1OMIA

Crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
224
Chain Sequence
GSEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Listeriolysin regulatory protein
publication title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 72
structure length 224
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1omiA03
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1omiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1omiA01
1R22A 4E2SA 1XMAA 2RN7A 1YYVA 3M3IA 2PN6A 1VR3A 3F3XA 1J2XA 3GLXA 3R0AA 5HS8A 1KU2A 4WF2A 5LGNA 2E1NA 2O6GE 3E97A 4RB3C 4ESBA 2Y0MA 4A6DA 3HSFA 4M73A 2R7FA 3EO6A 4JTOA 1WLTA 5JSRA 1XGSA 1PMIA 2KRFA 2GQQA 2IP2A 1BI0A 4KU8A 3IWZA 2HKOA 4XRFA 3KP6A 3EQEA 3DF8A 2HGCA 5ICFA 1HW2A 1B9NA 2KIFA 1FXZA 3ST7A 4RS8A 5ICCA 4HV5A 1FSHA 3E6MA 1K7AA 4GGGA 1R1TA 4WBBA 3ACLA 4MGRA 4E70A 2EK5A 5KVRA 3CUQA 3N4MA 3CEWA 1IF1A 4HDUA 2QQ9A 5CVVA 2HJIA 3FHZA 2HYFA 3CLPA 5KHKA 1O3SA 2GC1A 2A6EF 3W6KB 4Q4ZF 1U6GA 4EV0A 1UPIA 3KGZA 4A2UA 3J7AO 2OYZA 4F7ZA 4AIJA 4MGZE 2PAEA 4EWEA 2LKPA 4IXAA 2WC2A 2C6YA 5E18F 1R36A 5D8LB 4XLNF 3E6DA 5D6EA 5BPIA 5D4RA 2LF7A 3HHGA 4NHJA 3B02A 1IN5A 1EH8A 2OQRA 2PBIA 3ZQ7A 1D5VA 2PJPA 4IHTA 3LZZA 1ZH5A 5TRDA 2EV0A 3GXOA 2QNKA 1UHMA 4ASNA 2B0LA 4ENJA 2XKPA 1SQ4A 2QLZA 5E17F 1R58A 4AQ6A 2IW5A 4Q5SF 5CVRA 3NRVA 1JE8A 4HYEA 1CAXB 2QZ8A 4TV7A 3GZ6A 1NHAA 4KNYA 4ETSA 3PQKA 3F21A 3BB6A 4L2NA 3KSCA 4EGZA 4LEJA 2P17A 3HRTA 1HSTA 1TNSA 4ENMA 1RL3A 1B9MA 3KLOA 1YHFA 3IKTA 2EFNA 1B59A 5L3DA 3WTWC 4IVNA 3LWCA 5F64A 2HS5A 4M9SA 4MEXF 2MD5A 2H27A 3TDZC 4IESA 1ZX5A 1U12A 2H6CA 2F5FA 2LNBA 3F8CA 1L0OC 3WTVC 5LHHA 2EV5A 5K8SA 1W5TA 6PAXA 2M45A 1QXJA 4HMZA 1KU3A 2M5WA 4ESFA 4WK8F 4TLFA 4D7TA 3NVCA 3HRUA 3KETA 3ML6A 2BBYA 2XAJA 3WU1B 3P9IA 2K27A 1QBJA 2D5FA 3QPTA 1LQ1A 3RNSA 3F6VA 5K5QA 2QUFA 5LBQA 1CAVB 3EYIA 3LA2A 2HDCA 3M8EA 4GXOA 4UVCA 4LB5A 4S05A 2MNGA 3VFZA 2ESNA 2GIVA 4JTNA 1T39A 3MZYA 1H9TA 2JPBA 2W25A 4OMYA 4FHTA 1ZG1A 3J81Z 4G8XA 4D7SA 2FSWA 1J3PA 3OF1A 1YFHA 5FFXA 1ZARA 1FDIA 4KWLA 1FI2A 4A0ZA 2Z69A 3FX3A 3RKYA 2KJBA 3K1MA 5HLIA 2UWMA 4JVAA 3FMSA 2V1UA 3PFIA 1YUDA 3GVAA 3RJPA 3E5QA 4KIFA 2OZJA 4QMAA 1SFUA 1AWCA 3IWFA 1YO5C 5I93A 4G7HF 2UY8A 3LAGA 4RB2C 1TBXA 1XMKA 4F8AA 5C8WA 1XD7A 3KP4A 1QGPA 4YFKF 2EFWA 1SEFA 3J80K 5FPZA 5AVPA 2FQ3A 2Z9OA 3HT2A 2DCTA 2VOPA 4Y13A 2DK5A 1YLLA 1IN7A 1SMTA 2O3FA 2Z5UA 5E20A 1CAXA 2P10A 3H1MA 4UBGA 4I01A 3WE3A 1JHFA 2UXNA 3K2ZA 1J0RA 3DN7A 4A12A 2DQLA 2P4WA 2HWVA 3NJZA 1KQ0A 3OCPA 2NNYA 2X0LA 2ET7A 3ROUA 4BH9A 2E7WA 1WRJA 2A6HF 4RB0A 4BIFA 3KCCA 2ZKLA 3H9AA 1XSDA 4M71A 1O3TA 1YW8A 4BYYA 1IW7F 2K0GA 5EZWA 3JSOA 2L4AA 4R1HA 4G7ZF 1TW3A 4R52A 1FWZA 2CG4A 3BPVA 2VODA 3TNPB 2A68F 2P5LC 2F2EA 2DK8A 2L3DA 1YFYA 3UKTA 4IEPA 1FT9A 3U9GA 3BY6A 2Z33A 1IXSB 4ZZLA 1I5ZA 1JXSA 4LUMA 1RZ4A 2ZXJA 1SAXA 2D45A 4IEUA 3ZN0A 2QQAA 4KIGA 1ZRFA 3FZ3A 1DZTA 5CVIA 4KWJA 1FC3A 1YFWA 1MJ9A 2P6SA 4KA4A 5CYVA 3V7CA 2NRAC 1ON1A 4PIZA 3IIAA 1YQAA 3G73A 1CAVA 1ZYRF 1XE7A 3EQLF 1LDJA 4WCGA 2K4JA 3J80Z 3HTSB 2GZWA 2FRHA 1Q5OA 4LJZF 2KJCA 4LLLA 3HT1A 2EFPA 3WU0A 2ZCWA 3E5UA 1V4RA 1ONVA 1NZCA 1KA8A 1ZGAA 2O61A 3QAHA 5FCCA 3MDPA 3BU7A 1O57A 4O9EA 3TKYA 4KIBA 4XBFA 1U78A 4LA2A 2XV4S 3L00A 4BAYA 1ZMEC 3UKVA 1BC7C 2KXLA 4QX5A 2BNMA 3KMHA 1Q1HA 1FBUA 2CSOA 2UZKA 4H0EA 2XLGA 2BEOA 3NQOA 3SCFA 4I7HA 4YSFA 1DP7P 3JAMK 3K69A 1XDUA 3SQNA 2FF4A 4IERA 2Q0AA 4BXUA 3KEOA 2KIMA 3WW4A 3CO7C 1W4MA 2V1XA 3QRFF 4L5JA 3BOQA 1ZLKA 3T1BA 1NE6A 1SMYF 3TOBA 3CUOA 2BNOA 4G94A 5HDNA 2H0VA 4EMSA 3DPLC 1O3QA 2FE3A 2PQ8A 2FU4A 1OR7A 3JTHA 4YYOA 2Y48A 4L0YB 1ZG3A 2YSRA 4AVPA 4YG2F 3ELNA 1RNLA 4ZU5A 3E3VA 5HDKA 1JGSA 2XL7A 4XFIA 2LF8A 2ZFWA 4HVOA 3IDBB 4FX4A 4DQ2A 1BM9A 5BQTA 3EYYA 1BI3A 1U8RA 2XIGA 3ES1A 5LRSA 4MUVA 5D8KB 1XCVA 2V1DA 4ESJA 4HW0A 5BOXA 4L9VA 1BIBA 5DUIA 3JW4A 4XFCA 2O1QA 3P9KA 1S3JA 3VEPA 3NKTA 3I54A 1IN8A 3ZMUA 5KHHA 1DUXC 2IC1A 4O9GA 1USSA 4MTDA 4EM2A 3I53A 2XAQA 5LHIA 3U10A 2HR3A 2K9ZA 5LHGA 3QOPA 1EPZA 1U5TB 2ATFA 2MLGA 2N7GA 5I0UA 4HBLA 4CXFA 4I3PA 2PTMA 3Q9SA 3QU6A 2V79A 5H20A 1LEBA 1FBSA 3F6OA 3I5UA 4ZU4A 4BNCA 3GYHX 3OV8A 3F22A 3K9TA 3DP7A 4OIRF 4IJAA 1E2XA 1TNTA 4UNOA 3ZN1A 3KGLA 1WKMA 2JRTA 1XGMA 3QPHA 4KDPA 1WWXA 4RGSA 2A3SA 4L9JA 3L2CA 1V3FA 5KHIA 5E1XA 3BPXA 1SFXA 1FDOA 4U0YA 3SHRA 2VT2A 3V8LA 1EP0A 1IXCA 2DO7A 3JTGA 2W85A 2JTVA 3FWEA 2BE5F 1H0MA 3RDIA 3RYKA 2CV6A 5KHGA 5E8GA 1J59A 4I0AA 5HLGA 5LEJA 1J5YA 4MNUA 4EJTA 3M7GA 4MGYE 5ED4A 2CGPA 4R8HA 4BQAA 5T3NA 1F9NA 3KLNA 2XAFA 2ZNYA 4KN4X 3BCWA 4HLTA 4CO8A 4ORFA 2ZO4A 4ZYEA 2NAZA 3OOPA 4MGIE 4LA3A 2DBBA 1ZGJA 1S29A 2XUBA 4MZUA 1TQMA 4RGUA 5HS9A 1D8JA 4DINB 4AWXB 3NW4A 2PAMA 2YU3A 3IKVA 2Q4SA 3BP8A 2STTA 1OYWA 4Q0UA 3ZPLA 2PHLA 2EWNA 3BWGA 1B1BA 4UV8A 2IXHA 3HHHA 2V09A 3FXRA 4Q0PA 4G6QA 1Z05A 3GUDA 1LKNA 5DV5A 4Q29A 1W7PB 2VXZA 3DFGA 4QM8A 2J5PA 5JFRA 1K79A 5CVUA 3F8BA 2BV6A 2DLLA 4JK1X 4RGXA 3FMQA 5HVQC 1CAUB 3L9FA 1QO0D 5KK1A 3TOAA 4XFFA 3M70A 5K1YA 2VOOA 5D6FA 5H6RA 3FM5A 3KFWX 3OTFA 4YIFA 4UXAA 2GAUA 2E7XA 5DD8A 4IEWA 1R1UA 2RGVA 4L0ZB 3DKWA 4MV2A 1CGPA 2RNJA 3ZP5A 1U5TA 2A69F 4JBAA 5EEHA 1FNNA 3FFQA 1PM7A 5HOOA 4AVBA 3T5XA 1J3QA 2NNNA 5I91A 2GA1A 1QPMA 3J81K 3K0LA 1ZZ9A 1YS6A 1CAWB 1G3YA 2PA7A 3HUGA 1O5UA 2IXLA 4CDGA 1P4WA 2R7DA 5L3GA 2FMLA 4O5VA 1ZN2A 5BS6A 5JR3A 4EJOA 3SZTA 5I0TA 1TW2A 1VJ2A 3CJNA 1FPQA 2R3SA 1J75A 3USSA 5JAXA 5BPDA 2WWYA 3GFJA 1P4XA 4HA8A 4ZU7A 2A61A 2L4MA 4YFNF 5DYMA 5AIQA 1SFNA 4U7BA 2P5VA 1OKRA 3GO5A 2EVXA 1OPCA 2VC0A 4M72A 2K86A 3FM3A 2X4HA 3EUHA 1T2KA 5FQ0B 1Q3EA 2VBZA 2QDRA 1X8EA 4OFGA 2A07F 3WGGA 1UD1A 2UYAA 2L01A 1MZBA 3H25A 5HDGA 5BUVA 3MQ0A 4LLOA 2OZUA 2DU9A 4YRDA 5E1WA 3HQXA 1XE8A 1S8NA 3L7WA 3U1DA 1TQPA 3IDCB 4HLYA 1X82A 3RZZA 3GEZA 5FFZA 2VQAA 4NVPA 5AONA 1P2FA 3BALA 4Q48A 3DV8A 1SD5A 5IT9Z 1EH7A 1W7PA 4A5NA 3ULQB 2PQQA 2DFIA 2Q1ZB 1P4AA 3ABTA 1W7PD 4B8XA 2OQGA 4I2OA 1CAUA 4IEVA 2K7LA 3CUQC 1EV7A 5JSOA 5ICEA 4X6RB 4IF4A 1EYBA 2EA4A 1FYKA 4EJWA 1F4KA 4RAYA 3U11A 5D5VB 1TLHB 4KMFA 2QVSB 4I09A 3RYRA 1QWRA 5BY5A 4HLXA 1F5TA 1UW8A 5FLIA 1FX7A 1R5HA 2XAGA 3LFKA 2PHDA 4AIHA 4HF1A 2KKOA 2Q2EA 2RDPA 3ZMTA 4XLPF 4ZZDA 1IN6A 4HVRA 1CAWA 5AIPA 3SFZA 3TNQA 5ILVA 3E5XA 2IXCA 1T98A 2P7CB 4FAHA 2QENA 2Y75A 5K5OA 1O7FA 3IRRA 3JSPA 1QXRA 1TTYA 5J8FA 2IT0A 4U0WA 1DGRA 3CLOA 1YW9A 4OU0A 1O5LA 4RAZA 2CWEA 2ELHA 1AOYA 3LOIA 1P6RA 3C1DA 2F4PA 4UVBA 1FYMA 1UIJA 2D1VA 5FB2A 5LRRA 5CJ9A 5J6XA 5LLQA 2CO5A 4Q47A 4P55A 1IN4A 3F8FA 5L3EA 1KQ8A 4N9HA 5FQ0A 1NXMA 3D5LA 2ETHA 2VE9A 4HX7A 4QXKA 3SXWA 3ZMVA 5J8CA 1XGOA 1S6LA 4HDVA 4KFCA 2FBIA 1OYIA 3V7SA 2DAOA 4A6EA 4CYDA 3FXQA 2HKXA 2OA2A 3WTXC 3PQJA 1IRGA 4ZH4F 1J1LA 3VHRA 5K5RA 4HVQA 2ISZA 2ZKZA 2XGXA 4ZYDA 4ON0A 4GYIA 2IXJA 4RD7A 4Z82A 1HW1A 1YIOA 4LK0F 3O6BB 4UV9A 3RKWA 3ZDSA 5KBFA 1KYZA 4M74A 2IVMA 2GA2A 4YFXF 4XFGA 2UYBA 3HRSA 3R60A 1PP8F 3ISPA 2FXAA 4DNCA 2IXKA 1ULYA 1FLIA 3WTTC 2XKOA 4AD9A 2EA7A 2XLAA 2CW0F 1OI6A 4P96A 1STZA 3M1EA 4QLCU 4PGHA 4OINF 5E8IA 2WTEA 3KZZA 4LTAA 4HX8A 2XROA 1XN7A 1JHHA 1BBYA 5D5UB 2STWA 1Z7UA 4HBNA 2ZBKA 2OZ6A 3RYPA 4IETA 1X3UA 4J1XA 4XFAA 4G6DA 1QZYA 1OMIA 2PI0A 1R00A 3WGIA 2DPUA 3TQNA 4EWAA 4L5IA 2K4BA 1LEAA 5LGTA 2BGCA 3HTUA 2VE8A 2NS0A 3DEUA 2RC4A 2Z3YA 2EA2A 2E9QA 3SMHA 4G7OF 3H92A 2M8EA 2DQRA 4XFBA 3MEXA 1EY2A 5CU1A 3BJ6A 2G8YA 1V70A 4E2QA 3WW2A 1G4DA 4A5MA 2B9UA 5BV6A 2HYGD 1OFNA 2QCSB 2J5OA 4WVZA 1ZNPA 4WXDA 3CO6C 3SCHA 1J9IA 3EBRA 4RB1A 3GZ5A 4MTEA 2XL9A 4HF2A 4HF0A 5DEQA 5H6QA 4KT5C 5J48A 3SHFA 1LJ9A 2F5DA 2GC3A 2EB7A 2FNAA 1QQIA 2M1BA 4HZFA 2EJRA 4ENKA 1WA4A 1F1ZA 4OOIA 2PAKA 3CJXA 3ABUA 1UHWA 3S0MA 3WTZA 2IA0A 4QGNA 2OAZA 4XSZF 4XF4A 2PFWA 3VB2A 2HQRA 2W24A 5FLJA 3COAC 1UCRA 3WGHA 1ZHFA 3NSTA 4JQFA 1DDNA 1XRUA 1X7NA 1TQ5A 4H7LA 3I58A 1FBQA 3I59B 1G3WA 4MGKE 2P8TA 4L9NA 4M9ZA 1BI1A 3REOA 3EHKA 2D40A 2K02A 3ZMSA 4HV6A 2DT5A 4AXOA 3DPTA 4ZYHA 4KWKA 1O7LA 4M9XA 4AVCA 3M9AA 3R4KA 2HQNA 3PLQA 2GC0A 2M87A 3V8JA 4IHSA 1MGTA 2ETEA 3FHIB 1I1GA 3I0TA 3T8TA 1U3EM 3F23A 2FA5A 4EWDA 4JV4A 4OMZA 2COMA 3L2HA 5EFUA 3D0JA 5JCTA 4CICA 3PNAA 2QM3A 3HOTA 5E16A 4CZZA 1W5SA 3CO2A 2B5HA 2D2WA 3QP5A 1VP6A 1A04A 3CTAA 1KGSA 1ON2A 3KP3A 2H6BA 4HN1A 2VBWA 3L09A 4PJYA 1GXQA 2M30A 3RPQA 3Q9VA 3C3WA 3LA3A 3I71A 4IEZA 3MYXA 3WTUC 2DW4A 3GBFA 5I8YA 5E1ZB 4OLLA 2L54A 1K78B 3S7IA 2FNPA 4MHGA 4Z2YA 1QY4A 4MQVA 1FOKA 5LGUA 2LSOA 2YPRA 2BNNA 3LWFA 1XGNA 2ET1A 3FJSA 4KUMA 5ICGA 4U88A 3GF2A 4P9UA 1IUYA 4GULA 4YIIA 1QNTA 5FLHA 4L9TA 1YFUA 4PCQA 1BC8C 5KHJA 3LA7A 4AVAA 4OIPF 1Y0UA 3IHUA 4MX3A 4WXCA 2FMYA 1MDMB 4XEZA 1B4AA 3I64A 5FD5A 4GYGA 2Z2SB 4LG0B 5JHUA 2O03A 2YX7A 3CL1A 3BROA 2CYYA 3QP6A 3H8UA 1H1MA 2QJVA 5F1RA 2V6CA 4E2GA 4LD5A 2JPCA 2H09A 4P5OA 1BI2A 2QQBA 2OBPA 3MWMA 3QACA 2FEZA 1IPKA 4Q0VA 4I98B 1USTA 1IRFA 2MH9A 5D5XB 4HQMA 2QYOA 1FYLA 3GFIA 4FX0A 3V4GA 3I4PA 4Z07A 1Z6RA 4K8FA 2VPVA 2XHKA 5CVJA 1I1SA 1BN5A 3I59A 2GU9A 2XLFA 1RTVA 3OGJA 4NQWA 3KEQA 1SD4A 2O8XA 2RVCA 2JT1A 4WWCA 4UXNA 4L11A 4GO1A 1BJAA 3GFLA 3W6JB 1MJBA 2MPFA 1E17A 1PP7U 2HFHA 2IPQX 3FZVA 3GWZA 4P9FA 2P6TA 4XSXF 3O2PE 3RTRA 2QWWA 5JR7B 5DCMB 4IEXA 5E1RA 5JI6A 2DI3A 5IT9K 2GC2A 2ZMEB 1T38A 3FF5A 5CADA 1CF7B 3F72A 4EJUA 4HSLA 4KICA 3H7JA 4N9IA 4BHPA 1WGPA 5FLXK 3BJAA 4EM1A 4IEOA 2IA2A 3LAJA 1GHCA 1NE4A 2VBYA 3R0JA 2CQKA 2Z99A 3ES4A 1ZZCA 2OD5A 3WG9A 2ZJ2A 1KQ9A 3U2RA 3WW1A 3IL2A 4FT8A 3GW2A 4A0XA 4P9GA 3KZYA 4LFUA 3HIFA 3NL1A 1IZ1A 5D4SA 5I8SA 1K78A 4FBFA 3QU3A 3MCZA 2CAVA 3R6SA 1DGWA 4ONUA 4EM0B 2BYVE 1HKQA 3DQVC 1ZZ6A 1UB9A 1IPJA 3FE5A 1HQCA 4AIKA 2PYTA 2G9WA 3RIRA 2F5EA 2MBFA 5CLSA 2DPDA 1ZRRA 1J58A 5HS7A 3BZ6A 3CDHA 1EH6A 4XF1A 1SD7A 2G7UA 2FBHA 1DZRA 2MLKA 2GH2A 4U0VA 1SD6A 2V9VA 1MDMA 3C7JA 3ZMZA 3VOEA 3IN6A 3ZMDA 1YTYA 2CFXA 3R61A 1PUEE 5BXXA 4LG0A 4XF3A 1U2WA 2YR2A 4U7DA 5L3FA 4XF0A 1I6XA 3JZVA 4HSJA 3DXJF 4HAMA 1LR5A 3SXYA 3RI4A 2F5CA 4META 3IC7A 5J7MA 3B73A 1ZAOA 3I7DA 1ZLJA 4Y15A 4HOBA 2AS5F 2XVCA 3O6QA 1LNWA 2O0YA 4I02A 5I0RA 4LULA 1T6SA 5BPXA 2FOKA 4NB5A 3H50A 3BDDA 5FLXZ 4PIYA 2ISYA 2NYXA 1DPUA 5JVTA 1RGSA 2OPKA 3ERED 4I0BA 3KP7A 2EFOA 1WMKA 3P7NA 4CHUA 3G3ZA 3UKNA 3TO9A 2VN2A 2HZTA 3H7YA 2ACJA 3MFKA 2C0ZA 4M6XA 2AXLA 3WODF 1LVAA 4OIOF 4X6QB 3ECHA 2IXIA 1ZZBA 1T0FA 5DCMA 2IJLA 5HI0A 2JSCA 2I45A 1RUNA 2VBXA 2MHFA 2ZMEA 2QBYB 3AAFA 3HSEA 3M8FA 1D8KA 2YX4A 3C3VA 2O8QA 1CF7A 4BHCA 4LB6B 1ZVFA 3LSTA 3SZPA 5LEKA 4HN0A 1R7JA 2JZYA 2OU2A 3WW3A 4LLGF 3K1NA 3CF6E 3G7DA 3GYDA 1OD5A 1RIOH 4HX4A 2ZNZA 1U5TC 2HTJA 3TGNA 1FSEA 3MAJA 1LDDA 2UXXA 3MZHA 4RGRA 1RUOA 4GCVA 2VT3A 4UVAA 1L3JA 3HYIA 4XF9A 4Q0QA 2QVOA 3HSRA 1UIKA 3S2WA 3WTYC 4B29A 4O6JA 1K6OA 1H1IA 1KU9A 2FQPA 3V8KA 2IRFG 1VTNC 4EROA 1C0WA 2EV6A 3OD0A 4D0PA 2L02A 3LAPA 2XASA 2E1CA 1UFMA 4KMUX 4A0YA 3E6CC 2DTRA 2D5HA 1HKSA 3TDUC 5I8TA 4KU7A 4WZCA 2LDUA 2HOEA 1R1VA 5A2QK 3FMRA 1OYYA 3EDPA 5J3UA 1YS7A 3P9CA 1H9GA 2EAAA 4MQ9F 4LMYA 4PDKA 2IA1A 4PZJA 3N97A 3O3KA 4S04A 5D1IA 4QWQA 1J7KA 4IEQA 3T8RA 2Q30A 3GFMA 1Z9CA 3T0YA 4LGWA 3GX4X 1REPC 2RV8A 2HEOA 1G3SA 1ODDA 4WX9A 4YNIA 3ETQA 4EVIA 2WV0A 3EETA 2RQPA 3F8MA 1LDKB 2PFBA 2WFPA 3LQRA 2EFQA 2Y0OA 1J3RA 4J1WA 1Z91A 5ERIA 3SCGA 3LQQA 2FBKA 1QZZA 5DUKA 1HKTA 5FPXA 3U0ZA 3TO6A 2VECA 5HLHA 5FGMA 3DL3A 5FD6A 5C6CA 1IXRC 2VC1A 4N0BA 4AQ2A 4KN7X 1ZZ7A 2W57A 1R5GA 5L3CA 1O3RA 3RPUA 1YWKA 2Q8KA 1Z6TA 4MEYF 5TJJA 4L18B 3KP5A 3WE2A 1YW7A 3NEUA 2GWRA 1L3LA 1Q43A 4WXHA 4XETA 2ESHA 1LB2A 1DPRA 1GXPA 4IRIA 1ZRCA 1GQHA 3IBMA 1Y9QA 4QM9A 2CAUA 4FAGA 1PDNC 3F8NA 2GXBA 4PGGA 4LUKA 2QBYA 3O14A 1YLFA 2OA4A 2PG4A 5F6FA 3BPZA 2A5YB 4ENNA 1CX4A 3KE2A 4LK1F 5ILSA 5D5WB 1YFXA 1TQIA 5FO5A 1I27A 4KYWA 4R79A 2RKHA 2XRNA 1XB4A 5DCFA 5DDGA 3H1WA 1HBXG 1UCXA 1LRHA 1ZZ8A 5BMZA 1S7AA 5A2QZ 1Z1DA 4ZYGA 4YARA 1G3TA 4EQQA 2MA3A 5IT3A 5I0SA 5JSPA 2H94A 4IPAA 1P92A 1MD0A 1G6NA 4UBHA 3S7EA 4HQEA 4IRHA 1AJYA 3D82A 4IEYA 2G7HA 3HRMA 4XFHA 3IRQA 1MKMA 2UY9A 1FP1D 3ELKA 1GQGA 3H3ZA 2MC3A 5ILUA 5EEGA 2W84A 1KYWA 1YG2A 1HXDA 1O4TA 3CUQB 4M6YA 1FY7A 2VONA 1R23A 1ZREA 4MH0E 2D93A 3H1YA 1GVJA 1KU7A 1FP2A 1B6AA 1FZPB 5FDBA 1JUHA 2B8MA 3E6BA 1ZG5A 4O3MA 2Q0OA 1XCBA 4EGYA 1HW5A 1RI7A 3VODA 1WSUA 1HSJA 1IAWA 3H3UA 2P7VB 1ZRDA 4CGZA 1WI9A 4UHTA 3D0SA 2KIUA 3HOSA 3KP2A 4Q0SA 1XDSA 1XSVA 2D1HA 2PLYA 3K1PA 4KL1A 4IRGA 3BJOA 1WQ2A 1D3YA 2MH2A 4BHBA 3WTSC 5L3BA 2ADUA 5DD4A 3MPBA 1Y3TA 3TO7A 1NYWA 3EWKA 2XAHA 4B09A 2PEXA 4G9YA 2PMHA 3PVBB 1SFEA 2PMUA 3JAMZ 4UUVA 2TDXA 4QGLA 1MJAA 4QGMA 4Y17A 1XSXA 3RKXA 3ECOA 2HTSA 2GXGA 3V7RA 1RC6A 3Q5FA 3EJKA 1S7OA 3FXUA 1BIAA 4K2EA 4LLNA 4EJVA 1X8MA 2P5KA 1BOAA 3C18A 4OIQF 4PIXA
chains in the Genus database with same CATH superfamily
4E2SA 1VBC2 1SQBG 1IQDC 4GJZA 3PVEA 3OBRA 1B35A 2GMMA 1GL2A 1ODNA 3AYEA 4GMP3 1KU2A 4A45A 5GZCA 3QPSA 3S1QJ 4FPHA 1W3VA 2R5YB 3HSFA 3TGUG 4IL6E 1XGSA 2FYNC 1PMIA 4M3GA 2IP2A 1YQ6A 5A7WB 4AHYA 3EQEA 1DQ5A 2OARA 1B9NA 2KIFA 1FXZA 2YROA 5FMBA 1YQ3C 4W8JA 1J84A 4RS8A 5BNNB 4YW7A 2N9BA 1RUC1 1YE9A 3E6MA 4R4ZA 1R1TA 5F6LB 5A3UA 4NIAA 1H89C 2TBVA 3H6PA 4E70A 3KPHA 5KVRA 3HD7B 3CEWA 1IF1A 4HDUA 1D0ZA 1YIPA 2HJIA 4A41A 5IK5A 3CLPA 4GWIA 3MBWA 1O3SA 4NIDA 2A6EF 4CYCA 3I3LA 4QX3A 5FWJA 1LTSC 2QQNA 4PFPA 1QHGA 4EV0A 5H9RA 4BMBA 3KGZA 3J7AO 1ND2A 3FXKA 1AYM3 1UOBA 4AIJA 5BNPB 3U07A 2PAEA 1YOVB 2LKPA 3HUSA 1V6KA 2L5GB 1FOWA 2ECBA 2JVHA 4GA9A 1HV0A 4YGEA 2HXIA 1YQ8A 5A70A 2UWAA 4A6SA 4XLNF 3E6DA 3D6YA 1AA0A 4AQTA 3BODA 4NHJA 2KLUA 1SZBA 1IN5A 1O4YA 2OQRA 1JZ3A 2PBIA 3ZQ7A 1W2UA 3M1HA 1VNDA 4IHTA 3IDAA 2Y38A 1JI8A 2MW8A 2QNKA 4IDZA 1W9FA 4ASNA 2B0LA 4FP3A 4ES8A 1SLLA 5CNAA 3GCWA 4QU2A 2QLZA 3V65A 1VQNP 3DEMA 3G2BA 1JE8A 4E7HA 1COV2 2X09A 1DFQA 1KJRA 2QZ8A 4BLIA 5J3LA 3GZ6A 3GF6A 2ZGQA 2W48A 4RHV2 3W2VA 3F21A 5C44J 1PK6B 2FFDA 1YYCA 5DUVA 4LEJA 1F2NA 2JA2A 1JOCA 1HSTA 4FFHA 2DCYA 1G9AA 1LTJA 3IKTA 2EFNA 4IVNA 3LWCA 2XU6A 4MEXF 1GR3A 4XDQA 3PUSA 4Q4V1 4NPMA 1X4PA 4YLZA 3VBHA 1ZX5A 1LOGA 3GTLJ 2LNBA 3NWSA 2MJZA 3POJA 3HPHA 5LHHA 1BL0A 3K46A 2VTFA 1W5TA 4S2HA 1VBD1 6PAXA 2E42A 1HRV3 2M45A 1WZ2A 4HMZA 1E0EA 5JZGB 2R0QC 1L2PA 1ETWA 4AGVA 4TLFA 1M57D 3DTIA 4D7TA 3KETA 3L37A 1X8YA 1MUUA 5TJHA 4CDXC 4X8PA 2WNUB 2XJVA 1QU0A 1WA6X 4QKBA 2WNVA 5IFPA 3K3NA 2RS11 2R043 3RNSA 3JQWA 3AFGA 1LE8B 5K5QA 1WW4A 2AEMA 4XRSA 4A7PA 4CCJA 4LB5A 3VFZA 5A7NA 5C3OA 2ESNA 2GIVA 2RM22 5EYYA 1H9TA 1LHVA 1TMF2 3K4LA 3PUHA 1ZG1A 5FP7A 4G8XA 4K6BA 4FE7A 5BYNA 1ZYBA 2VUAA 3M4OJ 1NCRA 2R7ZJ 1V6NA 1W36D 3A5TA 2Z69A 1EDIA 4JGZA 3W3CA 3RKYA 1T08B 1OLTA 3GZEA 3MF6A 3S8PA 1YUDA 2BV4A 1NWQA 2X10A 4JHTA 1QXPA 4ZHNA 2P58A 3VZOA 4RB2C 1SVFA 1DP0A 3KP4A 1V6LA 1LFPA 2HNHA 5FPZA 1NHLA 2Z9OA 2OPTA 1N1SA 2VULA 1AL21 4XMYA 1KB9E 4FFGA 5FZGA 1CAXA 2P10A 3AE3C 1HRI1 4B86A 4I01A 2BRTA 3H1MA 4UBGA 4DXTA 1QL1A 3MEPA 2AREA 2IS2A 2P4WA 4JHZA 2VQTA 3OCPA 3VBRC 4UB6H 1LJ2A 2J7MA 3ROUA 2AACA 3PTZA 1HDKA 1ULEA 1SQQJ 5DS9A 5L73A 4JKKA 1XSDA 4M71A 1YW8A 2WFF1 1IW7F 2ZFUA 1DYPA 3LW5J 2CG4A 2CV1A 2F2EA 3A0HE 2JA5J 2EAKA 2HWD3 5FYYA 2EXIA 1Y6IA 1YFYA 4LBNA 1WJEA 4M4PA 2ZXQA 4AHZA 1LAJA 4IEPA 1IXSB 2M0MA 4P9IA 5FPBA 4XR6A 1SPPA 1SBDA 2NZ2A 1TME3 1F4AA 4LHLA 3RZGA 3Q8BA 1YFWA 2WAEA 1AR82 1MJ9A 2FY8A 3K5BA 3BR2A 3O0XA 4CA9A 1RUE1 3CPWO 3V7CA 3G73A 2W27A 2X48A 3H1CA 5F39A 1W6MB 3LQCA 2WT1A 4Z6YA 2DYRH 5D2AA 3IAM2 4JGYB 3HTSB 1AR72 4C3JJ 2FRHA 4GZ9A 1ZK8A 2IDBA 4LLLA 1JJ6C 1NG6A 4XKBA 5E8AA 4IW3A 2NVUB 2ZCWA 1S9KD 2UWBA 1ZGAA 1QJY3 3QAHA 3THTA 4GRIA 1VBC1 1O6UA 1TG7A 2D6PA 4KIBA 1LOFC 4R4MA 3GM8A 3L00A 4BAYA 3L4FA 1DP3A 4P14A 3CCMP 3UKVA 4CCLA 1K5JA 3I97A 3J7AY 2FXMA 2JDPA 1L0LJ 3RRDA 1UYXA 3FUOA 3WHUA 2FCVA 1L4AB 2WWUA 1FBUA 2UZKA 4H0EA 4UUSA 2XLGA 1ETQA 2CUJA 1VBA3 3WF3A 1Z3YA 1JOPA 1XDUA 1HJFA 3HXLA 1WJFA 4BXUA 4AI1A 1FOSE 1JZ7A 3CO7C 2O0OA 1QVUA 4O9BA 4L5JA 1ZLKA 3T1BA 2MGQA 5CFDA 5EYRA 2Y30A 3CUOA 2BNOA 4G94A 2H0VA 4LBJA 4PLOA 2M7BA 4PBOA 3DPLC 1MBEA 2NQYA 4LITA 1LNQA 4PJLA 4YG2F 3WMM0 3M3CA 3FISA 1ZQ3P 1IQAA 3H9QA 1K42A 1X3WB 1JGSA 2XL7A 2K37A 2X85A 1QF3A 4HVOA 2JDAA 1W5CE 4AHXA 1BM9A 3EYYA 1I9RA 2XIGA 2AXTH 1OW8A 5JPMB 5APQA 3ES1A 2VMGA 3TL4X 3MW3A 1TVGA 3AC0A 2V1DA 4ESJA 4HW0A 3DCFA 1SDDB 1BSNA 3VP9A 2HQ5A 1IK7A 4JYKA 1FIPA 4XFCA 1AR92 1AHDP 3BT9A 1STMA 3NKTA 3I54A 4TN7A 1MR5A 1W6OA 1QVTA 4KI5M 5FRAA 4FPGA 2V5DA 1WHUA 1DUXC 3I53A 3LSDA 5C4WB 5LHIA 1MV8A 2VZUA 1COV1 2H0BA 2IBZI 5GPAA 2MLGA 4QPGA 4H13B 4CXFA 2V4VA 4I3PA 3Q9SA 3QU6A 4RHV1 4RM3A 1BCCE 1A31A 1RMU3 1ZW0A 3F6OA 2DDUA 2VNRA 4Y4YA 3F22A 4Y26A 1YYNA 4OIRF 1MMNA 3ZKYA 3ZQHA 3KD4A 1UY3A 4UNOA 1TU3F 5GLWA 1WKMA 2A75A 3ZXGA 3QPHA 1S5LX 3KVBA 1WWXA 4FQ4A 3SEEA 3RK3C 2LC2A 2F48A 4L9JA 1UX7A 2GP5A 3VYIA 4H3WA 3VHPA 2BVLA 3BPXA 1D4M3 4XJUA 4U0YA 3U78A 3FLPA 2YNYA 1UJ8A 1IXCA 3VSKA 3M3EA 2AQEA 2HWD2 1KILB 1Z77A 1XNTA 5F08A 2B45X 1ZP0C 3RYKA 3ZFGA 1ZN5A 1R093 4B3XA 3G6EI 2HWE3 1K5MA 1KQRA 1K45A 4X8NA 4I0AA 2JR8A 1SVLA 4DUXA 2LRDA 1TME2 4EJTA 4MGYE 1KD7A 5ED4A 3VKMA 1OUXA 3CC2P 4CA0A 3ZR5A 3KLNA 2Z4FA 1HB3A 2ZO4A 4Y52J 1N7SC 2RM21 2CH0A 5KLVJ 1DGRN 4NPDA 1TMF1 3U1KA 1Z7S3 5F5AA 5GTIH 4MZUA 4RGUA 4YVSB 5HS9A 1D8JA 4DINB 1OWAA 2YU3A 2VMCA 3ZSKA 3U4SA 2IX7C 1HX6A 3N9NA 4PV1D 3L70G 1JU3A 3VL8A 4AFDA 3WDYA 3ZPLA 2E5NA 3Q1MA 3L2QA 2EWNA 5AW7B 1LOEA 3PLNA 1YJWI 3GTGJ 2R92J 1QJY2 2VUDA 1QJU2 3LDRA 1W7PB 3DFGA 2XB6C 1N75A 1K79A 1N77A 4CU7A 3POEA 5FR3A 3KZIC 1SQQD 1LNSA 4RGXA 3GZNB 1G2HA 1CAUB 4B3AA 3L9FA 4PLNA 3M70A 2Y2ZA 2VCCA 5F7UA 4H0LB 5H6RA 1GZTA 2M5AB 4JF7A 4I76A 4NAMA 5ANQA 5EJZB 2JJLA 3Q0WA 5B66C 2E7XA 1LEDA 1FOYA 1W1WE 1SEUA 4P9YA 3DKWA 1GW4A 1JW6A 2OKXA 3ZP5A 5IVJA 1FNNA 5ISLA 4JRAA 2YO3A 2OXBA 3ZFEC 3T5XA 1LGCA 4S2FA 1S2KA 5AW2B 2Q2EB 1E5WA 1X36A 3TSIA 3KYCB 3PTYA 2RR12 1UKGA 1ZZ9A 5FFOC 3V64A 3UT0A 1SAUA 1RUI2 2WSVA 3KF3A 4IQPA 2NXNB 3OSGA 4KT0J 4BL0B 1ZN2A 5BS6A 5JR3A 1C8NA 1LU2A 3CCEP 5FXVA 2DTZA 1NOHA 4P08A 3QD6A 4PD4H 1TW2A 1R4NB 5JAXA 1TNFA 1USDA 1YBKA 4FP2A 2IPPA 3GFJA 1Y1VJ 1V9U3 3LL7A 3RL0D 5LCWL 4V19K 2RE9A 2ZAEB 1W0TA 2AEYA 5AIQA 4JDOA 1IKPA 3GO5A 4CE8A 2EVXA 4J19A 1OPCA 3AKPA 2VZTA 3K51A 2HPIA 4RR3A 3TAYA 1HC8A 3D5OA 4OI4A 3WEZA 2A07F 4MIMA 3WGGA 2PP6A 1L0LD 3S3MA 1AR81 1RYYA 2BVBA 1UD1A 3RSJA 4CSWA 1GZLA 1B35C 1GL2C 5E79E 4LLOA 3DBRB 2VOVA 4A7KA 1BE3J 2DVAA 2OZUA 2DU9A 2WAQN 4B4PA 1AR71 4QPWA 1Y0NA 1PGW2 1XNCA 3CMGA 5E1WA 3HQXA 2P81A 2VMDA 1N73A 3SH5A 4PJ0E 1S8NA 1LHNA 3U1DA 2VMFA 1B72B 4Y22B 1V6IA 4HB1A 3K2AA 4XJAA 3DPRA 1GZ9A 3GEZA 4CRQA 4KHXA 5AONA 1NJIQ 4CCCA 3CMEI 4HSTA 1X33A 4HETA 4CVUA 3ILRA 1SD5A 2M7AA 1EH7A 2PHUA 1LOAA 1FJPA 5K7ZA 2OC6A 5JIUA 3MPPG 2K7LA 1OXCA 2PJRB 1POGA 5ICEA 2B87B 1EYBA 4GD4A 3ZXSA 3Q8FA 3P7KA 1F4KA 3U11A 1UF2C 3VBFA 2QVSB 3N35A 3ZN4A 5GZGA 3S9OA 1EUUA 1A5JA 3TEDA 1WJ5A 1ND2C 2E32A 3LFKA 1BGYG 1IKQA 1FOSF 3HUSC 2ERFA 1LVKA 2RDPA 3ZMTA 1KGYA 1R092 3O1VA 1IN6A 4HVRA 3WQ7A 2LTPA 3JCUC 1CAWA 2J59M 3KXDA 3PTRB 4J6GA 1M7LA 2NN8A 2QTWB 1JTXA 2Y75A 3IRRA 1TTYA 2J1TA 3ABVC 4DJGA 1DGRA 3CLOA 2WO2A 3JRAA 3J7MA 1W6QB 1Q81Q 5JMCA 5EEAA 4LOSA 4DW6A 2CWEA 3ATGA 2ELHA 1PPJG 2IZWA 1AOYA 3D8CA 1NY72 2JG8A 1Z7S2 2OIIA 2FHRA 1PNFA 1QOSA 1LWUB 4UVBA 4C90A 2D1VA 2LYCA 5FKMA 4BXXJ 1RR7A 1SQVJ 4DUVA 1MZ5A 3G1MA 3EFFK 2CO5A 2K3FA 1ENRA 2ZMLA 2P2UA 3F8FA 1KQ8A 5L3EA 2LR2A 2MC4A 4WM7B 2JRMA 1AR91 1RF1B 4N9HA 5FQ0A 1U0AA 5D8AA 2FFDC 4BQOA 4YZ4A 4QXKA 4AWDA 1LTAC 3ZMVA 1SQPJ 1Q8PA 1XGOA 4PLMA 5A1AA 2Y9YA 3BTJA 3H1LE 1OYIA 3V7SA 2WWJA 1LTJC 4CYDA 3FXQA 2PRRA 5FYSA 1PO12 2KP8A 1XTAA 2VVEA 1KDMA 4YVWB 1IRGA 4ZH4F 2VASA 4HVQA 3VBHC 4V2GA 2O14A 2XGXA 4ON0A 3LDKA 4U3FE 1ENSA 3HE4A 1R083 1URQB 4KNCA 2FMDA 4Z82A 1YIOA 4LK0F 2WN2A 5FK7A 5KAIH 3ZDSA 3B5NA 3POBA 1Y8QB 4A3MJ 2GA2A 4YFXF 3OA7A 2C0XA 1D1AA 2QIWA 4ES9A 1EPWA 5GTHC 1HGZA 4N7UA 4M00A 4BRYB 4DNCA 2IXKA 3S1KA 1FLIA 3WTTC 3K4NA 3CXHI 2WNVC 2DYSH 1NX9A 1OI6A 3JU9A 4AVSA 5KLVD 2QJKB 3KWVA 4OMDA 2JP3A 2NS8A 4OINF 4LTAA 1PHMA 2XROA 1XN7A 2TRTA 1W0UA 1ZGWA 2HWD1 4A3XA 2Y26A 3WP4A 2STWA 1Z7UA 4HBNA 1MEC2 1BR4A 1V9U2 4XZUG 4QDSA 2OZ6A 1WW7A 4EI2A 3RYPA 1X3UA 1NH3A 5FV3A 4RAGA 1NCRC 1OMIA 4BACA 3QYEA 2PI0A 5A33A 2VI6A 1CQTA 3F89A 1R00A 4JGZC 3CX5I 1NTKK 2G19A 4M0NA 3TQNA 4Y33A 2OVUA 1WMEA 1TME1 3CWBJ 1H30A 2K4BA 5IYBJ 3R4SA 2VE8A 2NS0A 3WQ1A 1IV8A 4HKLA 1S2BA 2RS32 2IGNA 2EA2A 1QKQA 4G7OF 2VQUA 3H92A 4CP9A 2HI3A 4MSVA 3ZXEA 5DG1A 2P6CA 1EY2A 1GU3A 1OLQA 5CU1A 2G8YA 2WAQA 3S32A 2ZVNB 4GIQA 3CCJP 1AX1A 3C7HA 5A6QA 2GNTA 2PQSA 3QOEA 4BA6A 1R4MB 3CO6C 3SCHA 3LOCA 2HEYF 3TP0A 1QOTA 5E3MA 1YCIA 3GZ5A 4MTEA 4OUEA 1X58A 5FKKA 2K46A 2XL9A 2IS4A 4OVNF 3ZSLA 1GV2A 1QJY1 4HF2A 1US3A 1MMSA 3H32B 1REFA 2M3BA 1IFDA 3AE5C 1QJU1 5FZ7A 4HF0A 3G1LA 4IFDK 3IT8A 4YW1A 3P6BA 1LJ9A 2KI7B 2EJRA 1NH4A 4ENKA 1WA4A 2JB4A 1J1TA 5GZDA 1J09A 3UV9A 2CV2A 3WY6A 2O8OA 3WHBA 2DODA 3K7AJ 3F5HA 2X8KA 2W1SA 4XSZF 1RUH3 2BXZA 4DBRA 4XF4A 3V2RA 3VB2A 4GWJA 2W24A 2D2CB 1PV3A 3WOGA 3COAC 1Z0XA 4LG3A 3WGHA 1SFCB 2W4SA 5GKAC 3ZYRA 2XXZA 3ABZA 5KLIB 3SKVA 3P5JA 1S4XA 2KM2A 1QH6A 1DDLA 1JTZX 3ZMSA 3WNXA 1OQEA 3HN3A 4A3GJ 3T0AA 4XACA 4MN4C 4FTBA 2ME6A 2RR11 3DPTA 4ZYHA 3EUKL 2YUEA 3HNMA 3OY8A 1PP9G 2W08A 2B7EA 1HBWA 1V6JA 1PIXA 2ZEZA 4LOCA 5HCHA 2RJ2A 3T8TA 1RUI1 4A3LJ 3AYCA 4RS5B 3L2VA 2FCUA 2DCKA 2JWAA 3V2QA 3F23A 2KIKA 2PHRA 4JV4A 2COMA 1W39A 3L2HA 1Y9BA 1ENHA 1BE3D 2VUMJ 4CICA 3AEAC 3PNAA 4A3DJ 4LHKA 5E16A 4CZZA 5IK7A 1F9KA 1W90A 3CO2A 4AM3A 3EYPA 5HCAA 2D2WA 4ASKA 3H42B 4CUCA 3L09A 4ASLA 5AVXB 2ZGRA 1SQXE 2FD8A 3DPUA 2XBO3 2QE3A 2DOEA 1MS8A 3C3WA 3G9RA 5AVTB 5BU5A 3WTUC 2G9ZA 3A22A 1VQLP 3LEGA 2QQPA 1S0EA 3D4KA 1K78B 4MQVA 2FYUJ 3ZMOA 1FTZA 2JDIH 3N7MA 1FPN2 5FZCA 2LSOA 2YPRA 3LWFA 1XGNA 4AEKA 2GSYA 1PGW1 1V5GA 3K4JA 2HPMA 2M8GX 4DO0A 1IUYA 2E74C 1MPXA 3GJAA 1QNTA 5DXDA 1YFUA 4PCQA 5FZ8A 4AVAA 2L7MP 1ULFA 3N7JA 4F83A 1YEWA 1HDPA 2WUHA 2B46X 1B4AA 1DLCA 1FMVA 3I64A 3PO2J 3BTYA 4GYGA 2Z2SB 5FZ6A 2OGUA 2O03A 2YX7A 3CL1A 1JZ2A 3QP6A 3S3OA 1SMVA 1H1MA 2Q1MA 2WS93 2WWWA 5C8CB 1LU1A 3OYMA 1OC1A 2CYFA 1S2EA 5CFDC 2H09A 2X5IB 1VQ7P 4UB8E 3A7OA 4P5OA 4H44C 4JKLA 3QACA 2FEZA 1VQ5P 1JMMA 1POV1 3NRUA 5C3QA 1K6YA 1XMXA 1CONA 4HQMA 4AAPA 2YC2A 2SBAA 1FYLA 2YMKA 1YQCA 2OF7A 3BTCA 4P1WA 4N43B 5JVVA 3BCCE 3V0BB 4DS0A 4IV1B 2E53A 2XHKA 4EN0A 1D7MA 1SQVD 1I1SA 1N86A 2GU9A 4NQWA 2NVQJ 4Y20A 2O8XA 1HVVA 3HQUA 2HBUA 2A6WA 1W2EA 5C3EJ 2BJSA 1R091 3POFA 1ENXA 1D5YA 2W46A 4GO1A 1BJAA 3T2TA 5CKMA 3W6JB 3CJTB 1E17A 3RJRA 2DA5A 3FZVA 1SQPD 3GWZA 2P6TA 3OSDA 3WUDA 2DMQA 4COYA 1OH3A 2ZMKA 1SQBE 5E1RA 1YX3A 3QH6A 2ZMEB 1T38A 3MIHA 4GWNA 4N3YB 1NY71 2IFRA 4CUBA 2BXYA 1Z7S1 2P1JA 1NU1K 4YM2A 4EJUA 4LK6A 4ASWA 2ZHLA 4C7NB 1UPSA 1KTMA 1H2LA 5FLXK 4IEOA 2F4MB 3SWYA 1GHCA 3R0JA 5JOZA 3G6JB 3G4SP 4QPGC 1W0PA 2ZJ2A 2YFZA 3ZOIA 2C4XA 4BE3A 3O1UA 2DDBA 1FZCA 1LOCA 2F4IA 1YO8A 4A0XA 2ZB9A 1XU2A 1YJNP 1QH7A 1DQ0A 1N8RQ 1UHSA 3JB8A 3RJ2X 1BVVA 1DGWA 4EM0B 1PO11 4GDOA 1UMZA 1HDDC 1IPJA 2X6XA 5AVSB 5LBBA 3DKQA 4HT1T 3VBOB 3RIRA 4XTPA 5CLSA 2DPDA 1IGOA 1J58A 2E76B 3WU2E 1KQSO 4NO4A 1SD6A 2W95A 2ZX3A 3DKYA 3IN6A 5KAFC 3KQ4B 3AZXA 1PNGA 1QDCA 1SVMA 4FISA 1AX0A 4K3UA 1PUEE 2A6VA 2ZYAA 1MMDA 3CWBD 1D0XA 1U2WA 3NWTA 5L3FA 1K5MC 3CJQB 1I6XA 4M0HA 2PLV3 3PUFA 2HEVF 2RREA 5HBAA 1RR8C 3KHBA 5DQ0A 1SPPB 3T3YA 2DOAA 1CSBA 3RI4A 4HEA2 4META 5J7MA 4CXYA 3CCRI 1ZAOA 2KD7A 1ZLJA 3DCQA 4QB2A 2BOLA 4BIOA 4ZDLA 3GJBA 1MS9A 4PF1A 4CP0A 5I0RA 4LULA 1T6SA 1MEC1 1V9U1 2YUSA 3DWLE 4G12A 3VZMA 1W2AX 1DEBA 5CFCB 1IC2A 3DEEA 3IM0A 2OPKA 3OGVA 1W0OA 1Z56A 2EFOA 2A6XA 4YFWA 2X6OA 1ZBE2 2AZ5A 4D94A 4CHUA 2PELA 3TO9A 1T2XA 2HZTA 4C2MJ 1HKDA 2ACJA 3MFKA 2BVVA 2DFFA 4M6XA 3TBIA 2AXLA 2RS31 5FMCA 2E2IJ 1SQVG 4OIOF 1C5HA 1RXGA 3T09A 5FZ4A 2GMEA 5LA0A 2H1LA 2ES3A 3OJAB 3FXOA 1VQ6I 2G3AA 3PO3J 1HLVA 3J4UH 2B4KA 1T0FA 2VM9A 4BB3A 2JSCA 4HRIA 1QJEA 2B88A 2MHFA 4HK9A 3L73J 3LSMA 2QBYB 4DJAA 5FMOL 3HSEA 2CPSA 1EXJA 1GBGA 1LTBC 2YX4A 1KYOD 4Y28J 3LB9A 1CF7A 5CCGA 3LSTA 2E36A 3SZPA 4LORA 2I2SA 5F5CA 4D8MA 2OU2A 5B5EE 2ZYDA 3WW3A 4LLGF 3K1NA 3I2FA 2VIXA 4JRLA 2E6VA 4EYYQ 3TGNA 4AEDB 1FSEA 3A7QA 1FTTA 4RGRA 2CY6A 1AZDA 4IE4A 1RUOA 3CJIA 4IUGA 4Q0QA 2WS92 5J1YA 5BNOA 2IEKA 1LHWA 2XDVA 4Y3OA 3NV3A 4EJRA 4M3CE 3ZDVA 3HE5A 1K6OA 1AVYA 3ZO0B 1UG2A 1QJX2 3DXTA 2OYOA 2E75B 4H55A 2Y6FA 1MVEA 4K21A 4L8QA 2FDHA 2PMWB 4BDVB 4E6KG 3WUTA 2LALA 4CU9A 4FOYA 1EZVG 2HOEA 1R1VA 2A7AA 1S0DA 4C3HJ 3EDPA 3P9CA 4WVWA 4LMYA 2FYUD 4RR3C 4UFHA 4GDFA 2KPMA 3KM5A 1F8VA 2RNGA 3CNAA 2P4EA 5FREA 3BZCA 5AC92 2QJYC 4QWQA 1C1FA 1REEA 4NRQA 1HB2A 4LGWA 5F37A 2HEOA 4A3JJ 4WX9A 3BZKA 4EVIA 1JUPA 2KOGA 2RQPA 4W7YA 3I49A 2PFBA 3SH4A 4QWNA 2ZHKA 1SCRA 1Z91A 2E63A 3ZN6B 3N7KA 1N73C 4CCOA 1GZWB 1JT0A 1QHHD 1M56D 3SCGA 5HODA 2B42B 2ARBA 4BLJA 3KYDB 3TO6A 3BCBA 3DPRC 5KWRA 3DL3A 5FD6A 3HOBA 1UZWA 3RK3D 2OUMA 4KG8A 1V0AA 3S14J 1R5GA 3JRHA 1D0GA 1FPN1 2V6EA 1JZ8A 2GH8A 1LP1A 5TJJA 1VIWB 3C2BA 3VD7A 2DDAA 3I4MJ 1A6QA 1LB2A 4PDWB 5JPNB 2CAUA 3INAA 4FAGA 5EIYB 3F8NA 3PRJA 1RUD3 1V00A 3V0AA 3LSRA 3O14A 4XLEA 1E5HA 2CQNA 2OA4A 4L75A 5F6FA 3NMDA 3BPZA 1ENQA 2XJQA 1CX4A 3VBFC 1NTZE 5F9TA 4LK1F 2NP0A 1AU7A 2ZX0A 5FO5A 1R8EA 1I27A 4IL6H 1PO23 2WQYC 4KJZA 3BRVB 4AGGA 3PSFA 2R0FA 1HBXG 1ZZ8A 1LRHA 2QQLA 1N7SD 3ZFGB 1Z1DA 4BE1A 5JXIA 3JCIA 5IT3A 1HXS3 1X9VA 4BQ2A 1I39A 4HQEA 4IRHA 2W3JA 5FZHA 3TW7A 3PMSA 3ASOH 3PNYA 2L7ZA 3RZOJ 3CI9A 4XFHA 2UY9A 3A01A 3JD72 4XLHA 3J7LA 5EEGA 1BJZA 4D6SA 2QJPB 1YG2A 2DWRA 2R073 4P9JA 4C91A 1OCTC 2JG8C 2XQXA 3V2NA 1FY7A 1YI7A 1GVJA 1FZAA 4UW6A 5IATA 4WY4B 1B6AA 4OI0A 5ACA2 3AZWA 2B39A 5A3MA 1XTGB 4IGOA 4C30A 4QHOA 5A7QA 3VHNA 5M3FJ 2VCAA 2LK2A 3NFQA 2DT7B 1RI7A 3VODA 3A23A 3DLLF 1WSUA 2CJJA 5EG0B 1HGVA 1H2KA 1IAWA 5D8AC 4P9XA 1WKYA 2FD5A 2ZBJA 1VQOI 2ZT9C 4E27A 4Q0SA 5E3OA 4BK5A 3A1YA 5FO7B 1UN1A 1WQ2A 2HYXA 3HVDA 1BVP1 1UXZA 3ASNH 3NV4A 1BSHA 5A1FA 3MPBA 2JG9B 4JQTA 4GKGA 5IW0A 3H9JA 3H5NA 2BWCA 4G9YA 2PMHA 4PJNA 3BOPA 1SBEA 2TDXA 3B5NC 3OIOA 1CIWA 3Q8AA 3MHZA 2Q9IA 2AXCA 3RKXA 3BUCA 3HJRA 1K73Q 1D1CA 2E31A 4CDUB 5IAVA 1NQDA 1RC6A 3Q5FA 2WADA 2NRGA 3USUA 5KXCA 2ZEXA 2ZGMA 5DZGA 2X1EA 3MMYB 2HOTA 3C18A 1BOAA 3WHCA 4HNUA 3PHLA 1WRGA 3M3IA 2R7VA 1VR3A 3GLXA 2D98A 3W67A 4BWNA 4HH2A 2W5FA 5LGNA 2E1NA 1GL2D 5IP6A 2LBFB 4A3IJ 2JUGA 4M73A 1XNDA 3ZOBA 2IBZD 4B48A 2L9RA 4AUWA 1OKOA 4XKWA 1WLTA 1IS3A 2GLOA 5GPCA 1GU5A 5JSRA 4BISA 3TYYA 2KRFA 1NXD1 4Q4X3 3OGRA 1O91A 3L73D 3KVAA 4XRFA 3KP6A 3ZXLA 4CZSA 4XQDA 5B2GB 1NKNA 3NTNA 5F3CA 2OTJI 1JKRC 4MOAA 4A6OA 3GTKJ 1OLMA 4XL9A 1C8M3 3CUQA 2YGLA 2BBVA 2ORZA 1ZBE1 2QQ9A 4OULA 5FZBA 2J1AA 3E7KA 2ZJPF 1NTMJ 3NV2A 2Y64A 4COWA 5KHKA 2WZR3 5FY8A 1Z3XA 1GOHA 4MO3M 4WBAA 3WUCA 5EPAA 5J37A 4OI1A 4AZZA 1V6MA 1CWPA 1CI6B 1H0TB 1UPIA 3IF4A 1NQJA 4Y4RA 4F7ZA 2D6OX 4CUAA 1IPSA 2V9PA 4E4ZA 3LSJA 3ZMNA 3C8XA 2SPZA 3IKWA 4XOTA 3J7NA 1HJ0A 2ZHNA 2OYHB 2A06E 4RGGA 5E18F 2Y0DA 1JY2O 1BHGA 2F5VA 5B3SH 1YJ9I 5BPIA 3CD6I 3JREA 5D4RA 1IJDB 2W82A 3KQRA 3HN1A 2DFBA 2FCTA 2WZPP 4FQZA 2JA8J 2PJPA 1D5VA 2WNEA 1Z21A 3MIDA 3NAPB 2WS91 1ZH5A 5TRDA 3GXOA 3AEGC 4GOEA 1R64A 1UHMA 1U5YA 1KB9H 4W7ZA 1PZ9A 4UUTA 1SQ4A 2VZ3A 1R58A 1U9OA 1HXS2 4QQHA 3OPZA 5CVRA 1QJX1 1G2CB 1A02F 1WMDA 2UWCA 1S0GA 3S16J 2JDYA 1NHAA 1JI6A 2B63J 2E71A 3GBWA 1I3AA 3VZKA 5FXWA 4ETSA 3AVRA 1PVC3 2AUYA 2VZVA 1NZIA 4E7IA 1WVRA 2KIQA 2P17A 4I6ZA 5M0TA 2R072 4RGKA 2JICA 4XBNA 1YHFA 4XJZA 2UWJE 3L70E 3H1KE 2XG3A 2FOWA 2HS5A 1VFCA 3A0HH 1YI9A 1V5EA 2R5YA 3TDZC 1HF0A 5AC91 2VVDA 1FU1A 2O1JA 2CL2A 3LFMA 2F5FA 3F8CA 3QLQA 1G59A 2DUOA 1JOBA 2YFUA 2E51A 3PUQA 3K4CA 1EF4A 3O0WA 5A7WA 4XUOA 4CCDA 3VDDB 5CG9A 5JLWA 3Q5RA 2M5WA 4WK8F 1SACA 2KYVA 4TT3H 2F4LA 3HRUA 3QODA 3GDBA 5BNNA 5CPRB 2RDQA 4MFEA 2BBYA 3UJOA 2BY2A 4N78E 1Q1VA 2XAJA 4PSXA 2K27A 1QBJA 2D5FA 1JY2P 2E7AA 3VZLA 5A32B 1W8OA 3F6VA 3HD7A 5A1LA 2YS9A 5K5GB 5FZKA 1CAVB 1BW6A 5JLXA 2HDCA 1YI2P 4GXOA 2JJ7A 4UVCA 2AEFA 2VTXA 4FPCA 3KT4A 2JPBA 3BTLA 2JDUA 4OMYA 5DG2A 5C7GA 1J3PA 1YTZI 4QIWN 4QXCA 5FFXA 2BTVC 4ANJA 4KWLA 5BNPA 2X1DA 4DIQA 4A0ZA 3A0NA 5DJUB 3FX3A 2RS53 3NNFA 2KJBA 1NK3P 4AVTA 5GM0A 2Y33A 2W8ZA 1GLNA 4II2A 3H36A 2QE7H 3FMSA 2V1UA 1MH4A 1O4ZA 3WT3A 2XPUA 4B1RA 2FBWC 1PZQA 4FOVA 3ZSEA 2OZJA 1AWCA 1RE3A 1BBT2 1F15A 2VW2A 3FHQA 1YO5C 1PM4A 1EDKA 3LAGA 2K3RA 1BW5A 1TBXA 4LGDE 1J1DC 4F8AA 2A3XA 1QGPA 4CDQB 3OD4A 4BBRJ 4J00A 1CJDA 3PJYA 2IVJA 2DCTA 3LSGA 2VOPA 2XF5A 2DK5A 2WLPA 3G6EP 1YLLA 1IN7A 4IGPA 2JE8A 5GAHJ 5IOZA 3JD71 3WE3A 3MKLA 1DX7A 1KXGA 1TNRA 3FXLA 4AYUA 1H8TB 2DQLA 5APYA 2HWVA 1Y8AA 2NNYA 2X0LA 4EN7B 1PK6A 3HWJA 1AL0G 1OCPA 2ZS6B 3NJVA 2XVKA 1WRJA 2A6HF 4RB0A 2WVRA 2NPSA 2ZHMA 2ZSIB 3KCCA 5ACA1 1C8M2 2WO7A 4JOMA 2ZKLA 1MBKA 4JX6A 3O12A 4CPBA 1N7LA 4L76A 2VBDA 2K0GA 4WVVA 3VKOA 2P3IA 4HXCA 3JSOA 3KPEA 1OCRH 1Y8RB 4G7ZF 2DVDA 2VZPA 1FZCC 2XJRA 3NO8A 1IJWC 2A68F 2DT6A 4EN9B 1YJWP 2I1JA 2VW0A 5LASA 1ZBA3 1OLME 2EBIA 5CKTA 1UMIA 3LE0A 1JHJA 1H2MA 2YU1A 4OZOA 1QJFA 1FT9A 3AL6A 1SP4A 2QEXP 2Z33A 5JZGA 1JXSA 3NNLA 1SAXA 3L71J 2D45A 3ZN0A 2QQAA 1ZRFA 2W6BA 4NPFX 3N4XA 3I2KA 2WNUA 1FC3A 5GZFA 2YO2A 2VQ0A 3LKJA 1RUJ3 4KA4A 3C7GA 2NRAC 4PIZA 2DMTA 1LE8A 4QT6A 1QNWA 1J83A 5AFEA 1ZYRF 2YDEA 1XE7A 4UB6C 1IDYA 4L97A 3TEWA 2CUFA 2VB6A 1VQ9P 1Q5OA 4IZZA 2KJCA 5IFTA 1OISA 1NA1B 2Z4EA 2LS6A 3E5UA 1NOVA 4PK4A 1V4RA 3FL7A 4LJHA 1MMGA 2M8RA 4CXWA 1AQ5A 1NZCA 1KA8A 2XGDA 5A3TA 1WCMJ 1PFIA 4XRSG 1OQ1A 1DGWX 2QM8A 3DLAA 3TKYA 4LA2A 1BA5A 2E1MC 2D44A 2A05A 1YXWA 3IPVB 1NTMD 4DZPA 3CZJA 4A3EJ 2KXLA 1GVDA 3Q3SA 4QX5A 3KMHA 1Q1HA 5GADJ 2J22A 2E74D 3AKRA 3NQOA 5DAXA 1XC5A 3P8CD 4LE4A 4YSFA 5FPUA 3BLYA 2V4HA 4COZA 3JAMK 1S0IA 1MZFA 4AEMA 2FF4A 2ZXEB 1WJBA 4IERA 4K9SA 3DBHB 1T0FC 1H9PA 3ABKH 3KEOA 1S0BA 3OPWA 1BCCG 3WW4A 5HPOA 3L74E 1PGQA 3CXHD 4WM8B 5CCGC 3AXDA 4NROA 3RQIA 4M4RA 2Z1DA 1O3QA 2LRPA 4H44D 4M3CB 4AVPA 4RGAA 5L7OB 2L9VA 1VE0A 2C24A 2CU7A 3A02A 3CJIC 3E3VA 1VDFA 2L2OA 5HDKA 1X1CA 2WSEJ 1VMFA 3GZTB 1VRBA 5BNOC 2JMWA 2DA2A 3OUHA 1S1CX 3CMEP 3OBAA 1U8RA 4MUVA 3GCXA 3ZLIA 3OBZA 4P00B 4QKDA 5BOXA 1BIBA 1W28A 2O1QA 3AP4A 1DHKB 3VEPA 1LGHB 4GH4B 4A42A 2WO3A 2XPVA 1IN8A 5KHHA 1ONAA 2V72A 3BTXA 5CQEA 1OVPA 4O9GA 4MTDA 1SQXJ 1W6MA 2XAQA 3IFMA 4TSVA 3M9BA 1JYXA 5APAA 1HXS1 2ZTNA 1X4OA 4JGYA 5LHGA 1WD3A 2E2JJ 2VZ1A 3EFGA 4DXSA 1EPZA 1U5TB 2ATFA 2ZJSE 1WW6A 2N7GA 3CIHA 4CEWA 2PTMA 3AE6C 1FAVA 4D6TJ 4D5FA 4DCKA 3OYWB 2YC0A 2VNVA 1FJKA 3JR9A 1FBSA 1JT6A 3I5UA 5DAPA 1LTGC 2VCBA 4I99C 3DGTA 1C28A 3GYHX 3OV8A 3VN4A 3GTOJ 2R071 2IUWA 4LLFA 1NAYA 4BPZA 2QA4I 3I4IA 1TNTA 1AYN2 1RUC3 4ZXEA 2AXTC 5A6ZA 2JRTA 1XGMA 2R6QA 2LM3A 1L4AA 3OGGA 4RYDA 1GNYA 2JWDA 2V5YA 5E1XA 3W20A 1AJKA 3AYAA 3JTGA 1ZBA2 3BTAA 2L0KA 3FWEA 1L0NJ 2HOAA 1H0MA 2GXAA 5KHGA 3M7AA 4KG0A 2VXJA 3FBIB 5E8GA 1XPXA 3HM5A 3RI8A 5E79H 1O8PA 3ZFFB 1X22A 4DPNA 1P84D 4FTEA 2CGPA 4R8HA 2VNGA 4BQAA 4PJ0H 3A0KA 2XAFA 1RUJ2 2J42A 4HLTA 4CO8A 5LY1A 1WGXA 4OCTA 4MGIE 3KV5A 1JH5A 4LA3A 4PF5A 3HZJA 4QPQA 2KZGA 1OA4A 2WY7Q 2WBKA 1TQMA 3NW4A 2PAMA 3GLMA 3KYLA 2RJKA 2XJTA 4EZHA 5HLTA 4BWOA 1OYWA 5BVZA 1HV1A 2EXJA 1B1BA 1AHSA 3HHHA 1SLTA 2V09A 1UWWA 4C7RA 3HOVJ 1SQBJ 3CL3D 3H1JE 4L73A 3GUDA 3ECQA 1WT6A 2J5PA 5JFRA 5CVUA 3E7LA 3F8BA 1CZVA 5GAGJ 3RWNA 1BBT1 4JK1X 1W2OA 2WYSA 3PL8A 4P9LA 3FMQA 3VUOA 2ELJA 1JNMA 3TGUJ 3LCPA 1QJZA 3FM5A 3O8GA 2PFXA 4EYUA 5FTTC 3AEDC 3C9IA 5C4WA 2Q8EA 4OGQC 1HWTC 4IEWA 5FYIA 5SV8A 3DYOA 1WJAA 4MV2A 1ITYA 3WV6A 1ETOA 4Q4V3 2RNJA 2A69F 2LY2A 4AVBA 2ZX4A 4BQXA 3L71D 2WSUA 2W00A 2GA1A 5I91A 5AVUB 3J81K 1X1DA 3BR5A 5GTIC 5EGOB 4DYCA 3ZM8A 2IXLA 1C8M1 1G9FA 1OW6A 5L3GA 4MADA 2YMZA 1WBFA 3SZTA 2ARXA 1HA8A 3Q9OA 1K8AQ 1YTZT 1OPMA 1VJ2A 2QSFX 2XHNA 3CESA 1FPQA 2R3SA 3USSA 1N1YA 5DUWA 5IVEA 1G9DA 2WWYA 4BBSJ 3CJIB 4RLQA 1T8ZA 4HA8A 2JA6J 3OS2A 1SFNA 4U7BA 2P5VA 2XF7A 2GMPA 2VC0A 1KILA 5BU8B 4TWTA 3FM3A 3SFIA 2MG4A 3OJBA 1Q3EA 2JKXA 4OHZA 3PVOA 1WH7A 2ZA9A 1XS9A 2UYAA 2L01A 4E7ZA 2DA1A 2IZ0A 3BN6A 2AR6A 2CUZA 1SLAA 1JUMA 5KKZC 5BUVA 4XW3A 5IYDJ 4HKWA 5FYHA 5C3PA 4QXBA 4GODA 3L72E 3UESA 3U21A 4RN5A 2NOGA 2DFCA 4A7YA 3HNYM 3L7WA 5FP8A 4YVSA 1KS5A 3IDCB 4N53B 1JEKA 4I7ZC 3OEAA 3AMMA 1KN7A 4IKFA 1AL23 1UY2A 1ND3B 4NVPA 4HK8A 3BALA 4Q48A 1HRI3 1W7PA 4A5NA 1NLRA 5H2FE 2A6YA 2Q1ZB 3RMXA 4B8XA 4I2OA 1VQ4I 1CAUA 4IEVA 5KHDA 4TYSA 3CUQC 3H1LG 1HOMA 5F3IA 4XAAA 2M4GA 1UIIA 3IAS2 2Y8KA 3NNMA 2M5AA 4KMFA 4D3WA 4F93B 4IOAF 3U14A 4JYBA 5EFWB 1Y4WA 2JDNA 1QQP2 4HLXA 1F5TA 4U3FG 3OUIA 4PCRA 1FX7A 1R5HA 2XAGA 1OCZH 5IYCJ 1A02J 2A45H 1TWAJ 2Q2EA 4LBKA 4ZZDA 3K4DA 1F43A 2Z5WA 5AIPA 3SFZA 4AHWA 3OL4A 1VF5B 1HJBA 1W6NB 3CCSI 3P3PA 3VD3A 2R7QA 4FAHA 4FXKB 3JSPA 1SQXD 1PX3A 1QXRA 5J8FA 2IT0A 2JE7A 4U0WA 5IVVA 4OU0A 1IV6A 1RUE3 1SVOA 3H35A 3O1MA 2E35A 3LOIA 5GP9A 3C1DA 5KXBA 1FYMA 4D6TD 1UIJA 5FB2A 5LD2C 5J6XA 2YY1A 1UU5A 2DCZA 2ZMNA 2OV7A 3SEZA 4IO9F 4OWRB 4QPYA 4CCEA 4W50A 3ASIA 4P5YA 2POHA 5J4VA 2JDMA 2P37A 1OHFA 4CEYB 1VBC3 4HX7A 5F0FA 5J8CA 5LK7B 5JIAA 3EPZA 3MW2A 4KFCA 2YIUB 2DAOA 2ZT9D 2LY9A 3CCUI 3TWIA 3WTXC 2FZ2A 2Z5HA 2CDOA 3VMXA 1PYVA 3OYKA 2XJUA 2WSEH 3MZ8A 1JYTA 4L0PA 1L0ND 1DQ2A 1JYVA 1B72A 4GYIA 2ZABA 4Y22A 1IS4A 3B00A 3WUVA 4RD7A 3LEKA 4XORA 1HW1A 4LO6B 4O65A 2GP3A 4UV9A 3RKWA 5KBFA 2ENRA 2DU0A 3UGHA 2XB5A 2N1TB 2JKBA 2VO5A 4DZOA 3B5ND 3R60A 1AYN1 2GNDA 2XGEA 5BNNC 2EXHA 3WNMA 1G8XA 1G1JA 4AD9A 2EA7A 2XLAA 1ERDA 2GBYA 1NTZJ 4FCYA 3HD7C 2PJRA 5FP4A 1W8FA 5DTDA 4UW3A 2B87A 3H3VK 1TZLA 2D43A 1A36A 4BOWA 3AG2H 1SFPA 1ZBA1 4GAZA 2R0HA 1SQBD 2E5ZA 2XKMA 4XFAA 5BNPC 1NTKE 2DPUA 3THPA 1X2MA 3BQYA 1J1EB 2OQQA 2Q8OA 4F3JA 4XICA 1HQWA 1NK2P 3DU5A 3DEUA 3TGUD 3WX5A 2RC4A 2Z3YA 1R5SA 1RUJ1 2M8EA 5APUA 2ZKNA 1X1AA 5KAIC 1BLZA 3I2JA 2DQRA 1RE3C 3E0JB 3BJ6A 1KILE 1V70A 4E2QA 3WW2A 2ZGOA 3VL9A 3HOXJ 4A5MA 5BV6A 1W6QA 3AG1H 2CQXA 4IHVA 4WVZA 1LTEA 2C1FA 2VKVA 4RQPB 5C3RA 3MFAA 5IK8A 2BY0A 4UFJA 1LWUA 3LGRA 1KDKA 3WINE 3FKIJ 1SQXG 5EZHA 4ASMB 3DTEA 2VU9A 1MS4A 5B4XA 3AKZA 2P3JA 1WJDA 4UB8H 3BG6A 4E4HA 2KXPB 2YKPA 4HZFA 4RHV3 4WM7A 3CCRP 1FC2C 1RF1A 2W9XA 5KNLA 1UHWA 1PK6C 3S0MA 1BXHA 1DH3A 2IA0A 4XE5B 4OH8B 3B94A 2HQRA 5FLJA 5DUXA 4EZ4A 1GYKA 4GKXA 4OUSA 3ZQLA 3WNKA 2N9YB 1XNKA 3NSTA 3CF2A 1XRUA 3A2KA 1X7NA 4H7LA 3MD0A 2XVGA 1GOFA 2YC4A 3HNBM 4YVWA 5M5WJ 4MGKE 4FCAA 5FYMA 3REOA 4C9YA 4HV6A 3VBUB 3GHMA 1URQA 5JOXA 1O7LA 4AVCA 4W1UA 3M9AA 4JQ0D 3PLQA 2GC0A 2M87A 1JCDA 1VQ6P 4TXWA 5JZGC 2EXKA 2A73B 3GF7A 3MLKA 2FA5A 2AQFA 2Q5UA 2PHTA 4BRYA 4RAFA 3HR9A 3D0JA 2HOSA 1NLQA 2QQUA 3HBKA 2WNUC 3Q0VA 2QM3A 3HOTA 4Y7NJ 1JY3O 3VYTB 2VKDA 4HN1A 2HWF2 3BCCG 5J40A 4UF0B 4YZ5A 1LT1A 2RM23 2CS3A 5LA2A 4PJYA 1QDOA 4MO7A 3RPQA 5FUNA 3S30A 1Y56A 3Q9VA 1RIRA 4NPRA 4CTEA 5FLVA 4RESB 3I71A 4IEZA 3MYXA 2C6SA 3BKZA 4OLLA 1XB9A 2L54A 3S7IA 4MHGA 4Z2YA 1FOKA 5LGUA 4OUMA 3TNUB 5IVBA 2BNNA 4MGSA 2V26A 1VQMI 2A6TA 2MEV2 2J1RA 4U88A 3GGLA 4P9UA 1UY1A 3WU2H 2G9FA 5T50A 5BNGA 5KHJA 4FPEA 4ARXA 1Y0UA 4FFIA 4FXGB 3UGGA 2AGSA 2W1OA 4O7XA 2FMYA 1IRZA 2YPJA 1MDMB 3ZXJA 4XEZA 2NMOA 1PIV2 1MZEA 5FD5A 1ZRTD 5JI7A 1K83J 4LG0B 3H32A 3BROA 1VI0A 3X29B 3OAKA 3FXDA 3OOXA 3S57A 5DDJ3 1DQUA 5HCBA 2JPCA 2Y6LA 1BKZA 4Q1RA 2XSDC 3HPGA 1DD4A 1NUKA 1IPKA 1Q8VA 1V55H 2MH9A 4LKSA 3O6QB 1SFCA 1POV0 2E7TA 3V5BA 3D5RC 2D6KA 4FX0A 1VMHA 3I4PA 3M3YJ 3AVSA 1Z6RA 2VPVA 1S9KE 3OB8A 1QQP1 1JY3P 1UX6A 5CVJA 1BN5A 3RZHA 1YX5A 2LD5A 1MIJA 4ZMDA 3OGJA 3PMEA 3IUOA 4J01A 2RVCA 3PURA 4UXNA 4L11A 2ZGNA 4YWAA 2BU9A 1PGSA 3I2OA 2BGOA 2R16A 5A3NA 3ORJA 5IT6A 1MJBA 3S2DJ 1PP7U 3GZUC 4YTPC 1EQ7A 4RS5A 1FZEA 1HIXA 2HODB 2D3RA 4URTA 5DCMB 1ACIA 2OTKE 5FYBA 5ABJB 1JCCA 1VB2A 4JX4A 2DI3A 1AR83 2BQPA 3DYMA 3GCMA 2I74A 2Q8CA 5B5EH 2DF7A 3MIBA 5CADA 1AA7A 1NU1E 1SLIA 3L70J 4HSLA 4KICA 2KSJA 2EZLA 4YM0A 3BPSA 4BHPA 3BJAA 4EM1A 1E5RA 3POIA 1AR73 4JGYC 4HFSA 2IA2A 3HC7A 3LAJA 4XOGA 3DKXA 3GNEA 4L92A 3WG9A 2BCCE 3A0BE 1G86A 1KQ9A 3U2RA 3WW1A 4XK4A 4FT8A 3GW2A 2WAFA 2LXBA 4P9GA 1JTHB 4LBLA 3NL1A 5APXA 3IAPA 3W58A 1PL5A 4NN0A 2JDHA 1K78A 1XYOA 3NARA 1REDA 4FASD 2GM4A 2BDRA 1WH5A 1ZZ6A 2NPSB 1UB9A 4BY7J 3RQ0A 2C26A 4F52A 5IHRA 4AIKA 2OYIB 2G9WA 3UL2A 1L4AC 5DJTB 2R5DA 1JTYA 1ZRRA 5HS7A 5L8RJ 4XF1A 1SD7A 2G7UA 3A4UA 2HVQA 3OS0A 5F5IA 2H8WA 3ZMDA 4K8RB 2CFXA 2CMPA 1JZ4A 2J58A 2DW3A 2QQVA 1POQA 1WCDJ 3RK2B 4XF0A 5C8CA 4BY1J 1VQOP 4HSJA 2XV5A 4OYUA 4D7MA 3SXYA 1KORA 2Y0CA 2X5IA 2M2EA 5TISE 3B73A 3CQZJ 1KYOI 2CQ7A 4IXLA 1Y1WJ 4Y15A 4DZGA 2JEEA 2XB0X 2VJJA 2ZJRF 4LHSA 3AP7A 2XVCA 4UW5A 1WCQA 4I02A 5BPXA 4N43A 3AXEA 1MVQA 4NB5A 4NE9A 3V0BA 4IV1A 3M07A 2ZEWA 3BDDA 1TC3C 4JQRA 2NYXA 1MS0A 5JVTA 2VW1A 4I0BA 3P7NA 4TLGA 3G3ZA 3ITKA 1TWGJ 1LTIC 4LO8A 3H7YA 2QQKA 3T1MA 4QPOA 4IV3B 4X6QB 3NMBA 1O59A 1DYKA 1GNHA 1SFOJ 1AR93 3O1OA 1ZZBA 5JOYA 1EAH2 3P5BA 4MYEA 1RUNA 4E9KA 2ZMEA 2AO9A 3AAFA 3O5SA 1KRIA 1W8TA 5AVVB 3VD5A 4U87A 2XAUA 2WL1A 5E3NA 2FYZA 5C4WC 2ZJQF 4C7NA 5CCGD 3BOWA 3GYDA 1OD5A 4HX4A 2ZNZA 1OVUA 5IPAA 2V4JC 4RMNA 2HTJA 4H13C 3V4QA 3J26N 1LDDA 2UXXA 5F8PA 3WZ1A 5DABA 2EICA 5IAXA 3KT1A 3IV5A 4Q8LA 3MLLA 1D4VB 2WITA 3WTYC 3O1RA 3ABMH 5DDJ2 4S0HB 2XPJA 1BZWA 4LIVA 2YHJA 2ZZJA 2FXOA 2BW3B 2OQ6A 2WT7B 2Y0SN 4NC6A 2IRFG 2OTJP 5CMZA 4EROA 4COVA 1M90Q 3VBOA 2W47A 2HEWF 3DXUA 5FZOB 2LLKA 2VPRA 4IE0A 2E1CA 1UFMA 1NTZG 2GNMA 1LTTC 1ZELA 4XCBA 1BGYJ 3D6ZA 3E6CC 4LKEA 4KU7A 4BQYA 2FBEA 2JD4A 2L5QA 1SQQE 1H8AA 1KILC 1DBNA 1OYYA 5J3UA 2EAAA 1H9GA 5AW9B 3CC4I 5KC5A 1NYHA 1F5FA 4LMFA 2ZGTA 3CZ6A 1B8IB 4S04A 5D1IA 5DUUA 4K20A 3AP6A 4IEQA 2Q30A 1HUCA 1BOBA 1Z9CA 3T0YA 1OSGA 2WA4A 3K3OA 2BVMA 3K10A 1ODDA 1YJ9P 3ETQA 4LKFA 2WV0A 3CD6P 2HWF1 4QSHA 4RLFA 1WWYA 3AJZA 4NHLA 1K4SA 1B09A 5A6XA 3RZJA 1J3RA 3OYAA 1S0FA 4J1WA 4MHRA 1EV12 4XBLA 5ERIA 1T6AA 2DFEA 4E7LA 2WYFA 1GMJA 2FBKA 4YVSC 4FPJA 5CFCA 5H9SA 1VQKI 2VECA 2HLOA 4CEWB 5FGMA 3QCWA 1IXRC 3GZAA 5CJ4A 4AQ2A 4KN7X 1ZZ7A 4DZJA 2P2KA 2A06D 2W57A 5L3CA 1QJU3 4K40A 4NC7A 4B4RA 2MEV1 2CU5A 2GWRA 3VWBA 2X05A 1DPRA 2WAOA 4IRIA 1Y9QA 4XTMA 4LC1A 5JLVA 5CA6A 3U1XA 3JRCA 4LUKA 2QBYA 5GAEJ 2PG4A 1OOPB 4H0LC 4FVVA 3APBA 1PIV1 4P02B 3FIWA 1TQIA 3FBYA 1RRJA 2RKHA 3MO4A 4ATEA 1XB4A 3AKTA 2ZACA 2CTVA 1L0LE 3CCEI 4MLOA 5DDGA 1AKHB 4YW3A 4AEDA 5LW9A 3VDBA 1UCXA 4CP2A 5BMZA 1S7AA 3M9QA 5A2QZ 1JO5A 4AGRA 3W21A 4YARA 4EQQA 2MA3A 2RR13 2GN3A 5I0SA 2H94A 2JDKA 4I6MC 3JXSA 3C1LA 4QPIB 2BUKA 4EN8B 1RUI3 2VTXJ 3WDTA 3LF7A 4IEYA 2G7HA 1YITI 3L70D 2VXDA 1GQGA 5GALA 5C9AB 1Q90D 1RUF2 4V1PA 2JJ6A 3ACIA 5J1XA 3H8XA 1IG7A 3MUY1 2DBIA 1XSRA 5DN2A 1KJLA 1KZHA 2VE1A 3QH9A 4EIJA 1ZREA 4MH0E 2D93A 5A3LA 1KU7A 1FP2A 3POYA 1UL9A 4R4LA 1JUHA 2B8MA 1U5ZA 1APLC 1XCBA 4XLAA 2BEZF 4OGQD 2CWSA 2WINB 3I3EA 4IL6C 4IX7A 1K3IA 4CGZA 3AB0A 2KIUA 3HOSA 3KP2A 1FMD2 2PGDA 1XSVA 1SLBA 2ARCA 3AL0B 3S15J 2N1TD 4IRGA 2R4GA 3BJOA 3V4WA 3IP4B 1ULPA 2MH2A 2GDFA 3N05A 4BHBA 4UOJA 1KB9I 2LFBA 2QQ8A 2JECA 3ZN6A 2ZAHA 1Y3TA 5E88A 1GZWA 3HTKB 1NYWA 3MKWB 4B09A 1ZR4A 3PVBB 1X2NA 3JAMZ 1UYZA 2VZOA 4UUVA 2QCOA 4QGLA 5FRNA 3C2UA 4LKDA 5FLMJ 5DPNA 5HNHA 1SS1A 2WQ4A 4B47A 2P7JA 1ORKA 4RSUA 2YXRB 3WHTA 1KFUL 1CZQA 2Y6KA 3SZGA 3H5AA 1JXNA 2HTSA 3MN2A 3EJKA 1S7OA 2Y0SA 4IL6X 2ZPXA 1BIAA 4ZDPA 4PDWA 4YM1A 3MLJA 5IOYA 4Q5OA 5FJHA 3BG5A 2A06G 4PIXA 2W83C 1Y9GA 1POV3 2W1WA 1SFKA 4KBZA 4M3DA 1YYVA 4XZPA 4KT6A 2PN6A 3JRDA 1DGWY 1J2XA 4NAOA 1PP9J 4Z1MH 5EP9A 3R0AA 5HS8A 2DA6A 2JA7J 1W8HA 5JHFA 5JDBA 1PUFB 4C3IJ 4Q4W2 2O6GE 4DYQA 3E97A 4RB3C 5JI9A 2ZYGA 4ESBA 4A6DA 2VMHA 4BQ1A 3EO6A 4JTOA 2R7UA 2BWAA 4YW6A 4WWIA 4KISA 3IWZA 5FYCA 4GKYA 1PVXA 1T33A 3DF8A 1HW2A 4RL7A 1E57A 3OR1C 4PD4D 4IHYA 3OYHA 5LBEA 1JMBA 3AEBC 2F4OB 5ICCA 1XNAA 1NKGA 2WWSA 1K7AA 5J09A 4DXZA 4WBBA 5FOJB 2EK5A 4YELA 5EJCA 2J1EA 3N4MA 2XGCA 3OYLA 1RINA 1LWUC 1AR63 5AFBA 4JZRA 3H1KG 3FHZA 1RUG2 3BTZA 3AE2C 2DYCA 4WY4A 4XURA 1DF0A 2LKSA 3M06A 1U9NA 1Z7LA 2C9KA 3OYBA 3WNPA 5KLVE 4WM7C 1RF1C 1EAH1 1LENA 4A2UA 2OYZA 4BU2A 1T3UA 5EG0A 1VBB2 4MGZE 2VQCA 5B1BH 5F0HA 3N9QA 4ZXKA 2XZRA 2RDRA 4IXAA 1GP4A 2JSPA 2WC2A 5FYTA 2UV1A 2C6YA 2IS1A 1RJ8A 2EIJH 1PO13 4YW2A 1FX5A 1R36A 5D8LB 4ITVA 1GMMA 1X1BA 1BGYD 4UY8I 5D6EA 4YVWC 5CQGA 3MZWB 2LF7A 5FY0A 3LD8A 1K12A 3B02A 1D0YA 1OT5A 3ZVXA 4QQLA 4F55A 2JG9A 1JZ5A 1A6IA 2VXRA 2LW8A 4NIHA 3HBLA 1VBE2 2HPCB 1URQC 2ZSHB 1M06G 3OL3A 4YPJA 5DDJ1 5CZKA 2OX0A 2QSHX 4ENJA 2W94A 4DXRA 2XKPA 3CZUA 2FDGA 4QDQA 4WVMB 4AQ6A 1ZTRA 2IW5A 4Q5SF 1WJCA 3R4YA 3NRVA 3HGYA 4BEHB 1G7YA 5A3WA 4C1XA 1PPJD 2IGOA 3VOPA 2KL4A 3G71I 3IDEA 1A8MA 4CDUA 4TV7A 3GBGA 4OAYA 3JBG2 1NO4A 1NGMB 3PQKA 3AX4A 1IDZA 2QJKC 2HWB3 2YYOA 4JBZA 3KSCA 3WG7H 3HRTA 4UI9L 1TNSA 1MSEC 1B9MA 1RL3A 3KLOA 4INDA 1UOJA 3R2PA 5C70A 4ZJZA 1MEC3 4IOCF 3WTWC 3GHGB 2LY1A 4Z2WA 4M9SA 1OUSA 3JSVC 2LBFA 2H27A 1LUJB 1YRNB 1WLWA 3Q5SA 1FE6A 5JR2A 5L19A 2EIEA 3GF3A 1L0OC 3WTVC 2RS33 2F6BA 2ITAA 1GWMA 5AW6B 1QXJA 2QDNA 1J2JB 3ZQCA 1FOD2 5EV7A 1EV11 1M1JB 5CCHA 1C4RA 3NVCA 3RGBA 2K9SA 3FLTA 2ECCA 2UURA 3WU1B 1K4TA 3ESWB 3QPTA 4QU1A 2Z16A 2QUFA 4XJ9A 5FZ9A 3DECA 2KUBA