1XTCC

Cholera toxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
SNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CHOLERA TOXIN
publication title The three-dimensional crystal structure of cholera toxin.
pubmed doi rcsb
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1996-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1xtcC00
1HTLC 1LTSC 1LTTC 1LTIC 1LTAC 1XTCC 1LTGC 1LTBC
chains in the Genus database with same CATH superfamily
2R44A 1FC2C 1PGJA 1EC5A 4NPFX 3V2QA 3PJSK 3CWBJ 1M8OB 1LTAC 2K1AA 2VRSA 1GMJA 3CCJP 1MKMA 4KJMA 1SQQG 2LKMA 2WSSH 3P8MC 1EDIA 1JNMA 2Z4EA 1NTKJ 2B89A 1DD3A 3C1LA 3CPWO 3KXDA 3V2NA 4BRYA 3H1HG 3CXHE 2QJKC 2KSJA 1X0TA 1LTJA 1OZHA 1N73A 2O01H 1SQBK 2OYIB 1L0NE 2XV5A 1L0LK 2K88A 5BVZA 2KXPB 1TU3F 4JYCA 1LTSC 2FKWB 1JCCA 5AVUB 3HUSA 1HWTC 4L76A 1K04A 1Q7YQ 1L0NJ 2RMZA 3CXHI 3IFMA 3L70E 5CCGD 3H1LE 1QVGO 2JWDA 1M1JC 1SQPK 2Q6QA 4WY4D 1ZOYC 2ZXEB 1SQVD 3H1LJ 2FYUG 5APSA 1RQUA 3L71G 4TT3H 1KYOE 3GF7A 2FFDB 1FE6A 4XA4A 2KIKA 3HE4A 3TGUD 2D2CD 1X8YA 1AQTA 3CCEP 5APXA 1KN7A 1GD2E 4IFDK 3QH9A 2BEQD 3AE1C 2IFMA 2Y9YA 1DEEG 1VQ8P 3M9QA 1KB9H 4R4LA 4GODA 3AEDC 1KYOI 3AEFC 3F5HA 3TYYA 1DEBA 1KORA 3SWKA 4HKZH 2V4HA 1LT9B 2RN0A 5GTIH 2W6AA 3E1RA 3P32A 5AW6B 4PD4H 3MUDA 1YTZI 1KILC 2W90A 3H1ID 4WY4B 4B86A 4DJGA 3M9BA 4IOIH 2NPSC 4U3FE 1H89A 3CCRP 3HE5B 1Q90D 1FDMA 1U7JA 2DW3A 3U1AA 1L4AA 3BCCE 4U3FJ 5APTA 5AVZB 1X79B 1LT1A 2OGUA 3S4RA 1GU4A 2H8PD 2D2CB 3D6ZA 1RF1C 1NH4A 2KK7A 3UIAA 1QL1A 5E79E 4Y99C 3BCCJ 1LWUB 3F89A 2YMYA 1BE3G 3H1HJ 1NTME 4IL6X 2KNCB 1HUCA 4D6TG 1NU1D 3L73D 3EFGA 1BSHA 3RGUA 1VQ6P 1T8ZA 2Q3IA 4Y28J 1ZR2A 1FU1A 1NTMJ 1EDLA 2KLUA 2ZAEB 1SLQA 1RH5B 1UIXA 1IFJA 2WPQA 3SSUA 1LT9A 2ZVOB 5B66E 2HPCB 4OWFA 2E75C 1QL2A 1BDDA 2HODB 2WSEH 5CCHA 1KQFB 3O6QB 1OX3A 1H0TA 5KAFE 2YKPA 2P7JA 3EFFK 1FS0E 2V7QH 4GOEA 5EFWB 2YXRB 2QM7A 3E7KA 2OQQA 5KLVD 2YKQA 1K05A 4IFFA 4QMAA 2FYUJ 3HE5A 3A0HE 1GL2D 1LTGC 2POHA 3L71J 1R5LA 3M0AA 3B5NC 2ZJSE 2Y9ZA 4C7RA 1KFMA 2H89C 3CWBD 2E76D 2A06D 2WSFH 1EQ7A 2J59M 2NPSD 3CLQA 1QVFO 2IPPA 2YO3A 1G2CA 2Q5UA 3LIDA 5KJ7D 1AVYA 4L73A 1OIPA 1VF5C 1NTKD 1HJBA 3HD7A 1LP1B 2WQYC 4I7ZB 1SQVE 5DJTB 1PGQA 2KUBA 2YIUC 1QLED 1NJIQ 1S72P 1M90Q 2QJPB 1OVRA 3V2RA 1SQVJ 2PFXA 4H0LC 1IC2A 3GLMA 1T2KC 2QJYC 3TGUE 2O01N 1LTTC 1NWQA 1GL2B 3JCUH 1R5SA 3CX5D 4ZNCA 3OW2O 1KQSO 1EZVD 4GKGA 1IFDA 1SQXG 2O01J 2E76B 3RK2C 4KHXA 1IJDB 4OVNF 3NMDA 2NPSB 2E5YA 2KOGA 4C7NA 2UWJE 1P84H 1UIIA 3CCQP 2JWAA 2WZ7A 1KMIZ 3PRJA 4I6MC 4DOJA 1KQGB 1BE3J 3A5TA 3IN6A 3CL3D 4AUWA 1BGYD 2FBWC 4H13D 1JTHA 1YBKA 1U7MA 3H1IE 3KHUA 1IO4A 1RF1B 2B87B 2PP6A 3H1JD 3V6IA 1FJKA 1S5LH 1NTZE 5KAIE 2P58A 3H1IJ 4ASVA 2ZYGA 1URQD 4H44D 4I1LA 5TJHA 2XZRA 2JEEA 1GU5A 1VQ4P 1NVOA 2R3CA 2Q7CA 1E79H 1NTZJ 1VQ5P 1DIPA 1L0NK 2RH0A 4O9BA 3H6PA 1CZQA 3HTKB 2A45H 2W27A 2P1JA 1T3UA 1VL2A 2SPZA 3A2AA 3GMAA 2WT7B 2OYHC 1CI6B 1NU1E 3L73E 1K9MQ 2E42A 2WWWA 3H1KD 1JCDA 1VPCA 2XKMA 3BATA 3N4XA 2NRGA 1XTGB 1NU1J 3L73J 2IFNA 2MJZA 1GDTA 3W68A 3L72G 3TNUB 3Q1MA 1IZNB 4YXWH 3GHGB 2CPSA 4JQ0D 4U3FD 2LXBA 4PV1D 1GK6A 1J1DB 1VQOP 1ZR4A 5KLVE 4GIFA 2E74C 2P2UA 3BCCD 1URQB 4H44B 5GTHH 4RO0A 1YJWP 3H1HD 3G71P 2CPBA 1ZRTD 1KTMA 3RK3D 3S9OA 5CCHC 1U57A 2BCCG 3CWBE 3M9HA 3RL0g 2A06E 3V2PA 3II6A 5KLIC 2YIUB 1DD4A 1SFCC 3VMZA 3RL0D 3E1IA 1CI6A 1M1KQ 5TISH 4W80A 3TSIA 1NKNA 3CCVP 1HF9A 5DJUB 3U59A 1NTKE 2FYNC 1FZCC 3CCSP 1X9VA 2N1TA 4GOFA 1QX8A 2WSCH 2FYUD 4PV1B 3L71D 4IL6E 2GUSA 4MN4C 2WSEJ 2HR3A 3N7NA 1PV3A 3WUUA 4HH2A 2A45G 1S4XA 2AXTH 3HD7C 2JJLA 2AXCA 1JEKA 3CX5E 1NTMK 1EZVE 3RK3B 3O8ZA 1JB0J 3WU2H 3IF4A 1SQBG 4GDOA 1L0LG 1Y8AA 5APVA 1M7LA 3RL0B 2FYZA 3B8EB 2E74D 2B9BA 1K73Q 1ZN5A 3JSVC 2WSFJ 2AEMA 3VMXA 1LNQA 1OMIA 1NYHA 2N9BA 1EXIA 1BGYE 3CX5I 3LW5J 1EZVI 1N7SD 2B88A 1E5WA 3MHVA 3H1JE 1SQPG 3AEGC 3OAKA 1J1EB 1RE3C 3H32B 1BGYJ 2OYHB 3A0BH 2WPVB 3JC22 4NPEA 4UB6E 3L74E 3T97B 2ZFCA 1FZBA 1BCCG 3AEEC 3H1JJ 1SFCD 1VQNP 5AVRB 5H2FH 3PHLA 2KSEA 4L74A 1W5CE 5L8RJ 3L74J 5K5GB 2JDIH 3L75G 1N7LA 1LTBC 4WB4A 4ZKUA 2QEXP 2OYIA 4OH8B 2JKVA 1BE3D 2Y0CA 5APYA 4YPCA 3H1KE 1FZGA 1NGMB 2OTJP 3USSA 1RQVA 3NFQA 3L36A 2E74B 2BCCJ 3H1KJ 4JF7A 2L5GB 1SQVK 5B5EE 2W83C 1YTZT 1FZAA 1N7SB 5AW5B 2GM4A 1HBWA 1SQQE 2K9JB 1SS1A 1NTZD 3H25A 1S5LE 2Q1KA 3U1CA 1USEA 4M3LA 4UB8H 2FY8A 2QSIA 3A7OA 1SQQJ 3H1HE 1SFCB 2LXCB 5AW0B 4R4MA 3KZIH 2FFDA 1ZRTE 2BASA 2H88C 1S9KE 3RK3E 2JP3A 1KB9D 1IFMA 1FZCB 1OVVA 5CBOA 4LC1A 2I1JA 3AE2C 5CHXA 3BASA 5CJ4A 1IK9A 3PLNA 1G1IA 2XNDH 4KT0J 1KC8Q 4BWNA 2QJKB 4PD4D 2M3BA 5AVYB 1MUUA 1GTWA 2M5AB 1IFNA 5CCGA 2KS1B 3VYIA 4AYCA 1NTZK 2FYUE 2K9YA 3L71E 1HGZA 1CSBA 4WY4A 1MFZA 1Y47A 1PGOA 5BU5A 1N7SA 1IFIA 3C8VA 4K35A 5APQA 5AVXB 2GA1A 5GTHE 5CJ0A 1SQPJ 2N1TC 1GK4A 1YHQP 1H88A 3CCMP 4HJGH 1M1JB 2GUVA 3CXHH 4EI2A 1N8RQ 1N86A 1JOCA 1KILD 1NU1K 1BCCJ 2IYOA 1Q81Q 1GW4A 2ZVNB 1NAYA 2IBZG 3I5CA 1XTCC 4BXLA 1A02F 1LWUA 3W67A 2C0WA 1LTJC 2JO1A 3FGAD 1ZMEC 4DCKA 2KNCA 1N73C 3KQGA 5KKZC 5C39A 2M0BA 1PP9G 2OARA 3HUSC 3A3YB 2WTYA 1M56D 2R3SA 2LR2A 4N6JA 1MV8A 4IFMA 2HPCA 5KLVK 2HODA 2O3JA 5KTBA 3O6QA 3V4QA 2G3AA 2HG5D 3FWLA 1KYOH 1L2PA 2OYOA 2AEFA 3B71A 1S5LX 2E75D 5AVQB 1NOHA 1KILB 3L4FA 1BE3E 1M1JA 3G4SP 4D6TE 4YTPC 2W8ZA 4U7JA 3TK1A 4YXDC 3K5BA 1NTKK 2K37A 1PPJG 1KV4A 4D6TJ 1VQMP 2Z5HA 3RBXA 2QE7H 3TF5A 2KLVA 3L72D 3B5ND 2OYIC 1JY3O 3LIEA 4Y99B 2C9LY 1R8EA 1LP1A 1NAFA 1OWAA 2ZYDA 1EDKA 3L74D 1HGVA 3MUDC 1Q82Q 3OA7A 2KZIA 2NZ2A 1QEXA 2J5UA 3Q5SA 2ZT9C 3BVHA 1VF5D 2QA4P 1YQ4C 2KP8A 3S1KA 5AVWB 3NTNA 3VMAA 1KB9E 2K3RA 1L0NG 1W2BO 2E75B 1GL2A 1OW7A 1JY2O 2BCCD 1L4AC 2PGDA 1P84D 4WBAA 1ZW0A 4ZMDA 4H0LD 5GTIE 1T2KD 3VP9A 1YITP 1VDFA 1Q2NA 4PD4E 2NPSA 3GF3A 3L70G 2YMKA 3H1LG 1KB9I 3NXSA 5KJ7A 2WPSA 2YXQB 3B5NB 1JO5A 1SQQD 1LGHB 4W7ZA 4N78E 3VOPA 2QG4A 1NO4A 1WMKA 3IR9A 5B66H 1RF1A 2B87A 3M06A 3RK2D 2WMMA 4BRYB 4JPZB 5AW2B 4LGDE 1PP9J 1LTJB 1LT9C 1N73B 3QWOC 3WMM0 1LJ2A 4OGQC 5CCGC 3CC4P 1S9KD 1VF5B 1RY3A 1KILE 1YJNP 3HTKA 1QGKB 3Q5PA 2YNYA 3P7KA 3HRNA 1SQXE 2WT7A 1L0LD 3FXDA 1G1JA 3AE8C 4I2LC 4H0LB 1RF0A 5AVSB 1SQXJ 2QJYB 2QVAA 1MFTA 2D2CC 1PPJE 2ZT9D 3IAOA 1PZQA 1SQQK 3MD0A 2R32A 3TNUA 2JR8A 1MZ9A 1LWUC 1SQPD 2R5DA 4U3FG 3GHGA 3MTUE 1L4AD 1RHZB 3RK2B 3B5NA 1SVFA 5M1BA 1YI2P 1HVVA 1ZV8A 2V7QJ 1BCCD 5BU8B 3HE4B 3BCCG 2I8DA 1URQA 1OW6A 1CW5A 1VQLP 2QIWA 3L75D 3AEBC 4EDFA 3SWFA 1DX7A 2C0XA 3EWKA 2OTKE 1NTMG 4A7PA 5CBNA 1KZUB 3BRTB 3CCLP 3VMYA 1FOSE 1AA0A 4EIJA 2P67A 4DZOA 3L72E 4OGQD 1JY3P 2W6BA 5CCHD 2ZT9B 2FYUK 1JUNA 3Q3DA 1RE4A 4Z1MH 4LLHA 1Y9BA 3L70J 3L72J 1AQ5A 3VN0A 1K8AQ 1L4AB 2N9YB 5KAIH 3TDKA 2OTLP 3JCUE 5AW8B 3P8CD 2O1KA 1JY2P 4I7ZC 4DT0A 1YJ9P 2BCCE 3ITKA 1HH0A 2KYVA 4D6TD 5AW4B 2R5BA 3WUVA 1P84E 3KDPB 2QJPC 1GW3A 4C46A 2C9NY 4K3AA 2M3EA 3MGNA 1S2EA 3HD7D 3V5BA 2WITA 4CPGA 3FXEA 1VQ9P 3L35A 1GL2C 2KI7B 3MZWB 1M57D 4OGQB 3Q5RA 2E5TA 1AVOA 1H0TB 1SQVG 1HJ0A 3OJAB 5AW1B 3EQ2A 1NKZB 3GG2A 1P84I 1PFIA 2E76C 5KLIB 2Y0EA 3AE9C 5AVVB 3H32A 3CMEP 2HFED 2OYHA 1KD1Q 1VQ7P 4PJ0H 3T97A 3TGUG 1ZLLA 1ZXGA 5KJ7C 2FYNB 2ZXXA 1VQKP 3WUTA 2O1JA 4RKUJ 1FZEA 3RBZA 2IYPA 2BEZF 1SQBE 2Q3EA 1L0LE 2XU6A 2XDJA 2IBZD 1G2CB 3SFEC 2CK3H 3SWYA 3L37A 2HLOA 2A45I 1SQBJ 2YKOA 1L0LJ 3HD7B 5AVTB 1T6AA 4GT1A 4W7YA 1PP9D 1JY3N 3H1IG 4N78D 4JYBA 1N2DC 1SQPE 1S1CX 1KFNA 4N3YB 1H8AA 2FXOA 1NTZG 1RF0C 2K9JA 3M0DA 1BCCE 3GW6A 2IDBA 4IL6H 1PL5A 2P10A 1JM0A 3C9IA 1Q86Q 1PGPA 1SFCA 2MKVA 3V4WA 3G6EP 3L75E 4H13C 5APWA 1BSNA 3GHGC 1JY2N 1WT6A 3AE3C 1SQXD 3R4YA 3PTZA 2E43A 3CX5H 4WWIA 1EXJA 1ZP0C 1NU1G 2W6JH 3L73G 1FZCA 4C7NB 1DH3A 1J1DC 3L75J 5APUA 4EOTA 5TISE 2Q9IA 2IX7C 1URQC 2XNXA 1Z56A 4H44C 2FXMA 1OVUA 1HTLC 1FZFA 1KQLA 2ITAA 1JTHB 1PPJD 3MIWA 4ASWA 5AW3B 3LW5H 2KB7P 2QM8A 3FX0A 4AQRD 2M5AA 3G3ZA 3ZDMA 2KS1A 4L75A 4JBZA 4XE5B 2WSCJ 1W2EA 3CMAP 2AXTE 5KLVG 1FDOA 2HYNA 1T3JA 4UB6H 3CXHD 2QRXA 3BRVB 3WU2E 1JMBA 3P8CE 1RE4C 1WRGA 1J2JB 1SQXK 1L0ND 5CMZA 1YYCA 3CWBG 2A06G 2Y0DA 4PV1C 2PAJA 3TGUJ 1VQPP 3B4SA 4XFJA 2L91A 1RE3A 1X22A 2N1TD 1IK7A 3L70D 1S3JA 3H1LD 1NTKG 1AV1A 3I56P 4RJTA 3CI9A 3Q2YA 2YO2A 1YQ3C 1SP4A 3RK3C 3A0BE 1JMMA 1LTIC 5B5EH 2I1KA 2IZ1A 3KPEA 3VTPC 5H2FE 1USDA 4TLFA 1D7MA 1KYOD 3RL0C 4HB1A 5AW9B 2PRRA 3AE7C 1FBMA 4HYTB 3MP7B 3R2PA 3CCUP 1A02J 2AEJA 1YIJP 1PIXA 3D70A 1EZVG 5E79H 3AE6C 5AW7B 1J1EC 3VP8A 2G8YA 3CC7P 3AE5C 1KILA 2IBZE 2H43A 2FFDC 3I55P 4RESB 1OXZA 3AE4C 1NHLA 3FWNA 1BDCA 3D71A 1FAVA 4EYYQ 4ZKPA 2N1TB 2H7HA 2J58A 1AJYA 1BGYG 3AECC 1PP9E 1EDJA 1OFCX 2KZJA 3PH0A 3PP5A 1OW8A 2RKLA 3H1JG 1FDIA 3ABVC 4H13B 4UB8E 1AFOA 2WVRA 2IBZI 3M91A 5KAFH 1IFPA 3L74G 4PD4I 3CC2P 3KZIE 2Z5IA 5KKZB 4NPDA 4PJ0E 2M8RA 2WPRA 3KYQA 3AEAC 1FOSF 1FJPA 3A0HH 3SFDC 3HUSB 4WY4C 2IZ0A 3G9RA 3CD6P 1N7SC 2ZYAA 5KLVJ 1SQBD 1GZLA 3D6YA 3M0DC 2FXPA 4WVZA 1NTMD 3H1KG
chains in the Genus database with same CATH topology
1MFZA 4AUWA 1JTHA 5BU5A 1N7SA 1IFIA 3P8CD 5APQA 2O1KA 1IO4A 1JY2P 5AVXB 1RF1B 3V2QA 2PP6A 1HH0A 5CJ0A 2KYVA 5AW4B 2N1TC 2R5BA 1GK4A 1H88A 3KDPB 1FJKA 1LTAC 1GW3A 1M1JB 2VRSA 2GUVA 4C46A 2C9NY 1N86A 1URQD 1JOCA 1KILD 1NU1K 4I1LA 3MGNA 2XZRA 2JEEA 2LKMA 1GU5A 3HD7D 3V5BA 2R3CA 1GW4A 2Q7CA 2WITA 3P8MC 3I5CA 1A02F 1L0NK 1XTCC 4O9BA 3H6PA 1LWUA 1CZQA 2C0WA 1LTJC 3HTKB 2A45H 2W27A 2P1JA 3L35A 1GL2C 1JNMA 2Z4EA 1N73C 1T3UA 3KQGA 3A2AA 3V2NA 2WT7B 3OJAB 2OYHC 5AW1B 1CI6B 3EQ2A 2KSJA 1NKZB 1LTJA 1PFIA 2E42A 2WWWA 1N73A 5AVVB 2OARA 2O01H 3H32A 3HUSC 3A3YB 2HFED 2WTYA 2OYHA 1SQBK 2OYIB 2XV5A 1JCDA 1L0LK 1VPCA 5BVZA 2XKMA 3T97A 3BATA 3N4XA 4JYCA 4N6JA 1MV8A 4IFMA 1XTGB 1LTSC 1ZLLA 2IFNA 2HPCA 2FKWB 5KJ7C 5KLVK 1JCCA 2MJZA 5AVUB 2HODA 3HUSA 1HWTC 1GDTA 5KTBA 3TNUB 3V4QA 2HG5D 3GHGB 2CPSA 2O1JA 3IFMA 1FZEA 5CCGD 2XU6A 2XDJA 1M1JC 1GK6A 1SQPK 1J1DB 1G2CB 1ZR4A 4GIFA 5AVQB 3SWYA 2P2UA 1NOHA 1URQB 1KILB 3L37A 4WY4D 2HLOA 2A45I 3L4FA 2ZXEB 2YKOA 5APSA 1M1JA 3HD7B 5AVTB 4GT1A 2CPBA 4W7YA 1JY3N 3RK3D 4N78D 5CCHC 4JYBA 1N2DC 3TK1A 2FFDB 1NTKK 4XA4A 3M9HA 1KFNA 4N3YB 3V2PA 3II6A 1H8AA 3HE4A 1X8YA 1RF0C 2Z5HA 5APXA 3M0DA 1GD2E 1SFCC 2KLVA 3VMZA 3RL0D 4IFDK 3B5ND 2OYIC 3E1IA 1CI6A 2IFMA 1JY3O 3LIEA 4Y99B 2C9LY 3M9QA 4W80A 3TSIA 1NAFA 1NKNA 1OWAA 3C9IA 1SFCA 3U59A 3V4WA 1FZCC 1X9VA 2N1TA 3TYYA 1DEBA 1HGVA 5APWA 3OA7A 3GHGC 1JY2N 1WT6A 1LT9B 2WSCH 2E43A 1FZCA 1DH3A 4C7NB 2W6AA 3BVHA 2KP8A 1J1DC 3P32A 5APUA 5AW6B 4EOTA 3MUDA 3NTNA 2GUSA 5AVWB 2Q9IA 2IX7C 3N7NA 1YTZI 1URQC 1KILC 2XNXA 1Z56A 2FXMA 1GL2A 1HTLC 2A45G 4HH2A 4WY4B 1FZFA 1KQLA 4B86A 1JY2O 1JTHB 3HD7C 3M9BA 1L4AC 2NPSC 2JJLA 3MIWA 5AW3B 1H89A 3LW5H 4WBAA 2KB7P 2QM8A 3HE5B 4AQRD 1FDMA 1NTMK 1T2KD 3VP9A 3RK3B 3O8ZA 1VDFA 3U1AA 3G3ZA 1L4AA 2NPSA 5APTA 5AVZB 1X79B 1GU4A 4XE5B 2H8PD 1W2EA 5APVA 1M7LA 1RF1C 1NH4A 3NXSA 5KJ7A 2WPSA 3UIAA 2HYNA 1QL1A 3RL0B 3B5NB 2FYZA 1JO5A 1T3JA 1LGHB 4W7ZA 3B8EB 4Y99C 4N78E 3VOPA 1ZN5A 1LWUB 1NO4A 2YMYA 3VMXA 3IR9A 1RF1A 1HUCA 2N9BA 3BRVB 3M06A 3RK2D 3EFGA 3P8CE 1RE4C 1WRGA 5AW2B 4LGDE 1J2JB 1T8ZA 1N7SD 1E5WA 1SQXK 2Q3IA 1LTJB 5CMZA 1LT9C 1YYCA 3OAKA 1ZR2A 1N73B 1J1EB 1FU1A 1RE3C 3H32B 3WMM0 5CCGC 1S9KD 2OYHB 2PAJA 1SLQA 1RY3A 1IFJA 2WPQA 2ZFCA 1FZBA 1LT9A 2HPCB 1SFCD 1RE3A 3HTKA 5AVRB 1QL2A 2HODB 2WSEH 2YNYA 2N1TD 3P7KA 5CCHA 3HRNA 2WT7A 2YKPA 2P7JA 1G1JA 3CI9A 2QM7A 4I2LC 2YO2A 3RK3C 1SP4A 1RF0A 1N7LA 1LTBC 4WB4A 4ZKUA 2YKQA 1JMMA 5AVSB 1LTIC 2OYIA 4IFFA 2I1KA 4OH8B 3KPEA 3HE5A 5APYA 3VTPC 1FZGA 1GL2D 1LTGC 2POHA 1SQQK 3MD0A 3M0AA 3RL0C 3B5NC 2R32A 3TNUA 1KFMA 4C7RA 5AW9B 1MZ9A 1LWUC 3NFQA 3L36A 2R5DA 1FBMA 4HYTB 3GHGA 3MTUE 2WSFH 1EQ7A 3R2PA 2J59M 4JF7A 1L4AD 1SQVK 2L5GB 2NPSD 3CLQA 3RK2B 3B5NA 1SVFA 1A02J 1HVVA 3A5TA 1ZV8A 2IPPA 2YO3A 1YTZT 1FZAA 5BU8B 1N7SB 3HE4B 1G2CA 5AW5B 2Q5UA 5AW7B 1J1EC 2GM4A 1HBWA 3VP8A 3LIDA 5KJ7D 1URQA 1KILA 2H43A 3U1CA 2FFDC 1HJBA 4M3LA 1CW5A 3HD7A 4RESB 1OXZA 3A7OA 3SWFA 1NHLA 1DX7A 2C0XA 1SFCB 1FAVA 5AW0B 4ZKPA 2N1TB 2H7HA 2FFDA 2J58A 2BASA 1KZUB 1S9KE 3BRTB 3PP5A 3V2RA 1IFMA 1FZCB 1IC2A 1T2KC 3VMYA 1AFOA 1FOSE 3M91A 1LTTC 4LC1A 4EIJA 2P67A 4DZOA 1NWQA 2I1JA 5CHXA 3BASA 1JY3P 1GL2B 5CJ4A 2W6BA 1IK9A 5CCHD 2FYUK 2Z5IA 2M8RA 1JUNA 1G1IA 2WPRA 1RE4A 3KYQA 1FOSF 4LLHA 4GKGA 1IFDA 1FJPA 1AQ5A 2M3BA 5AVYB 1MUUA 3RK2C 1GTWA 4KHXA 3VN0A 1IJDB 1IFNA 3NMDA 1L4AB 2NPSB 2KOGA 3HUSB 4WY4C 5CCGA 4C7NA 1N7SC 3VYIA 2WZ7A 4AYCA 1NTZK 1GZLA 4I6MC 3M0DC 4DOJA 5AW8B 1HGZA 1CSBA 4WY4A 3CL3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTL C;  1LTS C;  1LTT C;  1LTI C;  1LTA C;  1XTC C;  1LTG C;  1LTB C; 
#chains in the Genus database with same CATH topology
 2R44 A;  1FC2 C;  1PGJ A;  1EC5 A;  4NPF X;  3V2Q A;  3PJS K;  3CWB J;  1M8O B;  1LTA C;  2K1A A;  2VRS A;  1GMJ A;  3CCJ P;  1MKM A;  4KJM A;  1SQQ G;  2LKM A;  2WSS H;  3P8M C;  1EDI A;  1JNM A;  2Z4E A;  1NTK J;  2B89 A;  1DD3 A;  3C1L A;  3CPW O;  3KXD A;  3V2N A;  4BRY A;  3H1H G;  3CXH E;  2QJK C;  2KSJ A;  1X0T A;  1LTJ A;  1OZH A;  1N73 A;  2O01 H;  1SQB K;  2OYI B;  1L0N E;  2XV5 A;  1L0L K;  2K88 A;  5BVZ A;  2KXP B;  1TU3 F;  4JYC A;  1LTS C;  2FKW B;  1JCC A;  5AVU B;  3HUS A;  1HWT C;  4L76 A;  1K04 A;  1Q7Y Q;  1L0N J;  2RMZ A;  3CXH I;  3IFM A;  3L70 E;  5CCG D;  3H1L E;  1QVG O;  2JWD A;  1M1J C;  1SQP K;  2Q6Q A;  4WY4 D;  1ZOY C;  2ZXE B;  1SQV D;  3H1L J;  2FYU G;  5APS A;  1RQU A;  3L71 G;  4TT3 H;  1KYO E;  3GF7 A;  2FFD B;  1FE6 A;  4XA4 A;  2KIK A;  3HE4 A;  3TGU D;  2D2C D;  1X8Y A;  1AQT A;  3CCE P;  5APX A;  1KN7 A;  1GD2 E;  4IFD K;  3QH9 A;  2BEQ D;  3AE1 C;  2IFM A;  2Y9Y A;  1DEE G;  1VQ8 P;  3M9Q A;  1KB9 H;  4R4L A;  4GOD A;  3AED C;  1KYO I;  3AEF C;  3F5H A;  3TYY A;  1DEB A;  1KOR A;  3SWK A;  4HKZ H;  2V4H A;  1LT9 B;  2RN0 A;  5GTI H;  2W6A A;  3E1R A;  3P32 A;  5AW6 B;  4PD4 H;  3MUD A;  1YTZ I;  1KIL C;  2W90 A;  3H1I D;  4WY4 B;  4B86 A;  4DJG A;  3M9B A;  4IOI H;  2NPS C;  4U3F E;  1H89 A;  3CCR P;  3HE5 B;  1Q90 D;  1FDM A;  1U7J A;  2DW3 A;  3U1A A;  1L4A A;  3BCC E;  4U3F J;  5APT A;  5AVZ B;  1X79 B;  1LT1 A;  2OGU A;  3S4R A;  1GU4 A;  2H8P D;  2D2C B;  3D6Z A;  1RF1 C;  1NH4 A;  2KK7 A;  3UIA A;  1QL1 A;  5E79 E;  4Y99 C;  3BCC J;  1LWU B;  3F89 A;  2YMY A;  1BE3 G;  3H1H J;  1NTM E;  4IL6 X;  2KNC B;  1HUC A;  4D6T G;  1NU1 D;  3L73 D;  3EFG A;  1BSH A;  3RGU A;  1VQ6 P;  1T8Z A;  2Q3I A;  4Y28 J;  1ZR2 A;  1FU1 A;  1NTM J;  1EDL A;  2KLU A;  2ZAE B;  1SLQ A;  1RH5 B;  1UIX A;  1IFJ A;  2WPQ A;  3SSU A;  1LT9 A;  2ZVO B;  5B66 E;  2HPC B;  4OWF A;  2E75 C;  1QL2 A;  1BDD A;  2HOD B;  2WSE H;  5CCH A;  1KQF B;  3O6Q B;  1OX3 A;  1H0T A;  5KAF E;  2YKP A;  2P7J A;  3EFF K;  1FS0 E;  2V7Q H;  4GOE A;  5EFW B;  2YXR B;  2QM7 A;  3E7K A;  2OQQ A;  5KLV D;  2YKQ A;  1K05 A;  4IFF A;  4QMA A;  2FYU J;  3HE5 A;  3A0H E;  1GL2 D;  1LTG C;  2POH A;  3L71 J;  1R5L A;  3M0A A;  3B5N C;  2ZJS E;  2Y9Z A;  4C7R A;  1KFM A;  2H89 C;  3CWB D;  2E76 D;  2A06 D;  2WSF H;  1EQ7 A;  2J59 M;  2NPS D;  3CLQ A;  1QVF O;  2IPP A;  2YO3 A;  1G2C A;  2Q5U A;  3LID A;  5KJ7 D;  1AVY A;  4L73 A;  1OIP A;  1VF5 C;  1NTK D;  1HJB A;  3HD7 A;  1LP1 B;  2WQY C;  4I7Z B;  1SQV E;  5DJT B;  1PGQ A;  2KUB A;  2YIU C;  1QLE D;  1NJI Q;  1S72 P;  1M90 Q;  2QJP B;  1OVR A;  3V2R A;  1SQV J;  2PFX A;  4H0L C;  1IC2 A;  3GLM A;  1T2K C;  2QJY C;  3TGU E;  2O01 N;  1LTT C;  1NWQ A;  1GL2 B;  3JCU H;  1R5S A;  3CX5 D;  4ZNC A;  3OW2 O;  1KQS O;  1EZV D;  4GKG A;  1IFD A;  1SQX G;  2O01 J;  2E76 B;  3RK2 C;  4KHX A;  1IJD B;  4OVN F;  3NMD A;  2NPS B;  2E5Y A;  2KOG A;  4C7N A;  2UWJ E;  1P84 H;  1UII A;  3CCQ P;  2JWA A;  2WZ7 A;  1KMI Z;  3PRJ A;  4I6M C;  4DOJ A;  1KQG B;  1BE3 J;  3A5T A;  3IN6 A;  3CL3 D;  4AUW A;  1BGY D;  2FBW C;  4H13 D;  1JTH A;  1YBK A;  1U7M A;  3H1I E;  3KHU A;  1IO4 A;  1RF1 B;  2B87 B;  2PP6 A;  3H1J D;  3V6I A;  1FJK A;  1S5L H;  1NTZ E;  5KAI E;  2P58 A;  3H1I J;  4ASV A;  2ZYG A;  1URQ D;  4H44 D;  4I1L A;  5TJH A;  2XZR A;  2JEE A;  1GU5 A;  1VQ4 P;  1NVO A;  2R3C A;  2Q7C A;  1E79 H;  1NTZ J;  1VQ5 P;  1DIP A;  1L0N K;  2RH0 A;  4O9B A;  3H6P A;  1CZQ A;  3HTK B;  2A45 H;  2W27 A;  2P1J A;  1T3U A;  1VL2 A;  2SPZ A;  3A2A A;  3GMA A;  2WT7 B;  2OYH C;  1CI6 B;  1NU1 E;  3L73 E;  1K9M Q;  2E42 A;  2WWW A;  3H1K D;  1JCD A;  1VPC A;  2XKM A;  3BAT A;  3N4X A;  2NRG A;  1XTG B;  1NU1 J;  3L73 J;  2IFN A;  2MJZ A;  1GDT A;  3W68 A;  3L72 G;  3TNU B;  3Q1M A;  1IZN B;  4YXW H;  3GHG B;  2CPS A;  4JQ0 D;  4U3F D;  2LXB A;  4PV1 D;  1GK6 A;  1J1D B;  1VQO P;  1ZR4 A;  5KLV E;  4GIF A;  2E74 C;  2P2U A;  3BCC D;  1URQ B;  4H44 B;  5GTH H;  4RO0 A;  1YJW P;  3H1H D;  3G71 P;  2CPB A;  1ZRT D;  1KTM A;  3RK3 D;  3S9O A;  5CCH C;  1U57 A;  2BCC G;  3CWB E;  3M9H A;  3RL0 g;  2A06 E;  3V2P A;  3II6 A;  5KLI C;  2YIU B;  1DD4 A;  1SFC C;  3VMZ A;  3RL0 D;  3E1I A;  1CI6 A;  1M1K Q;  5TIS H;  4W80 A;  3TSI A;  1NKN A;  3CCV P;  1HF9 A;  5DJU B;  3U59 A;  1NTK E;  2FYN C;  1FZC C;  3CCS P;  1X9V A;  2N1T A;  4GOF A;  1QX8 A;  2WSC H;  2FYU D;  4PV1 B;  3L71 D;  4IL6 E;  2GUS A;  4MN4 C;  2WSE J;  2HR3 A;  3N7N A;  1PV3 A;  3WUU A;  4HH2 A;  2A45 G;  1S4X A;  2AXT H;  3HD7 C;  2JJL A;  2AXC A;  1JEK A;  3CX5 E;  1NTM K;  1EZV E;  3RK3 B;  3O8Z A;  1JB0 J;  3WU2 H;  3IF4 A;  1SQB G;  4GDO A;  1L0L G;  1Y8A A;  5APV A;  1M7L A;  3RL0 B;  2FYZ A;  3B8E B;  2E74 D;  2B9B A;  1K73 Q;  1ZN5 A;  3JSV C;  2WSF J;  2AEM A;  3VMX A;  1LNQ A;  1OMI A;  1NYH A;  2N9B A;  1EXI A;  1BGY E;  3CX5 I;  3LW5 J;  1EZV I;  1N7S D;  2B88 A;  1E5W A;  3MHV A;  3H1J E;  1SQP G;  3AEG C;  3OAK A;  1J1E B;  1RE3 C;  3H32 B;  1BGY J;  2OYH B;  3A0B H;  2WPV B;  3JC2 2;  4NPE A;  4UB6 E;  3L74 E;  3T97 B;  2ZFC A;  1FZB A;  1BCC G;  3AEE C;  3H1J J;  1SFC D;  1VQN P;  5AVR B;  5H2F H;  3PHL A;  2KSE A;  4L74 A;  1W5C E;  5L8R J;  3L74 J;  5K5G B;  2JDI H;  3L75 G;  1N7L A;  1LTB C;  4WB4 A;  4ZKU A;  2QEX P;  2OYI A;  4OH8 B;  2JKV A;  1BE3 D;  2Y0C A;  5APY A;  4YPC A;  3H1K E;  1FZG A;  1NGM B;  2OTJ P;  3USS A;  1RQV A;  3NFQ A;  3L36 A;  2E74 B;  2BCC J;  3H1K J;  4JF7 A;  2L5G B;  1SQV K;  5B5E E;  2W83 C;  1YTZ T;  1FZA A;  1N7S B;  5AW5 B;  2GM4 A;  1HBW A;  1SQQ E;  2K9J B;  1SS1 A;  1NTZ D;  3H25 A;  1S5L E;  2Q1K A;  3U1C A;  1USE A;  4M3L A;  4UB8 H;  2FY8 A;  2QSI A;  3A7O A;  1SQQ J;  3H1H E;  1SFC B;  2LXC B;  5AW0 B;  4R4M A;  3KZI H;  2FFD A;  1ZRT E;  2BAS A;  2H88 C;  1S9K E;  3RK3 E;  2JP3 A;  1KB9 D;  1IFM A;  1FZC B;  1OVV A;  5CBO A;  4LC1 A;  2I1J A;  3AE2 C;  5CHX A;  3BAS A;  5CJ4 A;  1IK9 A;  3PLN A;  1G1I A;  2XND H;  4KT0 J;  1KC8 Q;  4BWN A;  2QJK B;  4PD4 D;  2M3B A;  5AVY B;  1MUU A;  1GTW A;  2M5A B;  1IFN A;  5CCG A;  2KS1 B;  3VYI A;  4AYC A;  1NTZ K;  2FYU E;  2K9Y A;  3L71 E;  1HGZ A;  1CSB A;  4WY4 A;  1MFZ A;  1Y47 A;  1PGO A;  5BU5 A;  1N7S A;  1IFI A;  3C8V A;  4K35 A;  5APQ A;  5AVX B;  2GA1 A;  5GTH E;  5CJ0 A;  1SQP J;  2N1T C;  1GK4 A;  1YHQ P;  1H88 A;  3CCM P;  4HJG H;  1M1J B;  2GUV A;  3CXH H;  4EI2 A;  1N8R Q;  1N86 A;  1JOC A;  1KIL D;  1NU1 K;  1BCC J;  2IYO A;  1Q81 Q;  1GW4 A;  2ZVN B;  1NAY A;  2IBZ G;  3I5C A;  1XTC C;  4BXL A;  1A02 F;  1LWU A;  3W67 A;  2C0W A;  1LTJ C;  2JO1 A;  3FGA D;  1ZME C;  4DCK A;  2KNC A;  1N73 C;  3KQG A;  5KKZ C;  5C39 A;  2M0B A;  1PP9 G;  2OAR A;  3HUS C;  3A3Y B;  2WTY A;  1M56 D;  2R3S A;  2LR2 A;  4N6J A;  1MV8 A;  4IFM A;  2HPC A;  5KLV K;  2HOD A;  2O3J A;  5KTB A;  3O6Q A;  3V4Q A;  2G3A A;  2HG5 D;  3FWL A;  1KYO H;  1L2P A;  2OYO A;  2AEF A;  3B71 A;  1S5L X;  2E75 D;  5AVQ B;  1NOH A;  1KIL B;  3L4F A;  1BE3 E;  1M1J A;  3G4S P;  4D6T E;  4YTP C;  2W8Z A;  4U7J A;  3TK1 A;  4YXD C;  3K5B A;  1NTK K;  2K37 A;  1PPJ G;  1KV4 A;  4D6T J;  1VQM P;  2Z5H A;  3RBX A;  2QE7 H;  3TF5 A;  2KLV A;  3L72 D;  3B5N D;  2OYI C;  1JY3 O;  3LIE A;  4Y99 B;  2C9L Y;  1R8E A;  1LP1 A;  1NAF A;  1OWA A;  2ZYD A;  1EDK A;  3L74 D;  1HGV A;  3MUD C;  1Q82 Q;  3OA7 A;  2KZI A;  2NZ2 A;  1QEX A;  2J5U A;  3Q5S A;  2ZT9 C;  3BVH A;  1VF5 D;  2QA4 P;  1YQ4 C;  2KP8 A;  3S1K A;  5AVW B;  3NTN A;  3VMA A;  1KB9 E;  2K3R A;  1L0N G;  1W2B O;  2E75 B;  1GL2 A;  1OW7 A;  1JY2 O;  2BCC D;  1L4A C;  2PGD A;  1P84 D;  4WBA A;  1ZW0 A;  4ZMD A;  4H0L D;  5GTI E;  1T2K D;  3VP9 A;  1YIT P;  1VDF A;  1Q2N A;  4PD4 E;  2NPS A;  3GF3 A;  3L70 G;  2YMK A;  3H1L G;  1KB9 I;  3NXS A;  5KJ7 A;  2WPS A;  2YXQ B;  3B5N B;  1JO5 A;  1SQQ D;  1LGH B;  4W7Z A;  4N78 E;  3VOP A;  2QG4 A;  1NO4 A;  1WMK A;  3IR9 A;  5B66 H;  1RF1 A;  2B87 A;  3M06 A;  3RK2 D;  2WMM A;  4BRY B;  4JPZ B;  5AW2 B;  4LGD E;  1PP9 J;  1LTJ B;  1LT9 C;  1N73 B;  3QWO C;  3WMM 0;  1LJ2 A;  4OGQ C;  5CCG C;  3CC4 P;  1S9K D;  1VF5 B;  1RY3 A;  1KIL E;  1YJN P;  3HTK A;  1QGK B;  3Q5P A;  2YNY A;  3P7K A;  3HRN A;  1SQX E;  2WT7 A;  1L0L D;  3FXD A;  1G1J A;  3AE8 C;  4I2L C;  4H0L B;  1RF0 A;  5AVS B;  1SQX J;  2QJY B;  2QVA A;  1MFT A;  2D2C C;  1PPJ E;  2ZT9 D;  3IAO A;  1PZQ A;  1SQQ K;  3MD0 A;  2R32 A;  3TNU A;  2JR8 A;  1MZ9 A;  1LWU C;  1SQP D;  2R5D A;  4U3F G;  3GHG A;  3MTU E;  1L4A D;  1RHZ B;  3RK2 B;  3B5N A;  1SVF A;  5M1B A;  1YI2 P;  1HVV A;  1ZV8 A;  2V7Q J;  1BCC D;  5BU8 B;  3HE4 B;  3BCC G;  2I8D A;  1URQ A;  1OW6 A;  1CW5 A;  1VQL P;  2QIW A;  3L75 D;  3AEB C;  4EDF A;  3SWF A;  1DX7 A;  2C0X A;  3EWK A;  2OTK E;  1NTM G;  4A7P A;  5CBN A;  1KZU B;  3BRT B;  3CCL P;  3VMY A;  1FOS E;  1AA0 A;  4EIJ A;  2P67 A;  4DZO A;  3L72 E;  4OGQ D;  1JY3 P;  2W6B A;  5CCH D;  2ZT9 B;  2FYU K;  1JUN A;  3Q3D A;  1RE4 A;  4Z1M H;  4LLH A;  1Y9B A;  3L70 J;  3L72 J;  1AQ5 A;  3VN0 A;  1K8A Q;  1L4A B;  2N9Y B;  5KAI H;  3TDK A;  2OTL P;  3JCU E;  5AW8 B;  3P8C D;  2O1K A;  1JY2 P;  4I7Z C;  4DT0 A;  1YJ9 P;  2BCC E;  3ITK A;  1HH0 A;  2KYV A;  4D6T D;  5AW4 B;  2R5B A;  3WUV A;  1P84 E;  3KDP B;  2QJP C;  1GW3 A;  4C46 A;  2C9N Y;  4K3A A;  2M3E A;  3MGN A;  1S2E A;  3HD7 D;  3V5B A;  2WIT A;  4CPG A;  3FXE A;  1VQ9 P;  3L35 A;  1GL2 C;  2KI7 B;  3MZW B;  1M57 D;  4OGQ B;  3Q5R A;  2E5T A;  1AVO A;  1H0T B;  1SQV G;  1HJ0 A;  3OJA B;  5AW1 B;  3EQ2 A;  1NKZ B;  3GG2 A;  1P84 I;  1PFI A;  2E76 C;  5KLI B;  2Y0E A;  3AE9 C;  5AVV B;  3H32 A;  3CME P;  2HFE D;  2OYH A;  1KD1 Q;  1VQ7 P;  4PJ0 H;  3T97 A;  3TGU G;  1ZLL A;  1ZXG A;  5KJ7 C;  2FYN B;  2ZXX A;  1VQK P;  3WUT A;  2O1J A;  4RKU J;  1FZE A;  3RBZ A;  2IYP A;  2BEZ F;  1SQB E;  2Q3E A;  1L0L E;  2XU6 A;  2XDJ A;  2IBZ D;  1G2C B;  3SFE C;  2CK3 H;  3SWY A;  3L37 A;  2HLO A;  2A45 I;  1SQB J;  2YKO A;  1L0L J;  3HD7 B;  5AVT B;  1T6A A;  4GT1 A;  4W7Y A;  1PP9 D;  1JY3 N;  3H1I G;  4N78 D;  4JYB A;  1N2D C;  1SQP E;  1S1C X;  1KFN A;  4N3Y B;  1H8A A;  2FXO A;  1NTZ G;  1RF0 C;  2K9J A;  3M0D A;  1BCC E;  3GW6 A;  2IDB A;  4IL6 H;  1PL5 A;  2P10 A;  1JM0 A;  3C9I A;  1Q86 Q;  1PGP A;  1SFC A;  2MKV A;  3V4W A;  3G6E P;  3L75 E;  4H13 C;  5APW A;  1BSN A;  3GHG C;  1JY2 N;  1WT6 A;  3AE3 C;  1SQX D;  3R4Y A;  3PTZ A;  2E43 A;  3CX5 H;  4WWI A;  1EXJ A;  1ZP0 C;  1NU1 G;  2W6J H;  3L73 G;  1FZC A;  4C7N B;  1DH3 A;  1J1D C;  3L75 J;  5APU A;  4EOT A;  5TIS E;  2Q9I A;  2IX7 C;  1URQ C;  2XNX A;  1Z56 A;  4H44 C;  2FXM A;  1OVU A;  1HTL C;  1FZF A;  1KQL A;  2ITA A;  1JTH B;  1PPJ D;  3MIW A;  4ASW A;  5AW3 B;  3LW5 H;  2KB7 P;  2QM8 A;  3FX0 A;  4AQR D;  2M5A A;  3G3Z A;  3ZDM A;  2KS1 A;  4L75 A;  4JBZ A;  4XE5 B;  2WSC J;  1W2E A;  3CMA P;  2AXT E;  5KLV G;  1FDO A;  2HYN A;  1T3J A;  4UB6 H;  3CXH D;  2QRX A;  3BRV B;  3WU2 E;  1JMB A;  3P8C E;  1RE4 C;  1WRG A;  1J2J B;  1SQX K;  1L0N D;  5CMZ A;  1YYC A;  3CWB G;  2A06 G;  2Y0D A;  4PV1 C;  2PAJ A;  3TGU J;  1VQP P;  3B4S A;  4XFJ A;  2L91 A;  1RE3 A;  1X22 A;  2N1T D;  1IK7 A;  3L70 D;  1S3J A;  3H1L D;  1NTK G;  1AV1 A;  3I56 P;  4RJT A;  3CI9 A;  3Q2Y A;  2YO2 A;  1YQ3 C;  1SP4 A;  3RK3 C;  3A0B E;  1JMM A;  1LTI C;  5B5E H;  2I1K A;  2IZ1 A;  3KPE A;  3VTP C;  5H2F E;  1USD A;  4TLF A;  1D7M A;  1KYO D;  3RL0 C;  4HB1 A;  5AW9 B;  2PRR A;  3AE7 C;  1FBM A;  4HYT B;  3MP7 B;  3R2P A;  3CCU P;  1A02 J;  2AEJ A;  1YIJ P;  1PIX A;  3D70 A;  1EZV G;  5E79 H;  3AE6 C;  5AW7 B;  1J1E C;  3VP8 A;  2G8Y A;  3CC7 P;  3AE5 C;  1KIL A;  2IBZ E;  2H43 A;  2FFD C;  3I55 P;  4RES B;  1OXZ A;  3AE4 C;  1NHL A;  3FWN A;  1BDC A;  3D71 A;  1FAV A;  4EYY Q;  4ZKP A;  2N1T B;  2H7H A;  2J58 A;  1AJY A;  1BGY G;  3AEC C;  1PP9 E;  1EDJ A;  1OFC X;  2KZJ A;  3PH0 A;  3PP5 A;  1OW8 A;  2RKL A;  3H1J G;  1FDI A;  3ABV C;  4H13 B;  4UB8 E;  1AFO A;  2WVR A;  2IBZ I;  3M91 A;  5KAF H;  1IFP A;  3L74 G;  4PD4 I;  3CC2 P;  3KZI E;  2Z5I A;  5KKZ B;  4NPD A;  4PJ0 E;  2M8R A;  2WPR A;  3KYQ A;  3AEA C;  1FOS F;  1FJP A;  3A0H H;  3SFD C;  3HUS B;  4WY4 C;  2IZ0 A;  3G9R A;  3CD6 P;  1N7S C;  2ZYA A;  5KLV J;  1SQB D;  1GZL A;  3D6Y A;  3M0D C;  2FXP A;  4WVZ A;  1NTM D;  3H1K G; 
#chains in the Genus database with same CATH homology
 1MFZ A;  4AUW A;  1JTH A;  5BU5 A;  1N7S A;  1IFI A;  3P8C D;  5APQ A;  2O1K A;  1IO4 A;  1JY2 P;  5AVX B;  1RF1 B;  3V2Q A;  2PP6 A;  1HH0 A;  5CJ0 A;  2KYV A;  5AW4 B;  2N1T C;  2R5B A;  1GK4 A;  1H88 A;  3KDP B;  1FJK A;  1LTA C;  1GW3 A;  1M1J B;  2VRS A;  2GUV A;  4C46 A;  2C9N Y;  1N86 A;  1URQ D;  1JOC A;  1KIL D;  1NU1 K;  4I1L A;  3MGN A;  2XZR A;  2JEE A;  2LKM A;  1GU5 A;  3HD7 D;  3V5B A;  2R3C A;  1GW4 A;  2Q7C A;  2WIT A;  3P8M C;  3I5C A;  1A02 F;  1L0N K;  1XTC C;  4O9B A;  3H6P A;  1LWU A;  1CZQ A;  2C0W A;  1LTJ C;  3HTK B;  2A45 H;  2W27 A;  2P1J A;  3L35 A;  1GL2 C;  1JNM A;  2Z4E A;  1N73 C;  1T3U A;  3KQG A;  3A2A A;  3V2N A;  2WT7 B;  3OJA B;  2OYH C;  5AW1 B;  1CI6 B;  3EQ2 A;  2KSJ A;  1NKZ B;  1LTJ A;  1PFI A;  2E42 A;  2WWW A;  1N73 A;  5AVV B;  2OAR A;  2O01 H;  3H32 A;  3HUS C;  3A3Y B;  2HFE D;  2WTY A;  2OYH A;  1SQB K;  2OYI B;  2XV5 A;  1JCD A;  1L0L K;  1VPC A;  5BVZ A;  2XKM A;  3T97 A;  3BAT A;  3N4X A;  4JYC A;  4N6J A;  1MV8 A;  4IFM A;  1XTG B;  1LTS C;  1ZLL A;  2IFN A;  2HPC A;  2FKW B;  5KJ7 C;  5KLV K;  1JCC A;  2MJZ A;  5AVU B;  2HOD A;  3HUS A;  1HWT C;  1GDT A;  5KTB A;  3TNU B;  3V4Q A;  2HG5 D;  3GHG B;  2CPS A;  2O1J A;  3IFM A;  1FZE A;  5CCG D;  2XU6 A;  2XDJ A;  1M1J C;  1GK6 A;  1SQP K;  1J1D B;  1G2C B;  1ZR4 A;  4GIF A;  5AVQ B;  3SWY A;  2P2U A;  1NOH A;  1URQ B;  1KIL B;  3L37 A;  4WY4 D;  2HLO A;  2A45 I;  3L4F A;  2ZXE B;  2YKO A;  5APS A;  1M1J A;  3HD7 B;  5AVT B;  4GT1 A;  2CPB A;  4W7Y A;  1JY3 N;  3RK3 D;  4N78 D;  5CCH C;  4JYB A;  1N2D C;  3TK1 A;  2FFD B;  1NTK K;  4XA4 A;  3M9H A;  1KFN A;  4N3Y B;  3V2P A;  3II6 A;  1H8A A;  3HE4 A;  1X8Y A;  1RF0 C;  2Z5H A;  5APX A;  3M0D A;  1GD2 E;  1SFC C;  2KLV A;  3VMZ A;  3RL0 D;  4IFD K;  3B5N D;  2OYI C;  3E1I A;  1CI6 A;  2IFM A;  1JY3 O;  3LIE A;  4Y99 B;  2C9L Y;  3M9Q A;  4W80 A;  3TSI A;  1NAF A;  1NKN A;  1OWA A;  3C9I A;  1SFC A;  3U59 A;  3V4W A;  1FZC C;  1X9V A;  2N1T A;  3TYY A;  1DEB A;  1HGV A;  5APW A;  3OA7 A;  3GHG C;  1JY2 N;  1WT6 A;  1LT9 B;  2WSC H;  2E43 A;  1FZC A;  1DH3 A;  4C7N B;  2W6A A;  3BVH A;  2KP8 A;  1J1D C;  3P32 A;  5APU A;  5AW6 B;  4EOT A;  3MUD A;  3NTN A;  2GUS A;  5AVW B;  2Q9I A;  2IX7 C;  3N7N A;  1YTZ I;  1URQ C;  1KIL C;  2XNX A;  1Z56 A;  2FXM A;  1GL2 A;  1HTL C;  2A45 G;  4HH2 A;  4WY4 B;  1FZF A;  1KQL A;  4B86 A;  1JY2 O;  1JTH B;  3HD7 C;  3M9B A;  1L4A C;  2NPS C;  2JJL A;  3MIW A;  5AW3 B;  1H89 A;  3LW5 H;  4WBA A;  2KB7 P;  2QM8 A;  3HE5 B;  4AQR D;  1FDM A;  1NTM K;  1T2K D;  3VP9 A;  3RK3 B;  3O8Z A;  1VDF A;  3U1A A;  3G3Z A;  1L4A A;  2NPS A;  5APT A;  5AVZ B;  1X79 B;  1GU4 A;  4XE5 B;  2H8P D;  1W2E A;  5APV A;  1M7L A;  1RF1 C;  1NH4 A;  3NXS A;  5KJ7 A;  2WPS A;  3UIA A;  2HYN A;  1QL1 A;  3RL0 B;  3B5N B;  2FYZ A;  1JO5 A;  1T3J A;  1LGH B;  4W7Z A;  3B8E B;  4Y99 C;  4N78 E;  3VOP A;  1ZN5 A;  1LWU B;  1NO4 A;  2YMY A;  3VMX A;  3IR9 A;  1RF1 A;  1HUC A;  2N9B A;  3BRV B;  3M06 A;  3RK2 D;  3EFG A;  3P8C E;  1RE4 C;  1WRG A;  5AW2 B;  4LGD E;  1J2J B;  1T8Z A;  1N7S D;  1E5W A;  1SQX K;  2Q3I A;  1LTJ B;  5CMZ A;  1LT9 C;  1YYC A;  3OAK A;  1ZR2 A;  1N73 B;  1J1E B;  1FU1 A;  1RE3 C;  3H32 B;  3WMM 0;  5CCG C;  1S9K D;  2OYH B;  2PAJ A;  1SLQ A;  1RY3 A;  1IFJ A;  2WPQ A;  2ZFC A;  1FZB A;  1LT9 A;  2HPC B;  1SFC D;  1RE3 A;  3HTK A;  5AVR B;  1QL2 A;  2HOD B;  2WSE H;  2YNY A;  2N1T D;  3P7K A;  5CCH A;  3HRN A;  2WT7 A;  2YKP A;  2P7J A;  1G1J A;  3CI9 A;  2QM7 A;  4I2L C;  2YO2 A;  3RK3 C;  1SP4 A;  1RF0 A;  1N7L A;  1LTB C;  4WB4 A;  4ZKU A;  2YKQ A;  1JMM A;  5AVS B;  1LTI C;  2OYI A;  4IFF A;  2I1K A;  4OH8 B;  3KPE A;  3HE5 A;  5APY A;  3VTP C;  1FZG A;  1GL2 D;  1LTG C;  2POH A;  1SQQ K;  3MD0 A;  3M0A A;  3RL0 C;  3B5N C;  2R32 A;  3TNU A;  1KFM A;  4C7R A;  5AW9 B;  1MZ9 A;  1LWU C;  3NFQ A;  3L36 A;  2R5D A;  1FBM A;  4HYT B;  3GHG A;  3MTU E;  2WSF H;  1EQ7 A;  3R2P A;  2J59 M;  4JF7 A;  1L4A D;  1SQV K;  2L5G B;  2NPS D;  3CLQ A;  3RK2 B;  3B5N A;  1SVF A;  1A02 J;  1HVV A;  3A5T A;  1ZV8 A;  2IPP A;  2YO3 A;  1YTZ T;  1FZA A;  5BU8 B;  1N7S B;  3HE4 B;  1G2C A;  5AW5 B;  2Q5U A;  5AW7 B;  1J1E C;  2GM4 A;  1HBW A;  3VP8 A;  3LID A;  5KJ7 D;  1URQ A;  1KIL A;  2H43 A;  3U1C A;  2FFD C;  1HJB A;  4M3L A;  1CW5 A;  3HD7 A;  4RES B;  1OXZ A;  3A7O A;  3SWF A;  1NHL A;  1DX7 A;  2C0X A;  1SFC B;  1FAV A;  5AW0 B;  4ZKP A;  2N1T B;  2H7H A;  2FFD A;  2J58 A;  2BAS A;  1KZU B;  1S9K E;  3BRT B;  3PP5 A;  3V2R A;  1IFM A;  1FZC B;  1IC2 A;  1T2K C;  3VMY A;  1AFO A;  1FOS E;  3M91 A;  1LTT C;  4LC1 A;  4EIJ A;  2P67 A;  4DZO A;  1NWQ A;  2I1J A;  5CHX A;  3BAS A;  1JY3 P;  1GL2 B;  5CJ4 A;  2W6B A;  1IK9 A;  5CCH D;  2FYU K;  2Z5I A;  2M8R A;  1JUN A;  1G1I A;  2WPR A;  1RE4 A;  3KYQ A;  1FOS F;  4LLH A;  4GKG A;  1IFD A;  1FJP A;  1AQ5 A;  2M3B A;  5AVY B;  1MUU A;  3RK2 C;  1GTW A;  4KHX A;  3VN0 A;  1IJD B;  1IFN A;  3NMD A;  1L4A B;  2NPS B;  2KOG A;  3HUS B;  4WY4 C;  5CCG A;  4C7N A;  1N7S C;  3VYI A;  2WZ7 A;  4AYC A;  1NTZ K;  1GZL A;  4I6M C;  3M0D C;  4DOJ A;  5AW8 B;  1HGZ A;  1CSB A;  4WY4 A;  3CL3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...