1XTCC

Cholera toxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
SNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN
publication title The three-dimensional crystal structure of cholera toxin.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1996-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1xtcC00
1LTGC 1LTIC 1LTSC 1LTAC 1HTLC 1LTBC 1XTCC 1LTTC
chains in the Genus database with same CATH superfamily
3Q5RA 1KORA 3BCCG 3PP5A 1VQ7P 3PJSK 2YO2A 5AW9B 5KJ7A 2FFDC 4GT1A 1T8ZA 5BU8B 3CWBE 3CCQP 4ZKPA 1OWAA 1FS0E 2MJZA 3H6PA 3G3ZA 3AEDC 1KB9D 1RY3A 3LW5H 3S9OA 2QJYC 1JEKA 1HVVA 1SQXE 3SWYA 1FE6A 3L70J 3RK3D 3Q3DA 2D2CC 2HPCA 2L5GB 3H1HE 3NTNA 1S3JA 5BVZA 2AXCA 2IBZI 4BRYB 3L70D 4XFJA 4UB6E 2GUVA 4H13C 1LP1A 2N1TD 1BE3G 1A02J 2JKVA 1SQBE 1K05A 2O1KA 1NTME 3PLNA 1NTZG 4WB4A 1UIXA 3CD6P 3FWLA 3PHLA 2QA4P 1JY3O 1GL2A 2RMZA 2A06D 4WY4A 2HODB 3HUSC 3A0BE 1PV3A 3RK2D 1NGMB 2K9YA 1MZ9A 3FWNA 1S5LE 3QH9A 2Z5HA 2K1AA 4PD4D 2N9BA 1BCCJ 1VF5C 4LGDE 1K73Q 1N73A 2IBZE 1OX3A 1H8AA 3EFGA 1JNMA 3KZIH 1LWUC 3V2NA 1BCCD 2E5YA 2BCCJ 1VQLP 2FY8A 1SS1A 1EDKA 4RKUJ 4N78D 1NU1E 5APSA 3UIAA 2WSEH 2KK7A 3L4FA 3OAKA 4QMAA 2FYUE 5APXA 2IYOA 3B5NC 4W7ZA 2K37A 3L74G 4WBAA 1ZMEC 3CCRP 1OIPA 1GK6A 2WSSH 1KQGB 3GLMA 3V2PA 2ZYGA 2FFDB 3L75E 4TT3H 1FJKA 3TGUE 1M57D 3KPEA 5B66E 3GF3A 3AE3C 2XNXA 1EZVI 4N6JA 2QJYB 3SSUA 3V4WA 2IZ0A 2A45H 1S1CX 3H1JE 4C7NB 2D2CB 5APWA 1OXZA 5DJTB 4U3FJ 2QRXA 2ZJSE 2J59M 4H13B 3AEEC 2FYZA 1PL5A 2I1JA 3VOPA 4U3FD 4KHXA 2W8ZA 2C0WA 4EI2A 3HUSB 4UB6H 2E43A 1PP9J 2O01H 1SQVG 5CCHA 3O8ZA 1EZVE 1EXJA 3WUVA 1LT9A 4L73A 3NMDA 2LXCB 1VQPP 1BGYE 1X22A 1KILA 3AEBC 4Z1MH 1PP9D 1VF5B 3PRJA 1RF0C 4DCKA 4CPGA 1FZCA 3A0BH 3BCCJ 1NWQA 3L71G 3GW6A 1Q81Q 2AEFA 5CJ0A 1P84D 1S5LH 2FXOA 3O6QB 1NTZK 3BCCD 2OYIA 1NTKG 4BWNA 4NPFX 1ZP0C 1ZR2A 3R4YA 2D2CD 2XV5A 2Q9IA 1JMMA 5AW6B 3TNUA 1AFOA 1LTAC 1JY3P 1VQ6P 2BEZF 2Q7CA 3HE4B 4D6TG 1S9KD 3PTZA 2NPSC 1SQQG 1LTJB 2R3CA 1OMIA 4ZKUA 2KSEA 3OW2O 2I1KA 2N1TC 1BE3J 2YNYA 5AVSB 1JMBA 2Q5UA 5KLVE 2J58A 1NTZJ 1LTBC 2P2UA 2ZXEB 1JCCA 3P32A 3CCUP 2OGUA 1BE3D 1NTZD 4JYBA 2AXTE 2WSFJ 2M5AB 1G2CB 2RH0A 2YMKA 3B8EB 1OVVA 5AVUB 1RF1B 1FBMA 1YQ4C 1Y8AA 2KLUA 1KYOD 2BASA 2O01N 4DOJA 1VPCA 1EDJA 1YYCA 1CI6B 5APVA 5AW1B 3GG2A 1MFTA 2R32A 1M7LA 1NKZB 3EWKA 4C7RA 4XE5B 1K9MQ 4C46A 3V5BA 3USSA 2Q3IA 1YI2P 5DJUB 1E79H 2V7QJ 1RE4A 5B5EE 1EC5A 2KS1B 3L74J 2OYHC 1OW8A 3I56P 4I2LC 3GHGC 1HBWA 2PP6A 1AV1A 3R2PA 3L74D 3A2AA 3N4XA 1GU4A 1ZW0A 3CXHI 1RHZB 1L4AD 1ZLLA 4UB8H 3CMAP 2YIUC 2P10A 3FX0A 3H1KG 3VMYA 1J1EC 2GUSA 1SQVK 3L73E 3VMXA 4KT0J 3KZIE 2W6AA 2ZXXA 2B89A 2NPSB 3CMEP 2WT7B 2HODA 5AW4B 4I1LA 5CBOA 3N7NA 3FXDA 3BASA 1L0LE 4U7JA 2AEJA 1M90Q 1N7SA 3SFDC 2B87B 1A02F 1X79B 4LLHA 3P8MC 2A45G 4JF7A 1NTKK 3CXHE 2QE7H 2ZYAA 2B9BA 5CCGC 3CWBG 4ZNCA 3HTKB 3JSVC 4EIJA 3RGUA 4AUWA 3GF7A 3SWKA 3P7KA 4R4MA 3MP7B 4ZMDA 1RQUA 1G1JA 1SQXG 2RKLA 2QJKC 1SQVD 1SVFA 1SQQK 3H1HG 4GOFA 1T2KC 1DD3A 1T3JA 2AXTH 3L71J 1HTLC 3CCJP 3D71A 3M9BA 3T97B 1JY2N 1HGVA 5EFWB 1PZQA 1D7MA 1JUNA 1SQBG 2L91A 4PJ0E 1NTMG 3L71D 3U59A 3G9RA 1NTKJ 1L0NE 1VQ9P 2YKOA 3P8CE 1QVFO 3E1IA 4EDFA 4AQRD 4AYCA 1RE3C 2W6BA 2P1JA 2Y0EA 1NTKD 2NPSD 2YMYA 1N86A 4O9BA 1GTWA 3GMAA 2OYHB 2IFMA 1PPJE 2KI7B 4L76A 1H88A 3L72E 3IN6A 3GHGB 3M0DC 4C7NA 4L75A 2MKVA 1FZGA 2OTJP 1QL2A 2IBZG 4D6TD 1KN7A 5B5EH 2YIUB 1PGPA 3Q1MA 1SQQD 1J1EB 2LXBA 1JM0A 5AW0B 2ZT9C 1FZFA 4DZOA 3CCEP 4IFMA 5H2FE 1NU1G 3CLQA 1WT6A 2WITA 1VQKP 2WWWA 2P67A 2H88C 5APYA 1W2BO 2FYUG 1SP4A 5GTIE 1J1DC 3B71A 2GA1A 3AEGC 3CX5D 1X8YA 3FXEA 2KUBA 1GMJA 3QWOC 2Y9YA 4OGQC 1YBKA 1JB0J 2OTKE 3L75G 4RJTA 3D70A 3AE4C 3H1LE 3TGUG 3VTPC 2WZ7A 5APUA 3CCSP 1LWUA 3C9IA 2Q6QA 2FBWC 5AW5B 2WQYC 3HE5A 3M06A 3O6QA 2QJKB 1BDCA 1S72P 5AVYB 2QSIA 1SQPE 3CXHH 2HG5D 3HD7C 3H1JG 2KIKA 1ZN5A 2XDJA 5AVXB 2JDIH 4JYCA 3B5NA 1LTJC 3TK1A 3W67A 1U57A 5APQA 3SFEC 2FYNB 1AVYA 3HE4A 2WSEJ 5AW7B 1HJ0A 1USEA 1GW4A 1L4AC 3A7OA 1VQOP 3AEFC 1LTIC 3H1KJ 3H1IE 1QL1A 3RBZA 4K35A 1EZVG 2QJPC 3V6IA 1AJYA 3U1CA 1ZR4A 3H1KD 1SQXK 4PJ0H 3E7KA 2M0BA 1BGYG 3MUDC 1HGZA 2K9JA 1RF1C 3M0AA 1R5SA 1X9VA 2C9LY 5AVWB 1ZRTD 1IFNA 4HYTB 1VQ5P 3TYYA 1Q7YQ 3LIEA 5CMZA 5CCGD 1GL2B 1P84H 3WU2E 5C39A 1M56D 4JPZB 4WY4B 2ZT9B 4IL6X 2Y9ZA 1SQBK 3RL0g 1M1JC 1NTMK 1FDMA 3CC4P 5CCHC 3CWBJ 1IC2A 1OZHA 1IFMA 3G71P 1IJDB 3BVHA 4RESB 1J1DB 2WPQA 5E79H 4YXDC 3CWBD 1ZOYC 4GODA 4UB8E 1VDFA 1T2KD 1EXIA 1N73B 1KILE 1SQXJ 1KB9I 3ZDMA 2KYVA 3M9QA 4W80A 1U7MA 5H2FH 4Y99C 4OGQB 3H1HJ 1FDIA 3KQGA 1SQXD 1RH5B 5GTIH 2CK3H 2OYIC 5AW2B 3H1HD 1SQBJ 1URQC 5KLVG 2PFXA 3MIWA 1NTMJ 2Y0DA 1TU3F 1QVGO 1NU1K 5KAIE 3HD7B 1T6AA 3OA7A 1K8AQ 1SQBD 2FYUK 2KNCB 2NZ2A 2QEXP 1NTMD 3SWFA 1EDLA 4B86A 1HF9A 1KQFB 4GDOA 1KB9E 4GKGA 3A3YB 2Y0CA 4H0LC 1Y9BA 1GL2D 2NPSA 5KTBA 2H43A 3IFMA 1QEXA 2R5BA 3RK3E 1L4AB 4PD4I 3TDKA 4WY4D 2ZT9D 2WT7A 1N8RQ 1SLQA 2Q3EA 2SPZA 3VN0A 1YJWP 1G1IA 2N1TA 1YITP 2WPVB 3JC22 3L70E 4R4LA 3D6ZA 2IBZD 2QJPB 1YHQP 2ZYDA 1PGQA 3NXSA 4BXLA 3HTKA 2JWAA 2FYUJ 3BRVB 2K88A 1NU1D 4OGQD 3EQ2A 2A06E 4H44C 2FYUD 2WMMA 2WSCJ 2IX7C 1M1JB 3CI9A 4IFDK 2FXMA 1JY2O 2BCCG 3MD0A 3L75J 4I7ZC 2YXRB 4PD4E 1LT9B 4HB1A 2YO3A 2OTLP 4EOTA 1HJBA 3IF4A 3T97A 3CC2P 3F5HA 2XU6A 3HD7D 3AE5C 3L75D 3TF5A 4YTPC 5BU5A 2P7JA 3WU2H 3L73G 3TGUD 3D6YA 1RE4C 1BCCE 1GK4A 1DH3A 1KMIZ 2ZVNB 1HH0A 1QGKB 2C9NY 3AE1C 3FGAD 3VMZA 3L36A 2IZ1A 4Y99B 5K5GB 3H1JJ 2JP3A 4N78E 5GTHE 4Y28J 4M3LA 1KC8Q 1NAYA 2BCCE 2OYIB 1KD1Q 1OW7A 1L0LG 3H1JD 4BRYA 4NPDA 1NKNA 2W90A 1PGOA 3GHGA 1URQB 3S4RA 4HH2A 3PH0A 1SFCC 5AVQB 1JO5A 2KP8A 3OJAB 3CC7P 1GD2E 2Q1KA 2PGDA 1DIPA 4PV1D 2E74C 1VQNP 3M9HA 4JBZA 1VQMP 4A7PA 2ITAA 2QIWA 4W7YA 1JTHB 3K5BA 3II6A 1AQTA 2M3EA 4ASWA 1ZV8A 1BGYJ 3MHVA 2LKMA 4H0LB 2YKQA 2H8PD 1KFMA 5KAIH 2WTYA 1EZVD 2XZRA 3KHUA 1NYHA 1BGYD 1LTSC 5CCHD 1N7LA 3M91A 4DJGA 1KZUB 1KB9H 1YIJP 5KLVK 1SQVJ 1IFIA 1P84I 1L0NG 3V2RA 5CCGA 1RQVA 4U3FE 1NH4A 2FKWB 2JO1A 4OWFA 3VP8A 4DT0A 1PFIA 1WRGA 1KFNA 5KJ7C 2LR2A 2JEEA 4H44B 1PPJG 1LJ2A 3VYIA 3CCLP 3E1RA 3L72G 1EQ7A 2FYNC 4I7ZB 2PAJA 1DEBA 1URQD 1H0TB 3AEAC 2FFDA 5KLIC 1PP9E 1LNQA 2E75C 1Q82Q 2QVAA 2JR8A 1NO4A 5KLVJ 3RBXA 3CCMP 3WUTA 1Q2NA 2R3SA 5KKZC 4HKZH 1P84E 1FOSF 1T3UA 1FJPA 4PD4H 4D6TJ 3BCCE 1RE3A 5KLVD 1Q86Q 1SQQJ 4H0LD 1CZQA 3KYQA 3CX5H 1KTMA 3RL0C 3AE8C 3M0DA 5E79E 2C0XA 3LW5J 1VQ4P 1GL2C 1SFCB 4IL6E 1VQ8P 4WY4C 1DEEG 5GTHH 1S9KE 4YPCA 2N9YB 1NAFA 1KYOI 3H1LG 3H32B 2IYPA 2E74B 3Q5PA 1FDOA 1NOHA 5AW8B 1JY2P 3HUSA 1Q90D 2J5UA 2B88A 2PRRA 1N7SB 2RN0A 1N73C 2QG4A 3Q2YA 4H44D 1SQPG 2W6JH 3I55P 2O3JA 3HRNA 3I5CA 4WWIA 2Z4EA 1YJ9P 1BE3E 2R44A 2YKPA 2VRSA 1NTZE 3MTUE 1L0LK 1BDDA 4EYYQ 1NVOA 4NPEA 4RO0A 2E5TA 1AA0A 4ASVA 1KYOE 3KDPB 3V4QA 3H1IG 1IK7A 1KQLA 3MZWB 2BCCD 2POHA 2UWJE 1GU5A 3L73J 2KXPB 2K3RA 1R8EA 3CPWO 1W2EA 3HD7A 3L73D 1M1KQ 2KNCA 1IZNB 5KLIB 1SFCD 3AE2C 1LTJA 2E75B 4GIFA 1L0LJ 1OFCX 4K3AA 2XKMA 2E74D 3MGNA 1XTGB 2HPCB 3BATA 1JCDA 5KAFE 5KKZB 2W83C 1L0LD 1L0NK 1L4AA 3CL3D 5TISE 1XTCC 2E76C 3L74E 4PV1C 2BEQD 2KZIA 1LP1B 1N7SD 2JWDA 1M8OB 3CXHD 3AE9C 3NFQA 3B4SA 3RL0B 2M5AA 1G2CA 3ABVC 3JCUE 1YTZT 3Q5SA 1LTTC 4LC1A 3MUDA 1PIXA 4MN4C 1RF1A 1USDA 3L37A 1W5CE 2E42A 1JY3N 1R5LA 1CI6A 2W27A 1Y47A 2QM8A 1LT9C 2GM4A 1PGJA 3C1LA 1KILC 5AVZB 2M8RA 4I6MC 2P58A 1M1JA 2KSJA 1L0NJ 1FZBA 2ZAEB 4IL6H 5KJ7D 3G6EP 1HUCA 1AVOA 1FZCC 3WMM0 1E5WA 1S5LX 3IR9A 1L0ND 3P8CD 1IK9A 1KV4A 1RF0A 1GZLA 2KZJA 2KS1A 2XNDH 3L72J 2E75D 1LWUB 2O01J 1L2PA 5APTA 1FZEA 2QM7A 2H7HA 3U1AA 3AECC 1JOCA 1GDTA 1PPJD 1LGHB 4XA4A 1CSBA 3HE5B 1SQVE 2DW3A 3BRTB 3L72D 1AQ5A 5M1BA 1OVRA 2IPPA 3L70G 4TLFA 1LTGC 1URQA 5L8RJ 2G3AA 3B5NB 1IO4A 3A0HE 1VL2A 3LIDA 2KLVA 1N2DC 1SQPK 3RL0D 3L71E 2WSFH 3RK3C 1WMKA 1J2JB 1KYOH 1MKMA 3EFFK 2H89C 4H13D 5AVVB 4YXWH 3V2QA 2OQQA 1Z56A 3H25A 2A06G 1JTHA 1QLED 1NTKE 2KOGA 3VMAA 5TJHA 2OYOA 5CBNA 2B87A 1IFPA 3CX5I 1DD4A 2ZVOB 2Z5IA 3L35A 3KXDA 2E76B 3H1LJ 1NU1J 2WSCH 4PV1B 1GW3A 3CCVP 2WPSA 1FAVA 2V4HA 4D6TE 2K9JB 3H1LD 3IAOA 1HWTC 5B66H 1SQQE 3RK2C 3WUUA 1BCCG 1VF5D 5KAFH 2WVRA 1FC2C 1SQPJ 1CW5A 2V7QH 5TISH 2KB7P 1LT1A 2FXPA 4OVNF 1SQPD 3TGUJ 2M3BA 2WPRA 1X0TA 4IOIH 1KQSO 1U7JA 1KILB 5AVTB 2I8DA 3JCUH 3C8VA 3CX5E 3TSIA 1IFDA 1H0TA 1FZCB 1YJNP 3B5ND 2O1JA 3G4SP 1FZAA 3H1IJ 1QX8A 1MUUA 2HLOA 1BSNA 4OH8B 1S4XA 2CPSA 1DX7A 1YTZI 1K04A 4HJGH 1OW6A 3H1ID 3AE7C 2OYHA 2CPBA 2HR3A 2HYNA 5CHXA 2IFNA 3VP9A 3ITKA 5AVRB 3TNUB 1H89A 1EDIA 1S2EA 2E76D 2HFED 4WVZA 1IFJA 2YXQB 1FOSE 4JQ0D 1SFCA 4IFFA 3H32A 3RK3B 4U3FG 1N7SC 1NHLA 1BSHA 1YQ3C 2OARA 2ZFCA 2R5DA 2AEMA 2A45I 1NJIQ 2JJLA 1OVUA 3A0HH 2N1TB 1MFZA 1FU1A 3H1KE 5AW3B 4GOEA 5CJ4A 3A5TA 1KILD 1UIIA 2IDBA 1MV8A 4L74A 1PP9G 3AE6C 3F89A 3W68A 2G8YA 2NRGA 1ZRTE 3S1KA 1ZXGA 3RK2B 4N3YB 4KJMA
chains in the Genus database with same CATH topology
2KYVA 4C7RA 3M9QA 4W80A 3PP5A 4Y99C 4XE5B 4C46A 3V5BA 2Q3IA 3KDPB 2YO2A 5AW9B 3V4QA 5KJ7A 3KQGA 1KQLA 2FFDC 4GT1A 1T8ZA 2OYIC 2POHA 5BU8B 1GU5A 5AW2B 1RE4A 4ZKPA 1OWAA 2MJZA 3H6PA 3G3ZA 2OYHC 1URQC 3MIWA 1W2EA 1RY3A 3HD7A 3LW5H 4I2LC 3GHGC 1NU1K 1HBWA 2PP6A 1HVVA 3HD7B 3OA7A 1SFCD 3R2PA 3A2AA 3SWYA 3N4XA 1LTJA 1GU4A 3RK3D 4GIFA 2FYUK 1L4AD 1ZLLA 3SWFA 2HPCA 2L5GB 2XKMA 3NTNA 4B86A 5BVZA 3MGNA 3VMYA 1XTGB 2HPCB 1J1EC 3BATA 1JCDA 4GKGA 2GUSA 1SQVK 3VMXA 1L0NK 2GUVA 3A3YB 1L4AA 3CL3D 2N1TD 1XTCC 1GL2D 2NPSA 5KTBA 2H43A 1A02J 3IFMA 2W6AA 2R5BA 1L4AB 4WY4D 2O1KA 1N7SD 2WT7A 2NPSB 1SLQA 4WB4A 3VN0A 1G1IA 2WT7B 2N1TA 1JY3O 2HODA 5AW4B 1GL2A 4I1LA 3NFQA 3RL0B 3N7NA 1G2CA 3BASA 4WY4A 1N7SA 2HODB 3HUSC 1YTZT 1LTTC 1A02F 4LC1A 3RK2D 3MUDA 1RF1A 1MZ9A 1X79B 3NXSA 3L37A 3HTKA 4LLHA 3P8MC 2E42A 1JY3N 2A45G 3BRVB 1NTKK 2Z5HA 4JF7A 1CI6A 2N9BA 5CCGC 3HTKB 2W27A 2QM8A 1LT9C 4EIJA 4LGDE 3EQ2A 4AUWA 2GM4A 1KILC 5AVZB 2M8RA 1N73A 3P7KA 4I6MC 1H8AA 3EFGA 1M1JA 2KSJA 1JNMA 1FZBA 1LWUC 3V2NA 5KJ7D 2IX7C 1HUCA 1FZCC 1M1JB 3CI9A 3WMM0 4IFDK 1E5WA 1G1JA 2FXMA 1JY2O 3MD0A 3IR9A 4N78D 1SVFA 1LT9B 1SQQK 3P8CD 1IK9A 5APSA 1RF0A 3UIAA 2WSEH 2YO3A 3L4FA 1GZLA 1T2KC 4EOTA 1HJBA 3T97A 3OAKA 1T3JA 2XU6A 3HD7D 1HTLC 5APXA 5BU5A 3M9BA 2P7JA 1LWUB 1JY2N 1RE4C 5APTA 1GK4A 1DH3A 3B5NC 1HGVA 4W7ZA 1FZEA 2QM7A 2H7HA 1HH0A 2C9NY 3VMZA 3U1AA 3L36A 1JOCA 1JUNA 1GDTA 4WBAA 1LGHB 4Y99B 4XA4A 1CSBA 3HE5B 4N78E 3U59A 3BRTB 1AQ5A 1GK6A 2YKOA 3P8CE 4M3LA 3E1IA 3V2PA 2FFDB 4AQRD 4AYCA 2OYIB 1RE3C 2IPPA 2W6BA 2P1JA 1LTGC 1URQA 1FJKA 2NPSD 2YMYA 1NKNA 3B5NB 1IO4A 1N86A 4O9BA 1GTWA 3KPEA 2OYHB 3GHGA 3LIDA 1URQB 2IFMA 2KLVA 4HH2A 1N2DC 1SFCC 2XNXA 1SQPK 3RL0D 1H88A 2WSFH 5AVQB 1JO5A 3RK3C 3GHGB 1J2JB 3M0DC 4N6JA 2KP8A 3OJAB 1GD2E 4C7NA 5AVVB 3V4WA 1FZGA 3V2QA 2A45H 1Z56A 1QL2A 1JTHA 3M9HA 4C7NB 2KOGA 4W7YA 5APWA 1JTHB 3II6A 1OXZA 1J1EB 1ZV8A 2Z5IA 2LKMA 2J59M 5AW0B 3L35A 4DZOA 1FZFA 2YKQA 2FYZA 2H8PD 1KFMA 2WSCH 4IFMA 2WTYA 3CLQA 1WT6A 2WITA 1GW3A 2XZRA 2WWWA 2P67A 2WPSA 1FAVA 2I1JA 3VOPA 5APYA 4KHXA 1LTSC 5CCHD 1SP4A 1N7LA 3M91A 1HWTC 1J1DC 3RK2C 2C0WA 1KZUB 3HUSB 5KLVK 1CW5A 2E43A 1IFIA 2O01H 1X8YA 5CCHA 2KB7P 3O8ZA 3V2RA 5CCGA 1LT9A 3NMDA 1NH4A 2FKWB 3VP8A 1KILA 2M3BA 2WPRA 1PFIA 1WRGA 3VTPC 2WZ7A 1KFNA 5APUA 1RF0C 5KJ7C 1KILB 1LWUA 5AVTB 2JEEA 3C9IA 1FZCA 3VYIA 1NWQA 5AW5B 3TSIA 1IFDA 1FZCB 3HE5A 5CJ0A 3M06A 3B5ND 1EQ7A 2O1JA 1FZAA 2PAJA 1DEBA 5AVYB 1URQD 1MUUA 2FFDA 2HG5D 2HLOA 3HD7C 1NTZK 1ZN5A 2OYIA 2XDJA 4OH8B 5AVXB 2CPSA 1DX7A 1YTZI 4JYCA 3B5NA 1LTJC 1NO4A 3TK1A 2OYHA 2CPBA 1ZR2A 2HYNA 5CHXA 5APQA 2XV5A 2IFNA 2Q9IA 3VP9A 3HE4A 1JMMA 5AW6B 3TNUA 1FOSF 1T3UA 1AFOA 1FJPA 5AVRB 1LTAC 1JY3P 2Q7CA 1RE3A 5AW7B 3HE4B 3TNUB 1GW4A 1S9KD 1L4AC 3A7OA 1H89A 2NPSC 1LTJB 1LTIC 1CZQA 3KYQA 2HFED 1IFJA 2R3CA 1FOSE 1QL1A 1SFCA 3RL0C 4ZKUA 4IFFA 3M0DA 2C0XA 2I1KA 2N1TC 1GL2C 1SFCB 2YNYA 3U1CA 1ZR4A 5AVSB 1SQXK 3H32A 2Q5UA 3RK3B 4WY4C 1N7SC 1NHLA 2J58A 1S9KE 1LTBC 1NAFA 2OARA 2P2UA 3H32B 2ZFCA 2ZXEB 1JCCA 1HGZA 2R5DA 3P32A 1RF1C 3M0AA 1X9VA 2C9LY 5AVWB 1NOHA 2A45I 1IFNA 4HYTB 5AW8B 2JJLA 3TYYA 1JY2P 3HUSA 3LIEA 5CMZA 4JYBA 5CCGD 2N1TB 1MFZA 1GL2B 1FU1A 1G2CB 5AW3B 5CJ4A 4WY4B 3A5TA 1N7SB 1N73C 1KILD 1SQBK 1MV8A 3B8EB 1M1JC 1NTMK 3HRNA 1FDMA 3I5CA 5CCHC 2Z4EA 5AVUB 1RF1B 1FBMA 1IC2A 1IFMA 2YKPA 2BASA 4DOJA 1VPCA 1IJDB 1YYCA 3BVHA 1CI6B 2VRSA 4RESB 3MTUE 1L0LK 1J1DB 5APVA 2WPQA 3RK2B 5AW1B 2R32A 4N3YB 1M7LA 1VDFA 1T2KD 1NKZB 1N73B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTG C;  1LTI C;  1LTS C;  1LTA C;  1HTL C;  1LTB C;  1XTC C;  1LTT C; 
#chains in the Genus database with same CATH topology
 3Q5R A;  1KOR A;  3BCC G;  3PP5 A;  1VQ7 P;  3PJS K;  2YO2 A;  5AW9 B;  5KJ7 A;  2FFD C;  4GT1 A;  1T8Z A;  5BU8 B;  3CWB E;  3CCQ P;  4ZKP A;  1OWA A;  1FS0 E;  2MJZ A;  3H6P A;  3G3Z A;  3AED C;  1KB9 D;  1RY3 A;  3LW5 H;  3S9O A;  2QJY C;  1JEK A;  1HVV A;  1SQX E;  3SWY A;  1FE6 A;  3L70 J;  3RK3 D;  3Q3D A;  2D2C C;  2HPC A;  2L5G B;  3H1H E;  3NTN A;  1S3J A;  5BVZ A;  2AXC A;  2IBZ I;  4BRY B;  3L70 D;  4XFJ A;  4UB6 E;  2GUV A;  4H13 C;  1LP1 A;  2N1T D;  1BE3 G;  1A02 J;  2JKV A;  1SQB E;  1K05 A;  2O1K A;  1NTM E;  3PLN A;  1NTZ G;  4WB4 A;  1UIX A;  3CD6 P;  3FWL A;  3PHL A;  2QA4 P;  1JY3 O;  1GL2 A;  2RMZ A;  2A06 D;  4WY4 A;  2HOD B;  3HUS C;  3A0B E;  1PV3 A;  3RK2 D;  1NGM B;  2K9Y A;  1MZ9 A;  3FWN A;  1S5L E;  3QH9 A;  2Z5H A;  2K1A A;  4PD4 D;  2N9B A;  1BCC J;  1VF5 C;  4LGD E;  1K73 Q;  1N73 A;  2IBZ E;  1OX3 A;  1H8A A;  3EFG A;  1JNM A;  3KZI H;  1LWU C;  3V2N A;  1BCC D;  2E5Y A;  2BCC J;  1VQL P;  2FY8 A;  1SS1 A;  1EDK A;  4RKU J;  4N78 D;  1NU1 E;  5APS A;  3UIA A;  2WSE H;  2KK7 A;  3L4F A;  3OAK A;  4QMA A;  2FYU E;  5APX A;  2IYO A;  3B5N C;  4W7Z A;  2K37 A;  3L74 G;  4WBA A;  1ZME C;  3CCR P;  1OIP A;  1GK6 A;  2WSS H;  1KQG B;  3GLM A;  3V2P A;  2ZYG A;  2FFD B;  3L75 E;  4TT3 H;  1FJK A;  3TGU E;  1M57 D;  3KPE A;  5B66 E;  3GF3 A;  3AE3 C;  2XNX A;  1EZV I;  4N6J A;  2QJY B;  3SSU A;  3V4W A;  2IZ0 A;  2A45 H;  1S1C X;  3H1J E;  4C7N B;  2D2C B;  5APW A;  1OXZ A;  5DJT B;  4U3F J;  2QRX A;  2ZJS E;  2J59 M;  4H13 B;  3AEE C;  2FYZ A;  1PL5 A;  2I1J A;  3VOP A;  4U3F D;  4KHX A;  2W8Z A;  2C0W A;  4EI2 A;  3HUS B;  4UB6 H;  2E43 A;  1PP9 J;  2O01 H;  1SQV G;  5CCH A;  3O8Z A;  1EZV E;  1EXJ A;  3WUV A;  1LT9 A;  4L73 A;  3NMD A;  2LXC B;  1VQP P;  1BGY E;  1X22 A;  1KIL A;  3AEB C;  4Z1M H;  1PP9 D;  1VF5 B;  3PRJ A;  1RF0 C;  4DCK A;  4CPG A;  1FZC A;  3A0B H;  3BCC J;  1NWQ A;  3L71 G;  3GW6 A;  1Q81 Q;  2AEF A;  5CJ0 A;  1P84 D;  1S5L H;  2FXO A;  3O6Q B;  1NTZ K;  3BCC D;  2OYI A;  1NTK G;  4BWN A;  4NPF X;  1ZP0 C;  1ZR2 A;  3R4Y A;  2D2C D;  2XV5 A;  2Q9I A;  1JMM A;  5AW6 B;  3TNU A;  1AFO A;  1LTA C;  1JY3 P;  1VQ6 P;  2BEZ F;  2Q7C A;  3HE4 B;  4D6T G;  1S9K D;  3PTZ A;  2NPS C;  1SQQ G;  1LTJ B;  2R3C A;  1OMI A;  4ZKU A;  2KSE A;  3OW2 O;  2I1K A;  2N1T C;  1BE3 J;  2YNY A;  5AVS B;  1JMB A;  2Q5U A;  5KLV E;  2J58 A;  1NTZ J;  1LTB C;  2P2U A;  2ZXE B;  1JCC A;  3P32 A;  3CCU P;  2OGU A;  1BE3 D;  1NTZ D;  4JYB A;  2AXT E;  2WSF J;  2M5A B;  1G2C B;  2RH0 A;  2YMK A;  3B8E B;  1OVV A;  5AVU B;  1RF1 B;  1FBM A;  1YQ4 C;  1Y8A A;  2KLU A;  1KYO D;  2BAS A;  2O01 N;  4DOJ A;  1VPC A;  1EDJ A;  1YYC A;  1CI6 B;  5APV A;  5AW1 B;  3GG2 A;  1MFT A;  2R32 A;  1M7L A;  1NKZ B;  3EWK A;  4C7R A;  4XE5 B;  1K9M Q;  4C46 A;  3V5B A;  3USS A;  2Q3I A;  1YI2 P;  5DJU B;  1E79 H;  2V7Q J;  1RE4 A;  5B5E E;  1EC5 A;  2KS1 B;  3L74 J;  2OYH C;  1OW8 A;  3I56 P;  4I2L C;  3GHG C;  1HBW A;  2PP6 A;  1AV1 A;  3R2P A;  3L74 D;  3A2A A;  3N4X A;  1GU4 A;  1ZW0 A;  3CXH I;  1RHZ B;  1L4A D;  1ZLL A;  4UB8 H;  3CMA P;  2YIU C;  2P10 A;  3FX0 A;  3H1K G;  3VMY A;  1J1E C;  2GUS A;  1SQV K;  3L73 E;  3VMX A;  4KT0 J;  3KZI E;  2W6A A;  2ZXX A;  2B89 A;  2NPS B;  3CME P;  2WT7 B;  2HOD A;  5AW4 B;  4I1L A;  5CBO A;  3N7N A;  3FXD A;  3BAS A;  1L0L E;  4U7J A;  2AEJ A;  1M90 Q;  1N7S A;  3SFD C;  2B87 B;  1A02 F;  1X79 B;  4LLH A;  3P8M C;  2A45 G;  4JF7 A;  1NTK K;  3CXH E;  2QE7 H;  2ZYA A;  2B9B A;  5CCG C;  3CWB G;  4ZNC A;  3HTK B;  3JSV C;  4EIJ A;  3RGU A;  4AUW A;  3GF7 A;  3SWK A;  3P7K A;  4R4M A;  3MP7 B;  4ZMD A;  1RQU A;  1G1J A;  1SQX G;  2RKL A;  2QJK C;  1SQV D;  1SVF A;  1SQQ K;  3H1H G;  4GOF A;  1T2K C;  1DD3 A;  1T3J A;  2AXT H;  3L71 J;  1HTL C;  3CCJ P;  3D71 A;  3M9B A;  3T97 B;  1JY2 N;  1HGV A;  5EFW B;  1PZQ A;  1D7M A;  1JUN A;  1SQB G;  2L91 A;  4PJ0 E;  1NTM G;  3L71 D;  3U59 A;  3G9R A;  1NTK J;  1L0N E;  1VQ9 P;  2YKO A;  3P8C E;  1QVF O;  3E1I A;  4EDF A;  4AQR D;  4AYC A;  1RE3 C;  2W6B A;  2P1J A;  2Y0E A;  1NTK D;  2NPS D;  2YMY A;  1N86 A;  4O9B A;  1GTW A;  3GMA A;  2OYH B;  2IFM A;  1PPJ E;  2KI7 B;  4L76 A;  1H88 A;  3L72 E;  3IN6 A;  3GHG B;  3M0D C;  4C7N A;  4L75 A;  2MKV A;  1FZG A;  2OTJ P;  1QL2 A;  2IBZ G;  4D6T D;  1KN7 A;  5B5E H;  2YIU B;  1PGP A;  3Q1M A;  1SQQ D;  1J1E B;  2LXB A;  1JM0 A;  5AW0 B;  2ZT9 C;  1FZF A;  4DZO A;  3CCE P;  4IFM A;  5H2F E;  1NU1 G;  3CLQ A;  1WT6 A;  2WIT A;  1VQK P;  2WWW A;  2P67 A;  2H88 C;  5APY A;  1W2B O;  2FYU G;  1SP4 A;  5GTI E;  1J1D C;  3B71 A;  2GA1 A;  3AEG C;  3CX5 D;  1X8Y A;  3FXE A;  2KUB A;  1GMJ A;  3QWO C;  2Y9Y A;  4OGQ C;  1YBK A;  1JB0 J;  2OTK E;  3L75 G;  4RJT A;  3D70 A;  3AE4 C;  3H1L E;  3TGU G;  3VTP C;  2WZ7 A;  5APU A;  3CCS P;  1LWU A;  3C9I A;  2Q6Q A;  2FBW C;  5AW5 B;  2WQY C;  3HE5 A;  3M06 A;  3O6Q A;  2QJK B;  1BDC A;  1S72 P;  5AVY B;  2QSI A;  1SQP E;  3CXH H;  2HG5 D;  3HD7 C;  3H1J G;  2KIK A;  1ZN5 A;  2XDJ A;  5AVX B;  2JDI H;  4JYC A;  3B5N A;  1LTJ C;  3TK1 A;  3W67 A;  1U57 A;  5APQ A;  3SFE C;  2FYN B;  1AVY A;  3HE4 A;  2WSE J;  5AW7 B;  1HJ0 A;  1USE A;  1GW4 A;  1L4A C;  3A7O A;  1VQO P;  3AEF C;  1LTI C;  3H1K J;  3H1I E;  1QL1 A;  3RBZ A;  4K35 A;  1EZV G;  2QJP C;  3V6I A;  1AJY A;  3U1C A;  1ZR4 A;  3H1K D;  1SQX K;  4PJ0 H;  3E7K A;  2M0B A;  1BGY G;  3MUD C;  1HGZ A;  2K9J A;  1RF1 C;  3M0A A;  1R5S A;  1X9V A;  2C9L Y;  5AVW B;  1ZRT D;  1IFN A;  4HYT B;  1VQ5 P;  3TYY A;  1Q7Y Q;  3LIE A;  5CMZ A;  5CCG D;  1GL2 B;  1P84 H;  3WU2 E;  5C39 A;  1M56 D;  4JPZ B;  4WY4 B;  2ZT9 B;  4IL6 X;  2Y9Z A;  1SQB K;  3RL0 g;  1M1J C;  1NTM K;  1FDM A;  3CC4 P;  5CCH C;  3CWB J;  1IC2 A;  1OZH A;  1IFM A;  3G71 P;  1IJD B;  3BVH A;  4RES B;  1J1D B;  2WPQ A;  5E79 H;  4YXD C;  3CWB D;  1ZOY C;  4GOD A;  4UB8 E;  1VDF A;  1T2K D;  1EXI A;  1N73 B;  1KIL E;  1SQX J;  1KB9 I;  3ZDM A;  2KYV A;  3M9Q A;  4W80 A;  1U7M A;  5H2F H;  4Y99 C;  4OGQ B;  3H1H J;  1FDI A;  3KQG A;  1SQX D;  1RH5 B;  5GTI H;  2CK3 H;  2OYI C;  5AW2 B;  3H1H D;  1SQB J;  1URQ C;  5KLV G;  2PFX A;  3MIW A;  1NTM J;  2Y0D A;  1TU3 F;  1QVG O;  1NU1 K;  5KAI E;  3HD7 B;  1T6A A;  3OA7 A;  1K8A Q;  1SQB D;  2FYU K;  2KNC B;  2NZ2 A;  2QEX P;  1NTM D;  3SWF A;  1EDL A;  4B86 A;  1HF9 A;  1KQF B;  4GDO A;  1KB9 E;  4GKG A;  3A3Y B;  2Y0C A;  4H0L C;  1Y9B A;  1GL2 D;  2NPS A;  5KTB A;  2H43 A;  3IFM A;  1QEX A;  2R5B A;  3RK3 E;  1L4A B;  4PD4 I;  3TDK A;  4WY4 D;  2ZT9 D;  2WT7 A;  1N8R Q;  1SLQ A;  2Q3E A;  2SPZ A;  3VN0 A;  1YJW P;  1G1I A;  2N1T A;  1YIT P;  2WPV B;  3JC2 2;  3L70 E;  4R4L A;  3D6Z A;  2IBZ D;  2QJP B;  1YHQ P;  2ZYD A;  1PGQ A;  3NXS A;  4BXL A;  3HTK A;  2JWA A;  2FYU J;  3BRV B;  2K88 A;  1NU1 D;  4OGQ D;  3EQ2 A;  2A06 E;  4H44 C;  2FYU D;  2WMM A;  2WSC J;  2IX7 C;  1M1J B;  3CI9 A;  4IFD K;  2FXM A;  1JY2 O;  2BCC G;  3MD0 A;  3L75 J;  4I7Z C;  2YXR B;  4PD4 E;  1LT9 B;  4HB1 A;  2YO3 A;  2OTL P;  4EOT A;  1HJB A;  3IF4 A;  3T97 A;  3CC2 P;  3F5H A;  2XU6 A;  3HD7 D;  3AE5 C;  3L75 D;  3TF5 A;  4YTP C;  5BU5 A;  2P7J A;  3WU2 H;  3L73 G;  3TGU D;  3D6Y A;  1RE4 C;  1BCC E;  1GK4 A;  1DH3 A;  1KMI Z;  2ZVN B;  1HH0 A;  1QGK B;  2C9N Y;  3AE1 C;  3FGA D;  3VMZ A;  3L36 A;  2IZ1 A;  4Y99 B;  5K5G B;  3H1J J;  2JP3 A;  4N78 E;  5GTH E;  4Y28 J;  4M3L A;  1KC8 Q;  1NAY A;  2BCC E;  2OYI B;  1KD1 Q;  1OW7 A;  1L0L G;  3H1J D;  4BRY A;  4NPD A;  1NKN A;  2W90 A;  1PGO A;  3GHG A;  1URQ B;  3S4R A;  4HH2 A;  3PH0 A;  1SFC C;  5AVQ B;  1JO5 A;  2KP8 A;  3OJA B;  3CC7 P;  1GD2 E;  2Q1K A;  2PGD A;  1DIP A;  4PV1 D;  2E74 C;  1VQN P;  3M9H A;  4JBZ A;  1VQM P;  4A7P A;  2ITA A;  2QIW A;  4W7Y A;  1JTH B;  3K5B A;  3II6 A;  1AQT A;  2M3E A;  4ASW A;  1ZV8 A;  1BGY J;  3MHV A;  2LKM A;  4H0L B;  2YKQ A;  2H8P D;  1KFM A;  5KAI H;  2WTY A;  1EZV D;  2XZR A;  3KHU A;  1NYH A;  1BGY D;  1LTS C;  5CCH D;  1N7L A;  3M91 A;  4DJG A;  1KZU B;  1KB9 H;  1YIJ P;  5KLV K;  1SQV J;  1IFI A;  1P84 I;  1L0N G;  3V2R A;  5CCG A;  1RQV A;  4U3F E;  1NH4 A;  2FKW B;  2JO1 A;  4OWF A;  3VP8 A;  4DT0 A;  1PFI A;  1WRG A;  1KFN A;  5KJ7 C;  2LR2 A;  2JEE A;  4H44 B;  1PPJ G;  1LJ2 A;  3VYI A;  3CCL P;  3E1R A;  3L72 G;  1EQ7 A;  2FYN C;  4I7Z B;  2PAJ A;  1DEB A;  1URQ D;  1H0T B;  3AEA C;  2FFD A;  5KLI C;  1PP9 E;  1LNQ A;  2E75 C;  1Q82 Q;  2QVA A;  2JR8 A;  1NO4 A;  5KLV J;  3RBX A;  3CCM P;  3WUT A;  1Q2N A;  2R3S A;  5KKZ C;  4HKZ H;  1P84 E;  1FOS F;  1T3U A;  1FJP A;  4PD4 H;  4D6T J;  3BCC E;  1RE3 A;  5KLV D;  1Q86 Q;  1SQQ J;  4H0L D;  1CZQ A;  3KYQ A;  3CX5 H;  1KTM A;  3RL0 C;  3AE8 C;  3M0D A;  5E79 E;  2C0X A;  3LW5 J;  1VQ4 P;  1GL2 C;  1SFC B;  4IL6 E;  1VQ8 P;  4WY4 C;  1DEE G;  5GTH H;  1S9K E;  4YPC A;  2N9Y B;  1NAF A;  1KYO I;  3H1L G;  3H32 B;  2IYP A;  2E74 B;  3Q5P A;  1FDO A;  1NOH A;  5AW8 B;  1JY2 P;  3HUS A;  1Q90 D;  2J5U A;  2B88 A;  2PRR A;  1N7S B;  2RN0 A;  1N73 C;  2QG4 A;  3Q2Y A;  4H44 D;  1SQP G;  2W6J H;  3I55 P;  2O3J A;  3HRN A;  3I5C A;  4WWI A;  2Z4E A;  1YJ9 P;  1BE3 E;  2R44 A;  2YKP A;  2VRS A;  1NTZ E;  3MTU E;  1L0L K;  1BDD A;  4EYY Q;  1NVO A;  4NPE A;  4RO0 A;  2E5T A;  1AA0 A;  4ASV A;  1KYO E;  3KDP B;  3V4Q A;  3H1I G;  1IK7 A;  1KQL A;  3MZW B;  2BCC D;  2POH A;  2UWJ E;  1GU5 A;  3L73 J;  2KXP B;  2K3R A;  1R8E A;  3CPW O;  1W2E A;  3HD7 A;  3L73 D;  1M1K Q;  2KNC A;  1IZN B;  5KLI B;  1SFC D;  3AE2 C;  1LTJ A;  2E75 B;  4GIF A;  1L0L J;  1OFC X;  4K3A A;  2XKM A;  2E74 D;  3MGN A;  1XTG B;  2HPC B;  3BAT A;  1JCD A;  5KAF E;  5KKZ B;  2W83 C;  1L0L D;  1L0N K;  1L4A A;  3CL3 D;  5TIS E;  1XTC C;  2E76 C;  3L74 E;  4PV1 C;  2BEQ D;  2KZI A;  1LP1 B;  1N7S D;  2JWD A;  1M8O B;  3CXH D;  3AE9 C;  3NFQ A;  3B4S A;  3RL0 B;  2M5A A;  1G2C A;  3ABV C;  3JCU E;  1YTZ T;  3Q5S A;  1LTT C;  4LC1 A;  3MUD A;  1PIX A;  4MN4 C;  1RF1 A;  1USD A;  3L37 A;  1W5C E;  2E42 A;  1JY3 N;  1R5L A;  1CI6 A;  2W27 A;  1Y47 A;  2QM8 A;  1LT9 C;  2GM4 A;  1PGJ A;  3C1L A;  1KIL C;  5AVZ B;  2M8R A;  4I6M C;  2P58 A;  1M1J A;  2KSJ A;  1L0N J;  1FZB A;  2ZAE B;  4IL6 H;  5KJ7 D;  3G6E P;  1HUC A;  1AVO A;  1FZC C;  3WMM 0;  1E5W A;  1S5L X;  3IR9 A;  1L0N D;  3P8C D;  1IK9 A;  1KV4 A;  1RF0 A;  1GZL A;  2KZJ A;  2KS1 A;  2XND H;  3L72 J;  2E75 D;  1LWU B;  2O01 J;  1L2P A;  5APT A;  1FZE A;  2QM7 A;  2H7H A;  3U1A A;  3AEC C;  1JOC A;  1GDT A;  1PPJ D;  1LGH B;  4XA4 A;  1CSB A;  3HE5 B;  1SQV E;  2DW3 A;  3BRT B;  3L72 D;  1AQ5 A;  5M1B A;  1OVR A;  2IPP A;  3L70 G;  4TLF A;  1LTG C;  1URQ A;  5L8R J;  2G3A A;  3B5N B;  1IO4 A;  3A0H E;  1VL2 A;  3LID A;  2KLV A;  1N2D C;  1SQP K;  3RL0 D;  3L71 E;  2WSF H;  3RK3 C;  1WMK A;  1J2J B;  1KYO H;  1MKM A;  3EFF K;  2H89 C;  4H13 D;  5AVV B;  4YXW H;  3V2Q A;  2OQQ A;  1Z56 A;  3H25 A;  2A06 G;  1JTH A;  1QLE D;  1NTK E;  2KOG A;  3VMA A;  5TJH A;  2OYO A;  5CBN A;  2B87 A;  1IFP A;  3CX5 I;  1DD4 A;  2ZVO B;  2Z5I A;  3L35 A;  3KXD A;  2E76 B;  3H1L J;  1NU1 J;  2WSC H;  4PV1 B;  1GW3 A;  3CCV P;  2WPS A;  1FAV A;  2V4H A;  4D6T E;  2K9J B;  3H1L D;  3IAO A;  1HWT C;  5B66 H;  1SQQ E;  3RK2 C;  3WUU A;  1BCC G;  1VF5 D;  5KAF H;  2WVR A;  1FC2 C;  1SQP J;  1CW5 A;  2V7Q H;  5TIS H;  2KB7 P;  1LT1 A;  2FXP A;  4OVN F;  1SQP D;  3TGU J;  2M3B A;  2WPR A;  1X0T A;  4IOI H;  1KQS O;  1U7J A;  1KIL B;  5AVT B;  2I8D A;  3JCU H;  3C8V A;  3CX5 E;  3TSI A;  1IFD A;  1H0T A;  1FZC B;  1YJN P;  3B5N D;  2O1J A;  3G4S P;  1FZA A;  3H1I J;  1QX8 A;  1MUU A;  2HLO A;  1BSN A;  4OH8 B;  1S4X A;  2CPS A;  1DX7 A;  1YTZ I;  1K04 A;  4HJG H;  1OW6 A;  3H1I D;  3AE7 C;  2OYH A;  2CPB A;  2HR3 A;  2HYN A;  5CHX A;  2IFN A;  3VP9 A;  3ITK A;  5AVR B;  3TNU B;  1H89 A;  1EDI A;  1S2E A;  2E76 D;  2HFE D;  4WVZ A;  1IFJ A;  2YXQ B;  1FOS E;  4JQ0 D;  1SFC A;  4IFF A;  3H32 A;  3RK3 B;  4U3F G;  1N7S C;  1NHL A;  1BSH A;  1YQ3 C;  2OAR A;  2ZFC A;  2R5D A;  2AEM A;  2A45 I;  1NJI Q;  2JJL A;  1OVU A;  3A0H H;  2N1T B;  1MFZ A;  1FU1 A;  3H1K E;  5AW3 B;  4GOE A;  5CJ4 A;  3A5T A;  1KIL D;  1UII A;  2IDB A;  1MV8 A;  4L74 A;  1PP9 G;  3AE6 C;  3F89 A;  3W68 A;  2G8Y A;  2NRG A;  1ZRT E;  3S1K A;  1ZXG A;  3RK2 B;  4N3Y B;  4KJM A; 
#chains in the Genus database with same CATH homology
 2KYV A;  4C7R A;  3M9Q A;  4W80 A;  3PP5 A;  4Y99 C;  4XE5 B;  4C46 A;  3V5B A;  2Q3I A;  3KDP B;  2YO2 A;  5AW9 B;  3V4Q A;  5KJ7 A;  3KQG A;  1KQL A;  2FFD C;  4GT1 A;  1T8Z A;  2OYI C;  2POH A;  5BU8 B;  1GU5 A;  5AW2 B;  1RE4 A;  4ZKP A;  1OWA A;  2MJZ A;  3H6P A;  3G3Z A;  2OYH C;  1URQ C;  3MIW A;  1W2E A;  1RY3 A;  3HD7 A;  3LW5 H;  4I2L C;  3GHG C;  1NU1 K;  1HBW A;  2PP6 A;  1HVV A;  3HD7 B;  3OA7 A;  1SFC D;  3R2P A;  3A2A A;  3SWY A;  3N4X A;  1LTJ A;  1GU4 A;  3RK3 D;  4GIF A;  2FYU K;  1L4A D;  1ZLL A;  3SWF A;  2HPC A;  2L5G B;  2XKM A;  3NTN A;  4B86 A;  5BVZ A;  3MGN A;  3VMY A;  1XTG B;  2HPC B;  1J1E C;  3BAT A;  1JCD A;  4GKG A;  2GUS A;  1SQV K;  3VMX A;  1L0N K;  2GUV A;  3A3Y B;  1L4A A;  3CL3 D;  2N1T D;  1XTC C;  1GL2 D;  2NPS A;  5KTB A;  2H43 A;  1A02 J;  3IFM A;  2W6A A;  2R5B A;  1L4A B;  4WY4 D;  2O1K A;  1N7S D;  2WT7 A;  2NPS B;  1SLQ A;  4WB4 A;  3VN0 A;  1G1I A;  2WT7 B;  2N1T A;  1JY3 O;  2HOD A;  5AW4 B;  1GL2 A;  4I1L A;  3NFQ A;  3RL0 B;  3N7N A;  1G2C A;  3BAS A;  4WY4 A;  1N7S A;  2HOD B;  3HUS C;  1YTZ T;  1LTT C;  1A02 F;  4LC1 A;  3RK2 D;  3MUD A;  1RF1 A;  1MZ9 A;  1X79 B;  3NXS A;  3L37 A;  3HTK A;  4LLH A;  3P8M C;  2E42 A;  1JY3 N;  2A45 G;  3BRV B;  1NTK K;  2Z5H A;  4JF7 A;  1CI6 A;  2N9B A;  5CCG C;  3HTK B;  2W27 A;  2QM8 A;  1LT9 C;  4EIJ A;  4LGD E;  3EQ2 A;  4AUW A;  2GM4 A;  1KIL C;  5AVZ B;  2M8R A;  1N73 A;  3P7K A;  4I6M C;  1H8A A;  3EFG A;  1M1J A;  2KSJ A;  1JNM A;  1FZB A;  1LWU C;  3V2N A;  5KJ7 D;  2IX7 C;  1HUC A;  1FZC C;  1M1J B;  3CI9 A;  3WMM 0;  4IFD K;  1E5W A;  1G1J A;  2FXM A;  1JY2 O;  3MD0 A;  3IR9 A;  4N78 D;  1SVF A;  1LT9 B;  1SQQ K;  3P8C D;  1IK9 A;  5APS A;  1RF0 A;  3UIA A;  2WSE H;  2YO3 A;  3L4F A;  1GZL A;  1T2K C;  4EOT A;  1HJB A;  3T97 A;  3OAK A;  1T3J A;  2XU6 A;  3HD7 D;  1HTL C;  5APX A;  5BU5 A;  3M9B A;  2P7J A;  1LWU B;  1JY2 N;  1RE4 C;  5APT A;  1GK4 A;  1DH3 A;  3B5N C;  1HGV A;  4W7Z A;  1FZE A;  2QM7 A;  2H7H A;  1HH0 A;  2C9N Y;  3VMZ A;  3U1A A;  3L36 A;  1JOC A;  1JUN A;  1GDT A;  4WBA A;  1LGH B;  4Y99 B;  4XA4 A;  1CSB A;  3HE5 B;  4N78 E;  3U59 A;  3BRT B;  1AQ5 A;  1GK6 A;  2YKO A;  3P8C E;  4M3L A;  3E1I A;  3V2P A;  2FFD B;  4AQR D;  4AYC A;  2OYI B;  1RE3 C;  2IPP A;  2W6B A;  2P1J A;  1LTG C;  1URQ A;  1FJK A;  2NPS D;  2YMY A;  1NKN A;  3B5N B;  1IO4 A;  1N86 A;  4O9B A;  1GTW A;  3KPE A;  2OYH B;  3GHG A;  3LID A;  1URQ B;  2IFM A;  2KLV A;  4HH2 A;  1N2D C;  1SFC C;  2XNX A;  1SQP K;  3RL0 D;  1H88 A;  2WSF H;  5AVQ B;  1JO5 A;  3RK3 C;  3GHG B;  1J2J B;  3M0D C;  4N6J A;  2KP8 A;  3OJA B;  1GD2 E;  4C7N A;  5AVV B;  3V4W A;  1FZG A;  3V2Q A;  2A45 H;  1Z56 A;  1QL2 A;  1JTH A;  3M9H A;  4C7N B;  2KOG A;  4W7Y A;  5APW A;  1JTH B;  3II6 A;  1OXZ A;  1J1E B;  1ZV8 A;  2Z5I A;  2LKM A;  2J59 M;  5AW0 B;  3L35 A;  4DZO A;  1FZF A;  2YKQ A;  2FYZ A;  2H8P D;  1KFM A;  2WSC H;  4IFM A;  2WTY A;  3CLQ A;  1WT6 A;  2WIT A;  1GW3 A;  2XZR A;  2WWW A;  2P67 A;  2WPS A;  1FAV A;  2I1J A;  3VOP A;  5APY A;  4KHX A;  1LTS C;  5CCH D;  1SP4 A;  1N7L A;  3M91 A;  1HWT C;  1J1D C;  3RK2 C;  2C0W A;  1KZU B;  3HUS B;  5KLV K;  1CW5 A;  2E43 A;  1IFI A;  2O01 H;  1X8Y A;  5CCH A;  2KB7 P;  3O8Z A;  3V2R A;  5CCG A;  1LT9 A;  3NMD A;  1NH4 A;  2FKW B;  3VP8 A;  1KIL A;  2M3B A;  2WPR A;  1PFI A;  1WRG A;  3VTP C;  2WZ7 A;  1KFN A;  5APU A;  1RF0 C;  5KJ7 C;  1KIL B;  1LWU A;  5AVT B;  2JEE A;  3C9I A;  1FZC A;  3VYI A;  1NWQ A;  5AW5 B;  3TSI A;  1IFD A;  1FZC B;  3HE5 A;  5CJ0 A;  3M06 A;  3B5N D;  1EQ7 A;  2O1J A;  1FZA A;  2PAJ A;  1DEB A;  5AVY B;  1URQ D;  1MUU A;  2FFD A;  2HG5 D;  2HLO A;  3HD7 C;  1NTZ K;  1ZN5 A;  2OYI A;  2XDJ A;  4OH8 B;  5AVX B;  2CPS A;  1DX7 A;  1YTZ I;  4JYC A;  3B5N A;  1LTJ C;  1NO4 A;  3TK1 A;  2OYH A;  2CPB A;  1ZR2 A;  2HYN A;  5CHX A;  5APQ A;  2XV5 A;  2IFN A;  2Q9I A;  3VP9 A;  3HE4 A;  1JMM A;  5AW6 B;  3TNU A;  1FOS F;  1T3U A;  1AFO A;  1FJP A;  5AVR B;  1LTA C;  1JY3 P;  2Q7C A;  1RE3 A;  5AW7 B;  3HE4 B;  3TNU B;  1GW4 A;  1S9K D;  1L4A C;  3A7O A;  1H89 A;  2NPS C;  1LTJ B;  1LTI C;  1CZQ A;  3KYQ A;  2HFE D;  1IFJ A;  2R3C A;  1FOS E;  1QL1 A;  1SFC A;  3RL0 C;  4ZKU A;  4IFF A;  3M0D A;  2C0X A;  2I1K A;  2N1T C;  1GL2 C;  1SFC B;  2YNY A;  3U1C A;  1ZR4 A;  5AVS B;  1SQX K;  3H32 A;  2Q5U A;  3RK3 B;  4WY4 C;  1N7S C;  1NHL A;  2J58 A;  1S9K E;  1LTB C;  1NAF A;  2OAR A;  2P2U A;  3H32 B;  2ZFC A;  2ZXE B;  1JCC A;  1HGZ A;  2R5D A;  3P32 A;  1RF1 C;  3M0A A;  1X9V A;  2C9L Y;  5AVW B;  1NOH A;  2A45 I;  1IFN A;  4HYT B;  5AW8 B;  2JJL A;  3TYY A;  1JY2 P;  3HUS A;  3LIE A;  5CMZ A;  4JYB A;  5CCG D;  2N1T B;  1MFZ A;  1GL2 B;  1FU1 A;  1G2C B;  5AW3 B;  5CJ4 A;  4WY4 B;  3A5T A;  1N7S B;  1N73 C;  1KIL D;  1SQB K;  1MV8 A;  3B8E B;  1M1J C;  1NTM K;  3HRN A;  1FDM A;  3I5C A;  5CCH C;  2Z4E A;  5AVU B;  1RF1 B;  1FBM A;  1IC2 A;  1IFM A;  2YKP A;  2BAS A;  4DOJ A;  1VPC A;  1IJD B;  1YYC A;  3BVH A;  1CI6 B;  2VRS A;  4RES B;  3MTU E;  1L0L K;  1J1D B;  5APV A;  2WPQ A;  3RK2 B;  5AW1 B;  2R32 A;  4N3Y B;  1M7L A;  1VDF A;  1T2K D;  1NKZ B;  1N73 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...