGUD 2N1TC 4EYYQ 4TT3H 5AVUB 2IZ0A 3D6ZA 5APSA 1FDIA 1SQQD 1HUCA 1G1IA 1SQBK 3ABVC 3CWBG 3H1HD 1R5SA 2JDIH 1L0NG 1ZP0C 3B5ND 1TU3F 1EDLA 2E74C 4YXWH 3V4QA 1LTBC 5BU8B 5TISE 1HH0A 2N9YB 2E5YA 2H88C 5KLIC 1SQVJ 3IFMA 4L76A 4DJGA 3KZIH 5AW3B 1W5CE 1EC5A 1IK7A 2WVRA 1EDIA 2KK7A 2NPSA 3L74G 3H1KG 1BGYD 3MUDA 3R4YA 5M1BA 1QVFO 1LTIC 1IFNA 1BCCJ 1PPJG 1PP9E 1KC8Q 3I5CA 1NTMJ 1LNQA 2QJPB 4D6TD 2IBZI 1H8AA 1T3UA 1BDDA 2C9LY 1VQKP 2FXOA 3L4FA 1DH3A 2AXCA 4A7PA 2ZXXA 3E7KA 1IFDA 2Q9IA 2HLOA 3BRTB 3N4XA 1AA0A 2M5AA 2ZT9D 5AVQB 2HG5D 5B5EE 1S1CX 3H1LD 2WTYA 2OYHB 2FFDA 2WSFJ 2ZAEB 2R3SA 4JYCA 2I1KA 3BASA 1OVVA 3KXDA 2OARA 2WSSH 3L72G 2WSEJ 2BEQD 2YXRB 2KNCB 3L71J 3AEEC 2NPSB 2ZYDA 2KLUA 1MUUA 5B66E 1SQVE 2C0WA 2ZYGA 4ASWA 3O6QB 4OVNF 3ITKA 1T6AA 1SQQG 3NMDA 2A06G 1OVUA 1RH5B 2PAJA 3CCVP 3MD0A 2QJKC 1R5LA 2H89C 1BSHA 2D2CD 2DW3A 5CJ0A 1S9KE 1URQA 2W6BA 1HJBA 1VPCA 1BCCE 2FXPA 1KILB 3GG2A 4JPZB 1T8ZA 3TNUB 1RY3A 1SQVK 2JJLA 1KILD 1T2KC 1JM0A 3WUTA 2FKWB 2E75D 2Y0EA 3L72J 2WMMA 1LWUA 1MKMA 2R5BA 1NO4A 4PJ0H 5APWA 3WU2E 5KLVK 1JO5A 1L0LD 2NPSC 5CCHD 1RE3C 2W8ZA 3RL0C 3BVHA 4IL6E 5AW9B 2WZ7A 2KUBA 2P67A 1SQQJ 2FYNB 2QJPC 3M9QA 4L75A 3C8VA 4WBAA 3I56P 2XU6A 1VQ4P 1NKNA 2HYNA 3H1HJ 4IOIH 2RMZA 2YNYA 3L71E 3G6EP 2OYHC 2KXPB 1N73B 1NTKJ 1L0LJ 2AXTH 2BCCJ 2ZYAA 5KAIE 4AYCA 1FZCA 1A02F 1QX8A 1GZLA 1NU1G 1FZCC 1VQMP 1KZUB 4PV1C 3SFDC 1NTZD 2FYUG 5KTBA 3RL0g 1W2EA 2OYIA 3H1JG 2QEXP 2E76B 1VQ9P 2R44A 4RESB 2WT7A 4OGQD 2O1KA 1J1DC 1L4AC 1SFCC 3RL0D 1YJ9P 1GK6A 3SFEC 2O01N 4YPCA 3H32A 3MHVA 1IO4A 1NTKG 2BCCG 4U7JA 1JUNA 1YJWP 1L4AA 1SFCA 4GIFA 1NTZJ 3AECC 3VOPA 4GT1A 1VL2A 2K88A 1LTSC 2AEMA 3GW6A 2NZ2A 3SWKA 1Q81Q 1AVOA 1LWUC 1QVGO 1HWTC 3AEGC 3PP5A 3H1HE 2YO2A 1LWUB 3Q5PA 4CPGA 3TF5A 1LTJA 2OYOA 1URQD 2O01J 1Z56A 1N7SD 2LXBA 1YQ4C 3KZIE 3BCCG 1SVFA 1BGYJ 3UIAA 1VQ8P 1ZOYC 4H0LB 2P58A 1ZR4A 1BCCD 1CSBA 1YYCA 2RKLA 3A2AA 4NPDA 1KB9E 1SQBE 1SQPE 3N7NA 1M1JA 1K9MQ 1UIXA 2K9JA 3H1ID 3O6QA 3QWOC 1H89A 1BE3G 2ZFCA 3L73E 3A5TA 1NU1D 2ZT9C 4PD4E 3D71A 4KHXA 1YIJP 2OQQA 4M3LA 3CC2P 1DX7A 1FS0E 3Q5RA 2P1JA 1J2JB 1NH4A 2XKMA 5APQA 1R8EA 3CX5I 2OYIC 1OWAA 1NTMG 1WRGA 1NOHA 1X0TA 2E75B 2IBZD 4GKGA 3CCMP 3FX0A 1IFIA 4BXLA 5KLVD 5APUA 2D2CB 1FC2C 1G2CB 1T3JA 2UWJE 2W6AA 2QM7A 1PZQA 1QEXA 3L73D 1FZGA 1JY2N 1N73A 3EFFK 2O3JA 2WSCH 1GU5A 3B71A 4H13D 4D6TG 3B8EB 3CWBE 2KSEA 1FDOA 3MTUE 2FFDC 3LIDA 1S9KD 2FXMA 1IJDB 1L0NE 1SQPJ 2YO3A 3A0HE 2P2UA 3TYYA 2Y0CA 1Q7YQ 1K05A 3BRVB 5AW5B 3L37A 4DT0A 4O9BA 3SWFA 1KILE 1FZFA 1DEEG 2OTJP 3PJSK 1OX3A 2M3EA 2N1TB 2WPRA 3PTZA 4AQRD 5BU5A 3H25A 4OWFA 5APXA 3L74E 1CI6A 1N7SB 1OZHA 1FJKA 2J59M 3EQ2A 3H1KE 3H1IG 3JCUE 1SQPK 3L35A 1FE6A 1PPJE 1XTCC 1PP9G 3CXHI 3PH0A 5APTA 1EXJA 1VF5C 1NTKK 2WITA 4HB1A 3VTPC 3H1LE 3S4RA 1FBMA 3A0BE 2ZVOB 3RK2B 1HTLC 1VQ5P 1OW6A 3AEAC 1IC2A 2PGDA 3NFQA 1CZQA 2KOGA 4I6MC 3RBZA 2C9NY 4JF7A 1RHZB 5KLVG 1BSNA 1VF5D 3M0DC 5E79H 5AVXB 3WUUA 1FJPA 1DD4A 1SLQA 1PP9J 3OAKA 1SQVG 1KFNA 1LTJB 1ZV8A 4DCKA 1AQ5A 2YMYA 3M9BA 3CMAP 1JNMA 3KQGA 1J1EC 2KLVA 1M1JC 2E75C 4I2LC 2KB7P 4Z1MH 1KYOH 2Q6QA 4K3AA 1GK4A 2FYZA 2Q3EA 2WPVB 3VP8A 5CBOA 3MP7B 1VQ6P 1VQNP 2D2CC 3RK2C 3G71P 5GTHH 3I55P 1EZVG 1ZRTD 1W2BO 1QL2A 1JMMA 3AE6C 4H13C 3T97B 4Y99B 4IFFA 4UB6H 3CCUP 2WT7B 3D6YA 3V2QA 3CWBD 4PV1B 3TK1A 2OYIB 1WMKA 4WY4D 1LT9B 3A0BH 2L5GB 3HRNA 4XFJA 5KKZB 5DJTB 5CCGD 4BRYA 2KS1B 3RK3C 2XNXA 5AW4B 1JTHB 1KB9D 1SQBD 3L71G 3PRJA 5KJ7D 1N73C 1Q90D 1DEBA 4MN4C 5GTIE 1GL2D 3JCUH 3CCJP 2GUSA 3H1KD 1AJYA 1S2EA 3FWNA 2JO1A 3RGUA 1Q86Q 3MGNA 1M1KQ 1KORA 3SSUA 1MZ9A 3L70D 3V4WA 5CJ4A 1ZR2A 2FYUE 2OTKE 5DJUB 4IL6X 3S9OA 4WVZA 2QG4A 3P8MC 5KKZC 4DOJA 2WPQA 5KAFH 2JR8A 3BCCD 1JTHA 3B5NA 3SWYA 3V5BA 2WSCJ 1N2DC 4XE5B 1NTKE 1L0LE 2BCCE 3P8CE 3TGUG 1VQPP 3AE5C 3CMEP 1CW5A 5B66H 3GF3A 5CHXA 2PRRA 3V2PA 1K8AQ 5AW1B 2N9BA 4B86A 1URQB 5H2FE 1NGMB 1PL5A 1IFMA 3CC4P 3G4SP 1P84I 1IFJA 1Q82Q 3NTNA 1KYOD 1AQTA 3M0AA 2YMKA 3HD7A 3E1IA 2FBWC 1GW3A 1M1JB 5B5EH 1RQUA
chains in the Genus database with same CATH topology
1QL1A 4C7NB 1GL2B 1G1JA 4IFMA 3M0DA 3H6PA 4XA4A 2IX7C 5AVYB 1JY2O 1KQLA 1NTZK 4WY4B 3B5NB 2HPCB 1JY2P 4DZOA 2H8PD 3GHGC 1SP4A 1FZAA 1NTMK 2GUVA 3CI9A 3GHGA 3MIWA 1E5WA 3KYQA 3KPEA 2A45I 3C9IA 1GD2E 1X8YA 1JY3N 1JCCA 1NKZB 1ZN5A 3VMYA 5AW0B 3OA7A 2KYVA 1LT9A 2Q5UA 1HGVA 3HD7C 4OH8B 2C9NY 1LTTC 4N6JA 1RF1B 3U1AA 2E42A 1H88A 1EQ7A 1L0NK 1FOSF 1YTZI 2GM4A 4C46A 3M91A 3O8ZA 3GHGB 2IFMA 5AW6B 3B5NC 1NHLA 2WSEH 3HE5B 1SQQK 2I1JA 1IK9A 3VP9A 3IR9A 1J1EB 2N1TD 2YKQA 5AVVB 3V2NA 2M3BA 1RF1C 4HYTB 3V2RA 4LLHA 2WPSA 1GW4A 3OJAB 5AVRB 4C7RA 1WT6A 2A45G 3G3ZA 1RF0A 3HD7B 1RE4C 2A45H 3TSIA 4EIJA 3LW5H 5AVWB 3CLQA 3P8CD 5AW7B 2Z5HA 4EOTA 1FU1A 2Z4EA 2HPCA 4WY4A 1MV8A 2VRSA 3U59A 5KJ7A 2CPBA 4HH2A 1GL2A 2NPSD 5CCHC 1AFOA 1L4AB 1SFCB 3NXSA 3H32B 2KP8A 1GL2C 1T2KD 2XV5A 1FZEA 2J58A 3HE5A 1RF0C 5APVA 2HODA 2W27A 1M7LA 3RK2D 4W7YA 2PP6A 3HD7D 3RL0B 4ZKPA 1LTGC 1N7LA 4W7ZA 2LKMA 1GDTA 3U1CA 1RF1A 5KJ7C 3TNUA 5BVZA 1JCDA 3RK3D 5CCHA 5CCGC 3RK3B 3VYIA 1HVVA 2ZXEB 1N7SC 3VN0A 3T97A 5CJ4A 1LGHB 1FDMA 1JY3O 3HUSC 1RE4A 2R3CA 3HUSB 4JYBA 2KSJA 3HUSA 2O1JA 4AUWA 1LT9C 3BATA 3KDPB 3II6A 3L36A 1CI6B 2MJZA 4N78D 1NWQA 2H7HA 3EFGA 1GTWA 2FFDB 1OXZA 3HE4A 2IFNA 4C7NA 1KFMA 2POHA 2C0XA 1HGZA 2BASA 2FYUK 1FOSE 1N86A 1G2CA 1NU1K 2HODB 5CCGA 4WB4A 5AVSB 4I1LA 1N7SA 1KILA 4IFDK 2P7JA 2N1TA 2WSFH 3R2PA 3P7KA 3M9HA 2Z5IA 1FZBA 1XTGB 2Q3IA 4LGDE 2QM8A 2IPPA 1A02J 2E43A 3VMXA 2YKOA 2R5DA 3CL3D 4N3YB 5AW8B 3P32A 3HE4B 3HTKB 1HBWA 2XDJA 1MFZA 2HFED 2WWWA 4WY4C 4W80A 5AVTB 2OYHA 2JEEA 2M8RA 1J1DB 2CPSA 2H43A 1ZLLA 3VMZA 1SQXK 4N78E 3M06A 4Y99C 2Q7CA 1GU4A 2XZRA 1JOCA 2YKPA 3WMM0 5CMZA 1URQC 1JY3P 4LC1A 2O01H 1L0LK 3A3YB 1LTJC 1FAVA 1VDFA 5APYA 3HTKA 1RE3A 1YTZT 1PFIA 3A7OA 1X79B 1LTAC 1NAFA 2R32A 3LIEA 1X9VA 1L4AD 1SFCD 1KILC 2N1TC 5AVUB 5APSA 1HUCA 1G1IA 1SQBK 3B5ND 3V4QA 1LTBC 5BU8B 1HH0A 3IFMA 5AW3B 2NPSA 3MUDA 1LTIC 1IFNA 3I5CA 1H8AA 2C9LY 1T3UA 3L4FA 1DH3A 2Q9IA 1IFDA 2HLOA 3BRTB 3N4XA 5AVQB 2OYHB 2HG5D 2WTYA 4JYCA 2I1KA 3BASA 2OARA 2NPSB 1MUUA 2C0WA 3NMDA 2PAJA 3MD0A 5CJ0A 1S9KE 1URQA 2W6BA 1HJBA 1VPCA 1KILB 1T8ZA 3TNUB 1RY3A 1SQVK 2JJLA 1KILD 1T2KC 2FKWB 1LWUA 2R5BA 1NO4A 5APWA 5KLVK 1JO5A 2NPSC 5CCHD 1RE3C 3RL0C 3BVHA 5AW9B 2WZ7A 2P67A 3M9QA 4WBAA 2XU6A 1NKNA 2HYNA 2OYHC 2FFDA 2YNYA 1N73B 4AYCA 1FZCA 1A02F 1GZLA 1FZCC 1KZUB 5KTBA 1W2EA 2OYIA 4RESB 2WT7A 2O1KA 1J1DC 1L4AC 1SFCC 3RL0D 1GK6A 1IO4A 3H32A 1JUNA 1L4AA 1SFCA 4GIFA 3VOPA 4GT1A 1LTSC 1LWUC 1HWTC 3PP5A 2YO2A 1LWUB 1LTJA 1URQD 1Z56A 1N7SD 1SVFA 3UIAA 1ZR4A 1CSBA 1YYCA 3A2AA 3N7NA 1M1JA 1H89A 2ZFCA 3A5TA 4KHXA 4M3LA 1DX7A 2P1JA 1J2JB 1NH4A 2XKMA 5APQA 2OYIC 1OWAA 1WRGA 1NOHA 4GKGA 1IFIA 5APUA 1FZCB 1G2CB 1T3JA 2W6AA 1FZGA 2QM7A 1N73A 1JY2N 2WSCH 1GU5A 3B8EB 3MTUE 2FFDC 3LIDA 1S9KD 2FXMA 1IJDB 2YO3A 3TYYA 2P2UA 3BRVB 5AW5B 3L37A 4O9BA 3SWFA 1FZFA 5BU5A 2WPRA 2N1TB 4AQRD 5APXA 1CI6A 1N7SB 2J59M 1FJKA 3EQ2A 5AVZB 4ZKUA 5AW2B 3L35A 1SQPK 1XTCC 5APTA 1NTKK 2WITA 3VTPC 1FBMA 3RK2B 1HTLC 3NFQA 4I6MC 1IC2A 1CZQA 2KOGA 4JF7A 3M0DC 5AVXB 1FJPA 1SLQA 3OAKA 1KFNA 1LTJB 1ZV8A 1AQ5A 2YMYA 3M9BA 1JNMA 3KQGA 1J1EC 2KLVA 1M1JC 4I2LC 2KB7P 1GK4A 2FYZA 3VP8A 3RK2C 1QL2A 1JMMA 4Y99B 4IFFA 2WT7B 3V2QA 3TK1A 2OYIB 4WY4D 1LT9B 3HRNA 2L5GB 5CCGD 3RK3C 2XNXA 5AW4B 1JTHB 1N73C 5KJ7D 1DEBA 1GL2D 2GUSA 3MGNA 1MZ9A 3V4WA 1ZR2A 3P8MC 4DOJA 2WPQA 1JTHA 3B5NA 3SWYA 3V5BA 1N2DC 4XE5B 1CW5A 3P8CE 5CHXA 3V2PA 5AW1B 2N9BA 4B86A 1URQB 1IFMA 1IFJA 3NTNA 3M0AA 3HD7A 3E1IA 1M1JB 1GW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL2 B;  4W7Z A;  1L4A D;  1SFC D;  1KIL C;  2N1T C;  5KJ7 C;  4WY4 B;  3B5N B;  3RK3 D;  5CCH A;  5CCG C;  3B5N D;  3RK3 B;  2H8P D;  1HVV A;  1T3J A;  1N7S C;  3KYQ A;  2NPS A;  2N1T B;  1N7S B;  2HG5 D;  3HD7 C;  4OH8 B;  2NPS B;  3RK2 B;  2KOG A;  3B5N C;  5CCG A;  1NHL A;  4JF7 A;  3M0D C;  1URQ A;  1N7S A;  1KIL A;  2N1T D;  1KIL B;  2N1T A;  1KIL D;  2YMY A;  2NPS C;  5CCH D;  3RL0 C;  1XTG B;  2WZ7 A;  4LGD E;  3RK2 C;  3HD7 B;  3HTK B;  3TSI A;  2XDJ A;  2HFE D;  4WY4 C;  4W80 A;  4WY4 D;  2M8R A;  4WY4 A;  5CCG D;  3RK3 C;  1JTH B;  5KJ7 D;  5KJ7 A;  1GL2 D;  1L4A C;  1SFC C;  4N78 E;  3RL0 D;  1GL2 A;  2NPS D;  5CCH C;  1L4A B;  1SFC B;  1L4A A;  1SFC A;  1GL2 C;  3VOP A;  3PP5 A;  1JTH A;  3B5N A;  3P8C E;  1URQ C;  1URQ D;  1N7S D;  1URQ B;  3RK2 D;  4W7Y A;  3HD7 A;  2PP6 A;  3HD7 D;  3RL0 B; 
#chains in the Genus database with same CATH topology
 1QL1 A;  3AE8 C;  4C7N B;  1GL2 B;  1PGO A;  2LR2 A;  3AE1 C;  2IBZ G;  1G1J A;  4IFM A;  3M0D A;  4R4M A;  1SQB G;  3L71 D;  3H6P A;  1SQP G;  4GOF A;  1NTZ E;  4OGQ C;  4PD4 H;  4XA4 A;  1YHQ P;  1AVY A;  2IX7 C;  5AVY B;  1JY2 O;  1KTM A;  1KQL A;  1NTZ K;  1U7M A;  3L73 G;  4WY4 B;  2M5A B;  3B5N B;  2QJY B;  2HPC B;  4PV1 D;  1SQX J;  1DD3 A;  1JY2 P;  1IFP A;  1KB9 H;  1S4X A;  4DZO A;  2H8P D;  3GHG C;  1EDJ A;  1SP4 A;  1FZA A;  1NTM K;  2GUV A;  3CI9 A;  2FYN C;  4HJG H;  3GHG A;  3MIW A;  3CXH D;  1E5W A;  1LP1 A;  1BGY E;  3KYQ A;  2QJK B;  3KPE A;  5CBN A;  4L74 A;  3Q5S A;  2A45 I;  2QE7 H;  3C9I A;  1GD2 E;  1SQB J;  3FGA D;  3TDK A;  1X8Y A;  1K73 Q;  5AVZ B;  3IN6 A;  1HBW A;  1OW7 A;  1JY3 N;  1E79 H;  1JCC A;  1NKZ B;  1ZN5 A;  3L73 J;  3VMY A;  2A06 D;  3OA7 A;  3L70 E;  2KYV A;  5AW0 B;  4BRY B;  2JP3 A;  4D6T E;  4R4L A;  3B4S A;  1GMJ A;  1LT9 A;  1VF5 B;  2JKV A;  3H1J D;  3Q1M A;  2Q5U A;  1HGV A;  1EDK A;  3HD7 C;  4OH8 B;  1LTT C;  1M56 D;  2LXC B;  3L75 G;  4N6J A;  3U1A A;  3W68 A;  1RF1 B;  2QRX A;  2E42 A;  4HKZ H;  2RH0 A;  1H88 A;  1EQ7 A;  1L0N K;  1FOS F;  1YQ3 C;  1SQX E;  1YTZ I;  2V7Q J;  5H2F H;  3L74 D;  4C46 A;  2GM4 A;  2IYO A;  5L8R J;  3M91 A;  3O8Z A;  3H1J J;  4OGQ B;  4U3F J;  1KQS O;  1LP1 B;  3G9R A;  2IZ1 A;  3H1I E;  3FXD A;  3GHG B;  3JSV C;  1OMI A;  2IFM A;  3GLM A;  5AW6 B;  2AXT E;  5KAI H;  3B5N C;  1MFT A;  1NHL A;  2W83 C;  2WSE H;  1L0N J;  3HE5 B;  3VMA A;  1S72 P;  1SQQ K;  2I1J A;  1IK9 A;  2QIW A;  2BEZ F;  1J1E B;  1NVO A;  2N1T D;  2YKQ A;  1S5L X;  1SS1 A;  3GMA A;  3IR9 A;  5AVV B;  2M3B A;  3V2N A;  1RF1 C;  4HYT B;  2HR3 A;  3V2R A;  1VQ7 P;  4LLH A;  4ZMD A;  2YXQ B;  2ZT9 B;  1JMB A;  4EDF A;  4L73 A;  1X22 A;  2WPS A;  4U3F G;  1GW4 A;  3OJA B;  1L0N D;  4PJ0 E;  1M8O B;  5GTI H;  5KLV E;  5AVR B;  4C7R A;  1WT6 A;  2A45 G;  3AEF C;  3G3Z A;  2KNC A;  1RF0 A;  2E74 B;  3HD7 B;  1RE4 C;  2A45 H;  4H44 C;  1P84 H;  3TSI A;  3LW5 H;  5AVW B;  3CLQ A;  2K9Y A;  3P8C D;  5AW7 B;  4EIJ A;  3H1L J;  4ZKU A;  2Z5H A;  4EOT A;  1BE3 J;  3L75 D;  1FU1 A;  2Z4E A;  1BDC A;  2HPC A;  2G8Y A;  3CCR P;  1KB9 I;  1ZRT E;  4WY4 A;  5GTH E;  1PIX A;  4GDO A;  1EZV E;  1MV8 A;  2VRS A;  3FWL A;  1KYO E;  3U59 A;  1AFO A;  3TGU J;  3RBX A;  4K35 A;  5KJ7 A;  4RO0 A;  2CPB A;  4HH2 A;  4H44 B;  2GA1 A;  1AV1 A;  1GL2 A;  2NPS D;  3VP9 A;  3WUV A;  5CCH C;  1VQO P;  2B87 B;  1L4A B;  1SFC B;  4JBZ A;  4JQ0 D;  1PGJ A;  3NXS A;  5TJH A;  5K5G B;  2Y9Z A;  1IZN B;  3H32 B;  3L72 D;  2KP8 A;  1GL2 C;  1T2K D;  1QLE D;  4H0L D;  2ITA A;  2XV5 A;  1Y47 A;  2Y0D A;  1FZE A;  2NRG A;  2J58 A;  2M0B A;  2B88 A;  2OTL P;  1KMI Z;  2E43 A;  3ZDM A;  2IYP A;  1KV4 A;  1P84 D;  3W67 A;  2L91 A;  5TIS H;  3HE5 A;  1RF0 C;  5APV A;  2HOD A;  2W27 A;  3RK3 E;  2CK3 H;  1M7L A;  1NTK D;  2BCC D;  3RK2 D;  1HF9 A;  3CC7 P;  1EZV I;  4W7Y A;  1S3J A;  2Y9Y A;  1KQG B;  1L0L G;  2PP6 A;  3PLN A;  3AE9 C;  3TGU E;  1OFC X;  1KYO I;  2OGU A;  2Q1K A;  2B87 A;  3HD7 D;  3RL0 B;  3V6I A;  4ZKP A;  1YI2 P;  4GOD A;  1LTG C;  2MKV A;  3CPW O;  1N7L A;  4W7Z A;  2LKM A;  4GOE A;  1GDT A;  3FXE A;  3U1C A;  1EXI A;  2FYU J;  1K04 A;  1RF1 A;  2AEJ A;  2KS1 A;  3A0H H;  5KJ7 C;  1USE A;  1KN7 A;  3TNU A;  5BVZ A;  4UB8 E;  1JCD A;  4I7Z C;  3RK3 D;  2ZVN B;  5CCH A;  3CCS P;  5CCG C;  2XND H;  4PD4 I;  3RK3 B;  3VYI A;  1HVV A;  2IBZ E;  3D70 A;  2ZXE B;  4KT0 J;  3AE2 C;  1N7S C;  3VN0 A;  2JWD A;  2QVA A;  1NTZ G;  2YIU C;  3T97 A;  1PP9 D;  1LGH B;  2FYU D;  1BE3 D;  1JY3 O;  3EWK A;  3HUS C;  3L75 J;  2E76 C;  3K5B A;  2K37 A;  1RE4 A;  1HJ0 A;  1S5L H;  2R3C A;  3HUS B;  4JYB A;  1OIP A;  1Y9B A;  2ZJS E;  3E1R A;  4H13 B;  2KSJ A;  4UB8 H;  3CCL P;  2K1A A;  3HUS A;  1H0T A;  1H0T B;  5KAF E;  1Y8A A;  4BWN A;  2O1J A;  1NAY A;  1LT9 C;  4Y28 J;  4EI2 A;  1YIT P;  3AEB C;  3BAT A;  4AUW A;  4I7Z B;  3L72 E;  2E5T A;  3IF4 A;  3KDP B;  1BGY G;  3F89 A;  3II6 A;  3L36 A;  3MUD C;  1CI6 B;  3AED C;  3VMX A;  1FZC B;  4WWI A;  4YXD C;  2MJZ A;  4N78 D;  1NWQ A;  2H7H A;  2V4H A;  3EFG A;  1SQQ E;  3IAO A;  1NU1 J;  2A06 E;  2SPZ A;  2PFX A;  1GTW A;  2FFD B;  1N8R Q;  1OXZ A;  3HE4 A;  3L70 G;  1UII A;  1KD1 Q;  2IFN A;  4C7N A;  1KFM A;  1BCC G;  2POH A;  3QH9 A;  2C0X A;  1DIP A;  1HGZ A;  2BAS A;  1OVR A;  2FYU K;  1FOS E;  3L75 E;  1N86 A;  3PHL A;  4RJT A;  1NJI Q;  4UB6 E;  1ZME C;  1EZV D;  1G2C A;  1NU1 K;  2HOD B;  3AE4 C;  2V7Q H;  5CCG A;  1SQX G;  4TLF A;  3CD6 P;  1PGQ A;  4H44 D;  4WB4 A;  2KIK A;  3S1K A;  2KZI A;  5AVS B;  3CXH H;  4I1L A;  1N7S A;  1KIL A;  3OW2 O;  4IFD K;  2P7J A;  3CX5 H;  4U3F D;  1YJN P;  2N1T A;  2WSF H;  3AE3 C;  3R2P A;  2RN0 A;  3L70 J;  3P7K A;  4KJM A;  1NTM D;  4D6T J;  3M9H A;  1M57 D;  2Z5I A;  1FZB A;  1XTG B;  3MZW B;  2Q3I A;  4LGD E;  3CX5 E;  3BCC J;  2QM8 A;  2YIU B;  4RKU J;  1NU1 E;  2IPP A;  4PD4 D;  1A02 J;  1FDM A;  3CXH E;  5E79 E;  2YKO A;  2K9J B;  2R5D A;  3CL3 D;  4N3Y B;  3P32 A;  3HE4 B;  3HTK B;  5AW8 B;  4ZNC A;  2XDJ A;  3Q3D A;  1M90 Q;  1MFZ A;  1ZW0 A;  2HFE D;  2QJY C;  2E76 D;  2WWW A;  4WY4 C;  3H1J E;  4U3F E;  1JEK A;  2B9B A;  1KQF B;  1QGK B;  3H1I J;  4W80 A;  1Q2N A;  1SQV D;  5AVT B;  2OYH A;  2JEE A;  2M8R A;  2KZJ A;  2WQY C;  1P84 E;  3Q2Y A;  1J1D B;  2CPS A;  3LW5 J;  2H43 A;  5C39 A;  1ZLL A;  3CX5 D;  2AEF A;  4NPF X;  1OW8 A;  4IL6 H;  1JB0 J;  5EFW B;  3VMZ A;  2W90 A;  3JC2 2;  3CCE P;  1SQX K;  4N78 E;  3H1H G;  3KHU A;  1U7J A;  2IDB A;  1SQX D;  1ZXG A;  3WU2 H;  1PGP A;  3M06 A;  5KLV J;  1LT1 A;  1D7M A;  1USD A;  2JWA A;  2KI7 B;  4QMA A;  1RQV A;  3BCC E;  4Y99 C;  2Q7C A;  2FY8 A;  1GU4 A;  3F5H A;  2XZR A;  3AE7 C;  3CCQ P;  1JOC A;  2YKP A;  3USS A;  1U57 A;  2W6J H;  3WMM 0;  3C1L A;  5KLI B;  5CMZ A;  1S5L E;  1SQP D;  4YTP C;  2K3R A;  1NYH A;  1PPJ D;  1BE3 E;  1JY3 P;  1URQ C;  2G3A A;  4LC1 A;  2O01 H;  5AW2 B;  1VQL P;  1L0L K;  2E74 D;  2B89 A;  2QA4 P;  3A3Y B;  3CWB J;  4NPE A;  2J5U A;  1LTJ C;  3GF7 A;  1FAV A;  1VDF A;  5APY A;  4ASV A;  3HTK A;  1RE3 A;  1YBK A;  2QSI A;  1PV3 A;  2P10 A;  4H0L C;  1YTZ T;  1NTM E;  1PFI A;  3A7O A;  1LJ2 A;  1X79 B;  3H1L G;  1LTA C;  1NAF A;  2R32 A;  1L2P A;  1X9V A;  3LIE A;  1L4A D;  1SFC D;  3H1K J;  3L74 J;  1KIL C;  2I8D A;  3TGU D;  2N1T C;  4EYY Q;  4TT3 H;  5AVU B;  2IZ0 A;  3D6Z A;  5APS A;  1FDI A;  1SQQ D;  1HUC A;  1G1I A;  1SQB K;  3ABV C;  3CWB G;  3H1H D;  1R5S A;  2JDI H;  1L0N G;  1ZP0 C;  3B5N D;  1TU3 F;  1EDL A;  2E74 C;  4YXW H;  3V4Q A;  1LTB C;  5BU8 B;  5TIS E;  1HH0 A;  2N9Y B;  2E5Y A;  2H88 C;  5KLI C;  1SQV J;  3IFM A;  4L76 A;  4DJG A;  3KZI H;  5AW3 B;  1W5C E;  1EC5 A;  1IK7 A;  2WVR A;  1EDI A;  2KK7 A;  2NPS A;  3L74 G;  3H1K G;  1BGY D;  3MUD A;  3R4Y A;  5M1B A;  1QVF O;  1LTI C;  1IFN A;  1BCC J;  1PPJ G;  1PP9 E;  1KC8 Q;  3I5C A;  1NTM J;  1LNQ A;  2QJP B;  4D6T D;  2IBZ I;  1H8A A;  1T3U A;  1BDD A;  2C9L Y;  1VQK P;  2FXO A;  3L4F A;  1DH3 A;  2AXC A;  4A7P A;  2ZXX A;  3E7K A;  1IFD A;  2Q9I A;  2HLO A;  3BRT B;  3N4X A;  1AA0 A;  2M5A A;  2ZT9 D;  5AVQ B;  2HG5 D;  5B5E E;  1S1C X;  3H1L D;  2WTY A;  2OYH B;  2FFD A;  2WSF J;  2ZAE B;  2R3S A;  4JYC A;  2I1K A;  3BAS A;  1OVV A;  3KXD A;  2OAR A;  2WSS H;  3L72 G;  2WSE J;  2BEQ D;  2YXR B;  2KNC B;  3L71 J;  3AEE C;  2NPS B;  2ZYD A;  2KLU A;  1MUU A;  5B66 E;  1SQV E;  2C0W A;  2ZYG A;  4ASW A;  3O6Q B;  4OVN F;  3ITK A;  1T6A A;  1SQQ G;  3NMD A;  2A06 G;  1OVU A;  1RH5 B;  2PAJ A;  3CCV P;  3MD0 A;  2QJK C;  1R5L A;  2H89 C;  1BSH A;  2D2C D;  2DW3 A;  5CJ0 A;  1S9K E;  1URQ A;  2W6B A;  1HJB A;  1VPC A;  1BCC E;  2FXP A;  1KIL B;  3GG2 A;  4JPZ B;  1T8Z A;  3TNU B;  1RY3 A;  1SQV K;  2JJL A;  1KIL D;  1T2K C;  1JM0 A;  3WUT A;  2FKW B;  2E75 D;  2Y0E A;  3L72 J;  2WMM A;  1LWU A;  1MKM A;  2R5B A;  1NO4 A;  4PJ0 H;  5APW A;  3WU2 E;  5KLV K;  1JO5 A;  1L0L D;  2NPS C;  5CCH D;  1RE3 C;  2W8Z A;  3RL0 C;  3BVH A;  4IL6 E;  5AW9 B;  2WZ7 A;  2KUB A;  2P67 A;  1SQQ J;  2FYN B;  2QJP C;  3M9Q A;  4L75 A;  3C8V A;  4WBA A;  3I56 P;  2XU6 A;  1VQ4 P;  1NKN A;  2HYN A;  3H1H J;  4IOI H;  2RMZ A;  2YNY A;  3L71 E;  3G6E P;  2OYH C;  2KXP B;  1N73 B;  1NTK J;  1L0L J;  2AXT H;  2BCC J;  2ZYA A;  5KAI E;  4AYC A;  1FZC A;  1A02 F;  1QX8 A;  1GZL A;  1NU1 G;  1FZC C;  1VQM P;  1KZU B;  4PV1 C;  3SFD C;  1NTZ D;  2FYU G;  5KTB A;  3RL0 g;  1W2E A;  2OYI A;  3H1J G;  2QEX P;  2E76 B;  1VQ9 P;  2R44 A;  4RES B;  2WT7 A;  4OGQ D;  2O1K A;  1J1D C;  1L4A C;  1SFC C;  3RL0 D;  1YJ9 P;  1GK6 A;  3SFE C;  2O01 N;  4YPC A;  3H32 A;  3MHV A;  1IO4 A;  1NTK G;  2BCC G;  4U7J A;  1JUN A;  1YJW P;  1L4A A;  1SFC A;  4GIF A;  1NTZ J;  3AEC C;  3VOP A;  4GT1 A;  1VL2 A;  2K88 A;  1LTS C;  2AEM A;  3GW6 A;  2NZ2 A;  3SWK A;  1Q81 Q;  1AVO A;  1LWU C;  1QVG O;  1HWT C;  3AEG C;  3PP5 A;  3H1H E;  2YO2 A;  1LWU B;  3Q5P A;  4CPG A;  3TF5 A;  1LTJ A;  2OYO A;  1URQ D;  2O01 J;  1Z56 A;  1N7S D;  2LXB A;  1YQ4 C;  3KZI E;  3BCC G;  1SVF A;  1BGY J;  3UIA A;  1VQ8 P;  1ZOY C;  4H0L B;  2P58 A;  1ZR4 A;  1BCC D;  1CSB A;  1YYC A;  2RKL A;  3A2A A;  4NPD A;  1KB9 E;  1SQB E;  1SQP E;  3N7N A;  1M1J A;  1K9M Q;  1UIX A;  2K9J A;  3H1I D;  3O6Q A;  3QWO C;  1H89 A;  1BE3 G;  2ZFC A;  3L73 E;  3A5T A;  1NU1 D;  2ZT9 C;  4PD4 E;  3D71 A;  4KHX A;  1YIJ P;  2OQQ A;  4M3L A;  3CC2 P;  1DX7 A;  1FS0 E;  3Q5R A;  2P1J A;  1J2J B;  1NH4 A;  2XKM A;  5APQ A;  1R8E A;  3CX5 I;  2OYI C;  1OWA A;  1NTM G;  1WRG A;  1NOH A;  1X0T A;  2E75 B;  2IBZ D;  4GKG A;  3CCM P;  3FX0 A;  1IFI A;  4BXL A;  5KLV D;  5APU A;  2D2C B;  1FC2 C;  1G2C B;  1T3J A;  2UWJ E;  2W6A A;  2QM7 A;  1PZQ A;  1QEX A;  3L73 D;  1FZG A;  1JY2 N;  1N73 A;  3EFF K;  2O3J A;  2WSC H;  1GU5 A;  3B71 A;  4H13 D;  4D6T G;  3B8E B;  3CWB E;  2KSE A;  1FDO A;  3MTU E;  2FFD C;  3LID A;  1S9K D;  2FXM A;  1IJD B;  1L0N E;  1SQP J;  2YO3 A;  3A0H E;  2P2U A;  3TYY A;  2Y0C A;  1Q7Y Q;  1K05 A;  3BRV B;  5AW5 B;  3L37 A;  4DT0 A;  4O9B A;  3SWF A;  1KIL E;  1FZF A;  1DEE G;  2OTJ P;  3PJS K;  1OX3 A;  2M3E A;  2N1T B;  2WPR A;  3PTZ A;  4AQR D;  5BU5 A;  3H25 A;  4OWF A;  5APX A;  3L74 E;  1CI6 A;  1N7S B;  1OZH A;  1FJK A;  2J59 M;  3EQ2 A;  3H1K E;  3H1I G;  3JCU E;  1SQP K;  3L35 A;  1FE6 A;  1PPJ E;  1XTC C;  1PP9 G;  3CXH I;  3PH0 A;  5APT A;  1EXJ A;  1VF5 C;  1NTK K;  2WIT A;  4HB1 A;  3VTP C;  3H1L E;  3S4R A;  1FBM A;  3A0B E;  2ZVO B;  3RK2 B;  1HTL C;  1VQ5 P;  1OW6 A;  3AEA C;  1IC2 A;  2PGD A;  3NFQ A;  1CZQ A;  2KOG A;  4I6M C;  3RBZ A;  2C9N Y;  4JF7 A;  1RHZ B;  5KLV G;  1BSN A;  1VF5 D;  3M0D C;  5E79 H;  5AVX B;  3WUU A;  1FJP A;  1DD4 A;  1SLQ A;  1PP9 J;  3OAK A;  1SQV G;  1KFN A;  1LTJ B;  1ZV8 A;  4DCK A;  1AQ5 A;  2YMY A;  3M9B A;  3CMA P;  1JNM A;  3KQG A;  1J1E C;  2KLV A;  1M1J C;  2E75 C;  4I2L C;  2KB7 P;  4Z1M H;  1KYO H;  2Q6Q A;  4K3A A;  1GK4 A;  2FYZ A;  2Q3E A;  2WPV B;  3VP8 A;  5CBO A;  3MP7 B;  1VQ6 P;  1VQN P;  2D2C C;  3RK2 C;  3G71 P;  5GTH H;  3I55 P;  1EZV G;  1ZRT D;  1W2B O;  1QL2 A;  1JMM A;  3AE6 C;  4H13 C;  3T97 B;  4Y99 B;  4IFF A;  4UB6 H;  3CCU P;  2WT7 B;  3D6Y A;  3V2Q A;  3CWB D;  4PV1 B;  3TK1 A;  2OYI B;  1WMK A;  4WY4 D;  1LT9 B;  3A0B H;  2L5G B;  3HRN A;  4XFJ A;  5KKZ B;  5DJT B;  5CCG D;  4BRY A;  2KS1 B;  3RK3 C;  2XNX A;  5AW4 B;  1JTH B;  1KB9 D;  1SQB D;  3L71 G;  3PRJ A;  5KJ7 D;  1N73 C;  1Q90 D;  1DEB A;  4MN4 C;  5GTI E;  1GL2 D;  3JCU H;  3CCJ P;  2GUS A;  3H1K D;  1AJY A;  1S2E A;  3FWN A;  2JO1 A;  3RGU A;  1Q86 Q;  3MGN A;  1M1K Q;  1KOR A;  3SSU A;  1MZ9 A;  3L70 D;  3V4W A;  5CJ4 A;  1ZR2 A;  2FYU E;  2OTK E;  5DJU B;  4IL6 X;  3S9O A;  4WVZ A;  2QG4 A;  3P8M C;  5KKZ C;  4DOJ A;  2WPQ A;  5KAF H;  2JR8 A;  3BCC D;  1JTH A;  3B5N A;  3SWY A;  3V5B A;  2WSC J;  1N2D C;  4XE5 B;  1NTK E;  1L0L E;  2BCC E;  3P8C E;  3TGU G;  1VQP P;  3AE5 C;  3CME P;  1CW5 A;  5B66 H;  3GF3 A;  5CHX A;  2PRR A;  3V2P A;  1K8A Q;  5AW1 B;  2N9B A;  4B86 A;  1URQ B;  5H2F E;  1NGM B;  1PL5 A;  1IFM A;  3CC4 P;  3G4S P;  1P84 I;  1IFJ A;  1Q82 Q;  3NTN A;  1KYO D;  1AQT A;  3M0A A;  2YMK A;  3HD7 A;  3E1I A;  2FBW C;  1GW3 A;  1M1J B;  5B5E H;  1RQU A; 
#chains in the Genus database with same CATH homology
 1QL1 A;  4C7N B;  1GL2 B;  1G1J A;  4IFM A;  3M0D A;  3H6P A;  4XA4 A;  2IX7 C;  5AVY B;  1JY2 O;  1KQL A;  1NTZ K;  4WY4 B;  3B5N B;  2HPC B;  1JY2 P;  4DZO A;  2H8P D;  3GHG C;  1SP4 A;  1FZA A;  1NTM K;  2GUV A;  3CI9 A;  3GHG A;  3MIW A;  1E5W A;  3KYQ A;  3KPE A;  2A45 I;  3C9I A;  1GD2 E;  1X8Y A;  1JY3 N;  1JCC A;  1NKZ B;  1ZN5 A;  3VMY A;  5AW0 B;  3OA7 A;  2KYV A;  1LT9 A;  2Q5U A;  1HGV A;  3HD7 C;  4OH8 B;  2C9N Y;  1LTT C;  4N6J A;  1RF1 B;  3U1A A;  2E42 A;  1H88 A;  1EQ7 A;  1L0N K;  1FOS F;  1YTZ I;  2GM4 A;  4C46 A;  3M91 A;  3O8Z A;  3GHG B;  2IFM A;  5AW6 B;  3B5N C;  1NHL A;  2WSE H;  3HE5 B;  1SQQ K;  2I1J A;  1IK9 A;  3VP9 A;  3IR9 A;  1J1E B;  2N1T D;  2YKQ A;  5AVV B;  3V2N A;  2M3B A;  1RF1 C;  4HYT B;  3V2R A;  4LLH A;  2WPS A;  1GW4 A;  3OJA B;  5AVR B;  4C7R A;  1WT6 A;  2A45 G;  3G3Z A;  1RF0 A;  3HD7 B;  1RE4 C;  2A45 H;  3TSI A;  4EIJ A;  3LW5 H;  5AVW B;  3CLQ A;  3P8C D;  5AW7 B;  2Z5H A;  4EOT A;  1FU1 A;  2Z4E A;  2HPC A;  4WY4 A;  1MV8 A;  2VRS A;  3U59 A;  5KJ7 A;  2CPB A;  4HH2 A;  1GL2 A;  2NPS D;  5CCH C;  1AFO A;  1L4A B;  1SFC B;  3NXS A;  3H32 B;  2KP8 A;  1GL2 C;  1T2K D;  2XV5 A;  1FZE A;  2J58 A;  3HE5 A;  1RF0 C;  5APV A;  2HOD A;  2W27 A;  1M7L A;  3RK2 D;  4W7Y A;  2PP6 A;  3HD7 D;  3RL0 B;  4ZKP A;  1LTG C;  1N7L A;  4W7Z A;  2LKM A;  1GDT A;  3U1C A;  1RF1 A;  5KJ7 C;  3TNU A;  5BVZ A;  1JCD A;  3RK3 D;  5CCH A;  5CCG C;  3RK3 B;  3VYI A;  1HVV A;  2ZXE B;  1N7S C;  3VN0 A;  3T97 A;  5CJ4 A;  1LGH B;  1FDM A;  1JY3 O;  3HUS C;  1RE4 A;  2R3C A;  3HUS B;  4JYB A;  2KSJ A;  3HUS A;  2O1J A;  4AUW A;  1LT9 C;  3BAT A;  3KDP B;  3II6 A;  3L36 A;  1CI6 B;  2MJZ A;  4N78 D;  1NWQ A;  2H7H A;  3EFG A;  1GTW A;  2FFD B;  1OXZ A;  3HE4 A;  2IFN A;  4C7N A;  1KFM A;  2POH A;  2C0X A;  1HGZ A;  2BAS A;  2FYU K;  1FOS E;  1N86 A;  1G2C A;  1NU1 K;  2HOD B;  5CCG A;  4WB4 A;  5AVS B;  4I1L A;  1N7S A;  1KIL A;  4IFD K;  2P7J A;  2N1T A;  2WSF H;  3R2P A;  3P7K A;  3M9H A;  2Z5I A;  1FZB A;  1XTG B;  2Q3I A;  4LGD E;  2QM8 A;  2IPP A;  1A02 J;  2E43 A;  3VMX A;  2YKO A;  2R5D A;  3CL3 D;  4N3Y B;  5AW8 B;  3P32 A;  3HE4 B;  3HTK B;  1HBW A;  2XDJ A;  1MFZ A;  2HFE D;  2WWW A;  4WY4 C;  4W80 A;  5AVT B;  2OYH A;  2JEE A;  2M8R A;  1J1D B;  2CPS A;  2H43 A;  1ZLL A;  3VMZ A;  1SQX K;  4N78 E;  3M06 A;  4Y99 C;  2Q7C A;  1GU4 A;  2XZR A;  1JOC A;  2YKP A;  3WMM 0;  5CMZ A;  1URQ C;  1JY3 P;  4LC1 A;  2O01 H;  1L0L K;  3A3Y B;  1LTJ C;  1FAV A;  1VDF A;  5APY A;  3HTK A;  1RE3 A;  1YTZ T;  1PFI A;  3A7O A;  1X79 B;  1LTA C;  1NAF A;  2R32 A;  3LIE A;  1X9V A;  1L4A D;  1SFC D;  1KIL C;  2N1T C;  5AVU B;  5APS A;  1HUC A;  1G1I A;  1SQB K;  3B5N D;  3V4Q A;  1LTB C;  5BU8 B;  1HH0 A;  3IFM A;  5AW3 B;  2NPS A;  3MUD A;  1LTI C;  1IFN A;  3I5C A;  1H8A A;  2C9L Y;  1T3U A;  3L4F A;  1DH3 A;  2Q9I A;  1IFD A;  2HLO A;  3BRT B;  3N4X A;  5AVQ B;  2OYH B;  2HG5 D;  2WTY A;  4JYC A;  2I1K A;  3BAS A;  2OAR A;  2NPS B;  1MUU A;  2C0W A;  3NMD A;  2PAJ A;  3MD0 A;  5CJ0 A;  1S9K E;  1URQ A;  2W6B A;  1HJB A;  1VPC A;  1KIL B;  1T8Z A;  3TNU B;  1RY3 A;  1SQV K;  2JJL A;  1KIL D;  1T2K C;  2FKW B;  1LWU A;  2R5B A;  1NO4 A;  5APW A;  5KLV K;  1JO5 A;  2NPS C;  5CCH D;  1RE3 C;  3RL0 C;  3BVH A;  5AW9 B;  2WZ7 A;  2P67 A;  3M9Q A;  4WBA A;  2XU6 A;  1NKN A;  2HYN A;  2OYH C;  2FFD A;  2YNY A;  1N73 B;  4AYC A;  1FZC A;  1A02 F;  1GZL A;  1FZC C;  1KZU B;  5KTB A;  1W2E A;  2OYI A;  4RES B;  2WT7 A;  2O1K A;  1J1D C;  1L4A C;  1SFC C;  3RL0 D;  1GK6 A;  1IO4 A;  3H32 A;  1JUN A;  1L4A A;  1SFC A;  4GIF A;  3VOP A;  4GT1 A;  1LTS C;  1LWU C;  1HWT C;  3PP5 A;  2YO2 A;  1LWU B;  1LTJ A;  1URQ D;  1Z56 A;  1N7S D;  1SVF A;  3UIA A;  1ZR4 A;  1CSB A;  1YYC A;  3A2A A;  3N7N A;  1M1J A;  1H89 A;  2ZFC A;  3A5T A;  4KHX A;  4M3L A;  1DX7 A;  2P1J A;  1J2J B;  1NH4 A;  2XKM A;  5APQ A;  2OYI C;  1OWA A;  1WRG A;  1NOH A;  4GKG A;  1IFI A;  5APU A;  1FZC B;  1G2C B;  1T3J A;  2W6A A;  1FZG A;  2QM7 A;  1N73 A;  1JY2 N;  2WSC H;  1GU5 A;  3B8E B;  3MTU E;  2FFD C;  3LID A;  1S9K D;  2FXM A;  1IJD B;  2YO3 A;  3TYY A;  2P2U A;  3BRV B;  5AW5 B;  3L37 A;  4O9B A;  3SWF A;  1FZF A;  5BU5 A;  2WPR A;  2N1T B;  4AQR D;  5APX A;  1CI6 A;  1N7S B;  2J59 M;  1FJK A;  3EQ2 A;  5AVZ B;  4ZKU A;  5AW2 B;  3L35 A;  1SQP K;  1XTC C;  5APT A;  1NTK K;  2WIT A;  3VTP C;  1FBM A;  3RK2 B;  1HTL C;  3NFQ A;  4I6M C;  1IC2 A;  1CZQ A;  2KOG A;  4JF7 A;  3M0D C;  5AVX B;  1FJP A;  1SLQ A;  3OAK A;  1KFN A;  1LTJ B;  1ZV8 A;  1AQ5 A;  2YMY A;  3M9B A;  1JNM A;  3KQG A;  1J1E C;  2KLV A;  1M1J C;  4I2L C;  2KB7 P;  1GK4 A;  2FYZ A;  3VP8 A;  3RK2 C;  1QL2 A;  1JMM A;  4Y99 B;  4IFF A;  2WT7 B;  3V2Q A;  3TK1 A;  2OYI B;  4WY4 D;  1LT9 B;  3HRN A;  2L5G B;  5CCG D;  3RK3 C;  2XNX A;  5AW4 B;  1JTH B;  1N73 C;  5KJ7 D;  1DEB A;  1GL2 D;  2GUS A;  3MGN A;  1MZ9 A;  3V4W A;  1ZR2 A;  3P8M C;  4DOJ A;  2WPQ A;  1JTH A;  3B5N A;  3SWY A;  3V5B A;  1N2D C;  4XE5 B;  1CW5 A;  3P8C E;  5CHX A;  3V2P A;  5AW1 B;  2N9B A;  4B86 A;  1URQ B;  1IFM A;  1IFJ A;  3NTN A;  3M0A A;  3HD7 A;  3E1I A;  1M1J B;  1GW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...