1XTCC

Cholera toxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
b'SNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN
publication title The three-dimensional crystal structure of cholera toxin.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1996-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1xtcC00
1LTBC 1LTAC 1LTTC 1LTIC 1HTLC 1LTGC 1LTSC 1XTCC
chains in the Genus database with same CATH superfamily
4IL6E 2YXRB 4N6JA 2FBWC 1HF9A 3WUTA 3V6IA 1KQSO 4JQ0D 3HE4A 1PZQA 1ZP0C 2GM4A 1M1JA 2E5TA 5GTHE 3WUUA 2XDJA 3Q5RA 1LTJB 3TYYA 3KXDA 1HBWA 4KT0J 2IPPA 1M90Q 1GU4A 3ITKA 4D6TJ 1GL2D 3SFEC 1GL2C 3N4XA 1BDDA 3MUDA 1YQ3C 5AVYB 2FFDB 1LTBC 2OYHA 2I8DA 3QH9A 2V7QH 2AXCA 2BEQD 1PGOA 4OH8B 3PLNA 3CD6P 1K8AQ 1N86A 4HJGH 2IBZG 3CCJP 3KPEA 2P1JA 3H25A 1LT9C 4WY4D 3L70G 1JB0J 5AVUB 1GW3A 3E1RA 5KLVE 3SWYA 2WQYC 2HODA 2E76B 3BCCD 3CCMP 2KNCB 2JWAA 1H0TB 2VRSA 1SQPK 3RL0g 4AYCA 3A0BH 3C9IA 2M5AB 4XE5B 1SQXE 3JCUE 1L0NK 3L36A 1T6AA 5AVXB 2UWJE 2ZT9D 3L71G 4PV1D 1RE3C 2ZT9C 4PV1C 1YJNP 2FYUD 1SQXK 2A45H 3H32B 2R3SA 3OA7A 1DX7A 2W6BA 3H1KE 3KZIE 3L71D 3CCUP 3H1LG 1RE4C 3H1IJ 2XNDH 3L72J 2KSJA 1FDIA 1CI6A 2A45I 1DD4A 1SFCD 3L73J 1SFCC 2WPVB 1IO4A 1GK6A 1YIJP 3P8CE 1URQA 4I2LC 1IFJA 3HE5A 1LJ2A 2QG4A 1NTKG 3HE4B 5CMZA 2HG5D 1M1JB 1KQLA 1OMIA 1SQQK 1IFNA 3L74G 2Q7CA 3IN6A 2Z5HA 2Y0EA 3NFQA 3EFGA 5KJ7D 5KJ7C 1EXJA 1JOCA 5APYA 1X79B 2Y9ZA 2QEXP 1U57A 3L75E 2P7JA 1ZW0A 3FX0A 3B8EB 3ABVC 1JY3N 2Q6QA 3TSIA 1DD3A 1DIPA 2FXMA 1EXIA 1BE3D 4GOFA 3U1CA 1GL2A 1PPJE 2WPQA 1NO4A 3E7KA 5CJ0A 5KKZC 4HKZH 3CCLP 2CPBA 1JMBA 4GOEA 5KLVD 5E79H 1RF0C 1RY3A 1S1CX 1EZVD 1X9VA 2YO3A 1BGYG 4C7NA 3OJAB 3L70J 4D6TE 3TF5A 1YHQP 2E5YA 3BCCJ 4EOTA 2HODB 1MKMA 1AQ5A 2KB7P 1LT9A 1RH5B 1JCDA 2K1AA 2IBZI 5APUA 3H1KD 3SFDC 1YJWP 5KAFH 2MJZA 3OAKA 2ZAEB 2WPRA 1ZLLA 3SWFA 1NTMG 1KFNA 2C0WA 1M7LA 1PFIA 1L0LE 3L71J 3A0BE 5AVVB 1FOSE 2JWDA 2JP3A 3H1LJ 1CSBA 2YIUB 3NTNA 2FYNC 1N7LA 1CI6B 1GK4A 2KZJA 1RE3A 1AFOA 4GIFA 1DEBA 1L0LK 1NTZD 3E1IA 5TISH 3F89A 1RE4A 1SQQG 3CX5H 1L4AB 2QJPB 2W27A 2Q5UA 1GMJA 4RJTA 1PGJA 1URQB 3HE5B 2KXPB 2XNXA 2A06E 1SFCA 2NPSD 2R5DA 3CX5I 2NPSC 3H1HD 3CWBD 1YBKA 4GKGA 4A7PA 1IFIA 2K3RA 2JKVA 2L91A 1USEA 3CXHH 2YNYA 1NTKJ 1LTSC 2AXTH 3H1IE 1IZNB 3L72E 2ZYAA 3L74J 2QJKC 3H1JG 2YXQB 3N7NA 2R32A 1FZBA 1J1DC 2ZYGA 1LTAC 3V2NA 1Q7YQ 5DJUB 5H2FH 5AW7B 4BWNA 3GHGC 1S4XA 2BASA 5APSA 5KJ7A 5CCHC 1BE3J 1KYOH 1QVGO 3AECC 1KN7A 1NJIQ 4W80A 2G8YA 3VMAA 3FWNA 1E5WA 1KYOI 2KSEA 4N3YB 4D6TD 3CCQP 1LTTC 4M3LA 1TU3F 3Q5SA 1LWUC 2IFNA 2Q1KA 5BVZA 4C7NB 2WVRA 1BGYJ 4EI2A 1QEXA 3MIWA 4UB6H 3S9OA 1RF0A 2GUSA 5APWA 1GDTA 1LT9B 5E79E 4ASVA 3SSUA 2B88A 1YI2P 1X8YA 3AE3C 1M8OB 1NKNA 1KQFB 1PL5A 2FKWB 3USSA 3P7KA 4GDOA 2IBZE 1G2CA 1NTMJ 3KDPB 2Z4EA 1M57D 1USDA 1RQVA 2BEZF 1EDKA 4L73A 2BCCG 4WBAA 3TGUG 3BCCE 3D71A 2QE7H 3CPWO 1IFMA 2BCCD 1NTZJ 1KV4A 1WT6A 4PV1B 3S1KA 5AW4B 1IC2A 2A06D 3L35A 2WPSA 2K37A 2OGUA 2KYVA 2LXBA 1N7SD 2N1TD 1N7SC 2B87B 4U3FG 2N1TC 1N2DC 2PP6A 3HTKA 4TT3H 2HPCA 3L72D 2ZXEB 1VQ9P 3RK3D 1QX8A 3RK3C 2ITAA 3G3ZA 1VQMP 3L71E 3L73D 1FJKA 5TISE 3CX5E 2WSSH 3HD7C 2NPSA 2WT7A 1SQVG 2FYUK 1X22A 2OTKE 3VOPA 5KAIE 1T3UA 4RKUJ 1YJ9P 2MKVA 3B4SA 1LP1A 3CI9A 3Q3DA 4L74A 1SQBG 3P32A 3S4RA 1BSNA 1OW8A 1NTKE 2V7QJ 3GHGA 1AV1A 3HUSC 3M91A 3RL0D 5H2FE 2WSFJ 3L74E 2W83C 1K05A 3HRNA 2LR2A 3RK2D 5CCHA 3AEBC 3RK2C 3PH0A 2FXPA 2GUVA 1YITP 1MUUA 2R5BA 1KYOE 4OGQB 3BRVB 1JY2P 1X0TA 2WSFH 1DEEG 1WRGA 3FXEA 4DJGA 2H89C 2Q3IA 2PGDA 3VP9A 1BE3E 1D7MA 1VL2A 1PP9G 1LWUA 2IBZD 1ZR4A 1PP9D 4WY4C 4IFMA 3L70D 4GT1A 3LIDA 1M56D 3U1AA 1EZVE 1G2CB 1QGKB 3GMAA 4I7ZB 1VDFA 2LXCB 4GODA 3Q5PA 4I1LA 1UIIA 4YXWH 1BGYE 2PRRA 2M3BA 2BCCJ 3A0HH 5KLVK 3TGUJ 1H8AA 2E75D 1G1JA 2E75C 3GLMA 5AVTB 1NKZB 1GD2E 1BCCG 1RF1C 1VQ6P 5AVSB 3JC22 4NPDA 2SPZA 1BCCD 2HYNA 4AUWA 4EDFA 1NU1G 1GZLA 1JUNA 4JYBA 4H44D 3M9HA 2FYNB 2WSEJ 4H44C 3A5TA 2XU6A 1J2JB 3RBZA 3CX5D 3H1LD 5APXA 3KHUA 2HPCB 1HUCA 1RHZB 1N73C 1GW4A 1VQOP 2QIWA 2YO2A 4ZMDA 1N7SA 2N1TA 2WSEH 4Y99C 3CMEP 2CK3H 1GTWA 3CXHD 1KZUB 2NPSB 3D6YA 1J1EC 1NTZE 3V2PA 2WT7B 3CMAP 1SQVJ 2KUBA 5CCGD 3WMM0 1HWTC 5CCGC 4KHXA 3F5HA 2KOGA 2ZVOB 3HD7A 4ZKUA 5AW5B 1NTKD 3PJSK 1AQTA 1LP1B 3H1HE 3CWBE 2OYIC 1NTZK 3L74D 3VP8A 1SQBJ 1VQPP 1SVFA 2O3JA 1ZOYC 2PFXA 4H13D 4OWFA 4H13C 3V2QA 3GHGB 1KYOD 1QL2A 2HFED 2KZIA 5AVZB 3CL3D 3BRTB 3V4WA 3VMYA 5AW1B 4IFDK 1NOHA 3CLQA 2OYHB 4YPCA 2KLUA 3HUSA 5CJ4A 3II6A 2HLOA 3UIAA 2PAJA 1SQPG 1FDMA 4NPFX 1YTZI 2H43A 1W2BO 1SQPD 2Y0CA 1AJYA 1LWUB 1PP9J 4WWIA 1L0NG 3PRJA 1FU1A 1L2PA 1LTGC 1Q86Q 3NMDA 1CZQA 2B89A 4HB1A 1L0ND 1BGYD 2O01H 4ZKPA 1T3JA 2R44A 4DCKA 1SQXG 2N9YB 3VYIA 3D70A 4WY4A 3M0DC 3NXSA 4IFFA 1M1KQ 2IYOA 1UIXA 3A3YB 1VQNP 1VQ7P 1EDJA 1P84H 1A02F 2W6AA 1Y9BA 2E76D 2E76C 1Y8AA 1BCCJ 1N8RQ 1SS1A 4AQRD 1KQGB 2P58A 1P84I 2Q9IA 3VMZA 3G71P 1FE6A 1NTMD 1VF5D 1VF5C 1RF1A 3B5ND 3A0HE 2ZVNB 3B5NC 1KILE 5AVWB 1ZXGA 1JEKA 1N7SB 2N1TB 2JEEA 2QJYC 1Q2NA 3GF3A 2BCCE 2IYPA 1SQQD 1KB9H 3R4YA 4BXLA 1JNMA 3RK3B 1U7JA 1OWAA 1KB9I 3KQGA 1ZN5A 3HD7B 3O8ZA 3WUVA 1HGZA 2RMZA 2OTJP 1KD1Q 3W68A 3RK3E 3OW2O 3AE9C 1S5LH 3CXHI 4LGDE 5CCGA 3L73E 1DH3A 1HVVA 3H1JD 1GU5A 2W90A 3L75G 4C7RA 4JF7A 5DJTB 1JMMA 2RH0A 2IFMA 2OYIA 1KMIZ 4JPZB 2N9BA 3A2AA 2XV5A 1Y47A 5CHXA 1SQVE 2O01N 3K5BA 3AE4C 1PGPA 5AW2B 3MTUE 1PPJG 3I5CA 1EC5A 3HUSB 1GL2B 2P10A 2WSCJ 1Q90D 3TNUA 1S5LX 4CPGA 2NZ2A 1SQPJ 4XA4A 4N78D 4I6MC 2H88C 2Q3EA 2K9JA 1KTMA 1R5SA 1W2EA 2WSCH 1L0NJ 1HJBA 2Y0DA 2E74D 3V2RA 2E74C 1VQ5P 1HJ0A 4HYTB 4WY4B 2FXOA 3AEGC 1YQ4C 1H88A 1JY2O 5EFWB 3LIEA 1H89A 2KIKA 3MZWB 2KK7A 5CBNA 1L0LG 3M0DA 1NAYA 1PP9E 2OQQA 4PD4D 1KILD 1KILC 3H6PA 3SWKA 1NAFA 3FXDA 3L70E 5AW0B 4YTPC 3D6ZA 1RF1B 1H0TA 3EQ2A 1S9KE 5KAFE 2FY8A 3TGUD 2ZT9B 5L8RJ 2M5AA 2YKQA 2J59M 1VQ4P 1JO5A 4H44B 1FZCC 1SQQJ 1MZ9A 5KLIC 1WMKA 3B5NA 4U3FD 1SFCB 1BCCE 4ZNCA 5AW9B 4Y99B 4EYYQ 1BSHA 2W8ZA 3AE6C 2WZ7A 1YYCA 2ZFCA 1L4AD 3H1IG 1IFDA 1L4AC 3H1LE 4RO0A 4O9BA 3I55P 1URQD 1BDCA 1J1EB 3EWKA 1MV8A 3A7OA 4WVZA 3H1JJ 4UB8H 1JY3P 3M0AA 1SQVD 1FZAA 1OIPA 3CXHE 2OYIB 2AXTE 4BRYA 1LT1A 2RN0A 1S5LE 1R8EA 4H13B 1SQBD 2IZ1A 1A02J 2NRGA 2ZXXA 3TNUB 5B66H 3RL0C 2J58A 1LGHB 4PJ0H 5M1BA 2O1KA 2KS1A 3G9RA 2K9JB 2AEJA 1YTZT 1NTKK 3CC4P 1JTHA 5KKZB 3TK1A 3RBXA 1IFPA 2Z5IA 4LLHA 4ASWA 2IZ0A 3GW6A 4R4MA 2D2CD 2D2CC 4LC1A 5KTBA 4Y28J 4UB6E 1OW7A 1SQPE 3VMXA 5TJHA 1P84D 1S9KD 1L0LJ 1NWQA 1FZGA 4L76A 2I1JA 2KLVA 1L0NE 3BCCG 1SLQA 1OVRA 5GTIH 2ZJSE 4XFJA 1OX3A 4PD4H 1S2EA 1SP4A 4DZOA 1KILA 1JM0A 2AEFA 3C8VA 1R5LA 3BASA 5APTA 3TDKA 2OARA 3WU2H 4PD4I 1VF5B 1VQ8P 2M3EA 4U3FJ 3B5NB 3HTKB 1FC2C 1NU1D 1U7MA 3IF4A 3L37A 1G1IA 2FYUG 1OZHA 3MHVA 1NTME 3IAOA 1KB9D 3AEAC 2P67A 1FAVA 1FZCA 1AA0A 1T8ZA 2QJYB 5AW3B 4H0LD 1E79H 4H0LC 1IK9A 3BVHA 1MFTA 4L75A 4W7YA 1FS0E 3L4FA 1NTMK 3MD0A 3B71A 2OYOA 1L4AA 3CC2P 1SQQE 3M9QA 2ZYDA 1MFZA 3AE1C 2QJKB 1ZRTE 1J1DB 4BRYB 1AVYA 5CBOA 2YMYA 3VTPC 3M9BA 1NYHA 4UB8E 1PIXA 5APVA 3AE7C 2K9YA 2Y9YA 1VQKP 3W67A 1LTJC 1VQLP 5AW6B 3H1JE 1FZEA 2KS1B 3V5BA 5C39A 1T2KD 3LW5J 1T2KC 4HH2A 1JTHB 4B86A 1BE3G 5B66E 2JR8A 2O01J 4WB4A 2FFDC 2QSIA 3LW5H 4PJ0E 3CCRP 4QMAA 3VN0A 4OGQD 4KJMA 3CCVP 3PTZA 4K35A 2M0BA 1FDOA 4OGQC 5KLVG 1IK7A 2E74B 3ZDMA 3Q1MA 4N78E 2H8PD 5K5GB 3GG2A 4DOJA 1EZVG 3M06A 2IX7C 1OVVA 1NHLA 2C9NY 1SQXD 2L5GB 2C0XA 3PP5A 2J5UA 4JBZA 1Z56A 3QWOC 1NGMB 1JY2N 3H1KG 2CPSA 1KILB 3P8MC 1QL1A 4I7ZC 3I56P 4TLFA 2POHA 1NU1J 2O1JA 1K04A 4DT0A 1KORA 2FYZA 3RGUA 3AE2C 1K73Q 5GTIE 2FYUJ 3JSVC 1EDLA 4PD4E 1FZCB 2C9LY 4OVNF 1EQ7A 5KLIB 1PGQA 3P8CD 3WU2E 4Z1MH 1NTZG 3TGUE 3T97A 1KFMA 1ZRTD 2P2UA 3AE5C 5AVQB 2YMKA 1N73A 1ZR2A 2KP8A 4RESB 3MGNA 2HR3A 4MN4C 1LNQA 3Q2YA 2XZRA 4JYCA 2B87A 2YKOA 3H1HG 3CWBG 4U3FE 1FOSF 5B5EH 2V4HA 5KAIH 4IL6H 3O6QA 3AEEC 5AW8B 4IOIH 5GTHH 2AEMA 1W5CE 1M1JC 3CCSP 2KI7B 2LKMA 3L75D 1FJPA 1HH0A 1JY3O 1EDIA 1VPCA 4W7ZA 3V4QA 5BU8B 2G3AA 1PV3A 4EIJA 1LTJA 5AVRB 1ZMEC 3RL0B 1PPJD 3RK2B 4IL6X 5CCHD 4NPEA 3MUDC 4C46A 2OTLP 3U59A 1SQBE 1SQVK 1ZV8A 2QVAA 2OYHC 1OVUA 4D6TG 2QA4P 5KLVJ 5APQA 2FFDA 1NVOA 1SQBK 3AE8C 4U7JA 2D2CB 4R4LA 1SQXJ 3CC7P 1OXZA 3G4SP 3AEFC 4YXDC 1QLED 1HTLC 2RKLA 2GA1A 3KYQA 1RQUA 2QRXA 4K3AA 2W6JH 2WITA 2M8RA 1HGVA 2XKMA 2I1KA 3G6EP 1QVFO 3JCUH 1L0LD 3H1KJ 2IDBA 1EZVI 2WWWA 3CCEP 1Q81Q 2B9BA 1CW5A 3IFMA 2E75B 2K88A 2KNCA 2YKPA 1P84E 2JO1A 2R3CA 3AEDC 3KZIH 3MP7B 3FGAD 2A45G 3IR9A 2WMMA 2YIUC 2A06G 3T97B 1LTIC 1S3JA 1XTGB 1N73B 3C1LA 3H32A 2QM7A 2JDIH 1FZFA 2E43A 4H0LB 1S72P 2QJPC 1NU1E 3L72G 5BU5A 3PHLA 2WTYA 2JJLA 2E42A 3H1HJ 3CWBJ 3H1ID 1URQC 3L73G 1K9MQ 3FWLA 1KB9E 2FYUE 3O6QB 2DW3A 1FBMA 1OW6A 2QM8A 1XTCC 1NH4A 1NU1K 1OFCX 3HD7D 1KC8Q 3R2PA 3L75J 1AVOA 3GF7A 3EFFK 2H7HA 1IJDB 1Q82Q 5B5EE 3BATA 1JCCA
chains in the Genus database with same CATH topology
1T8ZA 5AW3B 4N6JA 1A02F 2W6AA 1LTTC 4M3LA 3HE4A 2GM4A 1M1JA 1IK9A 1LWUC 2XDJA 2IFNA 4AQRD 1LTJB 3BVHA 5BVZA 3TYYA 4C7NB 4W7YA 2Q9IA 3VMZA 3L4FA 1NTMK 3MIWA 3MD0A 1HBWA 1L4AA 2IPPA 1RF0A 2GUSA 5APWA 1GDTA 1RF1A 3M9QA 3B5ND 1GU4A 3B5NC 1LT9B 1MFZA 1GL2D 1GL2C 1J1DB 5AVWB 3N4XA 3MUDA 2YMYA 1X8YA 1N7SB 1NKNA 2N1TB 5AVYB 2FFDB 2FKWB 2JEEA 3VTPC 1LTBC 3M9BA 2OYHA 5APVA 3P7KA 1G2CA 3KDPB 1JNMA 4OH8B 2Z4EA 3RK3B 1LTJC 1N86A 1OWAA 5AW6B 4WBAA 3KQGA 1ZN5A 3KPEA 1FZEA 3HD7B 3V5BA 2P1JA 1IFMA 3O8ZA 1HGZA 1T2KD 1WT6A 1T2KC 1LT9C 4HH2A 1JTHB 5AW4B 4WY4D 1IC2A 3L35A 2WPSA 4LGDE 2KYVA 4B86A 5CCGA 5AVUB 1DH3A 1GW3A 1HVVA 3SWYA 1N7SD 2N1TD 1N7SC 2HODA 2N1TC 4WB4A 1N2DC 2FFDC 2PP6A 3HTKA 1GU5A 2VRSA 1SQPK 4AYCA 3LW5H 4C7RA 4JF7A 1JMMA 2HPCA 2IFMA 3C9IA 3VN0A 2OYIA 2N9BA 3A2AA 2ZXEB 4XE5B 3RK3D 3RK3C 3G3ZA 2XV5A 5CHXA 1L0NK 3L36A 4N78E 2H8PD 4DOJA 1FJKA 5AW2B 3MTUE 3I5CA 5AVXB 3HD7C 3M06A 2IX7C 3HUSB 2NPSA 1GL2B 1NHLA 1RE3C 2WT7A 2C9NY 3TNUA 1SQXK 2A45H 2L5GB 3H32B 2FYUK 3OA7A 1DX7A 2C0XA 2W6BA 3PP5A 3VOPA 4XA4A 4N78D 1RE4C 1T3UA 4I6MC 2KSJA 1CI6A 2A45I 1Z56A 1W2EA 2WSCH 1JY2N 2CPSA 1KILB 1SFCD 1QL1A 3CI9A 3P8MC 1SFCC 1HJBA 1IO4A 1GK6A 3P32A 2POHA 3V2RA 2O1JA 3P8CE 2FYZA 1URQA 4I2LC 3GHGA 1IFJA 4HYTB 3HE5A 4WY4B 3HUSC 3M91A 3RL0D 1H88A 1JY2O 1FZCB 3LIEA 3RK2D 3HRNA 5CCHA 2C9LY 3RK2C 1H89A 1EQ7A 3P8CD 3HE4B 5CMZA 2GUVA 2HG5D 1M1JB 1KQLA 1MUUA 2R5BA 1SQQK 3T97A 1IFNA 3M0DA 1KFMA 3BRVB 2P2UA 5AVQB 1JY2P 1N73A 1ZR2A 2Q7CA 2KP8A 2WSFH 1KILD 4RESB 2Z5HA 3MGNA 1KILC 1WRGA 3H6PA 1NAFA 3NFQA 3EFGA 5KJ7D 2XZRA 4JYCA 5AW0B 5KJ7C 2Q3IA 1RF1B 3VP9A 2YKOA 3EQ2A 1S9KE 1JOCA 5APYA 1X79B 1LWUA 1FOSF 1ZR4A 2P7JA 4WY4C 4IFMA 2YKQA 3B8EB 2J59M 5AW8B 1JO5A 1FZCC 1JY3N 4GT1A 1MZ9A 3TSIA 3LIDA 3B5NA 2FXMA 3U1AA 1M1JC 1G2CB 3U1CA 1GL2A 1SFCB 2LKMA 1VDFA 2WPQA 1NO4A 5CJ0A 1FJPA 2CPBA 4I1LA 5AW9B 4Y99B 1HH0A 2WZ7A 1YYCA 2ZFCA 2M3BA 1L4AD 5KLVK 1IFDA 1L4AC 1H8AA 1JY3O 1G1JA 1RF0C 1VPCA 4W7ZA 5AVTB 1NKZB 3V4QA 5BU8B 4O9BA 1GD2E 1RF1C 1RY3A 1URQD 4EIJA 1J1EB 1MV8A 1X9VA 1LTJA 5AVRB 3A7OA 3RL0B 2YO3A 5AVSB 4C7NA 3OJAB 2HYNA 3RK2B 4AUWA 5CCHD 1GZLA 1JUNA 4JYBA 4C46A 4EOTA 1JY3P 3M0AA 3M9HA 3U59A 2HODB 1SQVK 1FZAA 3A5TA 2XU6A 1J2JB 1ZV8A 1AQ5A 2KB7P 2OYHC 1LT9A 5APXA 2HPCB 2OYIB 1HUCA 1JCDA 1N73C 1GW4A 5APUA 2YO2A 1N7SA 2N1TA 2WSEH 4Y99C 5APQA 2FFDA 2MJZA 3OAKA 1SQBK 1A02J 2WPRA 1GTWA 1ZLLA 3SWFA 1KFNA 1KZUB 2C0WA 2NPSB 1M7LA 1PFIA 1OXZA 1J1EC 3V2PA 2WT7B 3TNUB 3RL0C 1HTLC 5AVVB 3KYQA 2WITA 5CCGD 3WMM0 1FOSE 2J58A 2M8RA 1HWTC 1HGVA 5CCGC 2XKMA 1LGHB 2I1KA 4KHXA 1CSBA 3NTNA 2KOGA 2O1KA 1N7LA 3HD7A 4ZKUA 1CI6B 1GK4A 5AW5B 1RE3A 1AFOA 1YTZT 1NTKK 4GIFA 1JTHA 3TK1A 1DEBA 2OYIC 1L0LK 1NTZK 3E1IA 2WWWA 2Z5IA 3VP8A 4LLHA 1RE4A 1CW5A 1L4AB 2W27A 3IFMA 1SVFA 2Q5UA 2YKPA 3V2QA 1URQB 3GHGB 3HE5B 2R3CA 2XNXA 1SFCA 2NPSD 2R5DA 1QL2A 2NPSC 2HFED 4LC1A 5AVZB 5KTBA 3CL3D 2A45G 4GKGA 3BRTB 3V4WA 3VMYA 1IFIA 5AW1B 4IFDK 3IR9A 1NOHA 3CLQA 2YNYA 2OYHB 1LTSC 3VMXA 1S9KD 1NWQA 1LTIC 3HUSA 1XTGB 5CJ4A 1N73B 3II6A 1FZGA 2HLOA 2I1JA 2KLVA 3H32A 3N7NA 3UIAA 2R32A 2QM7A 1FZBA 2PAJA 1J1DC 1SLQA 1LTAC 1FDMA 1FZFA 1YTZI 2E43A 2H43A 5BU5A 2WTYA 3V2NA 1LWUB 2JJLA 2E42A 1SP4A 5AW7B 1URQC 4DZOA 3GHGC 1FU1A 1KILA 1LTGC 2BASA 3NMDA 1CZQA 3BASA 5APSA 1FBMA 5APTA 2OARA 5KJ7A 2QM8A 5CCHC 1XTCC 2O01H 4ZKPA 1T3JA 1NH4A 3B5NB 3HTKB 1NU1K 3HD7D 3L37A 1G1IA 3R2PA 3VYIA 4IFFA 3M0DC 3NXSA 4W80A 4WY4A 2H7HA 1IJDB 1E5WA 1JCCA 4N3YB 2P67A 1FAVA 1FZCA 3BATA 3A3YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTB C;  1LTA C;  1LTT C;  1LTI C;  1HTL C;  1LTG C;  1LTS C;  1XTC C; 
#chains in the Genus database with same CATH topology
 4IL6 E;  2YXR B;  4N6J A;  2FBW C;  1HF9 A;  3WUT A;  3V6I A;  1KQS O;  4JQ0 D;  3HE4 A;  1PZQ A;  1ZP0 C;  2GM4 A;  1M1J A;  2E5T A;  5GTH E;  3WUU A;  2XDJ A;  3Q5R A;  1LTJ B;  3TYY A;  3KXD A;  1HBW A;  4KT0 J;  2IPP A;  1M90 Q;  1GU4 A;  3ITK A;  4D6T J;  1GL2 D;  3SFE C;  1GL2 C;  3N4X A;  1BDD A;  3MUD A;  1YQ3 C;  5AVY B;  2FFD B;  1LTB C;  2OYH A;  2I8D A;  3QH9 A;  2V7Q H;  2AXC A;  2BEQ D;  1PGO A;  4OH8 B;  3PLN A;  3CD6 P;  1K8A Q;  1N86 A;  4HJG H;  2IBZ G;  3CCJ P;  3KPE A;  2P1J A;  3H25 A;  1LT9 C;  4WY4 D;  3L70 G;  1JB0 J;  5AVU B;  1GW3 A;  3E1R A;  5KLV E;  3SWY A;  2WQY C;  2HOD A;  2E76 B;  3BCC D;  3CCM P;  2KNC B;  2JWA A;  1H0T B;  2VRS A;  1SQP K;  3RL0 g;  4AYC A;  3A0B H;  3C9I A;  2M5A B;  4XE5 B;  1SQX E;  3JCU E;  1L0N K;  3L36 A;  1T6A A;  5AVX B;  2UWJ E;  2ZT9 D;  3L71 G;  4PV1 D;  1RE3 C;  2ZT9 C;  4PV1 C;  1YJN P;  2FYU D;  1SQX K;  2A45 H;  3H32 B;  2R3S A;  3OA7 A;  1DX7 A;  2W6B A;  3H1K E;  3KZI E;  3L71 D;  3CCU P;  3H1L G;  1RE4 C;  3H1I J;  2XND H;  3L72 J;  2KSJ A;  1FDI A;  1CI6 A;  2A45 I;  1DD4 A;  1SFC D;  3L73 J;  1SFC C;  2WPV B;  1IO4 A;  1GK6 A;  1YIJ P;  3P8C E;  1URQ A;  4I2L C;  1IFJ A;  3HE5 A;  1LJ2 A;  2QG4 A;  1NTK G;  3HE4 B;  5CMZ A;  2HG5 D;  1M1J B;  1KQL A;  1OMI A;  1SQQ K;  1IFN A;  3L74 G;  2Q7C A;  3IN6 A;  2Z5H A;  2Y0E A;  3NFQ A;  3EFG A;  5KJ7 D;  5KJ7 C;  1EXJ A;  1JOC A;  5APY A;  1X79 B;  2Y9Z A;  2QEX P;  1U57 A;  3L75 E;  2P7J A;  1ZW0 A;  3FX0 A;  3B8E B;  3ABV C;  1JY3 N;  2Q6Q A;  3TSI A;  1DD3 A;  1DIP A;  2FXM A;  1EXI A;  1BE3 D;  4GOF A;  3U1C A;  1GL2 A;  1PPJ E;  2WPQ A;  1NO4 A;  3E7K A;  5CJ0 A;  5KKZ C;  4HKZ H;  3CCL P;  2CPB A;  1JMB A;  4GOE A;  5KLV D;  5E79 H;  1RF0 C;  1RY3 A;  1S1C X;  1EZV D;  1X9V A;  2YO3 A;  1BGY G;  4C7N A;  3OJA B;  3L70 J;  4D6T E;  3TF5 A;  1YHQ P;  2E5Y A;  3BCC J;  4EOT A;  2HOD B;  1MKM A;  1AQ5 A;  2KB7 P;  1LT9 A;  1RH5 B;  1JCD A;  2K1A A;  2IBZ I;  5APU A;  3H1K D;  3SFD C;  1YJW P;  5KAF H;  2MJZ A;  3OAK A;  2ZAE B;  2WPR A;  1ZLL A;  3SWF A;  1NTM G;  1KFN A;  2C0W A;  1M7L A;  1PFI A;  1L0L E;  3L71 J;  3A0B E;  5AVV B;  1FOS E;  2JWD A;  2JP3 A;  3H1L J;  1CSB A;  2YIU B;  3NTN A;  2FYN C;  1N7L A;  1CI6 B;  1GK4 A;  2KZJ A;  1RE3 A;  1AFO A;  4GIF A;  1DEB A;  1L0L K;  1NTZ D;  3E1I A;  5TIS H;  3F89 A;  1RE4 A;  1SQQ G;  3CX5 H;  1L4A B;  2QJP B;  2W27 A;  2Q5U A;  1GMJ A;  4RJT A;  1PGJ A;  1URQ B;  3HE5 B;  2KXP B;  2XNX A;  2A06 E;  1SFC A;  2NPS D;  2R5D A;  3CX5 I;  2NPS C;  3H1H D;  3CWB D;  1YBK A;  4GKG A;  4A7P A;  1IFI A;  2K3R A;  2JKV A;  2L91 A;  1USE A;  3CXH H;  2YNY A;  1NTK J;  1LTS C;  2AXT H;  3H1I E;  1IZN B;  3L72 E;  2ZYA A;  3L74 J;  2QJK C;  3H1J G;  2YXQ B;  3N7N A;  2R32 A;  1FZB A;  1J1D C;  2ZYG A;  1LTA C;  3V2N A;  1Q7Y Q;  5DJU B;  5H2F H;  5AW7 B;  4BWN A;  3GHG C;  1S4X A;  2BAS A;  5APS A;  5KJ7 A;  5CCH C;  1BE3 J;  1KYO H;  1QVG O;  3AEC C;  1KN7 A;  1NJI Q;  4W80 A;  2G8Y A;  3VMA A;  3FWN A;  1E5W A;  1KYO I;  2KSE A;  4N3Y B;  4D6T D;  3CCQ P;  1LTT C;  4M3L A;  1TU3 F;  3Q5S A;  1LWU C;  2IFN A;  2Q1K A;  5BVZ A;  4C7N B;  2WVR A;  1BGY J;  4EI2 A;  1QEX A;  3MIW A;  4UB6 H;  3S9O A;  1RF0 A;  2GUS A;  5APW A;  1GDT A;  1LT9 B;  5E79 E;  4ASV A;  3SSU A;  2B88 A;  1YI2 P;  1X8Y A;  3AE3 C;  1M8O B;  1NKN A;  1KQF B;  1PL5 A;  2FKW B;  3USS A;  3P7K A;  4GDO A;  2IBZ E;  1G2C A;  1NTM J;  3KDP B;  2Z4E A;  1M57 D;  1USD A;  1RQV A;  2BEZ F;  1EDK A;  4L73 A;  2BCC G;  4WBA A;  3TGU G;  3BCC E;  3D71 A;  2QE7 H;  3CPW O;  1IFM A;  2BCC D;  1NTZ J;  1KV4 A;  1WT6 A;  4PV1 B;  3S1K A;  5AW4 B;  1IC2 A;  2A06 D;  3L35 A;  2WPS A;  2K37 A;  2OGU A;  2KYV A;  2LXB A;  1N7S D;  2N1T D;  1N7S C;  2B87 B;  4U3F G;  2N1T C;  1N2D C;  2PP6 A;  3HTK A;  4TT3 H;  2HPC A;  3L72 D;  2ZXE B;  1VQ9 P;  3RK3 D;  1QX8 A;  3RK3 C;  2ITA A;  3G3Z A;  1VQM P;  3L71 E;  3L73 D;  1FJK A;  5TIS E;  3CX5 E;  2WSS H;  3HD7 C;  2NPS A;  2WT7 A;  1SQV G;  2FYU K;  1X22 A;  2OTK E;  3VOP A;  5KAI E;  1T3U A;  4RKU J;  1YJ9 P;  2MKV A;  3B4S A;  1LP1 A;  3CI9 A;  3Q3D A;  4L74 A;  1SQB G;  3P32 A;  3S4R A;  1BSN A;  1OW8 A;  1NTK E;  2V7Q J;  3GHG A;  1AV1 A;  3HUS C;  3M91 A;  3RL0 D;  5H2F E;  2WSF J;  3L74 E;  2W83 C;  1K05 A;  3HRN A;  2LR2 A;  3RK2 D;  5CCH A;  3AEB C;  3RK2 C;  3PH0 A;  2FXP A;  2GUV A;  1YIT P;  1MUU A;  2R5B A;  1KYO E;  4OGQ B;  3BRV B;  1JY2 P;  1X0T A;  2WSF H;  1DEE G;  1WRG A;  3FXE A;  4DJG A;  2H89 C;  2Q3I A;  2PGD A;  3VP9 A;  1BE3 E;  1D7M A;  1VL2 A;  1PP9 G;  1LWU A;  2IBZ D;  1ZR4 A;  1PP9 D;  4WY4 C;  4IFM A;  3L70 D;  4GT1 A;  3LID A;  1M56 D;  3U1A A;  1EZV E;  1G2C B;  1QGK B;  3GMA A;  4I7Z B;  1VDF A;  2LXC B;  4GOD A;  3Q5P A;  4I1L A;  1UII A;  4YXW H;  1BGY E;  2PRR A;  2M3B A;  2BCC J;  3A0H H;  5KLV K;  3TGU J;  1H8A A;  2E75 D;  1G1J A;  2E75 C;  3GLM A;  5AVT B;  1NKZ B;  1GD2 E;  1BCC G;  1RF1 C;  1VQ6 P;  5AVS B;  3JC2 2;  4NPD A;  2SPZ A;  1BCC D;  2HYN A;  4AUW A;  4EDF A;  1NU1 G;  1GZL A;  1JUN A;  4JYB A;  4H44 D;  3M9H A;  2FYN B;  2WSE J;  4H44 C;  3A5T A;  2XU6 A;  1J2J B;  3RBZ A;  3CX5 D;  3H1L D;  5APX A;  3KHU A;  2HPC B;  1HUC A;  1RHZ B;  1N73 C;  1GW4 A;  1VQO P;  2QIW A;  2YO2 A;  4ZMD A;  1N7S A;  2N1T A;  2WSE H;  4Y99 C;  3CME P;  2CK3 H;  1GTW A;  3CXH D;  1KZU B;  2NPS B;  3D6Y A;  1J1E C;  1NTZ E;  3V2P A;  2WT7 B;  3CMA P;  1SQV J;  2KUB A;  5CCG D;  3WMM 0;  1HWT C;  5CCG C;  4KHX A;  3F5H A;  2KOG A;  2ZVO B;  3HD7 A;  4ZKU A;  5AW5 B;  1NTK D;  3PJS K;  1AQT A;  1LP1 B;  3H1H E;  3CWB E;  2OYI C;  1NTZ K;  3L74 D;  3VP8 A;  1SQB J;  1VQP P;  1SVF A;  2O3J A;  1ZOY C;  2PFX A;  4H13 D;  4OWF A;  4H13 C;  3V2Q A;  3GHG B;  1KYO D;  1QL2 A;  2HFE D;  2KZI A;  5AVZ B;  3CL3 D;  3BRT B;  3V4W A;  3VMY A;  5AW1 B;  4IFD K;  1NOH A;  3CLQ A;  2OYH B;  4YPC A;  2KLU A;  3HUS A;  5CJ4 A;  3II6 A;  2HLO A;  3UIA A;  2PAJ A;  1SQP G;  1FDM A;  4NPF X;  1YTZ I;  2H43 A;  1W2B O;  1SQP D;  2Y0C A;  1AJY A;  1LWU B;  1PP9 J;  4WWI A;  1L0N G;  3PRJ A;  1FU1 A;  1L2P A;  1LTG C;  1Q86 Q;  3NMD A;  1CZQ A;  2B89 A;  4HB1 A;  1L0N D;  1BGY D;  2O01 H;  4ZKP A;  1T3J A;  2R44 A;  4DCK A;  1SQX G;  2N9Y B;  3VYI A;  3D70 A;  4WY4 A;  3M0D C;  3NXS A;  4IFF A;  1M1K Q;  2IYO A;  1UIX A;  3A3Y B;  1VQN P;  1VQ7 P;  1EDJ A;  1P84 H;  1A02 F;  2W6A A;  1Y9B A;  2E76 D;  2E76 C;  1Y8A A;  1BCC J;  1N8R Q;  1SS1 A;  4AQR D;  1KQG B;  2P58 A;  1P84 I;  2Q9I A;  3VMZ A;  3G71 P;  1FE6 A;  1NTM D;  1VF5 D;  1VF5 C;  1RF1 A;  3B5N D;  3A0H E;  2ZVN B;  3B5N C;  1KIL E;  5AVW B;  1ZXG A;  1JEK A;  1N7S B;  2N1T B;  2JEE A;  2QJY C;  1Q2N A;  3GF3 A;  2BCC E;  2IYP A;  1SQQ D;  1KB9 H;  3R4Y A;  4BXL A;  1JNM A;  3RK3 B;  1U7J A;  1OWA A;  1KB9 I;  3KQG A;  1ZN5 A;  3HD7 B;  3O8Z A;  3WUV A;  1HGZ A;  2RMZ A;  2OTJ P;  1KD1 Q;  3W68 A;  3RK3 E;  3OW2 O;  3AE9 C;  1S5L H;  3CXH I;  4LGD E;  5CCG A;  3L73 E;  1DH3 A;  1HVV A;  3H1J D;  1GU5 A;  2W90 A;  3L75 G;  4C7R A;  4JF7 A;  5DJT B;  1JMM A;  2RH0 A;  2IFM A;  2OYI A;  1KMI Z;  4JPZ B;  2N9B A;  3A2A A;  2XV5 A;  1Y47 A;  5CHX A;  1SQV E;  2O01 N;  3K5B A;  3AE4 C;  1PGP A;  5AW2 B;  3MTU E;  1PPJ G;  3I5C A;  1EC5 A;  3HUS B;  1GL2 B;  2P10 A;  2WSC J;  1Q90 D;  3TNU A;  1S5L X;  4CPG A;  2NZ2 A;  1SQP J;  4XA4 A;  4N78 D;  4I6M C;  2H88 C;  2Q3E A;  2K9J A;  1KTM A;  1R5S A;  1W2E A;  2WSC H;  1L0N J;  1HJB A;  2Y0D A;  2E74 D;  3V2R A;  2E74 C;  1VQ5 P;  1HJ0 A;  4HYT B;  4WY4 B;  2FXO A;  3AEG C;  1YQ4 C;  1H88 A;  1JY2 O;  5EFW B;  3LIE A;  1H89 A;  2KIK A;  3MZW B;  2KK7 A;  5CBN A;  1L0L G;  3M0D A;  1NAY A;  1PP9 E;  2OQQ A;  4PD4 D;  1KIL D;  1KIL C;  3H6P A;  3SWK A;  1NAF A;  3FXD A;  3L70 E;  5AW0 B;  4YTP C;  3D6Z A;  1RF1 B;  1H0T A;  3EQ2 A;  1S9K E;  5KAF E;  2FY8 A;  3TGU D;  2ZT9 B;  5L8R J;  2M5A A;  2YKQ A;  2J59 M;  1VQ4 P;  1JO5 A;  4H44 B;  1FZC C;  1SQQ J;  1MZ9 A;  5KLI C;  1WMK A;  3B5N A;  4U3F D;  1SFC B;  1BCC E;  4ZNC A;  5AW9 B;  4Y99 B;  4EYY Q;  1BSH A;  2W8Z A;  3AE6 C;  2WZ7 A;  1YYC A;  2ZFC A;  1L4A D;  3H1I G;  1IFD A;  1L4A C;  3H1L E;  4RO0 A;  4O9B A;  3I55 P;  1URQ D;  1BDC A;  1J1E B;  3EWK A;  1MV8 A;  3A7O A;  4WVZ A;  3H1J J;  4UB8 H;  1JY3 P;  3M0A A;  1SQV D;  1FZA A;  1OIP A;  3CXH E;  2OYI B;  2AXT E;  4BRY A;  1LT1 A;  2RN0 A;  1S5L E;  1R8E A;  4H13 B;  1SQB D;  2IZ1 A;  1A02 J;  2NRG A;  2ZXX A;  3TNU B;  5B66 H;  3RL0 C;  2J58 A;  1LGH B;  4PJ0 H;  5M1B A;  2O1K A;  2KS1 A;  3G9R A;  2K9J B;  2AEJ A;  1YTZ T;  1NTK K;  3CC4 P;  1JTH A;  5KKZ B;  3TK1 A;  3RBX A;  1IFP A;  2Z5I A;  4LLH A;  4ASW A;  2IZ0 A;  3GW6 A;  4R4M A;  2D2C D;  2D2C C;  4LC1 A;  5KTB A;  4Y28 J;  4UB6 E;  1OW7 A;  1SQP E;  3VMX A;  5TJH A;  1P84 D;  1S9K D;  1L0L J;  1NWQ A;  1FZG A;  4L76 A;  2I1J A;  2KLV A;  1L0N E;  3BCC G;  1SLQ A;  1OVR A;  5GTI H;  2ZJS E;  4XFJ A;  1OX3 A;  4PD4 H;  1S2E A;  1SP4 A;  4DZO A;  1KIL A;  1JM0 A;  2AEF A;  3C8V A;  1R5L A;  3BAS A;  5APT A;  3TDK A;  2OAR A;  3WU2 H;  4PD4 I;  1VF5 B;  1VQ8 P;  2M3E A;  4U3F J;  3B5N B;  3HTK B;  1FC2 C;  1NU1 D;  1U7M A;  3IF4 A;  3L37 A;  1G1I A;  2FYU G;  1OZH A;  3MHV A;  1NTM E;  3IAO A;  1KB9 D;  3AEA C;  2P67 A;  1FAV A;  1FZC A;  1AA0 A;  1T8Z A;  2QJY B;  5AW3 B;  4H0L D;  1E79 H;  4H0L C;  1IK9 A;  3BVH A;  1MFT A;  4L75 A;  4W7Y A;  1FS0 E;  3L4F A;  1NTM K;  3MD0 A;  3B71 A;  2OYO A;  1L4A A;  3CC2 P;  1SQQ E;  3M9Q A;  2ZYD A;  1MFZ A;  3AE1 C;  2QJK B;  1ZRT E;  1J1D B;  4BRY B;  1AVY A;  5CBO A;  2YMY A;  3VTP C;  3M9B A;  1NYH A;  4UB8 E;  1PIX A;  5APV A;  3AE7 C;  2K9Y A;  2Y9Y A;  1VQK P;  3W67 A;  1LTJ C;  1VQL P;  5AW6 B;  3H1J E;  1FZE A;  2KS1 B;  3V5B A;  5C39 A;  1T2K D;  3LW5 J;  1T2K C;  4HH2 A;  1JTH B;  4B86 A;  1BE3 G;  5B66 E;  2JR8 A;  2O01 J;  4WB4 A;  2FFD C;  2QSI A;  3LW5 H;  4PJ0 E;  3CCR P;  4QMA A;  3VN0 A;  4OGQ D;  4KJM A;  3CCV P;  3PTZ A;  4K35 A;  2M0B A;  1FDO A;  4OGQ C;  5KLV G;  1IK7 A;  2E74 B;  3ZDM A;  3Q1M A;  4N78 E;  2H8P D;  5K5G B;  3GG2 A;  4DOJ A;  1EZV G;  3M06 A;  2IX7 C;  1OVV A;  1NHL A;  2C9N Y;  1SQX D;  2L5G B;  2C0X A;  3PP5 A;  2J5U A;  4JBZ A;  1Z56 A;  3QWO C;  1NGM B;  1JY2 N;  3H1K G;  2CPS A;  1KIL B;  3P8M C;  1QL1 A;  4I7Z C;  3I56 P;  4TLF A;  2POH A;  1NU1 J;  2O1J A;  1K04 A;  4DT0 A;  1KOR A;  2FYZ A;  3RGU A;  3AE2 C;  1K73 Q;  5GTI E;  2FYU J;  3JSV C;  1EDL A;  4PD4 E;  1FZC B;  2C9L Y;  4OVN F;  1EQ7 A;  5KLI B;  1PGQ A;  3P8C D;  3WU2 E;  4Z1M H;  1NTZ G;  3TGU E;  3T97 A;  1KFM A;  1ZRT D;  2P2U A;  3AE5 C;  5AVQ B;  2YMK A;  1N73 A;  1ZR2 A;  2KP8 A;  4RES B;  3MGN A;  2HR3 A;  4MN4 C;  1LNQ A;  3Q2Y A;  2XZR A;  4JYC A;  2B87 A;  2YKO A;  3H1H G;  3CWB G;  4U3F E;  1FOS F;  5B5E H;  2V4H A;  5KAI H;  4IL6 H;  3O6Q A;  3AEE C;  5AW8 B;  4IOI H;  5GTH H;  2AEM A;  1W5C E;  1M1J C;  3CCS P;  2KI7 B;  2LKM A;  3L75 D;  1FJP A;  1HH0 A;  1JY3 O;  1EDI A;  1VPC A;  4W7Z A;  3V4Q A;  5BU8 B;  2G3A A;  1PV3 A;  4EIJ A;  1LTJ A;  5AVR B;  1ZME C;  3RL0 B;  1PPJ D;  3RK2 B;  4IL6 X;  5CCH D;  4NPE A;  3MUD C;  4C46 A;  2OTL P;  3U59 A;  1SQB E;  1SQV K;  1ZV8 A;  2QVA A;  2OYH C;  1OVU A;  4D6T G;  2QA4 P;  5KLV J;  5APQ A;  2FFD A;  1NVO A;  1SQB K;  3AE8 C;  4U7J A;  2D2C B;  4R4L A;  1SQX J;  3CC7 P;  1OXZ A;  3G4S P;  3AEF C;  4YXD C;  1QLE D;  1HTL C;  2RKL A;  2GA1 A;  3KYQ A;  1RQU A;  2QRX A;  4K3A A;  2W6J H;  2WIT A;  2M8R A;  1HGV A;  2XKM A;  2I1K A;  3G6E P;  1QVF O;  3JCU H;  1L0L D;  3H1K J;  2IDB A;  1EZV I;  2WWW A;  3CCE P;  1Q81 Q;  2B9B A;  1CW5 A;  3IFM A;  2E75 B;  2K88 A;  2KNC A;  2YKP A;  1P84 E;  2JO1 A;  2R3C A;  3AED C;  3KZI H;  3MP7 B;  3FGA D;  2A45 G;  3IR9 A;  2WMM A;  2YIU C;  2A06 G;  3T97 B;  1LTI C;  1S3J A;  1XTG B;  1N73 B;  3C1L A;  3H32 A;  2QM7 A;  2JDI H;  1FZF A;  2E43 A;  4H0L B;  1S72 P;  2QJP C;  1NU1 E;  3L72 G;  5BU5 A;  3PHL A;  2WTY A;  2JJL A;  2E42 A;  3H1H J;  3CWB J;  3H1I D;  1URQ C;  3L73 G;  1K9M Q;  3FWL A;  1KB9 E;  2FYU E;  3O6Q B;  2DW3 A;  1FBM A;  1OW6 A;  2QM8 A;  1XTC C;  1NH4 A;  1NU1 K;  1OFC X;  3HD7 D;  1KC8 Q;  3R2P A;  3L75 J;  1AVO A;  3GF7 A;  3EFF K;  2H7H A;  1IJD B;  1Q82 Q;  5B5E E;  3BAT A;  1JCC A; 
#chains in the Genus database with same CATH homology
 1T8Z A;  5AW3 B;  4N6J A;  1A02 F;  2W6A A;  1LTT C;  4M3L A;  3HE4 A;  2GM4 A;  1M1J A;  1IK9 A;  1LWU C;  2XDJ A;  2IFN A;  4AQR D;  1LTJ B;  3BVH A;  5BVZ A;  3TYY A;  4C7N B;  4W7Y A;  2Q9I A;  3VMZ A;  3L4F A;  1NTM K;  3MIW A;  3MD0 A;  1HBW A;  1L4A A;  2IPP A;  1RF0 A;  2GUS A;  5APW A;  1GDT A;  1RF1 A;  3M9Q A;  3B5N D;  1GU4 A;  3B5N C;  1LT9 B;  1MFZ A;  1GL2 D;  1GL2 C;  1J1D B;  5AVW B;  3N4X A;  3MUD A;  2YMY A;  1X8Y A;  1N7S B;  1NKN A;  2N1T B;  5AVY B;  2FFD B;  2FKW B;  2JEE A;  3VTP C;  1LTB C;  3M9B A;  2OYH A;  5APV A;  3P7K A;  1G2C A;  3KDP B;  1JNM A;  4OH8 B;  2Z4E A;  3RK3 B;  1LTJ C;  1N86 A;  1OWA A;  5AW6 B;  4WBA A;  3KQG A;  1ZN5 A;  3KPE A;  1FZE A;  3HD7 B;  3V5B A;  2P1J A;  1IFM A;  3O8Z A;  1HGZ A;  1T2K D;  1WT6 A;  1T2K C;  1LT9 C;  4HH2 A;  1JTH B;  5AW4 B;  4WY4 D;  1IC2 A;  3L35 A;  2WPS A;  4LGD E;  2KYV A;  4B86 A;  5CCG A;  5AVU B;  1DH3 A;  1GW3 A;  1HVV A;  3SWY A;  1N7S D;  2N1T D;  1N7S C;  2HOD A;  2N1T C;  4WB4 A;  1N2D C;  2FFD C;  2PP6 A;  3HTK A;  1GU5 A;  2VRS A;  1SQP K;  4AYC A;  3LW5 H;  4C7R A;  4JF7 A;  1JMM A;  2HPC A;  2IFM A;  3C9I A;  3VN0 A;  2OYI A;  2N9B A;  3A2A A;  2ZXE B;  4XE5 B;  3RK3 D;  3RK3 C;  3G3Z A;  2XV5 A;  5CHX A;  1L0N K;  3L36 A;  4N78 E;  2H8P D;  4DOJ A;  1FJK A;  5AW2 B;  3MTU E;  3I5C A;  5AVX B;  3HD7 C;  3M06 A;  2IX7 C;  3HUS B;  2NPS A;  1GL2 B;  1NHL A;  1RE3 C;  2WT7 A;  2C9N Y;  3TNU A;  1SQX K;  2A45 H;  2L5G B;  3H32 B;  2FYU K;  3OA7 A;  1DX7 A;  2C0X A;  2W6B A;  3PP5 A;  3VOP A;  4XA4 A;  4N78 D;  1RE4 C;  1T3U A;  4I6M C;  2KSJ A;  1CI6 A;  2A45 I;  1Z56 A;  1W2E A;  2WSC H;  1JY2 N;  2CPS A;  1KIL B;  1SFC D;  1QL1 A;  3CI9 A;  3P8M C;  1SFC C;  1HJB A;  1IO4 A;  1GK6 A;  3P32 A;  2POH A;  3V2R A;  2O1J A;  3P8C E;  2FYZ A;  1URQ A;  4I2L C;  3GHG A;  1IFJ A;  4HYT B;  3HE5 A;  4WY4 B;  3HUS C;  3M91 A;  3RL0 D;  1H88 A;  1JY2 O;  1FZC B;  3LIE A;  3RK2 D;  3HRN A;  5CCH A;  2C9L Y;  3RK2 C;  1H89 A;  1EQ7 A;  3P8C D;  3HE4 B;  5CMZ A;  2GUV A;  2HG5 D;  1M1J B;  1KQL A;  1MUU A;  2R5B A;  1SQQ K;  3T97 A;  1IFN A;  3M0D A;  1KFM A;  3BRV B;  2P2U A;  5AVQ B;  1JY2 P;  1N73 A;  1ZR2 A;  2Q7C A;  2KP8 A;  2WSF H;  1KIL D;  4RES B;  2Z5H A;  3MGN A;  1KIL C;  1WRG A;  3H6P A;  1NAF A;  3NFQ A;  3EFG A;  5KJ7 D;  2XZR A;  4JYC A;  5AW0 B;  5KJ7 C;  2Q3I A;  1RF1 B;  3VP9 A;  2YKO A;  3EQ2 A;  1S9K E;  1JOC A;  5APY A;  1X79 B;  1LWU A;  1FOS F;  1ZR4 A;  2P7J A;  4WY4 C;  4IFM A;  2YKQ A;  3B8E B;  2J59 M;  5AW8 B;  1JO5 A;  1FZC C;  1JY3 N;  4GT1 A;  1MZ9 A;  3TSI A;  3LID A;  3B5N A;  2FXM A;  3U1A A;  1M1J C;  1G2C B;  3U1C A;  1GL2 A;  1SFC B;  2LKM A;  1VDF A;  2WPQ A;  1NO4 A;  5CJ0 A;  1FJP A;  2CPB A;  4I1L A;  5AW9 B;  4Y99 B;  1HH0 A;  2WZ7 A;  1YYC A;  2ZFC A;  2M3B A;  1L4A D;  5KLV K;  1IFD A;  1L4A C;  1H8A A;  1JY3 O;  1G1J A;  1RF0 C;  1VPC A;  4W7Z A;  5AVT B;  1NKZ B;  3V4Q A;  5BU8 B;  4O9B A;  1GD2 E;  1RF1 C;  1RY3 A;  1URQ D;  4EIJ A;  1J1E B;  1MV8 A;  1X9V A;  1LTJ A;  5AVR B;  3A7O A;  3RL0 B;  2YO3 A;  5AVS B;  4C7N A;  3OJA B;  2HYN A;  3RK2 B;  4AUW A;  5CCH D;  1GZL A;  1JUN A;  4JYB A;  4C46 A;  4EOT A;  1JY3 P;  3M0A A;  3M9H A;  3U59 A;  2HOD B;  1SQV K;  1FZA A;  3A5T A;  2XU6 A;  1J2J B;  1ZV8 A;  1AQ5 A;  2KB7 P;  2OYH C;  1LT9 A;  5APX A;  2HPC B;  2OYI B;  1HUC A;  1JCD A;  1N73 C;  1GW4 A;  5APU A;  2YO2 A;  1N7S A;  2N1T A;  2WSE H;  4Y99 C;  5APQ A;  2FFD A;  2MJZ A;  3OAK A;  1SQB K;  1A02 J;  2WPR A;  1GTW A;  1ZLL A;  3SWF A;  1KFN A;  1KZU B;  2C0W A;  2NPS B;  1M7L A;  1PFI A;  1OXZ A;  1J1E C;  3V2P A;  2WT7 B;  3TNU B;  3RL0 C;  1HTL C;  5AVV B;  3KYQ A;  2WIT A;  5CCG D;  3WMM 0;  1FOS E;  2J58 A;  2M8R A;  1HWT C;  1HGV A;  5CCG C;  2XKM A;  1LGH B;  2I1K A;  4KHX A;  1CSB A;  3NTN A;  2KOG A;  2O1K A;  1N7L A;  3HD7 A;  4ZKU A;  1CI6 B;  1GK4 A;  5AW5 B;  1RE3 A;  1AFO A;  1YTZ T;  1NTK K;  4GIF A;  1JTH A;  3TK1 A;  1DEB A;  2OYI C;  1L0L K;  1NTZ K;  3E1I A;  2WWW A;  2Z5I A;  3VP8 A;  4LLH A;  1RE4 A;  1CW5 A;  1L4A B;  2W27 A;  3IFM A;  1SVF A;  2Q5U A;  2YKP A;  3V2Q A;  1URQ B;  3GHG B;  3HE5 B;  2R3C A;  2XNX A;  1SFC A;  2NPS D;  2R5D A;  1QL2 A;  2NPS C;  2HFE D;  4LC1 A;  5AVZ B;  5KTB A;  3CL3 D;  2A45 G;  4GKG A;  3BRT B;  3V4W A;  3VMY A;  1IFI A;  5AW1 B;  4IFD K;  3IR9 A;  1NOH A;  3CLQ A;  2YNY A;  2OYH B;  1LTS C;  3VMX A;  1S9K D;  1NWQ A;  1LTI C;  3HUS A;  1XTG B;  5CJ4 A;  1N73 B;  3II6 A;  1FZG A;  2HLO A;  2I1J A;  2KLV A;  3H32 A;  3N7N A;  3UIA A;  2R32 A;  2QM7 A;  1FZB A;  2PAJ A;  1J1D C;  1SLQ A;  1LTA C;  1FDM A;  1FZF A;  1YTZ I;  2E43 A;  2H43 A;  5BU5 A;  2WTY A;  3V2N A;  1LWU B;  2JJL A;  2E42 A;  1SP4 A;  5AW7 B;  1URQ C;  4DZO A;  3GHG C;  1FU1 A;  1KIL A;  1LTG C;  2BAS A;  3NMD A;  1CZQ A;  3BAS A;  5APS A;  1FBM A;  5APT A;  2OAR A;  5KJ7 A;  2QM8 A;  5CCH C;  1XTC C;  2O01 H;  4ZKP A;  1T3J A;  1NH4 A;  3B5N B;  3HTK B;  1NU1 K;  3HD7 D;  3L37 A;  1G1I A;  3R2P A;  3VYI A;  4IFF A;  3M0D C;  3NXS A;  4W80 A;  4WY4 A;  2H7H A;  1IJD B;  1E5W A;  1JCC A;  4N3Y B;  2P67 A;  1FAV A;  1FZC A;  3BAT A;  3A3Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...