1NTKG

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntkG00
1KB9H 3L72G 4U3FG 3L74G 3H1IG 1NTKG 1PP9G 1SQXG 3H1LG 1SQPG 1SQQG 3L71G 3BCCG 3TGUG 2BCCG 4PD4H 3H1KG 3L73G 2FYUG 1SQVG 1BGYG 2A06G 1NTMG 1BE3G 3L75G 1KYOH 4D6TG 1P84H 1SQBG 1PPJG 1L0NG 2IBZG 3CX5H 1L0LG 3CWBG 3CXHH 3H1JG 5KLVG 1BCCG 1EZVG 1NTZG 3H1HG 3L70G 1NU1G
chains in the Genus database with same CATH superfamily
4A7PA 1EZVI 2XV5A 1BGYJ 1NAYA 1T3UA 2KNCA 2Y0EA 3F89A 1RF0A 2FYUK 2P1JA 2WSCJ 1W5CE 2OYOA 3NFQA 4AQRD 1EDLA 2QG4A 2KSEA 5CJ0A 3AE2C 1P84D 1KN7A 1SQPJ 2POHA 3CC2P 3BCCE 1RQUA 2OGUA 4I1LA 3CX5D 4PJ0H 4UB8E 4WY4C 5AVTB 2NPSA 2KYVA 1SQBE 1L0NJ 1L4AC 1PL5A 2AEJA 2QSIA 3C1LA 3KDPB 4L76A 1T2KD 3RBXA 2Q5UA 3O6QB 2Q3EA 4UB8H 1NYHA 1N86A 1NU1K 3H1KD 4Z1MH 2KLVA 2ZYDA 4OWFA 3TNUB 1IFDA 3CXHH 4WY4D 1J2JB 2Y0CA 3AE1C 5KLVD 1OVVA 3IAOA 1AJYA 5AW0B 2FYNC 2WQYC 3L73D 2R44A 1NAFA 2B87B 1M57D 5AVQB 5KLVG 1EDKA 1P84I 2K88A 1FS0E 3GHGA 1BE3D 4PD4E 1SLQA 1LTSC 1LNQA 2E75B 1PIXA 2KK7A 5B5EE 5KJ7C 1H0TB 3HTKB 4M3LA 3H32A 1DX7A 1EZVE 3KXDA 1KYOE 4KJMA 5AW5B 1U7JA 2FYUG 3CMEP 3U1CA 2ZAEB 2KP8A 4GOFA 2WMMA 1KB9I 2P7JA 2Q1KA 2RH0A 3NMDA 1HH0A 1FZAA 2Q3IA 3AE3C 4H13D 4NPFX 1DEBA 5CCGC 4BRYA 4R4MA 1L4AB 1Q90D 1BE3E 1SQXD 2CK3H 2FKWB 2IX7C 2JJLA 2K3RA 3H1JD 4H0LB 1HGVA 1AQ5A 1Q82Q 1AFOA 2O3JA 1Y8AA 2YXQB 3H1ID 4JPZB 5TISH 4BWNA 1VF5C 3CXHI 1OXZA 5CHXA 1VQ9P 3D6YA 2LXCB 3JSVC 1VQ6P 1BCCG 2IFMA 3QH9A 5AW1B 3TNUA 2QVAA 1IJDB 1VQNP 2QJPC 1JEKA 1YJWP 3HD7C 3RL0C 1PFIA 5BU8B 4U3FG 2G8YA 2IYOA 2R3SA 2UWJE 3H1HE 3HUSC 2FYNB 3NXSA 1IZNB 1N7LA 3FX0A 4PJ0E 2WPVB 3RK2D 3TYYA 2C9LY 3RL0D 3HD7D 3M9HA 3BCCG 5CCHA 1G1JA 1SVFA 2QIWA 1LTIC 5AVSB 1SQPK 1QGKB 4DT0A 1K8AQ 3CWBJ 3H1JJ 3CD6P 1LWUB 1VF5D 5KKZC 4AUWA 2QM8A 1JMMA 1JTHA 1SQQE 2XDJA 2V4HA 3EQ2A 3II6A 5CCGD 3KQGA 2YNYA 2C0WA 2OYIA 1AVOA 2I1JA 3HE5B 2NPSC 3LW5H 2P2UA 4Y28J 5APVA 2YKPA 1G2CB 3T97A 2HFED 4ASWA 1KQGB 3PJSK 1IK9A 4HH2A 1OZHA 5KJ7D 1HJBA 4OVNF 3B5ND 4KHXA 1RF0C 2IZ1A 2OARA 4MN4C 3H1LG 1DD4A 3VMAA 1LTGC 3L71G 1YQ3C 3A0HE 3ITKA 3H1KG 1HVVA 3AEGC 1DIPA 4QMAA 4H44B 2IYPA 3PTZA 2IBZI 3GLMA 1KC8Q 1DH3A 2V7QJ 1MFZA 4ZKUA 3CCEP 2J5UA 1JY2O 2HODB 1BGYE 4D6TG 1IK7A 2MJZA 2FFDC 1FZGA 2YIUC 3ZDMA 3L70J 3WU2E 2JWDA 3RK3E 1ZRTD 2PFXA 1VF5B 2H88C 1EZVD 4RKUJ 3G3ZA 5AW8B 1VQLP 3WUTA 1GD2E 3N4XA 1JM0A 1WRGA 1N2DC 4OGQD 4WB4A 1EZVG 1M7LA 3AECC 2QJPB 3BATA 3HE4B 5BVZA 5AVXB 1ZR4A 1SQBJ 4EIJA 2R3CA 1AQTA 2JEEA 1PPJE 2B9BA 2O01J 1FDIA 4UB6E 3S4RA 1SQPD 3VOPA 2PRRA 2IBZD 2LR2A 4EYYQ 3Q5PA 1JY3O 4ZKPA 3UIAA 1SQXG 4N6JA 4OH8B 3V2QA 2WSSH 2Q6QA 2NRGA 1SQPG 2WSEH 3E7KA 1FOSE 1RH5B 4HKZH 4YXWH 5CCGA 1E79H 1M1JA 2I8DA 3FGAD 1MUUA 1S3JA 2HR3A 3KZIE 3O6QA 1NTMG 1YYCA 1BDDA 3L73E 5APYA 4AYCA 3G6EP 3P8CD 3CCQP 1QL2A 1KORA 2BEZF 2XKMA 2NPSB 1RQVA 3H1HD 1IFMA 4XA4A 1M1KQ 1NU1E 1JY2P 2IZ0A 1Q81Q 4U3FD 1M90Q 1ZOYC 1ZV8A 1NTKK 3HE4A 3CX5I 3WUVA 1PP9D 4RESB 3CWBG 5C39A 5BU5A 1H89A 2Y0DA 5AVVB 1L4AA 1MV8A 5GTHH 1LT9C 2HODA 2D2CC 3SWYA 3HD7A 2QA4P 2Z4EA 1KYOI 2WSCH 1SQVD 2FBWC 2M0BA 1Z56A 4GDOA 3HD7B 5B66E 1OVUA 3RK2C 3RL0B 1KQSO 3A0HH 3H32B 3RK3C 4IFFA 1SQQD 3AEAC 2E74D 1LP1A 3HE5A 5CBNA 2WVRA 1FBMA 1N73C 2KUBA 2ZVOB 4PV1C 4BXLA 1JY3P 1LJ2A 1SQQG 3LIEA 4DCKA 3Q2YA 3KHUA 1HGZA 1KILC 5APXA 1PGOA 3CMAP 2Y9YA 3A3YB 4JBZA 2P10A 4H0LC 3MUDA 1BGYG 5KLIC 4C7RA 4WWIA 5AW2B 3B5NA 1J1DC 3A2AA 3F5HA 1L0LK 2ZYAA 2WPSA 1NTMK 1CZQA 1YHQP 3MD0A 2HLOA 5EFWB 2OQQA 1HF9A 3VP9A 4EDFA 2OTKE 3M9QA 1GK6A 4H13B 1KB9D 2WT7B 3P32A 4XFJA 1S5LH 1L0NE 4C46A 1IFPA 1AV1A 1IO4A 3L71E 1NH4A 2QRXA 4IFMA 1USEA 3G71P 2YO2A 4N78D 1YITP 1VDFA 2KS1A 3M06A 1KB9H 2E5TA 4JQ0D 2A06E 3L74G 1LT9B 1E5WA 1RY3A 5APSA 4YXDC 1LT1A 2WTYA 5GTIE 2K9YA 1OW7A 2KB7P 3L72J 5E79E 1H8AA 2QM7A 2AXTE 2AEFA 2BCCG 1QEXA 3LW5J 3ABVC 1XTCC 3A7OA 3L70E 2JDIH 3OW2O 1SFCA 3WMM0 3MZWB 2OYHC 2A06G 2KOGA 3JCUE 1K9MQ 2L5GB 2W90A 1SQQK 1SQXJ 1JB0J 1PGQA 1URQB 5KAFE 3VTPC 2MKVA 2QJKC 3L36A 3VN0A 4CPGA 1X79B 3TGUE 3CLQA 1T2KC 2IBZG 3P7KA 1KQLA 3AEBC 2M5AA 3CCRP 1AVYA 2VRSA 1PP9E 1A02F 1GW4A 3CCVP 3P8MC 3GMAA 2E75D 4JYCA 1S4XA 1XTGB 3MIWA 4N78E 3EFFK 3I5CA 3L4FA 1EXJA 1K04A 3R2PA 3H1LJ 2KS1B 2IBZE 1LTJB 2Y9ZA 5KLVK 1CW5A 3N7NA 1GDTA 1BCCJ 1FOSF 2O1JA 3EWKA 1S9KE 1NWQA 3CPWO 1NOHA 1FZCB 4HYTB 5CCHD 3GHGC 1P84E 2IPPA 3A0BH 4N3YB 4GODA 4GOEA 5B5EH 1MFTA 3AEFC 1N7SD 3L75G 2FYUD 2K9JA 2P67A 2RKLA 4GIFA 3V2RA 3RBZA 3W68A 1UIXA 3W67A 1VQOP 3BASA 1NTZJ 4JF7A 3L75D 3D71A 1GMJA 2QE7H 1Q86Q 1OX3A 1JUNA 2WPQA 5GTHE 2O01H 1KB9E 2ZT9C 3H1JG 3HUSA 2A45G 1SQBK 1HUCA 2QJKB 1EC5A 1NKNA 1SP4A 1HJ0A 3VMXA 5AVUB 1LTBC 1CI6B 4LC1A 1BGYD 1YI2P 4IL6X 1OMIA 2N1TC 2OYIB 3E1RA 4NPEA 1EDIA 1JMBA 2M8RA 3VMYA 3TGUD 4U3FE 1IFNA 1FDOA 1LWUA 2B87A 3JCUH 4RJTA 4TLFA 1RF1A 1LTJC 5KAFH 4ZNCA 1Q7YQ 2PGDA 2WPRA 1LP1B 1YIJP 3JC22 3BCCD 2FXOA 1BE3G 1NJIQ 2DW3A 1SQBD 3C8VA 1LWUC 5KKZB 4EI2A 3L35A 2E76C 3TDKA 3LIDA 4IL6H 3L71J 1NTKE 3SSUA 3H1KJ 2E42A 2L91A 3L74D 1M1JC 3L74E 1URQD 3AE5C 2I1KA 4W80A 2J59M 3AE8C 1MZ9A 3L70D 2N1TB 4D6TJ 1S5LX 1SFCD 3HUSB 2OYIC 1VPCA 2BCCE 1T6AA 2K1AA 3L72E 3TK1A 4ASVA 2FYUE 3L70G 1NTKG 4LGDE 3I55P 3CCUP 3AE7C 4YTPC 1YJNP 1HTLC 5L8RJ 3IN6A 1KILB 1W2EA 1NTKD 2YXRB 1VQPP 2JR8A 1OWAA 2R5DA 3M0DA 4WBAA 3RK3D 4Y99C 2GUVA 5AW6B 5CBOA 4Y99B 1NO4A 1BCCD 3VMZA 3BRTB 5M1BA 1FZCC 2JWAA 1VQ7P 1MKMA 2WSEJ 1L0LJ 2ZT9D 4WY4A 1ZR2A 1GL2D 2ITAA 1KYOH 3O8ZA 2O01N 2LKMA 1TU3F 2WSFH 2WWWA 3AE9C 3PRJA 4HJGH 4I2LC 4OGQB 3USSA 1GW3A 2W27A 3FWLA 3VP8A 1Y9BA 2FXMA 2QJYB 1YQ4C 2A45I 1LTAC 2M3BA 3RL0g 1N7SC 1NKZB 1NTMJ 1NTZD 1VL2A 3OJAB 2KNCB 2K37A 1FZFA 1JNMA 3L72D 1N7SA 1NTZG 1OW6A 5APQA 5TISE 3MHVA 2KZIA 2FYZA 3L72G 4NPDA 4H44D 1ZXGA 3L75E 4L73A 1G2CA 3T97B 3CC4P 1KMIZ 1S72P 4HB1A 2JKVA 1FJKA 1USDA 2SPZA 2OYHA 1NTZE 3KPEA 1WMKA 1OW8A 1A02J 2XU6A 3B5NB 1UIIA 1KD1Q 2K9JB 2W83C 1JTHB 3GW6A 3PLNA 2M3EA 1DD3A 1IFJA 2W6AA 5KTBA 3S9OA 1OFCX 3CXHE 1YJ9P 3CC7P 1ZLLA 4WVZA 3IFMA 3C9IA 4B86A 2KXPB 1LGHB 1M1JB 4K3AA 1KFNA 1CSBA 1S1CX 2A45H 1OIPA 5AW7B 3SFDC 2N9YB 1GL2C 3BRVB 2W6JH 1R8EA 1YTZT 3FXDA 2YIUB 5AVYB 2QJYC 2E74B 5CMZA 3TSIA 3CWBD 4K35A 2FFDA 3MGNA 1JO5A 3L37A 5APUA 1SQXE 1KV4A 1DEEG 1RE3C 1SQPE 2Z5HA 3B8EB 1RHZB 1ZRTE 4O9BA 3MTUE 3H6PA 1IFIA 2H8PD 5B66H 3H1IJ 1PP9J 1NTKJ 1SFCC 1URQA 1KILE 4RO0A 3WU2H 3H25A 1H88A 1X0TA 3L74J 1N73B 2E43A 2NPSD 2WT7A 3G4SP 1IC2A 2QEXP 2ZYGA 1ZP0C 1SQVJ 1FC2C 1URQC 5AW4B 2E5YA 3H1LE 4DJGA 5KLVJ 2BCCJ 4LLHA 2E76D 3KYQA 5AW3B 2JP3A 2YKOA 3PHLA 3SWFA 1BCCE 1L0LG 2WZ7A 1LT9A 1Q2NA 4H0LD 3D70A 1H0TA 3L71D 1T8ZA 5DJUB 1L0LD 3TGUJ 2XNDH 3H1HG 3NTNA 3GG2A 1GTWA 1VQ8P 3D6ZA 4YPCA 1QX8A 1U7MA 1PPJD 1T3JA 2E74C 4D6TD 1GL2A 4DZOA 1PP9G 2OTJP 2AEMA 3M0DC 4R4LA 3RGUA 1KYOD 1D7MA 1JCCA 5CJ4A 2C9NY 1BE3J 4UB6H 3SFEC 3U59A 2E76B 4KT0J 1SQVG 2AXCA 1KZUB 2ZXEB 2FY8A 3MUDC 1K73Q 2GM4A 1FJPA 2GUSA 1EXIA 1FDMA 2BCCD 1LTJA 5E79H 3VYIA 1PGPA 1QLED 5APTA 1EQ7A 2XZRA 1FZEA 2A06D 3GF7A 3M0AA 3K5BA 4W7YA 3TF5A 3A5TA 4U7JA 1W2BO 3KZIH 1FE6A 1L0NG 2N1TA 1FAVA 2LXBA 2N9BA 3B4SA 4H13C 2ZT9B 4U3FJ 1CI6A 3H1HJ 3CL3D 3L75J 1L0ND 3V5BA 2KI7B 1S9KD 4GT1A 1BSNA 1L0LE 2ZVNB 1JY2N 5CCHC 3BCCJ 4I7ZB 1NU1G 1OVRA 5AVZB 3RK3B 3P8CE 1GU5A 1N73A 3H1LD 3RK2B 3Q1MA 1U57A 1NGMB 3R4YA 4IFDK 4XE5B 1NU1D 3B71A 1BSHA 3H1JE 4H44C 3M9BA 3H1KE 4TT3H 3S1KA 4W7ZA 1RE4A 2WSFJ 1KTMA 4L74A 2E75C 2WITA 2CPSA 2PP6A 4OGQC 3V6IA 2KIKA 1FZBA 2C0XA 3M91A 3CX5E 2G3AA 1M56D 2Z5IA 2FYUJ 3FWNA 2KLUA 4I6MC 1SQVK 1WT6A 2KSJA 2HG5D 4DOJA 4C7NA 1KQFB 1P84H 3A0BE 2NZ2A 2FXPA 3IF4A 3EFGA 4BRYB 2IDBA 1L4AD 2KZJA 3CX5H 2Q9IA 1GL2B 1NVOA 2P58A 2B88A 2J58A 1GU4A 3Q3DA 2CPBA 3CWBE 1QVGO 5GTIH 1KILA 1X22A 1X9VA 2JO1A 3HTKA 1VQ4P 1RF1C 1JCDA 2AXTH 1RF1B 3PP5A 1S5LE 2M5AB 2YMKA 3BVHA 3AE4C 1L2PA 1R5SA 3CXHD 3OAKA 3IR9A 2D2CB 3GHGB 1VQ5P 3B5NC 4D6TE 3WUUA 3CCJP 1NTZK 3GF3A 2V7QH 2W6BA 1HBWA 3TGUG 1NTMD 1RE4C 1NTME 3L73G 3V2NA 3QWOC 1M8OB 4PD4I 5KLVE 3I56P 1VQMP 2H89C 4PV1B 5H2FH 2H7HA 1EDJA 4ZMDA 1L0NK 1R5LA 1SS1A 2BEQD 5AW9B 3V2PA 3V4QA 1SQBG 2R5BA 1PPJG 5DJTB 3AEEC 5H2FE 1JY3N 1YTZI 4C7NB 1ZMEC 1VQKP 1N7SB 3H1IE 1GZLA 5AVWB 3CCSP 4IOIH 1RE3A 2OTLP 1PZQA 4IL6E 2YO3A 3FXEA 1KILD 3PH0A 2GA1A 2HYNA 2HPCB 1X8YA 1SQVE 4PD4D 1J1EC 4PV1D 1NHLA 1J1EB 2ZFCA 3H1IG 1FZCA 1SFCB 2O1KA 2N1TD 3CCMP 3L73J 5KLIB 2HPCA 4WY4B 5KAIH 1JOCA 2XNXA 1K05A 5APWA 3CCLP 2ZXXA 4PD4H 1Y47A 3OA7A 1NU1J 1J1DB 1S2EA 1ZN5A 2D2CD 2B89A 2YMYA 3Q5RA 4GKGA 1N8RQ 2RN0A 1BDCA 5KAIE 3Q5SA 2PAJA 2ZJSE 1ZW0A 5TJHA 2Q7CA 3E1IA 1YBKA 5KJ7A 4EOTA 4JYBA 3CI9A 1KFMA 4L75A 2OYHB 3AE6C 5AVRB 3MP7B 1LTTC 1PGJA 1HWTC 1QL1A 2YKQA 3U1AA 3V4WA 5K5GB 2R32A 2FFDB 1G1IA 2IFNA 1AA0A 2RMZA 2BASA 1GK4A 3AEDC 1SQXK 1SQQJ 1QVFO 3SWKA 3HRNA 3G9RA 2H43A 4I7ZC 1FU1A 1PV3A 2W8ZA
chains in the Genus database with same CATH topology
1KB9H 3L72G 4U3FG 3L74G 3H1IG 1NTKG 1PP9G 1SQXG 3H1LG 1SQPG 1SQQG 3L71G 3BCCG 3TGUG 2BCCG 4PD4H 3H1KG 3L73G 2FYUG 1SQVG 1BGYG 2A06G 1NTMG 1BE3G 3L75G 1KYOH 4D6TG 1P84H 1SQBG 1PPJG 1L0NG 2IBZG 3CX5H 1L0LG 3CWBG 3CXHH 3H1JG 5KLVG 1BCCG 1EZVG 1NTZG 3H1HG 3L70G 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 H;  3L72 G;  4U3F G;  3L74 G;  3H1I G;  1NTK G;  1PP9 G;  1SQX G;  3H1L G;  1SQP G;  1SQQ G;  3L71 G;  3BCC G;  3TGU G;  2BCC G;  4PD4 H;  3H1K G;  3L73 G;  2FYU G;  1SQV G;  1BGY G;  2A06 G;  1NTM G;  1BE3 G;  3L75 G;  1KYO H;  4D6T G;  1P84 H;  1SQB G;  1PPJ G;  1L0N G;  2IBZ G;  3CX5 H;  1L0L G;  3CWB G;  3CXH H;  3H1J G;  5KLV G;  1BCC G;  1EZV G;  1NTZ G;  3H1H G;  3L70 G;  1NU1 G; 
#chains in the Genus database with same CATH topology
 4A7P A;  1EZV I;  2XV5 A;  1BGY J;  1NAY A;  1T3U A;  2KNC A;  2Y0E A;  3F89 A;  1RF0 A;  2FYU K;  2P1J A;  2WSC J;  1W5C E;  2OYO A;  3NFQ A;  4AQR D;  1EDL A;  2QG4 A;  2KSE A;  5CJ0 A;  3AE2 C;  1P84 D;  1KN7 A;  1SQP J;  2POH A;  3CC2 P;  3BCC E;  1RQU A;  2OGU A;  4I1L A;  3CX5 D;  4PJ0 H;  4UB8 E;  4WY4 C;  5AVT B;  2NPS A;  2KYV A;  1SQB E;  1L0N J;  1L4A C;  1PL5 A;  2AEJ A;  2QSI A;  3C1L A;  3KDP B;  4L76 A;  1T2K D;  3RBX A;  2Q5U A;  3O6Q B;  2Q3E A;  4UB8 H;  1NYH A;  1N86 A;  1NU1 K;  3H1K D;  4Z1M H;  2KLV A;  2ZYD A;  4OWF A;  3TNU B;  1IFD A;  3CXH H;  4WY4 D;  1J2J B;  2Y0C A;  3AE1 C;  5KLV D;  1OVV A;  3IAO A;  1AJY A;  5AW0 B;  2FYN C;  2WQY C;  3L73 D;  2R44 A;  1NAF A;  2B87 B;  1M57 D;  5AVQ B;  5KLV G;  1EDK A;  1P84 I;  2K88 A;  1FS0 E;  3GHG A;  1BE3 D;  4PD4 E;  1SLQ A;  1LTS C;  1LNQ A;  2E75 B;  1PIX A;  2KK7 A;  5B5E E;  5KJ7 C;  1H0T B;  3HTK B;  4M3L A;  3H32 A;  1DX7 A;  1EZV E;  3KXD A;  1KYO E;  4KJM A;  5AW5 B;  1U7J A;  2FYU G;  3CME P;  3U1C A;  2ZAE B;  2KP8 A;  4GOF A;  2WMM A;  1KB9 I;  2P7J A;  2Q1K A;  2RH0 A;  3NMD A;  1HH0 A;  1FZA A;  2Q3I A;  3AE3 C;  4H13 D;  4NPF X;  1DEB A;  5CCG C;  4BRY A;  4R4M A;  1L4A B;  1Q90 D;  1BE3 E;  1SQX D;  2CK3 H;  2FKW B;  2IX7 C;  2JJL A;  2K3R A;  3H1J D;  4H0L B;  1HGV A;  1AQ5 A;  1Q82 Q;  1AFO A;  2O3J A;  1Y8A A;  2YXQ B;  3H1I D;  4JPZ B;  5TIS H;  4BWN A;  1VF5 C;  3CXH I;  1OXZ A;  5CHX A;  1VQ9 P;  3D6Y A;  2LXC B;  3JSV C;  1VQ6 P;  1BCC G;  2IFM A;  3QH9 A;  5AW1 B;  3TNU A;  2QVA A;  1IJD B;  1VQN P;  2QJP C;  1JEK A;  1YJW P;  3HD7 C;  3RL0 C;  1PFI A;  5BU8 B;  4U3F G;  2G8Y A;  2IYO A;  2R3S A;  2UWJ E;  3H1H E;  3HUS C;  2FYN B;  3NXS A;  1IZN B;  1N7L A;  3FX0 A;  4PJ0 E;  2WPV B;  3RK2 D;  3TYY A;  2C9L Y;  3RL0 D;  3HD7 D;  3M9H A;  3BCC G;  5CCH A;  1G1J A;  1SVF A;  2QIW A;  1LTI C;  5AVS B;  1SQP K;  1QGK B;  4DT0 A;  1K8A Q;  3CWB J;  3H1J J;  3CD6 P;  1LWU B;  1VF5 D;  5KKZ C;  4AUW A;  2QM8 A;  1JMM A;  1JTH A;  1SQQ E;  2XDJ A;  2V4H A;  3EQ2 A;  3II6 A;  5CCG D;  3KQG A;  2YNY A;  2C0W A;  2OYI A;  1AVO A;  2I1J A;  3HE5 B;  2NPS C;  3LW5 H;  2P2U A;  4Y28 J;  5APV A;  2YKP A;  1G2C B;  3T97 A;  2HFE D;  4ASW A;  1KQG B;  3PJS K;  1IK9 A;  4HH2 A;  1OZH A;  5KJ7 D;  1HJB A;  4OVN F;  3B5N D;  4KHX A;  1RF0 C;  2IZ1 A;  2OAR A;  4MN4 C;  3H1L G;  1DD4 A;  3VMA A;  1LTG C;  3L71 G;  1YQ3 C;  3A0H E;  3ITK A;  3H1K G;  1HVV A;  3AEG C;  1DIP A;  4QMA A;  4H44 B;  2IYP A;  3PTZ A;  2IBZ I;  3GLM A;  1KC8 Q;  1DH3 A;  2V7Q J;  1MFZ A;  4ZKU A;  3CCE P;  2J5U A;  1JY2 O;  2HOD B;  1BGY E;  4D6T G;  1IK7 A;  2MJZ A;  2FFD C;  1FZG A;  2YIU C;  3ZDM A;  3L70 J;  3WU2 E;  2JWD A;  3RK3 E;  1ZRT D;  2PFX A;  1VF5 B;  2H88 C;  1EZV D;  4RKU J;  3G3Z A;  5AW8 B;  1VQL P;  3WUT A;  1GD2 E;  3N4X A;  1JM0 A;  1WRG A;  1N2D C;  4OGQ D;  4WB4 A;  1EZV G;  1M7L A;  3AEC C;  2QJP B;  3BAT A;  3HE4 B;  5BVZ A;  5AVX B;  1ZR4 A;  1SQB J;  4EIJ A;  2R3C A;  1AQT A;  2JEE A;  1PPJ E;  2B9B A;  2O01 J;  1FDI A;  4UB6 E;  3S4R A;  1SQP D;  3VOP A;  2PRR A;  2IBZ D;  2LR2 A;  4EYY Q;  3Q5P A;  1JY3 O;  4ZKP A;  3UIA A;  1SQX G;  4N6J A;  4OH8 B;  3V2Q A;  2WSS H;  2Q6Q A;  2NRG A;  1SQP G;  2WSE H;  3E7K A;  1FOS E;  1RH5 B;  4HKZ H;  4YXW H;  5CCG A;  1E79 H;  1M1J A;  2I8D A;  3FGA D;  1MUU A;  1S3J A;  2HR3 A;  3KZI E;  3O6Q A;  1NTM G;  1YYC A;  1BDD A;  3L73 E;  5APY A;  4AYC A;  3G6E P;  3P8C D;  3CCQ P;  1QL2 A;  1KOR A;  2BEZ F;  2XKM A;  2NPS B;  1RQV A;  3H1H D;  1IFM A;  4XA4 A;  1M1K Q;  1NU1 E;  1JY2 P;  2IZ0 A;  1Q81 Q;  4U3F D;  1M90 Q;  1ZOY C;  1ZV8 A;  1NTK K;  3HE4 A;  3CX5 I;  3WUV A;  1PP9 D;  4RES B;  3CWB G;  5C39 A;  5BU5 A;  1H89 A;  2Y0D A;  5AVV B;  1L4A A;  1MV8 A;  5GTH H;  1LT9 C;  2HOD A;  2D2C C;  3SWY A;  3HD7 A;  2QA4 P;  2Z4E A;  1KYO I;  2WSC H;  1SQV D;  2FBW C;  2M0B A;  1Z56 A;  4GDO A;  3HD7 B;  5B66 E;  1OVU A;  3RK2 C;  3RL0 B;  1KQS O;  3A0H H;  3H32 B;  3RK3 C;  4IFF A;  1SQQ D;  3AEA C;  2E74 D;  1LP1 A;  3HE5 A;  5CBN A;  2WVR A;  1FBM A;  1N73 C;  2KUB A;  2ZVO B;  4PV1 C;  4BXL A;  1JY3 P;  1LJ2 A;  1SQQ G;  3LIE A;  4DCK A;  3Q2Y A;  3KHU A;  1HGZ A;  1KIL C;  5APX A;  1PGO A;  3CMA P;  2Y9Y A;  3A3Y B;  4JBZ A;  2P10 A;  4H0L C;  3MUD A;  1BGY G;  5KLI C;  4C7R A;  4WWI A;  5AW2 B;  3B5N A;  1J1D C;  3A2A A;  3F5H A;  1L0L K;  2ZYA A;  2WPS A;  1NTM K;  1CZQ A;  1YHQ P;  3MD0 A;  2HLO A;  5EFW B;  2OQQ A;  1HF9 A;  3VP9 A;  4EDF A;  2OTK E;  3M9Q A;  1GK6 A;  4H13 B;  1KB9 D;  2WT7 B;  3P32 A;  4XFJ A;  1S5L H;  1L0N E;  4C46 A;  1IFP A;  1AV1 A;  1IO4 A;  3L71 E;  1NH4 A;  2QRX A;  4IFM A;  1USE A;  3G71 P;  2YO2 A;  4N78 D;  1YIT P;  1VDF A;  2KS1 A;  3M06 A;  1KB9 H;  2E5T A;  4JQ0 D;  2A06 E;  3L74 G;  1LT9 B;  1E5W A;  1RY3 A;  5APS A;  4YXD C;  1LT1 A;  2WTY A;  5GTI E;  2K9Y A;  1OW7 A;  2KB7 P;  3L72 J;  5E79 E;  1H8A A;  2QM7 A;  2AXT E;  2AEF A;  2BCC G;  1QEX A;  3LW5 J;  3ABV C;  1XTC C;  3A7O A;  3L70 E;  2JDI H;  3OW2 O;  1SFC A;  3WMM 0;  3MZW B;  2OYH C;  2A06 G;  2KOG A;  3JCU E;  1K9M Q;  2L5G B;  2W90 A;  1SQQ K;  1SQX J;  1JB0 J;  1PGQ A;  1URQ B;  5KAF E;  3VTP C;  2MKV A;  2QJK C;  3L36 A;  3VN0 A;  4CPG A;  1X79 B;  3TGU E;  3CLQ A;  1T2K C;  2IBZ G;  3P7K A;  1KQL A;  3AEB C;  2M5A A;  3CCR P;  1AVY A;  2VRS A;  1PP9 E;  1A02 F;  1GW4 A;  3CCV P;  3P8M C;  3GMA A;  2E75 D;  4JYC A;  1S4X A;  1XTG B;  3MIW A;  4N78 E;  3EFF K;  3I5C A;  3L4F A;  1EXJ A;  1K04 A;  3R2P A;  3H1L J;  2KS1 B;  2IBZ E;  1LTJ B;  2Y9Z A;  5KLV K;  1CW5 A;  3N7N A;  1GDT A;  1BCC J;  1FOS F;  2O1J A;  3EWK A;  1S9K E;  1NWQ A;  3CPW O;  1NOH A;  1FZC B;  4HYT B;  5CCH D;  3GHG C;  1P84 E;  2IPP A;  3A0B H;  4N3Y B;  4GOD A;  4GOE A;  5B5E H;  1MFT A;  3AEF C;  1N7S D;  3L75 G;  2FYU D;  2K9J A;  2P67 A;  2RKL A;  4GIF A;  3V2R A;  3RBZ A;  3W68 A;  1UIX A;  3W67 A;  1VQO P;  3BAS A;  1NTZ J;  4JF7 A;  3L75 D;  3D71 A;  1GMJ A;  2QE7 H;  1Q86 Q;  1OX3 A;  1JUN A;  2WPQ A;  5GTH E;  2O01 H;  1KB9 E;  2ZT9 C;  3H1J G;  3HUS A;  2A45 G;  1SQB K;  1HUC A;  2QJK B;  1EC5 A;  1NKN A;  1SP4 A;  1HJ0 A;  3VMX A;  5AVU B;  1LTB C;  1CI6 B;  4LC1 A;  1BGY D;  1YI2 P;  4IL6 X;  1OMI A;  2N1T C;  2OYI B;  3E1R A;  4NPE A;  1EDI A;  1JMB A;  2M8R A;  3VMY A;  3TGU D;  4U3F E;  1IFN A;  1FDO A;  1LWU A;  2B87 A;  3JCU H;  4RJT A;  4TLF A;  1RF1 A;  1LTJ C;  5KAF H;  4ZNC A;  1Q7Y Q;  2PGD A;  2WPR A;  1LP1 B;  1YIJ P;  3JC2 2;  3BCC D;  2FXO A;  1BE3 G;  1NJI Q;  2DW3 A;  1SQB D;  3C8V A;  1LWU C;  5KKZ B;  4EI2 A;  3L35 A;  2E76 C;  3TDK A;  3LID A;  4IL6 H;  3L71 J;  1NTK E;  3SSU A;  3H1K J;  2E42 A;  2L91 A;  3L74 D;  1M1J C;  3L74 E;  1URQ D;  3AE5 C;  2I1K A;  4W80 A;  2J59 M;  3AE8 C;  1MZ9 A;  3L70 D;  2N1T B;  4D6T J;  1S5L X;  1SFC D;  3HUS B;  2OYI C;  1VPC A;  2BCC E;  1T6A A;  2K1A A;  3L72 E;  3TK1 A;  4ASV A;  2FYU E;  3L70 G;  1NTK G;  4LGD E;  3I55 P;  3CCU P;  3AE7 C;  4YTP C;  1YJN P;  1HTL C;  5L8R J;  3IN6 A;  1KIL B;  1W2E A;  1NTK D;  2YXR B;  1VQP P;  2JR8 A;  1OWA A;  2R5D A;  3M0D A;  4WBA A;  3RK3 D;  4Y99 C;  2GUV A;  5AW6 B;  5CBO A;  4Y99 B;  1NO4 A;  1BCC D;  3VMZ A;  3BRT B;  5M1B A;  1FZC C;  2JWA A;  1VQ7 P;  1MKM A;  2WSE J;  1L0L J;  2ZT9 D;  4WY4 A;  1ZR2 A;  1GL2 D;  2ITA A;  1KYO H;  3O8Z A;  2O01 N;  2LKM A;  1TU3 F;  2WSF H;  2WWW A;  3AE9 C;  3PRJ A;  4HJG H;  4I2L C;  4OGQ B;  3USS A;  1GW3 A;  2W27 A;  3FWL A;  3VP8 A;  1Y9B A;  2FXM A;  2QJY B;  1YQ4 C;  2A45 I;  1LTA C;  2M3B A;  3RL0 g;  1N7S C;  1NKZ B;  1NTM J;  1NTZ D;  1VL2 A;  3OJA B;  2KNC B;  2K37 A;  1FZF A;  1JNM A;  3L72 D;  1N7S A;  1NTZ G;  1OW6 A;  5APQ A;  5TIS E;  3MHV A;  2KZI A;  2FYZ A;  3L72 G;  4NPD A;  4H44 D;  1ZXG A;  3L75 E;  4L73 A;  1G2C A;  3T97 B;  3CC4 P;  1KMI Z;  1S72 P;  4HB1 A;  2JKV A;  1FJK A;  1USD A;  2SPZ A;  2OYH A;  1NTZ E;  3KPE A;  1WMK A;  1OW8 A;  1A02 J;  2XU6 A;  3B5N B;  1UII A;  1KD1 Q;  2K9J B;  2W83 C;  1JTH B;  3GW6 A;  3PLN A;  2M3E A;  1DD3 A;  1IFJ A;  2W6A A;  5KTB A;  3S9O A;  1OFC X;  3CXH E;  1YJ9 P;  3CC7 P;  1ZLL A;  4WVZ A;  3IFM A;  3C9I A;  4B86 A;  2KXP B;  1LGH B;  1M1J B;  4K3A A;  1KFN A;  1CSB A;  1S1C X;  2A45 H;  1OIP A;  5AW7 B;  3SFD C;  2N9Y B;  1GL2 C;  3BRV B;  2W6J H;  1R8E A;  1YTZ T;  3FXD A;  2YIU B;  5AVY B;  2QJY C;  2E74 B;  5CMZ A;  3TSI A;  3CWB D;  4K35 A;  2FFD A;  3MGN A;  1JO5 A;  3L37 A;  5APU A;  1SQX E;  1KV4 A;  1DEE G;  1RE3 C;  1SQP E;  2Z5H A;  3B8E B;  1RHZ B;  1ZRT E;  4O9B A;  3MTU E;  3H6P A;  1IFI A;  2H8P D;  5B66 H;  3H1I J;  1PP9 J;  1NTK J;  1SFC C;  1URQ A;  1KIL E;  4RO0 A;  3WU2 H;  3H25 A;  1H88 A;  1X0T A;  3L74 J;  1N73 B;  2E43 A;  2NPS D;  2WT7 A;  3G4S P;  1IC2 A;  2QEX P;  2ZYG A;  1ZP0 C;  1SQV J;  1FC2 C;  1URQ C;  5AW4 B;  2E5Y A;  3H1L E;  4DJG A;  5KLV J;  2BCC J;  4LLH A;  2E76 D;  3KYQ A;  5AW3 B;  2JP3 A;  2YKO A;  3PHL A;  3SWF A;  1BCC E;  1L0L G;  2WZ7 A;  1LT9 A;  1Q2N A;  4H0L D;  3D70 A;  1H0T A;  3L71 D;  1T8Z A;  5DJU B;  1L0L D;  3TGU J;  2XND H;  3H1H G;  3NTN A;  3GG2 A;  1GTW A;  1VQ8 P;  3D6Z A;  4YPC A;  1QX8 A;  1U7M A;  1PPJ D;  1T3J A;  2E74 C;  4D6T D;  1GL2 A;  4DZO A;  1PP9 G;  2OTJ P;  2AEM A;  3M0D C;  4R4L A;  3RGU A;  1KYO D;  1D7M A;  1JCC A;  5CJ4 A;  2C9N Y;  1BE3 J;  4UB6 H;  3SFE C;  3U59 A;  2E76 B;  4KT0 J;  1SQV G;  2AXC A;  1KZU B;  2ZXE B;  2FY8 A;  3MUD C;  1K73 Q;  2GM4 A;  1FJP A;  2GUS A;  1EXI A;  1FDM A;  2BCC D;  1LTJ A;  5E79 H;  3VYI A;  1PGP A;  1QLE D;  5APT A;  1EQ7 A;  2XZR A;  1FZE A;  2A06 D;  3GF7 A;  3M0A A;  3K5B A;  4W7Y A;  3TF5 A;  3A5T A;  4U7J A;  1W2B O;  3KZI H;  1FE6 A;  1L0N G;  2N1T A;  1FAV A;  2LXB A;  2N9B A;  3B4S A;  4H13 C;  2ZT9 B;  4U3F J;  1CI6 A;  3H1H J;  3CL3 D;  3L75 J;  1L0N D;  3V5B A;  2KI7 B;  1S9K D;  4GT1 A;  1BSN A;  1L0L E;  2ZVN B;  1JY2 N;  5CCH C;  3BCC J;  4I7Z B;  1NU1 G;  1OVR A;  5AVZ B;  3RK3 B;  3P8C E;  1GU5 A;  1N73 A;  3H1L D;  3RK2 B;  3Q1M A;  1U57 A;  1NGM B;  3R4Y A;  4IFD K;  4XE5 B;  1NU1 D;  3B71 A;  1BSH A;  3H1J E;  4H44 C;  3M9B A;  3H1K E;  4TT3 H;  3S1K A;  4W7Z A;  1RE4 A;  2WSF J;  1KTM A;  4L74 A;  2E75 C;  2WIT A;  2CPS A;  2PP6 A;  4OGQ C;  3V6I A;  2KIK A;  1FZB A;  2C0X A;  3M91 A;  3CX5 E;  2G3A A;  1M56 D;  2Z5I A;  2FYU J;  3FWN A;  2KLU A;  4I6M C;  1SQV K;  1WT6 A;  2KSJ A;  2HG5 D;  4DOJ A;  4C7N A;  1KQF B;  1P84 H;  3A0B E;  2NZ2 A;  2FXP A;  3IF4 A;  3EFG A;  4BRY B;  2IDB A;  1L4A D;  2KZJ A;  3CX5 H;  2Q9I A;  1GL2 B;  1NVO A;  2P58 A;  2B88 A;  2J58 A;  1GU4 A;  3Q3D A;  2CPB A;  3CWB E;  1QVG O;  5GTI H;  1KIL A;  1X22 A;  1X9V A;  2JO1 A;  3HTK A;  1VQ4 P;  1RF1 C;  1JCD A;  2AXT H;  1RF1 B;  3PP5 A;  1S5L E;  2M5A B;  2YMK A;  3BVH A;  3AE4 C;  1L2P A;  1R5S A;  3CXH D;  3OAK A;  3IR9 A;  2D2C B;  3GHG B;  1VQ5 P;  3B5N C;  4D6T E;  3WUU A;  3CCJ P;  1NTZ K;  3GF3 A;  2V7Q H;  2W6B A;  1HBW A;  3TGU G;  1NTM D;  1RE4 C;  1NTM E;  3L73 G;  3V2N A;  3QWO C;  1M8O B;  4PD4 I;  5KLV E;  3I56 P;  1VQM P;  2H89 C;  4PV1 B;  5H2F H;  2H7H A;  1EDJ A;  4ZMD A;  1L0N K;  1R5L A;  1SS1 A;  2BEQ D;  5AW9 B;  3V2P A;  3V4Q A;  1SQB G;  2R5B A;  1PPJ G;  5DJT B;  3AEE C;  5H2F E;  1JY3 N;  1YTZ I;  4C7N B;  1ZME C;  1VQK P;  1N7S B;  3H1I E;  1GZL A;  5AVW B;  3CCS P;  4IOI H;  1RE3 A;  2OTL P;  1PZQ A;  4IL6 E;  2YO3 A;  3FXE A;  1KIL D;  3PH0 A;  2GA1 A;  2HYN A;  2HPC B;  1X8Y A;  1SQV E;  4PD4 D;  1J1E C;  4PV1 D;  1NHL A;  1J1E B;  2ZFC A;  3H1I G;  1FZC A;  1SFC B;  2O1K A;  2N1T D;  3CCM P;  3L73 J;  5KLI B;  2HPC A;  4WY4 B;  5KAI H;  1JOC A;  2XNX A;  1K05 A;  5APW A;  3CCL P;  2ZXX A;  4PD4 H;  1Y47 A;  3OA7 A;  1NU1 J;  1J1D B;  1S2E A;  1ZN5 A;  2D2C D;  2B89 A;  2YMY A;  3Q5R A;  4GKG A;  1N8R Q;  2RN0 A;  1BDC A;  5KAI E;  3Q5S A;  2PAJ A;  2ZJS E;  1ZW0 A;  5TJH A;  2Q7C A;  3E1I A;  1YBK A;  5KJ7 A;  4EOT A;  4JYB A;  3CI9 A;  1KFM A;  4L75 A;  2OYH B;  3AE6 C;  5AVR B;  3MP7 B;  1LTT C;  1PGJ A;  1HWT C;  1QL1 A;  2YKQ A;  3U1A A;  3V4W A;  5K5G B;  2R32 A;  2FFD B;  1G1I A;  2IFN A;  1AA0 A;  2RMZ A;  2BAS A;  1GK4 A;  3AED C;  1SQX K;  1SQQ J;  1QVF O;  3SWK A;  3HRN A;  3G9R A;  2H43 A;  4I7Z C;  1FU1 A;  1PV3 A;  2W8Z A; 
#chains in the Genus database with same CATH homology
 1KB9 H;  3L72 G;  4U3F G;  3L74 G;  3H1I G;  1NTK G;  1PP9 G;  1SQX G;  3H1L G;  1SQP G;  1SQQ G;  3L71 G;  3BCC G;  3TGU G;  2BCC G;  4PD4 H;  3H1K G;  3L73 G;  2FYU G;  1SQV G;  1BGY G;  2A06 G;  1NTM G;  1BE3 G;  3L75 G;  1KYO H;  4D6T G;  1P84 H;  1SQB G;  1PPJ G;  1L0N G;  2IBZ G;  3CX5 H;  1L0L G;  3CWB G;  3CXH H;  3H1J G;  5KLV G;  1BCC G;  1EZV G;  1NTZ G;  3H1H G;  3L70 G;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...