4WY4D

Crystal structure of autophagic snare complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
65
structure length
64
Chain Sequence
HLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKVRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein 8
total genus 32
structure length 64
sequence length 65
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4D00
2NPSB 5KJ7D 2NPSD 1JTHB 1N7SB 1GL2C 2N1TC 3RK2D 3PP5A 5CCHA 2HFED 1JTHA 1GL2B 1SFCA 3RL0C 2H8PD 3B5ND 3B5NB 5CCHC 5CCGC 2YMYA 3VOPA 2PP6A 1GL2A 1SFCB 3RK3C 3RK3D 3RK2C 1L4AA 4WY4C 3RK2B 4LGDE 4OH8B 3HD7C 3HD7D 3HD7B 1URQA 2M8RA 3HD7A 2WZ7A 1SFCD 3HTKB 1T3JA 1URQD 1HVVA 3B5NC 3P8CE 4JF7A 3RL0B 5CCGD 2HG5D 1L4AD 1L4AB 3M0DC 2N1TB 1N7SC 2N1TD 5KJ7C 2NPSC 2XDJA 1URQB 5KJ7A 4W80A 4N78E 1KILA 1N7SA 1XTGB 2KOGA 3RL0D 1KILB 1KILC 5CCHD 1KILD 1N7SD 3B5NA 5CCGA 4W7ZA 3KYQA 4WY4D 4WY4B 1SFCC 1GL2D 1URQC 4W7YA 2N1TA 2NPSA 4WY4A 1L4AC 3RK3B 3TSIA 1NHLA
chains in the Genus database with same CATH superfamily
3UIAA 5CHXA 1N73B 4IFDK 3FGAD 3L73E 4D6TG 2W83C 3AECC 3FWNA 3L73J 4PD4I 1JTHB 3FWLA 2KNCA 1OVVA 5AVQB 1IO4A 4OVNF 2N1TC 1RF0A 1EDLA 1BE3E 1YJ9P 5CCHA 3CCQP 2W27A 1JTHA 1PPJG 2WT7B 1DD4A 2A06E 1GL2B 4H0LD 1E5WA 2FYUK 4N6JA 1BCCE 1X0TA 2XU6A 3A2AA 3B5ND 1SQVD 1S5LE 4IL6X 4EIJA 3I55P 2Y9YA 3FXDA 2ZAEB 1FU1A 2CPSA 2P7JA 5BU5A 1RQVA 1SLQA 1CW5A 2YNYA 1HJ0A 2PP6A 1GL2A 1L0LG 1ZV8A 2D2CC 3L71D 4O9BA 2OYIC 3MD0A 1BSHA 2JO1A 1BGYJ 3G9RA 4L74A 3RK3D 3OA7A 1LWUB 1Y47A 3PLNA 3Q5RA 1H89A 1IFPA 2B87A 2HODA 2KK7A 1KQSO 1HGVA 2Y0CA 3L70D 1BGYD 3H1LG 1L2PA 1RE3C 1S2EA 1OXZA 1EDKA 1RY3A 3IF4A 2V4HA 1SQPD 2IZ1A 3CX5D 3Q3DA 1YTZI 2FYUG 3VMAA 1PGPA 1GU4A 1BE3J 3QWOC 4WBAA 1FOSE 3WUUA 3A3YB 1QGKB 3HD7D 2GUSA 3VMXA 4Z1MH 1JY3P 5BVZA 2FYUE 2Q5UA 2W8ZA 3GHGA 1NTZJ 1VF5D 3AEDC 3R4YA 5AW4B 2ZFCA 3HE4A 5AW0B 2M8RA 1JCCA 2G8YA 1AVYA 1QL1A 3SWKA 1SQQK 1FDMA 3HE5B 3BRTB 5GTIE 5C39A 2KB7P 2KSJA 2L91A 2MKVA 2R5BA 1SFCD 2WZ7A 1M57D 1SP4A 3GG2A 1SQBG 3L73G 2M5AB 4IL6H 3L73D 4PD4H 5AVVB 4BXLA 1DH3A 1HVVA 2JDIH 1KQFB 2ZT9D 3GLMA 1NKNA 1SQBE 2JWAA 3HE5A 1KFNA 3M9HA 1P84E 4I1LA 5H2FE 1Q81Q 1KC8Q 1PZQA 1KV4A 1KTMA 3S1KA 1GK6A 4JF7A 1LTBC 2KLUA 1N8RQ 3TGUE 1Z56A 2KS1A 4D6TE 2OYHC 1BCCG 3CC4P 4PV1B 2HG5D 2QM8A 3T97A 1NTMK 3CXHE 4I7ZC 2E74B 2O01N 3IR9A 5AVYB 1EZVI 2KS1B 1L4AB 3L75D 1OX3A 3G3ZA 4ZNCA 2N1TD 1M56D 2WQYC 4JBZA 2D2CD 3ZDMA 3BCCE 3GHGC 5KJ7C 3HUSC 1LTTC 2NPSC 5APTA 3H1LD 2KIKA 2E76C 1KQLA 3CPWO 1NO4A 2KYVA 4BWNA 1RF1C 4W80A 5H2FH 2W6AA 1QL2A 2W6JH 3HRNA 2RN0A 1ZXGA 2KNCB 1SQVJ 1G1JA 3CMAP 2AXCA 4N3YB 5GTHE 2E75C 3LIDA 3M9QA 3VYIA 1NU1E 3RL0D 3L75J 1RF0C 1VQ5P 1IC2A 3TGUJ 4Y99C 2SPZA 1KILC 2WT7A 2WSSH 3S9OA 3AE1C 1JOCA 1P84I 1J1EB 3WU2H 4Y28J 1FZCC 3V2NA 1K73Q 1PP9G 3B71A 5B5EE 2R44A 2FFDA 1VQ9P 3CCJP 3AEAC 4K3AA 1DIPA 1PP9E 4EI2A 3KYQA 1IZNB 2IYPA 4WY4D 3JSVC 1SFCC 2FKWB 2C9NY 3MUDC 2FFDB 1FJPA 5TJHA 1EZVE 1HJBA 1L0NG 3L72D 2CK3H 2HODB 4H44D 1KYOH 2JKVA 1SQVG 2QEXP 2NPSA 3I5CA 3L71E 3HUSA 3P8CD 1HTLC 2FXOA 5CMZA 4A7PA 1FZGA 3AE5C 1JO5A 5KLVE 2ZXXA 1K05A 3FX0A 3L71G 3TYYA 3H1IJ 1K8AQ 3VMYA 1SQBK 2K1AA 4U3FD 1IFDA 2NPSB 2K9JA 1S5LX 4IL6E 1PIXA 5APUA 1VQKP 3GHGB 3EFFK 1NTKE 2C0XA 1NTMD 1X9VA 4AYCA 1GL2C 2WSEH 2OTLP 2IBZI 1P84H 1Q90D 1SQQE 3AEGC 3H1HG 3Q2YA 2I1KA 1AV1A 2HFED 1G2CB 5DJTB 1EZVD 1GTWA 1L0ND 3D6YA 1ZR4A 1SQQG 1W2EA 3N7NA 2J5UA 1SQVK 4H0LB 4ZKUA 5KJ7A 1UIXA 2A06D 1KYOE 2H8PD 1EQ7A 1KB9E 4HYTB 4L75A 2QM7A 3B5NB 4LLHA 4ASVA 5AW1B 2Z5HA 2IFMA 1J1DB 1G2CA 5CCGC 1PFIA 1NU1G 5B66H 2BCCJ 2QA4P 1H8AA 1YJWP 4LC1A 5APVA 1NKZB 2Q3EA 4U3FE 3RK3C 1X22A 2KXPB 1JY2P 3Q5PA 1LT1A 1SQBD 3A0HH 1S9KE 1FS0E 1UIIA 2QIWA 3D70A 2GUVA 3BCCJ 5APYA 3U1AA 1L4AA 2W6BA 2O01H 1CSBA 4RESB 4R4MA 1YTZT 3EQ2A 2ZXEB 3H1JD 4U7JA 1DEBA 4OH8B 4WY4C 4OGQD 2OGUA 4RKUJ 2Q7CA 3RK2B 3VMZA 1W2BO 2A45G 1IK9A 1VPCA 5GTHH 3L74E 1YJNP 3HD7B 3E1RA 3MP7B 3F5HA 3CX5I 2K88A 1VF5B 1N86A 2FYNC 2BEZF 5AVWB 3WU2E 1A02J 2BCCG 4YXWH 3WUTA 5B66E 1J1DC 2KUBA 3L75E 2OQQA 4C7NB 3HD7A 1YI2P 2YMKA 4H13C 5AVTB 1KYOI 1PV3A 2DW3A 2KZIA 1RE4C 1SQQJ 2FY8A 3H6PA 1BDCA 3L72J 4CPGA 2WSEJ 1FZEA 2Q1KA 1NVOA 2E76D 2KSEA 1BCCJ 3N4XA 1G1IA 1GDTA 1GZLA 2WPQA 1SQQD 1JB0J 2Q6QA 1M8OB 3NFQA 1CI6B 4XE5B 2QJYB 2IPPA 2B89A 2IZ0A 3MIWA 1H0TB 1EXJA 3H32B 5KAIH 1D7MA 3NMDA 3PRJA 5AVUB 1KN7A 2E75D 2YIUB 1KB9D 2E74C 1JCDA 2FXMA 2WMMA 3H1IG 2ZYGA 5TISE 1CI6A 3BRVB 3KXDA 2A45I 1PP9D 2J58A 1JMBA 1FZAA 5KLIB 3H32A 2E43A 3C9IA 3HUSB 2E5TA 1AQ5A 2E42A 3SFEC 1KZUB 1BE3G 2VRSA 1YBKA 3H1HJ 1BDDA 1URQB 2YKQA 1NAYA 2WWWA 3NXSA 3SSUA 1N7LA 2Y9ZA 3C8VA 2K9JB 3CX5H 2HLOA 1S72P 1FZFA 1FBMA 1PPJD 2QE7H 1KILA 5CJ4A 5CJ0A 3EWKA 2B88A 1KORA 4HKZH 4H44C 1M1JA 4NPDA 5APSA 2YO3A 3WMM0 3L74G 5KLVD 5GTIH 1RF1B 1NU1J 4OWFA 3KZIH 3L74D 1KILB 3M91A 5CCHD 5TISH 1LTSC 1MV8A 1QLED 2H43A 1AJYA 2QJPB 1Y8AA 3A0HE 1JY3O 3L36A 1RE3A 1HF9A 2YXRB 2WSCJ 3B5NA 3BATA 4JYBA 2NZ2A 1OW7A 3VN0A 5CCGA 1L0NJ 1EC5A 1IFJA 1KFMA 1LTJA 1LTIC 1OZHA 2QJKC 1GL2D 2V7QJ 2WSCH 1R5LA 2PGDA 4WY4B 1M1KQ 1T3UA 1WRGA 1USEA 3QH9A 4W7YA 3CXHH 3D6ZA 5AVZB 1MZ9A 4H44B 1LTJB 4L73A 4WY4A 1T2KC 1H88A 1FAVA 2WITA 2POHA 2WPSA 1L4AC 4U3FJ 3MZWB 1FJKA 4DCKA 3CC7P 2AEJA 3H1ID 1S3JA 1FDIA 3H1KJ 5EFWB 4H13D 1NHLA 5AW6B 3RK3B 2IBZE 4YPCA 3TDKA 1L0NK 2UWJE 5KJ7D 1NTZD 2R5DA 2JJLA 3JCUH 2NPSD 1GU5A 2XV5A 1RQUA 3PHLA 5L8RJ 1N7SB 2YXQB 3SFDC 3G71P 5AW3B 4EOTA 2NRGA 3TF5A 1Q2NA 1VQOP 4D6TJ 2GM4A 1KB9I 3P7KA 2LXBA 2KZJA 4L76A 3CCRP 4C7NA 4YXDC 3A5TA 3L74J 1USDA 1BSNA 1XTCC 2FYUD 2I8DA 1VQ8P 3TGUG 1VQMP 1SFCA 3SWYA 1SQXE 1HGZA 3V6IA 1T2KD 1HH0A 1PPJE 5KAIE 1RH5B 3A7OA 5B5EH 1QX8A 4UB8H 3VOPA 2YO2A 4TLFA 2P2UA 3L71J 1SFCB 1SQPK 1Q86Q 1NU1D 1W5CE 2AEMA 5CBOA 5KLVJ 1N2DC 1H0TA 1L0LE 1MFTA 4B86A 4HB1A 1PL5A 2RKLA 1S9KD 1L0LK 1ZOYC 2AXTE 4RO0A 2P10A 1LTGC 2O01J 3JC22 2WSFJ 1OFCX 1EDIA 5KAFE 1Q82Q 1OW6A 4C46A 1SQPE 3CX5E 1VQLP 2PAJA 3H1HD 5DJUB 3CCSP 3H1LJ 3P32A 1AQTA 3TNUB 1SQPG 3H1JE 3HD7C 4OGQB 1SQXD 1SQXK 4I6MC 1URQA 1LNQA 1TU3F 1BCCD 1ZR2A 1AVOA 1NJIQ 2QSIA 4Y99B 1NTZG 3AE7C 4D6TD 1WT6A 5APWA 1M1JB 3AEEC 2G3AA 2JR8A 2LXCB 3GF3A 3HTKB 1OWAA 2OARA 3K5BA 1DD3A 1RF1A 2Z4EA 4NPEA 3LW5J 2H89C 1T8ZA 2ZT9C 1P84D 3WUVA 5AVRB 5K5GB 1FE6A 3CWBJ 1NAFA 2BEQD 5AW2B 5KAFH 3AE3C 3HTKA 2E76B 3B5NC 3AE9C 1AA0A 3MHVA 3V5BA 3PJSK 3RL0B 2OYOA 2A06G 1X8YA 4XFJA 4ZKPA 2CPBA 1SQXG 4GOFA 1GMJA 2IDBA 4JYCA 5KLVG 3GW6A 1NGMB 1KYOD 3II6A 3PH0A 1ZRTE 2XNDH 1OMIA 3BCCG 3M0DC 4AQRD 3CCVP 1KD1Q 1JNMA 2Q9IA 5KTBA 4AUWA 3CCMP 1ZN5A 1LT9C 3V2QA 1JY2N 4MN4C 5AW5B 3NTNA 1BE3D 2N9YB 3MGNA 4IFFA 2XNXA 3IFMA 5APQA 1NTKJ 3TK1A 4GOEA 1VQ7P 2LKMA 3H1LE 5AVXB 1VQ4P 3CWBG 3OW2O 3VP9A 2ZYDA 3KPEA 1VQPP 3M9BA 2ZT9B 1N7SA 1K9MQ 3CMEP 1VDFA 2KOGA 3CC2P 1GD2E 2IYOA 2Z5IA 5AW9B 1JM0A 2RMZA 2LR2A 5APXA 2E5YA 3P8MC 2Y0DA 2KLVA 3RK3E 2BCCD 1NYHA 1KILD 1IJDB 3AE8C 3B4SA 1NTKD 3MTUE 2GA1A 2O1JA 1S5LH 4IOIH 1NTKK 2XKMA 3BASA 1FDOA 3PTZA 1VQ6P 2Y0EA 2AXTH 4KJMA 1LP1A 2IX7C 1OVRA 3CCEP 2V7QH 1NWQA 4WVZA 4W7ZA 3V4WA 1J1EC 1PP9J 1L0NE 3AE2C 3KQGA 4GDOA 4K35A 3S4RA 2D2CB 1Q7YQ 1IK7A 4EDFA 3GMAA 1URQC 3RL0g 3IAOA 4PD4D 5KLVK 2FXPA 1R8EA 4ZMDA 1NTMJ 2QVAA 2N1TA 4KT0J 3ABVC 5KKZB 4I2LC 2M0BA 2HPCA 1LT9A 2PFXA 2BASA 1ZLLA 4PJ0E 1Y9BA 2P58A 2OYIB 3TNUA 2ZVNB 1NTKG 3CCLP 2WPRA 1LT9B 1ZRTD 4RJTA 1S4XA 3H1HE 3M0AA 2OYHA 3E7KA 1CZQA 2I1JA 4C7RA 2JEEA 2P67A 1WMKA 2OYIA 1N73C 3RK2D 1YHQP 2H88C 3PP5A 4GODA 3O6QB 3E1IA 3H25A 1E79H 3CWBE 3TGUD 4PD4E 2FBWC 3KZIE 1PGOA 4ASWA 3A0BE 2OYHB 1HWTC 1LTJC 1U57A 1SQXJ 3RL0C 5BU8B 1PGJA 3CLQA 3CXHD 2C9LY 2HR3A 5CCHC 3F89A 4IFMA 4DJGA 2OTKE 2M3BA 2YMYA 4U3FG 1LJ2A 4WB4A 5E79H 1IFMA 3H1KG 4JQ0D 1U7JA 2YIUC 3W68A 1NOHA 3BCCD 3Q1MA 1A02F 2R3CA 3L37A 1RHZB 2XZRA 5KKZC 1M90Q 1ZMEC 1SQBJ 2L5GB 3L70E 3CD6P 4TT3H 3RBZA 3AEFC 3IN6A 3KHUA 1NTMG 3RK2C 3FXEA 4XA4A 3U59A 2FFDC 1FZBA 1IFNA 3L70G 5M1BA 2JWDA 2PRRA 1HBWA 1FZCA 3L4FA 1U7MA 1NTME 1QVFO 3V4QA 1EZVG 2C0WA 4LGDE 1HUCA 3LIEA 3OJAB 4OGQC 1KQGB 2J59M 2QG4A 3A0BH 5AVSB 1MFZA 1PGQA 1SQVE 3JCUE 2FYZA 2FYUJ 3I56P 1GW3A 1S1CX 2MJZA 4EYYQ 1IFIA 1RE4A 1T6AA 5E79E 3H1KD 5CBNA 2ZYAA 2KP8A 4YTPC 3O8ZA 2YKPA 1GW4A 1MUUA 3CCUP 2M3EA 4DOJA 2KI7B 4GIFA 1T3JA 1URQD 3G4SP 1JY2O 2K37A 1YQ4C 2AEFA 1LWUC 5KLIC 1YIJP 1R5SA 3L72E 2WPVB 1EXIA 1KMIZ 2P1JA 3Q5SA 3LW5H 1MKMA 1JEKA 4UB8E 3V2PA 3L72G 3P8CE 1JMMA 1JY3N 1ZP0C 1LP1B 2R32A 2RH0A 5CCGD 2ITAA 2QJYC 1OW8A 1LWUA 4PV1D 1QVGO 3R2PA 4KHXA 2QRXA 2ZVOB 2B87B 3VTPC 4PJ0H 3H1JJ 2E74D 1OVUA 3AE4C 2IBZG 3C1LA 4GT1A 1KILE 2YKOA 2WTYA 1L4AD 3H1KE 3AEBC 1X79B 1AFOA 2N1TB 3L70J 3L35A 1N7SC 1YYCA 3BVHA 1VQNP 2HPCB 4UB6H 3EFGA 4BRYA 3GF7A 1OIPA 3CXHI 1M7LA 1YITP 4JPZB 1SQPJ 1GK4A 2B9BA 2XDJA 4M3LA 2O3JA 1SVFA 2WSFH 2FYNB 2K9YA 3HE4B 1LGHB 2N9BA 4I7ZB 4R4LA 4DT0A 3ITKA 1NU1K 1DEEG 4N78E 4BRYB 4PV1C 1EDJA 1K04A 1XTGB 4NPFX 1FOSF 1DX7A 3CL3D 2IBZD 4H13B 2H7HA 2M5AA 1VL2A 4GKGA 3O6QA 3W67A 1JUNA 2R3SA 1N7SD 2BCCE 3RBXA 1VF5C 1KB9H 2QJKB 2E75B 3L75G 3SWFA 3G6EP 3KDPB 3RGUA 1QEXA 1BGYE 3AE6C 2ZJSE 3CI9A 4WWIA 1M1JC 4UB6E 1BGYG 2W90A 1YQ3C 1NTZK 2O1KA 2QJPC 2WVRA 5AW8B 3T97B 4DZOA 1ZW0A 2OTJP 1FC2C 3CWBD 3M0DA 4HJGH 1LTAC 1SS1A 5AW7B 3D71A 3H1JG 3USSA 1J2JB 4N78D 3U1CA 4HH2A 1N73A 2HYNA 4H0LC 3M06A 4QMAA 3VP8A 3MUDA 2A45H 2IFNA 3OAKA 2K3RA 1FZCB 1NH4A 2Q3IA 3TSIA 3V2RA 1L0LD 1L0LJ 3B8EB 3H1IE 1NTZE 2JP3A
chains in the Genus database with same CATH topology
3UIAA 5CHXA 1N73B 4IFDK 1JTHB 5AVQB 1IO4A 2N1TC 1RF0A 5CCHA 2W27A 1JTHA 2WT7B 1GL2B 1E5WA 2FYUK 4N6JA 3A2AA 2XU6A 3B5ND 4EIJA 1FU1A 2CPSA 2P7JA 5BU5A 1SLQA 2YNYA 2PP6A 1GL2A 1ZV8A 4O9BA 2OYIC 3MD0A 3RK3D 3OA7A 1LWUB 1H89A 2HODA 1HGVA 1RE3C 1OXZA 1RY3A 1YTZI 1GU4A 4WBAA 1FOSE 3A3YB 3HD7D 2GUSA 3VMXA 5BVZA 1JY3P 2Q5UA 3GHGA 5AW4B 2ZFCA 3HE4A 5AW0B 2M8RA 1JCCA 1QL1A 1SQQK 1FDMA 3HE5B 3BRTB 2KB7P 2KSJA 1ZR2A 2WZ7A 2R5BA 1SFCD 1SP4A 5AVVB 1DH3A 1HVVA 1NKNA 3HE5A 4I1LA 1KFNA 3M9HA 1GK6A 4JF7A 1LTBC 1Z56A 2OYHC 2HG5D 2QM8A 3T97A 1NTMK 5AVYB 3IR9A 1L4AB 3G3ZA 2N1TD 5KJ7C 3GHGC 3HUSC 1LTTC 2NPSC 5APTA 1KQLA 1NO4A 2KYVA 4W80A 2W6AA 1QL2A 3HRNA 1G1JA 4N3YB 3LIDA 3VYIA 3M9QA 3RL0D 1RF0C 1IC2A 4Y99C 1KILC 2WT7A 1JOCA 1J1EB 1FZCC 3V2NA 2FFDA 3KYQA 4WY4D 1SFCC 2FKWB 2C9NY 2FFDB 1FJPA 1HJBA 2HODB 2NPSA 3I5CA 3HUSA 3P8CD 1HTLC 5CMZA 1FZGA 1JO5A 3TYYA 3VMYA 1SQBK 1IFDA 2NPSB 5APUA 3GHGB 2C0XA 4AYCA 1X9VA 1GL2C 2WSEH 2I1KA 2HFED 1G2CB 1GTWA 1ZR4A 1W2EA 3N7NA 1SQVK 4ZKUA 1H8AA 3A5TA 2H8PD 4HYTB 1EQ7A 2QM7A 3B5NB 4LLHA 5AW1B 2Z5HA 2IFMA 1J1DB 1G2CA 5CCGC 1PFIA 4LC1A 5APVA 1NKZB 3RK3C 1JY2P 1S9KE 2GUVA 5APYA 3U1AA 1L4AA 2W6BA 2O01H 1CSBA 4RESB 1YTZT 3EQ2A 2ZXEB 4WY4C 2Q7CA 1DEBA 4OH8B 3RK2B 1RF1C 3VMZA 2A45G 1IK9A 1VPCA 3HD7B 1N86A 5AVWB 1A02J 1J1DC 4C7NB 3HD7A 5AVTB 1RE4C 3H6PA 1FZEA 3N4XA 1GDTA 1G1IA 1GZLA 2WPQA 3NFQA 1CI6B 4XE5B 2IPPA 3MIWA 3H32B 3NMDA 5AVUB 3VP9A 1JCDA 2FXMA 1CI6A 3BRVB 2A45I 2J58A 1FZAA 3H32A 2E43A 3C9IA 3HUSB 1AQ5A 2E42A 1KZUB 2VRSA 3NXSA 1URQB 2YKQA 2WWWA 1FZFA 1N7LA 2HLOA 1FBMA 5CJ4A 1KILA 5CJ0A 1M1JA 5APSA 3WMM0 2YO3A 1RF1B 1KILB 3M91A 5CCHD 1LTSC 1MV8A 2H43A 3L36A 1JY3O 1RE3A 3B5NA 5CCGA 3BATA 4JYBA 3VN0A 2WSCH 1IFJA 1KFMA 1LTJA 1LTIC 4WY4B 1GL2D 1T3UA 1WRGA 4W7YA 5AVZB 1MZ9A 1LTJB 4WY4A 1T2KC 1H88A 1FAVA 2WITA 2POHA 2WPSA 1L4AC 1FJKA 3RK3B 1GD2E 1NHLA 5AW6B 1L0NK 5KJ7D 2R5DA 2JJLA 2NPSD 1GU5A 2XV5A 4EOTA 1N7SB 5AW3B 2GM4A 3P7KA 4C7NA 1XTCC 1SFCA 3SWYA 1HGZA 1T2KD 1HH0A 3A7OA 3VOPA 2YO2A 2P2UA 1SFCB 1SQPK 1N2DC 4B86A 1S9KD 1L0LK 1LTGC 4C46A 2PAJA 3P32A 3TNUB 3HD7C 1SQXK 4I6MC 1URQA 4Y99B 1WT6A 5APWA 1M1JB 3HTKB 1OWAA 2OARA 1RF1A 2Z4EA 1T8ZA 5AVRB 5AW2B 1NAFA 3HTKA 3B5NC 3V5BA 3RL0B 1X8YA 4ZKPA 2CPBA 4JYCA 3II6A 2Q9IA 4AQRD 3M0DC 4AUWA 1JNMA 5KTBA 1ZN5A 1LT9C 3V2QA 1JY2N 5AW5B 3NTNA 3MGNA 4IFFA 2XNXA 3IFMA 5APQA 3TK1A 2LKMA 5AVXB 3KPEA 3M9BA 1N7SA 1VDFA 2KOGA 2Z5IA 5AW9B 5APXA 3P8MC 2KLVA 1KILD 1IJDB 3MTUE 2O1JA 1NTKK 2XKMA 3BASA 2IX7C 1NWQA 3V4WA 4W7ZA 1J1EC 3KQGA 1URQC 5KLVK 2N1TA 4I2LC 2HPCA 1LT9A 2BASA 1ZLLA 2OYIB 3TNUA 2WPRA 1LT9B 3M0AA 2OYHA 2OYIA 1CZQA 2I1JA 4C7RA 2JEEA 2P67A 1N73C 3RK2D 3PP5A 3E1IA 2OYHB 1HWTC 1LTJC 3RL0C 5BU8B 3CLQA 2C9LY 5CCHC 4IFMA 2M3BA 2YMYA 4WB4A 1IFMA 1NOHA 1A02F 2R3CA 3L37A 2XZRA 2L5GB 3RK2C 3U59A 4XA4A 2FFDC 1FZBA 1IFNA 1HBWA 1FZCA 3L4FA 3V4QA 2C0WA 4LGDE 1HUCA 3LIEA 3OJAB 5AVSB 2J59M 1MFZA 2FYZA 1GW3A 2MJZA 1IFIA 1RE4A 2KP8A 3O8ZA 2YKPA 1GW4A 1MUUA 4DOJA 4GIFA 1T3JA 1URQD 1JY2O 1LWUC 2P1JA 3LW5H 3V2PA 3P8CE 1JMMA 1JY3N 2R32A 5CCGD 1LWUA 3R2PA 4KHXA 3VTPC 4GT1A 2YKOA 2WTYA 1L4AD 1X79B 1AFOA 2N1TB 3BVHA 3L35A 1N7SC 1YYCA 2HPCB 3EFGA 1M7LA 1GK4A 2XDJA 4M3LA 1SVFA 2WSFH 3HE4B 1LGHB 2N9BA 5KJ7A 4N78E 1NU1K 1XTGB 1FOSF 1DX7A 3CL3D 2H7HA 4GKGA 1N7SD 3SWFA 1JUNA 3KDPB 3CI9A 1M1JC 2O1KA 1NTZK 5AW8B 4DZOA 3M0DA 1LTAC 5AW7B 1J2JB 4N78D 3U1CA 4HH2A 1N73A 2HYNA 3M06A 3VP8A 3OAKA 2A45H 2IFNA 3MUDA 1FZCB 1NH4A 2Q3IA 3TSIA 3V2RA 1CW5A 3B8EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS B;  5KJ7 D;  2NPS D;  1JTH B;  1N7S B;  1GL2 C;  2N1T C;  3RK2 D;  3PP5 A;  5CCH A;  2HFE D;  1JTH A;  1GL2 B;  1SFC A;  3RL0 C;  2H8P D;  3B5N D;  3B5N B;  5CCH C;  5CCG C;  2YMY A;  3VOP A;  2PP6 A;  1GL2 A;  1SFC B;  3RK3 C;  3RK3 D;  3RK2 C;  1L4A A;  4WY4 C;  3RK2 B;  4LGD E;  4OH8 B;  3HD7 C;  3HD7 D;  3HD7 B;  1URQ A;  2M8R A;  3HD7 A;  2WZ7 A;  1SFC D;  3HTK B;  1T3J A;  1URQ D;  1HVV A;  3B5N C;  3P8C E;  4JF7 A;  3RL0 B;  5CCG D;  2HG5 D;  1L4A D;  1L4A B;  3M0D C;  2N1T B;  1N7S C;  2N1T D;  5KJ7 C;  2NPS C;  2XDJ A;  1URQ B;  5KJ7 A;  4W80 A;  4N78 E;  1KIL A;  1N7S A;  1XTG B;  2KOG A;  3RL0 D;  1KIL B;  1KIL C;  5CCH D;  1KIL D;  1N7S D;  3B5N A;  5CCG A;  4W7Z A;  3KYQ A;  4WY4 D;  4WY4 B;  1SFC C;  1GL2 D;  1URQ C;  4W7Y A;  2N1T A;  2NPS A;  4WY4 A;  1L4A C;  3RK3 B;  3TSI A;  1NHL A; 
#chains in the Genus database with same CATH topology
 3UIA A;  5CHX A;  1N73 B;  4IFD K;  3FGA D;  3L73 E;  4D6T G;  2W83 C;  3AEC C;  3FWN A;  3L73 J;  4PD4 I;  1JTH B;  3FWL A;  2KNC A;  1OVV A;  5AVQ B;  1IO4 A;  4OVN F;  2N1T C;  1RF0 A;  1EDL A;  1BE3 E;  1YJ9 P;  5CCH A;  3CCQ P;  2W27 A;  1JTH A;  1PPJ G;  2WT7 B;  1DD4 A;  2A06 E;  1GL2 B;  4H0L D;  1E5W A;  2FYU K;  4N6J A;  1BCC E;  1X0T A;  2XU6 A;  3A2A A;  3B5N D;  1SQV D;  1S5L E;  4IL6 X;  4EIJ A;  3I55 P;  2Y9Y A;  3FXD A;  2ZAE B;  1FU1 A;  2CPS A;  2P7J A;  5BU5 A;  1RQV A;  1SLQ A;  1CW5 A;  2YNY A;  1HJ0 A;  2PP6 A;  1GL2 A;  1L0L G;  1ZV8 A;  2D2C C;  3L71 D;  4O9B A;  2OYI C;  3MD0 A;  1BSH A;  2JO1 A;  1BGY J;  3G9R A;  4L74 A;  3RK3 D;  3OA7 A;  1LWU B;  1Y47 A;  3PLN A;  3Q5R A;  1H89 A;  1IFP A;  2B87 A;  2HOD A;  2KK7 A;  1KQS O;  1HGV A;  2Y0C A;  3L70 D;  1BGY D;  3H1L G;  1L2P A;  1RE3 C;  1S2E A;  1OXZ A;  1EDK A;  1RY3 A;  3IF4 A;  2V4H A;  1SQP D;  2IZ1 A;  3CX5 D;  3Q3D A;  1YTZ I;  2FYU G;  3VMA A;  1PGP A;  1GU4 A;  1BE3 J;  3QWO C;  4WBA A;  1FOS E;  3WUU A;  3A3Y B;  1QGK B;  3HD7 D;  2GUS A;  3VMX A;  4Z1M H;  1JY3 P;  5BVZ A;  2FYU E;  2Q5U A;  2W8Z A;  3GHG A;  1NTZ J;  1VF5 D;  3AED C;  3R4Y A;  5AW4 B;  2ZFC A;  3HE4 A;  5AW0 B;  2M8R A;  1JCC A;  2G8Y A;  1AVY A;  1QL1 A;  3SWK A;  1SQQ K;  1FDM A;  3HE5 B;  3BRT B;  5GTI E;  5C39 A;  2KB7 P;  2KSJ A;  2L91 A;  2MKV A;  2R5B A;  1SFC D;  2WZ7 A;  1M57 D;  1SP4 A;  3GG2 A;  1SQB G;  3L73 G;  2M5A B;  4IL6 H;  3L73 D;  4PD4 H;  5AVV B;  4BXL A;  1DH3 A;  1HVV A;  2JDI H;  1KQF B;  2ZT9 D;  3GLM A;  1NKN A;  1SQB E;  2JWA A;  3HE5 A;  1KFN A;  3M9H A;  1P84 E;  4I1L A;  5H2F E;  1Q81 Q;  1KC8 Q;  1PZQ A;  1KV4 A;  1KTM A;  3S1K A;  1GK6 A;  4JF7 A;  1LTB C;  2KLU A;  1N8R Q;  3TGU E;  1Z56 A;  2KS1 A;  4D6T E;  2OYH C;  1BCC G;  3CC4 P;  4PV1 B;  2HG5 D;  2QM8 A;  3T97 A;  1NTM K;  3CXH E;  4I7Z C;  2E74 B;  2O01 N;  3IR9 A;  5AVY B;  1EZV I;  2KS1 B;  1L4A B;  3L75 D;  1OX3 A;  3G3Z A;  4ZNC A;  2N1T D;  1M56 D;  2WQY C;  4JBZ A;  2D2C D;  3ZDM A;  3BCC E;  3GHG C;  5KJ7 C;  3HUS C;  1LTT C;  2NPS C;  5APT A;  3H1L D;  2KIK A;  2E76 C;  1KQL A;  3CPW O;  1NO4 A;  2KYV A;  4BWN A;  1RF1 C;  4W80 A;  5H2F H;  2W6A A;  1QL2 A;  2W6J H;  3HRN A;  2RN0 A;  1ZXG A;  2KNC B;  1SQV J;  1G1J A;  3CMA P;  2AXC A;  4N3Y B;  5GTH E;  2E75 C;  3LID A;  3M9Q A;  3VYI A;  1NU1 E;  3RL0 D;  3L75 J;  1RF0 C;  1VQ5 P;  1IC2 A;  3TGU J;  4Y99 C;  2SPZ A;  1KIL C;  2WT7 A;  2WSS H;  3S9O A;  3AE1 C;  1JOC A;  1P84 I;  1J1E B;  3WU2 H;  4Y28 J;  1FZC C;  3V2N A;  1K73 Q;  1PP9 G;  3B71 A;  5B5E E;  2R44 A;  2FFD A;  1VQ9 P;  3CCJ P;  3AEA C;  4K3A A;  1DIP A;  1PP9 E;  4EI2 A;  3KYQ A;  1IZN B;  2IYP A;  4WY4 D;  3JSV C;  1SFC C;  2FKW B;  2C9N Y;  3MUD C;  2FFD B;  1FJP A;  5TJH A;  1EZV E;  1HJB A;  1L0N G;  3L72 D;  2CK3 H;  2HOD B;  4H44 D;  1KYO H;  2JKV A;  1SQV G;  2QEX P;  2NPS A;  3I5C A;  3L71 E;  3HUS A;  3P8C D;  1HTL C;  2FXO A;  5CMZ A;  4A7P A;  1FZG A;  3AE5 C;  1JO5 A;  5KLV E;  2ZXX A;  1K05 A;  3FX0 A;  3L71 G;  3TYY A;  3H1I J;  1K8A Q;  3VMY A;  1SQB K;  2K1A A;  4U3F D;  1IFD A;  2NPS B;  2K9J A;  1S5L X;  4IL6 E;  1PIX A;  5APU A;  1VQK P;  3GHG B;  3EFF K;  1NTK E;  2C0X A;  1NTM D;  1X9V A;  4AYC A;  1GL2 C;  2WSE H;  2OTL P;  2IBZ I;  1P84 H;  1Q90 D;  1SQQ E;  3AEG C;  3H1H G;  3Q2Y A;  2I1K A;  1AV1 A;  2HFE D;  1G2C B;  5DJT B;  1EZV D;  1GTW A;  1L0N D;  3D6Y A;  1ZR4 A;  1SQQ G;  1W2E A;  3N7N A;  2J5U A;  1SQV K;  4H0L B;  4ZKU A;  5KJ7 A;  1UIX A;  2A06 D;  1KYO E;  2H8P D;  1EQ7 A;  1KB9 E;  4HYT B;  4L75 A;  2QM7 A;  3B5N B;  4LLH A;  4ASV A;  5AW1 B;  2Z5H A;  2IFM A;  1J1D B;  1G2C A;  5CCG C;  1PFI A;  1NU1 G;  5B66 H;  2BCC J;  2QA4 P;  1H8A A;  1YJW P;  4LC1 A;  5APV A;  1NKZ B;  2Q3E A;  4U3F E;  3RK3 C;  1X22 A;  2KXP B;  1JY2 P;  3Q5P A;  1LT1 A;  1SQB D;  3A0H H;  1S9K E;  1FS0 E;  1UII A;  2QIW A;  3D70 A;  2GUV A;  3BCC J;  5APY A;  3U1A A;  1L4A A;  2W6B A;  2O01 H;  1CSB A;  4RES B;  4R4M A;  1YTZ T;  3EQ2 A;  2ZXE B;  3H1J D;  4U7J A;  1DEB A;  4OH8 B;  4WY4 C;  4OGQ D;  2OGU A;  4RKU J;  2Q7C A;  3RK2 B;  3VMZ A;  1W2B O;  2A45 G;  1IK9 A;  1VPC A;  5GTH H;  3L74 E;  1YJN P;  3HD7 B;  3E1R A;  3MP7 B;  3F5H A;  3CX5 I;  2K88 A;  1VF5 B;  1N86 A;  2FYN C;  2BEZ F;  5AVW B;  3WU2 E;  1A02 J;  2BCC G;  4YXW H;  3WUT A;  5B66 E;  1J1D C;  2KUB A;  3L75 E;  2OQQ A;  4C7N B;  3HD7 A;  1YI2 P;  2YMK A;  4H13 C;  5AVT B;  1KYO I;  1PV3 A;  2DW3 A;  2KZI A;  1RE4 C;  1SQQ J;  2FY8 A;  3H6P A;  1BDC A;  3L72 J;  4CPG A;  2WSE J;  1FZE A;  2Q1K A;  1NVO A;  2E76 D;  2KSE A;  1BCC J;  3N4X A;  1G1I A;  1GDT A;  1GZL A;  2WPQ A;  1SQQ D;  1JB0 J;  2Q6Q A;  1M8O B;  3NFQ A;  1CI6 B;  4XE5 B;  2QJY B;  2IPP A;  2B89 A;  2IZ0 A;  3MIW A;  1H0T B;  1EXJ A;  3H32 B;  5KAI H;  1D7M A;  3NMD A;  3PRJ A;  5AVU B;  1KN7 A;  2E75 D;  2YIU B;  1KB9 D;  2E74 C;  1JCD A;  2FXM A;  2WMM A;  3H1I G;  2ZYG A;  5TIS E;  1CI6 A;  3BRV B;  3KXD A;  2A45 I;  1PP9 D;  2J58 A;  1JMB A;  1FZA A;  5KLI B;  3H32 A;  2E43 A;  3C9I A;  3HUS B;  2E5T A;  1AQ5 A;  2E42 A;  3SFE C;  1KZU B;  1BE3 G;  2VRS A;  1YBK A;  3H1H J;  1BDD A;  1URQ B;  2YKQ A;  1NAY A;  2WWW A;  3NXS A;  3SSU A;  1N7L A;  2Y9Z A;  3C8V A;  2K9J B;  3CX5 H;  2HLO A;  1S72 P;  1FZF A;  1FBM A;  1PPJ D;  2QE7 H;  1KIL A;  5CJ4 A;  5CJ0 A;  3EWK A;  2B88 A;  1KOR A;  4HKZ H;  4H44 C;  1M1J A;  4NPD A;  5APS A;  2YO3 A;  3WMM 0;  3L74 G;  5KLV D;  5GTI H;  1RF1 B;  1NU1 J;  4OWF A;  3KZI H;  3L74 D;  1KIL B;  3M91 A;  5CCH D;  5TIS H;  1LTS C;  1MV8 A;  1QLE D;  2H43 A;  1AJY A;  2QJP B;  1Y8A A;  3A0H E;  1JY3 O;  3L36 A;  1RE3 A;  1HF9 A;  2YXR B;  2WSC J;  3B5N A;  3BAT A;  4JYB A;  2NZ2 A;  1OW7 A;  3VN0 A;  5CCG A;  1L0N J;  1EC5 A;  1IFJ A;  1KFM A;  1LTJ A;  1LTI C;  1OZH A;  2QJK C;  1GL2 D;  2V7Q J;  2WSC H;  1R5L A;  2PGD A;  4WY4 B;  1M1K Q;  1T3U A;  1WRG A;  1USE A;  3QH9 A;  4W7Y A;  3CXH H;  3D6Z A;  5AVZ B;  1MZ9 A;  4H44 B;  1LTJ B;  4L73 A;  4WY4 A;  1T2K C;  1H88 A;  1FAV A;  2WIT A;  2POH A;  2WPS A;  1L4A C;  4U3F J;  3MZW B;  1FJK A;  4DCK A;  3CC7 P;  2AEJ A;  3H1I D;  1S3J A;  1FDI A;  3H1K J;  5EFW B;  4H13 D;  1NHL A;  5AW6 B;  3RK3 B;  2IBZ E;  4YPC A;  3TDK A;  1L0N K;  2UWJ E;  5KJ7 D;  1NTZ D;  2R5D A;  2JJL A;  3JCU H;  2NPS D;  1GU5 A;  2XV5 A;  1RQU A;  3PHL A;  5L8R J;  1N7S B;  2YXQ B;  3SFD C;  3G71 P;  5AW3 B;  4EOT A;  2NRG A;  3TF5 A;  1Q2N A;  1VQO P;  4D6T J;  2GM4 A;  1KB9 I;  3P7K A;  2LXB A;  2KZJ A;  4L76 A;  3CCR P;  4C7N A;  4YXD C;  3A5T A;  3L74 J;  1USD A;  1BSN A;  1XTC C;  2FYU D;  2I8D A;  1VQ8 P;  3TGU G;  1VQM P;  1SFC A;  3SWY A;  1SQX E;  1HGZ A;  3V6I A;  1T2K D;  1HH0 A;  1PPJ E;  5KAI E;  1RH5 B;  3A7O A;  5B5E H;  1QX8 A;  4UB8 H;  3VOP A;  2YO2 A;  4TLF A;  2P2U A;  3L71 J;  1SFC B;  1SQP K;  1Q86 Q;  1NU1 D;  1W5C E;  2AEM A;  5CBO A;  5KLV J;  1N2D C;  1H0T A;  1L0L E;  1MFT A;  4B86 A;  4HB1 A;  1PL5 A;  2RKL A;  1S9K D;  1L0L K;  1ZOY C;  2AXT E;  4RO0 A;  2P10 A;  1LTG C;  2O01 J;  3JC2 2;  2WSF J;  1OFC X;  1EDI A;  5KAF E;  1Q82 Q;  1OW6 A;  4C46 A;  1SQP E;  3CX5 E;  1VQL P;  2PAJ A;  3H1H D;  5DJU B;  3CCS P;  3H1L J;  3P32 A;  1AQT A;  3TNU B;  1SQP G;  3H1J E;  3HD7 C;  4OGQ B;  1SQX D;  1SQX K;  4I6M C;  1URQ A;  1LNQ A;  1TU3 F;  1BCC D;  1ZR2 A;  1AVO A;  1NJI Q;  2QSI A;  4Y99 B;  1NTZ G;  3AE7 C;  4D6T D;  1WT6 A;  5APW A;  1M1J B;  3AEE C;  2G3A A;  2JR8 A;  2LXC B;  3GF3 A;  3HTK B;  1OWA A;  2OAR A;  3K5B A;  1DD3 A;  1RF1 A;  2Z4E A;  4NPE A;  3LW5 J;  2H89 C;  1T8Z A;  2ZT9 C;  1P84 D;  3WUV A;  5AVR B;  5K5G B;  1FE6 A;  3CWB J;  1NAF A;  2BEQ D;  5AW2 B;  5KAF H;  3AE3 C;  3HTK A;  2E76 B;  3B5N C;  3AE9 C;  1AA0 A;  3MHV A;  3V5B A;  3PJS K;  3RL0 B;  2OYO A;  2A06 G;  1X8Y A;  4XFJ A;  4ZKP A;  2CPB A;  1SQX G;  4GOF A;  1GMJ A;  2IDB A;  4JYC A;  5KLV G;  3GW6 A;  1NGM B;  1KYO D;  3II6 A;  3PH0 A;  1ZRT E;  2XND H;  1OMI A;  3BCC G;  3M0D C;  4AQR D;  3CCV P;  1KD1 Q;  1JNM A;  2Q9I A;  5KTB A;  4AUW A;  3CCM P;  1ZN5 A;  1LT9 C;  3V2Q A;  1JY2 N;  4MN4 C;  5AW5 B;  3NTN A;  1BE3 D;  2N9Y B;  3MGN A;  4IFF A;  2XNX A;  3IFM A;  5APQ A;  1NTK J;  3TK1 A;  4GOE A;  1VQ7 P;  2LKM A;  3H1L E;  5AVX B;  1VQ4 P;  3CWB G;  3OW2 O;  3VP9 A;  2ZYD A;  3KPE A;  1VQP P;  3M9B A;  2ZT9 B;  1N7S A;  1K9M Q;  3CME P;  1VDF A;  2KOG A;  3CC2 P;  1GD2 E;  2IYO A;  2Z5I A;  5AW9 B;  1JM0 A;  2RMZ A;  2LR2 A;  5APX A;  2E5Y A;  3P8M C;  2Y0D A;  2KLV A;  3RK3 E;  2BCC D;  1NYH A;  1KIL D;  1IJD B;  3AE8 C;  3B4S A;  1NTK D;  3MTU E;  2GA1 A;  2O1J A;  1S5L H;  4IOI H;  1NTK K;  2XKM A;  3BAS A;  1FDO A;  3PTZ A;  1VQ6 P;  2Y0E A;  2AXT H;  4KJM A;  1LP1 A;  2IX7 C;  1OVR A;  3CCE P;  2V7Q H;  1NWQ A;  4WVZ A;  4W7Z A;  3V4W A;  1J1E C;  1PP9 J;  1L0N E;  3AE2 C;  3KQG A;  4GDO A;  4K35 A;  3S4R A;  2D2C B;  1Q7Y Q;  1IK7 A;  4EDF A;  3GMA A;  1URQ C;  3RL0 g;  3IAO A;  4PD4 D;  5KLV K;  2FXP A;  1R8E A;  4ZMD A;  1NTM J;  2QVA A;  2N1T A;  4KT0 J;  3ABV C;  5KKZ B;  4I2L C;  2M0B A;  2HPC A;  1LT9 A;  2PFX A;  2BAS A;  1ZLL A;  4PJ0 E;  1Y9B A;  2P58 A;  2OYI B;  3TNU A;  2ZVN B;  1NTK G;  3CCL P;  2WPR A;  1LT9 B;  1ZRT D;  4RJT A;  1S4X A;  3H1H E;  3M0A A;  2OYH A;  3E7K A;  1CZQ A;  2I1J A;  4C7R A;  2JEE A;  2P67 A;  1WMK A;  2OYI A;  1N73 C;  3RK2 D;  1YHQ P;  2H88 C;  3PP5 A;  4GOD A;  3O6Q B;  3E1I A;  3H25 A;  1E79 H;  3CWB E;  3TGU D;  4PD4 E;  2FBW C;  3KZI E;  1PGO A;  4ASW A;  3A0B E;  2OYH B;  1HWT C;  1LTJ C;  1U57 A;  1SQX J;  3RL0 C;  5BU8 B;  1PGJ A;  3CLQ A;  3CXH D;  2C9L Y;  2HR3 A;  5CCH C;  3F89 A;  4IFM A;  4DJG A;  2OTK E;  2M3B A;  2YMY A;  4U3F G;  1LJ2 A;  4WB4 A;  5E79 H;  1IFM A;  3H1K G;  4JQ0 D;  1U7J A;  2YIU C;  3W68 A;  1NOH A;  3BCC D;  3Q1M A;  1A02 F;  2R3C A;  3L37 A;  1RHZ B;  2XZR A;  5KKZ C;  1M90 Q;  1ZME C;  1SQB J;  2L5G B;  3L70 E;  3CD6 P;  4TT3 H;  3RBZ A;  3AEF C;  3IN6 A;  3KHU A;  1NTM G;  3RK2 C;  3FXE A;  4XA4 A;  3U59 A;  2FFD C;  1FZB A;  1IFN A;  3L70 G;  5M1B A;  2JWD A;  2PRR A;  1HBW A;  1FZC A;  3L4F A;  1U7M A;  1NTM E;  1QVF O;  3V4Q A;  1EZV G;  2C0W A;  4LGD E;  1HUC A;  3LIE A;  3OJA B;  4OGQ C;  1KQG B;  2J59 M;  2QG4 A;  3A0B H;  5AVS B;  1MFZ A;  1PGQ A;  1SQV E;  3JCU E;  2FYZ A;  2FYU J;  3I56 P;  1GW3 A;  1S1C X;  2MJZ A;  4EYY Q;  1IFI A;  1RE4 A;  1T6A A;  5E79 E;  3H1K D;  5CBN A;  2ZYA A;  2KP8 A;  4YTP C;  3O8Z A;  2YKP A;  1GW4 A;  1MUU A;  3CCU P;  2M3E A;  4DOJ A;  2KI7 B;  4GIF A;  1T3J A;  1URQ D;  3G4S P;  1JY2 O;  2K37 A;  1YQ4 C;  2AEF A;  1LWU C;  5KLI C;  1YIJ P;  1R5S A;  3L72 E;  2WPV B;  1EXI A;  1KMI Z;  2P1J A;  3Q5S A;  3LW5 H;  1MKM A;  1JEK A;  4UB8 E;  3V2P A;  3L72 G;  3P8C E;  1JMM A;  1JY3 N;  1ZP0 C;  1LP1 B;  2R32 A;  2RH0 A;  5CCG D;  2ITA A;  2QJY C;  1OW8 A;  1LWU A;  4PV1 D;  1QVG O;  3R2P A;  4KHX A;  2QRX A;  2ZVO B;  2B87 B;  3VTP C;  4PJ0 H;  3H1J J;  2E74 D;  1OVU A;  3AE4 C;  2IBZ G;  3C1L A;  4GT1 A;  1KIL E;  2YKO A;  2WTY A;  1L4A D;  3H1K E;  3AEB C;  1X79 B;  1AFO A;  2N1T B;  3L70 J;  3L35 A;  1N7S C;  1YYC A;  3BVH A;  1VQN P;  2HPC B;  4UB6 H;  3EFG A;  4BRY A;  3GF7 A;  1OIP A;  3CXH I;  1M7L A;  1YIT P;  4JPZ B;  1SQP J;  1GK4 A;  2B9B A;  2XDJ A;  4M3L A;  2O3J A;  1SVF A;  2WSF H;  2FYN B;  2K9Y A;  3HE4 B;  1LGH B;  2N9B A;  4I7Z B;  4R4L A;  4DT0 A;  3ITK A;  1NU1 K;  1DEE G;  4N78 E;  4BRY B;  4PV1 C;  1EDJ A;  1K04 A;  1XTG B;  4NPF X;  1FOS F;  1DX7 A;  3CL3 D;  2IBZ D;  4H13 B;  2H7H A;  2M5A A;  1VL2 A;  4GKG A;  3O6Q A;  3W67 A;  1JUN A;  2R3S A;  1N7S D;  2BCC E;  3RBX A;  1VF5 C;  1KB9 H;  2QJK B;  2E75 B;  3L75 G;  3SWF A;  3G6E P;  3KDP B;  3RGU A;  1QEX A;  1BGY E;  3AE6 C;  2ZJS E;  3CI9 A;  4WWI A;  1M1J C;  4UB6 E;  1BGY G;  2W90 A;  1YQ3 C;  1NTZ K;  2O1K A;  2QJP C;  2WVR A;  5AW8 B;  3T97 B;  4DZO A;  1ZW0 A;  2OTJ P;  1FC2 C;  3CWB D;  3M0D A;  4HJG H;  1LTA C;  1SS1 A;  5AW7 B;  3D71 A;  3H1J G;  3USS A;  1J2J B;  4N78 D;  3U1C A;  4HH2 A;  1N73 A;  2HYN A;  4H0L C;  3M06 A;  4QMA A;  3VP8 A;  3MUD A;  2A45 H;  2IFN A;  3OAK A;  2K3R A;  1FZC B;  1NH4 A;  2Q3I A;  3TSI A;  3V2R A;  1L0L D;  1L0L J;  3B8E B;  3H1I E;  1NTZ E;  2JP3 A; 
#chains in the Genus database with same CATH homology
 3UIA A;  5CHX A;  1N73 B;  4IFD K;  1JTH B;  5AVQ B;  1IO4 A;  2N1T C;  1RF0 A;  5CCH A;  2W27 A;  1JTH A;  2WT7 B;  1GL2 B;  1E5W A;  2FYU K;  4N6J A;  3A2A A;  2XU6 A;  3B5N D;  4EIJ A;  1FU1 A;  2CPS A;  2P7J A;  5BU5 A;  1SLQ A;  2YNY A;  2PP6 A;  1GL2 A;  1ZV8 A;  4O9B A;  2OYI C;  3MD0 A;  3RK3 D;  3OA7 A;  1LWU B;  1H89 A;  2HOD A;  1HGV A;  1RE3 C;  1OXZ A;  1RY3 A;  1YTZ I;  1GU4 A;  4WBA A;  1FOS E;  3A3Y B;  3HD7 D;  2GUS A;  3VMX A;  5BVZ A;  1JY3 P;  2Q5U A;  3GHG A;  5AW4 B;  2ZFC A;  3HE4 A;  5AW0 B;  2M8R A;  1JCC A;  1QL1 A;  1SQQ K;  1FDM A;  3HE5 B;  3BRT B;  2KB7 P;  2KSJ A;  1ZR2 A;  2WZ7 A;  2R5B A;  1SFC D;  1SP4 A;  5AVV B;  1DH3 A;  1HVV A;  1NKN A;  3HE5 A;  4I1L A;  1KFN A;  3M9H A;  1GK6 A;  4JF7 A;  1LTB C;  1Z56 A;  2OYH C;  2HG5 D;  2QM8 A;  3T97 A;  1NTM K;  5AVY B;  3IR9 A;  1L4A B;  3G3Z A;  2N1T D;  5KJ7 C;  3GHG C;  3HUS C;  1LTT C;  2NPS C;  5APT A;  1KQL A;  1NO4 A;  2KYV A;  4W80 A;  2W6A A;  1QL2 A;  3HRN A;  1G1J A;  4N3Y B;  3LID A;  3VYI A;  3M9Q A;  3RL0 D;  1RF0 C;  1IC2 A;  4Y99 C;  1KIL C;  2WT7 A;  1JOC A;  1J1E B;  1FZC C;  3V2N A;  2FFD A;  3KYQ A;  4WY4 D;  1SFC C;  2FKW B;  2C9N Y;  2FFD B;  1FJP A;  1HJB A;  2HOD B;  2NPS A;  3I5C A;  3HUS A;  3P8C D;  1HTL C;  5CMZ A;  1FZG A;  1JO5 A;  3TYY A;  3VMY A;  1SQB K;  1IFD A;  2NPS B;  5APU A;  3GHG B;  2C0X A;  4AYC A;  1X9V A;  1GL2 C;  2WSE H;  2I1K A;  2HFE D;  1G2C B;  1GTW A;  1ZR4 A;  1W2E A;  3N7N A;  1SQV K;  4ZKU A;  1H8A A;  3A5T A;  2H8P D;  4HYT B;  1EQ7 A;  2QM7 A;  3B5N B;  4LLH A;  5AW1 B;  2Z5H A;  2IFM A;  1J1D B;  1G2C A;  5CCG C;  1PFI A;  4LC1 A;  5APV A;  1NKZ B;  3RK3 C;  1JY2 P;  1S9K E;  2GUV A;  5APY A;  3U1A A;  1L4A A;  2W6B A;  2O01 H;  1CSB A;  4RES B;  1YTZ T;  3EQ2 A;  2ZXE B;  4WY4 C;  2Q7C A;  1DEB A;  4OH8 B;  3RK2 B;  1RF1 C;  3VMZ A;  2A45 G;  1IK9 A;  1VPC A;  3HD7 B;  1N86 A;  5AVW B;  1A02 J;  1J1D C;  4C7N B;  3HD7 A;  5AVT B;  1RE4 C;  3H6P A;  1FZE A;  3N4X A;  1GDT A;  1G1I A;  1GZL A;  2WPQ A;  3NFQ A;  1CI6 B;  4XE5 B;  2IPP A;  3MIW A;  3H32 B;  3NMD A;  5AVU B;  3VP9 A;  1JCD A;  2FXM A;  1CI6 A;  3BRV B;  2A45 I;  2J58 A;  1FZA A;  3H32 A;  2E43 A;  3C9I A;  3HUS B;  1AQ5 A;  2E42 A;  1KZU B;  2VRS A;  3NXS A;  1URQ B;  2YKQ A;  2WWW A;  1FZF A;  1N7L A;  2HLO A;  1FBM A;  5CJ4 A;  1KIL A;  5CJ0 A;  1M1J A;  5APS A;  3WMM 0;  2YO3 A;  1RF1 B;  1KIL B;  3M91 A;  5CCH D;  1LTS C;  1MV8 A;  2H43 A;  3L36 A;  1JY3 O;  1RE3 A;  3B5N A;  5CCG A;  3BAT A;  4JYB A;  3VN0 A;  2WSC H;  1IFJ A;  1KFM A;  1LTJ A;  1LTI C;  4WY4 B;  1GL2 D;  1T3U A;  1WRG A;  4W7Y A;  5AVZ B;  1MZ9 A;  1LTJ B;  4WY4 A;  1T2K C;  1H88 A;  1FAV A;  2WIT A;  2POH A;  2WPS A;  1L4A C;  1FJK A;  3RK3 B;  1GD2 E;  1NHL A;  5AW6 B;  1L0N K;  5KJ7 D;  2R5D A;  2JJL A;  2NPS D;  1GU5 A;  2XV5 A;  4EOT A;  1N7S B;  5AW3 B;  2GM4 A;  3P7K A;  4C7N A;  1XTC C;  1SFC A;  3SWY A;  1HGZ A;  1T2K D;  1HH0 A;  3A7O A;  3VOP A;  2YO2 A;  2P2U A;  1SFC B;  1SQP K;  1N2D C;  4B86 A;  1S9K D;  1L0L K;  1LTG C;  4C46 A;  2PAJ A;  3P32 A;  3TNU B;  3HD7 C;  1SQX K;  4I6M C;  1URQ A;  4Y99 B;  1WT6 A;  5APW A;  1M1J B;  3HTK B;  1OWA A;  2OAR A;  1RF1 A;  2Z4E A;  1T8Z A;  5AVR B;  5AW2 B;  1NAF A;  3HTK A;  3B5N C;  3V5B A;  3RL0 B;  1X8Y A;  4ZKP A;  2CPB A;  4JYC A;  3II6 A;  2Q9I A;  4AQR D;  3M0D C;  4AUW A;  1JNM A;  5KTB A;  1ZN5 A;  1LT9 C;  3V2Q A;  1JY2 N;  5AW5 B;  3NTN A;  3MGN A;  4IFF A;  2XNX A;  3IFM A;  5APQ A;  3TK1 A;  2LKM A;  5AVX B;  3KPE A;  3M9B A;  1N7S A;  1VDF A;  2KOG A;  2Z5I A;  5AW9 B;  5APX A;  3P8M C;  2KLV A;  1KIL D;  1IJD B;  3MTU E;  2O1J A;  1NTK K;  2XKM A;  3BAS A;  2IX7 C;  1NWQ A;  3V4W A;  4W7Z A;  1J1E C;  3KQG A;  1URQ C;  5KLV K;  2N1T A;  4I2L C;  2HPC A;  1LT9 A;  2BAS A;  1ZLL A;  2OYI B;  3TNU A;  2WPR A;  1LT9 B;  3M0A A;  2OYH A;  2OYI A;  1CZQ A;  2I1J A;  4C7R A;  2JEE A;  2P67 A;  1N73 C;  3RK2 D;  3PP5 A;  3E1I A;  2OYH B;  1HWT C;  1LTJ C;  3RL0 C;  5BU8 B;  3CLQ A;  2C9L Y;  5CCH C;  4IFM A;  2M3B A;  2YMY A;  4WB4 A;  1IFM A;  1NOH A;  1A02 F;  2R3C A;  3L37 A;  2XZR A;  2L5G B;  3RK2 C;  3U59 A;  4XA4 A;  2FFD C;  1FZB A;  1IFN A;  1HBW A;  1FZC A;  3L4F A;  3V4Q A;  2C0W A;  4LGD E;  1HUC A;  3LIE A;  3OJA B;  5AVS B;  2J59 M;  1MFZ A;  2FYZ A;  1GW3 A;  2MJZ A;  1IFI A;  1RE4 A;  2KP8 A;  3O8Z A;  2YKP A;  1GW4 A;  1MUU A;  4DOJ A;  4GIF A;  1T3J A;  1URQ D;  1JY2 O;  1LWU C;  2P1J A;  3LW5 H;  3V2P A;  3P8C E;  1JMM A;  1JY3 N;  2R32 A;  5CCG D;  1LWU A;  3R2P A;  4KHX A;  3VTP C;  4GT1 A;  2YKO A;  2WTY A;  1L4A D;  1X79 B;  1AFO A;  2N1T B;  3BVH A;  3L35 A;  1N7S C;  1YYC A;  2HPC B;  3EFG A;  1M7L A;  1GK4 A;  2XDJ A;  4M3L A;  1SVF A;  2WSF H;  3HE4 B;  1LGH B;  2N9B A;  5KJ7 A;  4N78 E;  1NU1 K;  1XTG B;  1FOS F;  1DX7 A;  3CL3 D;  2H7H A;  4GKG A;  1N7S D;  3SWF A;  1JUN A;  3KDP B;  3CI9 A;  1M1J C;  2O1K A;  1NTZ K;  5AW8 B;  4DZO A;  3M0D A;  1LTA C;  5AW7 B;  1J2J B;  4N78 D;  3U1C A;  4HH2 A;  1N73 A;  2HYN A;  3M06 A;  3VP8 A;  3OAK A;  2A45 H;  2IFN A;  3MUD A;  1FZC B;  1NH4 A;  2Q3I A;  3TSI A;  3V2R A;  1CW5 A;  3B8E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...