1NTKG

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntkG00
4D6TG 2A06G 3H1LG 3CX5H 5KLVG 1BGYG 3L74G 1SQVG 1NTKG 1SQBG 1L0NG 4U3FG 3BCCG 1NU1G 1EZVG 1SQQG 2BCCG 3H1IG 3L72G 3H1HG 3H1JG 1KB9H 1PP9G 3L70G 1NTMG 1KYOH 3L75G 3CWBG 1L0LG 1BCCG 3H1KG 3L73G 1NTZG 1SQXG 3CXHH 1BE3G 3TGUG 2FYUG 2IBZG 3L71G 4PD4H 1SQPG 1PPJG 1P84H
chains in the Genus database with same CATH superfamily
2HG5D 4D6TG 2A06G 1T6AA 1NU1J 2QJKC 1IC2A 2FXPA 3L72J 2KI7B 2Y0DA 1N8RQ 1LTSC 5KLVG 1M1KQ 2ZYAA 1BSHA 3H32A 1QL1A 3H1IE 4NPEA 5APWA 5L8RJ 3L35A 3SWKA 3OA7A 1LTJC 1BE3D 1G2CA 1URQC 2E74B 3PRJA 1NHLA 4RO0A 3RK3E 2OYHC 1MFZA 3PJSK 3CWBG 2WPRA 3L75D 1LTBC 1RF0C 2K88A 4HB1A 1YI2P 2Q9IA 1HVVA 1SQPK 2BASA 3H6PA 2BEZF 5AVRB 3VMYA 4U3FE 2KNCB 5APTA 5B66E 3I55P 1P84D 1S1CX 2BCCE 3O6QA 1KQLA 5H2FE 1JY3N 2E74C 1H0TB 3HUSB 4EOTA 3CC2P 1NTMD 2KSEA 3M91A 4EI2A 1T3JA 2Y9YA 2Q3EA 3PP5A 1EZVI 1P84H 4U3FD 4A7PA 4BWNA 1AFOA 1KYOI 3V4QA 1PP9E 3CCUP 1HUCA 1MUUA 5KLVD 2H88C 1LWUC 5AW6B 1DH3A 1GD2E 3TDKA 1KC8Q 2FYNC 3L74G 5TISE 1VQ5P 1EDKA 2JWAA 2RKLA 4W80A 2Y9ZA 1SQQG 3G71P 2JDIH 4I7ZB 3HRNA 1GL2A 1PPJD 2Q6QA 1PP9G 1ZR2A 3HD7C 3CCMP 2C0XA 1SVFA 5CMZA 1CI6A 1SQBJ 1SQXD 2JO1A 2QRXA 1KN7A 2FYUD 2FFDB 3A3YB 1AA0A 1M90Q 1LTAC 3VP8A 1Y9BA 4K3AA 2FYUE 2FYNB 3MZWB 2K9JA 5AW1B 1Q2NA 1OVUA 2W6JH 2IBZG 1L0LJ 1FDOA 3GHGA 4XFJA 1VQKP 1OZHA 2IYPA 2M5AA 4M3LA 2P58A 4Z1MH 1SQXJ 2WPSA 1NH4A 1S3JA 2AXCA 2IX7C 1ZMEC 1RHZB 3L72E 3TNUB 1URQA 3AEAC 4AUWA 1LP1B 2I1KA 3CC4P 3H1IJ 5APXA 3AE9C 2QEXP 1LWUB 1VQ8P 2HPCB 3MIWA 3A7OA 1FS0E 3D70A 3PH0A 5GTHE 2OGUA 3IAOA 2WSCJ 1FOSE 4IL6X 2YXQB 1Q81Q 1NU1G 1U7MA 3CCQP 1URQB 3OJAB 2Z5IA 3VMZA 1Y47A 5EFWB 2OYHB 1USEA 1OIPA 2E76C 1X79B 4U3FJ 5AW2B 3M0AA 1QEXA 2P67A 1BCCG 2HODB 3AEEC 3L73D 4PD4E 4XE5B 1UIXA 1NTZG 2A45I 3FWLA 3H1HD 2H8PD 2KYVA 4PD4D 4U7JA 3RGUA 5CBOA 3B5NA 1R8EA 1VQ6P 2YNYA 4H0LC 2NPSB 2N1TB 3HE5A 3Q5RA 3KYQA 3AE5C 3H1ID 2HYNA 2WPQA 3CLQA 4K35A 2WPVB 3MGNA 4D6TE 2YO3A 3M0DA 3SFEC 3AEDC 3U1CA 3N4XA 3L70E 1QLED 1L0NJ 1R5SA 1P84E 1KILE 2A45G 2BCCD 2L5GB 3H1LD 1OMIA 2B9BA 2O01J 1IK7A 3AE6C 1K04A 2NPSA 2IYOA 3IN6A 3L71J 2UWJE 4GODA 4R4MA 3S9OA 1KILB 1SQPJ 3H1KE 1USDA 3FXEA 1ZXGA 1T2KD 2WWWA 3USSA 3HTKB 1DX7A 1J2JB 3RL0g 1N86A 1IZNB 2QJPC 4WY4D 4YXWH 1JO5A 3NFQA 1WRGA 1KYOH 2KS1A 1HJ0A 2NRGA 4I6MC 2FYUJ 2IFMA 4HYTB 3BCCJ 2IFNA 2M3BA 5KLVE 3CCJP 1FDMA 3H1KG 2XDJA 4JYCA 1NVOA 2P7JA 1KZUB 2AEFA 1G1JA 2PGDA 2NPSD 1SQXE 1N7LA 1NTZK 1JB0J 3A0HE 3H1LJ 1ZV8A 2A45H 3V2NA 4EIJA 3CCLP 1OW6A 2N1TC 2QJPB 1T3UA 2K3RA 4OWFA 1NWQA 1BGYJ 1DEEG 1ZW0A 4GIFA 5AVQB 4KT0J 1A02F 4GOFA 4ZMDA 3H25A 4H44B 4JYBA 2B87A 3L75E 4UB8E 3FGAD 1ZN5A 2OTJP 1M7LA 2JKVA 2B88A 2K9JB 1QL2A 1Q7YQ 1BSNA 4HJGH 3P7KA 4HH2A 2RMZA 1PFIA 1BE3E 1Q90D 4OGQC 1HH0A 3RK3B 3OW2O 1N73A 3CXHE 3R2PA 4BRYB 5CCGD 1IFMA 1HBWA 1S4XA 1EZVE 3RK2D 1YITP 3CXHD 2E74D 2G3AA 4TT3H 2O01N 2B89A 1YBKA 1YJWP 3H1KD 3R4YA 1NTKK 1JY3O 1JY3P 2KS1B 1ZRTD 3AE2C 4BRYA 5KJ7D 5AVXB 5TISH 2H43A 3M9HA 1NYHA 1SQQE 3RK3C 5BU5A 2NPSC 3H32B 4D6TJ 5CBNA 1QVFO 3V2RA 2E5TA 5KLIC 4GDOA 3N7NA 4C7RA 1A02J 2QG4A 1NTKD 3HD7B 1G2CB 1N73C 1PPJG 2N1TD 1DD4A 1AVOA 3IFMA 4H44D 2OYIC 1OXZA 2BCCJ 2Q5UA 2GA1A 3F5HA 3G6EP 1GZLA 2Q7CA 4D6TD 2K9YA 3CCVP 1KFMA 1SQBG 1S2EA 2KNCA 2LXCB 2ZVNB 3RL0B 4OGQB 2Z5HA 5KLIB 3MD0A 3L72G 1OW7A 1LP1A 2JP3A 3AECC 3BCCE 3CX5E 5DJUB 1NTMG 5AW0B 4EYYQ 1EDIA 2OARA 2WSFJ 5KLVJ 1SQXK 2N1TA 4AYCA 1VQ4P 1E5WA 2ZFCA 1RE4A 4UB6H 3D6YA 1HF9A 1FC2C 2L91A 2D2CC 2PRRA 4OVNF 3H1LE 1NTZD 3HUSA 3QWOC 3AEBC 3HTKA 3GF7A 3KQGA 1TU3F 3RL0C 2IDBA 5KJ7A 3A5TA 2QM8A 3JSVC 3ITKA 4GOEA 1D7MA 1J1EC 3A0BE 1W2BO 1BGYD 5AVYB 2E76B 3VN0A 4C46A 2OYIB 3H1LG 2WSCH 5KKZB 1FU1A 3KZIE 1NTMK 1L0LE 2CPSA 1FBMA 2W27A 1E79H 2PAJA 3GHGC 3HE5B 1GW3A 1LTTC 3L74E 1PGQA 5DJTB 1SQVG 5KAFE 3MUDC 1VPCA 4H0LB 3U59A 2E76D 4IL6E 1BDDA 1PGPA 5E79E 5E79H 3P32A 1S72P 2Z4EA 1SQPD 1FJPA 3NMDA 3VTPC 2E75D 2JJLA 2R44A 3WUUA 1NTKJ 3TSIA 4L74A 2H89C 3Q5PA 2P1JA 1RQVA 1VDFA 4PV1D 2C9NY 1JMBA 3GHGB 2WT7B 3CPWO 1NKNA 2KZJA 3B71A 1SQXG 1Z56A 3CXHH 2R5DA 2MKVA 1BE3G 1RY3A 1SP4A 2XV5A 1LTIC 2M8RA 3C9IA 4IFMA 2B87B 3TGUG 1JM0A 2IPPA 4PJ0E 3RL0D 5KAIH 1KQSO 3CMEP 3AE8C 1G1IA 1J1EB 3JC22 2KXPB 2OYIA 1SQQD 1NTZE 3Q1MA 1NAFA 2QSIA 1K9MQ 1GDTA 1N2DC 3CX5H 1JTHB 2YKPA 2ZXEB 4N3YB 2LR2A 2W83C 4WY4A 1M1JB 4Y99C 3SWYA 1RE4C 1WMKA 3A0HH 1LT9A 2MJZA 3HE4B 1JCDA 2WSEJ 1NO4A 3I5CA 1RF0A 3FX0A 1AQTA 4I1LA 1T8ZA 1JTHA 3D71A 3JCUH 4WBAA 1NOHA 4H44C 3WU2H 1LT9B 2SPZA 4RJTA 2D2CB 3GW6A 1GL2B 3V6IA 2PFXA 3S4RA 1OW8A 1VQOP 1LGHB 1FJKA 5KAFH 2QVAA 4L75A 3H1JD 1Y8AA 4OH8B 5C39A 2FYUK 1S5LH 1U57A 1SQPG 3WUTA 1S5LE 1NU1D 1LT9C 3QH9A 3SFDC 3IR9A 5K5GB 2FY8A 5AW8B 4YXDC 1GL2C 1PV3A 3GLMA 5B66H 5CHXA 1PZQA 1BGYE 5BVZA 3CXHI 1W5CE 1H88A 1JY2N 1GTWA 3AE1C 4BXLA 1J1DC 1M57D 3H1HG 4JBZA 2R32A 1CI6B 3AE3C 5AVTB 4DZOA 5CCGA 4IOIH 2KSJA 3LIEA 1JEKA 4I2LC 1H8AA 3M06A 4N78D 1RQUA 5CJ0A 3L73G 5AVZB 5KTBA 4PJ0H 2G8YA 2FYUG 1VQMP 4TLFA 1YHQP 2V7QJ 1J1DB 1PGJA 1NTZJ 2WSFH 5APUA 5BU8B 1KYOE 1GU4A 4R4LA 1H0TA 1SQQJ 3A2AA 1SQVE 3WUVA 2XZRA 1GL2D 1M1JC 2WTYA 3O6QB 2D2CD 3L4FA 4KJMA 4MN4C 1M8OB 4LLHA 2YKQA 3ZDMA 4AQRD 1VQNP 2HLOA 1IK9A 3FWNA 1NTME 1YTZT 3H1JG 2J58A 2KOGA 3TGUD 1PIXA 1VF5C 3GF3A 5AW5B 3JCUE 1JY2P 1S9KE 4CPGA 2RH0A 3P8MC 2XNDH 2ZT9B 3PLNA 1H89A 3K5BA 3V2QA 4DOJA 1IJDB 1LT1A 2E43A 3HE4A 2J5UA 1IFDA 4L76A 1YTZI 3E1IA 3T97B 4EDFA 3CMAP 1KFNA 1PPJE 3EWKA 1K73Q 3CWBE 2IBZE 4ZKUA 1SQBK 2HPCA 1MFTA 3RBZA 3VYIA 1FE6A 1GW4A 3SWFA 4PD4I 1VQLP 4ASVA 3KXDA 1FZFA 4WB4A 1ZR4A 1KB9E 2YXRB 4DJGA 1DD3A 5KJ7C 1BGYG 2W90A 3VP9A 3P8CE 3CD6P 2FKWB 3B5NB 4U3FG 5CCHC 3LIDA 3H1JE 1CZQA 4ZNCA 1BCCJ 1X9VA 3BVHA 4ASWA 2E75B 2ZYDA 2HODA 1AV1A 1OFCX 3CL3D 3L74J 1K05A 1JMMA 2JR8A 2QIWA 3MTUE 3NTNA 3L75G 2O01H 3B8EB 3FXDA 4Y28J 2WMMA 3H1HJ 1YQ4C 3MUDA 4Y99B 3W68A 2C9LY 1RF1A 1YIJP 1PP9D 1JOCA 3B5NC 3E7KA 1EXIA 1LJ2A 1NTKE 2WQYC 3LW5H 2E75C 2OYHA 1L0LK 3L71G 2P10A 3NXSA 3RK2B 1JNMA 2OQQA 1SQVJ 3BRVB 3VOPA 1GK6A 1GK4A 3TYYA 2IZ1A 3WMM0 1FZEA 1HGVA 1KB9I 2QM7A 1OWAA 3L73E 2AXTH 5CCHA 3TF5A 1EDJA 1RH5B 2VRSA 3O8ZA 1N7SA 3EFGA 3G3ZA 3CCSP 4RKUJ 2N9BA 2W6AA 1NTKG 5APQA 1IFNA 5TJHA 2QA4P 1KILA 4WVZA 1KB9H 3HD7D 1VF5B 1CSBA 2IBZI 3L71D 2OTLP 1LNQA 2P2UA 3AE4C 2YIUB 2LXBA 1FDIA 1L0LG 3AEGC 3F89A 4GT1A 1HWTC 1HTLC 3PTZA 1FZCB 5CJ4A 1ZP0C 2A06E 1KD1Q 1KYOD 1KMIZ 3L72D 4WY4B 1N7SD 5KAIE 1EZVD 1NU1E 1EC5A 2R3SA 4W7ZA 3CWBJ 3B5ND 4H13B 5GTHH 2XNXA 3Q3DA 1FZBA 1N73B 1BDCA 1YQ3C 3D6ZA 2GUVA 1YJNP 4NPDA 1FZGA 3AEFC 1VQ7P 1P84I 4HKZH 2J59M 1FOSF 3V4WA 2O3JA 2LKMA 3L74D 1NGMB 1S5LX 2HFED 2KP8A 1NJIQ 1KQGB 1K8AQ 4N78E 1YYCA 2AEMA 4YTPC 1X0TA 3W67A 1LTGC 2KZIA 1BCCE 5GTIH 1KV4A 4IFDK 1L0NG 3L37A 5M1BA 1SS1A 4RESB 3TK1A 1SFCA 1XTGB 4WWIA 1X8YA 1RF1C 2PP6A 3E1RA 3KZIH 2GM4A 2O1KA 3WU2E 1URQD 2ITAA 2BEQD 2KIKA 1S9KD 2E42A 1VQ9P 1CW5A 4ZKPA 1OVVA 2KK7A 4LGDE 1X22A 5KKZC 1EDLA 2QJYB 1LWUA 4L73A 3L70D 3M9QA 1WT6A 3BCCD 2HR3A 3EQ2A 4N6JA 4NPFX 1N7SC 5AW7B 1L4AB 3SSUA 2R3CA 2M0BA 1AVYA 3RK2C 4PD4H 5CCGC 1L0NK 3VMAA 2YKOA 5APSA 2FFDA 2A06D 2KLUA 2YMYA 2ZYGA 1DEBA 3T97A 1NKZB 1SQBD 2ZT9C 5APYA 2QJYC 1IFPA 2K37A 2OTKE 4O9BA 1VQPP 1SQBE 3PHLA 2WVRA 2KB7P 5H2FH 2IBZD 1IFIA 2W8ZA 4H13D 4H0LD 2BCCG 2AEJA 1JCCA 4UB6E 5KLVK 1DIPA 5AVWB 2N9YB 3CX5I 1RF1B 2V7QH 3BRTB 3MP7B 2WSSH 4XA4A 1RE3A 3TGUJ 1GU5A 2YO2A 2YIUC 5AW9B 2FFDC 4PV1C 1SFCB 3MHVA 2JWDA 3RBXA 4IFFA 1KB9D 1KTMA 2I8DA 4JF7A 1NTMJ 4LC1A 3GG2A 3IF4A 1R5LA 3KPEA 2ZVOB 3GMAA 2KUBA 2WZ7A 2AXTE 1W2EA 3CWBD 3RK3D 1EXJA 2H7HA 1N7SB 1L4AC 2NZ2A 3V5BA 3Q5SA 3P8CD 2JEEA 3B4SA 1JUNA 5B5EH 2OYOA 1XTCC 1OVRA 1SFCC 4DCKA 2ZJSE 4C7NB 3A0BH 1PL5A 2CK3H 4IL6H 2QE7H 3II6A 3EFFK 5GTIE 3CC7P 2ZT9D 2Y0CA 3L36A 3Q2YA 1U7JA 1FZAA 4OGQD 3BCCG 1FZCA 1MV8A 3I56P 3ABVC 3CCEP 1EQ7A 3H1IG 1LTJB 2M3EA 3CCRP 1AQ5A 4UB8H 2WT7A 2V4HA 3KDPB 4KHXA 4YPCA 5B5EE 2FXOA 1SFCD 4JPZB 2M5AB 3M0DC 1AJYA 1ZRTE 3BASA 3CI9A 1L0LD 3M9BA 3VMXA 2KLVA 1ZOYC 3H1JJ 5AW3B 5APVA 3BATA 1IFJA 1QGKB 1L0NE 3C1LA 3L70J 4W7YA 2GUSA 1M1JA 4JQ0D 2WSEH 2Q1KA 3C8VA 3L71E 1HGZA 3OAKA 1HJBA 1SQPE 3H1KJ 2Q3IA 5AVVB 3HUSC 2XKMA 3G9RA 1Q82Q 2POHA 3H1HE 4QMAA 2C0WA 1L0ND 1L4AD 1NU1K 2E5YA 3LW5J 1SQVD 5AVUB 1FAVA 1GMJA 1OX3A 3U1AA 3G4SP 4B86A 1FZCC 2DW3A 1KILD 2FXMA 1PP9J 1SLQA 2I1JA 3AE7C 4GKGA 4WY4C 4DT0A 2RN0A 3KHUA 5AVSB 4H13C 3TNUA 2CPBA 3CX5D 1EZVG 3TGUE 1L2PA 4I7ZC 1SQVK 1VF5D 3L73J 1MZ9A 1RE3C 1NAYA 2W6BA 3L70G 3S1KA 3HD7A 3V2PA 2YMKA 2FYZA 2WITA 2ZAEB 4PV1B 1L4AA 2IZ0A 2K1AA 1BCCD 1LTJA 1UIIA 1VL2A 2QJKB 1QVGO 1T2KC 2ZXXA 3UIAA 1M56D 1JY2O 1MKMA 1Q86Q 1KILC 1ZLLA 1IO4A 1QX8A 2O1JA 3L75J 2Y0EA 5CCHD 2FBWC 1KQFB 4C7NA 1YJ9P 2R5BA 2XU6A 5AW4B 1BE3J 1PGOA 1KORA 1SQQK
chains in the Genus database with same CATH topology
4D6TG 2A06G 3H1LG 3CX5H 5KLVG 1BGYG 3L74G 1SQVG 1NTKG 1SQBG 1L0NG 4U3FG 3BCCG 1NU1G 1EZVG 1SQQG 2BCCG 3H1IG 3L72G 3H1HG 3H1JG 1KB9H 1PP9G 3L70G 1NTMG 1KYOH 3L75G 3CWBG 1L0LG 1BCCG 3H1KG 3L73G 1NTZG 1SQXG 3CXHH 1BE3G 3TGUG 2FYUG 2IBZG 3L71G 4PD4H 1SQPG 1PPJG 1P84H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T G;  2A06 G;  3H1L G;  3CX5 H;  5KLV G;  1BGY G;  3L74 G;  1SQV G;  1NTK G;  1SQB G;  1L0N G;  4U3F G;  3BCC G;  1NU1 G;  1EZV G;  1SQQ G;  2BCC G;  3H1I G;  3L72 G;  3H1H G;  3H1J G;  1KB9 H;  1PP9 G;  3L70 G;  1NTM G;  1KYO H;  3L75 G;  3CWB G;  1L0L G;  1BCC G;  3H1K G;  3L73 G;  1NTZ G;  1SQX G;  3CXH H;  1BE3 G;  3TGU G;  2FYU G;  2IBZ G;  3L71 G;  4PD4 H;  1SQP G;  1PPJ G;  1P84 H; 
#chains in the Genus database with same CATH topology
 2HG5 D;  4D6T G;  2A06 G;  1T6A A;  1NU1 J;  2QJK C;  1IC2 A;  2FXP A;  3L72 J;  2KI7 B;  2Y0D A;  1N8R Q;  1LTS C;  5KLV G;  1M1K Q;  2ZYA A;  1BSH A;  3H32 A;  1QL1 A;  3H1I E;  4NPE A;  5APW A;  5L8R J;  3L35 A;  3SWK A;  3OA7 A;  1LTJ C;  1BE3 D;  1G2C A;  1URQ C;  2E74 B;  3PRJ A;  1NHL A;  4RO0 A;  3RK3 E;  2OYH C;  1MFZ A;  3PJS K;  3CWB G;  2WPR A;  3L75 D;  1LTB C;  1RF0 C;  2K88 A;  4HB1 A;  1YI2 P;  2Q9I A;  1HVV A;  1SQP K;  2BAS A;  3H6P A;  2BEZ F;  5AVR B;  3VMY A;  4U3F E;  2KNC B;  5APT A;  5B66 E;  3I55 P;  1P84 D;  1S1C X;  2BCC E;  3O6Q A;  1KQL A;  5H2F E;  1JY3 N;  2E74 C;  1H0T B;  3HUS B;  4EOT A;  3CC2 P;  1NTM D;  2KSE A;  3M91 A;  4EI2 A;  1T3J A;  2Y9Y A;  2Q3E A;  3PP5 A;  1EZV I;  1P84 H;  4U3F D;  4A7P A;  4BWN A;  1AFO A;  1KYO I;  3V4Q A;  1PP9 E;  3CCU P;  1HUC A;  1MUU A;  5KLV D;  2H88 C;  1LWU C;  5AW6 B;  1DH3 A;  1GD2 E;  3TDK A;  1KC8 Q;  2FYN C;  3L74 G;  5TIS E;  1VQ5 P;  1EDK A;  2JWA A;  2RKL A;  4W80 A;  2Y9Z A;  1SQQ G;  3G71 P;  2JDI H;  4I7Z B;  3HRN A;  1GL2 A;  1PPJ D;  2Q6Q A;  1PP9 G;  1ZR2 A;  3HD7 C;  3CCM P;  2C0X A;  1SVF A;  5CMZ A;  1CI6 A;  1SQB J;  1SQX D;  2JO1 A;  2QRX A;  1KN7 A;  2FYU D;  2FFD B;  3A3Y B;  1AA0 A;  1M90 Q;  1LTA C;  3VP8 A;  1Y9B A;  4K3A A;  2FYU E;  2FYN B;  3MZW B;  2K9J A;  5AW1 B;  1Q2N A;  1OVU A;  2W6J H;  2IBZ G;  1L0L J;  1FDO A;  3GHG A;  4XFJ A;  1VQK P;  1OZH A;  2IYP A;  2M5A A;  4M3L A;  2P58 A;  4Z1M H;  1SQX J;  2WPS A;  1NH4 A;  1S3J A;  2AXC A;  2IX7 C;  1ZME C;  1RHZ B;  3L72 E;  3TNU B;  1URQ A;  3AEA C;  4AUW A;  1LP1 B;  2I1K A;  3CC4 P;  3H1I J;  5APX A;  3AE9 C;  2QEX P;  1LWU B;  1VQ8 P;  2HPC B;  3MIW A;  3A7O A;  1FS0 E;  3D70 A;  3PH0 A;  5GTH E;  2OGU A;  3IAO A;  2WSC J;  1FOS E;  4IL6 X;  2YXQ B;  1Q81 Q;  1NU1 G;  1U7M A;  3CCQ P;  1URQ B;  3OJA B;  2Z5I A;  3VMZ A;  1Y47 A;  5EFW B;  2OYH B;  1USE A;  1OIP A;  2E76 C;  1X79 B;  4U3F J;  5AW2 B;  3M0A A;  1QEX A;  2P67 A;  1BCC G;  2HOD B;  3AEE C;  3L73 D;  4PD4 E;  4XE5 B;  1UIX A;  1NTZ G;  2A45 I;  3FWL A;  3H1H D;  2H8P D;  2KYV A;  4PD4 D;  4U7J A;  3RGU A;  5CBO A;  3B5N A;  1R8E A;  1VQ6 P;  2YNY A;  4H0L C;  2NPS B;  2N1T B;  3HE5 A;  3Q5R A;  3KYQ A;  3AE5 C;  3H1I D;  2HYN A;  2WPQ A;  3CLQ A;  4K35 A;  2WPV B;  3MGN A;  4D6T E;  2YO3 A;  3M0D A;  3SFE C;  3AED C;  3U1C A;  3N4X A;  3L70 E;  1QLE D;  1L0N J;  1R5S A;  1P84 E;  1KIL E;  2A45 G;  2BCC D;  2L5G B;  3H1L D;  1OMI A;  2B9B A;  2O01 J;  1IK7 A;  3AE6 C;  1K04 A;  2NPS A;  2IYO A;  3IN6 A;  3L71 J;  2UWJ E;  4GOD A;  4R4M A;  3S9O A;  1KIL B;  1SQP J;  3H1K E;  1USD A;  3FXE A;  1ZXG A;  1T2K D;  2WWW A;  3USS A;  3HTK B;  1DX7 A;  1J2J B;  3RL0 g;  1N86 A;  1IZN B;  2QJP C;  4WY4 D;  4YXW H;  1JO5 A;  3NFQ A;  1WRG A;  1KYO H;  2KS1 A;  1HJ0 A;  2NRG A;  4I6M C;  2FYU J;  2IFM A;  4HYT B;  3BCC J;  2IFN A;  2M3B A;  5KLV E;  3CCJ P;  1FDM A;  3H1K G;  2XDJ A;  4JYC A;  1NVO A;  2P7J A;  1KZU B;  2AEF A;  1G1J A;  2PGD A;  2NPS D;  1SQX E;  1N7L A;  1NTZ K;  1JB0 J;  3A0H E;  3H1L J;  1ZV8 A;  2A45 H;  3V2N A;  4EIJ A;  3CCL P;  1OW6 A;  2N1T C;  2QJP B;  1T3U A;  2K3R A;  4OWF A;  1NWQ A;  1BGY J;  1DEE G;  1ZW0 A;  4GIF A;  5AVQ B;  4KT0 J;  1A02 F;  4GOF A;  4ZMD A;  3H25 A;  4H44 B;  4JYB A;  2B87 A;  3L75 E;  4UB8 E;  3FGA D;  1ZN5 A;  2OTJ P;  1M7L A;  2JKV A;  2B88 A;  2K9J B;  1QL2 A;  1Q7Y Q;  1BSN A;  4HJG H;  3P7K A;  4HH2 A;  2RMZ A;  1PFI A;  1BE3 E;  1Q90 D;  4OGQ C;  1HH0 A;  3RK3 B;  3OW2 O;  1N73 A;  3CXH E;  3R2P A;  4BRY B;  5CCG D;  1IFM A;  1HBW A;  1S4X A;  1EZV E;  3RK2 D;  1YIT P;  3CXH D;  2E74 D;  2G3A A;  4TT3 H;  2O01 N;  2B89 A;  1YBK A;  1YJW P;  3H1K D;  3R4Y A;  1NTK K;  1JY3 O;  1JY3 P;  2KS1 B;  1ZRT D;  3AE2 C;  4BRY A;  5KJ7 D;  5AVX B;  5TIS H;  2H43 A;  3M9H A;  1NYH A;  1SQQ E;  3RK3 C;  5BU5 A;  2NPS C;  3H32 B;  4D6T J;  5CBN A;  1QVF O;  3V2R A;  2E5T A;  5KLI C;  4GDO A;  3N7N A;  4C7R A;  1A02 J;  2QG4 A;  1NTK D;  3HD7 B;  1G2C B;  1N73 C;  1PPJ G;  2N1T D;  1DD4 A;  1AVO A;  3IFM A;  4H44 D;  2OYI C;  1OXZ A;  2BCC J;  2Q5U A;  2GA1 A;  3F5H A;  3G6E P;  1GZL A;  2Q7C A;  4D6T D;  2K9Y A;  3CCV P;  1KFM A;  1SQB G;  1S2E A;  2KNC A;  2LXC B;  2ZVN B;  3RL0 B;  4OGQ B;  2Z5H A;  5KLI B;  3MD0 A;  3L72 G;  1OW7 A;  1LP1 A;  2JP3 A;  3AEC C;  3BCC E;  3CX5 E;  5DJU B;  1NTM G;  5AW0 B;  4EYY Q;  1EDI A;  2OAR A;  2WSF J;  5KLV J;  1SQX K;  2N1T A;  4AYC A;  1VQ4 P;  1E5W A;  2ZFC A;  1RE4 A;  4UB6 H;  3D6Y A;  1HF9 A;  1FC2 C;  2L91 A;  2D2C C;  2PRR A;  4OVN F;  3H1L E;  1NTZ D;  3HUS A;  3QWO C;  3AEB C;  3HTK A;  3GF7 A;  3KQG A;  1TU3 F;  3RL0 C;  2IDB A;  5KJ7 A;  3A5T A;  2QM8 A;  3JSV C;  3ITK A;  4GOE A;  1D7M A;  1J1E C;  3A0B E;  1W2B O;  1BGY D;  5AVY B;  2E76 B;  3VN0 A;  4C46 A;  2OYI B;  3H1L G;  2WSC H;  5KKZ B;  1FU1 A;  3KZI E;  1NTM K;  1L0L E;  2CPS A;  1FBM A;  2W27 A;  1E79 H;  2PAJ A;  3GHG C;  3HE5 B;  1GW3 A;  1LTT C;  3L74 E;  1PGQ A;  5DJT B;  1SQV G;  5KAF E;  3MUD C;  1VPC A;  4H0L B;  3U59 A;  2E76 D;  4IL6 E;  1BDD A;  1PGP A;  5E79 E;  5E79 H;  3P32 A;  1S72 P;  2Z4E A;  1SQP D;  1FJP A;  3NMD A;  3VTP C;  2E75 D;  2JJL A;  2R44 A;  3WUU A;  1NTK J;  3TSI A;  4L74 A;  2H89 C;  3Q5P A;  2P1J A;  1RQV A;  1VDF A;  4PV1 D;  2C9N Y;  1JMB A;  3GHG B;  2WT7 B;  3CPW O;  1NKN A;  2KZJ A;  3B71 A;  1SQX G;  1Z56 A;  3CXH H;  2R5D A;  2MKV A;  1BE3 G;  1RY3 A;  1SP4 A;  2XV5 A;  1LTI C;  2M8R A;  3C9I A;  4IFM A;  2B87 B;  3TGU G;  1JM0 A;  2IPP A;  4PJ0 E;  3RL0 D;  5KAI H;  1KQS O;  3CME P;  3AE8 C;  1G1I A;  1J1E B;  3JC2 2;  2KXP B;  2OYI A;  1SQQ D;  1NTZ E;  3Q1M A;  1NAF A;  2QSI A;  1K9M Q;  1GDT A;  1N2D C;  3CX5 H;  1JTH B;  2YKP A;  2ZXE B;  4N3Y B;  2LR2 A;  2W83 C;  4WY4 A;  1M1J B;  4Y99 C;  3SWY A;  1RE4 C;  1WMK A;  3A0H H;  1LT9 A;  2MJZ A;  3HE4 B;  1JCD A;  2WSE J;  1NO4 A;  3I5C A;  1RF0 A;  3FX0 A;  1AQT A;  4I1L A;  1T8Z A;  1JTH A;  3D71 A;  3JCU H;  4WBA A;  1NOH A;  4H44 C;  3WU2 H;  1LT9 B;  2SPZ A;  4RJT A;  2D2C B;  3GW6 A;  1GL2 B;  3V6I A;  2PFX A;  3S4R A;  1OW8 A;  1VQO P;  1LGH B;  1FJK A;  5KAF H;  2QVA A;  4L75 A;  3H1J D;  1Y8A A;  4OH8 B;  5C39 A;  2FYU K;  1S5L H;  1U57 A;  1SQP G;  3WUT A;  1S5L E;  1NU1 D;  1LT9 C;  3QH9 A;  3SFD C;  3IR9 A;  5K5G B;  2FY8 A;  5AW8 B;  4YXD C;  1GL2 C;  1PV3 A;  3GLM A;  5B66 H;  5CHX A;  1PZQ A;  1BGY E;  5BVZ A;  3CXH I;  1W5C E;  1H88 A;  1JY2 N;  1GTW A;  3AE1 C;  4BXL A;  1J1D C;  1M57 D;  3H1H G;  4JBZ A;  2R32 A;  1CI6 B;  3AE3 C;  5AVT B;  4DZO A;  5CCG A;  4IOI H;  2KSJ A;  3LIE A;  1JEK A;  4I2L C;  1H8A A;  3M06 A;  4N78 D;  1RQU A;  5CJ0 A;  3L73 G;  5AVZ B;  5KTB A;  4PJ0 H;  2G8Y A;  2FYU G;  1VQM P;  4TLF A;  1YHQ P;  2V7Q J;  1J1D B;  1PGJ A;  1NTZ J;  2WSF H;  5APU A;  5BU8 B;  1KYO E;  1GU4 A;  4R4L A;  1H0T A;  1SQQ J;  3A2A A;  1SQV E;  3WUV A;  2XZR A;  1GL2 D;  1M1J C;  2WTY A;  3O6Q B;  2D2C D;  3L4F A;  4KJM A;  4MN4 C;  1M8O B;  4LLH A;  2YKQ A;  3ZDM A;  4AQR D;  1VQN P;  2HLO A;  1IK9 A;  3FWN A;  1NTM E;  1YTZ T;  3H1J G;  2J58 A;  2KOG A;  3TGU D;  1PIX A;  1VF5 C;  3GF3 A;  5AW5 B;  3JCU E;  1JY2 P;  1S9K E;  4CPG A;  2RH0 A;  3P8M C;  2XND H;  2ZT9 B;  3PLN A;  1H89 A;  3K5B A;  3V2Q A;  4DOJ A;  1IJD B;  1LT1 A;  2E43 A;  3HE4 A;  2J5U A;  1IFD A;  4L76 A;  1YTZ I;  3E1I A;  3T97 B;  4EDF A;  3CMA P;  1KFN A;  1PPJ E;  3EWK A;  1K73 Q;  3CWB E;  2IBZ E;  4ZKU A;  1SQB K;  2HPC A;  1MFT A;  3RBZ A;  3VYI A;  1FE6 A;  1GW4 A;  3SWF A;  4PD4 I;  1VQL P;  4ASV A;  3KXD A;  1FZF A;  4WB4 A;  1ZR4 A;  1KB9 E;  2YXR B;  4DJG A;  1DD3 A;  5KJ7 C;  1BGY G;  2W90 A;  3VP9 A;  3P8C E;  3CD6 P;  2FKW B;  3B5N B;  4U3F G;  5CCH C;  3LID A;  3H1J E;  1CZQ A;  4ZNC A;  1BCC J;  1X9V A;  3BVH A;  4ASW A;  2E75 B;  2ZYD A;  2HOD A;  1AV1 A;  1OFC X;  3CL3 D;  3L74 J;  1K05 A;  1JMM A;  2JR8 A;  2QIW A;  3MTU E;  3NTN A;  3L75 G;  2O01 H;  3B8E B;  3FXD A;  4Y28 J;  2WMM A;  3H1H J;  1YQ4 C;  3MUD A;  4Y99 B;  3W68 A;  2C9L Y;  1RF1 A;  1YIJ P;  1PP9 D;  1JOC A;  3B5N C;  3E7K A;  1EXI A;  1LJ2 A;  1NTK E;  2WQY C;  3LW5 H;  2E75 C;  2OYH A;  1L0L K;  3L71 G;  2P10 A;  3NXS A;  3RK2 B;  1JNM A;  2OQQ A;  1SQV J;  3BRV B;  3VOP A;  1GK6 A;  1GK4 A;  3TYY A;  2IZ1 A;  3WMM 0;  1FZE A;  1HGV A;  1KB9 I;  2QM7 A;  1OWA A;  3L73 E;  2AXT H;  5CCH A;  3TF5 A;  1EDJ A;  1RH5 B;  2VRS A;  3O8Z A;  1N7S A;  3EFG A;  3G3Z A;  3CCS P;  4RKU J;  2N9B A;  2W6A A;  1NTK G;  5APQ A;  1IFN A;  5TJH A;  2QA4 P;  1KIL A;  4WVZ A;  1KB9 H;  3HD7 D;  1VF5 B;  1CSB A;  2IBZ I;  3L71 D;  2OTL P;  1LNQ A;  2P2U A;  3AE4 C;  2YIU B;  2LXB A;  1FDI A;  1L0L G;  3AEG C;  3F89 A;  4GT1 A;  1HWT C;  1HTL C;  3PTZ A;  1FZC B;  5CJ4 A;  1ZP0 C;  2A06 E;  1KD1 Q;  1KYO D;  1KMI Z;  3L72 D;  4WY4 B;  1N7S D;  5KAI E;  1EZV D;  1NU1 E;  1EC5 A;  2R3S A;  4W7Z A;  3CWB J;  3B5N D;  4H13 B;  5GTH H;  2XNX A;  3Q3D A;  1FZB A;  1N73 B;  1BDC A;  1YQ3 C;  3D6Z A;  2GUV A;  1YJN P;  4NPD A;  1FZG A;  3AEF C;  1VQ7 P;  1P84 I;  4HKZ H;  2J59 M;  1FOS F;  3V4W A;  2O3J A;  2LKM A;  3L74 D;  1NGM B;  1S5L X;  2HFE D;  2KP8 A;  1NJI Q;  1KQG B;  1K8A Q;  4N78 E;  1YYC A;  2AEM A;  4YTP C;  1X0T A;  3W67 A;  1LTG C;  2KZI A;  1BCC E;  5GTI H;  1KV4 A;  4IFD K;  1L0N G;  3L37 A;  5M1B A;  1SS1 A;  4RES B;  3TK1 A;  1SFC A;  1XTG B;  4WWI A;  1X8Y A;  1RF1 C;  2PP6 A;  3E1R A;  3KZI H;  2GM4 A;  2O1K A;  3WU2 E;  1URQ D;  2ITA A;  2BEQ D;  2KIK A;  1S9K D;  2E42 A;  1VQ9 P;  1CW5 A;  4ZKP A;  1OVV A;  2KK7 A;  4LGD E;  1X22 A;  5KKZ C;  1EDL A;  2QJY B;  1LWU A;  4L73 A;  3L70 D;  3M9Q A;  1WT6 A;  3BCC D;  2HR3 A;  3EQ2 A;  4N6J A;  4NPF X;  1N7S C;  5AW7 B;  1L4A B;  3SSU A;  2R3C A;  2M0B A;  1AVY A;  3RK2 C;  4PD4 H;  5CCG C;  1L0N K;  3VMA A;  2YKO A;  5APS A;  2FFD A;  2A06 D;  2KLU A;  2YMY A;  2ZYG A;  1DEB A;  3T97 A;  1NKZ B;  1SQB D;  2ZT9 C;  5APY A;  2QJY C;  1IFP A;  2K37 A;  2OTK E;  4O9B A;  1VQP P;  1SQB E;  3PHL A;  2WVR A;  2KB7 P;  5H2F H;  2IBZ D;  1IFI A;  2W8Z A;  4H13 D;  4H0L D;  2BCC G;  2AEJ A;  1JCC A;  4UB6 E;  5KLV K;  1DIP A;  5AVW B;  2N9Y B;  3CX5 I;  1RF1 B;  2V7Q H;  3BRT B;  3MP7 B;  2WSS H;  4XA4 A;  1RE3 A;  3TGU J;  1GU5 A;  2YO2 A;  2YIU C;  5AW9 B;  2FFD C;  4PV1 C;  1SFC B;  3MHV A;  2JWD A;  3RBX A;  4IFF A;  1KB9 D;  1KTM A;  2I8D A;  4JF7 A;  1NTM J;  4LC1 A;  3GG2 A;  3IF4 A;  1R5L A;  3KPE A;  2ZVO B;  3GMA A;  2KUB A;  2WZ7 A;  2AXT E;  1W2E A;  3CWB D;  3RK3 D;  1EXJ A;  2H7H A;  1N7S B;  1L4A C;  2NZ2 A;  3V5B A;  3Q5S A;  3P8C D;  2JEE A;  3B4S A;  1JUN A;  5B5E H;  2OYO A;  1XTC C;  1OVR A;  1SFC C;  4DCK A;  2ZJS E;  4C7N B;  3A0B H;  1PL5 A;  2CK3 H;  4IL6 H;  2QE7 H;  3II6 A;  3EFF K;  5GTI E;  3CC7 P;  2ZT9 D;  2Y0C A;  3L36 A;  3Q2Y A;  1U7J A;  1FZA A;  4OGQ D;  3BCC G;  1FZC A;  1MV8 A;  3I56 P;  3ABV C;  3CCE P;  1EQ7 A;  3H1I G;  1LTJ B;  2M3E A;  3CCR P;  1AQ5 A;  4UB8 H;  2WT7 A;  2V4H A;  3KDP B;  4KHX A;  4YPC A;  5B5E E;  2FXO A;  1SFC D;  4JPZ B;  2M5A B;  3M0D C;  1AJY A;  1ZRT E;  3BAS A;  3CI9 A;  1L0L D;  3M9B A;  3VMX A;  2KLV A;  1ZOY C;  3H1J J;  5AW3 B;  5APV A;  3BAT A;  1IFJ A;  1QGK B;  1L0N E;  3C1L A;  3L70 J;  4W7Y A;  2GUS A;  1M1J A;  4JQ0 D;  2WSE H;  2Q1K A;  3C8V A;  3L71 E;  1HGZ A;  3OAK A;  1HJB A;  1SQP E;  3H1K J;  2Q3I A;  5AVV B;  3HUS C;  2XKM A;  3G9R A;  1Q82 Q;  2POH A;  3H1H E;  4QMA A;  2C0W A;  1L0N D;  1L4A D;  1NU1 K;  2E5Y A;  3LW5 J;  1SQV D;  5AVU B;  1FAV A;  1GMJ A;  1OX3 A;  3U1A A;  3G4S P;  4B86 A;  1FZC C;  2DW3 A;  1KIL D;  2FXM A;  1PP9 J;  1SLQ A;  2I1J A;  3AE7 C;  4GKG A;  4WY4 C;  4DT0 A;  2RN0 A;  3KHU A;  5AVS B;  4H13 C;  3TNU A;  2CPB A;  3CX5 D;  1EZV G;  3TGU E;  1L2P A;  4I7Z C;  1SQV K;  1VF5 D;  3L73 J;  1MZ9 A;  1RE3 C;  1NAY A;  2W6B A;  3L70 G;  3S1K A;  3HD7 A;  3V2P A;  2YMK A;  2FYZ A;  2WIT A;  2ZAE B;  4PV1 B;  1L4A A;  2IZ0 A;  2K1A A;  1BCC D;  1LTJ A;  1UII A;  1VL2 A;  2QJK B;  1QVG O;  1T2K C;  2ZXX A;  3UIA A;  1M56 D;  1JY2 O;  1MKM A;  1Q86 Q;  1KIL C;  1ZLL A;  1IO4 A;  1QX8 A;  2O1J A;  3L75 J;  2Y0E A;  5CCH D;  2FBW C;  1KQF B;  4C7N A;  1YJ9 P;  2R5B A;  2XU6 A;  5AW4 B;  1BE3 J;  1PGO A;  1KOR A;  1SQQ K; 
#chains in the Genus database with same CATH homology
 4D6T G;  2A06 G;  3H1L G;  3CX5 H;  5KLV G;  1BGY G;  3L74 G;  1SQV G;  1NTK G;  1SQB G;  1L0N G;  4U3F G;  3BCC G;  1NU1 G;  1EZV G;  1SQQ G;  2BCC G;  3H1I G;  3L72 G;  3H1H G;  3H1J G;  1KB9 H;  1PP9 G;  3L70 G;  1NTM G;  1KYO H;  3L75 G;  3CWB G;  1L0L G;  1BCC G;  3H1K G;  3L73 G;  1NTZ G;  1SQX G;  3CXH H;  1BE3 G;  3TGU G;  2FYU G;  2IBZ G;  3L71 G;  4PD4 H;  1SQP G;  1PPJ G;  1P84 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...