1NTKG

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntkG00
2A06G 1SQVG 1BCCG 2BCCG 3L74G 1BE3G 1EZVG 3H1KG 1SQXG 1BGYG 1SQBG 3H1IG 1L0LG 1PP9G 3CXHH 3CX5H 1L0NG 1PPJG 1NTMG 2IBZG 3L70G 3CWBG 1KB9H 1SQQG 4D6TG 3L71G 4PD4H 1P84H 1NTKG 3H1LG 1NTZG 3L75G 3L73G 2FYUG 3H1JG 3TGUG 5KLVG 3L72G 3BCCG 1NU1G 1SQPG 4U3FG 1KYOH 3H1HG
chains in the Genus database with same CATH superfamily
2K3RA 1FE6A 1RQUA 3CI9A 2FBWC 3H1JE 2IFMA 1BGYG 1BE3D 1HF9A 3JC22 1M56D 4IOIH 3I56P 2WPSA 5KAIE 2HPCB 2VRSA 3L70E 3H1IG 1K04A 1NTZD 2O1JA 3CXHH 3MHVA 4K3AA 3H1HJ 3H1KJ 3PJSK 2QJYC 3QH9A 1K73Q 2H43A 3A0HE 5L8RJ 1FDMA 1K8AQ 1H8AA 1H0TA 4R4MA 3V6IA 1G2CB 1GMJA 2BASA 2WVRA 3L70G 4C7NB 2JEEA 3RK2B 1PGOA 1NTKJ 2CK3H 4LLHA 3BRTB 5APVA 4BRYB 1L4AA 1OX3A 3KQGA 2E42A 3TGUG 2OYHC 2WSEH 5AW0B 1P84E 3FWLA 4C7NA 1BCCE 1JCDA 3AE5C 2JP3A 3H1HG 1TU3F 1MKMA 2L5GB 1R5SA 3HE4B 3PLNA 4GT1A 2WT7A 1JY2N 1SQBD 1ZXGA 1PGPA 4ASVA 1Q7YQ 1GL2A 2IZ0A 3AE6C 5DJUB 1FZCB 4U3FD 3AEFC 5KLIC 1NTME 4YXDC 2QEXP 3P7KA 4JQ0D 4LGDE 3GHGA 1JTHA 3CMEP 3CCQP 4O9BA 5AW4B 2WZ7A 1GDTA 2WSCJ 4GIFA 1NHLA 4WY4B 3H1IJ 3II6A 1X8YA 1YTZT 1NU1D 3D6YA 1BE3E 2M5AB 2WQYC 1OVRA 3TNUA 2HG5D 3C1LA 1UIIA 1X0TA 1KYOI 2B88A 4NPEA 4NPDA 4PV1C 5AVRB 1AFOA 1ZRTD 2D2CB 2N9BA 1NTZJ 2N1TD 2Y9ZA 2FYUK 4WY4A 2P2UA 1Q82Q 2FFDA 5KAFE 5GTIE 3SFEC 4L73A 4OWFA 3CCEP 3HD7D 3B5NB 3B8EB 3GF3A 1NKZB 5AVYB 2ZT9D 1DD3A 3EFGA 1RE4C 2ZYDA 3H1LJ 3A3YB 1H0TB 3N4XA 1LGHB 2I1JA 2LXBA 4M3LA 1E79H 3AE8C 4GOEA 1PGJA 2K1AA 2XNDH 3GG2A 1SVFA 1LTIC 1NAYA 2GUVA 2YIUC 1SQPJ 2B9BA 2OYHA 3A7OA 3GW6A 3H1HE 4PD4E 2CPSA 1HWTC 3TYYA 1FZFA 1PPJG 2C0WA 2M0BA 1S5LX 3WMM0 3G3ZA 2QJKC 4AYCA 4W7ZA 2RKLA 1DEEG 1IFMA 4UB6H 2G8YA 2KYVA 2KZJA 5AVVB 1Z56A 2WTYA 1OVUA 1ZR4A 3AE7C 4GKGA 3E1IA 1PL5A 2SPZA 1LP1A 1IFJA 3MUDA 1M1KQ 1N73C 1VQKP 1FZEA 2ZXEB 1G2CA 1SQQE 5GTHE 1ZP0C 2FXMA 1SQVE 3BCCG 3L72G 3V5BA 1PPJD 1NTZK 3B71A 2KNCB 1JY2O 3CWBD 1XTGB 1KZUB 1MFTA 3P8CD 3AEDC 1USDA 2O01H 1KILE 1DEBA 1LP1B 3TF5A 5CBOA 1AA0A 2FFDB 3L71D 2C9LY 2WITA 1YJNP 4EYYQ 3FGAD 3ITKA 3H6PA 1ZMEC 1W2BO 4H44C 1G1IA 1KILD 1SQBJ 1FZCA 4IL6X 3P8CE 1QL1A 1URQA 3L72D 3CX5E 3WUTA 3L75E 3CXHE 2WPRA 5AW2B 1Y47A 1N8RQ 3A0BE 1JTHB 1SFCD 5KAIH 1PPJE 3CWBG 3D71A 2QRXA 1LTTC 2QE7H 1LTSC 1SQXD 1SQQD 3PP5A 2DW3A 3MGNA 2CPBA 4JPZB 1PP9D 5CCHA 2KOGA 1OIPA 2QM8A 3CD6P 3V2NA 1BSNA 3CXHI 5H2FH 4EDFA 2OYOA 3SWKA 3TSIA 1NTKK 1PGQA 1IK9A 2QJPB 1VQ4P 1IFDA 2KP8A 3OW2O 1K05A 2MKVA 2A45H 1KQLA 3D70A 1SQPE 1S72P 1T8ZA 1U7MA 4HJGH 3G9RA 3TK1A 3AEBC 5APTA 2W6AA 2KXPB 1VL2A 3KDPB 3CX5H 3VN0A 3L70J 2Q7CA 3CX5I 1W2EA 2YO3A 4QMAA 2M8RA 4N78D 2R3SA 3VYIA 1L0NK 2H8PD 1J1EB 1Q90D 2P67A 3NXSA 1FBMA 1AVYA 1OMIA 2WMMA 5B66H 3CCVP 1LJ2A 1JB0J 4WB4A 2E76D 1EXJA 2Y0CA 2Y9YA 1EDLA 1GL2D 1SQVD 2FXPA 3L73D 1SS1A 1NYHA 2IPPA 4JYBA 4WVZA 3IAOA 3V2PA 1N7SB 3M0DA 1AJYA 1M8OB 2B89A 2FYUJ 2QM7A 5AW3B 1SQVJ 2OYIA 1URQB 3HUSB 2A06D 1J1DB 1RF0C 1JY3N 2IBZI 1EDIA 5KLVK 2FY8A 1PP9E 1SQPK 2KSEA 1L4AD 1NU1E 3L74G 1HGZA 1SP4A 3JCUE 3NMDA 3AE3C 5APWA 2BEZF 2ZFCA 1T3JA 1IJDB 4ZKPA 1FZBA 1LWUB 1YTZI 3CXHD 3VMYA 1L4AC 1S3JA 2HODB 2UWJE 5APUA 1LT1A 3NTNA 1BGYE 3H1IE 5E79H 2J59M 2NPSB 2R5BA 1JY3O 1BE3J 5CMZA 2E75D 2O3JA 4OGQD 1VQ8P 1NTMK 1FDOA 1KB9D 1SQQG 2AEJA 2NRGA 3L35A 2K9YA 1FC2C 3AEAC 1RY3A 5GTIH 2GM4A 2PRRA 3AE2C 3M9HA 3HD7B 3CPWO 1MFZA 1LTJC 1NTZG 3AE1C 3H1LG 5CJ4A 1IO4A 3N7NA 1RF1C 4BWNA 1VF5B 3CCLP 1JOCA 1RQVA 5APXA 5E79E 2WSFH 3HRNA 5AVQB 1JMMA 3RL0D 1LT9A 3L37A 3CCUP 1GW4A 1KYOE 1NVOA 2V7QH 1HH0A 3H1LE 2Q3IA 3KXDA 1BCCG 5AW5B 4Y99C 3HD7C 5BVZA 1FOSF 2A45I 1JUNA 2KZIA 4H44B 2R5DA 2ZT9C 3D6ZA 2FYZA 3HD7A 2HPCA 3SWYA 5AVUB 4L74A 3U59A 1T2KC 3JCUH 1L0LG 2YMYA 4H0LD 3HTKB 1RF1A 1FJPA 1M90Q 1SFCC 2KLVA 4GODA 2BEQD 2NPSC 3EQ2A 1NTMD 3A0BH 3EWKA 2QIWA 1AV1A 1LWUC 3KHUA 1OW6A 2R32A 2IBZD 4WWIA 3BCCE 3HTKA 4H0LC 4A7PA 1Q81Q 1YYCA 2B87A 2XNXA 5CCGC 3Q1MA 5AVWB 5AVZB 1NTKG 1YI2P 2FYUD 3RK3D 1QL2A 1WT6A 1ZV8A 5B66E 3OA7A 1ZN5A 1GL2B 2PP6A 3VOPA 3Q5PA 3CC2P 1EDJA 5AW1B 1OWAA 1NU1G 3L4FA 3L74E 3TGUJ 2GUSA 2JWDA 1VPCA 1SQXJ 1S5LE 3VMXA 1YBKA 1N7SC 1PP9J 2W6JH 2YMKA 1OZHA 3F89A 1GZLA 3H1ID 3RK3E 3VMAA 3UIAA 5KLVJ 1EZVG 2PFXA 4I2LC 3L72J 4HB1A 5M1BA 1IFPA 2WSSH 3BCCD 5GTHH 4ZKUA 4HH2A 2WT7B 3WUVA 2OYIC 1AQTA 1OXZA 5KKZC 1KFMA 3M06A 3O6QB 1J1EC 3ABVC 4I7ZC 1M7LA 4JF7A 2E5YA 1CW5A 2QSIA 1U57A 1IC2A 1NOHA 2J5UA 2W27A 2R44A 3HE4A 2N1TB 3K5BA 3H1JD 3KZIH 3M0DC 3PHLA 5KJ7D 4LC1A 3U1AA 4ASWA 1BGYJ 2AEFA 2NPSD 2OTLP 3MD0A 5TISE 3BVHA 3AECC 1KILC 1OW8A 1J2JB 2KSJA 3GHGB 2HR3A 4PD4H 4WY4D 5C39A 1LTBC 3RK2D 3TDKA 1YITP 3CWBJ 5AVXB 1KTMA 2BCCJ 3L73G 1X22A 1MUUA 2JDIH 4PJ0E 4KT0J 1JNMA 3AE9C 3LW5J 2OARA 3KYQA 4U3FG 1KYOH 1VF5D 1BCCD 2HLOA 1X9VA 1P84D 1G1JA 3CC7P 1L0NJ 3FX0A 1VQMP 4IFMA 2ITAA 1BE3G 2WSCH 5TJHA 4N6JA 4AQRD 4DZOA 4EIJA 3FXEA 2KK7A 2PAJA 4TT3H 5KAFH 2IBZE 2E43A 3MUDC 1N73A 4B86A 1SQXK 4D6TE 1SQPD 1EZVE 1DD4A 1FZAA 3H1KE 2M3EA 5EFWB 3P32A 1QX8A 3BCCJ 3G71P 1VQ5P 3BATA 4I6MC 2A45G 1YIJP 3MP7B 2OYHB 1R5LA 1R8EA 3TGUD 2A06E 1KQSO 3NFQA 3H1LD 3IR9A 1SQXE 2FYNC 3RGUA 1HBWA 3G6EP 1M1JA 3RK2C 3WU2H 2B87B 2E74D 1Q2NA 3L73E 1QVFO 3USSA 4Y28J 2K9JA 1SQVG 3IFMA 3L72E 3PTZA 1T2KD 1RE4A 1GTWA 1NH4A 1VQ6P 1SQXG 2QJYB 1KQGB 1M1JB 1S4XA 1NU1J 5BU5A 1EC5A 2YNYA 4DJGA 1S2EA 2HYNA 2H7HA 1EDKA 2N1TC 1VQOP 2Q5UA 2K9JB 2E5TA 2O01N 2WPVB 3CCJP 5AW8B 1BGYD 3FXDA 1EXIA 3E7KA 4I1LA 3AE4C 1SQBK 3G4SP 2Q9IA 5KKZB 1ZW0A 1IZNB 2KLUA 3KPEA 1KB9H 4D6TG 1PZQA 1X79B 1KB9I 1N7LA 3VP8A 4DOJA 1KORA 1KV4A 1QEXA 1WMKA 4KHXA 4UB8E 2C0XA 5AW6B 4IFFA 1YJWP 2PGDA 2H89C 1KN7A 1GW3A 3R2PA 1GL2C 4UB8H 1BSHA 2ZVNB 1IFIA 5TISH 2D2CD 4RESB 2XV5A 3B5NC 1LTAC 1VDFA 2JJLA 1L0NE 3B5NA 2E74C 2IDBA 3B4SA 3BASA 2Y0EA 3C8VA 3GMAA 3HE5B 3QWOC 4H44D 1RF0A 4BRYA 2P58A 3CLQA 2YO2A 1SQBG 1VQ7P 3L75D 2D2CC 1LNQA 2L91A 2ZYAA 1CZQA 5CCGD 1M57D 4KJMA 1FJKA 4XFJA 2OTJP 1AQ5A 1GD2E 4D6TJ 1FAVA 5KJ7A 1KMIZ 1K9MQ 1UIXA 5APQA 2J58A 1FS0E 3CL3D 5APSA 2JR8A 3V4WA 2K37A 1N7SD 2FXOA 3L74D 2N9YB 4BXLA 2AXCA 3H32B 2IFNA 2ZXXA 4YXWH 3WU2E 3SWFA 1JO5A 1SQQJ 3M9QA 2POHA 1IFNA 5CBNA 4H13D 5BU8B 1D7MA 3TGUE 1QLED 3I5CA 5B5EE 3SFDC 4UB6E 3E1RA 4HKZH 1P84I 1FU1A 1MZ9A 1JCCA 2V4HA 1LT9C 3GF7A 3H32A 4PD4I 1ZOYC 4C46A 1H89A 4R4LA 1RHZB 1HVVA 2IX7C 3CX5D 2W90A 1BDDA 2RH0A 1M1JC 5CCHC 2KNCA 2M3BA 1RH5B 1OFCX 1PV3A 1SQBE 4PD4D 4CPGA 1PIXA 2G3AA 3F5HA 3L75J 1KFNA 2QG4A 2YXRB 3W68A 3L71G 3FWNA 3C9IA 1JEKA 4EOTA 1VQLP 1CI6A 4IL6E 2NZ2A 1L2PA 2FYNB 1J1DC 1L0LD 1URQC 5K5GB 4U3FJ 3H1JG 4ZMDA 2XU6A 3RL0B 3PRJA 2IYPA 1SQVK 2KB7P 2I8DA 2AXTH 3CWBE 4C7RA 2NPSA 4PJ0H 2RMZA 2ZAEB 4TLFA 2IYOA 2XDJA 1N2DC 2WWWA 1URQD 1NU1K 2LR2A 1ZR2A 3H1KG 1NO4A 1YQ4C 4RKUJ 1GU4A 3M91A 5B5EH 3MIWA 1NTKD 2E75C 2YKOA 3KZIE 4OGQC 2O01J 2E76C 4N78E 5AVSB 4YTPC 4AUWA 2O1KA 1KQFB 1H88A 2Z5IA 2ZJSE 1A02F 1QGKB 2OGUA 4NPFX 4L75A 1NTKE 2C9NY 1JMBA 3BRVB 1LTJA 2R3CA 4H13B 5CJ0A 3H25A 1DH3A 1VQ9P 2Q3EA 2ZVOB 3H1HD 3V4QA 2P10A 2AEMA 1HGVA 3R4YA 4HYTB 2Z4EA 3L36A 1P84H 3IF4A 5KJ7C 4OVNF 3U1CA 4XA4A 3VP9A 1S5LH 2QJPC 1JY3P 1FZGA 3VTPC 3GHGC 1Q86Q 1KILB 2HODA 2Q1KA 3GLMA 2FYUE 2A06G 1L0LE 1FDIA 1OVVA 2BCCG 3L73J 3LIEA 2E76B 2W8ZA 1N7SA 2MJZA 3Q2YA 1NWQA 3A0HH 3M0AA 1CI6B 2YKQA 1LTGC 3P8MC 4I7ZB 1EQ7A 1N86A 1WRGA 1ZRTE 1HTLC 4L76A 3I55P 1DX7A 4ZNCA 1AVOA 1GK4A 2OYIB 3CCSP 5CCGA 1NTZE 3L70D 2W6BA 3RL0g 3CCMP 4JBZA 3RK3C 3WUUA 2FFDC 2H88C 1GU5A 1E5WA 3S1KA 2XZRA 1LWUA 3RL0C 3A2AA 5APYA 4U3FE 3S4RA 1KYOD 3B5ND 4DCKA 1HJ0A 4MN4C 3O6QA 4U7JA 1IK7A 4WBAA 4PV1D 4DT0A 3L71E 3V2RA 4K35A 5KLVG 2Z5HA 2HFED 1SQPG 1NAFA 2N1TA 1CSBA 1OW7A 3LW5H 3EFFK 3SSUA 3CCRP 1JM0A 4H0LB 1N73B 1A02J 1DIPA 3Q3DA 2I1KA 3OJAB 4EI2A 4IFDK 1T6AA 2P1JA 1U7JA 1QVGO 1KB9E 1VQNP 1ZLLA 3H1JJ 5AW9B 1S9KD 5CCHD 2LXCB 4IL6H 1SFCB 1PP9G 1LT9B 2FKWB 3RK3B 1YJ9P 2QJKB 3CC4P 4Z1MH 1NGMB 1FOSE 1RE3A 3Q5RA 1NTMG 4YPCA 1SQQK 3OAKA 1YHQP 2K88A 2ZT9B 1KILA 2ZYGA 3VMZA 4Y99B 2IBZG 3AEGC 3HUSA 3O8ZA 5DJTB 1NJIQ 2Q6QA 2YIUB 3PH0A 3V2QA 2WPQA 3CMAP 3MTUE 1HUCA 2WSEJ 3AEEC 5KTBA 2RN0A 1L0ND 1VF5C 2OTKE 3MZWB 1RF1B 1BCCJ 2FYUG 2OQQA 2QVAA 1LTJB 2W83C 4XE5B 3A5TA 2BCCD 2KS1B 1S1CX 1L0LJ 3L74J 4N3YB 2KUBA 1KC8Q 2JO1A 1GK6A 5AW7B 2QA4P 3RBZA 1L0LK 3W67A 1Y8AA 4OH8B 4W80A 2P7JA 2M5AA 3TNUB 5KLVE 3H1KD 1EZVD 3IN6A 1L4AB 4D6TD 3JSVC 1YQ3C 3ZDMA 4PV1B 1NTMJ 1Y9BA 1MV8A 4H13C 5AVTB 1L0NG 1NKNA 4GOFA 2JWAA 1VQPP 2E74B 3S9OA 2LKMA 1EZVI 4WY4C 2KS1A 5CHXA 2YKPA 2JKVA 3M9BA 1T3UA 2AXTE 2YXQB 2E75B 4OGQB 3RBXA 4RJTA 2KI7B 4RO0A 3T97A 3Q5SA 1S9KE 2KIKA 5KLIB 3HUSC 2XKMA 1FZCC 2IZ1A 5KLVD 3L71J 1KD1Q 4GDOA 2Y0DA 4JYCA 1RE3C 3L75G 4W7YA 1SFCA 1SLQA 1HJBA 3LIDA 1USEA 2V7QJ 3HE5A 3T97B 1BDCA 1PFIA 1W5CE 2BCCE 5H2FE 2WSFJ 1XTCC 2GA1A 1JY2P
chains in the Genus database with same CATH topology
2A06G 1SQVG 1BCCG 2BCCG 3L74G 1BE3G 1EZVG 3H1KG 1SQXG 1BGYG 1SQBG 3H1IG 1L0LG 1PP9G 3CXHH 3CX5H 1L0NG 1PPJG 1NTMG 2IBZG 3L70G 3CWBG 1KB9H 1SQQG 4D6TG 3L71G 4PD4H 1P84H 1NTKG 3H1LG 1NTZG 3L75G 3L73G 2FYUG 3H1JG 3TGUG 5KLVG 3L72G 3BCCG 1NU1G 1SQPG 4U3FG 1KYOH 3H1HG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  1SQV G;  1BCC G;  2BCC G;  3L74 G;  1BE3 G;  1EZV G;  3H1K G;  1SQX G;  1BGY G;  1SQB G;  3H1I G;  1L0L G;  1PP9 G;  3CXH H;  3CX5 H;  1L0N G;  1PPJ G;  1NTM G;  2IBZ G;  3L70 G;  3CWB G;  1KB9 H;  1SQQ G;  4D6T G;  3L71 G;  4PD4 H;  1P84 H;  1NTK G;  3H1L G;  1NTZ G;  3L75 G;  3L73 G;  2FYU G;  3H1J G;  3TGU G;  5KLV G;  3L72 G;  3BCC G;  1NU1 G;  1SQP G;  4U3F G;  1KYO H;  3H1H G; 
#chains in the Genus database with same CATH topology
 2K3R A;  1FE6 A;  1RQU A;  3CI9 A;  2FBW C;  3H1J E;  2IFM A;  1BGY G;  1BE3 D;  1HF9 A;  3JC2 2;  1M56 D;  4IOI H;  3I56 P;  2WPS A;  5KAI E;  2HPC B;  2VRS A;  3L70 E;  3H1I G;  1K04 A;  1NTZ D;  2O1J A;  3CXH H;  3MHV A;  4K3A A;  3H1H J;  3H1K J;  3PJS K;  2QJY C;  3QH9 A;  1K73 Q;  2H43 A;  3A0H E;  5L8R J;  1FDM A;  1K8A Q;  1H8A A;  1H0T A;  4R4M A;  3V6I A;  1G2C B;  1GMJ A;  2BAS A;  2WVR A;  3L70 G;  4C7N B;  2JEE A;  3RK2 B;  1PGO A;  1NTK J;  2CK3 H;  4LLH A;  3BRT B;  5APV A;  4BRY B;  1L4A A;  1OX3 A;  3KQG A;  2E42 A;  3TGU G;  2OYH C;  2WSE H;  5AW0 B;  1P84 E;  3FWL A;  4C7N A;  1BCC E;  1JCD A;  3AE5 C;  2JP3 A;  3H1H G;  1TU3 F;  1MKM A;  2L5G B;  1R5S A;  3HE4 B;  3PLN A;  4GT1 A;  2WT7 A;  1JY2 N;  1SQB D;  1ZXG A;  1PGP A;  4ASV A;  1Q7Y Q;  1GL2 A;  2IZ0 A;  3AE6 C;  5DJU B;  1FZC B;  4U3F D;  3AEF C;  5KLI C;  1NTM E;  4YXD C;  2QEX P;  3P7K A;  4JQ0 D;  4LGD E;  3GHG A;  1JTH A;  3CME P;  3CCQ P;  4O9B A;  5AW4 B;  2WZ7 A;  1GDT A;  2WSC J;  4GIF A;  1NHL A;  4WY4 B;  3H1I J;  3II6 A;  1X8Y A;  1YTZ T;  1NU1 D;  3D6Y A;  1BE3 E;  2M5A B;  2WQY C;  1OVR A;  3TNU A;  2HG5 D;  3C1L A;  1UII A;  1X0T A;  1KYO I;  2B88 A;  4NPE A;  4NPD A;  4PV1 C;  5AVR B;  1AFO A;  1ZRT D;  2D2C B;  2N9B A;  1NTZ J;  2N1T D;  2Y9Z A;  2FYU K;  4WY4 A;  2P2U A;  1Q82 Q;  2FFD A;  5KAF E;  5GTI E;  3SFE C;  4L73 A;  4OWF A;  3CCE P;  3HD7 D;  3B5N B;  3B8E B;  3GF3 A;  1NKZ B;  5AVY B;  2ZT9 D;  1DD3 A;  3EFG A;  1RE4 C;  2ZYD A;  3H1L J;  3A3Y B;  1H0T B;  3N4X A;  1LGH B;  2I1J A;  2LXB A;  4M3L A;  1E79 H;  3AE8 C;  4GOE A;  1PGJ A;  2K1A A;  2XND H;  3GG2 A;  1SVF A;  1LTI C;  1NAY A;  2GUV A;  2YIU C;  1SQP J;  2B9B A;  2OYH A;  3A7O A;  3GW6 A;  3H1H E;  4PD4 E;  2CPS A;  1HWT C;  3TYY A;  1FZF A;  1PPJ G;  2C0W A;  2M0B A;  1S5L X;  3WMM 0;  3G3Z A;  2QJK C;  4AYC A;  4W7Z A;  2RKL A;  1DEE G;  1IFM A;  4UB6 H;  2G8Y A;  2KYV A;  2KZJ A;  5AVV B;  1Z56 A;  2WTY A;  1OVU A;  1ZR4 A;  3AE7 C;  4GKG A;  3E1I A;  1PL5 A;  2SPZ A;  1LP1 A;  1IFJ A;  3MUD A;  1M1K Q;  1N73 C;  1VQK P;  1FZE A;  2ZXE B;  1G2C A;  1SQQ E;  5GTH E;  1ZP0 C;  2FXM A;  1SQV E;  3BCC G;  3L72 G;  3V5B A;  1PPJ D;  1NTZ K;  3B71 A;  2KNC B;  1JY2 O;  3CWB D;  1XTG B;  1KZU B;  1MFT A;  3P8C D;  3AED C;  1USD A;  2O01 H;  1KIL E;  1DEB A;  1LP1 B;  3TF5 A;  5CBO A;  1AA0 A;  2FFD B;  3L71 D;  2C9L Y;  2WIT A;  1YJN P;  4EYY Q;  3FGA D;  3ITK A;  3H6P A;  1ZME C;  1W2B O;  4H44 C;  1G1I A;  1KIL D;  1SQB J;  1FZC A;  4IL6 X;  3P8C E;  1QL1 A;  1URQ A;  3L72 D;  3CX5 E;  3WUT A;  3L75 E;  3CXH E;  2WPR A;  5AW2 B;  1Y47 A;  1N8R Q;  3A0B E;  1JTH B;  1SFC D;  5KAI H;  1PPJ E;  3CWB G;  3D71 A;  2QRX A;  1LTT C;  2QE7 H;  1LTS C;  1SQX D;  1SQQ D;  3PP5 A;  2DW3 A;  3MGN A;  2CPB A;  4JPZ B;  1PP9 D;  5CCH A;  2KOG A;  1OIP A;  2QM8 A;  3CD6 P;  3V2N A;  1BSN A;  3CXH I;  5H2F H;  4EDF A;  2OYO A;  3SWK A;  3TSI A;  1NTK K;  1PGQ A;  1IK9 A;  2QJP B;  1VQ4 P;  1IFD A;  2KP8 A;  3OW2 O;  1K05 A;  2MKV A;  2A45 H;  1KQL A;  3D70 A;  1SQP E;  1S72 P;  1T8Z A;  1U7M A;  4HJG H;  3G9R A;  3TK1 A;  3AEB C;  5APT A;  2W6A A;  2KXP B;  1VL2 A;  3KDP B;  3CX5 H;  3VN0 A;  3L70 J;  2Q7C A;  3CX5 I;  1W2E A;  2YO3 A;  4QMA A;  2M8R A;  4N78 D;  2R3S A;  3VYI A;  1L0N K;  2H8P D;  1J1E B;  1Q90 D;  2P67 A;  3NXS A;  1FBM A;  1AVY A;  1OMI A;  2WMM A;  5B66 H;  3CCV P;  1LJ2 A;  1JB0 J;  4WB4 A;  2E76 D;  1EXJ A;  2Y0C A;  2Y9Y A;  1EDL A;  1GL2 D;  1SQV D;  2FXP A;  3L73 D;  1SS1 A;  1NYH A;  2IPP A;  4JYB A;  4WVZ A;  3IAO A;  3V2P A;  1N7S B;  3M0D A;  1AJY A;  1M8O B;  2B89 A;  2FYU J;  2QM7 A;  5AW3 B;  1SQV J;  2OYI A;  1URQ B;  3HUS B;  2A06 D;  1J1D B;  1RF0 C;  1JY3 N;  2IBZ I;  1EDI A;  5KLV K;  2FY8 A;  1PP9 E;  1SQP K;  2KSE A;  1L4A D;  1NU1 E;  3L74 G;  1HGZ A;  1SP4 A;  3JCU E;  3NMD A;  3AE3 C;  5APW A;  2BEZ F;  2ZFC A;  1T3J A;  1IJD B;  4ZKP A;  1FZB A;  1LWU B;  1YTZ I;  3CXH D;  3VMY A;  1L4A C;  1S3J A;  2HOD B;  2UWJ E;  5APU A;  1LT1 A;  3NTN A;  1BGY E;  3H1I E;  5E79 H;  2J59 M;  2NPS B;  2R5B A;  1JY3 O;  1BE3 J;  5CMZ A;  2E75 D;  2O3J A;  4OGQ D;  1VQ8 P;  1NTM K;  1FDO A;  1KB9 D;  1SQQ G;  2AEJ A;  2NRG A;  3L35 A;  2K9Y A;  1FC2 C;  3AEA C;  1RY3 A;  5GTI H;  2GM4 A;  2PRR A;  3AE2 C;  3M9H A;  3HD7 B;  3CPW O;  1MFZ A;  1LTJ C;  1NTZ G;  3AE1 C;  3H1L G;  5CJ4 A;  1IO4 A;  3N7N A;  1RF1 C;  4BWN A;  1VF5 B;  3CCL P;  1JOC A;  1RQV A;  5APX A;  5E79 E;  2WSF H;  3HRN A;  5AVQ B;  1JMM A;  3RL0 D;  1LT9 A;  3L37 A;  3CCU P;  1GW4 A;  1KYO E;  1NVO A;  2V7Q H;  1HH0 A;  3H1L E;  2Q3I A;  3KXD A;  1BCC G;  5AW5 B;  4Y99 C;  3HD7 C;  5BVZ A;  1FOS F;  2A45 I;  1JUN A;  2KZI A;  4H44 B;  2R5D A;  2ZT9 C;  3D6Z A;  2FYZ A;  3HD7 A;  2HPC A;  3SWY A;  5AVU B;  4L74 A;  3U59 A;  1T2K C;  3JCU H;  1L0L G;  2YMY A;  4H0L D;  3HTK B;  1RF1 A;  1FJP A;  1M90 Q;  1SFC C;  2KLV A;  4GOD A;  2BEQ D;  2NPS C;  3EQ2 A;  1NTM D;  3A0B H;  3EWK A;  2QIW A;  1AV1 A;  1LWU C;  3KHU A;  1OW6 A;  2R32 A;  2IBZ D;  4WWI A;  3BCC E;  3HTK A;  4H0L C;  4A7P A;  1Q81 Q;  1YYC A;  2B87 A;  2XNX A;  5CCG C;  3Q1M A;  5AVW B;  5AVZ B;  1NTK G;  1YI2 P;  2FYU D;  3RK3 D;  1QL2 A;  1WT6 A;  1ZV8 A;  5B66 E;  3OA7 A;  1ZN5 A;  1GL2 B;  2PP6 A;  3VOP A;  3Q5P A;  3CC2 P;  1EDJ A;  5AW1 B;  1OWA A;  1NU1 G;  3L4F A;  3L74 E;  3TGU J;  2GUS A;  2JWD A;  1VPC A;  1SQX J;  1S5L E;  3VMX A;  1YBK A;  1N7S C;  1PP9 J;  2W6J H;  2YMK A;  1OZH A;  3F89 A;  1GZL A;  3H1I D;  3RK3 E;  3VMA A;  3UIA A;  5KLV J;  1EZV G;  2PFX A;  4I2L C;  3L72 J;  4HB1 A;  5M1B A;  1IFP A;  2WSS H;  3BCC D;  5GTH H;  4ZKU A;  4HH2 A;  2WT7 B;  3WUV A;  2OYI C;  1AQT A;  1OXZ A;  5KKZ C;  1KFM A;  3M06 A;  3O6Q B;  1J1E C;  3ABV C;  4I7Z C;  1M7L A;  4JF7 A;  2E5Y A;  1CW5 A;  2QSI A;  1U57 A;  1IC2 A;  1NOH A;  2J5U A;  2W27 A;  2R44 A;  3HE4 A;  2N1T B;  3K5B A;  3H1J D;  3KZI H;  3M0D C;  3PHL A;  5KJ7 D;  4LC1 A;  3U1A A;  4ASW A;  1BGY J;  2AEF A;  2NPS D;  2OTL P;  3MD0 A;  5TIS E;  3BVH A;  3AEC C;  1KIL C;  1OW8 A;  1J2J B;  2KSJ A;  3GHG B;  2HR3 A;  4PD4 H;  4WY4 D;  5C39 A;  1LTB C;  3RK2 D;  3TDK A;  1YIT P;  3CWB J;  5AVX B;  1KTM A;  2BCC J;  3L73 G;  1X22 A;  1MUU A;  2JDI H;  4PJ0 E;  4KT0 J;  1JNM A;  3AE9 C;  3LW5 J;  2OAR A;  3KYQ A;  4U3F G;  1KYO H;  1VF5 D;  1BCC D;  2HLO A;  1X9V A;  1P84 D;  1G1J A;  3CC7 P;  1L0N J;  3FX0 A;  1VQM P;  4IFM A;  2ITA A;  1BE3 G;  2WSC H;  5TJH A;  4N6J A;  4AQR D;  4DZO A;  4EIJ A;  3FXE A;  2KK7 A;  2PAJ A;  4TT3 H;  5KAF H;  2IBZ E;  2E43 A;  3MUD C;  1N73 A;  4B86 A;  1SQX K;  4D6T E;  1SQP D;  1EZV E;  1DD4 A;  1FZA A;  3H1K E;  2M3E A;  5EFW B;  3P32 A;  1QX8 A;  3BCC J;  3G71 P;  1VQ5 P;  3BAT A;  4I6M C;  2A45 G;  1YIJ P;  3MP7 B;  2OYH B;  1R5L A;  1R8E A;  3TGU D;  2A06 E;  1KQS O;  3NFQ A;  3H1L D;  3IR9 A;  1SQX E;  2FYN C;  3RGU A;  1HBW A;  3G6E P;  1M1J A;  3RK2 C;  3WU2 H;  2B87 B;  2E74 D;  1Q2N A;  3L73 E;  1QVF O;  3USS A;  4Y28 J;  2K9J A;  1SQV G;  3IFM A;  3L72 E;  3PTZ A;  1T2K D;  1RE4 A;  1GTW A;  1NH4 A;  1VQ6 P;  1SQX G;  2QJY B;  1KQG B;  1M1J B;  1S4X A;  1NU1 J;  5BU5 A;  1EC5 A;  2YNY A;  4DJG A;  1S2E A;  2HYN A;  2H7H A;  1EDK A;  2N1T C;  1VQO P;  2Q5U A;  2K9J B;  2E5T A;  2O01 N;  2WPV B;  3CCJ P;  5AW8 B;  1BGY D;  3FXD A;  1EXI A;  3E7K A;  4I1L A;  3AE4 C;  1SQB K;  3G4S P;  2Q9I A;  5KKZ B;  1ZW0 A;  1IZN B;  2KLU A;  3KPE A;  1KB9 H;  4D6T G;  1PZQ A;  1X79 B;  1KB9 I;  1N7L A;  3VP8 A;  4DOJ A;  1KOR A;  1KV4 A;  1QEX A;  1WMK A;  4KHX A;  4UB8 E;  2C0X A;  5AW6 B;  4IFF A;  1YJW P;  2PGD A;  2H89 C;  1KN7 A;  1GW3 A;  3R2P A;  1GL2 C;  4UB8 H;  1BSH A;  2ZVN B;  1IFI A;  5TIS H;  2D2C D;  4RES B;  2XV5 A;  3B5N C;  1LTA C;  1VDF A;  2JJL A;  1L0N E;  3B5N A;  2E74 C;  2IDB A;  3B4S A;  3BAS A;  2Y0E A;  3C8V A;  3GMA A;  3HE5 B;  3QWO C;  4H44 D;  1RF0 A;  4BRY A;  2P58 A;  3CLQ A;  2YO2 A;  1SQB G;  1VQ7 P;  3L75 D;  2D2C C;  1LNQ A;  2L91 A;  2ZYA A;  1CZQ A;  5CCG D;  1M57 D;  4KJM A;  1FJK A;  4XFJ A;  2OTJ P;  1AQ5 A;  1GD2 E;  4D6T J;  1FAV A;  5KJ7 A;  1KMI Z;  1K9M Q;  1UIX A;  5APQ A;  2J58 A;  1FS0 E;  3CL3 D;  5APS A;  2JR8 A;  3V4W A;  2K37 A;  1N7S D;  2FXO A;  3L74 D;  2N9Y B;  4BXL A;  2AXC A;  3H32 B;  2IFN A;  2ZXX A;  4YXW H;  3WU2 E;  3SWF A;  1JO5 A;  1SQQ J;  3M9Q A;  2POH A;  1IFN A;  5CBN A;  4H13 D;  5BU8 B;  1D7M A;  3TGU E;  1QLE D;  3I5C A;  5B5E E;  3SFD C;  4UB6 E;  3E1R A;  4HKZ H;  1P84 I;  1FU1 A;  1MZ9 A;  1JCC A;  2V4H A;  1LT9 C;  3GF7 A;  3H32 A;  4PD4 I;  1ZOY C;  4C46 A;  1H89 A;  4R4L A;  1RHZ B;  1HVV A;  2IX7 C;  3CX5 D;  2W90 A;  1BDD A;  2RH0 A;  1M1J C;  5CCH C;  2KNC A;  2M3B A;  1RH5 B;  1OFC X;  1PV3 A;  1SQB E;  4PD4 D;  4CPG A;  1PIX A;  2G3A A;  3F5H A;  3L75 J;  1KFN A;  2QG4 A;  2YXR B;  3W68 A;  3L71 G;  3FWN A;  3C9I A;  1JEK A;  4EOT A;  1VQL P;  1CI6 A;  4IL6 E;  2NZ2 A;  1L2P A;  2FYN B;  1J1D C;  1L0L D;  1URQ C;  5K5G B;  4U3F J;  3H1J G;  4ZMD A;  2XU6 A;  3RL0 B;  3PRJ A;  2IYP A;  1SQV K;  2KB7 P;  2I8D A;  2AXT H;  3CWB E;  4C7R A;  2NPS A;  4PJ0 H;  2RMZ A;  2ZAE B;  4TLF A;  2IYO A;  2XDJ A;  1N2D C;  2WWW A;  1URQ D;  1NU1 K;  2LR2 A;  1ZR2 A;  3H1K G;  1NO4 A;  1YQ4 C;  4RKU J;  1GU4 A;  3M91 A;  5B5E H;  3MIW A;  1NTK D;  2E75 C;  2YKO A;  3KZI E;  4OGQ C;  2O01 J;  2E76 C;  4N78 E;  5AVS B;  4YTP C;  4AUW A;  2O1K A;  1KQF B;  1H88 A;  2Z5I A;  2ZJS E;  1A02 F;  1QGK B;  2OGU A;  4NPF X;  4L75 A;  1NTK E;  2C9N Y;  1JMB A;  3BRV B;  1LTJ A;  2R3C A;  4H13 B;  5CJ0 A;  3H25 A;  1DH3 A;  1VQ9 P;  2Q3E A;  2ZVO B;  3H1H D;  3V4Q A;  2P10 A;  2AEM A;  1HGV A;  3R4Y A;  4HYT B;  2Z4E A;  3L36 A;  1P84 H;  3IF4 A;  5KJ7 C;  4OVN F;  3U1C A;  4XA4 A;  3VP9 A;  1S5L H;  2QJP C;  1JY3 P;  1FZG A;  3VTP C;  3GHG C;  1Q86 Q;  1KIL B;  2HOD A;  2Q1K A;  3GLM A;  2FYU E;  2A06 G;  1L0L E;  1FDI A;  1OVV A;  2BCC G;  3L73 J;  3LIE A;  2E76 B;  2W8Z A;  1N7S A;  2MJZ A;  3Q2Y A;  1NWQ A;  3A0H H;  3M0A A;  1CI6 B;  2YKQ A;  1LTG C;  3P8M C;  4I7Z B;  1EQ7 A;  1N86 A;  1WRG A;  1ZRT E;  1HTL C;  4L76 A;  3I55 P;  1DX7 A;  4ZNC A;  1AVO A;  1GK4 A;  2OYI B;  3CCS P;  5CCG A;  1NTZ E;  3L70 D;  2W6B A;  3RL0 g;  3CCM P;  4JBZ A;  3RK3 C;  3WUU A;  2FFD C;  2H88 C;  1GU5 A;  1E5W A;  3S1K A;  2XZR A;  1LWU A;  3RL0 C;  3A2A A;  5APY A;  4U3F E;  3S4R A;  1KYO D;  3B5N D;  4DCK A;  1HJ0 A;  4MN4 C;  3O6Q A;  4U7J A;  1IK7 A;  4WBA A;  4PV1 D;  4DT0 A;  3L71 E;  3V2R A;  4K35 A;  5KLV G;  2Z5H A;  2HFE D;  1SQP G;  1NAF A;  2N1T A;  1CSB A;  1OW7 A;  3LW5 H;  3EFF K;  3SSU A;  3CCR P;  1JM0 A;  4H0L B;  1N73 B;  1A02 J;  1DIP A;  3Q3D A;  2I1K A;  3OJA B;  4EI2 A;  4IFD K;  1T6A A;  2P1J A;  1U7J A;  1QVG O;  1KB9 E;  1VQN P;  1ZLL A;  3H1J J;  5AW9 B;  1S9K D;  5CCH D;  2LXC B;  4IL6 H;  1SFC B;  1PP9 G;  1LT9 B;  2FKW B;  3RK3 B;  1YJ9 P;  2QJK B;  3CC4 P;  4Z1M H;  1NGM B;  1FOS E;  1RE3 A;  3Q5R A;  1NTM G;  4YPC A;  1SQQ K;  3OAK A;  1YHQ P;  2K88 A;  2ZT9 B;  1KIL A;  2ZYG A;  3VMZ A;  4Y99 B;  2IBZ G;  3AEG C;  3HUS A;  3O8Z A;  5DJT B;  1NJI Q;  2Q6Q A;  2YIU B;  3PH0 A;  3V2Q A;  2WPQ A;  3CMA P;  3MTU E;  1HUC A;  2WSE J;  3AEE C;  5KTB A;  2RN0 A;  1L0N D;  1VF5 C;  2OTK E;  3MZW B;  1RF1 B;  1BCC J;  2FYU G;  2OQQ A;  2QVA A;  1LTJ B;  2W83 C;  4XE5 B;  3A5T A;  2BCC D;  2KS1 B;  1S1C X;  1L0L J;  3L74 J;  4N3Y B;  2KUB A;  1KC8 Q;  2JO1 A;  1GK6 A;  5AW7 B;  2QA4 P;  3RBZ A;  1L0L K;  3W67 A;  1Y8A A;  4OH8 B;  4W80 A;  2P7J A;  2M5A A;  3TNU B;  5KLV E;  3H1K D;  1EZV D;  3IN6 A;  1L4A B;  4D6T D;  3JSV C;  1YQ3 C;  3ZDM A;  4PV1 B;  1NTM J;  1Y9B A;  1MV8 A;  4H13 C;  5AVT B;  1L0N G;  1NKN A;  4GOF A;  2JWA A;  1VQP P;  2E74 B;  3S9O A;  2LKM A;  1EZV I;  4WY4 C;  2KS1 A;  5CHX A;  2YKP A;  2JKV A;  3M9B A;  1T3U A;  2AXT E;  2YXQ B;  2E75 B;  4OGQ B;  3RBX A;  4RJT A;  2KI7 B;  4RO0 A;  3T97 A;  3Q5S A;  1S9K E;  2KIK A;  5KLI B;  3HUS C;  2XKM A;  1FZC C;  2IZ1 A;  5KLV D;  3L71 J;  1KD1 Q;  4GDO A;  2Y0D A;  4JYC A;  1RE3 C;  3L75 G;  4W7Y A;  1SFC A;  1SLQ A;  1HJB A;  3LID A;  1USE A;  2V7Q J;  3HE5 A;  3T97 B;  1BDC A;  1PFI A;  1W5C E;  2BCC E;  5H2F E;  2WSF J;  1XTC C;  2GA1 A;  1JY2 P; 
#chains in the Genus database with same CATH homology
 2A06 G;  1SQV G;  1BCC G;  2BCC G;  3L74 G;  1BE3 G;  1EZV G;  3H1K G;  1SQX G;  1BGY G;  1SQB G;  3H1I G;  1L0L G;  1PP9 G;  3CXH H;  3CX5 H;  1L0N G;  1PPJ G;  1NTM G;  2IBZ G;  3L70 G;  3CWB G;  1KB9 H;  1SQQ G;  4D6T G;  3L71 G;  4PD4 H;  1P84 H;  1NTK G;  3H1L G;  1NTZ G;  3L75 G;  3L73 G;  2FYU G;  3H1J G;  3TGU G;  5KLV G;  3L72 G;  3BCC G;  1NU1 G;  1SQP G;  4U3F G;  1KYO H;  3H1H G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...