1KILA

Three-dimensional structure of the complexin/snare complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
b'SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptobrevin SNARE motif
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 27
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kilA00
3KYQA 3RK2B 3HD7B 2HG5D 1NHLA 3RL0C 3VOPA 3HTKB 5CCGD 2NPSD 2WZ7A 4WY4A 3B5NB 3RK3C 5CCHD 1URQA 2PP6A 3RL0B 2M8RA 5CCGA 1N7SD 3RK3B 2YMYA 1JTHA 4JF7A 3RK2C 4W7ZA 3HD7C 3P8CE 1SFCC 1L4AB 4WY4D 2N1TB 1N7SA 1SFCB 3M0DC 2HFED 2XDJA 4W80A 1KILA 1GL2A 1L4AC 2N1TC 2NPSB 5KJ7C 3HD7A 3B5NA 3PP5A 3TSIA 4OH8B 1KILD 1GL2D 4N78E 1URQC 4WY4B 3RK2D 5CCGC 3HD7D 2NPSC 4W7YA 1URQB 5CCHC 1L4AA 3B5ND 2H8PD 2N1TA 5KJ7A 3RL0D 1N7SC 1T3JA 1SFCA 1JTHB 3RK3D 1XTGB 1HVVA 1N7SB 4WY4C 1L4AD 2N1TD 1KILC 1GL2C 5KJ7D 2NPSA 2KOGA 1SFCD 5CCHA 4LGDE 1KILB 1GL2B 3B5NC 1URQD
chains in the Genus database with same CATH superfamily
1T6AA 2O01J 1L0LG 3VOPA 5CMZA 2YKQA 3AE8C 3SWKA 2R5DA 1WMKA 3MIWA 3L71J 3RK3B 1LTJC 3G3ZA 3E1RA 4W7ZA 3H1ID 1JY2O 1YIJP 2KK7A 1S4XA 2WSEJ 3L75J 1W2EA 3TDKA 3ITKA 3RBZA 2WWWA 1NH4A 1LT9A 1EDKA 3H1HJ 4JYBA 3H1KJ 3RL0g 5AVYB 1L0NG 4O9BA 1VQ4P 1K9MQ 3EFFK 3BCCD 4HB1A 5KTBA 3D71A 1PP9E 1G1IA 2YXQB 2D2CC 1GDTA 1IK7A 2E5TA 4Y99B 1S9KE 4PD4H 3H32B 3I55P 1VF5C 1S72P 2M0BA 2A06G 1J1EC 1N73A 2KNCB 1KFMA 1SQQD 1SQXK 2HPCA 3L71G 3V4WA 2FKWB 3QWOC 5AVRB 2FYZA 1JO5A 2P58A 4ASWA 1MFTA 3L75G 5K5GB 5AVSB 4M3LA 3V2RA 3BVHA 1HJBA 1NHLA 2KSEA 3Q3DA 3L72E 2YO3A 3RL0B 1KYOI 1M7LA 3H1KG 5CCGA 1SQBE 5KLIB 3AEGC 3C1LA 1S5LX 3TYYA 3LIDA 1KYOD 1L4AB 1DIPA 2N1TB 2L91A 3AECC 1MUUA 3L74J 2GUSA 2V7QH 4GOFA 1N86A 2B88A 1ZV8A 2J58A 2N9BA 1Q86Q 2XDJA 2QIWA 3L4FA 2IZ1A 3NMDA 1PZQA 3M9QA 1IO4A 4GIFA 2HODB 2KS1A 3CCMP 4C7RA 3CCEP 1MZ9A 2V7QJ 3EFGA 1IFNA 1QGKB 4N3YB 1SS1A 2OTLP 4L74A 1WT6A 1NTKD 2I1KA 2HYNA 1DX7A 4EOTA 1VQKP 2OYIB 2K9JB 4I6MC 4D6TG 1RF1B 3HUSC 5C39A 3HE4A 3AEAC 3TNUA 1GD2E 1DD3A 1U57A 1AFOA 3GHGC 2E76D 1ZMEC 4RKUJ 1IK9A 1GU5A 1IZNB 4C7NB 1PP9J 1PPJG 1T8ZA 3VTPC 1XTCC 2WSCH 4PV1B 2BASA 1NU1D 4DCKA 2KYVA 1FOSE 2FXOA 3V4QA 2HR3A 2IBZI 3R4YA 1JUNA 1LWUB 3CCSP 1SQQK 1BE3E 4KHXA 4JQ0D 1YBKA 2W27A 3OAKA 3LW5H 1VQPP 2LXCB 1J1DB 2JWDA 1E5WA 3H6PA 2H8PD 4R4MA 3Q5RA 1H88A 1JCCA 1MKMA 2Q1KA 2FYUE 2YXRB 1T3JA 3MD0A 1VQMP 1SQBJ 2M5AA 1BCCE 2YIUC 4L73A 1HVVA 1JCDA 1Z56A 1N2DC 1H0TB 4Y28J 1JY3P 1KILC 3CCLP 4H13D 1X79B 3SWYA 1PV3A 1Y47A 1PP9G 1HF9A 3A3YB 1HTLC 1GL2B 1L0LE 1M1JB 3B5NC 1TU3F 3AE4C 3L70G 4IFDK 5AVZB 2E43A 3VMXA 4WY4A 5AVWB 1URQA 2KSJA 4GODA 1FJPA 1G1JA 3CCUP 3WUVA 4I1LA 2XKMA 5M1BA 3CC2P 3GMAA 4WY4D 1X22A 2ZXXA 4NPDA 4DJGA 4ZKUA 4H44D 3TGUD 3S4RA 1LJ2A 2A45I 2Y9ZA 1SQVE 3MTUE 2Q5UA 4W80A 1OIPA 3KZIE 3P8CD 1USEA 1QEXA 2FFDA 3L72G 3G9RA 5B5EE 1NTKK 3HE5A 1ZLLA 3AE6C 2H7HA 4KT0J 3AE7C 3KQGA 1YJWP 1AVYA 3RK2D 4BRYB 2E76C 1ZW0A 3CL3D 1EZVG 1LTJA 1Q2NA 1HUCA 3M0AA 3AE9C 1YI2P 2A06E 1BGYE 1U7JA 1K04A 1FS0E 5APSA 1N7SB 2YKOA 1X0TA 1RQVA 3WU2E 1UIIA 1K73Q 5AW7B 3OJAB 3M9HA 1KQSO 3V2NA 1NU1K 1SVFA 3V2QA 1KYOH 3CWBE 3H1JD 1NTMD 2IBZE 3CCVP 2QEXP 5APUA 1VPCA 4H0LB 1BE3J 3H1IG 2J59M 2E74D 1RE4C 1AVOA 2BCCE 2IYPA 1JTHA 1ZR2A 4IOIH 3F5HA 3Q2YA 2Q6QA 2FYUJ 2D2CD 1BCCJ 5KLVE 4HJGH 5AVUB 2XV5A 2AXCA 1H8AA 1VF5D 4R4LA 1J2JB 3GF7A 1OW7A 3MUDC 4OH8B 1L0LJ 1PGQA 5DJUB 4U7JA 2ZT9B 2N9YB 4PD4E 5B5EH 3E7KA 3CXHI 1FZEA 1M56D 1XTGB 2IFMA 1FAVA 1G2CA 4D6TE 3CXHD 4WY4C 3QH9A 1VQ7P 1VQOP 4H44C 1RE3C 1BE3G 4OGQB 1JB0J 3A5TA 1KQGB 1SQVJ 1QVFO 3MGNA 1OWAA 1CW5A 2OTKE 1KZUB 4YXDC 2FYUG 1AQ5A 2E42A 1SQPD 2LKMA 1BCCG 3N7NA 1RH5B 4RESB 1HH0A 1IJDB 3RK2C 4JYCA 1KB9D 2QSIA 3IN6A 1S5LE 1SFCB 1KN7A 3RBXA 1RY3A 1BGYJ 3CPWO 3MHVA 2KZIA 2OYHB 2W6AA 2WQYC 1E79H 3HUSA 1R8EA 3AE2C 5CHXA 2R5BA 3CX5I 1BDDA 1JY3N 3M9BA 3GF3A 3CX5D 3GHGA 3CWBJ 5BU8B 3CI9A 2K88A 3SFEC 1USDA 1NTKG 3A7OA 1SQVG 1Q7YQ 2E74C 1NTMK 3TK1A 2AEFA 4NPEA 2W6JH 2BCCJ 1KV4A 1CI6A 5AW9B 5KKZB 2W83C 2QA4P 4ZNCA 2E5YA 3L70E 2CK3H 1RF0C 5KLVJ 2KUBA 3U1CA 1SQXE 1HWTC 3OW2O 2RKLA 2ZXEB 3F89A 4IL6X 4HKZH 1FDMA 1BGYG 3RK3C 1FDOA 5CJ4A 2CPBA 4GDOA 3T97A 1JOCA 1OW8A 3H1LE 2KLUA 2A45H 1FOSF 5GTHH 2XU6A 3P7KA 3CCJP 3BATA 3I56P 3C8VA 1GW3A 1ZRTD 2ZYAA 4U3FE 3II6A 3CWBG 1KILA 2IBZG 2B87B 3U59A 4D6TJ 2Z4EA 5CBNA 3C9IA 2LR2A 5APVA 3HTKA 1PGJA 2BCCG 3B5NA 1KILD 3CCQP 2ZFCA 1S5LH 1FU1A 3L37A 5B66H 1EZVE 2QJYB 3VP8A 1A02J 3G4SP 3L73E 4W7YA 1GMJA 3B5ND 3LIEA 5KLVG 5KJ7A 1SQPK 3U1AA 2OQQA 1NTZD 3KPEA 3W67A 4GKGA 4HYTB 5KJ7D 2NPSA 1LT9B 2K37A 1KQFB 2ZYDA 5BVZA 1N8RQ 2R3CA 1S2EA 1MV8A 4RJTA 4AQRD 3H1IE 3RL0C 2NPSD 3KXDA 5KLIC 1YTZT 2MJZA 3V5BA 3NFQA 1IFPA 1EXJA 4JF7A 4GOEA 1NWQA 2ZJSE 2A45G 3WUTA 1JM0A 1L0ND 4GT1A 3BCCE 2PRRA 2IZ0A 1N73B 4TLFA 2HPCB 1P84D 1LP1A 4I2LC 1Y9BA 2Y0DA 1KQLA 1CZQA 3L70J 3O6QA 1RHZB 4C46A 1SQXJ 2WT7A 2K9YA 3A0BE 4UB8E 1SQQE 2NRGA 1RE4A 1R5SA 1L2PA 1SLQA 1FZGA 5TISE 5DJTB 3L71D 1OXZA 3WUUA 3H1LJ 2OYIC 1CSBA 1RF1C 2OGUA 3L75D 3IFMA 2WSCJ 3E1IA 1Y8AA 1JNMA 1U7MA 1FZCA 2KXPB 1GW4A 2C0WA 3H1JG 5H2FE 4LGDE 3L72J 4U3FJ 3H1HD 3WMM0 3CLQA 1IFDA 3H1KD 1KYOE 1NKNA 4XE5B 5AVTB 1LTAC 2KS1B 3MUDA 2IPPA 1N7SD 1YITP 3LW5J 2YMYA 3L73J 2RN0A 3AEFC 5AW2B 2E75B 3BRVB 1SQXG 2C0XA 2KI7B 1RE3A 3CX5H 2XZRA 3L35A 2G8YA 2NZ2A 1OMIA 2E76B 5KJ7C 3HD7A 2K1AA 3HE4B 1NTZK 5AW4B 1N7LA 3Q1MA 3VN0A 3TNUB 3A0HE 3H1LG 1KORA 3HRNA 2FYNB 2PGDA 3AE3C 3L36A 1AJYA 1NTKE 2J5UA 1YJ9P 4LC1A 1Q81Q 5EFWB 2HLOA 3H1IJ 2NPSC 3HD7D 3P32A 4WWIA 1X8YA 4U3FG 4WBAA 2QJPC 1AQTA 1FZAA 4N78D 3VMYA 1GZLA 3L74D 3GG2A 1GL2C 4JPZB 3B8EB 3B71A 1JY2P 1A02F 3JSVC 3USSA 3CMEP 3A0BH 1M1JC 4UB8H 3CCRP 3BCCJ 2JJLA 3L73G 5KAIH 1L0NK 3BRTB 5TISH 1PPJD 1M1KQ 1FZBA 3VMZA 5TJHA 2M8RA 1NU1E 4IFMA 3VMAA 3N4XA 2Y0EA 3EQ2A 5H2FH 3AE1C 1SQQJ 1LTGC 2BEQD 4H13B 1FC2C 2YKPA 5KAFH 2M5AB 3UIAA 2Z5IA 1GK4A 2R3SA 1D7MA 4K35A 1NO4A 2ITAA 2GUVA 3FWLA 4ZMDA 3OA7A 1VDFA 3AE5C 1RF0A 1LTSC 2K3RA 3CMAP 3AEBC 2QJKC 4LLHA 4WY4B 3KHUA 1FZCC 1URQB 2RMZA 4H44B 2ZAEB 3Q5PA 2GM4A 1KFNA 2WTYA 5E79E 3BCCG 1H89A 1NKZB 1N7SC 3B4SA 4EYYQ 3RK3D 1PP9D 2PAJA 5AVQB 2WSFH 1VQ8P 1LTIC 3A0HH 3TF5A 2M3BA 1K8AQ 2M3EA 3CD6P 1S9KD 4N6JA 1QVGO 2FFDB 1SQQG 3RK2B 2H89C 2JEEA 5BU5A 3HE5B 3TGUE 1OVUA 2V4HA 3KDPB 4IL6E 4MN4C 3Q5SA 4XFJA 1NTKJ 3H32A 1JY3O 2IFNA 3HD7C 3P8CE 2AEJA 5GTHE 1LTJB 1BSNA 2KNCA 3A2AA 1NAYA 2G3AA 2Q9IA 1OX3A 1Q82Q 1SQBD 2Y0CA 2RH0A 1KB9I 1YQ4C 2O01H 1QL1A 2E74B 3TSIA 2IDBA 4L76A 3VYIA 2ZT9C 5B66E 1KC8Q 2WVRA 2B9BA 1L4AA 2N1TA 3IF4A 1X9VA 1FZFA 2D2CB 3RL0D 1OW6A 3FXDA 1NU1J 4EI2A 1JTHB 4OGQC 1VF5B 2O3JA 2O01N 1L4AD 3H1JE 1GTWA 1NTME 2N1TD 2OTJP 2LXBA 2OARA 5AW1B 5APTA 1J1EB 2YNYA 5CCHA 2HODA 4XA4A 2YO2A 5E79H 3D70A 1JEKA 1ZR4A 1EDLA 3KYQA 1SP4A 5CCHD 3GW6A 1LTTC 1YJNP 2QG4A 4I7ZC 3AEEC 1Q90D 3PRJA 4YXWH 1SFCC 3MZWB 2R32A 2DW3A 2OYHC 1S3JA 1VQ9P 3RK3E 2OYIA 3M0DC 2K9JA 1M90Q 5AW3B 1LTBC 1RF1A 1G2CB 1KMIZ 4IL6H 1NU1G 5CJ0A 1JY2N 4DT0A 3H25A 2QVAA 4C7NA 1NVOA 1EDJA 4B86A 3CXHE 2AXTE 2CPSA 3TGUJ 1BE3D 3S1KA 2JR8A 2I8DA 5KKZC 1PGOA 2O1JA 2Z5HA 3H1HG 1KD1Q 4Y99C 1SQPE 2Y9YA 2FYUD 4PV1D 3CC4P 1LWUA 1BCCD 3JCUE 3SFDC 3HUSB 2FY8A 1AA0A 1SQBK 2POHA 1KB9E 5CCGD 1DH3A 2MKVA 1PIXA 3PH0A 3GHGB 2WSSH 1FE6A 4PJ0E 1L0LD 1M8OB 1HGZA 2P10A 1FBMA 3SSUA 4L75A 1H0TA 5APYA 3G71P 2XNDH 1ZP0C 3CX5E 1GL2A 4QMAA 1GU4A 1CI6B 1L4AC 1M1JA 3TGUG 1S1CX 2R44A 2N1TC 2P1JA 5AW0B 3H1JJ 1NTMJ 4JBZA 1PGPA 3RGUA 2QJYC 2Q3IA 1SQVD 1FDIA 1GL2D 3W68A 2P7JA 5GTIE 2W6BA 1P84I 1YYCA 2E75D 1ZOYC 4WB4A 4A7PA 5CCHC 2FXPA 1DD4A 2FXMA 1LNQA 1W2BO 3T97B 1IC2A 4TT3H 3L74G 1KTMA 4CPGA 1NYHA 2KLVA 1LT9C 2YIUB 4EIJA 3K5BA 3CXHH 1PL5A 2AXTH 2A06D 1BGYD 2JO1A 2ZVNB 1KILB 5KAIE 2YMKA 1QX8A 1OZHA 4IFFA 2WPRA 3M91A 3HTKB 2WZ7A 4BRYA 3B5NB 1T3UA 2PP6A 1R5LA 2KIKA 4YTPC 4DOJA 1JMMA 1ZRTE 2ZVOB 2ZYGA 1NTMG 3CWBD 2KB7P 2IBZD 3JCUH 1N7SA 3G6EP 1HJ0A 1NJIQ 1YTZI 5KAFE 1AV1A 1N73C 2C9LY 1KB9H 2HFED 1KILE 4AYCA 2BCCD 1HGVA 2JP3A 1NOHA 1OVRA 2UWJE 4PJ0H 2XNXA 4OVNF 1GK6A 1NGMB 2NPSB 1DEBA 4NPFX 1SQPJ 4PV1C 4UB6E 2PFXA 4BWNA 3PP5A 2AEMA 2QJPB 5KLVD 3V6IA 5APWA 2FYUK 1LT1A 1FJKA 1NTZE 5CCGC 1WRGA 1OVVA 2H43A 1LWUC 1M57D 4H0LD 4KJMA 2KZJA 3MP7B 3FXEA 2Q3EA 1J1DC 1L0LK 1ZXGA 4PD4I 2QE7H 5GTIH 2KOGA 1DEEG 4PD4D 2WPVB 3D6YA 1IFMA 1T2KD 2WMMA 2FBWC 4D6TD 1URQD 1LP1B 3V2PA 2HG5D 2OYOA 3PHLA 2W8ZA 3O6QB 1L0NE 2WT7B 3FWNA 4AUWA 1SQVK 1YQ3C 2E75C 1SQBG 1P84E 1SQPG 2O1KA 1MFZA 2ZT9D 3IR9A 2QM8A 1NAFA 1QL2A 3M06A 2QJKB 3PTZA 2IX7C 3NXSA 1FZCB 1PFIA 4K3AA 2B89A 4OGQD 2FYNC 1EC5A 1EQ7A 4ZKPA 3S9OA 1VQ5P 3L71E 3BASA 3FGAD 3PLNA 2WITA 3L75E 1JMBA 5AVXB 2L5GB 2QRXA 4RO0A 3I5CA 1SFCA 1YHQP 2WPSA 1VQLP 3R2PA 1IFJA 3AEDC 3H1HE 4UB6H 2OYHA 1UIXA 2VRSA 3H1KE 3M0DA 2QM7A 5AW5B 2Q7CA 5AW6B 1SFCD 1EDIA 1BSHA 3CC7P 1W5CE 5AVVB 3SWFA 1BDCA 1LGHB 3HD7B 4ASVA 2P2UA 3PJSK 1OFCX 4OWFA 3L70D 2WPQA 4H13C 1SQXD 1RQUA 5CBOA 5KLVK 1NTZJ 2JWAA 1IFIA 1K05A 4Z1MH 2H88C 4BXLA 4YPCA 2P67A 4H0LC 2KP8A 5APQA 3GLMA 3P8MC 4WVZA 3H1LD 2WSFJ 3KZIH 3VP9A 3ABVC 3EWKA 2BEZF 2JKVA 1VQNP 2IYOA 1P84H 3L72D 1T2KC 4U3FD 4N78E 1VL2A 1URQC 3O8ZA 3ZDMA 3JC22 2JDIH 4HH2A 1VQ6P 2I1JA 1QLED 1HBWA 3L74E 3FX0A 2W90A 1EZVI 4EDFA 5APXA 1L0NJ 1EZVD 3L73D 3NTNA 2C9NY 1EXIA 4DZOA 1PPJE 3D6ZA 2B87A 3IAOA 1ZN5A 5L8RJ 2FFDC 5AW8B 3WU2H 2SPZA 2WSEH 4I7ZB 2GA1A 1NTZG
chains in the Genus database with same CATH topology
1NU1K 1SVFA 3V2QA 1SQBK 1NKNA 2POHA 4XE5B 5AVTB 1LTAC 3VOPA 5CMZA 5CCGD 5APUA 3MUDA 2YKQA 1DH3A 1VPCA 2R5DA 2J59M 3GHGB 1RE4C 3MIWA 2IPPA 1N7SD 3RK3B 1HGZA 1LTJC 1FBMA 2YMYA 3G3ZA 1JTHA 1ZR2A 4W7ZA 1JY2O 1W2EA 5APYA 5AW2B 2WWWA 1NH4A 3BRVB 2C0XA 1LT9A 1RE3A 1GL2A 5AVUB 4JYBA 2XV5A 1GU4A 1CI6B 2XZRA 5AVYB 3L35A 1L4AC 1M1JA 2N1TC 2P1JA 5AW0B 1H8AA 5KJ7C 3HD7A 3HE4B 4O9BA 1NTZK 5AW4B 1N7LA 3VN0A 3TNUB 1J2JB 2Q3IA 3HRNA 4OH8B 1GL2D 5KTBA 2P7JA 3L36A 2W6BA 1G1IA 4LC1A 1YYCA 2HLOA 3HD7D 2NPSC 3P32A 4WB4A 1GDTA 1X8YA 5CCHC 4Y99B 4WBAA 2FXMA 1S9KE 1IC2A 1FZAA 3H32B 4N78D 1FZEA 1XTGB 3VMYA 2IFMA 1FAVA 1GZLA 1G2CA 1J1EC 2KLVA 4WY4C 1N73A 1LT9C 1KFMA 1RE3C 4EIJA 1SQXK 2HPCA 1GL2C 3B8EB 1A02F 1JY2P 1M1JC 3A5TA 3V4WA 2FKWB 1KILB 2JJLA 2FYZA 5AVRB 1JO5A 3MGNA 1OWAA 1L0NK 5AVSB 3BRTB 4IFFA 2WPRA 4M3LA 1CW5A 3M91A 3V2RA 3BVHA 1HJBA 1KZUB 1NHLA 1FZBA 3VMZA 3HTKB 2WZ7A 1AQ5A 3B5NB 1T3UA 2E42A 2LKMA 2PP6A 2YO3A 3N7NA 3RL0B 2M8RA 1M7LA 4IFMA 4RESB 4DOJA 1JMMA 5CCGA 1HH0A 3N4XA 1IJDB 3TYYA 3LIDA 3RK2C 3EQ2A 4JYCA 2KB7P 1L4AB 2N1TB 1N7SA 1LTGC 1MUUA 2GUSA 2YKPA 1YTZI 1N86A 1SFCB 1N73C 2C9LY 1RY3A 1ZV8A 3UIAA 2Z5IA 1GK4A 2J58A 2N9BA 2HFED 2OYHB 4AYCA 1HGVA 2XDJA 3L4FA 1NOHA 3NMDA 2W6AA 3M9QA 1NO4A 1IO4A 3HUSA 2GUVA 2XNXA 3OA7A 1GK6A 1VDFA 2NPSB 1DEBA 4GIFA 1RF0A 5CHXA 2R5BA 1LTSC 2HODB 1JY3N 3PP5A 3M9BA 4C7RA 1MZ9A 5APWA 3GHGA 2FYUK 3EFGA 4LLHA 1IFNA 1FJKA 4N3YB 4WY4B 5CCGC 1FZCC 5BU8B 1WRGA 3CI9A 1URQB 2H43A 2GM4A 1KFNA 2WTYA 1LWUC 3A7OA 1H89A 1WT6A 1NKZB 1NTMK 3TK1A 1N7SC 3RK3D 2PAJA 2I1KA 5AVQB 1J1DC 2HYNA 1L0LK 2WSFH 1LTIC 1DX7A 2M3BA 1CI6A 4EOTA 2OYIB 5AW9B 4I6MC 2KOGA 1RF1B 3HUSC 3HE4A 1S9KD 4N6JA 1RF0C 1IFMA 3TNUA 1T2KD 3U1CA 1GD2E 2FFDB 1URQD 1HWTC 1AFOA 3RK2B 2ZXEB 3V2PA 2HG5D 2JEEA 3GHGC 1FDMA 5BU5A 3RK3C 3HE5B 1IK9A 5CJ4A 1GU5A 3KDPB 4C7NB 2WT7B 2CPBA 3T97A 1JOCA 3H32A 4AUWA 1JY3O 2IFNA 1T8ZA 3HD7C 3P8CE 1SQVK 2A45H 3VTPC 1LTJB 2O1KA 1FOSF 1MFZA 1XTCC 2XU6A 3IR9A 3P7KA 3BATA 2WSCH 3A2AA 2BASA 2Q9IA 1GW3A 2QM8A 1NAFA 1QL2A 3II6A 3M06A 2KYVA 1FOSE 1KILA 2IX7C 3U59A 3V4QA 2Z4EA 3NXSA 2O01H 1FZCB 1PFIA 3C9IA 1QL1A 1JUNA 5APVA 3HTKA 1LWUB 1SQQK 3B5NA 1EQ7A 4KHXA 3TSIA 4ZKPA 1KILD 3VYIA 2ZFCA 3BASA 1FU1A 3L37A 2W27A 3OAKA 3LW5H 3VP8A 1A02J 2WITA 1J1DB 4W7YA 1E5WA 3H6PA 2L5GB 1L4AA 5AVXB 3B5ND 2H8PD 2N1TA 3LIEA 1H88A 1X9VA 1JCCA 1FZFA 3I5CA 5KJ7A 3RL0D 1SFCA 1T3JA 3MD0A 2WPSA 1JTHB 1SQPK 3U1AA 3R2PA 1IFJA 1HVVA 2OYHA 1JCDA 2VRSA 1Z56A 1N2DC 3M0DA 1JY3P 1L4AD 1GTWA 3KPEA 2N1TD 1KILC 2OARA 2QM7A 5AW1B 4GKGA 4HYTB 5AW5B 1X79B 5APTA 3SWYA 1J1EB 5KJ7D 2NPSA 2Q7CA 5AW6B 1SFCD 1LT9B 2YNYA 3A3YB 5CCHA 1HTLC 2HODA 4XA4A 5BVZA 1GL2B 5AVVB 3SWFA 2R3CA 2YO2A 1LGHB 1M1JB 1ZR4A 3B5NC 1MV8A 3KYQA 3HD7B 4AQRD 4IFDK 5AVZB 3RL0C 2P2UA 2E43A 3VMXA 2NPSD 4WY4A 5AVWB 1SP4A 5CCHD 1URQA 2KSJA 1YTZT 2MJZA 1LTTC 1FJPA 3V5BA 3NFQA 1G1JA 2WPQA 4I1LA 2XKMA 4JF7A 1SFCC 5KLVK 1IFIA 4WY4D 1NWQA 2R32A 4ZKUA 2OYHC 2P67A 2A45G 2KP8A 2OYIA 3M0DC 2A45I 4GT1A 5AW3B 1LTBC 1RF1A 3MTUE 1G2CB 2Q5UA 4W80A 5APQA 3P8MC 1N73B 3VP9A 3P8CD 2HPCB 2FFDA 1NTKK 4I2LC 5CJ0A 3HE5A 1ZLLA 1KQLA 2H7HA 1CZQA 1JY2N 1T2KC 4N78E 1URQC 3O8ZA 4C7NA 3KQGA 4C46A 2WT7A 4B86A 4HH2A 3RK2D 2I1JA 1RE4A 3CL3D 1HBWA 2CPSA 1LTJA 1SLQA 1FZGA 1HUCA 3M0AA 5APXA 1OXZA 2OYIC 5APSA 3NTNA 1N7SB 2C9NY 1CSBA 1RF1C 4DZOA 2O1JA 2Z5HA 2YKOA 3IFMA 3E1IA 1JNMA 4Y99C 1ZN5A 1FZCA 2FFDC 1GW4A 5AW8B 2C0WA 2WSEH 1LWUA 4LGDE 5AW7B 3OJAB 3M9HA 3WMM0 3CLQA 3HUSB 1IFDA 3V2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYQ A;  3RK2 B;  3HD7 B;  2HG5 D;  1NHL A;  3RL0 C;  3VOP A;  3HTK B;  5CCG D;  2NPS D;  2WZ7 A;  4WY4 A;  3B5N B;  3RK3 C;  5CCH D;  1URQ A;  2PP6 A;  3RL0 B;  2M8R A;  5CCG A;  1N7S D;  3RK3 B;  2YMY A;  1JTH A;  4JF7 A;  3RK2 C;  4W7Z A;  3HD7 C;  3P8C E;  1SFC C;  1L4A B;  4WY4 D;  2N1T B;  1N7S A;  1SFC B;  3M0D C;  2HFE D;  2XDJ A;  4W80 A;  1KIL A;  1GL2 A;  1L4A C;  2N1T C;  2NPS B;  5KJ7 C;  3HD7 A;  3B5N A;  3PP5 A;  3TSI A;  4OH8 B;  1KIL D;  1GL2 D;  4N78 E;  1URQ C;  4WY4 B;  3RK2 D;  5CCG C;  3HD7 D;  2NPS C;  4W7Y A;  1URQ B;  5CCH C;  1L4A A;  3B5N D;  2H8P D;  2N1T A;  5KJ7 A;  3RL0 D;  1N7S C;  1T3J A;  1SFC A;  1JTH B;  3RK3 D;  1XTG B;  1HVV A;  1N7S B;  4WY4 C;  1L4A D;  2N1T D;  1KIL C;  1GL2 C;  5KJ7 D;  2NPS A;  2KOG A;  1SFC D;  5CCH A;  4LGD E;  1KIL B;  1GL2 B;  3B5N C;  1URQ D; 
#chains in the Genus database with same CATH topology
 1T6A A;  2O01 J;  1L0L G;  3VOP A;  5CMZ A;  2YKQ A;  3AE8 C;  3SWK A;  2R5D A;  1WMK A;  3MIW A;  3L71 J;  3RK3 B;  1LTJ C;  3G3Z A;  3E1R A;  4W7Z A;  3H1I D;  1JY2 O;  1YIJ P;  2KK7 A;  1S4X A;  2WSE J;  3L75 J;  1W2E A;  3TDK A;  3ITK A;  3RBZ A;  2WWW A;  1NH4 A;  1LT9 A;  1EDK A;  3H1H J;  4JYB A;  3H1K J;  3RL0 g;  5AVY B;  1L0N G;  4O9B A;  1VQ4 P;  1K9M Q;  3EFF K;  3BCC D;  4HB1 A;  5KTB A;  3D71 A;  1PP9 E;  1G1I A;  2YXQ B;  2D2C C;  1GDT A;  1IK7 A;  2E5T A;  4Y99 B;  1S9K E;  4PD4 H;  3H32 B;  3I55 P;  1VF5 C;  1S72 P;  2M0B A;  2A06 G;  1J1E C;  1N73 A;  2KNC B;  1KFM A;  1SQQ D;  1SQX K;  2HPC A;  3L71 G;  3V4W A;  2FKW B;  3QWO C;  5AVR B;  2FYZ A;  1JO5 A;  2P58 A;  4ASW A;  1MFT A;  3L75 G;  5K5G B;  5AVS B;  4M3L A;  3V2R A;  3BVH A;  1HJB A;  1NHL A;  2KSE A;  3Q3D A;  3L72 E;  2YO3 A;  3RL0 B;  1KYO I;  1M7L A;  3H1K G;  5CCG A;  1SQB E;  5KLI B;  3AEG C;  3C1L A;  1S5L X;  3TYY A;  3LID A;  1KYO D;  1L4A B;  1DIP A;  2N1T B;  2L91 A;  3AEC C;  1MUU A;  3L74 J;  2GUS A;  2V7Q H;  4GOF A;  1N86 A;  2B88 A;  1ZV8 A;  2J58 A;  2N9B A;  1Q86 Q;  2XDJ A;  2QIW A;  3L4F A;  2IZ1 A;  3NMD A;  1PZQ A;  3M9Q A;  1IO4 A;  4GIF A;  2HOD B;  2KS1 A;  3CCM P;  4C7R A;  3CCE P;  1MZ9 A;  2V7Q J;  3EFG A;  1IFN A;  1QGK B;  4N3Y B;  1SS1 A;  2OTL P;  4L74 A;  1WT6 A;  1NTK D;  2I1K A;  2HYN A;  1DX7 A;  4EOT A;  1VQK P;  2OYI B;  2K9J B;  4I6M C;  4D6T G;  1RF1 B;  3HUS C;  5C39 A;  3HE4 A;  3AEA C;  3TNU A;  1GD2 E;  1DD3 A;  1U57 A;  1AFO A;  3GHG C;  2E76 D;  1ZME C;  4RKU J;  1IK9 A;  1GU5 A;  1IZN B;  4C7N B;  1PP9 J;  1PPJ G;  1T8Z A;  3VTP C;  1XTC C;  2WSC H;  4PV1 B;  2BAS A;  1NU1 D;  4DCK A;  2KYV A;  1FOS E;  2FXO A;  3V4Q A;  2HR3 A;  2IBZ I;  3R4Y A;  1JUN A;  1LWU B;  3CCS P;  1SQQ K;  1BE3 E;  4KHX A;  4JQ0 D;  1YBK A;  2W27 A;  3OAK A;  3LW5 H;  1VQP P;  2LXC B;  1J1D B;  2JWD A;  1E5W A;  3H6P A;  2H8P D;  4R4M A;  3Q5R A;  1H88 A;  1JCC A;  1MKM A;  2Q1K A;  2FYU E;  2YXR B;  1T3J A;  3MD0 A;  1VQM P;  1SQB J;  2M5A A;  1BCC E;  2YIU C;  4L73 A;  1HVV A;  1JCD A;  1Z56 A;  1N2D C;  1H0T B;  4Y28 J;  1JY3 P;  1KIL C;  3CCL P;  4H13 D;  1X79 B;  3SWY A;  1PV3 A;  1Y47 A;  1PP9 G;  1HF9 A;  3A3Y B;  1HTL C;  1GL2 B;  1L0L E;  1M1J B;  3B5N C;  1TU3 F;  3AE4 C;  3L70 G;  4IFD K;  5AVZ B;  2E43 A;  3VMX A;  4WY4 A;  5AVW B;  1URQ A;  2KSJ A;  4GOD A;  1FJP A;  1G1J A;  3CCU P;  3WUV A;  4I1L A;  2XKM A;  5M1B A;  3CC2 P;  3GMA A;  4WY4 D;  1X22 A;  2ZXX A;  4NPD A;  4DJG A;  4ZKU A;  4H44 D;  3TGU D;  3S4R A;  1LJ2 A;  2A45 I;  2Y9Z A;  1SQV E;  3MTU E;  2Q5U A;  4W80 A;  1OIP A;  3KZI E;  3P8C D;  1USE A;  1QEX A;  2FFD A;  3L72 G;  3G9R A;  5B5E E;  1NTK K;  3HE5 A;  1ZLL A;  3AE6 C;  2H7H A;  4KT0 J;  3AE7 C;  3KQG A;  1YJW P;  1AVY A;  3RK2 D;  4BRY B;  2E76 C;  1ZW0 A;  3CL3 D;  1EZV G;  1LTJ A;  1Q2N A;  1HUC A;  3M0A A;  3AE9 C;  1YI2 P;  2A06 E;  1BGY E;  1U7J A;  1K04 A;  1FS0 E;  5APS A;  1N7S B;  2YKO A;  1X0T A;  1RQV A;  3WU2 E;  1UII A;  1K73 Q;  5AW7 B;  3OJA B;  3M9H A;  1KQS O;  3V2N A;  1NU1 K;  1SVF A;  3V2Q A;  1KYO H;  3CWB E;  3H1J D;  1NTM D;  2IBZ E;  3CCV P;  2QEX P;  5APU A;  1VPC A;  4H0L B;  1BE3 J;  3H1I G;  2J59 M;  2E74 D;  1RE4 C;  1AVO A;  2BCC E;  2IYP A;  1JTH A;  1ZR2 A;  4IOI H;  3F5H A;  3Q2Y A;  2Q6Q A;  2FYU J;  2D2C D;  1BCC J;  5KLV E;  4HJG H;  5AVU B;  2XV5 A;  2AXC A;  1H8A A;  1VF5 D;  4R4L A;  1J2J B;  3GF7 A;  1OW7 A;  3MUD C;  4OH8 B;  1L0L J;  1PGQ A;  5DJU B;  4U7J A;  2ZT9 B;  2N9Y B;  4PD4 E;  5B5E H;  3E7K A;  3CXH I;  1FZE A;  1M56 D;  1XTG B;  2IFM A;  1FAV A;  1G2C A;  4D6T E;  3CXH D;  4WY4 C;  3QH9 A;  1VQ7 P;  1VQO P;  4H44 C;  1RE3 C;  1BE3 G;  4OGQ B;  1JB0 J;  3A5T A;  1KQG B;  1SQV J;  1QVF O;  3MGN A;  1OWA A;  1CW5 A;  2OTK E;  1KZU B;  4YXD C;  2FYU G;  1AQ5 A;  2E42 A;  1SQP D;  2LKM A;  1BCC G;  3N7N A;  1RH5 B;  4RES B;  1HH0 A;  1IJD B;  3RK2 C;  4JYC A;  1KB9 D;  2QSI A;  3IN6 A;  1S5L E;  1SFC B;  1KN7 A;  3RBX A;  1RY3 A;  1BGY J;  3CPW O;  3MHV A;  2KZI A;  2OYH B;  2W6A A;  2WQY C;  1E79 H;  3HUS A;  1R8E A;  3AE2 C;  5CHX A;  2R5B A;  3CX5 I;  1BDD A;  1JY3 N;  3M9B A;  3GF3 A;  3CX5 D;  3GHG A;  3CWB J;  5BU8 B;  3CI9 A;  2K88 A;  3SFE C;  1USD A;  1NTK G;  3A7O A;  1SQV G;  1Q7Y Q;  2E74 C;  1NTM K;  3TK1 A;  2AEF A;  4NPE A;  2W6J H;  2BCC J;  1KV4 A;  1CI6 A;  5AW9 B;  5KKZ B;  2W83 C;  2QA4 P;  4ZNC A;  2E5Y A;  3L70 E;  2CK3 H;  1RF0 C;  5KLV J;  2KUB A;  3U1C A;  1SQX E;  1HWT C;  3OW2 O;  2RKL A;  2ZXE B;  3F89 A;  4IL6 X;  4HKZ H;  1FDM A;  1BGY G;  3RK3 C;  1FDO A;  5CJ4 A;  2CPB A;  4GDO A;  3T97 A;  1JOC A;  1OW8 A;  3H1L E;  2KLU A;  2A45 H;  1FOS F;  5GTH H;  2XU6 A;  3P7K A;  3CCJ P;  3BAT A;  3I56 P;  3C8V A;  1GW3 A;  1ZRT D;  2ZYA A;  4U3F E;  3II6 A;  3CWB G;  1KIL A;  2IBZ G;  2B87 B;  3U59 A;  4D6T J;  2Z4E A;  5CBN A;  3C9I A;  2LR2 A;  5APV A;  3HTK A;  1PGJ A;  2BCC G;  3B5N A;  1KIL D;  3CCQ P;  2ZFC A;  1S5L H;  1FU1 A;  3L37 A;  5B66 H;  1EZV E;  2QJY B;  3VP8 A;  1A02 J;  3G4S P;  3L73 E;  4W7Y A;  1GMJ A;  3B5N D;  3LIE A;  5KLV G;  5KJ7 A;  1SQP K;  3U1A A;  2OQQ A;  1NTZ D;  3KPE A;  3W67 A;  4GKG A;  4HYT B;  5KJ7 D;  2NPS A;  1LT9 B;  2K37 A;  1KQF B;  2ZYD A;  5BVZ A;  1N8R Q;  2R3C A;  1S2E A;  1MV8 A;  4RJT A;  4AQR D;  3H1I E;  3RL0 C;  2NPS D;  3KXD A;  5KLI C;  1YTZ T;  2MJZ A;  3V5B A;  3NFQ A;  1IFP A;  1EXJ A;  4JF7 A;  4GOE A;  1NWQ A;  2ZJS E;  2A45 G;  3WUT A;  1JM0 A;  1L0N D;  4GT1 A;  3BCC E;  2PRR A;  2IZ0 A;  1N73 B;  4TLF A;  2HPC B;  1P84 D;  1LP1 A;  4I2L C;  1Y9B A;  2Y0D A;  1KQL A;  1CZQ A;  3L70 J;  3O6Q A;  1RHZ B;  4C46 A;  1SQX J;  2WT7 A;  2K9Y A;  3A0B E;  4UB8 E;  1SQQ E;  2NRG A;  1RE4 A;  1R5S A;  1L2P A;  1SLQ A;  1FZG A;  5TIS E;  5DJT B;  3L71 D;  1OXZ A;  3WUU A;  3H1L J;  2OYI C;  1CSB A;  1RF1 C;  2OGU A;  3L75 D;  3IFM A;  2WSC J;  3E1I A;  1Y8A A;  1JNM A;  1U7M A;  1FZC A;  2KXP B;  1GW4 A;  2C0W A;  3H1J G;  5H2F E;  4LGD E;  3L72 J;  4U3F J;  3H1H D;  3WMM 0;  3CLQ A;  1IFD A;  3H1K D;  1KYO E;  1NKN A;  4XE5 B;  5AVT B;  1LTA C;  2KS1 B;  3MUD A;  2IPP A;  1N7S D;  1YIT P;  3LW5 J;  2YMY A;  3L73 J;  2RN0 A;  3AEF C;  5AW2 B;  2E75 B;  3BRV B;  1SQX G;  2C0X A;  2KI7 B;  1RE3 A;  3CX5 H;  2XZR A;  3L35 A;  2G8Y A;  2NZ2 A;  1OMI A;  2E76 B;  5KJ7 C;  3HD7 A;  2K1A A;  3HE4 B;  1NTZ K;  5AW4 B;  1N7L A;  3Q1M A;  3VN0 A;  3TNU B;  3A0H E;  3H1L G;  1KOR A;  3HRN A;  2FYN B;  2PGD A;  3AE3 C;  3L36 A;  1AJY A;  1NTK E;  2J5U A;  1YJ9 P;  4LC1 A;  1Q81 Q;  5EFW B;  2HLO A;  3H1I J;  2NPS C;  3HD7 D;  3P32 A;  4WWI A;  1X8Y A;  4U3F G;  4WBA A;  2QJP C;  1AQT A;  1FZA A;  4N78 D;  3VMY A;  1GZL A;  3L74 D;  3GG2 A;  1GL2 C;  4JPZ B;  3B8E B;  3B71 A;  1JY2 P;  1A02 F;  3JSV C;  3USS A;  3CME P;  3A0B H;  1M1J C;  4UB8 H;  3CCR P;  3BCC J;  2JJL A;  3L73 G;  5KAI H;  1L0N K;  3BRT B;  5TIS H;  1PPJ D;  1M1K Q;  1FZB A;  3VMZ A;  5TJH A;  2M8R A;  1NU1 E;  4IFM A;  3VMA A;  3N4X A;  2Y0E A;  3EQ2 A;  5H2F H;  3AE1 C;  1SQQ J;  1LTG C;  2BEQ D;  4H13 B;  1FC2 C;  2YKP A;  5KAF H;  2M5A B;  3UIA A;  2Z5I A;  1GK4 A;  2R3S A;  1D7M A;  4K35 A;  1NO4 A;  2ITA A;  2GUV A;  3FWL A;  4ZMD A;  3OA7 A;  1VDF A;  3AE5 C;  1RF0 A;  1LTS C;  2K3R A;  3CMA P;  3AEB C;  2QJK C;  4LLH A;  4WY4 B;  3KHU A;  1FZC C;  1URQ B;  2RMZ A;  4H44 B;  2ZAE B;  3Q5P A;  2GM4 A;  1KFN A;  2WTY A;  5E79 E;  3BCC G;  1H89 A;  1NKZ B;  1N7S C;  3B4S A;  4EYY Q;  3RK3 D;  1PP9 D;  2PAJ A;  5AVQ B;  2WSF H;  1VQ8 P;  1LTI C;  3A0H H;  3TF5 A;  2M3B A;  1K8A Q;  2M3E A;  3CD6 P;  1S9K D;  4N6J A;  1QVG O;  2FFD B;  1SQQ G;  3RK2 B;  2H89 C;  2JEE A;  5BU5 A;  3HE5 B;  3TGU E;  1OVU A;  2V4H A;  3KDP B;  4IL6 E;  4MN4 C;  3Q5S A;  4XFJ A;  1NTK J;  3H32 A;  1JY3 O;  2IFN A;  3HD7 C;  3P8C E;  2AEJ A;  5GTH E;  1LTJ B;  1BSN A;  2KNC A;  3A2A A;  1NAY A;  2G3A A;  2Q9I A;  1OX3 A;  1Q82 Q;  1SQB D;  2Y0C A;  2RH0 A;  1KB9 I;  1YQ4 C;  2O01 H;  1QL1 A;  2E74 B;  3TSI A;  2IDB A;  4L76 A;  3VYI A;  2ZT9 C;  5B66 E;  1KC8 Q;  2WVR A;  2B9B A;  1L4A A;  2N1T A;  3IF4 A;  1X9V A;  1FZF A;  2D2C B;  3RL0 D;  1OW6 A;  3FXD A;  1NU1 J;  4EI2 A;  1JTH B;  4OGQ C;  1VF5 B;  2O3J A;  2O01 N;  1L4A D;  3H1J E;  1GTW A;  1NTM E;  2N1T D;  2OTJ P;  2LXB A;  2OAR A;  5AW1 B;  5APT A;  1J1E B;  2YNY A;  5CCH A;  2HOD A;  4XA4 A;  2YO2 A;  5E79 H;  3D70 A;  1JEK A;  1ZR4 A;  1EDL A;  3KYQ A;  1SP4 A;  5CCH D;  3GW6 A;  1LTT C;  1YJN P;  2QG4 A;  4I7Z C;  3AEE C;  1Q90 D;  3PRJ A;  4YXW H;  1SFC C;  3MZW B;  2R32 A;  2DW3 A;  2OYH C;  1S3J A;  1VQ9 P;  3RK3 E;  2OYI A;  3M0D C;  2K9J A;  1M90 Q;  5AW3 B;  1LTB C;  1RF1 A;  1G2C B;  1KMI Z;  4IL6 H;  1NU1 G;  5CJ0 A;  1JY2 N;  4DT0 A;  3H25 A;  2QVA A;  4C7N A;  1NVO A;  1EDJ A;  4B86 A;  3CXH E;  2AXT E;  2CPS A;  3TGU J;  1BE3 D;  3S1K A;  2JR8 A;  2I8D A;  5KKZ C;  1PGO A;  2O1J A;  2Z5H A;  3H1H G;  1KD1 Q;  4Y99 C;  1SQP E;  2Y9Y A;  2FYU D;  4PV1 D;  3CC4 P;  1LWU A;  1BCC D;  3JCU E;  3SFD C;  3HUS B;  2FY8 A;  1AA0 A;  1SQB K;  2POH A;  1KB9 E;  5CCG D;  1DH3 A;  2MKV A;  1PIX A;  3PH0 A;  3GHG B;  2WSS H;  1FE6 A;  4PJ0 E;  1L0L D;  1M8O B;  1HGZ A;  2P10 A;  1FBM A;  3SSU A;  4L75 A;  1H0T A;  5APY A;  3G71 P;  2XND H;  1ZP0 C;  3CX5 E;  1GL2 A;  4QMA A;  1GU4 A;  1CI6 B;  1L4A C;  1M1J A;  3TGU G;  1S1C X;  2R44 A;  2N1T C;  2P1J A;  5AW0 B;  3H1J J;  1NTM J;  4JBZ A;  1PGP A;  3RGU A;  2QJY C;  2Q3I A;  1SQV D;  1FDI A;  1GL2 D;  3W68 A;  2P7J A;  5GTI E;  2W6B A;  1P84 I;  1YYC A;  2E75 D;  1ZOY C;  4WB4 A;  4A7P A;  5CCH C;  2FXP A;  1DD4 A;  2FXM A;  1LNQ A;  1W2B O;  3T97 B;  1IC2 A;  4TT3 H;  3L74 G;  1KTM A;  4CPG A;  1NYH A;  2KLV A;  1LT9 C;  2YIU B;  4EIJ A;  3K5B A;  3CXH H;  1PL5 A;  2AXT H;  2A06 D;  1BGY D;  2JO1 A;  2ZVN B;  1KIL B;  5KAI E;  2YMK A;  1QX8 A;  1OZH A;  4IFF A;  2WPR A;  3M91 A;  3HTK B;  2WZ7 A;  4BRY A;  3B5N B;  1T3U A;  2PP6 A;  1R5L A;  2KIK A;  4YTP C;  4DOJ A;  1JMM A;  1ZRT E;  2ZVO B;  2ZYG A;  1NTM G;  3CWB D;  2KB7 P;  2IBZ D;  3JCU H;  1N7S A;  3G6E P;  1HJ0 A;  1NJI Q;  1YTZ I;  5KAF E;  1AV1 A;  1N73 C;  2C9L Y;  1KB9 H;  2HFE D;  1KIL E;  4AYC A;  2BCC D;  1HGV A;  2JP3 A;  1NOH A;  1OVR A;  2UWJ E;  4PJ0 H;  2XNX A;  4OVN F;  1GK6 A;  1NGM B;  2NPS B;  1DEB A;  4NPF X;  1SQP J;  4PV1 C;  4UB6 E;  2PFX A;  4BWN A;  3PP5 A;  2AEM A;  2QJP B;  5KLV D;  3V6I A;  5APW A;  2FYU K;  1LT1 A;  1FJK A;  1NTZ E;  5CCG C;  1WRG A;  1OVV A;  2H43 A;  1LWU C;  1M57 D;  4H0L D;  4KJM A;  2KZJ A;  3MP7 B;  3FXE A;  2Q3E A;  1J1D C;  1L0L K;  1ZXG A;  4PD4 I;  2QE7 H;  5GTI H;  2KOG A;  1DEE G;  4PD4 D;  2WPV B;  3D6Y A;  1IFM A;  1T2K D;  2WMM A;  2FBW C;  4D6T D;  1URQ D;  1LP1 B;  3V2P A;  2HG5 D;  2OYO A;  3PHL A;  2W8Z A;  3O6Q B;  1L0N E;  2WT7 B;  3FWN A;  4AUW A;  1SQV K;  1YQ3 C;  2E75 C;  1SQB G;  1P84 E;  1SQP G;  2O1K A;  1MFZ A;  2ZT9 D;  3IR9 A;  2QM8 A;  1NAF A;  1QL2 A;  3M06 A;  2QJK B;  3PTZ A;  2IX7 C;  3NXS A;  1FZC B;  1PFI A;  4K3A A;  2B89 A;  4OGQ D;  2FYN C;  1EC5 A;  1EQ7 A;  4ZKP A;  3S9O A;  1VQ5 P;  3L71 E;  3BAS A;  3FGA D;  3PLN A;  2WIT A;  3L75 E;  1JMB A;  5AVX B;  2L5G B;  2QRX A;  4RO0 A;  3I5C A;  1SFC A;  1YHQ P;  2WPS A;  1VQL P;  3R2P A;  1IFJ A;  3AED C;  3H1H E;  4UB6 H;  2OYH A;  1UIX A;  2VRS A;  3H1K E;  3M0D A;  2QM7 A;  5AW5 B;  2Q7C A;  5AW6 B;  1SFC D;  1EDI A;  1BSH A;  3CC7 P;  1W5C E;  5AVV B;  3SWF A;  1BDC A;  1LGH B;  3HD7 B;  4ASV A;  2P2U A;  3PJS K;  1OFC X;  4OWF A;  3L70 D;  2WPQ A;  4H13 C;  1SQX D;  1RQU A;  5CBO A;  5KLV K;  1NTZ J;  2JWA A;  1IFI A;  1K05 A;  4Z1M H;  2H88 C;  4BXL A;  4YPC A;  2P67 A;  4H0L C;  2KP8 A;  5APQ A;  3GLM A;  3P8M C;  4WVZ A;  3H1L D;  2WSF J;  3KZI H;  3VP9 A;  3ABV C;  3EWK A;  2BEZ F;  2JKV A;  1VQN P;  2IYO A;  1P84 H;  3L72 D;  1T2K C;  4U3F D;  4N78 E;  1VL2 A;  1URQ C;  3O8Z A;  3ZDM A;  3JC2 2;  2JDI H;  4HH2 A;  1VQ6 P;  2I1J A;  1QLE D;  1HBW A;  3L74 E;  3FX0 A;  2W90 A;  1EZV I;  4EDF A;  5APX A;  1L0N J;  1EZV D;  3L73 D;  3NTN A;  2C9N Y;  1EXI A;  4DZO A;  1PPJ E;  3D6Z A;  2B87 A;  3IAO A;  1ZN5 A;  5L8R J;  2FFD C;  5AW8 B;  3WU2 H;  2SPZ A;  2WSE H;  4I7Z B;  2GA1 A;  1NTZ G; 
#chains in the Genus database with same CATH homology
 1NU1 K;  1SVF A;  3V2Q A;  1SQB K;  1NKN A;  2POH A;  4XE5 B;  5AVT B;  1LTA C;  3VOP A;  5CMZ A;  5CCG D;  5APU A;  3MUD A;  2YKQ A;  1DH3 A;  1VPC A;  2R5D A;  2J59 M;  3GHG B;  1RE4 C;  3MIW A;  2IPP A;  1N7S D;  3RK3 B;  1HGZ A;  1LTJ C;  1FBM A;  2YMY A;  3G3Z A;  1JTH A;  1ZR2 A;  4W7Z A;  1JY2 O;  1W2E A;  5APY A;  5AW2 B;  2WWW A;  1NH4 A;  3BRV B;  2C0X A;  1LT9 A;  1RE3 A;  1GL2 A;  5AVU B;  4JYB A;  2XV5 A;  1GU4 A;  1CI6 B;  2XZR A;  5AVY B;  3L35 A;  1L4A C;  1M1J A;  2N1T C;  2P1J A;  5AW0 B;  1H8A A;  5KJ7 C;  3HD7 A;  3HE4 B;  4O9B A;  1NTZ K;  5AW4 B;  1N7L A;  3VN0 A;  3TNU B;  1J2J B;  2Q3I A;  3HRN A;  4OH8 B;  1GL2 D;  5KTB A;  2P7J A;  3L36 A;  2W6B A;  1G1I A;  4LC1 A;  1YYC A;  2HLO A;  3HD7 D;  2NPS C;  3P32 A;  4WB4 A;  1GDT A;  1X8Y A;  5CCH C;  4Y99 B;  4WBA A;  2FXM A;  1S9K E;  1IC2 A;  1FZA A;  3H32 B;  4N78 D;  1FZE A;  1XTG B;  3VMY A;  2IFM A;  1FAV A;  1GZL A;  1G2C A;  1J1E C;  2KLV A;  4WY4 C;  1N73 A;  1LT9 C;  1KFM A;  1RE3 C;  4EIJ A;  1SQX K;  2HPC A;  1GL2 C;  3B8E B;  1A02 F;  1JY2 P;  1M1J C;  3A5T A;  3V4W A;  2FKW B;  1KIL B;  2JJL A;  2FYZ A;  5AVR B;  1JO5 A;  3MGN A;  1OWA A;  1L0N K;  5AVS B;  3BRT B;  4IFF A;  2WPR A;  4M3L A;  1CW5 A;  3M91 A;  3V2R A;  3BVH A;  1HJB A;  1KZU B;  1NHL A;  1FZB A;  3VMZ A;  3HTK B;  2WZ7 A;  1AQ5 A;  3B5N B;  1T3U A;  2E42 A;  2LKM A;  2PP6 A;  2YO3 A;  3N7N A;  3RL0 B;  2M8R A;  1M7L A;  4IFM A;  4RES B;  4DOJ A;  1JMM A;  5CCG A;  1HH0 A;  3N4X A;  1IJD B;  3TYY A;  3LID A;  3RK2 C;  3EQ2 A;  4JYC A;  2KB7 P;  1L4A B;  2N1T B;  1N7S A;  1LTG C;  1MUU A;  2GUS A;  2YKP A;  1YTZ I;  1N86 A;  1SFC B;  1N73 C;  2C9L Y;  1RY3 A;  1ZV8 A;  3UIA A;  2Z5I A;  1GK4 A;  2J58 A;  2N9B A;  2HFE D;  2OYH B;  4AYC A;  1HGV A;  2XDJ A;  3L4F A;  1NOH A;  3NMD A;  2W6A A;  3M9Q A;  1NO4 A;  1IO4 A;  3HUS A;  2GUV A;  2XNX A;  3OA7 A;  1GK6 A;  1VDF A;  2NPS B;  1DEB A;  4GIF A;  1RF0 A;  5CHX A;  2R5B A;  1LTS C;  2HOD B;  1JY3 N;  3PP5 A;  3M9B A;  4C7R A;  1MZ9 A;  5APW A;  3GHG A;  2FYU K;  3EFG A;  4LLH A;  1IFN A;  1FJK A;  4N3Y B;  4WY4 B;  5CCG C;  1FZC C;  5BU8 B;  1WRG A;  3CI9 A;  1URQ B;  2H43 A;  2GM4 A;  1KFN A;  2WTY A;  1LWU C;  3A7O A;  1H89 A;  1WT6 A;  1NKZ B;  1NTM K;  3TK1 A;  1N7S C;  3RK3 D;  2PAJ A;  2I1K A;  5AVQ B;  1J1D C;  2HYN A;  1L0L K;  2WSF H;  1LTI C;  1DX7 A;  2M3B A;  1CI6 A;  4EOT A;  2OYI B;  5AW9 B;  4I6M C;  2KOG A;  1RF1 B;  3HUS C;  3HE4 A;  1S9K D;  4N6J A;  1RF0 C;  1IFM A;  3TNU A;  1T2K D;  3U1C A;  1GD2 E;  2FFD B;  1URQ D;  1HWT C;  1AFO A;  3RK2 B;  2ZXE B;  3V2P A;  2HG5 D;  2JEE A;  3GHG C;  1FDM A;  5BU5 A;  3RK3 C;  3HE5 B;  1IK9 A;  5CJ4 A;  1GU5 A;  3KDP B;  4C7N B;  2WT7 B;  2CPB A;  3T97 A;  1JOC A;  3H32 A;  4AUW A;  1JY3 O;  2IFN A;  1T8Z A;  3HD7 C;  3P8C E;  1SQV K;  2A45 H;  3VTP C;  1LTJ B;  2O1K A;  1FOS F;  1MFZ A;  1XTC C;  2XU6 A;  3IR9 A;  3P7K A;  3BAT A;  2WSC H;  3A2A A;  2BAS A;  2Q9I A;  1GW3 A;  2QM8 A;  1NAF A;  1QL2 A;  3II6 A;  3M06 A;  2KYV A;  1FOS E;  1KIL A;  2IX7 C;  3U59 A;  3V4Q A;  2Z4E A;  3NXS A;  2O01 H;  1FZC B;  1PFI A;  3C9I A;  1QL1 A;  1JUN A;  5APV A;  3HTK A;  1LWU B;  1SQQ K;  3B5N A;  1EQ7 A;  4KHX A;  3TSI A;  4ZKP A;  1KIL D;  3VYI A;  2ZFC A;  3BAS A;  1FU1 A;  3L37 A;  2W27 A;  3OAK A;  3LW5 H;  3VP8 A;  1A02 J;  2WIT A;  1J1D B;  4W7Y A;  1E5W A;  3H6P A;  2L5G B;  1L4A A;  5AVX B;  3B5N D;  2H8P D;  2N1T A;  3LIE A;  1H88 A;  1X9V A;  1JCC A;  1FZF A;  3I5C A;  5KJ7 A;  3RL0 D;  1SFC A;  1T3J A;  3MD0 A;  2WPS A;  1JTH B;  1SQP K;  3U1A A;  3R2P A;  1IFJ A;  1HVV A;  2OYH A;  1JCD A;  2VRS A;  1Z56 A;  1N2D C;  3M0D A;  1JY3 P;  1L4A D;  1GTW A;  3KPE A;  2N1T D;  1KIL C;  2OAR A;  2QM7 A;  5AW1 B;  4GKG A;  4HYT B;  5AW5 B;  1X79 B;  5APT A;  3SWY A;  1J1E B;  5KJ7 D;  2NPS A;  2Q7C A;  5AW6 B;  1SFC D;  1LT9 B;  2YNY A;  3A3Y B;  5CCH A;  1HTL C;  2HOD A;  4XA4 A;  5BVZ A;  1GL2 B;  5AVV B;  3SWF A;  2R3C A;  2YO2 A;  1LGH B;  1M1J B;  1ZR4 A;  3B5N C;  1MV8 A;  3KYQ A;  3HD7 B;  4AQR D;  4IFD K;  5AVZ B;  3RL0 C;  2P2U A;  2E43 A;  3VMX A;  2NPS D;  4WY4 A;  5AVW B;  1SP4 A;  5CCH D;  1URQ A;  2KSJ A;  1YTZ T;  2MJZ A;  1LTT C;  1FJP A;  3V5B A;  3NFQ A;  1G1J A;  2WPQ A;  4I1L A;  2XKM A;  4JF7 A;  1SFC C;  5KLV K;  1IFI A;  4WY4 D;  1NWQ A;  2R32 A;  4ZKU A;  2OYH C;  2P67 A;  2A45 G;  2KP8 A;  2OYI A;  3M0D C;  2A45 I;  4GT1 A;  5AW3 B;  1LTB C;  1RF1 A;  3MTU E;  1G2C B;  2Q5U A;  4W80 A;  5APQ A;  3P8M C;  1N73 B;  3VP9 A;  3P8C D;  2HPC B;  2FFD A;  1NTK K;  4I2L C;  5CJ0 A;  3HE5 A;  1ZLL A;  1KQL A;  2H7H A;  1CZQ A;  1JY2 N;  1T2K C;  4N78 E;  1URQ C;  3O8Z A;  4C7N A;  3KQG A;  4C46 A;  2WT7 A;  4B86 A;  4HH2 A;  3RK2 D;  2I1J A;  1RE4 A;  3CL3 D;  1HBW A;  2CPS A;  1LTJ A;  1SLQ A;  1FZG A;  1HUC A;  3M0A A;  5APX A;  1OXZ A;  2OYI C;  5APS A;  3NTN A;  1N7S B;  2C9N Y;  1CSB A;  1RF1 C;  4DZO A;  2O1J A;  2Z5H A;  2YKO A;  3IFM A;  3E1I A;  1JNM A;  4Y99 C;  1ZN5 A;  1FZC A;  2FFD C;  1GW4 A;  5AW8 B;  2C0W A;  2WSE H;  1LWU A;  4LGD E;  5AW7 B;  3OJA B;  3M9H A;  3WMM 0;  3CLQ A;  3HUS B;  1IFD A;  3V2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...