1XTCC

Cholera toxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
SNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional crystal structure of cholera toxin.
pubmed doi rcsb
molecule tags Toxin
molecule keywords CHOLERA TOXIN
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1996-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1xtcC00
1LTTC 1XTCC 1HTLC 1LTIC 1LTBC 1LTGC 1LTAC 1LTSC
chains in the Genus database with same CATH superfamily
2R5BA 1KYOE 2Q7CA 2BCCD 3FXDA 5KAIE 3S9OA 3KQGA 3V4QA 2FFDC 2FFDB 5AW6B 4HB1A 2P1JA 5DJUB 1NYHA 4M3LA 2ZYDA 2WSCH 3U1CA 1GU4A 3USSA 4GDOA 4AYCA 1P84I 3W67A 1ZR4A 5KLVG 2Y9YA 1QX8A 2G8YA 3TGUD 1JO5A 1EZVG 2E74C 2LKMA 2J5UA 3M06A 1GK6A 3VOPA 3H1HG 3Q5RA 1JCDA 4PD4H 1VQKP 1PP9G 4WY4B 3GMAA 3MD0A 1KQLA 1NTZE 2OTJP 3D71A 3GHGC 4ASVA 2KUBA 2DW3A 2MKVA 3KZIH 1PGPA 1SQVE 3CWBG 3EWKA 2PGDA 2FYUK 2QJYB 2B89A 3KDPB 3HD7B 1KILC 4YTPC 3Q2YA 2KLVA 1K9MQ 2E76B 2R3CA 3VTPC 2Q5UA 5APTA 2N9BA 2SPZA 3VMAA 4L75A 2B9BA 3CX5H 3AE4C 3L71D 1WRGA 2KIKA 3H25A 1LT1A 1AV1A 2KXPB 1VQ7P 1VQ6P 3H1LD 1N7SA 3BCCJ 3TYYA 1ZOYC 3PLNA 3V2NA 2IBZD 3PTZA 2WVRA 3C9IA 3AEFC 2B87B 1NTMD 5KLIC 2FYUD 2Z5HA 1SQVK 3AEEC 3L35A 4IFMA 1WMKA 1YYCA 2WPRA 4H44D 4NPDA 1L4AB 1M1JA 1KILA 3BCCD 4PD4D 2AEFA 3MZWB 1PFIA 3VMXA 1HWTC 1EQ7A 1SQBG 2HFED 3CCMP 2W8ZA 4GKGA 1NU1E 2AXCA 1LWUB 3JCUH 3L71J 4W7ZA 1AFOA 2P58A 2FYUJ 1KB9H 2WSEJ 1MUUA 1K73Q 1IFMA 1GL2B 1EDIA 1T8ZA 4C46A 1FOSF 2C9LY 4EI2A 2AEJA 1KILB 1L0NE 4OWFA 1Q90D 1M1JC 1HTLC 3UIAA 1EZVI 2XNDH 2W90A 1ZLLA 2KS1B 1N2DC 1N7SD 5B5EH 1LTTC 2E5YA 1S72P 1CSBA 1N7SC 1ZRTD 1NU1D 3AE2C 3IF4A 4YPCA 3A7OA 3P8CE 1M7LA 5AW3B 3RK3B 4B86A 1K05A 3H1HD 3CCUP 3IN6A 4DOJA 2KZIA 2YXRB 4PD4E 2HODB 2H88C 3MGNA 1HBWA 1G1IA 3FX0A 3SFDC 3PP5A 1NTME 1KB9E 2FBWC 5H2FE 5CBOA 3CCRP 2ZXEB 2QVAA 1A02F 4PJ0H 1IFIA 1OVUA 2W83C 3B71A 4U7JA 3CX5D 3EFFK 4K3AA 4WB4A 1FDMA 3GHGA 4ZNCA 3L73J 5AVVB 2K3RA 1KMIZ 3B5NA 4Y99B 3CCQP 2OYIC 1GDTA 1J2JB 3VMZA 3CWBE 1GK4A 5K5GB 1DD3A 1PPJD 1PGJA 1VQ4P 3N7NA 1D7MA 3IFMA 3L75J 5B5EE 1QGKB 1N73C 1DH3A 5EFWB 1IFPA 1OZHA 1SQQD 4ZMDA 1SQVD 2QJYC 1JY2P 2ITAA 3L74D 4O9BA 1JUNA 2PFXA 5H2FH 1HGZA 1BE3E 3HE5A 3OJAB 3WU2H 1JY3N 2Q1KA 1E5WA 1SQXK 1KN7A 2BCCG 2M3EA 2FXOA 1FZBA 5APVA 3M0AA 1L4AA 1M1JB 1SP4A 3KHUA 1NU1K 1X22A 3C8VA 2RMZA 5AVZB 1SQVJ 3L70J 1IFNA 1FZCB 2ZT9D 2WITA 4WY4C 3IR9A 4QMAA 3ZDMA 4GIFA 1U7MA 2BCCE 3L75E 3PJSK 4PJ0E 4UB8E 1L0NK 1S2EA 1EDJA 1SQXD 5GTHH 3L73G 2YIUB 3L74J 1SQPG 1SS1A 5C39A 1PP9E 1RE3A 1L0NG 2K1AA 2I1JA 2UWJE 1X8YA 3RL0C 3TDKA 2A45H 2KS1A 2P10A 4EIJA 5KLVE 2XKMA 5CBNA 1FZGA 2O1JA 4JQ0D 2YKPA 3L75G 3M0DA 3PH0A 4UB8H 1QLED 2KNCA 2O3JA 1HH0A 5APWA 5AVTB 4KHXA 3H1JE 2NPSB 2GA1A 2HG5D 3KZIE 1FZFA 1SFCB 1HUCA 1L4AD 1EZVD 1NTMK 2V7QJ 1NU1J 2OYOA 4K35A 4XA4A 4N78E 1Q2NA 1URQA 3E1IA 1S5LH 2WSSH 2WT7A 3V5BA 1YJ9P 1FOSE 1OWAA 3NMDA 5KAFE 1NTMG 2GUVA 3U59A 3V2PA 1BGYE 1NGMB 3H1HJ 2WZ7A 2A06D 1SQBJ 2QG4A 4OGQC 3TK1A 4DJGA 3S4RA 1OXZA 2AEMA 1LJ2A 2NZ2A 1URQD 1NTKG 2K9JA 3AE8C 3NXSA 4I6MC 5AW1B 2C9NY 5GTIE 1JEKA 3G71P 1YIJP 1YI2P 1VQOP 1M1KQ 2E74B 1K04A 2Y0DA 4NPFX 2KSJA 1IK7A 4MN4C 5AVYB 1J1EB 3T97B 1Y9BA 1BGYD 3FWLA 3M9QA 1NJIQ 1CI6A 1NTZG 1NTKE 1PIXA 1RF0C 2LR2A 3FWNA 3GG2A 5AVUB 3RK3D 2WMMA 5GTIH 1HF9A 1SQVG 1NTMJ 2IFNA 1JB0J 2E75B 3CCLP 3A3YB 4IL6X 3W68A 1JY3O 2E76C 2QIWA 3AE6C 4H44B 3H1LJ 1BGYJ 2BEZF 2OYIA 3TF5A 1SQBE 4ASWA 2QM8A 3L37A 4H13C 3WUTA 5TISH 3TSIA 1FDOA 1LTJC 1N7LA 3EQ2A 2IYOA 3BVHA 3G9RA 5CCGD 1T2KD 2WPSA 1BDDA 4JPZB 2ZVNB 2BEQD 2N1TB 1N86A 3AE3C 1SFCA 5B66H 3A0HE 4H0LD 1IJDB 1P84D 2KSEA 3CCSP 5AVRB 1NVOA 2YMYA 2ZYGA 4PV1C 1RF1A 2KNCB 5BU8B 2ZYAA 3TNUB 2OQQA 3F89A 2D2CC 3TGUJ 1U57A 4JYBA 1VQMP 1OX3A 1VPCA 2N1TA 1S3JA 2NPSA 3I5CA 4BWNA 3L70E 3CC2P 3CMEP 2FY8A 3CCJP 3E7KA 1NH4A 1RHZB 2YKQA 4HKZH 5AW4B 2BCCJ 4U3FE 1Q86Q 1U7JA 1HJ0A 1KZUB 1NTKD 1YBKA 2HPCB 4W80A 1GZLA 1RE4C 1FC2C 1T3UA 1T3JA 2K9YA 2QE7H 3L74E 1PGOA 3QWOC 1PP9J 3CD6P 1OW8A 2C0WA 1PPJG 2L5GB 2PAJA 5CJ0A 1MFTA 1SQQK 3RL0g 3BRTB 1KILE 2E74D 3F5HA 1HJBA 2WSFH 3CC4P 1EXJA 1PV3A 5AW8B 2I8DA 2QA4P 2NPSC 2GM4A 1OW6A 3HD7C 4H0LB 3L74G 2A06E 4JYCA 3NTNA 2PP6A 2M5AA 1SVFA 3L72D 3P7KA 3R2PA 2P7JA 1AA0A 1LWUA 1JTHA 4R4LA 5AW2B 2NPSD 1ZR2A 2IFMA 1S5LX 1NKZB 1IK9A 1RY3A 3B5ND 3MIWA 2KOGA 2PRRA 2WPVB 4N78D 4U3FJ 1R5SA 1EZVE 1AJYA 1SQBK 1NTZK 1JMBA 3G3ZA 3H1JJ 1MFZA 1FS0E 1TU3F 2XZRA 3ABVC 3H1HE 3H1KJ 2FKWB 3KPEA 1HVVA 3R4YA 5CMZA 3HTKB 2FXPA 4PV1D 1YTZI 1N73A 1J1DC 2ZT9B 2H43A 1J1DB 2ZT9C 1VDFA 1LTJA 3CXHH 5KLVK 5KAIH 1AQTA 3D6ZA 1BE3G 1W2EA 1GTWA 3A0BE 3HD7D 3A2AA 2KB7P 1KQGB 1L0ND 1USEA 1N73B 2K88A 2A06G 2J59M 2O01N 2IX7C 3GF7A 3L75D 3VP9A 4N3YB 2Y0EA 3BATA 4IOIH 1LP1B 2FFDA 2HR3A 2O01J 4JBZA 3TNUA 3AECC 1NAFA 4H0LC 3MUDC 3H32B 2E75D 3B5NB 3L4FA 5KJ7D 3PRJA 3AE5C 3SFEC 2Q9IA 2OYHC 1IC2A 2E75C 1CW5A 1H8AA 1KQSO 2MJZA 2XU6A 2FYUE 2Q3EA 2IPPA 1BE3D 3AE9C 3GF3A 1BCCD 3OA7A 5AVQB 3VP8A 3LW5J 4C7NB 2WWWA 3CX5I 3Q1MA 2W27A 3H1LE 3MTUE 1WT6A 2HPCA 2D2CD 1RH5B 1ZMEC 2OTLP 3H32A 2D2CB 4RESB 4DZOA 1SQQE 2OARA 1BSHA 3HE5B 1URQB 2JKVA 1URQC 2R3SA 1VQNP 1PPJE 1YITP 1QVGO 1LT9A 2FYZA 4EDFA 2CK3H 1H0TB 1NWQA 4Z1MH 1KQFB 1IFDA 5B66E 1N7SB 1ZV8A 1MKMA 1NTZD 3CX5E 3HUSC 1ZW0A 4IL6E 1PL5A 2O1KA 3H1IJ 4D6TD 1QVFO 4DCKA 1LTGC 1LT9C 4L74A 1KB9D 1L0LJ 2POHA 1LNQA 1SFCD 2B87A 4EYYQ 1VQ5P 4H13B 1N8RQ 3TGUE 3RK2D 5KKZB 3BCCG 1Q81Q 2QEXP 4LGDE 4AQRD 1JMMA 2W6BA 3P8CD 1JY2O 2C0XA 4TT3H 2CPBA 5AW9B 3CPWO 1IO4A 1KYOD 4CPGA 4IL6H 4D6TJ 3AEBC 2J58A 1KYOH 1L4AC 1XTGB 4KJMA 3M9BA 2Z4EA 2OYHA 3SWYA 3V6IA 1LTAC 4BRYB 2V4HA 5KLIB 2O01H 4W7YA 1IFJA 3M91A 1BE3J 1LP1A 1YQ3C 2P67A 2RH0A 5APUA 1W2BO 1KD1Q 1GU5A 1EXIA 4GOFA 1OMIA 4GT1A 1YJNP 1JY2N 1UIIA 2E42A 5BU5A 5CCGA 3WMM0 3GW6A 1BCCG 2YMKA 2HODA 3BCCE 1NOHA 2K9JB 1SQPD 3CI9A 3KXDA 1M8OB 1MV8A 3RK2B 3H1IG 5KJ7C 2ZXXA 2H7HA 3CLQA 4U3FG 1X9VA 2IBZE 4RKUJ 3B4SA 3A0HH 3B5NC 2XNXA 1OVRA 2R44A 3GHGB 2YO3A 4R4MA 4OVNF 4WY4D 3C1LA 1GW4A 3HUSB 4D6TE 2WSCJ 5APQA 1NKNA 1DEBA 2KK7A 1KFNA 4I7ZB 1NAYA 5KAFH 1IZNB 3L71E 2N1TD 2QJKC 4XFJA 1QL1A 3AE7C 3LIEA 3RK2C 3TGUG 1OVVA 1VL2A 4GOEA 5TISE 3KYQA 4D6TG 4IFDK 1DIPA 1AQ5A 2P2UA 4HYTB 3S1KA 3VMYA 2A45I 3L72G 1J1EC 2VRSA 3LW5H 4I2LC 1JNMA 3RBZA 3GLMA 3MP7B 3G6EP 3HD7A 1BCCE 4U3FD 2XV5A 5CHXA 3IAOA 2K37A 1FDIA 1OW7A 2NRGA 2YIUC 3L70D 3SWFA 1PZQA 5KTBA 5TJHA 3H1KD 3RK3C 3HE4B 4I7ZC 3AEGC 4YXWH 1KC8Q 1YJWP 1BGYG 2Q3IA 2QJPB 3L36A 5KJ7A 1RF1B 3JC22 5DJTB 3WUUA 1P84E 2JJLA 1YHQP 2FYUG 2QJKB 3V2QA 4OH8B 1XTCC 2ZJSE 3L73D 1SLQA 1NTKJ 2KZJA 1LTSC 2IZ1A 3CWBJ 3H1IE 2JO1A 3BRVB 1FAVA 1LTJB 1EC5A 2AXTE 1LWUC 2QJPC 3N4XA 5AVSB 1SQPJ 2A45G 2M8RA 3V4WA 1RF1C 3H1KG 2H89C 2YXQB 3CCEP 1QEXA 2JP3A 2RKLA 1G2CB 1FU1A 3RGUA 2IYPA 1R8EA 1QL2A 3II6A 3K5BA 2ZFCA 1G1JA 3JSVC 3V2RA 3CXHD 3I56P 4HH2A 1L0LE 1VQLP 2G3AA 2R32A 1ZP0C 1JCCA 2GUSA 1Z56A 2IDBA 1CZQA 2XDJA 2YNYA 1KYOI 4PV1B 1E79H 1NHLA 2M3BA 4NPEA 1Y8AA 3L72E 1RE4A 2Y0CA 4OGQB 4OGQD 1MZ9A 2M5AB 5GTHE 1S9KD 2Q6QA 1S4XA 5AW5B 3HRNA 5KKZC 1KILD 1NTKK 4JF7A 2E5TA 3CL3D 3NFQA 2CPSA 2V7QH 4UB6H 3AEAC 1KB9I 2HLOA 2JWDA 2N1TC 1H0TA 4IFFA 1PGQA 1HGVA 3BASA 1CI6B 4RO0A 4WVZA 3T97A 1R5LA 3WUVA 3H1LG 3HTKA 3P8MC 5KLVJ 3Q5PA 1KORA 4C7RA 1VQ8P 5M1BA 3H1JG 1Q82Q 1L0LD 2LXCB 2ZAEB 3CXHE 2QRXA 1GL2A 5APXA 2I1KA 5CJ4A 1SFCC 1X0TA 2OGUA 2WTYA 1NTZJ 1JOCA 1GW3A 3EFGA 4H44C 3HE4A 4Y99C 4DT0A 4ZKUA 2OYIB 2JR8A 1OIPA 5AW7B 1H88A 2ZVOB 3Q3DA 1M90Q 3A5TA 3CMAP 2BASA 2FXMA 1LTIC 3B8EB 1L2PA 1AVOA 1GL2D 3AEDC 4LLHA 1FZEA 4EOTA 3H1ID 1BDCA 5KLVD 2W6AA 4PD4I 3SSUA 2RN0A 2JEEA 2E43A 1G2CA 1BSNA 2IBZG 2WPQA 3QH9A 1KV4A 5CCGC 1LTBC 4L73A 5AVWB 1Q7YQ 1FZCA 1FJPA 1FE6A 1L0LG 2IBZI 2YKOA 1BCCJ 3VN0A 5CCHA 2OTKE 3D6YA 1P84H 1RF0A 1NU1G 3ITKA 4XE5B 1SQBD 4TLFA 4WWIA 3H1KE 1ZN5A 1DEEG 2HYNA 3CC7P 1OFCX 1SQXG 5BVZA 3OAKA 4LC1A 5CCHD 3SWKA 3D70A 2JWAA 2KLUA 3P32A 2KYVA 1VQPP 1LT9B 2KI7B 3FXEA 3RK3E 4Y28J 1L0LK 3O6QB 4RJTA 4I1LA 4WY4A 1T2KC 2R5DA 4UB6E 1FZAA 1NO4A 1L0NJ 3A0BH 3RL0B 4YXDC 3I55P 1YTZT 1AVYA 2FYNB 2W6JH 3RBXA 1EDLA 3CXHI 3L71G 2QM7A 3H6PA 1VF5D 5L8RJ 2WQYC 2Z5IA 1USDA 1VF5B 5AW0B 2N9YB 3VYIA 1VF5C 5E79E 2WT7B 3CCVP 2E76D 2WSFJ 4N6JA 4GODA 3CWBD 1FBMA 3JCUE 3LIDA 1Y47A 4WBAA 1K8AQ 2FYNC 3O6QA 1X79B 1EDKA 1DD4A 1JM0A 2LXBA 2B88A 3HUSA 1SQXJ 1S9KE 1DX7A 2JDIH 3E1RA 3MHVA 1VQ9P 3M0DC 2YO2A 1JTHB 2KP8A 2WSEH 5CCHC 1RQUA 3Q5SA 1KTMA 2AXTH 1W5CE 4H13D 3O8ZA 1GD2E 2Y9ZA 1FZCC 1SQPE 5AVXB 4C7NA 3L70G 1RE3C 4HJGH 1H89A 1M57D 1LGHB 3H1JD 2OYHB 2QSIA 1SQQJ 4BRYA 3OW2O 1GMJA 3G4SP 1ZRTE 3M9HA 4L76A 3WU2E 1S1CX 1ZXGA 4KT0J 4AUWA 1M56D 2M0BA 2IZ0A 3AE1C 1SQQG 3RL0D 1S5LE 3FGAD 5APYA 5APSA 1RQVA 3L72J 4A7PA 1PP9D 5E79H 4ZKPA 1UIXA 3L73E 1FJKA 2H8PD 3PHLA 1SQXE 2L91A 1SQPK 3MUDA 1GL2C 3U1AA 1A02J 1JY3P 4BXLA 1YQ4C 1KFMA 1T6AA
chains in the Genus database with same CATH topology
2R5BA 2Q7CA 2FFDC 3KQGA 3V4QA 2FFDB 5AW6B 2P1JA 4M3LA 3U1CA 2WSCH 1GU4A 4AYCA 1ZR4A 1JO5A 2LKMA 3M06A 1GK6A 3VOPA 1JCDA 4WY4B 3MD0A 1KQLA 3GHGC 2FYUK 3KDPB 3HD7B 1KILC 2KLVA 2R3CA 3VTPC 2Q5UA 5APTA 2N9BA 1WRGA 1N7SA 3TYYA 3V2NA 3C9IA 2Z5HA 1SQVK 3L35A 4IFMA 4C7NB 1YYCA 2WPRA 1GDTA 1L4AB 1M1JA 1KILA 1PFIA 3VMXA 1HWTC 1EQ7A 2HFED 4GKGA 4W7ZA 1AFOA 1LWUB 1MUUA 1IFMA 1GL2B 1T8ZA 1FOSF 4C46A 2C9LY 1KILB 1M1JC 1HTLC 3UIAA 1ZLLA 1N2DC 1N7SD 1LTTC 1CSBA 1N7SC 3A7OA 3P8CE 1M7LA 5AW3B 3RK3B 4B86A 4DOJA 2HODB 3MGNA 1HBWA 1G1IA 3PP5A 2ZXEB 1A02F 1IFIA 1FDMA 4WB4A 3GHGA 5AVVB 3B5NA 4Y99B 2OYIC 1J2JB 3VMZA 1GK4A 3N7NA 3IFMA 1DH3A 1JY2P 4O9BA 1JUNA 1HGZA 3HE5A 3OJAB 1JY3N 1E5WA 1SQXK 1FZBA 5APVA 3M0AA 1L4AA 1M1JB 1SP4A 1NU1K 5AVZB 1IFNA 1FZCB 2WITA 4WY4C 3IR9A 4GIFA 1L0NK 1RE3A 2I1JA 3RL0C 1X8YA 2A45H 4EIJA 1FZGA 2XKMA 2O1JA 2YKPA 3M0DA 1HH0A 5APWA 5AVTB 4KHXA 2NPSB 2HG5D 1FZFA 1SFCB 1HUCA 1L4AD 1NTMK 4XA4A 4N78E 1URQA 3E1IA 2WT7A 1FOSE 3V5BA 1OWAA 3NMDA 2GUVA 3U59A 3V2PA 2WZ7A 3TK1A 1OXZA 1URQD 3NXSA 4I6MC 5AW1B 2C9NY 2KSJA 5AVYB 1J1EB 3M9QA 1CI6A 1RF0C 5AVUB 3RK3D 2IFNA 3A3YB 1JY3O 2OYIA 2QM8A 3L37A 3TSIA 1LTJC 1N7LA 3EQ2A 3BVHA 5CCGD 1T2KD 2WPSA 2N1TB 1N86A 1SFCA 1IJDB 5AVRB 1RF1A 2YMYA 5BU8B 3TNUB 4JYBA 1VPCA 2N1TA 2NPSA 3I5CA 1NH4A 2YKQA 5AW4B 1KZUB 2HPCB 4W80A 1GZLA 1RE4C 1T3UA 1T3JA 2C0WA 2L5GB 2PAJA 5CJ0A 1SQQK 3BRTB 1HJBA 2WSFH 5AW8B 2GM4A 2NPSC 3HD7C 4JYCA 3NTNA 2PP6A 1SVFA 3P7KA 3R2PA 2P7JA 1LWUA 1JTHA 5AW2B 2NPSD 1ZR2A 2IFMA 3B5ND 1NKZB 1IK9A 1RY3A 3MIWA 2KOGA 4N78D 1SQBK 1NTZK 3G3ZA 1MFZA 2XZRA 2FKWB 3KPEA 1HVVA 5CMZA 1N73A 3HTKB 1YTZI 1J1DC 1J1DB 1VDFA 1LTJA 5KLVK 1W2EA 1GTWA 3HD7D 3A2AA 2KB7P 1N73B 2J59M 2IX7C 3VP9A 4N3YB 3BATA 2FFDA 3TNUA 1NAFA 3H32B 3L4FA 3B5NB 5KJ7D 2OYHC 2Q9IA 1IC2A 1H8AA 2MJZA 2XU6A 5AVQB 2IPPA 3VP8A 3OA7A 2WWWA 2HPCA 2W27A 3MTUE 1WT6A 3H32A 4RESB 4DZOA 2OARA 3HE5B 1URQB 1URQC 1LT9A 2FYZA 1NWQA 1IFDA 1N7SB 1ZV8A 3HUSC 5AW5B 1CW5A 2O1KA 1LTGC 1LT9C 2POHA 1SFCD 3RK2D 4LGDE 4AQRD 1JMMA 2W6BA 3P8CD 1JY2O 2C0XA 2CPBA 5AW9B 1IO4A 2J58A 1L4AC 1XTGB 3M9BA 2Z4EA 2OYHA 3SWYA 1LTAC 2O01H 4W7YA 1IFJA 3M91A 5APUA 2P67A 1GU5A 4GT1A 1JY2N 2E42A 5BU5A 5CCGA 3WMM0 2HODA 1NOHA 3CI9A 1MV8A 3RK2B 2H7HA 3CLQA 1X9VA 3B5NC 2XNXA 3GHGB 2YO3A 4WY4D 1GW4A 3HUSB 1N73C 5APQA 1NKNA 1DEBA 1KFNA 2N1TD 1QL1A 3LIEA 3RK2C 4IFDK 3KYQA 1AQ5A 2P2UA 4HYTB 3VMYA 2A45I 1J1EC 2VRSA 3LW5H 4I2LC 1JNMA 3HD7A 2XV5A 5CHXA 3SWFA 5KTBA 3RK3C 3HE4B 2Q3IA 3L36A 5KJ7A 1RF1B 2JJLA 3V2QA 4OH8B 1XTCC 1SLQA 1LTSC 3BRVB 1FAVA 1LTJB 5AVSB 1LWUC 3N4XA 3V4WA 1RF1C 2A45G 2M8RA 1G2CB 1FU1A 1QL2A 3II6A 2ZFCA 1G1JA 3V2RA 4HH2A 2R32A 5AW0B 1JCCA 2GUSA 1Z56A 2YNYA 1CZQA 2XDJA 5KJ7C 1NHLA 2M3BA 1RE4A 1MZ9A 1S9KD 3HRNA 1KILD 1NTKK 4JF7A 3CL3D 3NFQA 2CPSA 2HLOA 2N1TC 4IFFA 3BASA 1HGVA 3T97A 1CI6B 3HTKA 3P8MC 4C7RA 1GL2A 5APXA 2I1KA 5CJ4A 1SFCC 2WTYA 1JOCA 1GW3A 3EFGA 4Y99C 3HE4A 4ZKUA 2OYIB 5AW7B 1H88A 3A5TA 2BASA 2FXMA 1LTIC 3B8EB 1GL2D 4EOTA 4LLHA 1FZEA 2W6AA 2JEEA 2E43A 1G2CA 2WPQA 5CCGC 1LTBC 1FZCA 5AVWB 1FJPA 2YKOA 3VN0A 5CCHA 1RF0A 4XE5B 1ZN5A 2HYNA 5BVZA 3OAKA 4LC1A 5CCHD 3P32A 2KYVA 1LT9B 2H43A 1T2KC 1L0LK 4I1LA 4WY4A 2R5DA 1FZAA 1NO4A 3RL0B 1YTZT 2QM7A 3H6PA 2Z5IA 3VYIA 2WT7B 4N6JA 3LIDA 1FBMA 4WBAA 1X79B 1S9KE 3HUSA 1DX7A 3M0DC 2YO2A 1JTHB 2KP8A 2WSEH 5CCHC 1GD2E 3O8ZA 1FZCC 5AVXB 4C7NA 1RE3C 1H89A 1LGHB 2OYHB 3M9HA 4AUWA 3RL0D 5APYA 5APSA 4ZKPA 1FJKA 2H8PD 1A02J 1SQPK 3MUDA 1GL2C 3U1AA 1JY3P 1KFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTT C;  1XTC C;  1HTL C;  1LTI C;  1LTB C;  1LTG C;  1LTA C;  1LTS C; 
#chains in the Genus database with same CATH topology
 2R5B A;  1KYO E;  2Q7C A;  2BCC D;  3FXD A;  5KAI E;  3S9O A;  3KQG A;  3V4Q A;  2FFD C;  2FFD B;  5AW6 B;  4HB1 A;  2P1J A;  5DJU B;  1NYH A;  4M3L A;  2ZYD A;  2WSC H;  3U1C A;  1GU4 A;  3USS A;  4GDO A;  4AYC A;  1P84 I;  3W67 A;  1ZR4 A;  5KLV G;  2Y9Y A;  1QX8 A;  2G8Y A;  3TGU D;  1JO5 A;  1EZV G;  2E74 C;  2LKM A;  2J5U A;  3M06 A;  1GK6 A;  3VOP A;  3H1H G;  3Q5R A;  1JCD A;  4PD4 H;  1VQK P;  1PP9 G;  4WY4 B;  3GMA A;  3MD0 A;  1KQL A;  1NTZ E;  2OTJ P;  3D71 A;  3GHG C;  4ASV A;  2KUB A;  2DW3 A;  2MKV A;  3KZI H;  1PGP A;  1SQV E;  3CWB G;  3EWK A;  2PGD A;  2FYU K;  2QJY B;  2B89 A;  3KDP B;  3HD7 B;  1KIL C;  4YTP C;  3Q2Y A;  2KLV A;  1K9M Q;  2E76 B;  2R3C A;  3VTP C;  2Q5U A;  5APT A;  2N9B A;  2SPZ A;  3VMA A;  4L75 A;  2B9B A;  3CX5 H;  3AE4 C;  3L71 D;  1WRG A;  2KIK A;  3H25 A;  1LT1 A;  1AV1 A;  2KXP B;  1VQ7 P;  1VQ6 P;  3H1L D;  1N7S A;  3BCC J;  3TYY A;  1ZOY C;  3PLN A;  3V2N A;  2IBZ D;  3PTZ A;  2WVR A;  3C9I A;  3AEF C;  2B87 B;  1NTM D;  5KLI C;  2FYU D;  2Z5H A;  1SQV K;  3AEE C;  3L35 A;  4IFM A;  1WMK A;  1YYC A;  2WPR A;  4H44 D;  4NPD A;  1L4A B;  1M1J A;  1KIL A;  3BCC D;  4PD4 D;  2AEF A;  3MZW B;  1PFI A;  3VMX A;  1HWT C;  1EQ7 A;  1SQB G;  2HFE D;  3CCM P;  2W8Z A;  4GKG A;  1NU1 E;  2AXC A;  1LWU B;  3JCU H;  3L71 J;  4W7Z A;  1AFO A;  2P58 A;  2FYU J;  1KB9 H;  2WSE J;  1MUU A;  1K73 Q;  1IFM A;  1GL2 B;  1EDI A;  1T8Z A;  4C46 A;  1FOS F;  2C9L Y;  4EI2 A;  2AEJ A;  1KIL B;  1L0N E;  4OWF A;  1Q90 D;  1M1J C;  1HTL C;  3UIA A;  1EZV I;  2XND H;  2W90 A;  1ZLL A;  2KS1 B;  1N2D C;  1N7S D;  5B5E H;  1LTT C;  2E5Y A;  1S72 P;  1CSB A;  1N7S C;  1ZRT D;  1NU1 D;  3AE2 C;  3IF4 A;  4YPC A;  3A7O A;  3P8C E;  1M7L A;  5AW3 B;  3RK3 B;  4B86 A;  1K05 A;  3H1H D;  3CCU P;  3IN6 A;  4DOJ A;  2KZI A;  2YXR B;  4PD4 E;  2HOD B;  2H88 C;  3MGN A;  1HBW A;  1G1I A;  3FX0 A;  3SFD C;  3PP5 A;  1NTM E;  1KB9 E;  2FBW C;  5H2F E;  5CBO A;  3CCR P;  2ZXE B;  2QVA A;  1A02 F;  4PJ0 H;  1IFI A;  1OVU A;  2W83 C;  3B71 A;  4U7J A;  3CX5 D;  3EFF K;  4K3A A;  4WB4 A;  1FDM A;  3GHG A;  4ZNC A;  3L73 J;  5AVV B;  2K3R A;  1KMI Z;  3B5N A;  4Y99 B;  3CCQ P;  2OYI C;  1GDT A;  1J2J B;  3VMZ A;  3CWB E;  1GK4 A;  5K5G B;  1DD3 A;  1PPJ D;  1PGJ A;  1VQ4 P;  3N7N A;  1D7M A;  3IFM A;  3L75 J;  5B5E E;  1QGK B;  1N73 C;  1DH3 A;  5EFW B;  1IFP A;  1OZH A;  1SQQ D;  4ZMD A;  1SQV D;  2QJY C;  1JY2 P;  2ITA A;  3L74 D;  4O9B A;  1JUN A;  2PFX A;  5H2F H;  1HGZ A;  1BE3 E;  3HE5 A;  3OJA B;  3WU2 H;  1JY3 N;  2Q1K A;  1E5W A;  1SQX K;  1KN7 A;  2BCC G;  2M3E A;  2FXO A;  1FZB A;  5APV A;  3M0A A;  1L4A A;  1M1J B;  1SP4 A;  3KHU A;  1NU1 K;  1X22 A;  3C8V A;  2RMZ A;  5AVZ B;  1SQV J;  3L70 J;  1IFN A;  1FZC B;  2ZT9 D;  2WIT A;  4WY4 C;  3IR9 A;  4QMA A;  3ZDM A;  4GIF A;  1U7M A;  2BCC E;  3L75 E;  3PJS K;  4PJ0 E;  4UB8 E;  1L0N K;  1S2E A;  1EDJ A;  1SQX D;  5GTH H;  3L73 G;  2YIU B;  3L74 J;  1SQP G;  1SS1 A;  5C39 A;  1PP9 E;  1RE3 A;  1L0N G;  2K1A A;  2I1J A;  2UWJ E;  1X8Y A;  3RL0 C;  3TDK A;  2A45 H;  2KS1 A;  2P10 A;  4EIJ A;  5KLV E;  2XKM A;  5CBN A;  1FZG A;  2O1J A;  4JQ0 D;  2YKP A;  3L75 G;  3M0D A;  3PH0 A;  4UB8 H;  1QLE D;  2KNC A;  2O3J A;  1HH0 A;  5APW A;  5AVT B;  4KHX A;  3H1J E;  2NPS B;  2GA1 A;  2HG5 D;  3KZI E;  1FZF A;  1SFC B;  1HUC A;  1L4A D;  1EZV D;  1NTM K;  2V7Q J;  1NU1 J;  2OYO A;  4K35 A;  4XA4 A;  4N78 E;  1Q2N A;  1URQ A;  3E1I A;  1S5L H;  2WSS H;  2WT7 A;  3V5B A;  1YJ9 P;  1FOS E;  1OWA A;  3NMD A;  5KAF E;  1NTM G;  2GUV A;  3U59 A;  3V2P A;  1BGY E;  1NGM B;  3H1H J;  2WZ7 A;  2A06 D;  1SQB J;  2QG4 A;  4OGQ C;  3TK1 A;  4DJG A;  3S4R A;  1OXZ A;  2AEM A;  1LJ2 A;  2NZ2 A;  1URQ D;  1NTK G;  2K9J A;  3AE8 C;  3NXS A;  4I6M C;  5AW1 B;  2C9N Y;  5GTI E;  1JEK A;  3G71 P;  1YIJ P;  1YI2 P;  1VQO P;  1M1K Q;  2E74 B;  1K04 A;  2Y0D A;  4NPF X;  2KSJ A;  1IK7 A;  4MN4 C;  5AVY B;  1J1E B;  3T97 B;  1Y9B A;  1BGY D;  3FWL A;  3M9Q A;  1NJI Q;  1CI6 A;  1NTZ G;  1NTK E;  1PIX A;  1RF0 C;  2LR2 A;  3FWN A;  3GG2 A;  5AVU B;  3RK3 D;  2WMM A;  5GTI H;  1HF9 A;  1SQV G;  1NTM J;  2IFN A;  1JB0 J;  2E75 B;  3CCL P;  3A3Y B;  4IL6 X;  3W68 A;  1JY3 O;  2E76 C;  2QIW A;  3AE6 C;  4H44 B;  3H1L J;  1BGY J;  2BEZ F;  2OYI A;  3TF5 A;  1SQB E;  4ASW A;  2QM8 A;  3L37 A;  4H13 C;  3WUT A;  5TIS H;  3TSI A;  1FDO A;  1LTJ C;  1N7L A;  3EQ2 A;  2IYO A;  3BVH A;  3G9R A;  5CCG D;  1T2K D;  2WPS A;  1BDD A;  4JPZ B;  2ZVN B;  2BEQ D;  2N1T B;  1N86 A;  3AE3 C;  1SFC A;  5B66 H;  3A0H E;  4H0L D;  1IJD B;  1P84 D;  2KSE A;  3CCS P;  5AVR B;  1NVO A;  2YMY A;  2ZYG A;  4PV1 C;  1RF1 A;  2KNC B;  5BU8 B;  2ZYA A;  3TNU B;  2OQQ A;  3F89 A;  2D2C C;  3TGU J;  1U57 A;  4JYB A;  1VQM P;  1OX3 A;  1VPC A;  2N1T A;  1S3J A;  2NPS A;  3I5C A;  4BWN A;  3L70 E;  3CC2 P;  3CME P;  2FY8 A;  3CCJ P;  3E7K A;  1NH4 A;  1RHZ B;  2YKQ A;  4HKZ H;  5AW4 B;  2BCC J;  4U3F E;  1Q86 Q;  1U7J A;  1HJ0 A;  1KZU B;  1NTK D;  1YBK A;  2HPC B;  4W80 A;  1GZL A;  1RE4 C;  1FC2 C;  1T3U A;  1T3J A;  2K9Y A;  2QE7 H;  3L74 E;  1PGO A;  3QWO C;  1PP9 J;  3CD6 P;  1OW8 A;  2C0W A;  1PPJ G;  2L5G B;  2PAJ A;  5CJ0 A;  1MFT A;  1SQQ K;  3RL0 g;  3BRT B;  1KIL E;  2E74 D;  3F5H A;  1HJB A;  2WSF H;  3CC4 P;  1EXJ A;  1PV3 A;  5AW8 B;  2I8D A;  2QA4 P;  2NPS C;  2GM4 A;  1OW6 A;  3HD7 C;  4H0L B;  3L74 G;  2A06 E;  4JYC A;  3NTN A;  2PP6 A;  2M5A A;  1SVF A;  3L72 D;  3P7K A;  3R2P A;  2P7J A;  1AA0 A;  1LWU A;  1JTH A;  4R4L A;  5AW2 B;  2NPS D;  1ZR2 A;  2IFM A;  1S5L X;  1NKZ B;  1IK9 A;  1RY3 A;  3B5N D;  3MIW A;  2KOG A;  2PRR A;  2WPV B;  4N78 D;  4U3F J;  1R5S A;  1EZV E;  1AJY A;  1SQB K;  1NTZ K;  1JMB A;  3G3Z A;  3H1J J;  1MFZ A;  1FS0 E;  1TU3 F;  2XZR A;  3ABV C;  3H1H E;  3H1K J;  2FKW B;  3KPE A;  1HVV A;  3R4Y A;  5CMZ A;  3HTK B;  2FXP A;  4PV1 D;  1YTZ I;  1N73 A;  1J1D C;  2ZT9 B;  2H43 A;  1J1D B;  2ZT9 C;  1VDF A;  1LTJ A;  3CXH H;  5KLV K;  5KAI H;  1AQT A;  3D6Z A;  1BE3 G;  1W2E A;  1GTW A;  3A0B E;  3HD7 D;  3A2A A;  2KB7 P;  1KQG B;  1L0N D;  1USE A;  1N73 B;  2K88 A;  2A06 G;  2J59 M;  2O01 N;  2IX7 C;  3GF7 A;  3L75 D;  3VP9 A;  4N3Y B;  2Y0E A;  3BAT A;  4IOI H;  1LP1 B;  2FFD A;  2HR3 A;  2O01 J;  4JBZ A;  3TNU A;  3AEC C;  1NAF A;  4H0L C;  3MUD C;  3H32 B;  2E75 D;  3B5N B;  3L4F A;  5KJ7 D;  3PRJ A;  3AE5 C;  3SFE C;  2Q9I A;  2OYH C;  1IC2 A;  2E75 C;  1CW5 A;  1H8A A;  1KQS O;  2MJZ A;  2XU6 A;  2FYU E;  2Q3E A;  2IPP A;  1BE3 D;  3AE9 C;  3GF3 A;  1BCC D;  3OA7 A;  5AVQ B;  3VP8 A;  3LW5 J;  4C7N B;  2WWW A;  3CX5 I;  3Q1M A;  2W27 A;  3H1L E;  3MTU E;  1WT6 A;  2HPC A;  2D2C D;  1RH5 B;  1ZME C;  2OTL P;  3H32 A;  2D2C B;  4RES B;  4DZO A;  1SQQ E;  2OAR A;  1BSH A;  3HE5 B;  1URQ B;  2JKV A;  1URQ C;  2R3S A;  1VQN P;  1PPJ E;  1YIT P;  1QVG O;  1LT9 A;  2FYZ A;  4EDF A;  2CK3 H;  1H0T B;  1NWQ A;  4Z1M H;  1KQF B;  1IFD A;  5B66 E;  1N7S B;  1ZV8 A;  1MKM A;  1NTZ D;  3CX5 E;  3HUS C;  1ZW0 A;  4IL6 E;  1PL5 A;  2O1K A;  3H1I J;  4D6T D;  1QVF O;  4DCK A;  1LTG C;  1LT9 C;  4L74 A;  1KB9 D;  1L0L J;  2POH A;  1LNQ A;  1SFC D;  2B87 A;  4EYY Q;  1VQ5 P;  4H13 B;  1N8R Q;  3TGU E;  3RK2 D;  5KKZ B;  3BCC G;  1Q81 Q;  2QEX P;  4LGD E;  4AQR D;  1JMM A;  2W6B A;  3P8C D;  1JY2 O;  2C0X A;  4TT3 H;  2CPB A;  5AW9 B;  3CPW O;  1IO4 A;  1KYO D;  4CPG A;  4IL6 H;  4D6T J;  3AEB C;  2J58 A;  1KYO H;  1L4A C;  1XTG B;  4KJM A;  3M9B A;  2Z4E A;  2OYH A;  3SWY A;  3V6I A;  1LTA C;  4BRY B;  2V4H A;  5KLI B;  2O01 H;  4W7Y A;  1IFJ A;  3M91 A;  1BE3 J;  1LP1 A;  1YQ3 C;  2P67 A;  2RH0 A;  5APU A;  1W2B O;  1KD1 Q;  1GU5 A;  1EXI A;  4GOF A;  1OMI A;  4GT1 A;  1YJN P;  1JY2 N;  1UII A;  2E42 A;  5BU5 A;  5CCG A;  3WMM 0;  3GW6 A;  1BCC G;  2YMK A;  2HOD A;  3BCC E;  1NOH A;  2K9J B;  1SQP D;  3CI9 A;  3KXD A;  1M8O B;  1MV8 A;  3RK2 B;  3H1I G;  5KJ7 C;  2ZXX A;  2H7H A;  3CLQ A;  4U3F G;  1X9V A;  2IBZ E;  4RKU J;  3B4S A;  3A0H H;  3B5N C;  2XNX A;  1OVR A;  2R44 A;  3GHG B;  2YO3 A;  4R4M A;  4OVN F;  4WY4 D;  3C1L A;  1GW4 A;  3HUS B;  4D6T E;  2WSC J;  5APQ A;  1NKN A;  1DEB A;  2KK7 A;  1KFN A;  4I7Z B;  1NAY A;  5KAF H;  1IZN B;  3L71 E;  2N1T D;  2QJK C;  4XFJ A;  1QL1 A;  3AE7 C;  3LIE A;  3RK2 C;  3TGU G;  1OVV A;  1VL2 A;  4GOE A;  5TIS E;  3KYQ A;  4D6T G;  4IFD K;  1DIP A;  1AQ5 A;  2P2U A;  4HYT B;  3S1K A;  3VMY A;  2A45 I;  3L72 G;  1J1E C;  2VRS A;  3LW5 H;  4I2L C;  1JNM A;  3RBZ A;  3GLM A;  3MP7 B;  3G6E P;  3HD7 A;  1BCC E;  4U3F D;  2XV5 A;  5CHX A;  3IAO A;  2K37 A;  1FDI A;  1OW7 A;  2NRG A;  2YIU C;  3L70 D;  3SWF A;  1PZQ A;  5KTB A;  5TJH A;  3H1K D;  3RK3 C;  3HE4 B;  4I7Z C;  3AEG C;  4YXW H;  1KC8 Q;  1YJW P;  1BGY G;  2Q3I A;  2QJP B;  3L36 A;  5KJ7 A;  1RF1 B;  3JC2 2;  5DJT B;  3WUU A;  1P84 E;  2JJL A;  1YHQ P;  2FYU G;  2QJK B;  3V2Q A;  4OH8 B;  1XTC C;  2ZJS E;  3L73 D;  1SLQ A;  1NTK J;  2KZJ A;  1LTS C;  2IZ1 A;  3CWB J;  3H1I E;  2JO1 A;  3BRV B;  1FAV A;  1LTJ B;  1EC5 A;  2AXT E;  1LWU C;  2QJP C;  3N4X A;  5AVS B;  1SQP J;  2A45 G;  2M8R A;  3V4W A;  1RF1 C;  3H1K G;  2H89 C;  2YXQ B;  3CCE P;  1QEX A;  2JP3 A;  2RKL A;  1G2C B;  1FU1 A;  3RGU A;  2IYP A;  1R8E A;  1QL2 A;  3II6 A;  3K5B A;  2ZFC A;  1G1J A;  3JSV C;  3V2R A;  3CXH D;  3I56 P;  4HH2 A;  1L0L E;  1VQL P;  2G3A A;  2R32 A;  1ZP0 C;  1JCC A;  2GUS A;  1Z56 A;  2IDB A;  1CZQ A;  2XDJ A;  2YNY A;  1KYO I;  4PV1 B;  1E79 H;  1NHL A;  2M3B A;  4NPE A;  1Y8A A;  3L72 E;  1RE4 A;  2Y0C A;  4OGQ B;  4OGQ D;  1MZ9 A;  2M5A B;  5GTH E;  1S9K D;  2Q6Q A;  1S4X A;  5AW5 B;  3HRN A;  5KKZ C;  1KIL D;  1NTK K;  4JF7 A;  2E5T A;  3CL3 D;  3NFQ A;  2CPS A;  2V7Q H;  4UB6 H;  3AEA C;  1KB9 I;  2HLO A;  2JWD A;  2N1T C;  1H0T A;  4IFF A;  1PGQ A;  1HGV A;  3BAS A;  1CI6 B;  4RO0 A;  4WVZ A;  3T97 A;  1R5L A;  3WUV A;  3H1L G;  3HTK A;  3P8M C;  5KLV J;  3Q5P A;  1KOR A;  4C7R A;  1VQ8 P;  5M1B A;  3H1J G;  1Q82 Q;  1L0L D;  2LXC B;  2ZAE B;  3CXH E;  2QRX A;  1GL2 A;  5APX A;  2I1K A;  5CJ4 A;  1SFC C;  1X0T A;  2OGU A;  2WTY A;  1NTZ J;  1JOC A;  1GW3 A;  3EFG A;  4H44 C;  3HE4 A;  4Y99 C;  4DT0 A;  4ZKU A;  2OYI B;  2JR8 A;  1OIP A;  5AW7 B;  1H88 A;  2ZVO B;  3Q3D A;  1M90 Q;  3A5T A;  3CMA P;  2BAS A;  2FXM A;  1LTI C;  3B8E B;  1L2P A;  1AVO A;  1GL2 D;  3AED C;  4LLH A;  1FZE A;  4EOT A;  3H1I D;  1BDC A;  5KLV D;  2W6A A;  4PD4 I;  3SSU A;  2RN0 A;  2JEE A;  2E43 A;  1G2C A;  1BSN A;  2IBZ G;  2WPQ A;  3QH9 A;  1KV4 A;  5CCG C;  1LTB C;  4L73 A;  5AVW B;  1Q7Y Q;  1FZC A;  1FJP A;  1FE6 A;  1L0L G;  2IBZ I;  2YKO A;  1BCC J;  3VN0 A;  5CCH A;  2OTK E;  3D6Y A;  1P84 H;  1RF0 A;  1NU1 G;  3ITK A;  4XE5 B;  1SQB D;  4TLF A;  4WWI A;  3H1K E;  1ZN5 A;  1DEE G;  2HYN A;  3CC7 P;  1OFC X;  1SQX G;  5BVZ A;  3OAK A;  4LC1 A;  5CCH D;  3SWK A;  3D70 A;  2JWA A;  2KLU A;  3P32 A;  2KYV A;  1VQP P;  1LT9 B;  2KI7 B;  3FXE A;  3RK3 E;  4Y28 J;  1L0L K;  3O6Q B;  4RJT A;  4I1L A;  4WY4 A;  1T2K C;  2R5D A;  4UB6 E;  1FZA A;  1NO4 A;  1L0N J;  3A0B H;  3RL0 B;  4YXD C;  3I55 P;  1YTZ T;  1AVY A;  2FYN B;  2W6J H;  3RBX A;  1EDL A;  3CXH I;  3L71 G;  2QM7 A;  3H6P A;  1VF5 D;  5L8R J;  2WQY C;  2Z5I A;  1USD A;  1VF5 B;  5AW0 B;  2N9Y B;  3VYI A;  1VF5 C;  5E79 E;  2WT7 B;  3CCV P;  2E76 D;  2WSF J;  4N6J A;  4GOD A;  3CWB D;  1FBM A;  3JCU E;  3LID A;  1Y47 A;  4WBA A;  1K8A Q;  2FYN C;  3O6Q A;  1X79 B;  1EDK A;  1DD4 A;  1JM0 A;  2LXB A;  2B88 A;  3HUS A;  1SQX J;  1S9K E;  1DX7 A;  2JDI H;  3E1R A;  3MHV A;  1VQ9 P;  3M0D C;  2YO2 A;  1JTH B;  2KP8 A;  2WSE H;  5CCH C;  1RQU A;  3Q5S A;  1KTM A;  2AXT H;  1W5C E;  4H13 D;  3O8Z A;  1GD2 E;  2Y9Z A;  1FZC C;  1SQP E;  5AVX B;  4C7N A;  3L70 G;  1RE3 C;  4HJG H;  1H89 A;  1M57 D;  1LGH B;  3H1J D;  2OYH B;  2QSI A;  1SQQ J;  4BRY A;  3OW2 O;  1GMJ A;  3G4S P;  1ZRT E;  3M9H A;  4L76 A;  3WU2 E;  1S1C X;  1ZXG A;  4KT0 J;  4AUW A;  1M56 D;  2M0B A;  2IZ0 A;  3AE1 C;  1SQQ G;  3RL0 D;  1S5L E;  3FGA D;  5APY A;  5APS A;  1RQV A;  3L72 J;  4A7P A;  1PP9 D;  5E79 H;  4ZKP A;  1UIX A;  3L73 E;  1FJK A;  2H8P D;  3PHL A;  1SQX E;  2L91 A;  1SQP K;  3MUD A;  1GL2 C;  3U1A A;  1A02 J;  1JY3 P;  4BXL A;  1YQ4 C;  1KFM A;  1T6A A; 
#chains in the Genus database with same CATH homology
 2R5B A;  2Q7C A;  2FFD C;  3KQG A;  3V4Q A;  2FFD B;  5AW6 B;  2P1J A;  4M3L A;  3U1C A;  2WSC H;  1GU4 A;  4AYC A;  1ZR4 A;  1JO5 A;  2LKM A;  3M06 A;  1GK6 A;  3VOP A;  1JCD A;  4WY4 B;  3MD0 A;  1KQL A;  3GHG C;  2FYU K;  3KDP B;  3HD7 B;  1KIL C;  2KLV A;  2R3C A;  3VTP C;  2Q5U A;  5APT A;  2N9B A;  1WRG A;  1N7S A;  3TYY A;  3V2N A;  3C9I A;  2Z5H A;  1SQV K;  3L35 A;  4IFM A;  4C7N B;  1YYC A;  2WPR A;  1GDT A;  1L4A B;  1M1J A;  1KIL A;  1PFI A;  3VMX A;  1HWT C;  1EQ7 A;  2HFE D;  4GKG A;  4W7Z A;  1AFO A;  1LWU B;  1MUU A;  1IFM A;  1GL2 B;  1T8Z A;  1FOS F;  4C46 A;  2C9L Y;  1KIL B;  1M1J C;  1HTL C;  3UIA A;  1ZLL A;  1N2D C;  1N7S D;  1LTT C;  1CSB A;  1N7S C;  3A7O A;  3P8C E;  1M7L A;  5AW3 B;  3RK3 B;  4B86 A;  4DOJ A;  2HOD B;  3MGN A;  1HBW A;  1G1I A;  3PP5 A;  2ZXE B;  1A02 F;  1IFI A;  1FDM A;  4WB4 A;  3GHG A;  5AVV B;  3B5N A;  4Y99 B;  2OYI C;  1J2J B;  3VMZ A;  1GK4 A;  3N7N A;  3IFM A;  1DH3 A;  1JY2 P;  4O9B A;  1JUN A;  1HGZ A;  3HE5 A;  3OJA B;  1JY3 N;  1E5W A;  1SQX K;  1FZB A;  5APV A;  3M0A A;  1L4A A;  1M1J B;  1SP4 A;  1NU1 K;  5AVZ B;  1IFN A;  1FZC B;  2WIT A;  4WY4 C;  3IR9 A;  4GIF A;  1L0N K;  1RE3 A;  2I1J A;  3RL0 C;  1X8Y A;  2A45 H;  4EIJ A;  1FZG A;  2XKM A;  2O1J A;  2YKP A;  3M0D A;  1HH0 A;  5APW A;  5AVT B;  4KHX A;  2NPS B;  2HG5 D;  1FZF A;  1SFC B;  1HUC A;  1L4A D;  1NTM K;  4XA4 A;  4N78 E;  1URQ A;  3E1I A;  2WT7 A;  1FOS E;  3V5B A;  1OWA A;  3NMD A;  2GUV A;  3U59 A;  3V2P A;  2WZ7 A;  3TK1 A;  1OXZ A;  1URQ D;  3NXS A;  4I6M C;  5AW1 B;  2C9N Y;  2KSJ A;  5AVY B;  1J1E B;  3M9Q A;  1CI6 A;  1RF0 C;  5AVU B;  3RK3 D;  2IFN A;  3A3Y B;  1JY3 O;  2OYI A;  2QM8 A;  3L37 A;  3TSI A;  1LTJ C;  1N7L A;  3EQ2 A;  3BVH A;  5CCG D;  1T2K D;  2WPS A;  2N1T B;  1N86 A;  1SFC A;  1IJD B;  5AVR B;  1RF1 A;  2YMY A;  5BU8 B;  3TNU B;  4JYB A;  1VPC A;  2N1T A;  2NPS A;  3I5C A;  1NH4 A;  2YKQ A;  5AW4 B;  1KZU B;  2HPC B;  4W80 A;  1GZL A;  1RE4 C;  1T3U A;  1T3J A;  2C0W A;  2L5G B;  2PAJ A;  5CJ0 A;  1SQQ K;  3BRT B;  1HJB A;  2WSF H;  5AW8 B;  2GM4 A;  2NPS C;  3HD7 C;  4JYC A;  3NTN A;  2PP6 A;  1SVF A;  3P7K A;  3R2P A;  2P7J A;  1LWU A;  1JTH A;  5AW2 B;  2NPS D;  1ZR2 A;  2IFM A;  3B5N D;  1NKZ B;  1IK9 A;  1RY3 A;  3MIW A;  2KOG A;  4N78 D;  1SQB K;  1NTZ K;  3G3Z A;  1MFZ A;  2XZR A;  2FKW B;  3KPE A;  1HVV A;  5CMZ A;  1N73 A;  3HTK B;  1YTZ I;  1J1D C;  1J1D B;  1VDF A;  1LTJ A;  5KLV K;  1W2E A;  1GTW A;  3HD7 D;  3A2A A;  2KB7 P;  1N73 B;  2J59 M;  2IX7 C;  3VP9 A;  4N3Y B;  3BAT A;  2FFD A;  3TNU A;  1NAF A;  3H32 B;  3L4F A;  3B5N B;  5KJ7 D;  2OYH C;  2Q9I A;  1IC2 A;  1H8A A;  2MJZ A;  2XU6 A;  5AVQ B;  2IPP A;  3VP8 A;  3OA7 A;  2WWW A;  2HPC A;  2W27 A;  3MTU E;  1WT6 A;  3H32 A;  4RES B;  4DZO A;  2OAR A;  3HE5 B;  1URQ B;  1URQ C;  1LT9 A;  2FYZ A;  1NWQ A;  1IFD A;  1N7S B;  1ZV8 A;  3HUS C;  5AW5 B;  1CW5 A;  2O1K A;  1LTG C;  1LT9 C;  2POH A;  1SFC D;  3RK2 D;  4LGD E;  4AQR D;  1JMM A;  2W6B A;  3P8C D;  1JY2 O;  2C0X A;  2CPB A;  5AW9 B;  1IO4 A;  2J58 A;  1L4A C;  1XTG B;  3M9B A;  2Z4E A;  2OYH A;  3SWY A;  1LTA C;  2O01 H;  4W7Y A;  1IFJ A;  3M91 A;  5APU A;  2P67 A;  1GU5 A;  4GT1 A;  1JY2 N;  2E42 A;  5BU5 A;  5CCG A;  3WMM 0;  2HOD A;  1NOH A;  3CI9 A;  1MV8 A;  3RK2 B;  2H7H A;  3CLQ A;  1X9V A;  3B5N C;  2XNX A;  3GHG B;  2YO3 A;  4WY4 D;  1GW4 A;  3HUS B;  1N73 C;  5APQ A;  1NKN A;  1DEB A;  1KFN A;  2N1T D;  1QL1 A;  3LIE A;  3RK2 C;  4IFD K;  3KYQ A;  1AQ5 A;  2P2U A;  4HYT B;  3VMY A;  2A45 I;  1J1E C;  2VRS A;  3LW5 H;  4I2L C;  1JNM A;  3HD7 A;  2XV5 A;  5CHX A;  3SWF A;  5KTB A;  3RK3 C;  3HE4 B;  2Q3I A;  3L36 A;  5KJ7 A;  1RF1 B;  2JJL A;  3V2Q A;  4OH8 B;  1XTC C;  1SLQ A;  1LTS C;  3BRV B;  1FAV A;  1LTJ B;  5AVS B;  1LWU C;  3N4X A;  3V4W A;  1RF1 C;  2A45 G;  2M8R A;  1G2C B;  1FU1 A;  1QL2 A;  3II6 A;  2ZFC A;  1G1J A;  3V2R A;  4HH2 A;  2R32 A;  5AW0 B;  1JCC A;  2GUS A;  1Z56 A;  2YNY A;  1CZQ A;  2XDJ A;  5KJ7 C;  1NHL A;  2M3B A;  1RE4 A;  1MZ9 A;  1S9K D;  3HRN A;  1KIL D;  1NTK K;  4JF7 A;  3CL3 D;  3NFQ A;  2CPS A;  2HLO A;  2N1T C;  4IFF A;  3BAS A;  1HGV A;  3T97 A;  1CI6 B;  3HTK A;  3P8M C;  4C7R A;  1GL2 A;  5APX A;  2I1K A;  5CJ4 A;  1SFC C;  2WTY A;  1JOC A;  1GW3 A;  3EFG A;  4Y99 C;  3HE4 A;  4ZKU A;  2OYI B;  5AW7 B;  1H88 A;  3A5T A;  2BAS A;  2FXM A;  1LTI C;  3B8E B;  1GL2 D;  4EOT A;  4LLH A;  1FZE A;  2W6A A;  2JEE A;  2E43 A;  1G2C A;  2WPQ A;  5CCG C;  1LTB C;  1FZC A;  5AVW B;  1FJP A;  2YKO A;  3VN0 A;  5CCH A;  1RF0 A;  4XE5 B;  1ZN5 A;  2HYN A;  5BVZ A;  3OAK A;  4LC1 A;  5CCH D;  3P32 A;  2KYV A;  1LT9 B;  2H43 A;  1T2K C;  1L0L K;  4I1L A;  4WY4 A;  2R5D A;  1FZA A;  1NO4 A;  3RL0 B;  1YTZ T;  2QM7 A;  3H6P A;  2Z5I A;  3VYI A;  2WT7 B;  4N6J A;  3LID A;  1FBM A;  4WBA A;  1X79 B;  1S9K E;  3HUS A;  1DX7 A;  3M0D C;  2YO2 A;  1JTH B;  2KP8 A;  2WSE H;  5CCH C;  1GD2 E;  3O8Z A;  1FZC C;  5AVX B;  4C7N A;  1RE3 C;  1H89 A;  1LGH B;  2OYH B;  3M9H A;  4AUW A;  3RL0 D;  5APY A;  5APS A;  4ZKP A;  1FJK A;  2H8P D;  1A02 J;  1SQP K;  3MUD A;  1GL2 C;  3U1A A;  1JY3 P;  1KFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...