1NTKG

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntkG00
1L0LG 1KYOH 1KB9H 3CX5H 3L72G 1NTMG 3CWBG 3L73G 1BE3G 4U3FG 1SQBG 3H1JG 3L74G 3L71G 1NU1G 1P84H 1PPJG 1EZVG 1PP9G 1SQPG 3H1LG 3H1HG 4PD4H 2A06G 3BCCG 1BGYG 3TGUG 1SQXG 4D6TG 3L75G 1L0NG 3H1IG 1NTKG 2FYUG 1SQQG 3CXHH 1SQVG 1BCCG 2IBZG 3H1KG 5KLVG 1NTZG 2BCCG 3L70G
chains in the Genus database with same CATH superfamily
1BDCA 2IYPA 1NGMB 2RN0A 4OVNF 5CCGD 3AECC 1PPJG 3L73J 4WB4A 1VQ8P 3MUDA 5AVTB 2KNCB 2WPRA 3VYIA 3H32B 1L0LG 2HPCB 1HJ0A 1DX7A 3CWBD 1EZVD 1JUNA 5B66H 4A7PA 1RQVA 3L75G 2KNCA 1SQPJ 2YXQB 1Q86Q 3NXSA 3Q2YA 3O8ZA 1NTZD 3P8CE 3H32A 2L91A 2HPCA 3H1LE 2GUVA 3V2RA 3AE4C 3V2NA 4C46A 2YIUB 4W7ZA 3Q5PA 1JTHB 2C9LY 3VMAA 3L73G 1L4AB 2P58A 3RL0g 1P84H 3O6QB 2QIWA 3M9BA 1JY3P 3IN6A 2E5TA 1SQVD 4NPEA 1JTHA 1LT9A 1L4AA 3O6QA 1SQPG 1ZRTD 1ZXGA 1BE3J 4N6JA 3PP5A 5AW8B 5BU8B 4Y28J 5AVZB 1KTMA 3LW5H 1URQB 5KLVJ 3CL3D 3CCVP 3AEDC 3A0BH 1U7MA 2M5AB 4RESB 1SLQA 1YITP 3AE5C 3RK3B 1EDKA 2YIUC 1A02F 3MZWB 3E1IA 1SQVK 1URQA 3JCUE 2KIKA 2K9YA 3CC7P 1L4AC 1U57A 3FXEA 2AXTH 2VRSA 4PD4H 2PGDA 2M5AA 2YMYA 1X8YA 1KB9E 3P8MC 2YXRB 3SFEC 3ITKA 3L72E 1JEKA 2KSJA 1VF5B 5AW4B 2IBZI 2R32A 1OVVA 1VQ7P 1MZ9A 1BE3G 4KHXA 1DEBA 3FWLA 2OYHB 1RF0C 1QVGO 2BCCE 1FU1A 3T97B 5KLVG 1ZN5A 1URQC 3HRNA 1Y9BA 3H1IE 5BVZA 3H1HD 2LXCB 2KUBA 4HJGH 1SQVE 4HKZH 4ASWA 3RK3C 2P1JA 2FYUD 3T97A 2K88A 4M3LA 4OWFA 1KYOD 1L4AD 1ZRTE 1KB9I 4WY4B 1GMJA 1Q90D 3F5HA 1FOSE 3QWOC 2QEXP 4WWIA 1SQXJ 1VF5C 4UB6E 4I2LC 2WSCH 2NRGA 1VQ5P 3RL0B 3LW5J 4U3FD 3IFMA 2OYHC 1VQ4P 4WY4A 1FE6A 2XNDH 4LC1A 3S1KA 3AE6C 4D6TG 1URQD 2FYUK 4HH2A 1KD1Q 3A3YB 2FBWC 3RK3D 3QH9A 1EQ7A 1Q7YQ 3H1JJ 3L35A 1FBMA 1IFDA 4Y99B 5E79E 2KS1B 2HR3A 1K04A 4WY4C 4NPFX 1SQQE 2A06G 1N73B 1W2EA 4C7RA 1SQXG 2WSSH 1VF5D 2N1TB 1NWQA 2OGUA 1OFCX 2KS1A 4BWNA 1SP4A 4YTPC 3RL0C 3VP8A 3H1HE 4GODA 5GTHE 4AQRD 1IO4A 4IL6H 1N73A 3H1LJ 1KYOE 1YYCA 3BCCJ 4N78D 2W83C 4XA4A 3HTKB 2E76D 3E7KA 3E1RA 2KP8A 1EXJA 3H1JG 4MN4C 3AE9C 2QJPB 3V6IA 1LTAC 2H89C 3AE8C 3H25A 1PGQA 1LTTC 3V4QA 3A0HE 1NH4A 1LTSC 2KLUA 4OGQB 4Y99C 4WBAA 1L2PA 3R2PA 2BEQD 4GOEA 2CPBA 1FAVA 3EFGA 3HTKA 1M8OB 5AW7B 4WY4D 4IL6X 3AEFC 2ZYAA 5GTIE 1N73C 1R5SA 5CMZA 1NYHA 4ZNCA 2N1TC 3UIAA 3RL0D 2WSEJ 4I1LA 2E75B 1IK9A 4GOFA 3RK3E 3MGNA 1HVVA 1LTGC 1YQ3C 4ZKPA 1GZLA 1LTBC 3BCCG 1ZP0C 2KZIA 2A45I 3SWFA 1K8AQ 1FZCB 3K5BA 3CXHH 3AEBC 1MKMA 5B66E 2QRXA 2N9BA 2HLOA 2G3AA 2QJPC 3CWBJ 4TLFA 3RGUA 1FDIA 2ZYDA 1ZW0A 1QGKB 2E43A 4OGQC 2B87B 1FDOA 1OVUA 3MP7B 2R3CA 3VTPC 3PTZA 2LR2A 3WU2H 1NTZJ 2PAJA 2BEZF 3ZDMA 3G3ZA 1T3JA 2QJYB 4CPGA 1IJDB 3HUSB 2YMKA 3BRVB 1HGZA 2B87A 2E75C 1P84E 1SQBG 3B71A 2G8YA 5APVA 1H88A 4ASVA 1KILE 4H0LB 3IAOA 5H2FE 3L71G 2AEFA 1T3UA 4DCKA 2Y9YA 1XTGB 3HUSA 2ZFCA 1FZCC 4K35A 1N7SB 3PLNA 2Q9IA 1NOHA 3OJAB 5KAFE 3B5NB 2O3JA 3G71P 3AE7C 3CWBG 1BDDA 1DD4A 1K73Q 1EZVG 1FJKA 4UB8H 1KN7A 4OGQD 3GLMA 1NTKD 3L70E 1N7SA 3WUUA 2IBZD 1PZQA 2OTJP 3B5NA 1NTZG 1GL2B 1MFTA 4YPCA 2QJYC 1P84I 1NU1K 3HUSC 2E75D 1A02J 1VQ9P 4GT1A 1FC2C 2AXTE 1OIPA 3V5BA 3L74E 4PD4E 2IFNA 4H0LC 2E74B 3I5CA 5M1BA 2C0WA 2K3RA 1RF1B 1L0NG 1N7SC 1PP9J 2CK3H 3SWKA 1NTKK 3B5NC 2QM8A 1KB9D 1JB0J 1VPCA 1YBKA 3L72D 3CCSP 2LXBA 2YO2A 2BASA 3V2PA 1HJBA 1RF1A 1S4XA 3OA7A 1BCCD 3G4SP 2XNXA 2BCCD 1OX3A 1NU1E 1HWTC 1GL2C 3G9RA 3PJSK 1D7MA 1PV3A 1Q82Q 4GKGA 3RK2B 4H44B 1NTMJ 4I6MC 3PH0A 2DW3A 4PD4I 3CCRP 1GK4A 3Q1MA 3H1ID 3H1HJ 1J1EB 3PRJA 3A7OA 1CW5A 2W8ZA 4I7ZB 3TYYA 4H0LD 1L0LD 2FYUJ 2P67A 2O1KA 2IX7C 1RH5B 1PGPA 1S5LH 2E74C 1YJWP 2JR8A 2WZ7A 1NTKE 1CI6B 5CJ4A 1PP9G 1N7SD 2IBZE 3WUTA 4JPZB 3TGUD 3L75D 1RF1C 1FZGA 3CCMP 3B5ND 2QA4P 3MTUE 4GDOA 4HYTB 5B5EH 2QVAA 2YKQA 3KZIH 2JKVA 1GU4A 1CI6A 4TT3H 2XZRA 4U3FJ 1FOSF 1RF0A 4EOTA 2FXMA 1LTJB 3KDPB 1S5LX 4R4LA 1NTMG 1L0LK 3RK2C 3USSA 4H44C 3AEGC 1IFNA 1J1EC 2FYUG 1M1JB 3Q3DA 4I7ZC 1Q2NA 3CX5H 1IK7A 2W6BA 2B88A 1S72P 4K3AA 1YQ4C 4R4MA 1BCCE 5AW3B 3M0AA 1NAYA 3D70A 1M1JA 1SQQD 1IFJA 4O9BA 1JOCA 1PPJE 4YXDC 1KORA 3TSIA 2W27A 1G1IA 4U3FG 2Q1KA 4QMAA 2O01J 2OYHA 4C7NB 3W67A 1GK6A 3N4XA 1G1JA 1G2CB 1L0LE 1LTJC 4BXLA 3VMYA 2H8PD 1KILB 1SS1A 1RHZB 1SVFA 3AEEC 3U1AA 1X79B 1X0TA 4H44D 3VP9A 4RJTA 3TGUE 3L75E 1FZBA 2OTLP 3TK1A 2YNYA 4C7NA 1KV4A 3M0DA 4DOJA 1SQPK 3SFDC 1G2CA 3SWYA 2QM7A 1M1JC 1TU3F 4PV1B 1KILA 1FS0E 1SQQK 3WMM0 1VQ6P 1JY2O 2ITAA 2KXPB 3IF4A 1YTZT 3L4FA 2QJKB 5KKZB 3D6ZA 5TISE 1OW8A 1ZV8A 2D2CB 2WSEH 1QVFO 3L73E 5AW9B 2JEEA 5AVSB 2J58A 1XTCC 2YKOA 4U7JA 3V4WA 3CXHE 1KQGB 1KC8Q 3P32A 3M0DC 1T6AA 2UWJE 1H8AA 1KILC 3C8VA 3GHGB 3BVHA 3C1LA 2HYNA 2B89A 1AQ5A 3CC4P 1N2DC 2JJLA 1SQPE 4IFDK 3KQGA 2I1JA 3TNUB 4L74A 3JCUH 4XE5B 1LWUB 1H89A 3WU2E 2K37A 4PV1C 1NO4A 1EXIA 3GHGA 4WVZA 2JDIH 5AW1B 2YO3A 3MIWA 1QEXA 1E79H 3CMEP 2QJKC 1PGOA 5KKZC 2MKVA 2RH0A 1GU5A 3HD7B 3TNUA 1BSNA 3KXDA 1HBWA 4D6TD 1OXZA 2D2CC 1LWUA 1HTLC 2HFED 2N1TA 1OMIA 3CXHI 3I56P 2ZVNB 4HB1A 3M9QA 5AW5B 2FXPA 1PL5A 1P84D 4N3YB 3ABVC 2AEMA 3HD7A 2Q3EA 4LGDE 1UIIA 1KILD 3F89A 1EC5A 4L73A 1EDJA 3GHGC 5KAIH 3H1KD 2Q7CA 3FGAD 2OARA 3CCJP 1JMBA 1DEEG 4IFMA 2PFXA 1JO5A 2M3EA 2A06D 1KMIZ 4PV1D 5KLVE 1LWUC 2P10A 4RKUJ 2C0XA 3L70D 2JO1A 1SFCB 4OH8B 3TF5A 4L76A 1X22A 4UB6H 3HD7C 2JP3A 3H1LG 1FJPA 3AE1C 2W6AA 1S9KE 1BGYD 1ZOYC 4EDFA 3LIDA 3NMDA 1YJNP 1Y8AA 1RQUA 3R4YA 1SFCA 3H1JD 3L74D 4PD4D 4DZOA 2KI7B 1JY2N 1R5LA 2Z5HA 1S3JA 1PGJA 1DH3A 1FZCA 1SQXK 3EFFK 3GW6A 3CCQP 2IDBA 2FYZA 1JCCA 2WPVB 5APQA 4D6TE 5E79H 1RY3A 1K05A 3L72J 2Z5IA 3RBXA 2N1TD 1GW3A 2I1KA 1VL2A 2ZXXA 2O1JA 2KZJA 3S9OA 1BCCJ 1SFCC 3MD0A 3HD7D 1LJ2A 2BCCJ 1LT1A 1NU1D 1OW7A 2HODB 4KJMA 3CC2P 2Y0EA 1LTIC 5GTHH 1N7LA 3H1KE 4PJ0H 3Q5SA 3H1IJ 2GM4A 5TJHA 4W80A 1KYOH 1SQVJ 2A06E 2AEJA 1VQMP 1SQXE 1L0LJ 1LNQA 1VQKP 2HODA 2V4HA 2A45H 4L75A 1H0TB 5CHXA 1HH0A 5APUA 5AVWB 3TGUJ 4AUWA 3A0BE 1M7LA 3L72G 2E5YA 4ZMDA 4XFJA 1BGYE 3CMAP 1VQPP 2GUSA 2M8RA 2W90A 2IZ1A 1H0TA 3S4RA 1NKNA 2WQYC 3HE5B 1SFCD 5CBOA 1SQBD 3H1JE 2BCCG 2QSIA 2WMMA 1GL2A 2J5UA 3U1CA 3L71D 2JWAA 2WVRA 2P2UA 1NHLA 4JYBA 3CX5E 3H1IG 3L37A 1S2EA 2N9YB 1SQVG 3HE5A 2POHA 3KHUA 2Q3IA 2P7JA 2XDJA 1GD2E 3GF7A 5KJ7A 3SSUA 3GG2A 2WTYA 5C39A 3G6EP 1JNMA 2ZYGA 1VQNP 1USEA 3TGUG 1AVOA 2KLVA 3C9IA 4IOIH 1PFIA 1SQQJ 2KB7P 3M9HA 1SQBK 3BCCE 3AE2C 5KTBA 2O01H 1MFZA 5AVQB 1PPJD 2ZJSE 3AEAC 1X9VA 3MUDC 3VN0A 4H13B 2AXCA 2M0BA 2IZ0A 2SPZA 3BATA 1JMMA 1LT9B 5CJ0A 2Y9ZA 2XV5A 1FZAA 1OZHA 5KJ7C 3CX5I 3EWKA 2FKWB 1VDFA 3VMZA 3Q5RA 1GW4A 1L0ND 2WITA 2E42A 5H2FH 3CCUP 1Q81Q 5AW6B 1K9MQ 1NTZK 1AVYA 5KAFH 1FZEA 4ZKUA 1T2KC 2R5DA 1SQBE 1ZR2A 2WSFJ 1SQQG 1JY2P 1RE3A 2J59M 1GL2D 1PIXA 3L71E 3M06A 3JC22 2H88C 3L73D 2ZT9B 2WPSA 2Y0DA 3H1HG 1RE4A 1DIPA 5AVUB 4JQ0D 1WMKA 4H13C 2QG4A 3CXHD 3FX0A 1QLED 1L0NK 1LTJA 3CWBE 1LT9C 5APXA 5KJ7D 2E74D 2MJZA 1EZVE 3II6A 2CPSA 3JSVC 3U59A 1HGVA 1PP9D 1SQPD 2A45G 2K9JB 3KYQA 3HE4B 1QL2A 1NTZE 1RE3C 2WPQA 3CLQA 2QE7H 1J1DB 3B4SA 1U7JA 4IL6E 2XKMA 2WWWA 2PP6A 1T2KD 5AVYB 2FYNB 1T8ZA 2K9JA 1GDTA 1RE4C 1NAFA 1AFOA 3OW2O 3OAKA 3HE4A 1M56D 5BU5A 2W6JH 1UIXA 2KK7A 5DJTB 1JY3O 4D6TJ 3V2QA 2R44A 3RK2D 1NTMD 2ZT9C 3AE3C 2E76B 1L0NE 5KAIE 4H13D 2R5BA 1YTZI 1Y47A 5APYA 5AVRB 1JCDA 5KLIB 1EZVI 1QX8A 2ZAEB 2Z4EA 1NVOA 2IYOA 3H1KJ 1BSHA 5AVVB 1IZNB 2B9BA 2OYIB 1BE3D 4W7YA 2Q5UA 3LIEA 2Q6QA 1AQTA 1MUUA 3D6YA 5KLVD 3GF3A 1KFMA 1J1DC 3P7KA 2YKPA 4EYYQ 2H43A 1IFPA 1KFNA 2V7QH 2OYIA 2ZVOB 3A5TA 2FYNC 3L70J 2OTKE 4BRYB 5AW0B 1NTMK 3CD6P 1EDLA 5EFWB 1LP1B 3H6PA 1JM0A 2M3BA 1MV8A 1BGYJ 1S9KD 2ZT9D 3VOPA 1PP9E 2RKLA 2E76C 3M91A 1EDIA 4BRYA 5CCHA 1NJIQ 1N8RQ 5KLIC 1LP1A 3L74J 3FWNA 2L5GB 1WRGA 3MHVA 1YJ9P 3H1KG 3W68A 5K5GB 3I55P 1W5CE 1KB9H 2IPPA 5KLVK 2OYIC 5CBNA 1DD3A 4JBZA 2FY8A 2O01N 1Z56A 2PRRA 3BRTB 1FDMA 3BASA 1NTME 4JF7A 1KQLA 4KT0J 3L70G 4DT0A 2KSEA 5CCHC 3N7NA 4PJ0E 2FYUE 4AYCA 1KZUB 1YIJP 1BGYG 1ZMEC 1OVRA 1NU1J 3IR9A 3D71A 1BE3E 2NPSB 4UB8E 1YI2P 2WT7B 4RO0A 3L74G 5AW2B 1J2JB 1ZR4A 1SQXD 1CZQA 3B8EB 4Z1MH 3EQ2A 1HUCA 3VMXA 4U3FE 1VQLP 1HF9A 1NTKJ 3KPEA 2NPSA 1IFIA 2WT7A 2WSCJ 2I8DA 1FZFA 2GA1A 1JY3N 4IFFA 2V7QJ 3NTNA 3PHLA 2D2CD 1QL1A 2XU6A 1WT6A 4EIJA 3RBZA 3CCLP 1KQSO 1AV1A 5TISH 4DJGA 1CSBA 5CCHD 2NZ2A 1KYOI 1SQBJ 5L8RJ 2KOGA 4LLHA 1NU1G 5APTA 3CCEP 1R8EA 3A2AA 5CCGA 1ZLLA 3L71J 3WUVA 5AVXB 2ZXEB 2FXOA 3GMAA 2JWDA 1IFMA 3CX5D 2NPSC 2K1AA 3NFQA 2OYOA 2RMZA 1AA0A 4B86A 1W2BO 2R3SA 1OWAA 1NTKG 4YXWH 2IBZG 4NPDA 2FFDB 3P8CD 3L36A 3H1LD 2HG5D 4N78E 5CCGC 1LGHB 3BCCD 5APWA 1E5WA 1S5LE 1M1KQ 1VQOP 3TDKA 2IFMA 2Y0CA 1M90Q 2FFDA 3CPWO 5DJUB 1GTWA 2KYVA 4GIFA 4EI2A 2H7HA 3CI9A 5B5EE 3KZIE 1USDA 1M57D 1NKZB 2NPSD 1YHQP 1L0NJ 5APSA 3L75J 2OQQA 1KQFB 1OW6A 4JYCA 1AJYA 1IC2A 3A0HH 2LKMA 3FXDA 1N86A 2WSFH 1BCCG 5GTIH 1S1CX 2FFDC 2C9NY
chains in the Genus database with same CATH topology
1L0LG 1KYOH 1KB9H 3CX5H 3L72G 1NTMG 3CWBG 3L73G 1BE3G 4U3FG 1SQBG 3H1JG 3L74G 3L71G 1NU1G 1P84H 1PPJG 1EZVG 1PP9G 1SQPG 3H1LG 3H1HG 4PD4H 2A06G 3BCCG 1BGYG 3TGUG 1SQXG 4D6TG 3L75G 1L0NG 3H1IG 1NTKG 2FYUG 1SQQG 3CXHH 1SQVG 1BCCG 2IBZG 3H1KG 5KLVG 1NTZG 2BCCG 3L70G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L G;  1KYO H;  1KB9 H;  3CX5 H;  3L72 G;  1NTM G;  3CWB G;  3L73 G;  1BE3 G;  4U3F G;  1SQB G;  3H1J G;  3L74 G;  3L71 G;  1NU1 G;  1P84 H;  1PPJ G;  1EZV G;  1PP9 G;  1SQP G;  3H1L G;  3H1H G;  4PD4 H;  2A06 G;  3BCC G;  1BGY G;  3TGU G;  1SQX G;  4D6T G;  3L75 G;  1L0N G;  3H1I G;  1NTK G;  2FYU G;  1SQQ G;  3CXH H;  1SQV G;  1BCC G;  2IBZ G;  3H1K G;  5KLV G;  1NTZ G;  2BCC G;  3L70 G; 
#chains in the Genus database with same CATH topology
 1BDC A;  2IYP A;  1NGM B;  2RN0 A;  4OVN F;  5CCG D;  3AEC C;  1PPJ G;  3L73 J;  4WB4 A;  1VQ8 P;  3MUD A;  5AVT B;  2KNC B;  2WPR A;  3VYI A;  3H32 B;  1L0L G;  2HPC B;  1HJ0 A;  1DX7 A;  3CWB D;  1EZV D;  1JUN A;  5B66 H;  4A7P A;  1RQV A;  3L75 G;  2KNC A;  1SQP J;  2YXQ B;  1Q86 Q;  3NXS A;  3Q2Y A;  3O8Z A;  1NTZ D;  3P8C E;  3H32 A;  2L91 A;  2HPC A;  3H1L E;  2GUV A;  3V2R A;  3AE4 C;  3V2N A;  4C46 A;  2YIU B;  4W7Z A;  3Q5P A;  1JTH B;  2C9L Y;  3VMA A;  3L73 G;  1L4A B;  2P58 A;  3RL0 g;  1P84 H;  3O6Q B;  2QIW A;  3M9B A;  1JY3 P;  3IN6 A;  2E5T A;  1SQV D;  4NPE A;  1JTH A;  1LT9 A;  1L4A A;  3O6Q A;  1SQP G;  1ZRT D;  1ZXG A;  1BE3 J;  4N6J A;  3PP5 A;  5AW8 B;  5BU8 B;  4Y28 J;  5AVZ B;  1KTM A;  3LW5 H;  1URQ B;  5KLV J;  3CL3 D;  3CCV P;  3AED C;  3A0B H;  1U7M A;  2M5A B;  4RES B;  1SLQ A;  1YIT P;  3AE5 C;  3RK3 B;  1EDK A;  2YIU C;  1A02 F;  3MZW B;  3E1I A;  1SQV K;  1URQ A;  3JCU E;  2KIK A;  2K9Y A;  3CC7 P;  1L4A C;  1U57 A;  3FXE A;  2AXT H;  2VRS A;  4PD4 H;  2PGD A;  2M5A A;  2YMY A;  1X8Y A;  1KB9 E;  3P8M C;  2YXR B;  3SFE C;  3ITK A;  3L72 E;  1JEK A;  2KSJ A;  1VF5 B;  5AW4 B;  2IBZ I;  2R32 A;  1OVV A;  1VQ7 P;  1MZ9 A;  1BE3 G;  4KHX A;  1DEB A;  3FWL A;  2OYH B;  1RF0 C;  1QVG O;  2BCC E;  1FU1 A;  3T97 B;  5KLV G;  1ZN5 A;  1URQ C;  3HRN A;  1Y9B A;  3H1I E;  5BVZ A;  3H1H D;  2LXC B;  2KUB A;  4HJG H;  1SQV E;  4HKZ H;  4ASW A;  3RK3 C;  2P1J A;  2FYU D;  3T97 A;  2K88 A;  4M3L A;  4OWF A;  1KYO D;  1L4A D;  1ZRT E;  1KB9 I;  4WY4 B;  1GMJ A;  1Q90 D;  3F5H A;  1FOS E;  3QWO C;  2QEX P;  4WWI A;  1SQX J;  1VF5 C;  4UB6 E;  4I2L C;  2WSC H;  2NRG A;  1VQ5 P;  3RL0 B;  3LW5 J;  4U3F D;  3IFM A;  2OYH C;  1VQ4 P;  4WY4 A;  1FE6 A;  2XND H;  4LC1 A;  3S1K A;  3AE6 C;  4D6T G;  1URQ D;  2FYU K;  4HH2 A;  1KD1 Q;  3A3Y B;  2FBW C;  3RK3 D;  3QH9 A;  1EQ7 A;  1Q7Y Q;  3H1J J;  3L35 A;  1FBM A;  1IFD A;  4Y99 B;  5E79 E;  2KS1 B;  2HR3 A;  1K04 A;  4WY4 C;  4NPF X;  1SQQ E;  2A06 G;  1N73 B;  1W2E A;  4C7R A;  1SQX G;  2WSS H;  1VF5 D;  2N1T B;  1NWQ A;  2OGU A;  1OFC X;  2KS1 A;  4BWN A;  1SP4 A;  4YTP C;  3RL0 C;  3VP8 A;  3H1H E;  4GOD A;  5GTH E;  4AQR D;  1IO4 A;  4IL6 H;  1N73 A;  3H1L J;  1KYO E;  1YYC A;  3BCC J;  4N78 D;  2W83 C;  4XA4 A;  3HTK B;  2E76 D;  3E7K A;  3E1R A;  2KP8 A;  1EXJ A;  3H1J G;  4MN4 C;  3AE9 C;  2QJP B;  3V6I A;  1LTA C;  2H89 C;  3AE8 C;  3H25 A;  1PGQ A;  1LTT C;  3V4Q A;  3A0H E;  1NH4 A;  1LTS C;  2KLU A;  4OGQ B;  4Y99 C;  4WBA A;  1L2P A;  3R2P A;  2BEQ D;  4GOE A;  2CPB A;  1FAV A;  3EFG A;  3HTK A;  1M8O B;  5AW7 B;  4WY4 D;  4IL6 X;  3AEF C;  2ZYA A;  5GTI E;  1N73 C;  1R5S A;  5CMZ A;  1NYH A;  4ZNC A;  2N1T C;  3UIA A;  3RL0 D;  2WSE J;  4I1L A;  2E75 B;  1IK9 A;  4GOF A;  3RK3 E;  3MGN A;  1HVV A;  1LTG C;  1YQ3 C;  4ZKP A;  1GZL A;  1LTB C;  3BCC G;  1ZP0 C;  2KZI A;  2A45 I;  3SWF A;  1K8A Q;  1FZC B;  3K5B A;  3CXH H;  3AEB C;  1MKM A;  5B66 E;  2QRX A;  2N9B A;  2HLO A;  2G3A A;  2QJP C;  3CWB J;  4TLF A;  3RGU A;  1FDI A;  2ZYD A;  1ZW0 A;  1QGK B;  2E43 A;  4OGQ C;  2B87 B;  1FDO A;  1OVU A;  3MP7 B;  2R3C A;  3VTP C;  3PTZ A;  2LR2 A;  3WU2 H;  1NTZ J;  2PAJ A;  2BEZ F;  3ZDM A;  3G3Z A;  1T3J A;  2QJY B;  4CPG A;  1IJD B;  3HUS B;  2YMK A;  3BRV B;  1HGZ A;  2B87 A;  2E75 C;  1P84 E;  1SQB G;  3B71 A;  2G8Y A;  5APV A;  1H88 A;  4ASV A;  1KIL E;  4H0L B;  3IAO A;  5H2F E;  3L71 G;  2AEF A;  1T3U A;  4DCK A;  2Y9Y A;  1XTG B;  3HUS A;  2ZFC A;  1FZC C;  4K35 A;  1N7S B;  3PLN A;  2Q9I A;  1NOH A;  3OJA B;  5KAF E;  3B5N B;  2O3J A;  3G71 P;  3AE7 C;  3CWB G;  1BDD A;  1DD4 A;  1K73 Q;  1EZV G;  1FJK A;  4UB8 H;  1KN7 A;  4OGQ D;  3GLM A;  1NTK D;  3L70 E;  1N7S A;  3WUU A;  2IBZ D;  1PZQ A;  2OTJ P;  3B5N A;  1NTZ G;  1GL2 B;  1MFT A;  4YPC A;  2QJY C;  1P84 I;  1NU1 K;  3HUS C;  2E75 D;  1A02 J;  1VQ9 P;  4GT1 A;  1FC2 C;  2AXT E;  1OIP A;  3V5B A;  3L74 E;  4PD4 E;  2IFN A;  4H0L C;  2E74 B;  3I5C A;  5M1B A;  2C0W A;  2K3R A;  1RF1 B;  1L0N G;  1N7S C;  1PP9 J;  2CK3 H;  3SWK A;  1NTK K;  3B5N C;  2QM8 A;  1KB9 D;  1JB0 J;  1VPC A;  1YBK A;  3L72 D;  3CCS P;  2LXB A;  2YO2 A;  2BAS A;  3V2P A;  1HJB A;  1RF1 A;  1S4X A;  3OA7 A;  1BCC D;  3G4S P;  2XNX A;  2BCC D;  1OX3 A;  1NU1 E;  1HWT C;  1GL2 C;  3G9R A;  3PJS K;  1D7M A;  1PV3 A;  1Q82 Q;  4GKG A;  3RK2 B;  4H44 B;  1NTM J;  4I6M C;  3PH0 A;  2DW3 A;  4PD4 I;  3CCR P;  1GK4 A;  3Q1M A;  3H1I D;  3H1H J;  1J1E B;  3PRJ A;  3A7O A;  1CW5 A;  2W8Z A;  4I7Z B;  3TYY A;  4H0L D;  1L0L D;  2FYU J;  2P67 A;  2O1K A;  2IX7 C;  1RH5 B;  1PGP A;  1S5L H;  2E74 C;  1YJW P;  2JR8 A;  2WZ7 A;  1NTK E;  1CI6 B;  5CJ4 A;  1PP9 G;  1N7S D;  2IBZ E;  3WUT A;  4JPZ B;  3TGU D;  3L75 D;  1RF1 C;  1FZG A;  3CCM P;  3B5N D;  2QA4 P;  3MTU E;  4GDO A;  4HYT B;  5B5E H;  2QVA A;  2YKQ A;  3KZI H;  2JKV A;  1GU4 A;  1CI6 A;  4TT3 H;  2XZR A;  4U3F J;  1FOS F;  1RF0 A;  4EOT A;  2FXM A;  1LTJ B;  3KDP B;  1S5L X;  4R4L A;  1NTM G;  1L0L K;  3RK2 C;  3USS A;  4H44 C;  3AEG C;  1IFN A;  1J1E C;  2FYU G;  1M1J B;  3Q3D A;  4I7Z C;  1Q2N A;  3CX5 H;  1IK7 A;  2W6B A;  2B88 A;  1S72 P;  4K3A A;  1YQ4 C;  4R4M A;  1BCC E;  5AW3 B;  3M0A A;  1NAY A;  3D70 A;  1M1J A;  1SQQ D;  1IFJ A;  4O9B A;  1JOC A;  1PPJ E;  4YXD C;  1KOR A;  3TSI A;  2W27 A;  1G1I A;  4U3F G;  2Q1K A;  4QMA A;  2O01 J;  2OYH A;  4C7N B;  3W67 A;  1GK6 A;  3N4X A;  1G1J A;  1G2C B;  1L0L E;  1LTJ C;  4BXL A;  3VMY A;  2H8P D;  1KIL B;  1SS1 A;  1RHZ B;  1SVF A;  3AEE C;  3U1A A;  1X79 B;  1X0T A;  4H44 D;  3VP9 A;  4RJT A;  3TGU E;  3L75 E;  1FZB A;  2OTL P;  3TK1 A;  2YNY A;  4C7N A;  1KV4 A;  3M0D A;  4DOJ A;  1SQP K;  3SFD C;  1G2C A;  3SWY A;  2QM7 A;  1M1J C;  1TU3 F;  4PV1 B;  1KIL A;  1FS0 E;  1SQQ K;  3WMM 0;  1VQ6 P;  1JY2 O;  2ITA A;  2KXP B;  3IF4 A;  1YTZ T;  3L4F A;  2QJK B;  5KKZ B;  3D6Z A;  5TIS E;  1OW8 A;  1ZV8 A;  2D2C B;  2WSE H;  1QVF O;  3L73 E;  5AW9 B;  2JEE A;  5AVS B;  2J58 A;  1XTC C;  2YKO A;  4U7J A;  3V4W A;  3CXH E;  1KQG B;  1KC8 Q;  3P32 A;  3M0D C;  1T6A A;  2UWJ E;  1H8A A;  1KIL C;  3C8V A;  3GHG B;  3BVH A;  3C1L A;  2HYN A;  2B89 A;  1AQ5 A;  3CC4 P;  1N2D C;  2JJL A;  1SQP E;  4IFD K;  3KQG A;  2I1J A;  3TNU B;  4L74 A;  3JCU H;  4XE5 B;  1LWU B;  1H89 A;  3WU2 E;  2K37 A;  4PV1 C;  1NO4 A;  1EXI A;  3GHG A;  4WVZ A;  2JDI H;  5AW1 B;  2YO3 A;  3MIW A;  1QEX A;  1E79 H;  3CME P;  2QJK C;  1PGO A;  5KKZ C;  2MKV A;  2RH0 A;  1GU5 A;  3HD7 B;  3TNU A;  1BSN A;  3KXD A;  1HBW A;  4D6T D;  1OXZ A;  2D2C C;  1LWU A;  1HTL C;  2HFE D;  2N1T A;  1OMI A;  3CXH I;  3I56 P;  2ZVN B;  4HB1 A;  3M9Q A;  5AW5 B;  2FXP A;  1PL5 A;  1P84 D;  4N3Y B;  3ABV C;  2AEM A;  3HD7 A;  2Q3E A;  4LGD E;  1UII A;  1KIL D;  3F89 A;  1EC5 A;  4L73 A;  1EDJ A;  3GHG C;  5KAI H;  3H1K D;  2Q7C A;  3FGA D;  2OAR A;  3CCJ P;  1JMB A;  1DEE G;  4IFM A;  2PFX A;  1JO5 A;  2M3E A;  2A06 D;  1KMI Z;  4PV1 D;  5KLV E;  1LWU C;  2P10 A;  4RKU J;  2C0X A;  3L70 D;  2JO1 A;  1SFC B;  4OH8 B;  3TF5 A;  4L76 A;  1X22 A;  4UB6 H;  3HD7 C;  2JP3 A;  3H1L G;  1FJP A;  3AE1 C;  2W6A A;  1S9K E;  1BGY D;  1ZOY C;  4EDF A;  3LID A;  3NMD A;  1YJN P;  1Y8A A;  1RQU A;  3R4Y A;  1SFC A;  3H1J D;  3L74 D;  4PD4 D;  4DZO A;  2KI7 B;  1JY2 N;  1R5L A;  2Z5H A;  1S3J A;  1PGJ A;  1DH3 A;  1FZC A;  1SQX K;  3EFF K;  3GW6 A;  3CCQ P;  2IDB A;  2FYZ A;  1JCC A;  2WPV B;  5APQ A;  4D6T E;  5E79 H;  1RY3 A;  1K05 A;  3L72 J;  2Z5I A;  3RBX A;  2N1T D;  1GW3 A;  2I1K A;  1VL2 A;  2ZXX A;  2O1J A;  2KZJ A;  3S9O A;  1BCC J;  1SFC C;  3MD0 A;  3HD7 D;  1LJ2 A;  2BCC J;  1LT1 A;  1NU1 D;  1OW7 A;  2HOD B;  4KJM A;  3CC2 P;  2Y0E A;  1LTI C;  5GTH H;  1N7L A;  3H1K E;  4PJ0 H;  3Q5S A;  3H1I J;  2GM4 A;  5TJH A;  4W80 A;  1KYO H;  1SQV J;  2A06 E;  2AEJ A;  1VQM P;  1SQX E;  1L0L J;  1LNQ A;  1VQK P;  2HOD A;  2V4H A;  2A45 H;  4L75 A;  1H0T B;  5CHX A;  1HH0 A;  5APU A;  5AVW B;  3TGU J;  4AUW A;  3A0B E;  1M7L A;  3L72 G;  2E5Y A;  4ZMD A;  4XFJ A;  1BGY E;  3CMA P;  1VQP P;  2GUS A;  2M8R A;  2W90 A;  2IZ1 A;  1H0T A;  3S4R A;  1NKN A;  2WQY C;  3HE5 B;  1SFC D;  5CBO A;  1SQB D;  3H1J E;  2BCC G;  2QSI A;  2WMM A;  1GL2 A;  2J5U A;  3U1C A;  3L71 D;  2JWA A;  2WVR A;  2P2U A;  1NHL A;  4JYB A;  3CX5 E;  3H1I G;  3L37 A;  1S2E A;  2N9Y B;  1SQV G;  3HE5 A;  2POH A;  3KHU A;  2Q3I A;  2P7J A;  2XDJ A;  1GD2 E;  3GF7 A;  5KJ7 A;  3SSU A;  3GG2 A;  2WTY A;  5C39 A;  3G6E P;  1JNM A;  2ZYG A;  1VQN P;  1USE A;  3TGU G;  1AVO A;  2KLV A;  3C9I A;  4IOI H;  1PFI A;  1SQQ J;  2KB7 P;  3M9H A;  1SQB K;  3BCC E;  3AE2 C;  5KTB A;  2O01 H;  1MFZ A;  5AVQ B;  1PPJ D;  2ZJS E;  3AEA C;  1X9V A;  3MUD C;  3VN0 A;  4H13 B;  2AXC A;  2M0B A;  2IZ0 A;  2SPZ A;  3BAT A;  1JMM A;  1LT9 B;  5CJ0 A;  2Y9Z A;  2XV5 A;  1FZA A;  1OZH A;  5KJ7 C;  3CX5 I;  3EWK A;  2FKW B;  1VDF A;  3VMZ A;  3Q5R A;  1GW4 A;  1L0N D;  2WIT A;  2E42 A;  5H2F H;  3CCU P;  1Q81 Q;  5AW6 B;  1K9M Q;  1NTZ K;  1AVY A;  5KAF H;  1FZE A;  4ZKU A;  1T2K C;  2R5D A;  1SQB E;  1ZR2 A;  2WSF J;  1SQQ G;  1JY2 P;  1RE3 A;  2J59 M;  1GL2 D;  1PIX A;  3L71 E;  3M06 A;  3JC2 2;  2H88 C;  3L73 D;  2ZT9 B;  2WPS A;  2Y0D A;  3H1H G;  1RE4 A;  1DIP A;  5AVU B;  4JQ0 D;  1WMK A;  4H13 C;  2QG4 A;  3CXH D;  3FX0 A;  1QLE D;  1L0N K;  1LTJ A;  3CWB E;  1LT9 C;  5APX A;  5KJ7 D;  2E74 D;  2MJZ A;  1EZV E;  3II6 A;  2CPS A;  3JSV C;  3U59 A;  1HGV A;  1PP9 D;  1SQP D;  2A45 G;  2K9J B;  3KYQ A;  3HE4 B;  1QL2 A;  1NTZ E;  1RE3 C;  2WPQ A;  3CLQ A;  2QE7 H;  1J1D B;  3B4S A;  1U7J A;  4IL6 E;  2XKM A;  2WWW A;  2PP6 A;  1T2K D;  5AVY B;  2FYN B;  1T8Z A;  2K9J A;  1GDT A;  1RE4 C;  1NAF A;  1AFO A;  3OW2 O;  3OAK A;  3HE4 A;  1M56 D;  5BU5 A;  2W6J H;  1UIX A;  2KK7 A;  5DJT B;  1JY3 O;  4D6T J;  3V2Q A;  2R44 A;  3RK2 D;  1NTM D;  2ZT9 C;  3AE3 C;  2E76 B;  1L0N E;  5KAI E;  4H13 D;  2R5B A;  1YTZ I;  1Y47 A;  5APY A;  5AVR B;  1JCD A;  5KLI B;  1EZV I;  1QX8 A;  2ZAE B;  2Z4E A;  1NVO A;  2IYO A;  3H1K J;  1BSH A;  5AVV B;  1IZN B;  2B9B A;  2OYI B;  1BE3 D;  4W7Y A;  2Q5U A;  3LIE A;  2Q6Q A;  1AQT A;  1MUU A;  3D6Y A;  5KLV D;  3GF3 A;  1KFM A;  1J1D C;  3P7K A;  2YKP A;  4EYY Q;  2H43 A;  1IFP A;  1KFN A;  2V7Q H;  2OYI A;  2ZVO B;  3A5T A;  2FYN C;  3L70 J;  2OTK E;  4BRY B;  5AW0 B;  1NTM K;  3CD6 P;  1EDL A;  5EFW B;  1LP1 B;  3H6P A;  1JM0 A;  2M3B A;  1MV8 A;  1BGY J;  1S9K D;  2ZT9 D;  3VOP A;  1PP9 E;  2RKL A;  2E76 C;  3M91 A;  1EDI A;  4BRY A;  5CCH A;  1NJI Q;  1N8R Q;  5KLI C;  1LP1 A;  3L74 J;  3FWN A;  2L5G B;  1WRG A;  3MHV A;  1YJ9 P;  3H1K G;  3W68 A;  5K5G B;  3I55 P;  1W5C E;  1KB9 H;  2IPP A;  5KLV K;  2OYI C;  5CBN A;  1DD3 A;  4JBZ A;  2FY8 A;  2O01 N;  1Z56 A;  2PRR A;  3BRT B;  1FDM A;  3BAS A;  1NTM E;  4JF7 A;  1KQL A;  4KT0 J;  3L70 G;  4DT0 A;  2KSE A;  5CCH C;  3N7N A;  4PJ0 E;  2FYU E;  4AYC A;  1KZU B;  1YIJ P;  1BGY G;  1ZME C;  1OVR A;  1NU1 J;  3IR9 A;  3D71 A;  1BE3 E;  2NPS B;  4UB8 E;  1YI2 P;  2WT7 B;  4RO0 A;  3L74 G;  5AW2 B;  1J2J B;  1ZR4 A;  1SQX D;  1CZQ A;  3B8E B;  4Z1M H;  3EQ2 A;  1HUC A;  3VMX A;  4U3F E;  1VQL P;  1HF9 A;  1NTK J;  3KPE A;  2NPS A;  1IFI A;  2WT7 A;  2WSC J;  2I8D A;  1FZF A;  2GA1 A;  1JY3 N;  4IFF A;  2V7Q J;  3NTN A;  3PHL A;  2D2C D;  1QL1 A;  2XU6 A;  1WT6 A;  4EIJ A;  3RBZ A;  3CCL P;  1KQS O;  1AV1 A;  5TIS H;  4DJG A;  1CSB A;  5CCH D;  2NZ2 A;  1KYO I;  1SQB J;  5L8R J;  2KOG A;  4LLH A;  1NU1 G;  5APT A;  3CCE P;  1R8E A;  3A2A A;  5CCG A;  1ZLL A;  3L71 J;  3WUV A;  5AVX B;  2ZXE B;  2FXO A;  3GMA A;  2JWD A;  1IFM A;  3CX5 D;  2NPS C;  2K1A A;  3NFQ A;  2OYO A;  2RMZ A;  1AA0 A;  4B86 A;  1W2B O;  2R3S A;  1OWA A;  1NTK G;  4YXW H;  2IBZ G;  4NPD A;  2FFD B;  3P8C D;  3L36 A;  3H1L D;  2HG5 D;  4N78 E;  5CCG C;  1LGH B;  3BCC D;  5APW A;  1E5W A;  1S5L E;  1M1K Q;  1VQO P;  3TDK A;  2IFM A;  2Y0C A;  1M90 Q;  2FFD A;  3CPW O;  5DJU B;  1GTW A;  2KYV A;  4GIF A;  4EI2 A;  2H7H A;  3CI9 A;  5B5E E;  3KZI E;  1USD A;  1M57 D;  1NKZ B;  2NPS D;  1YHQ P;  1L0N J;  5APS A;  3L75 J;  2OQQ A;  1KQF B;  1OW6 A;  4JYC A;  1AJY A;  1IC2 A;  3A0H H;  2LKM A;  3FXD A;  1N86 A;  2WSF H;  1BCC G;  5GTI H;  1S1C X;  2FFD C;  2C9N Y; 
#chains in the Genus database with same CATH homology
 1L0L G;  1KYO H;  1KB9 H;  3CX5 H;  3L72 G;  1NTM G;  3CWB G;  3L73 G;  1BE3 G;  4U3F G;  1SQB G;  3H1J G;  3L74 G;  3L71 G;  1NU1 G;  1P84 H;  1PPJ G;  1EZV G;  1PP9 G;  1SQP G;  3H1L G;  3H1H G;  4PD4 H;  2A06 G;  3BCC G;  1BGY G;  3TGU G;  1SQX G;  4D6T G;  3L75 G;  1L0N G;  3H1I G;  1NTK G;  2FYU G;  1SQQ G;  3CXH H;  1SQV G;  1BCC G;  2IBZ G;  3H1K G;  5KLV G;  1NTZ G;  2BCC G;  3L70 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...