1OMIA

Crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
224
Chain Sequence
GSEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 72
structure length 224
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1omiA03
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1omiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1omiA01
2MLKA 1VP6A 4XFBA 2MA3A 1FDIA 2STWA 4PIYA 4TV7A 4DQ2A 1BI2A 3KP6A 2HTSA 3BJAA 3U0ZA 1ZG1A 4LULA 3Q9VA 2D1HA 3CJNA 1UCRA 2EV0A 3KP7A 2W57A 4ORFA 4EROA 2QWWA 2XAJA 2D93A 4LG0B 2UZKA 1FSEA 3P9KA 2OA2A 3HRTA 3CO2A 2OPKA 3H7JA 4EJVA 1PM7A 5D4SA 4KIBA 3NW4A 3HIFA 2O0YA 2L02A 3SXYA 3PQJA 1XE8A 3DPLC 2B0LA 1BI0A 2BBYA 5I0TA 3OGJA 3TNQA 2KKOA 4AIHA 1ZZBA 3SCGA 5DV5A 1T38A 5I91A 2DTRA 4Q47A 4ESJA 2RV8A 5D4RA 2K02A 2V1DA 2PBIA 3U11A 1BJAA 1U3EM 1A04A 3IDCB 3U2RA 4KA4A 3FXUA 2VOOA 3KP2A 4DINB 4HVOA 1XE7A 3WTVC 1R1TA 4RGSA 4IEXA 5L3EA 3RI4A 3I59B 1J7KA 4G6DA 1OYWA 1U5TC 5J6XA 2FBHA 3QU3A 4X6RB 4BH9A 3R4KA 2XASA 1G6NA 4FX0A 3G73A 1OFNA 1X8MA 5LRSA 4NB5A 2L54A 2QJVA 1FLIA 2GC0A 2K86A 2QBYB 4EMSA 2EB7A 2E7XA 1U6GA 4RGXA 1J3QA 5FO5A 1B4AA 1NE6A 2KXLA 3WW2A 3RPUA 5FD5A 2H09A 1Z6TA 5EEGA 5HLHA 4OFGA 1CAVA 5CU1A 3Q9SA 4BIFA 1W5SA 6PAXA 3SMHA 3N97A 1CAXA 3VHRA 1EY2A 2LKPA 1IW7F 1TQIA 2K4JA 4HF0A 1IN7A 3K1PA 1LR5A 2QQBA 3VOEA 2Y75A 4AIJA 3HUGA 3OTFA 4MGKE 4MTDA 3OOPA 1W4MA 2D1VA 3ZMVA 4EV0A 2XL7A 4QGMA 1EH6A 4UHTA 4NVPA 4I0AA 5C8WA 4ENMA 1J0RA 1Y9QA 3K69A 1DPRA 3QRFF 3S2WA 3FXQA 3O2PE 1WRJA 5LHHA 4MQ9F 5E16A 4XFFA 3ZN0A 3EYIA 4Q48A 2R7DA 2P7VB 2FEZA 5DCMA 3ES1A 3WODF 4Z07A 4QMAA 1PMIA 1G3WA 2CV6A 2HR3A 3TNPB 1OPCA 5DDGA 2ZMEB 4JTOA 2D40A 2EA4A 4L18B 1P4XA 2ADUA 1WA4A 2DI3A 5FLXK 5FQ0B 3WU0A 4AIKA 3IL2A 5HVQC 1CAUA 3CDHA 3BWGA 3P9IA 3FMSA 3V7CA 3DN7A 5H6QA 2VPVA 3GUDA 1YS6A 2P5VA 2AXLA 2PMHA 5J8CA 4UBHA 1DDNA 2MLGA 3J80Z 4KDPA 5E8IA 5FB2A 1IN4A 1GXPA 1WKMA 2LDUA 3WTYC 1B1BA 1KQ8A 2UY8A 4E2SA 3ULQB 3WGIA 1DZRA 4P5OA 2O1QA 2VE9A 3ZDSA 3BPVA 2A5YB 2EA2A 3H7YA 4HF2A 5K5QA 2O6GE 4O9GA 3FM3A 2PFWA 1TW2A 4P9FA 3COAC 1R36A 3I7DA 4A12A 4Q0UA 4CYDA 4U0VA 4MEXF 4I2OA 2KRFA 4ZZDA 2CW0F 2GA1A 1W5TA 2O8XA 5FFZA 1ZZ8A 4U0WA 1BC8C 1MD0A 2QQ9A 3DF8A 1IN6A 1ZX5A 4JVAA 2P17A 2VT2A 1DUXC 3CF6E 3RJPA 1EH7A 3I58A 2ACJA 2VQAA 2HEOA 5KBFA 3M70A 1O3QA 3WE2A 1OMIA 1U2WA 2PN6A 3F8NA 2QUFA 4M72A 1BI1A 5CADA 1U78A 2XGXA 3KLNA 4BHPA 3EO6A 2DCTA 4QGLA 3WGHA 1ON2A 2OD5A 3WTWC 3RYRA 4L9JA 3ECOA 5ILSA 4KL1A 2WC2A 4I09A 5K1YA 3FJSA 5E1WA 2EA7A 2Z99A 3ABUA 3GFLA 3EYYA 3TKYA 5JR7B 1YLFA 5ICCA 1WGPA 4CDGA 3KZYA 4UUVA 1TQPA 3MZHA 4ZZLA 3HHGA 4EM0B 5LBQA 1RUOA 2M45A 4KWKA 4KNYA 1SMYF 5HS7A 3DQVC 2BNOA 3MEXA 4HW0A 2DPDA 4M6YA 4TLFA 3M8FA 1REPC 1T98A 2JZYA 3ML6A 1L3LA 5KHJA 4O5VA 4JBAA 1D8JA 4MEYF 1P6RA 1HXDA 2PAEA 1STZA 3ZMUA 1Z05A 1F4KA 3L09A 5CVRA 4F7ZA 3O14A 4CHUA 4L11A 3UKNA 4YRDA 3F8FA 4CICA 4HN0A 3BY6A 3M8EA 3GFJA 2CWEA 1J2XA 5FGMA 2N7GA 1IPKA 1YFWA 2EFPA 2ETHA 5EZWA 2IXLA 3SFZA 4LLGF 2PEXA 1UFMA 4XRFA 3FMRA 1KQ0A 3EDPA 3QACA 4QM8A 1UIKA 2ZKLA 4IEVA 1IRGA 2D45A 4FHTA 5CJ9A 3VB2A 1NXMA 1FYKA 3GXOA 4XF4A 1USTA 3V7RA 5FLIA 3P9CA 1YW8A 1FI2A 1TTYA 4UV9A 3ELNA 2MD5A 4LB5A 2CAUA 4MH0E 2JT1A 1HKTA 1XGNA 2YX7A 5FPXA 1JHFA 3QP6A 3H9AA 2GA2A 4OIRF 1HSJA 3I4PA 1ZZ7A 1YFXA 1BOAA 4IRGA 4LK0F 2RDPA 3WW1A 2YPRA 5LHIA 1FZPB 3LA3A 4O3MA 3GYHX 2FNAA 2A6HF 4XF9A 4CZZA 3H1WA 1U5TB 4UVBA 2OZ6A 1ZAOA 1P92A 4MHGA 2RQPA 3PFIA 4PIZA 2QVOA 2IP2A 1GVJA 3M7GA 3I59A 1FWZA 3M9AA 2C6YA 1J3RA 1E17A 1OKRA 2IA2A 1RUNA 4KU8A 5ICEA 4RB3C 1MJAA 2JPBA 1KYZA 2OQRA 1UHWA 4HYEA 2PA7A 3GEZA 3HRMA 3WTSC 3EBRA 2J5PA 4EQQA 4HLYA 3ISPA 4LJZF 4PGGA 3HTSB 2H0VA 1ON1A 2FQPA 1SD5A 3JTHA 1FX7A 4GYGA 4HV6A 1ZRDA 2QYOA 3IHUA 5HDGA 3MZYA 4HLTA 3E6BA 4IHSA 1ZYRF 1R7JA 4EWEA 2EJRA 5IT3A 2IXIA 3J7AO 3FF5A 3HYIA 4KN7X 4UVCA 5LGNA 5HI0A 3WTXC 4I98B 4QM9A 5F64A 1R1UA 4Q0SA 2FMLA 3LQRA 2Q4SA 4A5NA 3IC7A 3BCWA 3U1DA 2FQ3A 5E20A 2IRFG 1QGPA 5LLQA 2VN2A 3H8UA 2BV6A 1ZMEC 2CQKA 4LD5A 1G3SA 4AQ2A 4LA2A 2OZUA 2XHKA 4R52A 5D1IA 5JSPA 2HQRA 5I93A 4RD7A 1T2KA 4YFNF 4B29A 4IERA 4JTNA 4LUKA 3MWMA 4XFAA 4S05A 2PYTA 3QP5A 1WI9A 3JSOA 1H1MA 2ATFA 2FOKA 5BPXA 1DZTA 4MTEA 2QQAA 4QLCU 1G3TA 1P4WA 2OBPA 5BPIA 2GC1A 1XSXA 2H6BA 2M87A 1VJ2A 4U7BA 1S3JA 2CG4A 5BPDA 4YIFA 1K79A 2B5HA 4AVPA 4HDVA 2VBXA 2IA0A 1QY4A 5JI6A 5DCMB 3H25A 1LJ9A 2P4WA 3C18A 3CUQB 3FHZA 4KWLA 2RKHA 1BIAA 1O4TA 3ZP5A 3LAPA 2XAGA 2W25A 1ZHFA 2VOPA 2LNBA 4M74A 4LLLA 4BXUA 4OIQF 1YHFA 4RGRA 1VTNC 4RS8A 4N0BA 4L9TA 1QXJA 3HT2A 1XCBA 1MDMB 1CGPA 3ELKA 1XSVA 2F4PA 4Y15A 1CF7B 4IHTA 2XKOA 2CO5A 2XVCA 5L3BA 1KU9A 2LF8A 4WX9A 3V8JA 2XKPA 4L5JA 4ZU5A 2WFPA 1W7PA 1K78A 1XGMA 1JUHA 1XD7A 4BYYA 4EM1A 2PQQA 2DT5A 4KN4X 1W7PD 1HBXG 5F6FA 5I0SA 4LTAA 2EV5A 1V3FA 5J48A 2O3FA 2A68F 1IAWA 2XIGA 3U9GA 1MKMA 4HBNA 2JTVA 4IRIA 2PTMA 4PIXA 2OYZA 3DV8A 2O03A 4Q0VA 4N9IA 1H0MA 2YX4A 4U7DA 3I64A 3S0MA 4MX3A 3I54A 1HW5A 5D6FA 1F1ZA 5TJJA 1DPUA 1DGWA 4HDUA 5J3UA 2HYGD 1LDKB 3T5XA 3LAGA 5TRDA 3HOSA 3LOIA 4BQAA 3CJXA 1ZREA 1LVAA 4M6XA 3C7JA 3JSPA 5KHHA 1HKSA 1D8KA 2BNNA 2XUBA 3LAJA 1PP8F 3F3XA 2NS0A 4WK8F 4HF1A 4Q5SF 3TO9A 4IEZA 2HGCA 3UKTA 2EWNA 5HS8A 3KP3A 4I01A 3DL3A 3L9FA 3ERED 1YQAA 3DEUA 4HA8A 2H6CA 2X4HA 3ABTA 2HKXA 3KP4A 2FF4A 2DO7A 2COMA 4HX7A 1KGSA 2IPQX 2MH2A 4LK1F 1TBXA 4K8FA 4EWAA 2RN7A 4CXFA 3CLPA 5JSOA 1ZLJA 4M9SA 4ZH4F 5D8LB 2GXBA 1SEFA 1TQ5A 2IA1A 1X7NA 2V6CA 2FE3A 2EFQA 2F5EA 5AONA 3TO6A 1YLLA 1KU7A 2RNJA 3VODA 4HZFA 1UW8A 3FFQA 1SMTA 1Z91A 3RYKA 3TOAA 2QM3A 2FNPA 1IXSB 1ZLKA 3KLOA 3BPZA 3SXWA 1ZVFA 5HLIA 4ASNA 2Z3YA 4XEZA 3IKTA 1PDNC 1FBQA 2A6EF 4P9UA 1XDSA 1ZRCA 1ZARA 1Z7UA 2K27A 1AOYA 2Z5UA 4HVQA 1USSA 2ZMEA 1S6LA 2C0ZA 4ZU4A 5HS9A 1RZ4A 3HT1A 3FHIB 2EK5A 3KGLA 1NE4A 4A0XA 4WBBA 3JW4A 3NL1A 3I5UA 3GX4X 1R22A 2ISZA 4WWCA 3MCZA 3CO6C 3BROA 5CVJA 1MJ9A 4LLNA 3FE5A 1TW3A 2KIUA 1O3TA 4P9GA 3M1EA 4MGZE 3TO7A 1RIOH 5AVPA 1QQIA 4H7LA 2ESNA 1Y3TA 4MGIE 1K6OA 3HTUA 3F8BA 3ST7A 1KU2A 3JTGA 4E2QA 5D5WB 5DCFA 3GO5A 2HYFA 2LF7A 2UYBA 3SZTA 3VFZA 3HQXA 2BYVE 4AXOA 1UIJA 2ESHA 1IZ1A 1OI6A 2D5HA 3CL1A 2EFWA 1O5UA 1ZRFA 2VC1A 2DLLA 4LG0A 5CVUA 2WWYA 4HSLA 3HOTA 3KEOA 5HDNA 1L0OC 1J75A 4F8AA 3KGZA 2G9WA 4YFXF 2FBKA 1FT9A 5LHGA 1CAUB 1YWKA 2QZ8A 3DFGA 5L3DA 4XFGA 1GXQA 1QWRA 1XGSA 3DKWA 5I8YA 4L0ZB 1J5YA 1ONVA 3I71A 3ROUA 3WTZA 2HQNA 2P6SA 3HSEA 5D5UB 1ZZCA 5D6EA 1XSDA 3NVCA 1Z6RA 4RGUA 3WU1B 2R7FA 3C1DA 4OMZA 3S7EA 2QENA 4HQMA 4HX8A 1W7PB 1ODDA 4BAYA 5K8SA 1NZCA 1SAXA 1SD4A 3SZPA 2V09A 4JV4A 3CUOA 1I1GA 4EWDA 2Q0OA 1IXRC 2DQRA 2EV6A 3TQNA 1FYMA 1YS7A 3GYDA 2B9UA 4IEPA 3W6KB 2ETEA 3L2CA 3EUHA 1T6SA 5H6RA 3H92A 4J1WA 2K4BA 2W24A 2YSRA 4YNIA 3MAJA 1J1LA 5JFRA 3CEWA 5H20A 3LZZA 4N9HA 2E1CA 3E6MA 3R0JA 1LNWA 3ZMTA 4QX5A 1CAXB 3WE3A 5FQ0A 2BEOA 2PMUA 3I0TA 2VECA 2UYAA 3RNSA 4OLLA 4MNUA 3RKXA 3V4GA 3KZZA 2DU9A 4IEYA 1SFUA 3M3IA 5KHIA 1OYIA 2E1NA 3U10A 2ET1A 1QZZA 3K2ZA 4MZUA 5DD4A 4NQWA 3BJ6A 3RIRA 4R1HA 2A3SA 1IN5A 1KA8A 3F21A 2VXZA 1R5GA 5KK1A 3W6JB 4CO8A 3TDZC 1XRUA 4PJYA 4BHCA 4OIPF 5BV6A 2DFIA 3BJOA 2G8YA 5I8TA 1X82A 2OU2A 4BNCA 2XLGA 2P6TA 3LA7A 4HOBA 3RZZA 3KSCA 1RC6A 3G7DA 3GBFA 2H94A 2KJBA 1LEAA 4LB6B 4U88A 3HRUA 4B09A 1ZN2A 2NYXA 1FPQA 1XCVA 2Z9OA 1XMAA 1IF1A 4XSZF 2XRNA 2QBYA 5LGTA 1VR3A 1T0FA 2H27A 2Q0AA 4K2EA 2P8TA 3E6CC 4IESA 4EGZA 1HW2A 3L2HA 4META 4GO1A 3DPTA 5JAXA 3RKYA 2PHDA 3DXJF 1PP7U 3IWZA 1RI7A 4HV5A 1HW1A 3NJZA 4G9YA 1NHAA 4EJTA 3F8CA 4RB0A 3PQKA 1CAVB 3MPBA 5D5VB 2UXNA 2GU9A 3R61A 4M73A 3CO7C 2P10A 3V8LA 3WG9A 5AIQA 4HSJA 5KHGA 3PNAA 1RL3A 2ET7A 4YARA 3R0AA 3FX3A 4LGWA 4HLXA 2X0LA 1X3UA 2CSOA 4UXAA 3K1NA 1GHCA 4ESFA 4O9EA 4XF1A 1DGRA 3LWFA 1B9MA 3SCHA 4M9XA 3WW4A 3H50A 4G8XA 1JXSA 3CLOA 1YUDA 3SHFA 2VC0A 4PDKA 4JK1X 1Z9CA 1MJBA 3DP7A 3FZVA 2XLFA 5FLXZ 1IRFA 3SCFA 1TNTA 1GQHA 2MNGA 1NYWA 2MHFA 3GWZA 4EJUA 4G7HF 5CVVA 1R1VA 1ZG3A 2ZCWA 4XLPF 5CYVA 3RKWA 2Q30A 1YIOA 1O57A 1UD1A 3QPTA 2V9VA 4EJWA 4L9VA 4IPAA 1WMKA 3REOA 1XB4A 1YW9A 1RNLA 1I27A 3V7SA 4WXHA 5BOXA 1QBJA 3KFWX 3MDPA 4ENNA 2IVMA 2GAUA 4XBFA 4I0BA 4M71A 4L0YB 5J7MA 2XROA 5DUKA 3IRQA 3JZVA 5BUVA 3OD0A 3EJKA 2IJLA 4FX4A 4XFIA 1O5LA 4KT5C 4ON0A 5JSRA 1P2FA 2OQGA 3LFKA 2E7WA 4IJAA 3FZ3A 4L5IA 4A2UA 1S8NA 1S7AA 4LEJA 5FLHA 3S7IA 3ES4A 3IRRA 3GZ6A 2NNYA 4YIIA 3HSFA 3HRSA 4QGNA 1BM9A 4AWXB 2V1UA 2FBIA 1SD7A 5ICFA 1UPIA 4ONUA 2WTEA 5LEJA 1O3RA 3E3VA 3IKVA 2O8QA 3H1YA 4LFUA 1AWCA 1EV7A 2DW4A 2DK8A 3NEUA 3NQOA 2STTA 2JSCA 2VE8A 1ZGAA 1HKQA 1BN5A 4E70A 4IXAA 1J3PA 1QZYA 5CLSA 3K0LA 5A2QK 4HQEA 3EWKA 1YO5C 4L2NA 1J9IA 4IRHA 3ZMZA 4OMYA 2IXHA 2Z69A 1DP7P 5DUIA 3LWCA 5L3GA 2PHLA 1BI3A 4Q0PA 3GFMA 4Y17A 1H9GA 2ZKZA 4Z2YA 3GLXA 3BZ6A 4KFCA 1LEBA 2F5CA 1T39A 4KWJA 5FPZA 4IEQA 4HN1A 1OD5A 2NAZA 1KQ9A 1YW7A 4OU0A 4AD9A 3OF1A 4KUMA 4AVAA 1ZRRA 4UXNA 3MQ0A 2TDXA 1Q1HA 2IXCA 1B6AA 3CTAA 1U5TA 2CFXA 5ICGA 2P5LC 4UNOA 5E8GA 4OINF 2P7CB 5K5RA 1TNSA 2GQQA 2A07F 1SD6A 2VT3A 3TDUC 4U0YA 5EFUA 3ZQ7A 3HHHA 2CYYA 4CGZA 3RYPA 3H3ZA 3F8MA 3WGGA 1FC3A 4LUMA 1LDJA 2FSWA 1KU3A 5LRRA 3D0SA 1S7OA 2VBYA 1YFUA 4EGYA 1V70A 3CUQC 4L9NA 4HVRA 3T8TA 5E17F 1WLTA 1E2XA 5T3NA 3PVBB 2V1XA 1IXCA 4GGGA 5D8KB 1YYVA 2LSOA 4JQFA 2IT0A 4KIFA 3MYXA 2BNMA 1MZBA 3NSTA 2Z33A 2D2WA 1G3YA 4XFHA 3LQQA 1O7LA 1PUEE 4Q29A 3FWEA 4PGHA 4WCGA 4IVNA 4HMZA 5BMZA 3BALA 2HWVA 4A5MA 2UWMA 3EQLF 1ZGJA 3F22A 4I7HA 4WXDA 1YFHA 4IEOA 5ILVA 2I45A 2GC3A 2PAMA 4IETA 3BOQA 1EYBA 2WV0A 4RB2C 1WWXA 3IDBB 3JAMK 2ZXJA 3VEPA 2Q1ZB 3E5QA 2YU3A 3GF2A 2RC4A 3EETA 2DAOA 2EAAA 2DBBA 2QLZA 2FU4A 1D5VA 1ULYA 4RAZA 3F72A 1WQ2A 3D82A 3JAMZ 2M5WA 4ZYGA 2K0GA 4G94A 1RTVA 3SQNA 2RVCA 1F5TA 4AQ6A 2IW5A 4XFCA 3RPQA 4WVZA 2ZFWA 1Q43A 1QPMA 2FA5A 1I6XA 3J81Z 5IT9K 2K9ZA 1FNNA 4KICA 1LQ1A 3ZN1A 2P5KA 1U12A 4Z82A 2E9QA 3FMQA 3NKTA 5I8SA 3Q5FA 4FT8A 4RB1A 1ZNPA 3LSTA 4E2GA 3IIAA 5HOOA 1UB9A 3FXRA 2KJCA 1BBYA 4YG2F 2HZTA 4PCQA 4XF0A 2Y0OA 3EQEA 5HLGA 4ZYEA 4H0EA 4D7SA 3TGNA 3WTTC 3ZPLA 3GZ5A 5DYMA 3QU6A 1CAWB 2Q2EA 1RGSA 5HDKA 4FAHA 2QNKA 4Q0QA 1H9TA 3KETA 3GVAA 3USSA 2FXAA 2D5FA 2BGCA 1UCXA 3ACLA 4M9ZA 5AIPA 1OYYA 1F9NA 5L3CA 3BP8A 1EH8A 4EVIA 4YYOA 1LKNA 5DEQA 2HKOA 1V4RA 5K5OA 4ZYDA 1LRHA 2IC1A 1HQCA 3I53A 4GCVA 3B73A 1I5ZA 2GZWA 2XAFA 2VODA 4PZJA 1GQGA 3H1MA 1MGTA 4FAGA 2L4AA 3ZMSA 4BHBA 1KYWA 2DQLA 1R23A 1L3JA 2O61A 2ZNYA 1IPJA 1FP1D 2L01A 2QVSB 1B9NA 1ZH5A 1LB2A 1G4DA 4ENJA 1MDMA 3BB6A 2JRTA 3H3UA 1AJYA 1CX4A 2A69F 1SFEA 1IN8A 5FCCA 3L7WA 4KMFA 4AVCA 4DNCA 2L4MA 5L3FA 1EPZA 2EVXA 5E1ZB 2MH9A 5F1RA 2PI0A 2PQ8A 4R8HA 1Q3EA 3SHRA 1SFXA 2DPUA 1QNTA 3P7NA 1K78B 4ETSA 1QXRA 4KIGA 4LA3A 5ILUA 2EFOA 3FM5A 3MFKA 3RDIA 4MUVA 2M8EA 4LLOA 1O3SA 2V79A 1IUYA 2PAKA 3KE2A 4D0PA 2YR2A 4B8XA 4WXCA 1S29A 1B59A 4A6EA 1SFNA 2F5FA 3AAFA 3T1BA 3ETQA 3B02A 1BIBA 2HDCA 1XN7A 3RTRA 2Z2SB 3ECHA 2XV4S 5I0RA 5FD6A 2L3DA 3QOPA 3CUQA 4GULA 1LDDA 4UBGA 5FDBA 2Q8KA 4WF2A 2KIMA 1ZG5A 4LMYA 3E6DA 2HS5A 5EEHA 5C6CA 4XSXF 2G7UA 2CAVA 4D7TA 3HSRA 5LGUA 4EJOA 2W85A 2HFHA 3PLQA 1O7FA 5E1RA 4ZYHA 4XF3A 1OR7A 5JR3A 3BDDA 1J58A 2ZBKA 2MPFA 4AVBA 1FDOA 1Z1DA 4HX4A 2PG4A 1XMKA 4G7OF 3TOBA 4GYIA 3N4MA 2GXGA 5JCTA 2EFNA 1CF7A 2ISYA 4IEWA 2PFBA 1TQMA 5E1XA 4WZCA 3KMHA 2VBZA 1R5HA 2GIVA 2GH2A 2Y48A 3OV8A 5ED4A 1YTYA 2NRAC 5D5XB 1ZZ6A 2PJPA 2A61A 4R79A 3F6VA 2B8MA 3GFIA 4G6QA 4RAYA 2UXXA 2QCSB 3WW3A 3ZMDA 1BC7C 2W84A 3D5LA 1SQ4A 3O3KA 5A2QZ 4P55A 4GXOA 1TLHB 2AS5F 2IXKA 4KYWA 3K1MA 2J5OA 3BU7A 3LA2A 3IN6A 4ZU7A 3EHKA 4UVAA 3KEQA 4HBLA 4MGYE 4XLNF 4EM2A 2RGVA 4IF4A 1U8RA 5LEKA 2GC2A 4OOIA 3NRVA 1FY7A 1XDUA 4A0ZA 4I3PA 1FSHA 2JPCA 3J80K 1I1SA 2HOEA 1QO0D 2PLYA 3T8RA 4A6DA 3KCCA 4KU7A 2XAQA 3C3WA 5FFXA 2IXJA 4QXKA 2NNNA 3C3VA 4IEUA 4A0YA 4I02A 2GWRA 2VONA 4KMUX 1H1IA 2M30A 2R3SA 2ZNZA 5BQTA 1WSUA 2KIFA 1CAWA 2QDRA 5KVRA 3WTUC 3F6OA 2ZO4A 5BY5A 4Q4ZF 2M1BA 2UY9A 1J59A 2HJIA 1Q5OA 4FBFA 4YSFA 4ESBA 3T0YA 1YFYA 5JHUA 3QAHA 1FXZA 3QPHA 2FRHA 4X6QB 2XLAA 5J8FA 5FLJA 5BXXA 3OCPA 1P4AA 3K9TA 5BS6A 3BPXA 1FBSA 1R58A 5JVTA 2F2EA 5ERIA 2MC3A 2OA4A 1C0WA 1XGOA 3E5UA 3UKVA 3O6QA 5DD8A 3R6SA 1ZZ9A 4O6JA 3IBMA 3G3ZA 4OIOF 2HTJA 5KHKA 2OZJA 4J1XA 2BE5F 4S04A 4XETA 3E97A 4MV2A 3D0JA 3F23A 2Y0MA 2ELHA 2K7LA 4G7ZF 3L00A 1YG2A 3R60A 1Y0UA 2DK5A 2FMYA 1FBUA 3O6BB 4MQVA 2OAZA 4HAMA 1UHMA 4MGRA 3IWFA 4QWQA 4NHJA 1R00A 5E18F 3J81K 3KP5A 5IT9Z 1K7AA 5I0UA 3GW2A 3E5XA 1HSTA 2MBFA 5CVIA 1JHHA 1JGSA 4P96A 1X8EA 1EP0A 1FOKA 1JE8A 2G7HA 2F5DA 1D3YA 4UV8A 4Y13A 4ENKA 2CGPA 2VBWA 2ZJ2A 1FP2A 1FYLA 4YFKF 2XL9A 3V8KA 2XAHA
chains in the Genus database with same CATH superfamily
1AYN3 2J1VA 5EZGA 3BG5A 4M3CB 2W68A 4Y1YA 2MA3A 1FDIA 2STWA 1VRH3 1D0XA 1WH7A 4G4FA 3ZQIA 4TV7A 4LT5A 3KP6A 3FHQA 2HTSA 3DU5A 3Q9VA 1K5MA 1SCRA 2OC6A 4N78D 4A93J 1Y8RB 2QWWA 4YGDA 5F2WA 2D93A 4JHZA 1MMAA 4OH8B 3UNPA 1S5LE 1KZUB 3P9KA 2OA2A 1EQ7A 1W9WA 5ACA3 4ZJZA 2ZYDA 3WNNA 4CEYB 1D7PM 2ZMEC 3JBG2 3SXYA 3PQJA 4GQ7A 2BBYA 1FMD1 2DFCA 1Q2NA 4YFWA 5FJKA 3N4XA 3R0RA 1LTBC 3TNQA 1ZZBA 3SCGA 4NC7A 5DV5A 2FYUG 1ZYBA 3DEEA 5I91A 3QYBA 2B88A 2W82A 2DTRA 2RV8A 1PVEA 5DUWA 3U11A 1BJAA 1GL2B 3IDCB 3GTPJ 4W65A 3LSDA 3U2RA 5KLIB 1AR83 2LRPA 5FP7A 3U37A 1GDTA 4DINB 2J1UA 2PFXA 4ZYAA 1R1TA 1D0YA 5IATA 3CCJI 2R4GA 5J6XA 1BJZA 3H1KE 2VZTA 3RK3C 3WP5A 1L0LJ 4FX0A 2P81A 1JW6A 2CU7A 3TGUJ 4FOYA 4MGSA 2QJVA 1FLIA 4ZMDA 3B93A 1W2TA 3H0DA 4FFGA 3X29B 3OMYA 5B1BH 4EN0A 1RMU2 4Y5TA 4YWAA 2AC1A 1IFNA 1OC1A 2W83C 3RKQA 1YHQI 1J1EB 4RGXA 1VRH1 2Q3IA 5IVBA 2LRDA 1DU6A 1RR7A 1OLTA 3TF5A 2A75A 5FZ3A 3RPUA 3W2AA 4ET7A 1Z6TA 1C5HA 5HLHA 2VR4A 2QGUA 4PK4A 3UK9A 1BKZA 1NCRA 4Z92B 5F6LB 4QKBA 1EY2A 2LKPA 1AHDP 1TQIA 2LKSA 4RS5C 3K1PA 3EXUA 2Y75A 4AIJA 5GTHE 1CPNA 3RI9A 2G0EA 4IZZA 1W4MA 2XL7A 1S7EA 4P9WA 1PVC1 4B1RA 1OXCA 2MSYA 2ZT9B 4NVPA 4PBPA 4NR1A 1RUG2 3T1MA 2K1AA 3I3LA 2FD5A 2QBXA 1QVGO 1ZRTD 1ZA4A 5ERLA 1T8IA 4OWFA 3L73J 1GYKA 1O4ZA 3LDRA 1UY2A 4MQ9F 3PUHA 2EINH 3K51A 5CISA 3ZN4A 5A70A 1N1SA 4Q48A 3KCYA 5FO8B 2R7DA 5DMYA 2FEZA 4FTSA 3PL8A 4RGKA 2XSDC 2DUPA 4QMAA 1PMIA 1LE8A 1G3WA 1SEUA 4AFMA 2CV0A 3TNPB 2GMPA 3WUUA 3RBXA 1WA4A 2DI3A 2VD7A 1W9TA 2BZDA 5FJHA 3DBHB 1R081 2PMZN 4XE9A 3O1SA 4JC1A 4X8NA 1JZ2A 3CCSI 2YMKA 5K0UC 4KDPA 2E32A 3ZFEB 5LA9A 5DJUB 1L0LG 3EUHC 2UY8A 5E3LA 3GM8A 5F27A 1F15A 3L70E 3OYEA 2JEEA 4PV1D 2VE9A 3VBRC 3ZDSA 2JVGA 1MPXA 1R4NB 3FDYA 4PLNA 4Y1XA 1TNFA 5K5QA 1W9SA 2H1LA 1H2LA 3W2WA 4YW2A 4P9FA 3A01B 4HEA2 1HKDA 1R36A 3PVEA 2H0BA 5DXDA 3GHGB 4JHTA 3PTRB 1BR4A 3ZGKA 1YQ5A 2WBMA 4QSHA 4P5YA 4MEXF 2KRFA 1G8WA 4AWDA 4ZZDA 2GA1A 2WSEJ 4QPQA 4Y33A 1ZZ8A 5C44J 5EZHA 4N7UA 3Q8EA 3K4LA 1IN6A 2A3YA 2ZC2A 1MQTB 4JGYA 5K7ZA 1V6NA 5EGOB 1DUXC 5FAXA 4EJRA 3H1KJ 2VTXA 1RVF1 2E76C 2QSHX 1JYNA 3DCFA 3I58A 4CXWA 3VZMA 2Z16A 1BCCJ 1POGA 3OG2A 1O3QA 1ZTRA 4LHNA 5FMCA 3L2QA 3F8NA 1BI1A 2HVRA 3JR9A 3WP3A 3B5NB 2XGXA 2XVLA 2VJIA 3SFDC 4IL6X 2QQIA 1H8TC 2B39A 5IWFA 3D6ZA 3BZKA 3CJRB 1N86A 1MS4A 1XG1A 4RYDA 2NLRA 4RR3B 3FX0A 3ECOA 5ILSA 4I09A 5K1YA 4L99A 5H2FE 3M0DA 3GFLA 4PD4D 1SAUA 1LTJC 2ME0A 3TKYA 1DIPA 2W1OA 2IWGB 5ICCA 1UL9A 4BQWA 1WGPA 3ONQA 4CDGA 2R7EB 3AKPA 3AMMA 4LE3A 3OL4A 1NXD1 2OYHA 1OIPA 2R7WA 3CXHE 2WAOA 5CFCB 1GW3A 1AX0A 1MSEC 1EC5A 4IV1C 2BFUL 1SMYF 1FZGA 3K70D 1YITP 1H8TB 2HPCB 2DPDA 1WMXA 1SQPE 3M8FA 1REPC 2X5IB 3CU7A 1T98A 4XABA 2WV1A 1YQ2A 2Q9IA 4O5VA 4JBAA 1D8JA 5JLVA 2KK7A 5F39A 2XZRA 1XB9A 2V5YA 2QQNA 3MW2A 4RMNA 1STZA 3ZMUA 2HBTA 1FOXA 3L09A 3O14A 4PLOA 3UKNA 4YRDA 1Y9BA 2ZXXA 3PL0A 3GFJA 1NHLA 4IV3A 2P6HA 4UI9L 2CWEA 3WY6A 5FK7A 3BCCG 5K7FA 3H32A 5EZWA 3TW6A 3AECC 2IXLA 1RE3C 3FMRA 1LESA 4IEVA 3SKJE 4EN8B 2B63J 1PP9E 5CCGD 2YKQA 2IZ1A 5B5EE 1IJWC 1FYKA 2OTKE 1R5SA 3H9JA 4RHV3 3V6IA 4DXTA 4QQLA 3V7RA 1JO5A 3P9CA 1DGLA 2R0HA 1Z0XA 1F35A 2VQ0A 1ZR4A 1N7LA 1ND3C 2V72A 4NHLA 3ZQQA 1JYCA 1WZXA 4RN5A 2HVQA 2RDSA 2YX7A 3QH7A 5BNNC 1JHFA 1ULOA 2FYZA 1DLCA 1YI2I 4OIRF 3AP4A 4W1UA 1HSJA 4Q1PA 3VKFC 1XC5A 1BOAA 2R1BA 4GAZA 4H44D 3I3DA 3LA3A 2R061 2Q8CA 2DCZA 2R32A 5F3GA 2A6VA 4Y99B 1WJ5A 2WNUA 4RGAA 4LKDA 1E5HA 4FTBA 2DCYA 1U5TB 3THDA 1FAVA 1LHWA 3RZGA 4MHGA 1WUVA 2CSGA 4AK3A 5JZGC 3PFIA 1W05A 4PIZA 5FKMA 2MEV1 2LD5A 3M9AA 3JREA 3NFQA 4XAEA 2R93J 1E0EA 1J1DC 4DYRA 2IA2A 1E17A 3VBSA 1YQ4C 1FC2C 3IN9A 1H30A 3H8RA 1VBC2 5ICEA 4RB3C 2R0QC 2ZGUA 3PJQA 2JPBA 1JY3P 4Q4Y1 2PA7A 2WWWA 3CIHA 2VTXJ 3IH4A 3WTSC 3CMEP 4EQQA 4HLYA 4KGGA 4GALA 3MKWB 1RUF2 1CZVA 1RUC3 2F48A 1F9KA 2E75B 4Q4Y2 1VBB3 1TVGA 1PZ8A 2DMPA 4HV6A 4YM1A 2QYOA 4WM8B 1WBLA 5HDGA 2QSGX 2NPSB 1POV3 4IHSA 5FLVA 1ZYRF 5A33B 5BYNA 5A1FA 3DYPA 1R7JA 2EJRA 2XNXA 5HI0A 4BJ6C 4I98B 1RUE1 5F64A 2X05A 1R1UA 1RMU3 2EXJA 2FMLA 3KM5A 1MFTA 1D5YA 1NTMJ 4BK5A 4A5NA 4YPCA 1SQXD 3I3EA 3U1DA 4LBQD 3T97B 2DMTA 1JKPC 1FZCC 2W08A 2K40A 2OZUA 4RR3C 4FQGA 2XHKA 1WH5A 4XDPA 1CQ9A 1LWUA 1X9VA 4YFNF 3UESA 4B29A 2R16A 3LW5J 2IGKA 4JTNA 4V2GA 5EFWB 1H1MA 5IFTA 3L75E 2FOKA 1OHFA 2N1TC 1IFMA 4WY4A 4INDA 2VW1A 1N77A 1AKHB 2H7HA 1P84I 1P4WA 1BOBA 3S3NA 1Y6IA 5BPIA 1XSXA 2H6BA 1S3JA 5BPDA 1SQXG 3TB0A 1QY4A 1LECA 2A70A 3I3MA 3H1IE 5DCMB 3H25A 2W95A 5FZ9A 1D4M2 2VKHA 2RKHA 2EIJH 4D5CA 3VHOA 3WUCA 1MBHA 3ZP5A 4LHKA 1ZHFA 2HQAA 1W9YA 1YJWI 4M74A 3TL4X 4OIQF 1W6OA 4DYQA 3M7AA 4UF0A 1R5ID 2WQ8A 1SQBD 1KFNA 3IH2A 4CCKA 1PP9J 2WA3A 1QXJA 3HT2A 5GTIC 3C8XA 2R30A 2YXRB 2RMU2 2DURA 2ARXA 1OPMA 1Q82Q 1HRI2 3A0BC 3LSIA 1EPWA 1LP1A 2XR4A 2CO5A 4DZPA 1OX3A 1OFSA 3I2OA 4W50A 2CMPA 1JY2P 5HV4A 2XU6A 1RVF2 1L7QA 1HIXA 2HH9A 4L5JA 4BDZA 2QQKA 1KYOH 4CDQB 5FYMA 4ZU5A 3GMAA 2O5RA 1R083 1J1TA 1W7PA 2WFPA 3FIWA 1K78A 3FBIB 1JUHA 1XD7A 3B9IA 2PQQA 2P2KA 2DBNA 2KDZA 4B4PA 2AR6A 1YIJI 2A68F 1IAWA 4MADA 2XIGA 3U9GA 1MZ6A 1PGJA 2H89C 3RJ2X 3A0NA 4WVMB 4CXYA 2QKDA 2M8RA 2B9SA 1R71A 4BDYA 2WZR2 1HB3A 3LD8A 1X3ZB 5GTHH 2KMUA 1SC7A 4K40A 2YX4A 4U7DA 4DZGA 5B4NA 3S0MA 1VBA2 2R063 2IXSA 1W39A 1HB1A 5HNFA 1DPUA 1LTJA 4HDUA 2HYGD 3HOSA 2JE9A 3OPWA 2JK3A 4DRRA 1DH3A 3OBZA 1ZREA 3JSPA 2JG8B 1D8KA 2E1MB 1JNMA 5L9BA 3ESWB 4XCAA 2KLVA 1U5XA 1PO11 4DNYA 2NS0A 3J7HA 3TO9A 4FPOB 2HGCA 3AFHA 2VG9A 4EOTA 1W9FA 3LPFA 4XDQA 4MIMA 5HS8A 4I01A 3L9FA 4ZXEA 4CDUA 2NVXJ 2N9BA 2DO7A 3LFMA 3AMHA 4B43A 4CCEA 3BASA 3TN91 3R4YA 2Y9ZA 5EPAA 4QB6A 5E79C 2RR12 2VZVA 3PIGA 5J36A 4CXFA 3CLPA 1L7LA 3FFZA 1FTZA 3C1LA 2YMZA 3CZJA 1ZLJA 3AG1H 4QPIA 4K35A 1LOFC 2LREA 2GXBA 3HOZJ 4W97A 2HVSA 2FE3A 3CCVP 1FTTA 3MZWB 5G05L 1ZA7A 2DA7A 3V64A 4Q1RA 3CMMA 4M3EA 3G6EI 3FFQA 3LQCA 1F5FA 1Z91A 2PN5A 3RYKA 1GUUA 2MD0A 1JT0A 2FNPA 3KLOA 1TWFJ 2I8DA 4ZDLA 4ASNA 4XEZA 4XNFA 1BR1A 3POIA 2A6EF 2DDBA 1ZARA 4KBZA 2X8KA 3HAGA 2VZOA 2R1DA 1QEXA 2XGEA 1ERDA 4ZU4A 3L2WA 3V42A 4QWNA 2R3CA 2A6WA 4FFIA 1CWPA 4HT1T 3U4XA 5AVXB 3NL1A 2B42B 2QVAA 1R22A 3CCSP 1NKNA 2ISZA 5DZGA 4CVUA 1FOD1 2CQXA 3CO6C 4HPKA 1MJ9A 2VZ1A 1TW3A 3NWTA 4ES9A 2WLPA 4XJAA 3ZFEA 2MGQA 1VQ5P 4JDNA 2VMHA 3PTZA 1Y3TA 1W6MA 4MGIE 4GOEA 2KZIA 1T2KC 4PHZA 3JTGA 4CCNA 4ITVA 4OMCA 2JE8A 3GO5A 2LF7A 3QQAA 3VFZA 5IK4A 3KT7A 3HQXA 2K3PA 1VF9A 1GL2D 1Y43B 1NA1C 1IZ1A 4XVHA 2KS1A 3JD71 5J98B 1NA1B 4NNJA 1O5UA 2VZRA 3SH5A 3HKZA 4IE5A 3OIOA 2WWYA 3KEOA 3WOGA 2N1TD 4NIDA 5F0HA 4F8AA 1HC8A 2G9WA 2FBKA 1B72B 1OURA 5IUQA 3HPGA 3DFGA 1VI0A 2KI7B 1PVC2 4YW3A 5FP4A 1QWRA 1XGSA 3DKWA 1U8BA 3HJEA 1YRNA 2BRTA 1MH3A 3AE3C 1J5YA 1SLLA 3I71A 5IJRA 4QXHA 3QPSA 3GALA 3AKRA 1S4CA 3MLKA 2WSEH 5CCGA 3GW6A 2YS9A 4QHZA 3JCUC 3C1DA 3K4BA 1N78A 1G2HA 4RLQA 2OQ7A 4N4OB 4GJYA 1R1A3 4NPFX 1NK2P 2P7JA 5GP9A 2QSIA 4BAYA 3VBUB 3B5NA 3BTCA 1EUUA 1NZCA 2PHFA 1OUXA 3I3BA 4JV4A 2A1XA 2PHUA 1FZCA 3MD0A 1I1GA 3PTYA 4EWDA 3FXEA 4XRSG 2A06E 5H9QA 1J09A 5CCHC 1AXKA 1JT6A 2HWF3 4N43B 4YGBA 1YS7A 2ZX4A 3VPRA 2D44A 4CDQC 3A2AA 2GBYA 2CPSA 1OW7A 2B9UA 2EXIA 4WM8A 2V4VA 4WM7C 1FEXA 2F6BA 5A33A 3P5JA 1IQAA 1RUE3 2CW7A 4D1QA 1SVMA 2XJPA 1KB9I 4YGCA 4BRYA 3VP9A 2VZPA 3CEWA 3LZZA 3Q5SA 2TCTA 3JUUA 2AQEA 4BQOA 2FFDC 1LNWA 4QX5A 4W7YA 3WE3A 1M1JC 2BEOA 1N2DC 1YRNB 3N35A 4RJTA 1F2NA 2E51A 4CDWA 2DA1A 5IVFA 1Q90D 4MNUA 3L35A 1W36C 3S4RA 1W0OA 1OCZH 1LTAC 2JDZA 5H9PA 3RKXA 3KZZA 3HB9A 3THPA 3BG6A 5KHIA 1OYIA 1C4RA 5ISLA 5AW1B 5EHDA 3CCEI 3KV9A 2ET1A 1QZZA 1IS5A 4UB8C 3QWOC 3S17J 5L9VA 1DEBA 3OOUA 3K3OA 2WMMA 1IN5A 1R5GA 3SYTA 5KK1A 3KV4A 4CO8A 4OIPF 3N7MA 2HDWA 5I8TA 5ABJA 2OU2A 4BNCA 2XLGA 3JQWA 2P6TA 2WZ8A 3LIGA 3RZZA 2VVDA 2FYNC 3G7DA 2H94A 2KJBA 2VZQA 1XU2A 1SQBG 4XORA 4B09A 1ETVA 2XDJA 1XCVA 1S0BA 1IF1A 3K4AA 2VOKA 5LGTA 1G1IA 3TDKA 2A6TA 4K2EA 4XLEA 3VYRB 4IESA 3N9MA 4EGZA 3L2HA 3PSFA 3MHZA 1LWUC 1PP7U 3ZYFA 4AI0A 3IWZA 1RI7A 2VCMA 4HV5A 1J2JB 1TU3F 2V4HA 1NHAA 4EJTA 2XONA 3OBRA 1HB2A 2D3SA 1OXZA 2V5DA 2WSCJ 4I2LC 4IL7A 2HWE3 1FE6A 4HSJA 2ES3A 5KHGA 2ET7A 3J8F2 3IP4B 2DF7A 4YARA 3LEIA 4HLXA 5A6ZA 3K1NA 1YIPA 1B9MA 1WD4A 1COV2 4M9XA 1WW5A 2IVIB 1LHVA 3WW4A 1L2PA 3HD7B 2L7MP 4G8XA 1JXSA 1W5CE 1BLZA 1YUDA 2WNVC 4R9AA 3CL3D 3O8ZA 3SHFA 1Z9CA 2P6CA 4XACA 3DP7A 2ORXA 5FLXZ 2GNBA 1Q7YQ 3SCFA 5HBAA 4KG0A 3N7LA 3AP9A 5J40A 1HWTC 1NYWA 5C4XJ 2KUBA 4A3FJ 3GWZA 4ABZA 4G7HF 1QDCA 5CVVA 1GFF2 2Q30A 1GV2A 1QHDA 3Q3SA 2PGDA 1O57A 1UD1A 3LSKA 4L9VA 3ITKA 4IPAA 5J1UA 4XQ4A 3UIAA 3HOUJ 2NRGA 1IV8A 5AVAA 2ID6A 4E6KG 1YX3A 3MIEA 4WXHA 2PJRB 2RVAA 1SHWB 3H1HE 1HLCA 3MDPA 2IVMA 4XBFA 3FMGA 4L0YB 5J7MA 2ZEZA 2KP8A 3RGUA 3JZVA 5F3CA 2RG4A 3II6A 2ZSHB 2CRGA 3DUIA 3LSJA 1GL2C 3BTZA 2Z4FA 3S1NJ 4LO6B 2LR8A 2V4AA 1EV11 2ZAHA 2YUSA 3L71E 4HJGH 1U0JA 1P2FA 2EXHA 5DM7F 1XE0A 2OVUA 1CI6A 2ZGSA 4ZKPA 2X1EA 1G2CB 4AIDA 1S8NA 1S7AA 5FLHA 3S7IA 3WZ1A 1X50A 1QVUA 3I97A 4QGNA 5LZ6A 1JKRC 1IGOA 1SD7A 5FXWA 3A7QA 5C5TA 2ZPXA 4AU7A 1A3KA 4UOJA 1EV12 4IXLA 2W6AA 1I50J 3GLMA 5AVVB 5GZCA 1ZGAA 1LE8B 2I07B 3OR1C 3FXDA 1J3PA 5KCMA 1QZYA 2DFEA 5KLVD 5HXVA 1PZQA 1OKQA 3K0LA 2VUDA 1GU4A 3ZYHA 3I2IA 1GU5A 3QYFA 4N53C 5A2QK 4HQEA 3SH4A 1U5ZA 3CJIC 3BCCE 5FWEA 2GUSA 3CJIB 1JH5A 2PJRA 5BVZA 2W3JA 2HYJA 4Q8LA 1BI3A 2RMU3 3VMXA 3O1MA 1A78A 2QA4I 3BZ6A 3PUFA 2IDBA 4P1WA 1LEBA 4UF0B 4IEQA 4D94A 3CCLI 4OU0A 3OF1A 1EDIA 5C3SA 1ZRRA 3KIOA 1RIRA 3OYLA 3UJQA 2OF7A 4FETA 3CTAA 2ZAEB 2HWB1 1X9PA 2R7ZJ 3W3CA 1H8AA 4Q4V3 4V1PA 4AL9A 2JN6A 1LJ7A 2P7CB 1E3PA 4J00A 4DS0A 3AEEC 1SG3A 3AEDC 1OOPC 3IH3A 1A31A 4U0YA 2FDKA 4CGZA 3C9IA 3NNLA 3H3ZA 3JBG1 1MS5A 2QJKB 5A80A 2LMDA 1LDJA 3K4MA 2NS8A 2GP5A 4OQ8A 1BSHA 5HCHA 4EGYA 3VBRA 3CUQC 5EV7A 3IFMA 4ZC3A 5E17F 2DCKA 1NY72 1CIYA 3ZMOA 5APAA 1BDCA 5D8KB 4XRSA 4BBSJ 4QPYA 3LCPA 1YIFA 2VOVA 2YC2A 3VD7A 4OI0A 1QVFO 2XQXA 3AVSA 2EICA 1PUEE 4IQJA 4A45A 1AR91 1UHSA 4HMZA 3BTYA 2JA8J 1OQYA 3S6PA 2LROA 1ETYA 2WFF3 4JKMA 2UWMA 2R7QA 4Z2WA 3J8F3 4I7HA 3NAPB 2GSYA 2KSEA 3TGUG 2VLAA 4R4LA 1R1A1 3W6VA 3IPVB 4BXSV 4L0PA 4MSVA 3VDXA 3SZGA 3JAMK 2X6OA 3RZMA 1FOYA 5LB6A 1K3IA 2K88A 3MIFA 4L76A 3BCCJ 5A6YA 5AVQB 3VLBB 2M0CA 4RAZA 5AC91 3OS1A 3DPRB 3LDKA 3D82A 2NYYA 3TYYA 3O1TA 4ZYGA 4FPHA 2K0GA 1RTVA 1H8TA 3SQNA 4AQ6A 3RPQA 1V55H 3NJYA 5FFOC 5GZGA 2K9ZA 4KICA 4I7ZB 2XF5A 5IK7A 2P5KA 4CCJA 1HRV2 3IMNA 3PU3A 1RQUA 2XV5A 3MGNA 5M1BA 2VI6A 3NKTA 1UMQA 4QPGC 4G9SB 3JD73 4CP1A 5AW7B 3HD7D 4FT8A 2AGSA 3KS7A 2XAUA 2Z5IA 1WA6X 4RB1A 4R9BA 4BE3A 1VBC3 3HKZN 2Z1DA 2RDNA 3U21A 2Y0OA 1W0TA 5J1RA 3H1IG 2QQUA 4D7SA 3TGNA 1IS6A 3CKHA 2BHZA 1BHGA 4LO8A 2QM8A 1PPJE 3WDVA 1SQVK 5DYMA 3QU6A 3OGVA 1NTZG 1D4VB 2ZXHA 3RK2B 5T5JA 2ZXEB 4FAHA 4CCLA 1H9TA 4A3ZA 5KLIC 2FXAA 4P9XA 3T30A 4XC9A 2D5FA 3SFEC 3ACLA 4M9ZA 5EYXA 4V2WA 5L3CA 3BP8A 4YYOA 1LKNA 5L9RA 1OA3A 2NOGA 2YFUA 5K5OA 1TWGJ 1LRHA 3CX5H 1ACIA 3I53A 1KB9D 3GDBA 1UU5A 3B73A 4OAZA 1G59A 3RSJA 1QGLA 2HWD1 1V0AA 3H1MA 2WJSA 1MGTA 3AMPA 3KLSA 4FAGA 3KVAA 1PP9D 4BHBA 4JYBA 3H9QA 2O61A 4DYCA 4B8EA 2QVSB 1LB2A 2QJYB 4ZDOA 3RK2D 5DAVA 3M07A 4Y1VA 1SFEA 4M6VA 1U7JA 4KMFA 1ETOA 1G8XA 4XJ9A 2ZEYA 4Q4X3 2IYOA 4AFBA 5E1ZB 2MH9A 3RG0A 1Q3EA 3Q1MA 3POWA 1QNTA 1X1PA 5M0TA 1OKOA 3OSDA 5J4YA 3HN1A 3B69A 1QXRA 5FY5A 2EFOA 2JKBA 1SQQE 2I1JA 1L0NK 3RZKA 1UOJA 2BW8A 5FZLA 4Y4YA 4TYSA 2YR2A 3HM5A 5D8AC 5LY2A 3WU2E 3TMOA 4AM3A 4BZ4A 1UXZA 1B59A 5BNQA 1PO13 3O1VA 1MBJA 1C8NA 4GFBA 4IHVA 1U5IA 5IVYA 1SFNA 1V6JA 2F5FA 2IBZE 4AEDA 5APSA 3HR9A 1Q86Q 1BIBA 4KHXA 1JKOC 1GMMA 1XN7A 3RTRA 1SQVD 1IFIA 3WG4A 3PUQA 1VQKP 1Q8QA 1LDDA 3G4SI 2VVEA 4FQ4A 4UBGA 2JJLA 3RWKX 1VDFA 1MSFC 5FZ7A 1UG0A 4XSXF 1H2KA 3W9AA 4D7TA 1XYPA 1ZBE1 2PHXA 4XPVA 1O7FA 5E1RA 1R093 4LIVA 1J58A 1LWUB 2QKMB 1NG0A 2MPFA 2DUOA 2WS91 1LOGA 1OH4A 1XMKA 4G7OF 1MV8A 4XUQA 3TOBA 3N4MA 1YJ9I 1NOVA 3INAA 2EFNA 3T4VA 4WY4B 5DG2A 5HLTA 2ISYA 4BQ5A 2L5QA 1OVSA 1PMHX 4CP0A 2HFED 1RHI1 5LBEA 3ZFFB 2NRAC 3OUIA 1IO4A 4EQVA 1I9RA 2A61A 2XXZA 4F92B 1S1CX 1NTKE 4MG2A 2BCCE 3CCRP 2X85A 4YZ3A 4OMDA 4YVWB 5DDJ3 5FIXA 3I55P 3U14A 2YB7A 2E75C 1FMWA 3RWNA 4DMIA 4KJZA 2G9FA 1H88C 4BGDA 2QZ2A 3KV5A 1HJBA 1FIAA 2ZKNA 2J58A 1TLHB 3BR3A 1QOTA 3SISA 4OQ9A 2J5OA 3BU7A 1QJY2 2BQPA 4XXAA 3A3YB 1VB4A 2RN0A 1LJ2A 3KEQA 1ZOYC 4XLNF 4EM2A 4IF4A 4Y3OA 2H8WA 5LEKA 2DW3A 2FFDA 4CDWB 1XNDA 3HNBM 5LBFA 1M57D 3WVJA 3J80K 1LP1B 1NU1K 1I1SA 2R5YA 4A6DA 5FFXA 2IXJA 2NNNA 1FV2A 4Y5Z0 5J3LA 3PM1A 4A0YA 4NHMA 1VQNP 1UU4A 2KISA 2W7NA 3TP3A 1WSUA 1CAWA 4YVSA 1IDYA 1JXNA 5FYYA 3L74G 3F5HA 5EJZB 3F6OA 4XJUA 4II3A 3OPTA 4EZ4A 5BY5A 1OLRA 3PUSA 1RUJ1 3C2BA 1H0TB 4E4ZA 2HJIA 1Q5OA 2K85A 3AZWA 1JY2N 5CG9A 3T0YA 1YFYA 1AJOA 3A0HE 3QPHA 3L72E 2JMWA 4X6QB 2FXMA 3B9CA 1SQQD 3GCXA 2R071 1DGWX 3ZQFA 2W39A 5BNPA 3VKMA 2XPWA 3AFKA 2C6SA 4AGGA 2A6ZA 5ERIA 2OA4A 1C0WA 3MUY1 1HUCA 2HODA 1NTZJ 3O6QA 3IBMA 4GB32 3OBTA 3K2OA 2BE5F 1MZFA 4PD4I 3WHCA 1RUJ2 5KAIC 3HG9A 1HOMA 3E97A 4TSVA 4CE8A 4MV2A 1SACA 4W8JA 4G7ZF 1ENXA 3R60A 1Y0UA 4K21A 2A06G 5DZEA 3O6BB 3GJAA 4MQVA 4TWTA 2LH9A 2L0KA 3HOBA 3JRAA 4NRMA 4OHZA 3W67A 4XK4A 1L0NJ 4CUAA 2WPSA 2WQ4A 4NHJA 3EMRA 2YMYA 5E18F 3J81K 3VBHB 2NP0A 4YG6A 2MBFA 3VD4A 1JHHA 1KFMA 1JGSA 1EP0A 3H1LE 3KQ4B 1D3YA 2ZXIA 4Y13A 2WFF2 3FLRA 2ZJ2A 1FYLA 4YFKF 4C2UA 5C3QA 5AW9B 1JKQC 3MW3A 1VP6A 3OGGA 3PJSK 4EYUA 3VYSB 3U75A 4Y22A 3VGIA 3QYEA 4LHSA 5FZOB 4E7LA 1PZ7A 1HN0A 5GTIE 3BJAA 3U0ZA 1Z77A 1ZG1A 2Z5HA 1X2MA 2YHJA 3CJNA 1UCRA 3KP7A 1V9U2 2W57A 2XAJA 1FSEA 3WF3A 3CO2A 3VMYA 2OPKA 3H1KD 2C0XA 5GLZA 3WQ7A 1XE8A 1JM0A 3DPLC 5I0TA 1BI0A 1PJRA 3JRGA 3ZKUA 3A03A 4UB6E 3QLQA 4M3DA 3HOXJ 4QQOA 3OS2A 3OWTA 1RUF1 2KKOA 4MLOA 2JECA 1UOBA 4NPEA 2GLOA 5F1JA 3D1NI 3BR2A 4BB3A 2LXBA 1A02J 4BPZA 2W48A 5D4RA 2PBIA 1NZIA 1U3EM 1A04A 3LSRA 1BDDA 5A1AA 3FXUA 2YU2A 1U0AA 4DZJA 1RUE2 1BGYG 1XE7A 3WTVC 1LKXA 5L3EA 4FPYA 3RI4A 2JQ7A 1J7KA 3WDYA 3K6GA 1OYWA 4M3CE 2FBHA 3O0XA 5F2SA 1BBT3 4CRQA 3ZSKA 2FDHA 2XASA 1X36A 3ON7A 3L74J 3ZXEA 5H9SA 5K7HA 2XPUA 1X8MA 5LRSA 3VDBA 2QBYB 3OPZA 2YPDA 2AENA 4N53A 3OA7A 4D0QA 2HWD3 3ZFEC 1QF3A 1X0TA 2C24A 2ILMA 1PZ9A 4RBOA 1ZQ3P 4YPJA 5FO5A 5APXA 1WBFA 2KXLA 1BE3E 5EEGA 1A6IA 4AEKA 2IGNA 1YE9A 3RCOA 4OFGA 5CU1A 3OB8A 1JYWA 2JDNA 4BIFA 2DA5A 4XIOA 4LK7A 3N97A 3KZ4C 3WX5A 3CMYA 2KZJA 2D6KA 1AU7A 1IW7F 1G9DA 2QQBA 1LHUA 4CDXC 4Z6YA 5FP9A 3ETPA 1HDDC 4QGMA 1H8AC 3DXUA 1AXZA 3NV1A 3JRCA 4BWOA 1RKTA 1J0RA 1JOPA 4AI9A 1Y9QA 1CN1A 3ZR8X 1DPRA 3BODA 3S2WA 2L9VA 3H1HG 3FXQA 5CMZA 2YKPA 5FLMJ 5LHHA 1VBE3 1B8IB 1UG2A 1SCSA 2WAQN 4A7YA 4BE0A 3VZJA 1T6AA 4E4SA 1L0ND 5M3FJ 4NIGA 4QIWN 4XFJA 3B5NC 3ZXDA 3ZLIA 2CV6A 3GF6A 2IFNA 1OPCA 4JYCA 2ZMEB 3M8JA 2EA4A 2ADUA 4OGQB 3BVHA 1AR73 2ZGKA 4Y52J 1RR8C 2KD7A 1CAUA 3CDHA 4ZY9A 3FK6A 1KYOD 4LLFA 2H8RA 3CQZJ 3DN7A 2E63A 4Q5OA 3BR1A 2BOLA 3AYEA 4PDWA 2BXZA 4WM7A 5AW5B 4BLIA 1SLQA 3CWBD 2M7BA 1T95A 3P3PA 1AQ5A 3UETA 3S3OA 2AXLA 1K04A 2PMHA 5CBNA 5E6HA 2MLGA 5TISC 3J80Z 3AEFC 3N7KA 5E8IA 5FB2A 1IN4A 2XJRA 5EJCA 3ULQB 4BWNA 4BJ5C 5B66C 2UWBA 3AE2C 3I4NJ 1NAEA 2EA2A 3H7YA 5T5OA 5KHDA 4YVWA 3FM3A 3VBSC 3GLLA 1JY3N 2PFWA 3VBSB 1YO8A 2K9JA 4PV1B 1N7SC 2NMOA 3SSUA 3ASOH 1B8IA 4W4ZA 4Q0UA 4D6TE 3CNAA 3MW4A 4G12A 3POBA 3JCUE 4U0VA 3PMSA 1MACA 1UY0A 2Y6GA 1LU2A 1R64A 1QX8A 2E74C 1NAYA 3L36A 3DTKA 2CW0F 1XPWA 3ZPYA 1BC8C 2OX0A 3BGAA 3SH3A 3DF8A 3VMZA 4OAYA 3BC8A 1FPN1 1Y1VJ 4M3FA 2FFDB 1YRZA 2VM9A 1XPXA 2KIKA 1OF4A 2VQAA 3NNFA 2WQZC 3SWKA 2AO9A 5TSWA 3M70A 1AYM1 4WM7B 3WE2A 1OMIA 1PO21 4UAPA 1U2WA 2PN6A 3QWLA 4M72A 5CADA 2E76D 1U78A 1ENHA 4E7JA 4LLHA 4WBAA 1VBA1 1PL5A 4HETA 4BQYA 4FPJA 3Q5PA 4BHPA 3VP8A 1EZVE 1V9U1 2DCTA 3ACGA 2E2HJ 2LK2A 1QHGA 3WTWC 2CQNA 3RYRA 2IS2A 2A73B 4KL1A 2E19A 1F43A 2VJ4A 2WC2A 3FJSA 1HRI3 4FOVA 1Z56A 3ABUA 2D6MA 4RGGA 5APVA 2DA2A 3BG3A 5JR7B 4LBLA 5AW2B 1TMF2 5C9AA 1UKRA 2B7EA 3TGUD 1R8EA 1FU1A 4LKEA 1R082 4O7XA 3ZN6A 2Y0EA 1X9TA 5I0DA 4RL7A 1EF4A 4PQQA 2KNCB 4KWKA 4KNYA 3M2MA 1ND3A 2COBA 5HS7A 4UFIA 4B3XA 1HGZA 3MEXA 4XRMA 4ARXA 4M6YA 3ML6A 1L3LA 2DJIA 1JU3A 2WA4A 1HJGA 4BK4A 4N78E 1P6RA 1XC6A 1BCCG 2M34A 3BR0A 4GWMA 4BMEA 1PNFA 2ZJPF 2RJKA 1Z05A 2YROA 1RUI3 1W36D 1E5IA 3IAPA 4GDOA 2VNGA 3KZIE 3W20A 3RQ4A 4XCBA 4NIAA 4TT3H 4JAAA 4CU6A 1MW7A 1HVVA 2GMMA 4IV1A 4BQQA 4OHWA 4QX2A 1KONA 3VV1A 2NQYA 1VQ7I 3M8EA 2JDMA 1AR61 1MNEA 4EATA 4I6ZA 3PLNA 3GTLJ 4LR4A 1IPKA 1REEA 3LEKA 4XN3A 3BKZA 1YFWA 2ZJCA 2YU1A 1J84A 2ETHA 3AJYA 3TYJA 1QJFA 2FCVA 2PEXA 4XRFA 2KA3A 1WLWA 2BEQD 2LKMA 2O14A 1QDOA 4FHTA 3VB2A 5C9AB 1NXMA 2E31A 5B1AH 1GP4A 1FYUA 5FLIA 4FPLA 1YW8A 3ELNA 1N47A 4LB5A 1WCKA 1QJY3 4AHXA 2ZGRA 2O01J 4JGZC 5ACA1 1HKTA 4AI1A 4YZ2A 1V54H 3QP6A 4QQHA 1VMHA 2GA2A 1NTZE 3I4PA 2CUEA 1ZZ7A 1YFXA 1ALYA 3ACHA 4S2GA 3VN4A 3WMM0 3MP7B 4C90A 2RDPA 3WW1A 1KJRA 2JG8A 5LHIA 1FZPB 2WB1N 3BTIA 5M5XJ 1GOGA 1W0PA 4XJWA 1M1EB 2XJVA 4DUWA 1DP0A 2IX7C 4FPFA 1YITI 3P5BA 3H1WA 4UVBA 1Q1VA 3CDZB 1ZAOA 1ZGWA 3H9GA 1QJX1 2WRAA 2FY8A 1P8JA 3ZFFA 2QVOA 1C28A 4BL0B 4YELA 3NAPA 1FWZA 2QZ3A 2Y64A 1JCDA 3L75J 3WF2A 4GMP3 4AFAA 4OGQD 4KU8A 2OQRA 2IZ0A 4A3XA 3CC7P 4HYEA 3MIGA 3AE4C 3GEZA 4A3IJ 2FYUK 4LJZF 4PGGA 2H0VA 3GTQJ 1LTSC 5IP7J 3ZMNA 2ZX2A 3KD4A 2BWCA 5KAIE 2QG4A 1ONAA 4RESB 3J7AO 3FF5A 4A6OA 4KN7X 2D2CD 1HXS1 4PJ0C 3AZXA 1IFDA 5F08A 4LOTA 2GUVA 2F4LA 2WINB 4FPGA 4UWDA 2QJYC 1PGL2 1MUUA 3T3YA 2Q1MA 3IC7A 1O4YA 3B3QE 3CWBG 2VN2A 2K9QA 3H8UA 3TWIA 2BV6A 1WMFA 1KXGA 4LD5A 1G3SA 4LA2A 2IBZG 5KLVE 3J4UH 1QH7A 2DFHA 1K6YA 4AGVA 1ZXGA 3HE4A 3EUKL 1T2KA 3RGBA 5LD2C 4LUKA 3MWMA 4B3AA 4XFAA 4S05A 2PYTA 5B3SH 3JSOA 2L9NA 4DCKA 1KQSO 5K7PA 4HXCA 5DN2A 4I99C 2QQAA 2UWCA 1FX5A 1G3TA 1MEC3 3SEZA 1KORA 4BY1J 1M8OB 1BMV1 1QL1A 1SFCB 1FPN3 2DTYA 1KB9H 5HCAA 4UW4A 2YBPA 5C4WC 1VJ2A 4U7BA 4CZCA 3OYJA 2WYFA 4YIFA 1K79A 2J42A 4H13B 5JMCA 3ZYBA 4V2FA 2VBXA 1GTWA 1LJ9A 4L97A 2JDUA 3FHZA 5IYCJ 4C1XA 1BIAA 1O4TA 5KXEA 4IE4A 5GAGJ 3PVNA 3EB7A 1GV9A 3OOXA 1SFKA 2VOPA 3L2YA 3HL2A 3J7MA 1K5MC 4LLLA 1VAVA 1NTKG 2CQQA 4X6AJ 4RS8A 2LTNA 4N0BA 4AAPA 1DCSA 3PNYA 3Q5RA 1WWYA 5A3LA 3ELKA 4AEMA 3UNGC 2JD4A 4QD2A 1Q56A 1ULGA 4RO0A 2VZSA 2XVCA 3MUDA 3BIWE 3LL7A 3WQBA 2LFBA 4ATFA 3V8JA 2XKPA 1HCRA 3W68A 1QRYA 3AZVA 3WNLA 4CDUC 1AYN2 3S14J 4XZPA 2DT5A 1G9FA 2DVDA 1HBXG 1W8UA 4XKBA 5J48A 2O3FA 2RMU1 4QHOA 3I2KA 2TUNA 4C9YA 1KD7A 4HBNA 2JTVA 3OYDA 2PTMA 3CCEP 4FFFA 4UB8E 1UNBA 2CUJA 4QPWA 3DV8A 3M3OA 4IE0A 3H0OA 2FYUE 4PD4E 2VKVA 1H0MA 4MX3A 3I54A 1PX3A 2JA7J 1UYZA 5D6FA 2JUCA 4M3BA 5IYYA 4FOWA 3WHBA 4N90A 3L74E 2W46A 5DG1A 4IL6E 4OVEA 3T5XA 4GMP1 4AVVA 4BQAA 3J26N 4Y28J 1G9CA 1IUFA 1N73A 1LVAA 4M6XA 1S5LH 2ZZQA 5KHHA 5HV0A 4JKLA 2XUBA 3Q8CA 1PP8F 4OGQC 3L72G 3E1IA 4HF1A 1RXGA 1LTEA 4LO5B 4BCUA 2VMCA 3G1MA 1MQTC 5KLVJ 3D5SC 3S16J 1OCOH 3GCWA 3DEUA 2PHWA 2H6CA 1UZWA 2X4HA 2R7RA 2Y0CA 5T54A 1W5CC 2JWPA 4J19A 2X6YA 3TSIA 3AZZA 4AYBN 1KGSA 2XBO1 1AL0G 1XYOA 4OZOA 2IPQX 4ATEA 2MH2A 1TBXA 1GP6A 4K8FA 4EWAA 2RN7A 5JSOA 4N6JA 4M9SA 2Y6HA 4ISQA 5D8LB 2JKXA 3GNEA 1D0HA 2IA1A 1X7NA 4HRIA 2EFQA 1KU7A 2RNJA 3VODA 4HZFA 4BY7J 4A42A 4BA6A 4CZSA 4XKWA 1NA1A 1UIXA 4RM3A 3VBHC 3RZOJ 1YYNA 3TOAA 2QM3A 4OUEA 1LTJB 3OY8A 3F0CA 3ZQLA 5JZGA 5HLIA 1BE3J 1TNRA 2FD8A 3CESA 1ETXA 3RBZA 3GTMJ 1QH6A 1UPSA 5IW0A 5IOYA 1UZZA 1SBDA 4DRVA 2ZMEA 2YC0A 3S9OA 5IOZA 5HS9A 5JUVA 1PUFA 2WZEA 1H4GA 3TK1A 4UB6H 4P9IA 2EK5A 1CVNA 4GMP0 1RESA 4BQ4A 5K9YA 1S0CA 2IS1A 4GIQA 2JWTA 2LY9A 4A7ZA 1XXNA 4D6QA 3CCQI 1PGSA 3AMNA 2JIGA 4NC8A 3VBOA 3BROA 5CVJA 1PGQA 4LLNA 3ZIXA 2ZBJA 1OCTC 1S55A 3R4DB 2R062 1W8ZA 3EYPA 3Q9OA 5AVPA 1VBD2 2KR2A 2ZOEB 1Y56A 4H7LA 4QPIB 3F8BA 3P3NA 1GSLA 3PH0A 1ULCA 2HYFA 5FJ8J 2UYBA 3SZTA 2DVFA 3OD4A 2KLOA 1OLQA 1DQ2A 1OI6A 2DLLA 3MVPA 4LG0A 3POYA 5GLWA 1EA3A 5F04A 5M5YJ 1ZRIA 3OYKA 2SLIA 3HOTA 3WCSA 4O65A 1LGNA 4QX1A 2W1WA 3HBKA 3L70G 1NH4A 1PGW2 5LHGA 4XYXA 2L9LA 2EZLA 4NWWA 2CJJA 4XFGA 2CW8A 2K9NA 3HE5A 4K6BA 2ZT9D 4CCOA 4URTA 3TN92 4ZZ8A 2HEYF 3L73E 4B4QA 1S0EA 1BEV1 2P6SA 5D5UB 1ZZCA 1QU3A 1OH3A 2AREA 2LLKA 1FZAA 3AEGC 5TGTA 4RGUA 4PF1A 1LT1A 1POV0 1C1FA 1U9NA 4PJMA 3H42B 1MEC1 1JMUB 3S7EA 2QENA 1OVVA 4HX8A 4Y20B 3ZKYA 2QUOA 2W94A 3K4KA 4RSUA 1ODDA 2RDQA 2JDAA 5K8SA 1SLAA 4RQPA 5LATA 2K37A 2Q0OA 3RI8A 1WJEA 2RS11 4XUNA 3MFCA 2EV6A 4C2TA 4JDMA 3TQNA 5A6QA 4B3NA 5EIYB 1FMVA 3LE0A 4NOTA 2KS1B 3OYGA 4ASKA 1BW6A 3G6EP 1O91A 3OIQA 5CBLA 5H6RA 3OYBA 3H92A 2DT6A 4J1WA 4R4XA 1UELB 1T8ZA 3Q0WA 3AE7C 5A3MA 3W5NA 2YSRA 1AA0A 1J1LA 2HWF1 5JFRA 4K1YA 1OF3A 3E6MA 2IFMA 2Y0DA 5CAZA 4OHYA 1VBD1 5FQ0A 4DJGA 3I0TA 1O8PA 2UYAA 4Z8BA 2NPSC 1UAIA 5FOBB 1UO9A 3Q3DA 5FXVA 3V4GA 3MHVA 2DU9A 3M3IA 2WS92 4U7JA 3UGGA 3U10A 1S0JA 2Y8KA 3HBLA 3BPSA 3CC2P 1I3HA 2FJ1A 4JX5A 2VB6A 1OA4A 3M3EA 3RIRA 1URXA 3CX5E 3ZXFA 2A3SA 1R4MB 1U57A 4BEHA 1VALA 4ZKUA 2X53S 3TDZC 2JG9A 3BG7A 2ZTNA 2WNVA 2WUHA 1ND2A 5LW9A 2M3EA 2WSCH 2OT7A 1OLMA 3LA7A 4HOBA 3I5CA 1RC6A 2Y6LA 1W03A 3PUBA 2EBIA 1AX1A 3GHGA 1A6QA 1OFCX 3X2QH 4L9BA 4D6TJ 2NYXA 3BQYA 1QNWA 1XMAA 3LW5H 4XSZF 2B46X 2XRNA 2DMUA 2QBYA 1VBE1 1VR3A 2BBVA 1T0FA 3RPUD 1ENSA 3E6CC 2H88C 4MOAA 3T08A 4GO1A 2WDBA 3BATA 2MYSA 3OY9A 2EIDA 1BZWA 3RKYA 3A7OA 2B45X 2JEMA 4Q4Y3 3DXJF 1V00A 4OZXA 5GZDA 3PIOF 4HNTA 3L2UA 1HW1A 3B71A 2VZUA 1YIJP 3AP5A 3LOBA 1WLCA 4PT6A 4NHKA 5D5VB 2UXNA 3VBFA 2LOOA 2KSJA 2GU9A 3R61A 4M73A 1MZEA 5EQUA 3V8LA 3G2BA 2D97A 5AIQA 3LEMA 2WZPP 3PNAA 3WP4A 3R0AA 3TP0A 4ASWA 3G1OA 2IGOA 2CWSA 1X3UA 3CC7I 4NN0A 4W6YA 1YI2P 2P34A 4XF1A 2E5YA 4LBOA 1GZWA 3MTUE 4XUPA 3HD8B 1DHKB 1Z78A 4XBNA 3PNVA 1SQPJ 4PDKA 2BY2A 4FE7A 1JY3O 3HOYJ 4XHBA 1G9BA 3VDDC 2HU9A 5KR7A 1IRFA 2MNGA 5D21A 3BCAA 4DOZA 1W2OA 2W6BA 2ZHNA 2MHFA 2PLV2 1Y8AA 4C3IJ 3CC4P 1W6NA 2XUMA 1R1VA 2ZCWA 5DJTB 5CYVA 4GIFA 2ZA9A 1YIOA 3VKOA 4B4RA 3QODA 3QPTA 5FYUA 2V9VA 3AMQA 4NROA 2LR2A 4FPKA 1EZVG 2NVUB 1BBT1 4CU7A 2EIEA 4COUA 1QQP1 3NNGA 2QDNA 3V7SA 4RHV1 5EG0A 5FV3A 1Q8OA 3M9BA 5CKNA 4D5FA 5FRAA 3CX5I 4M71A 5A7OA 2DOEA 2XROA 2BGOA 3K77A 2X5IA 4RHV2 2V1NA 4QPOA 3VDDB 3TN93 4LORA 3CPWO 3ZFFC 4WB4A 5F7UA 1DX7A 1XYNA 4DXZA 2IZWA 5BU5A 1O5LA 2VRSA 3O8HA 4ON0A 5JSRA 3Q8BA 4Y99C 1FBMA 4IJAA 1OISA 1HRI1 4L5IA 4Q4X1 4SBVA 2RR11 3ZDMA 4A2UA 1NTKK 1E5SA 4IV3C 2XVGA 3WT3A 5GTHC 3GZ6A 3HSFA 3IZOA 1U9OA 2LW8A 4Q4X2 1V9U3 1SQVJ 2V1UA 2FBIA 2WTEA 1BCCE 1Y8QB 3H1YA 1X8YA 3MD2A 1VBB2 4DPNA 4LFUA 1JTZX 1JMBA 2DW4A 3NEUA 2STTA 1XX5A 1W2BO 4E70A 3ATGA 1Q8SA 4U87A 2G4IA 4W80A 3THCA 1V5EA 1RH5B 5IVVA 3DECA 1QGKB 3CF2A 3VMAA 1TL8A 4AHWA 3O1RA 4L2NA 3CWBJ 1S0DA 2L7KA 1H2MA 1RHI2 5FMOS 4C0HA 2IXHA 1UZYA 1PX4A 3SEPA 1DGRN 1WT6A 3LWCA 3DKXA 4A3BJ 1H9GA 2CH0A 2ZKZA 5B4XA 3B6AA 4KFCA 2F5CA 4JOMA 1T39A 3HTKB 4KWJA 4YIRX 3ZQGA 1OD5A 2VVFA 5FY4A 1E5WA 1NYHA 3SNMA 5IVCA 3U59A 2Q3EA 2NAZA 2B87A 1EUTA 4QB1A 1YW7A 4AVAA 4AD9A 2JA2A 3MQ0A 1QPIA 1IK7A 4AUXA 1B6AA 1TC3C 3S1KA 3SEEA 2WAQA 4L73A 1VQLI 1U5TA 4QTRA 3CXHH 5ICGA 1NH3A 4UNOA 4OINF 2E7QA 1TNSA 1SFCA 2W1QA 1Z0HA 4TXWA 4CP9B 1A35A 4ZNCA 3NXSA 2D3RA 5E88A 2ZX0A 4IE7A 5EFUA 3ZQ7A 3ZX7A 1OWAA 3WNKA 3OSFA 2M5AA 4LGDE 1VBD3 2WO1A 1EKEA 4Q4W2 5LRRA 2OTLP 1S7OA 4KNCA 5IYDJ 2YYOA 2HQ5A 1YFUA 5AW3B 1AHSA 2QIWA 3ZFGA 5AC93 1AQTA 1BGYJ 4JGZB 1TT0A 5T3NA 1VQ8P 2G19A 4QX7A 4GGGA 4OI2A 1D0ZA 1P7IA 4P08A 3E1F1 2VH9A 1N7SA 3H1JD 2R49A 1BW5A 3BCCD 2HZDA 5C4JJ 1MZBA 1SLBA 3FC0A 3HUGB 2KYVA 1RRJA 1SVOA 3FXOA 3NARA 4LBQA 3UYJA 4Q29A 2ECCA 4WCGA 2RS13 5CKQA 5AVZB 1GNYA 5BMZA 4Y4RA 3BALA 4A5MA 2V73A 5CFDB 4H44B 1SPPA 5CFDC 3C2HA 3F22A 3USUA 4C46A 4WXDA 1YFHA 4GWIA 2QQVA 1EAH3 2QSFX 2RM21 3KYLA 5AVRB 5GZEA 4IETA 3GHNA 4GODA 1GK4A 4RB2C 3OUHA 2E26A 1KYOE 3VEPA 4GH4A 2Q1ZB 2DYSH 3E5QA 2O8KA 3WV6A 4NC6A 2W0XA 3ZN6B 3POEA 3UGFA 3FXKA 2DAOA 3ZYJB 3C7OA 1VF5B 2QLZA 3CWBE 2FU4A 4HL0A 3S3MA 1H2NA 1VNDA 2D98A 5L73A 1IJDB 3NV4A 1X4OA 5KLVG 1LTTC 1F5TA 4BQ1A 2IW5A 5GKAC 3SWFA 1HX6A 4H44C 1HQWA 4XONA 1VBB1 3ALQA 3J81Z 5DAPA 2MG4A 1UN1A 4EN9B 3ZN1A 3CCMP 1U12A 1VQPI 1HV1A 5FZ1A 1OQDA 3WEZA 2DTZA 4DOUA 1MQTA 3FMQA 2E42A 3CCYA 1PK6B 5I8SA 3PVOA 3CXHD 4COZA 3M0DC 4HONA 1S2BA 3TEXA 4ASLA 1ZNPA 4E2GA 3M3CA 3IIAA 4K8RB 3AFGA 2HZTA 4XF0A 4HFSA 3MLJA 4C91A 1VL2A 1E79H 5FMOL 4H0EA 3JRHA 2AEMA 3PFYA 3KEYA 2QQWA 1PVC3 2J1RA 5JXJA 1SQBJ 3LSHA 5HDKA 3ERMA 3KQRA 1FV3A 4HNVA 4YG3A 3VYTB 1NLSA 3HDDA 3KETA 3GVAA 4HOOA 4IFMA 5D2AA 4C2MJ 5EWSA 3VBOB 4A6SA 1MVEA 2BGCA 1ZW0A 1GZ9A 4AZZA 2VUMJ 2FZ1A 1F9NA 3CCVI 2ZGTA 4EVIA 2W9XA 2EH3A 3AXDA 4LITA 1V4RA 3CXHI 2OUMA 3PSIA 3OYMA 3RL0g 1RYYA 2WWJA 2IC1A 3N9OA 3QBQA 4GCVA 1I5ZA 4YRVA 1GQGA 2ARCA 1KYWA 2DQLA 1HB4A 3WDXA 1L3JA 1R23A 2ZNYA 1FP1D 1P84E 3J9SA 1BK1A 5JXGA 1ZH5A 3SEQA 3MV11 2BW3B 2LBFB 1LT9C 2JX9A 4SLIA 5FZ4A 3NNJA 4AVCA 4DNCA 4ZHNA 1QMJA 2L4MA 5L3FA 1EPZA 3TAYA 3WG1A 2FXOA 3FKIJ 3F9KA 4U3FJ 2PQ8A 1W8HA 4AG4A 3H1JE 1SFXA 4JQRA 2YXQB 2VU9A 1AR81 2XBO3 1NWQA 5F3IA 4LA3A 5ILUA 1OW6A 3FM5A 1QNYA 3RDIA 2LYCA 3L71D 2XPVA 2ZX1A 1LFUP 3GHGC 1AR92 4QT6A 1JZ7A 5KAIH 5TISH 4B8XA 3O12A 2AEJA 2R041 5FZBA 2OYHB 3MFAA 5JOZA 4HSRA 1NLRA 1VQ9I 4Y1UA 3AAFA 3T1BA 4CA9A 3ETQA 3WUTA 2DVBA 1SFPA 2HOAA 5K5GB 3DTEA 2CUZA 2HDCA 4IDZA 5I0RA 5FD6A 3VBFC 4YEJA 1SBFA 1AVOA 4WF2A 3RL0D 2R5DA 4P9JA 5C70A 1JTYA 1IKQA 9ANTA 3KYCB 2ZGQA 3CMAP 2OS2A 3HSRA 5LGUA 2BERA 1NQDA 4EJOA 2Y6FA 2ZHLA 4A7PA 2VCBA 4MYEA 4ZYHA 4XF3A 4QKDA 2BP6A 4YGEA 2EIBA 3F89A 3NKGA 3BDDA 3AEBC 4E8DA 1FDOA 2CDOA 4DXSA 2HWE1 4N3YB 1QJU3 5F8PA 4YVSB 1XOYA 2L91A 2GIVA 3LB9A 2LVSA 2OQQA 4RQPB 4QX0A 4B86A 1ASJ1 4R79A 3S5AA 3F6VA 5CB7A 3GFIA 4G6QA 3SDGA 5A3NA 3BIEA 1J1EC 3ZMDA 4HG2A 2W84A 1KILB 1SQ4A 3O3KA 5A2QZ 1W1WE 4HK9A 3E0JB 2DTWA 3BTXA 2V7FA 2IXKA 2X5IC 5CG8A 1DYPA 4OHXA 4H4KC 2RS51 3PNTA 3WG2A 3LA2A 2AHQA 3MIDA 1YQCA 2C5DA 1X79B 2NPSA 3EHKA 4J25A 4HBLA 2YU9J 3JB4C 3FGAD 2RGVA 3V4QA 1K05A 1U8RA 4M4RA 2GC2A 3K4CA 2VMIA 4A0ZA 2ELKA 4I3PA 3IIIA 3MZ8A 2CY6A 1PIV1 4XJ8A 5DUVA 2XWJB 2HOEA 1QO0D 2E36A 1XU1A 3T8RA 2ORZA 4KU7A 2XAQA 4N7IA 5A7NA 3FWLA 2BGPA 1JTHA 3C3VA 1RITA 4IEUA 4NRQA 2JENA 1H1IA 4H55A 5BQTA 5FTTC 2WB1A 1SQBE 2WADA 1KV4A 3VSLA 3VHPA 4I76A 1GICA 4CP9A 3M0AA 5FPLA 3KWVA 1X22A 1PIV3 2UY9A 2XQRA 4ESBA 4H13C 5KLVK 5JXIA 3QAHA 2M5AB 2FRHA 3A4UA 2KHMA 5BNNB 5L36A 5J8FA 2VZ3A 3HEFA 1ZBE3 1P4AA 2WY7Q 2OQ6A 2QF7A 4B47A 2ZJRF 1MS8A 5BS6A 1XJAA 3BPXA 4KT0J 1K5MB 1FBSA 3ZYGA 2RS53 1R58A 1NUKA 3N9LA 2C9NY 2F2EA 2MC3A 1KFXL 1XGOA 1GWLA 4R4ZA 2W52A 3UKVA 3R6SA 2D2CC 2HTJA 5KHKA 2OZJA 2BDRA 4Q4W3 1FOWA 1MS1A 4JZRA 3MV01 3OBAA 1NVOA 4XETA 5LCWL 1QVTA 1X1CA 2Q5UA 2W92A 1GLHA 5FKBA 1Z7S2 3PU8A 1OPOA 1FBUA 3BOPA 3AYDA 1W28A 3RZHA 1Y1WJ 5E8AA 4XAAA 5DDJ2 3HXLA 4WV8A 1UF2C 3WD5A 2EALA 2UUZA 1R00A 3KP5A 4NAMA 2DA4A 1R1A2 3KZIC 1K7AA 3HJRA 2G9ZA 3GW2A 5FZEA 1Z21A 1JOCA 2GALA 5A3TA 1X8EA 1FOKA 1JE8A 4FXKB 2G7HA 3CP2A 2WZ7A 2I74A 3WU2C 4R9CA 2CGPA 2VBWA 3H32B 2VGDA 4PSXA 4WVVA 3CCUI 1W8OA 2XL9A 4BACA 3FUQA 2XAHA 5CZKA 2MLKA 1I1EA 1TZOA 1BVP1 4A3GJ 1VQ9P 3RFRA 2P58A 2ECBA 4PIYA 4II2A 1W8FA 1JCCA 1BI2A 1CESA 1SQPD 3TEDA 5ANNA 3IR9A 1D4M1 4LULA 3UKGA 3L71G 3WUVA 2D1HA 1BSNA 5APTA 2DJNA 1X1AA 5TISE 1UZVA 1KQRA 3MLLA 4LG0B 2UZKA 4WZFA 2M0MA 1PM7A 1YBKA 3PDQA 5FPVA 4KIBA 3CZ6A 4ZPIA 3I8TA 1XNKA 3DEWA 5DUUA 1W2UA 4X8PA 1ETWA 2MC4A 3WNXA 2LKXA 1QKQA 3N05A 3ILNA 1FIPA 4GDFA 3VBHA 4ESJA 5KKZC 2Y34A 2K02A 1O4XA 1XTAA 2FCTA 5APWA 5FUIA 1PO22 4XIKA 5A7SA 1ODNA 4KA4A 1E3OC 3MIWA 2JP3A 2VOOA 1W0UA 3KP2A 2WAAA 2DOFA 1M06G 3LEGA 5CEHA 1LT9A 1RUI2 2XGDA 1V6OA 3K70C 4RGSA 1WCSA 2WNEA 4OHVA 3I59B 4OYUA 4G6DA 1YEWA 4A3CJ 4BH9A 4A4AA 2CK3H 1G6NA 3M4FA 5EJ3A 3T1LA 1A6CA 4AQRD 2E34A 1OFNA 2WL1A 2DVAA 2L54A 3RK2C 2DN0A 2GC0A 4EIJA 1VF5D 4BE1A 2TEPA 2E7AA 3ABMH 2BTVC 2DODA 5DS9A 4O61A 2E7XA 1OQEA 5KTBA 2IS4A 3B7MA 3MIHA 3ZYPA 1SQVE 3WW2A 5FD5A 2H09A 4KWUA 5FZAA 3I56I 4JF7A 5JOWA 3V0AA 1W5SA 6PAXA 2WO7A 3H5AA 5FZKA 5EP9A 2KP6A 1CAXA 2E43A 2J7MA 5DAQA 3OJAB 3VHRA 2K4JA 4HF0A 1IN7A 1LR5A 4Q4V2 3VOEA 4Y20A 2BCCJ 1LGBA 3HUGA 2NS7A 4MTDA 4EV0A 2D1VA 1SANA 3AE9C 3AKSA 1DGRM 5ANQA 5F5AA 5IK5A 1KD1Q 4I0AA 3KYDB 5C8WA 4ENMA 4RFRB 2QEXP 4MN4C 1IS3A 3K69A 5FYCA 3QRFF 3O2PE 1WRJA 1LGHB 1GD2E 2ARBA 1AYM3 4LBNA 4IL6H 1AR93 3KX2A 5E16A 3VL9A 3I56P 1ZM1A 2P7VB 4M01A 3BN6A 4AC0A 5DCMA 1YJLA 5AFBA 3ZFGB 1TWHJ 1AA7A