1KILA

Three-dimensional structure of the complexin/snare complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Synaptobrevin SNARE motif
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 27
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kilA00
2N1TA 4W80A 2NPSB 2NPSC 1GL2A 3RK3C 1N7SC 1KILB 3M0DC 3RK2C 3B5ND 4WY4A 1URQD 4WY4D 2H8PD 3PP5A 2XDJA 2YMYA 3HTKB 1SFCB 2N1TD 1JTHA 5KJ7C 5CCHC 1GL2D 1N7SA 5CCGC 3RL0B 3RL0C 3HD7B 3HD7C 1KILC 1URQB 2KOGA 1L4AA 3VOPA 2N1TB 1L4AD 5KJ7A 2M8RA 4JF7A 1SFCC 1GL2B 3KYQA 2NPSA 2PP6A 2NPSD 5CCHA 4LGDE 3RK3D 5CCGA 3TSIA 1N7SD 2WZ7A 3HD7A 1KILA 2HFED 3B5NB 1XTGB 3B5NC 2HG5D 3RK2D 1URQC 4WY4C 4WY4B 3P8CE 4W7ZA 4OH8B 2N1TC 1JTHB 1SFCA 1SFCD 4N78E 5KJ7D 1GL2C 3RK3B 1N7SB 1HVVA 5CCHD 3RK2B 4W7YA 5CCGD 3B5NA 3RL0D 1NHLA 3HD7D 1KILD 1URQA 1L4AB 1L4AC 1T3JA
chains in the Genus database with same CATH superfamily
1FZBA 3CCEP 2RKLA 4M3LA 2QVAA 1JUNA 3HE4B 1ZR4A 2JDIH 1ZR2A 3C8VA 1U7JA 5AW7B 1UIXA 1CSBA 5AW8B 1AFOA 1MKMA 1SP4A 1FS0E 1ZLLA 3KXDA 2K37A 2Q3IA 2O01J 2WPSA 3NFQA 1R5LA 1L2PA 3PRJA 2MJZA 3H6PA 2ZAEB 2IBZD 4H13B 1PZQA 2XU6A 1NAFA 1PP9D 3CX5E 2PP6A 2Z5HA 1GW3A 2IYOA 4H0LB 3HUSC 1YJNP 1LGHB 2DW3A 4Y28J 2E74C 2IPPA 2ZXXA 2BCCJ 3L74G 1SQQK 4OH8B 5C39A 1BDCA 3L37A 5GTHE 2I8DA 2O1JA 1M1JB 3C1LA 3MZWB 3WUUA 4W7YA 4UB6H 1QEXA 1Q2NA 2KYVA 3B5NA 3FX0A 5AW1B 1DEEG 2Q7CA 1KYOI 2A45H 1SQXG 1NU1K 3CX5H 1NTMJ 2YNYA 1CI6B 1IFJA 1W2EA 2KSJA 3BRTB 3BATA 1U57A 1T8ZA 4BRYA 1VQPP 1LTSC 3B71A 1ZRTE 2HPCB 4JQ0D 1AV1A 3OAKA 5GTHH 1PP9G 1FBMA 4RESB 3BVHA 1BGYE 3LW5J 3IFMA 1Y8AA 2BCCD 1G2CA 3FWLA 1N7SA 3TK1A 2YXQB 1SLQA 3HE5A 3VMZA 3HUSB 2YKQA 3GLMA 4PV1D 3FXDA 4C7RA 4OGQC 2FYUK 3RL0g 3USSA 1JMMA 1L4AA 3Q5RA 2KNCB 3KYQA 1YI2P 2E76B 5EFWB 2ZJSE 1NTMD 1Q81Q 4PJ0E 2HG5D 1P84I 2HR3A 3CC7P 2E75C 1J1EC 1GMJA 3IF4A 1OVRA 4JYBA 1VQ5P 4N78E 1RE4A 1UIIA 1N8RQ 3TNUA 2HODA 1OMIA 3GF7A 2AXCA 3FWNA 2BEQD 1VPCA 1X8YA 3SWYA 3AEEC 3L71E 4GKGA 1OW8A 1PGPA 2PRRA 3TYYA 1SQVJ 2M0BA 4PJ0H 4GIFA 4PD4D 4I1LA 3M0DC 3RK2C 1NJIQ 4OGQB 1SQQE 4WY4D 2WMMA 3OW2O 1QX8A 5AVZB 3H1JG 2OYIA 1JY3O 1JY3P 4K35A 3CPWO 2QM8A 3HD7B 2M3BA 2E75B 1J1EB 1NU1E 1R8EA 1RE3C 1NO4A 2Q1KA 4Y99C 2KXPB 3L36A 4JF7A 2YIUC 1EQ7A 1GDTA 2NPSD 2B9BA 3I55P 3HE4A 3GF3A 1GK6A 2V7QH 2IX7C 4D6TG 1SQPJ 1HBWA 3JC22 1N2DC 1SQVD 1FZGA 3VP9A 3P8CE 5AVYB 1K04A 2JKVA 1FZAA 1HJ0A 1KC8Q 2QEXP 2K9JB 5AVSB 3U1CA 2QJKB 5AVXB 2D2CD 2GUVA 3RK2B 2FYUE 1LJ2A 1Z56A 3SWFA 3S9OA 2J5UA 2WSSH 2NZ2A 3TF5A 1MV8A 1VQOP 2A45I 4JPZB 3WUVA 3CX5I 1NYHA 2FKWB 1A02F 5AW4B 1R5SA 3Q5SA 2H8PD 3D6YA 4Y99B 3A5TA 1SQPD 1KV4A 1JMBA 2YIUB 2A45G 3P8MC 2P58A 1M1JA 1TU3F 1NTMK 1LTTC 3SWKA 1G1JA 1HGVA 1D7MA 2QA4P 2WWWA 1KFNA 1GU4A 1PGJA 2JP3A 3M0AA 1YHQP 2YMKA 1IFPA 1CI6A 1FU1A 2FYZA 4LGDE 2B87B 2IBZE 1SS1A 1LTGC 1Y9BA 3B5NB 3CCQP 2HPCA 1CZQA 2HYNA 2P7JA 2C0WA 3L70J 4HJGH 1GL2C 2Y0CA 4MN4C 5CCGD 2C9NY 3HUSA 4N6JA 3RGUA 4K3AA 2IDBA 1BGYG 5BVZA 2KI7B 2WITA 2KNCA 4ASVA 2B88A 3BRVB 4AQRD 3AEBC 3FGAD 2BEZF 1EC5A 5KAIE 3QWOC 2I1KA 2N1TD 2KS1B 1AQTA 3AEFC 1ZN5A 4H44D 3RL0C 1SQVK 3H25A 3H1HJ 2FYUJ 1L0NJ 2W83C 2IZ0A 1J1DB 2BCCE 3H1LJ 3R2PA 1L4AD 1X22A 1PPJD 5APTA 1S5LE 1YQ3C 2O01H 2XZRA 1GL2B 5APXA 3JSVC 4IFMA 5APVA 1FZCC 4RKUJ 1SQBJ 3M9BA 1VDFA 3V2PA 1S2EA 1LWUC 1L0LJ 1NTME 2P10A 3L71G 3L75J 3M06A 5KJ7D 4A7PA 3IN6A 3CCRP 3CXHD 1RF1B 3EWKA 4JBZA 1JY3N 2H88C 1SQQG 2V4HA 1S5LH 1SQPK 3H1HD 1EDIA 3KZIE 2FYUD 5KAFE 2XNDH 3V5BA 1L0ND 3U1AA 1OVUA 3VP8A 3H1LD 1OIPA 3F5HA 3Q5PA 3AE7C 1QVGO 1KB9E 1Q7YQ 5AW2B 2C9LY 3QH9A 1NU1G 2WSCJ 1JB0J 2KSEA 3CL3D 1M7LA 2YMYA 2QJYB 4PD4E 3CMAP 1SQBD 2ZT9D 2JO1A 1CW5A 1GK4A 1L0LD 2K9JA 2A06D 2FFDC 4U3FJ 1GU5A 1FZCB 4BWNA 3L75D 3T97B 1H88A 3KZIH 3LW5H 1LWUB 1DD4A 3CC2P 2L5GB 4Z1MH 1SFCC 1LTBC 1AVYA 3OA7A 2LXBA 5AW0B 3WUTA 1T2KD 3H1HG 1RH5B 2FYUG 3VMYA 3AE8C 2HFED 1XTGB 2P1JA 1PFIA 3G6EP 3C9IA 4PD4H 3H1LG 4W7ZA 3H1IJ 1YITP 2M3EA 1S4XA 3H32B 1SQVE 3G9RA 2XKMA 5CCHD 1ZW0A 1ZMEC 3VMXA 1Q86Q 3TDKA 3I56P 2FYNC 4U3FD 2WT7B 4H13D 2A06G 2OARA 2J59M 3A7OA 1LT9C 1NTZJ 2XV5A 3KDPB 2GA1A 4XA4A 1KQSO 2B87A 2IBZI 5CMZA 1WT6A 5AW5B 4H0LD 1N73C 3M91A 3V2NA 1M57D 3PP5A 2RN0A 1X0TA 3H1KE 3A0HE 2LKMA 1SFCB 3H1ID 1VF5D 2WSEJ 4DCKA 1X79B 2IBZG 2ZVNB 4EYYQ 1SQPE 2QE7H 3CMEP 2W6AA 1IFIA 2FXPA 1JO5A 5APUA 3O6QB 5TISE 4GOEA 1NTKJ 1GW4A 2FYNB 3U59A 3CCUP 4WY4C 1NTZD 3A0HH 1H89A 2E74B 2M5AB 4NPFX 1L0NK 2GM4A 1FOSE 3B8EB 1LT9B 2AEFA 2Z4EA 2KS1A 3KHUA 2KB7P 4GT1A 4WVZA 1AVOA 1DH3A 5CJ4A 1OXZA 3H1IG 2N9YB 1N73B 4KT0J 5TISH 5AW6B 3JCUE 1SQBK 2KIKA 4W80A 2NPSC 1GL2A 1L0LK 1WMKA 2JJLA 1PGOA 2E76D 5AVVB 3AE3C 3MTUE 1IZNB 1U7MA 4GOFA 3ITKA 3CCLP 1URQD 2BCCG 2O3JA 1NTKD 1KB9D 4OWFA 3GMAA 3CWBJ 3HTKB 4EI2A 1RHZB 5KLIC 1Q82Q 1KTMA 5KLVJ 2D2CC 1RF1A 3GHGC 2KZJA 1VQ8P 1HGZA 2ZVOB 3JCUH 4IFFA 4I2LC 3G71P 3PTZA 2K9YA 1NTMG 2AEMA 4EIJA 3R4YA 2M8RA 3L70E 3MD0A 1QVFO 5DJUB 2AXTE 1PPJE 3MIWA 1W2BO 2GUSA 2ZYGA 1N7LA 3H1KJ 2OTKE 1HWTC 3S1KA 5CBNA 5AW3B 3CWBD 3RBZA 1FZCA 3T97A 1DD3A 3HD7D 1KILD 3GW6A 2E75D 1IFDA 5KLVD 4IOIH 3AE1C 1OFCX 3AE5C 3CXHE 1LWUA 1KZUB 1IC2A 2Y0DA 5KTBA 2AXTH 2C0XA 4GDOA 1YTZI 2HLOA 3GHGB 3D6ZA 3PH0A 1FJKA 3H1HE 1PL5A 1L0NE 4C7NB 3H1LE 3H32A 5DJTB 3I5CA 3ABVC 2QJPC 1W5CE 4GODA 3BASA 5CJ0A 3H1KD 3BCCJ 5CCGC 3CCVP 1H0TB 3II6A 1NTZK 2KK7A 2KOGA 3CXHH 1SQBE 2WT7A 3VOPA 2K3RA 1L0LE 2A06E 3O8ZA 5AW9B 3L75E 1SQVG 1BDDA 2KLUA 1RQVA 1NWQA 2Q5UA 3L72J 1DX7A 2OYHC 3EFGA 1J2JB 1JNMA 3PLNA 4YXDC 2N1TC 1JTHB 1SFCA 1SVFA 3G3ZA 2G3AA 4H44C 3AEAC 1OX3A 1IK7A 5GTIE 1OZHA 5E79E 3BCCD 1NTKK 1L4AC 1EZVD 3H1KG 3O6QA 4KHXA 1G1IA 2E5TA 3L73J 4U3FE 1VQMP 1ZOYC 1SQPG 4UB8E 1JEKA 4NPDA 3B5ND 4LLHA 3L72D 3WU2E 2FXMA 2M5AA 1LNQA 3MUDC 4I7ZC 5BU5A 1BE3J 2CPBA 2E42A 5KJ7C 1LT9A 5H2FE 1ZP0C 1KQLA 5GTIH 2WSCH 1USEA 1FZEA 5E79H 2H43A 2OYHB 3VN0A 1N73A 3V2RA 3SFEC 2BASA 3H1IE 2QM7A 2N1TB 1LTJC 1YBKA 3HRNA 3V4QA 2H7HA 4H44B 4UB8H 3CCMP 4L74A 2L91A 2K1AA 1QL2A 1VQLP 4OVNF 1N7SD 1NGMB 2N9BA 3L70D 5KLVK 1EDKA 1YIJP 3L73D 5H2FH 2OYOA 3WMM0 3L35A 2OYIC 4IL6E 2ZT9C 2WSFJ 3HTKA 1NH4A 4LC1A 2LR2A 2ZXEB 1KN7A 5KAIH 1QGKB 1NTZE 1BE3D 1P84E 2ZYDA 1RF0C 3CC4P 2KUBA 4I7ZB 1NKNA 5APSA 1GD2E 3PJSK 4R4LA 1OVVA 1T2KC 2IYPA 3IR9A 3N4XA 1PIXA 4WB4A 3L74J 1EDLA 2XDJA 5B5EE 4DZOA 1LTJB 1K73Q 3LIEA 3L70G 3AEDC 1KMIZ 5CCHC 2J58A 1JOCA 3B4SA 5M1BA 3RL0B 1PPJG 2QRXA 1NTKE 1S5LX 5APQA 4TT3H 4H13C 2YXRB 3P7KA 1SQXJ 3CI9A 1LT1A 3TGUJ 2POHA 5APWA 3RK3D 1HUCA 3GHGA 3M0DA 4H0LC 1YYCA 5KAFH 4C7NA 4HB1A 2E43A 3E7KA 3VMAA 1KQGB 1VF5C 1M1JC 3L74D 1HVVA 1KB9H 1JCDA 3CCSP 3S4RA 1H0TA 4JYCA 1L0NG 1BCCJ 2JWAA 1AA0A 1RE3A 5AVQB 1FDIA 2R5BA 1JY2O 3CWBE 1JY2P 1MZ9A 4O9BA 1KILE 2MKVA 1SQXD 5KLVE 1K8AQ 3SFDC 1NOHA 3TGUD 3V2QA 1SQBG 2O01N 4PV1C 4UB6E 1FZFA 1FJPA 2Q3EA 1M56D 1L0LG 1Y47A 1AJYA 1FC2C 2WPVB 1JTHA 3L75G 1IO4A 1KYOD 1QLED 2Y9ZA 2FFDB 4R4MA 2SPZA 3K5BA 2CK3H 3AEGC 4U7JA 1BCCD 1VF5B 2CPSA 2E76C 3AE2C 2W8ZA 5CCGA 3TSIA 3VTPC 1S9KD 2WZ7A 1S3JA 1URQC 3KQGA 2P2UA 2ITAA 2Q9IA 3H1JJ 3TGUG 1SFCD 4U3FG 2B89A 4WWIA 4PV1B 4EOTA 2OYHA 1MFZA 2OTLP 2ZYAA 1P84D 2JEEA 1T3JA 2N1TA 1IJDB 1M8OB 4I6MC 4HKZH 3D70A 3CD6P 1A02J 3EFFK 2UWJE 3GG2A 3BCCE 1WRGA 1EZVE 3E1IA 1BCCG 4D6TJ 2PFXA 3RBXA 2WQYC 2E74D 1NAYA 1HJBA 1GZLA 2NRGA 3VYIA 2R3SA 2YKOA 1EXJA 3L72E 3H1JD 2QG4A 3HD7C 1KILC 3CCJP 1URQB 4RO0A 3AE4C 3MUDA 2FBWC 2FXOA 1N86A 5KJ7A 3Q3DA 3MHVA 1NTZG 1AQ5A 3ZDMA 2FY8A 3UIAA 1EXIA 2WTYA 2YO2A 4WY4B 4HH2A 1OW7A 3A0BE 1HH0A 4D6TD 4ZKUA 2QSIA 1LTJA 3Q1MA 1QL1A 1SQXK 2PAJA 1USDA 3MP7B 2OTJP 2QJKC 3L73E 5AVTB 1KB9I 1XTCC 4OGQD 3AE9C 4YXWH 2Q6QA 1NVOA 3LIDA 1BE3E 4PD4I 1RY3A 2NPSB 2WPRA 1KFMA 2OGUA 1KILB 3V6IA 1NTKG 2YO3A 3A0BH 1RF0A 2Y9YA 4WBAA 1T6AA 1VQ6P 2G8YA 4EDFA 1VQ4P 2IFNA 1DEBA 5KLIB 1VQ7P 3L4FA 1LP1B 4RJTA 4B86A 2D2CB 1Q90D 3KPEA 1MUUA 3CX5D 4ASWA 4NPEA 1H8AA 1BGYJ 1PV3A 2H89C 2W6JH 5CCHA 1JY2N 1T3UA 3W67A 1GTWA 3B5NC 1K05A 3RK2D 2OQQA 1IFMA 2O1KA 5CHXA 4C46A 2PGDA 4TLFA 3CWBG 3RK3E 4ZNCA 2WVRA 5KLVG 2KLVA 2FFDA 1FDMA 3AE6C 2WPQA 1YQ4C 1M1KQ 1IK9A 1ZRTD 3A3YB 2WSFH 2W6BA 3L74E 4ZMDA 2XNXA 1ZV8A 3SSUA 1EDJA 4KJMA 1N7SC 1BGYD 2Z5IA 4IFDK 4XE5B 4DJGA 2W27A 1JCCA 4XFJA 1PGQA 1SQXE 2R44A 1FDOA 2QJPB 3L71J 3TGUE 2R3CA 5AVWB 2I1JA 1MFTA 1FE6A 5CBOA 5L8RJ 1SQQJ 1HF9A 2V7QJ 1KYOE 2P67A 3G4SP 1PP9E 1J1DC 2JR8A 1K9MQ 1RQUA 5BU8B 1E5WA 2VRSA 1YJ9P 1KD1Q 4AUWA 1RE4C 4BRYB 2KZIA 1NKZB 4L73A 3OJAB 1OWAA 4N78D 1EZVI 4ZKPA 3P32A 3W68A 1YJWP 2LXCB 1BCCE 2R5DA 1NU1J 4BXLA 3AECC 3NXSA 3F89A 1S9KE 1G2CB 3N7NA 1N7SB 1RF1C 2IZ1A 4YPCA 3BCCG 3D71A 1EZVG 3HE5B 1KYOH 3L71D 1VL2A 3WU2H 1NHLA 3V4WA 1URQA 2YKPA 1L4AB 1E79H 3M9HA 1SQQD 5KKZC 1FAVA 1IFNA 3RK3C 3L72G 4L75A 1KQFB 2QIWA 1VQKP 1LTAC 1YTZT 2R32A 4WY4A 5K5GB 2KP8A 4AYCA 2AEJA 5AVUB 2QJYC 5B66E 2Y0EA 3M9QA 1NU1D 3Q2YA 3EQ2A 4HYTB 4DT0A 4CPGA 1FOSF 1GL2D 3TNUB 1S1CX 2HODB 5TJHA 3IAOA 4IL6H 5APYA 2K88A 1BSHA 4YTPC 2JWDA 3H1JE 3FXEA 3P8CD 1LTIC 1VQ9P 1X9VA 2W90A 3PHLA 2NPSA 1P84H 3L73G 4N3YB 3HD7A 1KILA 1BSNA 4IL6X 1VQNP 3A2AA 5B66H 1OW6A 4DOJA 2OYIB 5KKZB 2ZT9B 1BE3G 3E1RA 3CXHI 2WSEH 3CLQA 3RK3B 4QMAA 3NTNA 1LP1A 3NMDA 5AVRB 1S72P 2E5YA 1HTLC 2RH0A 1ZXGA 1M90Q 2RMZA 1DIPA 1KORA 3RL0D 3MGNA 4L76A 4D6TE 1JM0A 5B5EH 1PP9J 2ZFCA 2IFMA
chains in the Genus database with same CATH topology
1FZBA 2N1TA 1IJDB 5BVZA 1IC2A 4I6MC 2WITA 4M3LA 5KTBA 1JUNA 1A02J 3HE4B 1ZR4A 2C0XA 3BRVB 4AQRD 1ZR2A 1YTZI 2HLOA 3GHGB 1WRGA 3E1IA 1FJKA 5AW7B 1CSBA 5AW8B 1AFOA 4C7NB 2I1KA 1SP4A 1HJBA 3H32A 1ZLLA 2N1TD 1GZLA 3I5CA 3VYIA 2YKOA 2Q3IA 2WPSA 3BASA 5CJ0A 3NFQA 1ZN5A 5CCGC 3RL0C 1SQVK 3HD7C 1KILC 3II6A 1NTZK 2MJZA 3H6PA 1URQB 2KOGA 1J1DB 3R2PA 2WT7A 3VOPA 3MUDA 1L4AD 5APTA 1N86A 3O8ZA 2O01H 2XZRA 5KJ7A 5AW9B 1GL2B 2XU6A 1NAFA 5APXA 2PP6A 1AQ5A 2Z5HA 1NWQA 2Q5UA 1GW3A 4IFMA 5APVA 3UIAA 1FZCC 2WTYA 3HUSC 1DX7A 2OYHC 2YO2A 3EFGA 4WY4B 1J2JB 1LGHB 1JNMA 4HH2A 2IPPA 3M9BA 1VDFA 3V2PA 1SQQK 4OH8B 1LWUC 3L37A 1HH0A 2N1TC 4ZKUA 1JTHB 1LTJA 1SFCA 2O1JA 3M06A 1M1JB 5KJ7D 1QL1A 1SQXK 1SVFA 3G3ZA 2PAJA 1RF1B 4W7YA 1JY3N 5AVTB 2KYVA 3B5NA 5AW1B 1XTCC 1NTKK 1SQPK 2Q7CA 1L4AC 2A45H 1NU1K 4KHXA 3LIDA 3V5BA 2YNYA 3U1AA 3VP8A 1CI6B 1IFJA 1W2EA 2KSJA 1RY3A 2NPSB 3BATA 3BRTB 1G1IA 2WPRA 1KFMA 1T8ZA 1LTSC 1KILB 2YO3A 5AW2B 2HPCB 2C9LY 3B5ND 4LLHA 3OAKA 1RF0A 3CL3D 2FXMA 4WBAA 1FBMA 1M7LA 4RESB 3BVHA 5BU5A 2YMYA 2CPBA 2IFNA 1DEBA 1LT9A 3IFMA 5KJ7C 2E42A 3L4FA 1G2CA 1CW5A 4B86A 1GK4A 1KQLA 1N7SA 2FFDC 3TK1A 1GU5A 2WSCH 3KPEA 1FZCB 1FZEA 1MUUA 1SLQA 3HE5A 3HUSB 3VMZA 2H43A 2YKQA 2OYHB 1H88A 4C7RA 3VN0A 1N73A 2FYUK 3V2RA 2BASA 2QM7A 1H8AA 3LW5H 1LWUB 1JMMA 1L4AA 2N1TB 2L5GB 1LTJC 1SFCC 3HRNA 1LTBC 3KYQA 3V4QA 3OA7A 2H7HA 5AW0B 5CCHA 1QL2A 1T2KD 1N7SD 1JY2N 1T3UA 3VMYA 2N9BA 2HFED 1GTWA 1XTGB 3B5NC 2HG5D 2P1JA 3RK2D 5KLVK 1PFIA 3C9IA 1J1EC 1IFMA 2O1KA 4W7ZA 5CHXA 4C46A 3H32B 3WMM0 3L35A 2OYIC 4JYBA 3HTKA 1NH4A 4LC1A 4N78E 2ZXEB 1RE4A 2KLVA 2XKMA 5CCHD 2FFDA 3TNUA 1FDMA 3VMXA 2WPQA 2HODA 1RF0C 2WT7B 1IK9A 3A3YB 2WSFH 1NKNA 2W6BA 5APSA 1GD2E 1VPCA 2OARA 2XNXA 1X8YA 2J59M 3A7OA 1ZV8A 3SWYA 1LT9C 4GKGA 3TYYA 4GIFA 1T2KC 2XV5A 1N7SC 3KDPB 4XA4A 2Z5IA 3IR9A 4I1LA 5CMZA 3M0DC 3RK2C 3N4XA 4IFDK 1WT6A 4XE5B 4WB4A 5AW5B 1N73C 2W27A 4WY4D 3M91A 3V2NA 3PP5A 1JCCA 2XDJA 5AVZB 4DZOA 1LTJB 2OYIA 2LKMA 3LIEA 1JY3O 1SFCB 1JY3P 2R3CA 5AVWB 2I1JA 1X79B 5CCHC 2J58A 1JOCA 3RL0B 2QM8A 3HD7B 2M3BA 5APQA 1J1EB 2W6AA 1IFIA 2P67A 1RE3C 1J1DC 1NO4A 1JO5A 3P7KA 5APUA 4Y99C 3L36A 4JF7A 5BU8B 3CI9A 1E5WA 1EQ7A 2VRSA 1GDTA 2POHA 2NPSD 4AUWA 1RE4C 3HE4A 5APWA 3RK3D 1NKZB 1GK6A 3OJAB 3GHGA 1HUCA 1OWAA 2IX7C 3M0DA 4N78D 3P32A 1GW4A 4ZKPA 1HBWA 1YYCA 1N2DC 3U59A 4WY4C 1FZGA 2R5DA 1LWUA 3VP9A 3P8CE 1H89A 5AVYB 4C7NA 1L0NK 2GM4A 1FOSE 2E43A 3B8EB 1LT9B 3NXSA 1S9KE 2Z4EA 1FZAA 1G2CB 1M1JC 3N7NA 1N7SB 1RF1C 1HVVA 2KB7P 4GT1A 5AVSB 3U1CA 1JCDA 5AVXB 1DH3A 2GUVA 3RK2B 3HE5B 4JYCA 1NHLA 5CJ4A 1Z56A 3V4WA 1URQA 1OXZA 3SWFA 1N73B 2YKPA 1L4AB 1RE3A 5AW6B 5AVQB 1SQBK 3M9HA 2R5BA 1JY2O 1FAVA 4W80A 1JY2P 1MZ9A 4O9BA 1MV8A 2NPSC 1GL2A 1L0LK 1IFNA 2JJLA 2A45I 3RK3C 5AVVB 1NOHA 3MTUE 2FKWB 3V2QA 1A02F 5AW4B 1LTAC 1YTZT 2R32A 4WY4A 1URQD 2KP8A 1FZFA 2H8PD 4AYCA 1FJPA 5AVUB 4Y99B 3A5TA 3HTKB 1JTHA 3M9QA 1IO4A 2A45G 3P8MC 3EQ2A 4HYTB 1M1JA 1NTMK 1GL2D 1FOSF 1LTTC 1RF1A 2FFDB 3TNUB 3GHGC 1G1JA 1HGVA 1HGZA 2HODB 2WWWA 4IFFA 4I2LC 1KFNA 1GU4A 5APYA 3M0AA 4EIJA 2M8RA 3P8CD 1LTIC 1X9VA 1CI6A 1FU1A 2NPSA 3MD0A 2CPSA 2FYZA 4LGDE 5CCGA 1LTGC 3TSIA 4N3YB 3VTPC 1S9KD 2WZ7A 3HD7A 1KILA 3B5NB 3MIWA 2GUSA 3A2AA 2HPCA 1URQC 3KQGA 2P2UA 1CZQA 2HYNA 2P7JA 4DOJA 1N7LA 2Q9IA 2OYIB 2C0WA 1HWTC 2WSEH 1SFCD 1GL2C 3CLQA 3RK3B 3NTNA 3NMDA 5AVRB 5AW3B 1HTLC 5CCGD 2C9NY 1FZCA 3RL0D 3T97A 3MGNA 3HUSA 4EOTA 3HD7D 1KILD 2OYHA 4N6JA 1MFZA 1IFDA 2ZFCA 2JEEA 2IFMA 1KZUB 1T3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1T A;  4W80 A;  2NPS B;  2NPS C;  1GL2 A;  3RK3 C;  1N7S C;  1KIL B;  3M0D C;  3RK2 C;  3B5N D;  4WY4 A;  1URQ D;  4WY4 D;  2H8P D;  3PP5 A;  2XDJ A;  2YMY A;  3HTK B;  1SFC B;  2N1T D;  1JTH A;  5KJ7 C;  5CCH C;  1GL2 D;  1N7S A;  5CCG C;  3RL0 B;  3RL0 C;  3HD7 B;  3HD7 C;  1KIL C;  1URQ B;  2KOG A;  1L4A A;  3VOP A;  2N1T B;  1L4A D;  5KJ7 A;  2M8R A;  4JF7 A;  1SFC C;  1GL2 B;  3KYQ A;  2NPS A;  2PP6 A;  2NPS D;  5CCH A;  4LGD E;  3RK3 D;  5CCG A;  3TSI A;  1N7S D;  2WZ7 A;  3HD7 A;  1KIL A;  2HFE D;  3B5N B;  1XTG B;  3B5N C;  2HG5 D;  3RK2 D;  1URQ C;  4WY4 C;  4WY4 B;  3P8C E;  4W7Z A;  4OH8 B;  2N1T C;  1JTH B;  1SFC A;  1SFC D;  4N78 E;  5KJ7 D;  1GL2 C;  3RK3 B;  1N7S B;  1HVV A;  5CCH D;  3RK2 B;  4W7Y A;  5CCG D;  3B5N A;  3RL0 D;  1NHL A;  3HD7 D;  1KIL D;  1URQ A;  1L4A B;  1L4A C;  1T3J A; 
#chains in the Genus database with same CATH topology
 1FZB A;  3CCE P;  2RKL A;  4M3L A;  2QVA A;  1JUN A;  3HE4 B;  1ZR4 A;  2JDI H;  1ZR2 A;  3C8V A;  1U7J A;  5AW7 B;  1UIX A;  1CSB A;  5AW8 B;  1AFO A;  1MKM A;  1SP4 A;  1FS0 E;  1ZLL A;  3KXD A;  2K37 A;  2Q3I A;  2O01 J;  2WPS A;  3NFQ A;  1R5L A;  1L2P A;  3PRJ A;  2MJZ A;  3H6P A;  2ZAE B;  2IBZ D;  4H13 B;  1PZQ A;  2XU6 A;  1NAF A;  1PP9 D;  3CX5 E;  2PP6 A;  2Z5H A;  1GW3 A;  2IYO A;  4H0L B;  3HUS C;  1YJN P;  1LGH B;  2DW3 A;  4Y28 J;  2E74 C;  2IPP A;  2ZXX A;  2BCC J;  3L74 G;  1SQQ K;  4OH8 B;  5C39 A;  1BDC A;  3L37 A;  5GTH E;  2I8D A;  2O1J A;  1M1J B;  3C1L A;  3MZW B;  3WUU A;  4W7Y A;  4UB6 H;  1QEX A;  1Q2N A;  2KYV A;  3B5N A;  3FX0 A;  5AW1 B;  1DEE G;  2Q7C A;  1KYO I;  2A45 H;  1SQX G;  1NU1 K;  3CX5 H;  1NTM J;  2YNY A;  1CI6 B;  1IFJ A;  1W2E A;  2KSJ A;  3BRT B;  3BAT A;  1U57 A;  1T8Z A;  4BRY A;  1VQP P;  1LTS C;  3B71 A;  1ZRT E;  2HPC B;  4JQ0 D;  1AV1 A;  3OAK A;  5GTH H;  1PP9 G;  1FBM A;  4RES B;  3BVH A;  1BGY E;  3LW5 J;  3IFM A;  1Y8A A;  2BCC D;  1G2C A;  3FWL A;  1N7S A;  3TK1 A;  2YXQ B;  1SLQ A;  3HE5 A;  3VMZ A;  3HUS B;  2YKQ A;  3GLM A;  4PV1 D;  3FXD A;  4C7R A;  4OGQ C;  2FYU K;  3RL0 g;  3USS A;  1JMM A;  1L4A A;  3Q5R A;  2KNC B;  3KYQ A;  1YI2 P;  2E76 B;  5EFW B;  2ZJS E;  1NTM D;  1Q81 Q;  4PJ0 E;  2HG5 D;  1P84 I;  2HR3 A;  3CC7 P;  2E75 C;  1J1E C;  1GMJ A;  3IF4 A;  1OVR A;  4JYB A;  1VQ5 P;  4N78 E;  1RE4 A;  1UII A;  1N8R Q;  3TNU A;  2HOD A;  1OMI A;  3GF7 A;  2AXC A;  3FWN A;  2BEQ D;  1VPC A;  1X8Y A;  3SWY A;  3AEE C;  3L71 E;  4GKG A;  1OW8 A;  1PGP A;  2PRR A;  3TYY A;  1SQV J;  2M0B A;  4PJ0 H;  4GIF A;  4PD4 D;  4I1L A;  3M0D C;  3RK2 C;  1NJI Q;  4OGQ B;  1SQQ E;  4WY4 D;  2WMM A;  3OW2 O;  1QX8 A;  5AVZ B;  3H1J G;  2OYI A;  1JY3 O;  1JY3 P;  4K35 A;  3CPW O;  2QM8 A;  3HD7 B;  2M3B A;  2E75 B;  1J1E B;  1NU1 E;  1R8E A;  1RE3 C;  1NO4 A;  2Q1K A;  4Y99 C;  2KXP B;  3L36 A;  4JF7 A;  2YIU C;  1EQ7 A;  1GDT A;  2NPS D;  2B9B A;  3I55 P;  3HE4 A;  3GF3 A;  1GK6 A;  2V7Q H;  2IX7 C;  4D6T G;  1SQP J;  1HBW A;  3JC2 2;  1N2D C;  1SQV D;  1FZG A;  3VP9 A;  3P8C E;  5AVY B;  1K04 A;  2JKV A;  1FZA A;  1HJ0 A;  1KC8 Q;  2QEX P;  2K9J B;  5AVS B;  3U1C A;  2QJK B;  5AVX B;  2D2C D;  2GUV A;  3RK2 B;  2FYU E;  1LJ2 A;  1Z56 A;  3SWF A;  3S9O A;  2J5U A;  2WSS H;  2NZ2 A;  3TF5 A;  1MV8 A;  1VQO P;  2A45 I;  4JPZ B;  3WUV A;  3CX5 I;  1NYH A;  2FKW B;  1A02 F;  5AW4 B;  1R5S A;  3Q5S A;  2H8P D;  3D6Y A;  4Y99 B;  3A5T A;  1SQP D;  1KV4 A;  1JMB A;  2YIU B;  2A45 G;  3P8M C;  2P58 A;  1M1J A;  1TU3 F;  1NTM K;  1LTT C;  3SWK A;  1G1J A;  1HGV A;  1D7M A;  2QA4 P;  2WWW A;  1KFN A;  1GU4 A;  1PGJ A;  2JP3 A;  3M0A A;  1YHQ P;  2YMK A;  1IFP A;  1CI6 A;  1FU1 A;  2FYZ A;  4LGD E;  2B87 B;  2IBZ E;  1SS1 A;  1LTG C;  1Y9B A;  3B5N B;  3CCQ P;  2HPC A;  1CZQ A;  2HYN A;  2P7J A;  2C0W A;  3L70 J;  4HJG H;  1GL2 C;  2Y0C A;  4MN4 C;  5CCG D;  2C9N Y;  3HUS A;  4N6J A;  3RGU A;  4K3A A;  2IDB A;  1BGY G;  5BVZ A;  2KI7 B;  2WIT A;  2KNC A;  4ASV A;  2B88 A;  3BRV B;  4AQR D;  3AEB C;  3FGA D;  2BEZ F;  1EC5 A;  5KAI E;  3QWO C;  2I1K A;  2N1T D;  2KS1 B;  1AQT A;  3AEF C;  1ZN5 A;  4H44 D;  3RL0 C;  1SQV K;  3H25 A;  3H1H J;  2FYU J;  1L0N J;  2W83 C;  2IZ0 A;  1J1D B;  2BCC E;  3H1L J;  3R2P A;  1L4A D;  1X22 A;  1PPJ D;  5APT A;  1S5L E;  1YQ3 C;  2O01 H;  2XZR A;  1GL2 B;  5APX A;  3JSV C;  4IFM A;  5APV A;  1FZC C;  4RKU J;  1SQB J;  3M9B A;  1VDF A;  3V2P A;  1S2E A;  1LWU C;  1L0L J;  1NTM E;  2P10 A;  3L71 G;  3L75 J;  3M06 A;  5KJ7 D;  4A7P A;  3IN6 A;  3CCR P;  3CXH D;  1RF1 B;  3EWK A;  4JBZ A;  1JY3 N;  2H88 C;  1SQQ G;  2V4H A;  1S5L H;  1SQP K;  3H1H D;  1EDI A;  3KZI E;  2FYU D;  5KAF E;  2XND H;  3V5B A;  1L0N D;  3U1A A;  1OVU A;  3VP8 A;  3H1L D;  1OIP A;  3F5H A;  3Q5P A;  3AE7 C;  1QVG O;  1KB9 E;  1Q7Y Q;  5AW2 B;  2C9L Y;  3QH9 A;  1NU1 G;  2WSC J;  1JB0 J;  2KSE A;  3CL3 D;  1M7L A;  2YMY A;  2QJY B;  4PD4 E;  3CMA P;  1SQB D;  2ZT9 D;  2JO1 A;  1CW5 A;  1GK4 A;  1L0L D;  2K9J A;  2A06 D;  2FFD C;  4U3F J;  1GU5 A;  1FZC B;  4BWN A;  3L75 D;  3T97 B;  1H88 A;  3KZI H;  3LW5 H;  1LWU B;  1DD4 A;  3CC2 P;  2L5G B;  4Z1M H;  1SFC C;  1LTB C;  1AVY A;  3OA7 A;  2LXB A;  5AW0 B;  3WUT A;  1T2K D;  3H1H G;  1RH5 B;  2FYU G;  3VMY A;  3AE8 C;  2HFE D;  1XTG B;  2P1J A;  1PFI A;  3G6E P;  3C9I A;  4PD4 H;  3H1L G;  4W7Z A;  3H1I J;  1YIT P;  2M3E A;  1S4X A;  3H32 B;  1SQV E;  3G9R A;  2XKM A;  5CCH D;  1ZW0 A;  1ZME C;  3VMX A;  1Q86 Q;  3TDK A;  3I56 P;  2FYN C;  4U3F D;  2WT7 B;  4H13 D;  2A06 G;  2OAR A;  2J59 M;  3A7O A;  1LT9 C;  1NTZ J;  2XV5 A;  3KDP B;  2GA1 A;  4XA4 A;  1KQS O;  2B87 A;  2IBZ I;  5CMZ A;  1WT6 A;  5AW5 B;  4H0L D;  1N73 C;  3M91 A;  3V2N A;  1M57 D;  3PP5 A;  2RN0 A;  1X0T A;  3H1K E;  3A0H E;  2LKM A;  1SFC B;  3H1I D;  1VF5 D;  2WSE J;  4DCK A;  1X79 B;  2IBZ G;  2ZVN B;  4EYY Q;  1SQP E;  2QE7 H;  3CME P;  2W6A A;  1IFI A;  2FXP A;  1JO5 A;  5APU A;  3O6Q B;  5TIS E;  4GOE A;  1NTK J;  1GW4 A;  2FYN B;  3U59 A;  3CCU P;  4WY4 C;  1NTZ D;  3A0H H;  1H89 A;  2E74 B;  2M5A B;  4NPF X;  1L0N K;  2GM4 A;  1FOS E;  3B8E B;  1LT9 B;  2AEF A;  2Z4E A;  2KS1 A;  3KHU A;  2KB7 P;  4GT1 A;  4WVZ A;  1AVO A;  1DH3 A;  5CJ4 A;  1OXZ A;  3H1I G;  2N9Y B;  1N73 B;  4KT0 J;  5TIS H;  5AW6 B;  3JCU E;  1SQB K;  2KIK A;  4W80 A;  2NPS C;  1GL2 A;  1L0L K;  1WMK A;  2JJL A;  1PGO A;  2E76 D;  5AVV B;  3AE3 C;  3MTU E;  1IZN B;  1U7M A;  4GOF A;  3ITK A;  3CCL P;  1URQ D;  2BCC G;  2O3J A;  1NTK D;  1KB9 D;  4OWF A;  3GMA A;  3CWB J;  3HTK B;  4EI2 A;  1RHZ B;  5KLI C;  1Q82 Q;  1KTM A;  5KLV J;  2D2C C;  1RF1 A;  3GHG C;  2KZJ A;  1VQ8 P;  1HGZ A;  2ZVO B;  3JCU H;  4IFF A;  4I2L C;  3G71 P;  3PTZ A;  2K9Y A;  1NTM G;  2AEM A;  4EIJ A;  3R4Y A;  2M8R A;  3L70 E;  3MD0 A;  1QVF O;  5DJU B;  2AXT E;  1PPJ E;  3MIW A;  1W2B O;  2GUS A;  2ZYG A;  1N7L A;  3H1K J;  2OTK E;  1HWT C;  3S1K A;  5CBN A;  5AW3 B;  3CWB D;  3RBZ A;  1FZC A;  3T97 A;  1DD3 A;  3HD7 D;  1KIL D;  3GW6 A;  2E75 D;  1IFD A;  5KLV D;  4IOI H;  3AE1 C;  1OFC X;  3AE5 C;  3CXH E;  1LWU A;  1KZU B;  1IC2 A;  2Y0D A;  5KTB A;  2AXT H;  2C0X A;  4GDO A;  1YTZ I;  2HLO A;  3GHG B;  3D6Z A;  3PH0 A;  1FJK A;  3H1H E;  1PL5 A;  1L0N E;  4C7N B;  3H1L E;  3H32 A;  5DJT B;  3I5C A;  3ABV C;  2QJP C;  1W5C E;  4GOD A;  3BAS A;  5CJ0 A;  3H1K D;  3BCC J;  5CCG C;  3CCV P;  1H0T B;  3II6 A;  1NTZ K;  2KK7 A;  2KOG A;  3CXH H;  1SQB E;  2WT7 A;  3VOP A;  2K3R A;  1L0L E;  2A06 E;  3O8Z A;  5AW9 B;  3L75 E;  1SQV G;  1BDD A;  2KLU A;  1RQV A;  1NWQ A;  2Q5U A;  3L72 J;  1DX7 A;  2OYH C;  3EFG A;  1J2J B;  1JNM A;  3PLN A;  4YXD C;  2N1T C;  1JTH B;  1SFC A;  1SVF A;  3G3Z A;  2G3A A;  4H44 C;  3AEA C;  1OX3 A;  1IK7 A;  5GTI E;  1OZH A;  5E79 E;  3BCC D;  1NTK K;  1L4A C;  1EZV D;  3H1K G;  3O6Q A;  4KHX A;  1G1I A;  2E5T A;  3L73 J;  4U3F E;  1VQM P;  1ZOY C;  1SQP G;  4UB8 E;  1JEK A;  4NPD A;  3B5N D;  4LLH A;  3L72 D;  3WU2 E;  2FXM A;  2M5A A;  1LNQ A;  3MUD C;  4I7Z C;  5BU5 A;  1BE3 J;  2CPB A;  2E42 A;  5KJ7 C;  1LT9 A;  5H2F E;  1ZP0 C;  1KQL A;  5GTI H;  2WSC H;  1USE A;  1FZE A;  5E79 H;  2H43 A;  2OYH B;  3VN0 A;  1N73 A;  3V2R A;  3SFE C;  2BAS A;  3H1I E;  2QM7 A;  2N1T B;  1LTJ C;  1YBK A;  3HRN A;  3V4Q A;  2H7H A;  4H44 B;  4UB8 H;  3CCM P;  4L74 A;  2L91 A;  2K1A A;  1QL2 A;  1VQL P;  4OVN F;  1N7S D;  1NGM B;  2N9B A;  3L70 D;  5KLV K;  1EDK A;  1YIJ P;  3L73 D;  5H2F H;  2OYO A;  3WMM 0;  3L35 A;  2OYI C;  4IL6 E;  2ZT9 C;  2WSF J;  3HTK A;  1NH4 A;  4LC1 A;  2LR2 A;  2ZXE B;  1KN7 A;  5KAI H;  1QGK B;  1NTZ E;  1BE3 D;  1P84 E;  2ZYD A;  1RF0 C;  3CC4 P;  2KUB A;  4I7Z B;  1NKN A;  5APS A;  1GD2 E;  3PJS K;  4R4L A;  1OVV A;  1T2K C;  2IYP A;  3IR9 A;  3N4X A;  1PIX A;  4WB4 A;  3L74 J;  1EDL A;  2XDJ A;  5B5E E;  4DZO A;  1LTJ B;  1K73 Q;  3LIE A;  3L70 G;  3AED C;  1KMI Z;  5CCH C;  2J58 A;  1JOC A;  3B4S A;  5M1B A;  3RL0 B;  1PPJ G;  2QRX A;  1NTK E;  1S5L X;  5APQ A;  4TT3 H;  4H13 C;  2YXR B;  3P7K A;  1SQX J;  3CI9 A;  1LT1 A;  3TGU J;  2POH A;  5APW A;  3RK3 D;  1HUC A;  3GHG A;  3M0D A;  4H0L C;  1YYC A;  5KAF H;  4C7N A;  4HB1 A;  2E43 A;  3E7K A;  3VMA A;  1KQG B;  1VF5 C;  1M1J C;  3L74 D;  1HVV A;  1KB9 H;  1JCD A;  3CCS P;  3S4R A;  1H0T A;  4JYC A;  1L0N G;  1BCC J;  2JWA A;  1AA0 A;  1RE3 A;  5AVQ B;  1FDI A;  2R5B A;  1JY2 O;  3CWB E;  1JY2 P;  1MZ9 A;  4O9B A;  1KIL E;  2MKV A;  1SQX D;  5KLV E;  1K8A Q;  3SFD C;  1NOH A;  3TGU D;  3V2Q A;  1SQB G;  2O01 N;  4PV1 C;  4UB6 E;  1FZF A;  1FJP A;  2Q3E A;  1M56 D;  1L0L G;  1Y47 A;  1AJY A;  1FC2 C;  2WPV B;  1JTH A;  3L75 G;  1IO4 A;  1KYO D;  1QLE D;  2Y9Z A;  2FFD B;  4R4M A;  2SPZ A;  3K5B A;  2CK3 H;  3AEG C;  4U7J A;  1BCC D;  1VF5 B;  2CPS A;  2E76 C;  3AE2 C;  2W8Z A;  5CCG A;  3TSI A;  3VTP C;  1S9K D;  2WZ7 A;  1S3J A;  1URQ C;  3KQG A;  2P2U A;  2ITA A;  2Q9I A;  3H1J J;  3TGU G;  1SFC D;  4U3F G;  2B89 A;  4WWI A;  4PV1 B;  4EOT A;  2OYH A;  1MFZ A;  2OTL P;  2ZYA A;  1P84 D;  2JEE A;  1T3J A;  2N1T A;  1IJD B;  1M8O B;  4I6M C;  4HKZ H;  3D70 A;  3CD6 P;  1A02 J;  3EFF K;  2UWJ E;  3GG2 A;  3BCC E;  1WRG A;  1EZV E;  3E1I A;  1BCC G;  4D6T J;  2PFX A;  3RBX A;  2WQY C;  2E74 D;  1NAY A;  1HJB A;  1GZL A;  2NRG A;  3VYI A;  2R3S A;  2YKO A;  1EXJ A;  3L72 E;  3H1J D;  2QG4 A;  3HD7 C;  1KIL C;  3CCJ P;  1URQ B;  4RO0 A;  3AE4 C;  3MUD A;  2FBW C;  2FXO A;  1N86 A;  5KJ7 A;  3Q3D A;  3MHV A;  1NTZ G;  1AQ5 A;  3ZDM A;  2FY8 A;  3UIA A;  1EXI A;  2WTY A;  2YO2 A;  4WY4 B;  4HH2 A;  1OW7 A;  3A0B E;  1HH0 A;  4D6T D;  4ZKU A;  2QSI A;  1LTJ A;  3Q1M A;  1QL1 A;  1SQX K;  2PAJ A;  1USD A;  3MP7 B;  2OTJ P;  2QJK C;  3L73 E;  5AVT B;  1KB9 I;  1XTC C;  4OGQ D;  3AE9 C;  4YXW H;  2Q6Q A;  1NVO A;  3LID A;  1BE3 E;  4PD4 I;  1RY3 A;  2NPS B;  2WPR A;  1KFM A;  2OGU A;  1KIL B;  3V6I A;  1NTK G;  2YO3 A;  3A0B H;  1RF0 A;  2Y9Y A;  4WBA A;  1T6A A;  1VQ6 P;  2G8Y A;  4EDF A;  1VQ4 P;  2IFN A;  1DEB A;  5KLI B;  1VQ7 P;  3L4F A;  1LP1 B;  4RJT A;  4B86 A;  2D2C B;  1Q90 D;  3KPE A;  1MUU A;  3CX5 D;  4ASW A;  4NPE A;  1H8A A;  1BGY J;  1PV3 A;  2H89 C;  2W6J H;  5CCH A;  1JY2 N;  1T3U A;  3W67 A;  1GTW A;  3B5N C;  1K05 A;  3RK2 D;  2OQQ A;  1IFM A;  2O1K A;  5CHX A;  4C46 A;  2PGD A;  4TLF A;  3CWB G;  3RK3 E;  4ZNC A;  2WVR A;  5KLV G;  2KLV A;  2FFD A;  1FDM A;  3AE6 C;  2WPQ A;  1YQ4 C;  1M1K Q;  1IK9 A;  1ZRT D;  3A3Y B;  2WSF H;  2W6B A;  3L74 E;  4ZMD A;  2XNX A;  1ZV8 A;  3SSU A;  1EDJ A;  4KJM A;  1N7S C;  1BGY D;  2Z5I A;  4IFD K;  4XE5 B;  4DJG A;  2W27 A;  1JCC A;  4XFJ A;  1PGQ A;  1SQX E;  2R44 A;  1FDO A;  2QJP B;  3L71 J;  3TGU E;  2R3C A;  5AVW B;  2I1J A;  1MFT A;  1FE6 A;  5CBO A;  5L8R J;  1SQQ J;  1HF9 A;  2V7Q J;  1KYO E;  2P67 A;  3G4S P;  1PP9 E;  1J1D C;  2JR8 A;  1K9M Q;  1RQU A;  5BU8 B;  1E5W A;  2VRS A;  1YJ9 P;  1KD1 Q;  4AUW A;  1RE4 C;  4BRY B;  2KZI A;  1NKZ B;  4L73 A;  3OJA B;  1OWA A;  4N78 D;  1EZV I;  4ZKP A;  3P32 A;  3W68 A;  1YJW P;  2LXC B;  1BCC E;  2R5D A;  1NU1 J;  4BXL A;  3AEC C;  3NXS A;  3F89 A;  1S9K E;  1G2C B;  3N7N A;  1N7S B;  1RF1 C;  2IZ1 A;  4YPC A;  3BCC G;  3D71 A;  1EZV G;  3HE5 B;  1KYO H;  3L71 D;  1VL2 A;  3WU2 H;  1NHL A;  3V4W A;  1URQ A;  2YKP A;  1L4A B;  1E79 H;  3M9H A;  1SQQ D;  5KKZ C;  1FAV A;  1IFN A;  3RK3 C;  3L72 G;  4L75 A;  1KQF B;  2QIW A;  1VQK P;  1LTA C;  1YTZ T;  2R32 A;  4WY4 A;  5K5G B;  2KP8 A;  4AYC A;  2AEJ A;  5AVU B;  2QJY C;  5B66 E;  2Y0E A;  3M9Q A;  1NU1 D;  3Q2Y A;  3EQ2 A;  4HYT B;  4DT0 A;  4CPG A;  1FOS F;  1GL2 D;  3TNU B;  1S1C X;  2HOD B;  5TJH A;  3IAO A;  4IL6 H;  5APY A;  2K88 A;  1BSH A;  4YTP C;  2JWD A;  3H1J E;  3FXE A;  3P8C D;  1LTI C;  1VQ9 P;  1X9V A;  2W90 A;  3PHL A;  2NPS A;  1P84 H;  3L73 G;  4N3Y B;  3HD7 A;  1KIL A;  1BSN A;  4IL6 X;  1VQN P;  3A2A A;  5B66 H;  1OW6 A;  4DOJ A;  2OYI B;  5KKZ B;  2ZT9 B;  1BE3 G;  3E1R A;  3CXH I;  2WSE H;  3CLQ A;  3RK3 B;  4QMA A;  3NTN A;  1LP1 A;  3NMD A;  5AVR B;  1S72 P;  2E5Y A;  1HTL C;  2RH0 A;  1ZXG A;  1M90 Q;  2RMZ A;  1DIP A;  1KOR A;  3RL0 D;  3MGN A;  4L76 A;  4D6T E;  1JM0 A;  5B5E H;  1PP9 J;  2ZFC A;  2IFM A; 
#chains in the Genus database with same CATH homology
 1FZB A;  2N1T A;  1IJD B;  5BVZ A;  1IC2 A;  4I6M C;  2WIT A;  4M3L A;  5KTB A;  1JUN A;  1A02 J;  3HE4 B;  1ZR4 A;  2C0X A;  3BRV B;  4AQR D;  1ZR2 A;  1YTZ I;  2HLO A;  3GHG B;  1WRG A;  3E1I A;  1FJK A;  5AW7 B;  1CSB A;  5AW8 B;  1AFO A;  4C7N B;  2I1K A;  1SP4 A;  1HJB A;  3H32 A;  1ZLL A;  2N1T D;  1GZL A;  3I5C A;  3VYI A;  2YKO A;  2Q3I A;  2WPS A;  3BAS A;  5CJ0 A;  3NFQ A;  1ZN5 A;  5CCG C;  3RL0 C;  1SQV K;  3HD7 C;  1KIL C;  3II6 A;  1NTZ K;  2MJZ A;  3H6P A;  1URQ B;  2KOG A;  1J1D B;  3R2P A;  2WT7 A;  3VOP A;  3MUD A;  1L4A D;  5APT A;  1N86 A;  3O8Z A;  2O01 H;  2XZR A;  5KJ7 A;  5AW9 B;  1GL2 B;  2XU6 A;  1NAF A;  5APX A;  2PP6 A;  1AQ5 A;  2Z5H A;  1NWQ A;  2Q5U A;  1GW3 A;  4IFM A;  5APV A;  3UIA A;  1FZC C;  2WTY A;  3HUS C;  1DX7 A;  2OYH C;  2YO2 A;  3EFG A;  4WY4 B;  1J2J B;  1LGH B;  1JNM A;  4HH2 A;  2IPP A;  3M9B A;  1VDF A;  3V2P A;  1SQQ K;  4OH8 B;  1LWU C;  3L37 A;  1HH0 A;  2N1T C;  4ZKU A;  1JTH B;  1LTJ A;  1SFC A;  2O1J A;  3M06 A;  1M1J B;  5KJ7 D;  1QL1 A;  1SQX K;  1SVF A;  3G3Z A;  2PAJ A;  1RF1 B;  4W7Y A;  1JY3 N;  5AVT B;  2KYV A;  3B5N A;  5AW1 B;  1XTC C;  1NTK K;  1SQP K;  2Q7C A;  1L4A C;  2A45 H;  1NU1 K;  4KHX A;  3LID A;  3V5B A;  2YNY A;  3U1A A;  3VP8 A;  1CI6 B;  1IFJ A;  1W2E A;  2KSJ A;  1RY3 A;  2NPS B;  3BAT A;  3BRT B;  1G1I A;  2WPR A;  1KFM A;  1T8Z A;  1LTS C;  1KIL B;  2YO3 A;  5AW2 B;  2HPC B;  2C9L Y;  3B5N D;  4LLH A;  3OAK A;  1RF0 A;  3CL3 D;  2FXM A;  4WBA A;  1FBM A;  1M7L A;  4RES B;  3BVH A;  5BU5 A;  2YMY A;  2CPB A;  2IFN A;  1DEB A;  1LT9 A;  3IFM A;  5KJ7 C;  2E42 A;  3L4F A;  1G2C A;  1CW5 A;  4B86 A;  1GK4 A;  1KQL A;  1N7S A;  2FFD C;  3TK1 A;  1GU5 A;  2WSC H;  3KPE A;  1FZC B;  1FZE A;  1MUU A;  1SLQ A;  3HE5 A;  3HUS B;  3VMZ A;  2H43 A;  2YKQ A;  2OYH B;  1H88 A;  4C7R A;  3VN0 A;  1N73 A;  2FYU K;  3V2R A;  2BAS A;  2QM7 A;  1H8A A;  3LW5 H;  1LWU B;  1JMM A;  1L4A A;  2N1T B;  2L5G B;  1LTJ C;  1SFC C;  3HRN A;  1LTB C;  3KYQ A;  3V4Q A;  3OA7 A;  2H7H A;  5AW0 B;  5CCH A;  1QL2 A;  1T2K D;  1N7S D;  1JY2 N;  1T3U A;  3VMY A;  2N9B A;  2HFE D;  1GTW A;  1XTG B;  3B5N C;  2HG5 D;  2P1J A;  3RK2 D;  5KLV K;  1PFI A;  3C9I A;  1J1E C;  1IFM A;  2O1K A;  4W7Z A;  5CHX A;  4C46 A;  3H32 B;  3WMM 0;  3L35 A;  2OYI C;  4JYB A;  3HTK A;  1NH4 A;  4LC1 A;  4N78 E;  2ZXE B;  1RE4 A;  2KLV A;  2XKM A;  5CCH D;  2FFD A;  3TNU A;  1FDM A;  3VMX A;  2WPQ A;  2HOD A;  1RF0 C;  2WT7 B;  1IK9 A;  3A3Y B;  2WSF H;  1NKN A;  2W6B A;  5APS A;  1GD2 E;  1VPC A;  2OAR A;  2XNX A;  1X8Y A;  2J59 M;  3A7O A;  1ZV8 A;  3SWY A;  1LT9 C;  4GKG A;  3TYY A;  4GIF A;  1T2K C;  2XV5 A;  1N7S C;  3KDP B;  4XA4 A;  2Z5I A;  3IR9 A;  4I1L A;  5CMZ A;  3M0D C;  3RK2 C;  3N4X A;  4IFD K;  1WT6 A;  4XE5 B;  4WB4 A;  5AW5 B;  1N73 C;  2W27 A;  4WY4 D;  3M91 A;  3V2N A;  3PP5 A;  1JCC A;  2XDJ A;  5AVZ B;  4DZO A;  1LTJ B;  2OYI A;  2LKM A;  3LIE A;  1JY3 O;  1SFC B;  1JY3 P;  2R3C A;  5AVW B;  2I1J A;  1X79 B;  5CCH C;  2J58 A;  1JOC A;  3RL0 B;  2QM8 A;  3HD7 B;  2M3B A;  5APQ A;  1J1E B;  2W6A A;  1IFI A;  2P67 A;  1RE3 C;  1J1D C;  1NO4 A;  1JO5 A;  3P7K A;  5APU A;  4Y99 C;  3L36 A;  4JF7 A;  5BU8 B;  3CI9 A;  1E5W A;  1EQ7 A;  2VRS A;  1GDT A;  2POH A;  2NPS D;  4AUW A;  1RE4 C;  3HE4 A;  5APW A;  3RK3 D;  1NKZ B;  1GK6 A;  3OJA B;  3GHG A;  1HUC A;  1OWA A;  2IX7 C;  3M0D A;  4N78 D;  3P32 A;  1GW4 A;  4ZKP A;  1HBW A;  1YYC A;  1N2D C;  3U59 A;  4WY4 C;  1FZG A;  2R5D A;  1LWU A;  3VP9 A;  3P8C E;  1H89 A;  5AVY B;  4C7N A;  1L0N K;  2GM4 A;  1FOS E;  2E43 A;  3B8E B;  1LT9 B;  3NXS A;  1S9K E;  2Z4E A;  1FZA A;  1G2C B;  1M1J C;  3N7N A;  1N7S B;  1RF1 C;  1HVV A;  2KB7 P;  4GT1 A;  5AVS B;  3U1C A;  1JCD A;  5AVX B;  1DH3 A;  2GUV A;  3RK2 B;  3HE5 B;  4JYC A;  1NHL A;  5CJ4 A;  1Z56 A;  3V4W A;  1URQ A;  1OXZ A;  3SWF A;  1N73 B;  2YKP A;  1L4A B;  1RE3 A;  5AW6 B;  5AVQ B;  1SQB K;  3M9H A;  2R5B A;  1JY2 O;  1FAV A;  4W80 A;  1JY2 P;  1MZ9 A;  4O9B A;  1MV8 A;  2NPS C;  1GL2 A;  1L0L K;  1IFN A;  2JJL A;  2A45 I;  3RK3 C;  5AVV B;  1NOH A;  3MTU E;  2FKW B;  3V2Q A;  1A02 F;  5AW4 B;  1LTA C;  1YTZ T;  2R32 A;  4WY4 A;  1URQ D;  2KP8 A;  1FZF A;  2H8P D;  4AYC A;  1FJP A;  5AVU B;  4Y99 B;  3A5T A;  3HTK B;  1JTH A;  3M9Q A;  1IO4 A;  2A45 G;  3P8M C;  3EQ2 A;  4HYT B;  1M1J A;  1NTM K;  1GL2 D;  1FOS F;  1LTT C;  1RF1 A;  2FFD B;  3TNU B;  3GHG C;  1G1J A;  1HGV A;  1HGZ A;  2HOD B;  2WWW A;  4IFF A;  4I2L C;  1KFN A;  1GU4 A;  5APY A;  3M0A A;  4EIJ A;  2M8R A;  3P8C D;  1LTI C;  1X9V A;  1CI6 A;  1FU1 A;  2NPS A;  3MD0 A;  2CPS A;  2FYZ A;  4LGD E;  5CCG A;  1LTG C;  3TSI A;  4N3Y B;  3VTP C;  1S9K D;  2WZ7 A;  3HD7 A;  1KIL A;  3B5N B;  3MIW A;  2GUS A;  3A2A A;  2HPC A;  1URQ C;  3KQG A;  2P2U A;  1CZQ A;  2HYN A;  2P7J A;  4DOJ A;  1N7L A;  2Q9I A;  2OYI B;  2C0W A;  1HWT C;  2WSE H;  1SFC D;  1GL2 C;  3CLQ A;  3RK3 B;  3NTN A;  3NMD A;  5AVR B;  5AW3 B;  1HTL C;  5CCG D;  2C9N Y;  1FZC A;  3RL0 D;  3T97 A;  3MGN A;  3HUS A;  4EOT A;  3HD7 D;  1KIL D;  2OYH A;  4N6J A;  1MFZ A;  1IFD A;  2ZFC A;  2JEE A;  2IFM A;  1KZU B;  1T3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...