1OMIA

Crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
224
Chain Sequence
GSEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 72
structure length 224
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1omiA03
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1omiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1omiA01
4RB0A 3V7CA 1C0WA 1ON2A 4E2QA 3RI4A 1J2XA 1ZZ6A 2V79A 1UHWA 1IN6A 1J3QA 1U5TC 2W84A 1GHCA 3SCGA 3M1EA 3QP5A 5HS7A 1JE8A 4LLNA 4LTAA 4G7OF 3W6KB 5F1RA 2PLYA 1JHFA 1BN5A 5F6FA 1EPZA 4HZFA 1XDSA 3BP8A 2PMUA 2RDPA 4A12A 1T38A 3E6MA 3ML6A 1Y3TA 4GULA 4O9GA 4F7ZA 2DI3A 2C6YA 4MH0E 3UKNA 4M9XA 2I45A 2FMYA 5D4RA 2E1NA 1XE7A 2DK5A 2AS5F 5ERIA 2VQAA 2OYZA 4I02A 1FC3A 5DUKA 3HYIA 3EYIA 3K1NA 3KEOA 2RC4A 5FB2A 4UV8A 3BJAA 5E18F 2FQ3A 1LDJA 2MBFA 2OZ6A 1FBQA 2VBWA 3CF6E 2DBBA 3HRMA 3GZ6A 2UXXA 1BC8C 1YQAA 5T3NA 4ENKA 3WTVC 5D5XB 2FEZA 5CU1A 2YX4A 2Z3YA 4LEJA 4M9SA 3TNQA 5JCTA 5BQTA 3EQEA 3PVBB 3UKTA 3HUGA 1BOAA 4AWXB 1MJAA 2L01A 2Q30A 2UWMA 4E70A 3CUQC 2WTEA 2YPRA 3KEQA 5LEKA 2UXNA 3C3WA 5DUIA 4UVAA 5I8SA 4OIOF 3ISPA 3C1DA 4M71A 2P7CB 1AJYA 1UHMA 5HDGA 1W5SA 2CO5A 1FZPB 1X82A 2QENA 1KYZA 4XSZF 1SFNA 3R60A 3J81K 4IEOA 2QQ9A 1USSA 2MC3A 2QVOA 4HOBA 3E97A 4IETA 2KRFA 4PJYA 2FOKA 3M3IA 3JAMZ 5JR7B 3BPVA 2Z2SB 4IEZA 2Y0MA 3TGNA 2XLAA 2DQLA 4UUVA 2YR2A 4PGHA 1VJ2A 1R23A 1XGNA 4IEVA 1OI6A 2KIMA 2OU2A 4BYYA 2CWEA 5H6RA 3V4GA 2A68F 3R4KA 4YFKF 4IHTA 2ZJ2A 3LA2A 1X7NA 2FMLA 4IF4A 4B29A 4KWKA 1YFHA 3LFKA 4AVPA 2M5WA 3HRSA 4HF2A 1X8EA 3D0JA 1NXMA 2BNOA 2ADUA 3FM5A 3FHZA 3LZZA 4MGZE 2FNPA 2H09A 3HSEA 4QM9A 4TLFA 4HF1A 2JTVA 2MLKA 1MDMA 1B9MA 4S04A 1OD5A 1DP7P 4IVNA 2ET7A 4G9YA 1FY7A 2K7LA 5H6QA 1PP7U 3LSTA 2BNMA 2N7GA 2ZO4A 3S2WA 3HHHA 3FZ3A 2MLGA 3JTGA 3U1DA 5J3UA 3TKYA 2H94A 1OMIA 4ESJA 4L11A 1SD4A 1KU3A 1B9NA 4GYGA 1YFXA 1BI1A 1BM9A 1FDIA 3HTSB 5BMZA 3BU7A 3VFZA 4IRHA 2PAKA 4EWDA 4AQ6A 2WWYA 5LHGA 4H7LA 3CO6C 4YIIA 4LB5A 1QGPA 3P9IA 4UBHA 2FF4A 2K4BA 4LMYA 4KMFA 1BJAA 5KHJA 2EV6A 4MGIE 5ICEA 1ZH5A 3HT2A 1GQGA 1IN4A 4RGUA 1IRFA 3G3ZA 1K7AA 3ZQ7A 4A6DA 3RDIA 3WODF 1QZYA 3CDHA 4XETA 1RI7A 1IN5A 4ENJA 1ZVFA 2IPQX 3FFQA 4HN1A 1YFYA 3TO6A 2FBHA 5J7MA 4EGYA 2FXAA 3GWZA 3QP6A 5HDKA 1XB4A 3MPBA 1ZRDA 2IXKA 4HVRA 1ZGJA 3NVCA 3J80Z 5FLJA 3WU1B 2DU9A 5ILUA 3BPZA 4EJUA 1FOKA 1JHHA 4KWLA 1HW1A 1W4MA 3KP6A 2O03A 2RGVA 2D40A 4DQ2A 4XBFA 1I1GA 1FYKA 2VBXA 4LA2A 1UW8A 3H8UA 2OZJA 4WWCA 4Q0VA 3OCPA 3R0AA 4P5OA 2ZKZA 1UIJA 4L9VA 4J1WA 4ZH4F 1KU2A 3EUHA 2MH9A 4ASNA 5L3BA 2XASA 3E6DA 3LQRA 3ROUA 2VC0A 4KIFA 1R1UA 3E5XA 1CX4A 1XSDA 2YSRA 1JXSA 2O8QA 5K8SA 1J7KA 4XFGA 1Z6RA 4IRIA 4U7BA 2CGPA 4KUMA 2CW0F 3HSRA 5K5OA 4LA3A 4NB5A 2K0GA 3H1MA 1TNTA 5KHGA 3IRRA 4ON0A 1XRUA 2PN6A 4JVAA 2EFPA 4NVPA 3U9GA 3I64A 1GQHA 1RIOH 5I93A 4P55A 3GUDA 4KNYA 4XF4A 2IXLA 4D7SA 5KHHA 2ZNYA 4WX9A 1U78A 1WI9A 2XHKA 4YIFA 3BJOA 2UZKA 2QM3A 5LRRA 2GA2A 3H92A 2DTRA 5HS8A 5E1RA 4HSJA 2HR3A 1WRJA 1XGMA 3I59A 2O1QA 1QBJA 1CF7A 3L9FA 3T5XA 1IPKA 5I0TA 5E8IA 4HLYA 1OPCA 1FLIA 4EJVA 2HYGD 4IEQA 1MD0A 2XKPA 2COMA 3TDUC 5I8YA 4HLXA 1EH8A 4KA4A 3E3VA 5J6XA 1R7JA 2LF7A 3F21A 2WV0A 3H1YA 2NRAC 3KCCA 3ZP5A 4G6QA 1B6AA 2CV6A 1P2FA 3GXOA 4HSLA 4GXOA 1UIKA 3KP5A 4CICA 4Q4ZF 2EAAA 2IJLA 2VC1A 2PHLA 2P8TA 5I0SA 4MTDA 1CAUA 4UVBA 1LRHA 2R3SA 4WK8F 4A0ZA 4IRGA 2XGXA 1U12A 4XFBA 5I0RA 3H7YA 2MH2A 1D8KA 4BAYA 2ZKLA 3TOAA 2EA4A 4A5NA 2XL9A 1O57A 2XLGA 1O3RA 4WF2A 2XV4S 4ETSA 3EBRA 1CAWB 3EYYA 2HYFA 1O5UA 3SXWA 3CO7C 2IRFG 4AVCA 1H1IA 4WVZA 4RGSA 3B73A 4AIHA 4O9EA 4XEZA 3S0MA 4X6QB 2QNKA 3D0SA 2PG4A 2VE9A 3DEUA 5KBFA 1IRGA 2W24A 5ED4A 5FFZA 1ULYA 3QRFF 3BROA 1ZARA 3DV8A 2XIGA 3EWKA 2IXIA 1D5VA 4UXNA 4OU0A 1R5GA 3P9CA 3MZHA 2UYBA 3TOBA 4ESBA 4G6DA 3IBMA 1RGSA 5H20A 4KYWA 1RTVA 4Q29A 4D7TA 5E1ZB 1YG2A 4Y13A 1YW9A 2Q8KA 2KIUA 3C7JA 1MJ9A 1EP0A 3EETA 5ICGA 3DQVC 2W57A 2K86A 3V8JA 3IDCB 1WMKA 3ZDSA 1CGPA 2B9UA 1TLHB 2DQRA 1MKMA 1UFMA 4RAZA 2F4PA 3ZN0A 4DINB 1BI0A 5E1XA 1J59A 4JBAA 5AONA 5EFUA 4R52A 2A5YB 4KDPA 1FP1D 2BGCA 5D8LB 1AOYA 5ICCA 4ZYDA 2PAEA 4WBBA 3IWFA 1PUEE 5CVVA 3GVAA 4AD9A 2BEOA 1J0RA 2O3FA 2QBYB 5FQ0A 1HXDA 2HEOA 4I7HA 4U0YA 3ULQB 2A6EF 2M45A 5FFXA 2XAGA 3M8FA 5J48A 5F64A 4EVIA 3WU0A 2QLZA 3PLQA 1ON1A 3S7EA 3LAGA 5K5RA 3CTAA 2VT2A 4A5MA 4L2NA 4M6XA 1YFUA 5IT9Z 4IEYA 2Q1ZB 3M70A 3QACA 2GAUA 4ESFA 2UYAA 2MA3A 2L3DA 2VN2A 4R8HA 2Q4SA 2M30A 3SQNA 2D45A 5D4SA 1XD7A 3OTFA 1HKSA 1OKRA 3C18A 4E2GA 3G7DA 5FDBA 2V09A 2DT5A 2L4MA 1CAWA 4HDVA 3HHGA 2Z33A 1QWRA 5E17F 2CFXA 1G3SA 2V9VA 5DCFA 1W5TA 2H27A 1LKNA 1NZCA 2OD5A 1STZA 2STWA 5BXXA 4MHGA 1O3SA 3ELNA 4HX7A 2RN7A 3H3ZA 4EGZA 2GQQA 3WTYC 5DYMA 5HOOA 4HX8A 4MGYE 2M1BA 4O3MA 1TTYA 5L3CA 2F5DA 1HSTA 1Z91A 3JSPA 2XRNA 2R7FA 3PQJA 5JI6A 1KQ9A 3HTUA 4I0AA 3CLPA 4CDGA 4HMZA 3ZPLA 2D5HA 5ICFA 1RL3A 2V1XA 2ISYA 2CAUA 3T8TA 4FAHA 3WTWC 4IHSA 2O61A 1Q3EA 3H9AA 3LQQA 4Z07A 3I4PA 2GIVA 4Q0SA 2EFWA 3K1PA 1VR3A 1TNSA 5ILVA 1O7FA 1IXCA 4XF3A 2D2WA 1LEAA 4JTOA 1HKQA 3DFGA 3TDZC 3DKWA 5BY5A 3JZVA 3MEXA 4WXHA 2EWNA 5L3GA 1S6LA 2RV8A 2H6BA 1ODDA 5FO5A 2Z9OA 2HWVA 4B8XA 3H1WA 1KQ8A 4ZU7A 5JHUA 1FNNA 4JTNA 3L2HA 2LSOA 1D3YA 1TQMA 4LK1F 2QCSB 3EHKA 1EY2A 3FZVA 3R0JA 1YO5C 2IW5A 3MWMA 4CHUA 1S3JA 4OMZA 5HLGA 4EM2A 2XAQA 2OBPA 4XRFA 1YS7A 5KK1A 5BS6A 1ZYRF 4M6YA 3GFLA 4FBFA 4Q48A 1YHFA 4XFFA 2HQRA 1I6XA 3I54A 1SD7A 1LVAA 4UXAA 2XKOA 2EB7A 1HKTA 3RZZA 2D1HA 2XL7A 1OYIA 4QXKA 2OPKA 3WW4A 1PP8F 2ZXJA 1CAVB 4RB1A 3GEZA 4I0BA 4OOIA 3V7SA 5EZWA 4XFCA 1ZG3A 3EJKA 2GXGA 2Y75A 1IZ1A 3RKWA 3M7GA 1P4XA 3DP7A 1XGSA 4KL1A 4BIFA 2A3SA 1J3RA 4Z2YA 5L3DA 2OA4A 2P4WA 4BQAA 2PAMA 1H0MA 4YSFA 5IT9K 4ZYGA 3GFIA 3E6BA 4ENNA 3GBFA 1TQIA 2JPBA 4N0BA 2PQ8A 2M87A 2Z69A 5HI0A 3SHFA 1TW2A 3WE3A 1L3LA 3FWEA 2HS5A 5FCCA 1RC6A 2V1DA 3L00A 4YFNF 3IDBB 3USSA 1KA8A 3N4MA 4WCGA 3ZMTA 4LJZF 4OIQF 4GGGA 1FPQA 2CSOA 5E1WA 4IEXA 3ABUA 3VOEA 1JGSA 2HKOA 2W25A 4RGXA 3MAJA 2DFIA 2H6CA 2BBYA 5FLXK 2E9QA 1BIBA 3KP4A 3KFWX 2QBYA 1FDOA 1ZG5A 2ZMEB 1IXRC 3OV8A 3KETA 1Z9CA 4YG2F 2KJBA 3QPHA 2Q0OA 5AIPA 4Q5SF 3SFZA 1DGRA 5JSOA 4R79A 4Q0QA 3KLOA 3ZMZA 1Q5OA 4BHPA 3F8FA 4CZZA 5FQ0B 4KT5C 2IA2A 4BNCA 1ZZCA 4U7DA 1AWCA 2C0ZA 1P6RA 4QLCU 1SD6A 4LULA 4IJAA 4MTEA 4QMAA 1XCBA 4HX4A 1IPJA 3C3VA 3NEUA 2QZ8A 4DNCA 2F5FA 2O0YA 1FYLA 2XVCA 2PHDA 2XAFA 3SZPA 1USTA 3QOPA 2E7XA 1SFEA 3CEWA 3RYRA 4YYOA 3HOTA 3ZMUA 1B59A 1FXZA 2MHFA 5HDNA 3QU6A 3KP2A 3Q5FA 2G7HA 4XFHA 4S05A 4AVAA 2L4AA 1QNTA 5A2QK 2DPUA 4HBLA 4AIJA 2RNJA 5CVIA 3O14A 4RB3C 3RNSA 4FX4A 5JSPA 4LLGF 1HBXG 1J75A 5CADA 3CL1A 4UNOA 3FMRA 3L2CA 2FSWA 1CAUB 5K5QA 2FU4A 2AXLA 4KU8A 1RZ4A 4WZCA 1R1VA 4KU7A 3MDPA 4EMSA 5K1YA 5HVQC 3PNAA 1K78A 3ECHA 3RPQA 1S7OA 2DPDA 5KVRA 4KIGA 3RTRA 2EK5A 3MZYA 1LQ1A 2X4HA 1X8MA 1LDDA 1K6OA 4XF9A 3GYHX 2LDUA 3NKTA 1H9TA 3DF8A 1HSJA 2B8MA 4BHCA 1V4RA 4Y15A 4P96A 3ST7A 2HZTA 3BOQA 3BWGA 4R1HA 3SXYA 3ZMSA 5AVPA 2V6CA 3I7DA 1WSUA 1T2KA 3PQKA 3FX3A 2EFQA 2LKPA 4BXUA 4HQMA 1XSXA 2FBKA 5AIQA 1EH7A 2STTA 3CJNA 4G7HF 1GXPA 5DEQA 3V7RA 3E6CC 1EV7A 3GZ5A 3BB6A 4CXFA 3FHIB 3OGJA 3GFJA 2FRHA 1REPC 1ZLKA 3F6OA 1FBSA 4LGWA 2DLLA 2P5LC 1LNWA 1ZAOA 1XCVA 2E7WA 3FMSA 3O2PE 5L3EA 2ZMEA 2ACJA 4WXDA 2EFNA 3VHRA 1ZG1A 1IN8A 2J5PA 2NS0A 3E5UA 3BALA 5LGTA 3GW2A 2IXHA 2K27A 1YW7A 4PIYA 3BJ6A 1U6GA 2VONA 3GX4X 3J81Z 4I98B 3ERED 4XLNF 1WLTA 3ELKA 1Q43A 3I53A 1ZRRA 4WXCA 1IW7F 1W7PD 2DAOA 2O8XA 5JSRA 3H7JA 2VODA 3Q9VA 3ACLA 2ZNZA 2J5OA 2IC1A 3S7IA 3SCHA 1SMYF 1P4WA 3MYXA 4Z82A 4EJWA 4NQWA 4G94A 2D1VA 2UY8A 2QUFA 4QX5A 2CAVA 1NE6A 1I5ZA 3WG9A 4HQEA 3P9KA 1O5LA 2GC2A 1YIOA 3VB2A 1G3TA 4G8XA 5DCMA 3I71A 4A6EA 4LUMA 2IXJA 1P92A 2HKXA 3LA3A 1DGWA 4PIZA 3T8RA 1CF7B 2Y0OA 3CJXA 2KXLA 4XFAA 4HVOA 4L0ZB 1WA4A 4L5IA 4FT8A 1IAWA 1LJ9A 3T0YA 2G9WA 5TJJA 3IKVA 3WTZA 2RVCA 4RB2C 3V8LA 5EEHA 1U5TB 1FX7A 3HRTA 1DPUA 2QDRA 3IN6A 2JPCA 3DPTA 5BOXA 3W6JB 3I0TA 3BPXA 4FX0A 4NHJA 5EEGA 1HQCA 2EA7A 4MUVA 1YLFA 4MEXF 2QWWA 1ONVA 1ZZ9A 5FPZA 3OD0A 5J8FA 5JAXA 3ZMDA 3RYPA 1FT9A 1BC7C 2ELHA 2GWRA 3LAJA 1X3UA 1MGTA 2VOOA 1SD5A 5E16A 4OMYA 3WW1A 4JV4A 4OIPF 1WWXA 3UKVA 3HT1A 2PJPA 2NYXA 3LOIA 4A0YA 4MNUA 1MJBA 4EM1A 4LD5A 4Q47A 3U11A 2EFOA 3DL3A 3O3KA 3O6QA 3TNPB 1QPMA 3FXQA 3GO5A 1SEFA 4P9FA 1LDKB 4BH9A 1GXQA 3WGHA 3JTHA 1ZREA 4LLLA 1Q1HA 5DD4A 3WW3A 3FXUA 4F8AA 3DN7A 4I3PA 4IEUA 1OFNA 2PFWA 1XMAA 3MFKA 3CUQB 2BYVE 3SHRA 4CYDA 4EQQA 5CJ9A 1V3FA 2HGCA 2IVMA 5LHIA 4PDKA 5FPXA 1VTNC 3M8EA 2PTMA 3ECOA 1ZX5A 3Q9SA 2H0VA 2HQNA 2CQKA 3K9TA 1SMTA 3M9AA 3FXRA 1Z7UA 4OFGA 2ISZA 1O4TA 5D5UB 2VXZA 3KMHA 1CAXB 2F5EA 1UCXA 3VEPA 2A69F 2V1UA 3GYDA 1F1ZA 1ZHFA 3CUOA 2ZFWA 3QAHA 4KICA 4D0PA 3EQLF 3AAFA 4YNIA 1P4AA 3EO6A 4HAMA 1U3EM 1RNLA 4QWQA 3ES1A 4OLLA 1F4KA 3U10A 3COAC 4L9JA 2PA7A 2BE5F 2G8YA 4P9GA 5BV6A 3RYKA 5I8TA 4PZJA 3PFIA 4OINF 2L54A 3ZN1A 3NL1A 2ATFA 4IERA 3N97A 2F5CA 4HN0A 2VECA 4EV0A 4LLOA 1FWZA 2HTSA 2QVSB 1EYBA 4FHTA 4MEYF 4EM0B 2PYTA 5D1IA 3NW4A 1PMIA 4MV2A 3IRQA 5J8CA 3JW4A 1LR5A 1T39A 5BPXA 1ZRCA 1QY4A 2YX7A 2VBYA 3LWCA 4KIBA 2KIFA 3ZMVA 4XF0A 4HF0A 1J58A 4L18B 3QU3A 4RD7A 2RKHA 3G73A 4UBGA 4AQ2A 4AVBA 2Q2EA 5C8WA 4HDUA 2EVXA 2EA2A 3D5LA 4Y17A 3L7WA 2JSCA 1QXJA 4HVQA 2ESNA 3WW2A 4X6RB 4A2UA 3TO9A 2VOPA 3R6SA 2IXCA 3CUQA 2K9ZA 2OZUA 4HYEA 5CVJA 2NAZA 4U88A 4IPAA 2D93A 1IF1A 1UB9A 2P6SA 3BY6A 4M9ZA 2HTJA 2M8EA 2GA1A 3J80K 1L3JA 4JK1X 1TW3A 4META 1SQ4A 3OF1A 1NE4A 2X0LA 5LGNA 4ZYEA 1J9IA 3WGGA 3TO7A 4L0YB 1YWKA 2GC0A 2WC2A 4UV9A 1PM7A 1S8NA 2UY9A 2EV0A 3KZYA 3IWZA 4EJOA 4H0EA 4PIXA 3MQ0A 1B4AA 1R1TA 5E20A 2RQPA 4OIRF 1K78B 1B1BA 5IT3A 3T1BA 2B5HA 5LEJA 1E17A 6PAXA 3DXJF 1KU7A 4RAYA 1FBUA 5CVRA 1H9GA 2FE3A 3F72A 3CLOA 4LUKA 4GO1A 4MZUA 1H1MA 4XLPF 4HBNA 3LWFA 2LF8A 2A6HF 2WFPA 3LA7A 2PFBA 4QGNA 2K02A 3F22A 1JUHA 1BI3A 2F2EA 1HW5A 4KN4X 4XSXF 5LHHA 5HLHA 4MX3A 1U8RA 2DO7A 1O7LA 4EWEA 1TBXA 1FSEA 1SFUA 5JFRA 1V70A 1ZZ8A 1R5HA 1NHAA 5FD6A 1UD1A 2ETEA 4U0VA 1TQPA 3F6VA 2XLFA 3FE5A 1ZGAA 4EWAA 1DPRA 2HDCA 1OYYA 3F8CA 1YLLA 2O6GE 4O5VA 4N9HA 1LEBA 2G7UA 5CVUA 5D5WB 3HRUA 3IIAA 1WQ2A 1O3QA 2XAJA 3FF5A 3IL2A 2QYOA 4K8FA 3KZZA 1Y0UA 1WKMA 1J5YA 3FJSA 1IXSB 1BIAA 1YTYA 5FLIA 1RUOA 2CYYA 4HV5A 1PDNC 4QGMA 1WGPA 5FGMA 2ETHA 3H25A 4Q0PA 1E2XA 1XSVA 1ZZBA 4PGGA 2E1CA 4EJTA 4XFIA 1XGOA 1Z1DA 1U2WA 3I5UA 4ENMA 3SCFA 2JZYA 3R61A 1MZBA 4K2EA 1O3TA 3CO2A 5LRSA 1G4DA 5DDGA 3V8KA 4AIKA 2GZWA 4FAGA 2ET1A 2GC1A 4KN7X 1ZMEC 1HW2A 2Q0AA 2OQRA 5BPDA 4UHTA 2IT0A 4E2SA 3VODA 5C6CA 3I58A 4MQVA 4I09A 2JT1A 2XROA 1YS6A 5I91A 2FBIA 1NYWA 4LFUA 1S7AA 4O6JA 2P5VA 1W7PA 3KLNA 3P7NA 4IXAA 5D6FA 2P17A 4J1XA 3GLXA 3RJPA 5HLIA 3IC7A 4QGLA 2L02A 5FD5A 5ILSA 3H3UA 1FSHA 3GF2A 4IEWA 4B09A 3GFMA 1F5TA 3NJZA 1XMKA 2HOEA 1K79A 3NQOA 5KHKA 3IHUA 4ONUA 1ZNPA 4LG0A 4YFXF 1T98A 5LLQA 5CYVA 1RUNA 4ZZDA 1R00A 4MGRA 3K1MA 2Z5UA 3NRVA 5JR3A 4M74A 2LNBA 4CGZA 3WTXC 2KJCA 1I27A 2P7VB 3IKTA 5I0UA 1I1SA 3KE2A 3KP3A 2D5FA 1EH6A 3SZTA 4JQFA 1TQ5A 5FLHA 3KSCA 1R36A 1BI2A 2DCTA 3HOSA 2GH2A 1CAVA 1SFXA 4XF1A 1OYWA 2XAHA 3U2RA 4HV6A 1QO0D 5D5VB 2FA5A 3E5QA 2Y48A 4G7ZF 1YFWA 3BDDA 3JSOA 1T0FA 3F23A 3WE2A 1F9NA 2P6TA 2EJRA 5BPIA 4ORFA 3K69A 1FP2A 2GXBA 3DPLC 2XUBA 1YW8A 3K2ZA 2KKOA 1G3YA 3F8BA 2GC3A 1UCRA 4I01A 1DZRA 2FNAA 3WTTC 2VBZA 1LB2A 3F8NA 4IESA 2QQAA 1BBYA 3FMQA 4KFCA 2IA1A 4BHBA 2P10A 1XDUA 5KHIA 1GVJA 1KU9A 1ZRFA 2PQQA 4EROA 3WTUC 2A61A 2IA0A 3ETQA 1XN7A 1Z6TA 5JVTA 3H50A 1T6SA 1CAXA 3L09A 1G6NA 4ZU4A 5LGUA 1J3PA 1IUYA 2B0LA 3I59B 5D6EA 3WGIA 3REOA 4Q0UA 5BUVA 3TQNA 1D8JA 2OAZA 2FQPA 3HQXA 1FYMA 4LB6B 1DDNA 1YUDA 4L5JA 4P9UA 5E8GA 1VP6A 5D8KB 1ZLJA 1SAXA 3KGZA 4M73A 2IP2A 3RKYA 1U5TA 2PMHA 1L0OC 3U0ZA 3EDPA 4ZU5A 1R22A 1J1LA 2MNGA 3O6BB 2PEXA 1MDMB 4HA8A 2OQGA 1W7PB 3FM3A 5HS9A 2VPVA 4YARA 2VT3A 1DUXC 2Z99A 3D82A 3ABTA 4U0WA 3WTSC 4LK0F 2YU3A 2TDXA 4CO8A 2CG4A 1KGSA 1QZZA 4KMUX 4GCVA 3BZ6A 5FLXZ 2R7DA 3F3XA 5L3FA 2OA2A 4L9NA 2NNYA 4KWJA 4AXOA 2MD5A 3OOPA 4RS8A 3QPTA 2PI0A 3BCWA 2QJVA 4IEPA 2HFHA 3MCZA 4LG0B 1DZTA 3SMHA 1R58A 1KYWA 1FI2A 3JAMK 4I2OA 4A0XA 3HIFA 2NNNA 5LBQA 2QQBA 1KQ0A 4ZZLA 4ZYHA 2VE8A 2PBIA 3ES4A 2BNNA 4UVCA 2ZBKA 1OR7A 5TRDA 2ESHA 1G3WA 4PCQA 4M72A 1UPIA 4HLTA 3NSTA 2ZCWA 3HSFA 2A07F 2MPFA 3RKXA 1Y9QA 1XE8A 4HW0A 1YYVA 1ZN2A 5DCMB 3K0LA 1A04A 4L9TA 1QXRA 4QM8A 3RIRA 1S29A 4MQ9F 2DK8A 2JRTA 2K4JA 3KP7A 4RGRA 4TV7A 1QQIA 2DW4A 3B02A 2BV6A 5DD8A 3F8MA 4MGKE 5CLSA 2EV5A 1Z05A 5A2QZ 3LAPA 4N9IA 1ZZ7A 2W85A 4YRDA 2P5KA 3J7AO 4GYIA 3KGLA 3RPUA 2GU9A 5DV5A 1IN7A 2HJIA
chains in the Genus database with same CATH superfamily
3Q3DA 5HNFA 1C0WA 1ON2A 3W20A 4E7ZA 1IN6A 4KQ7A 4EN7B 1RF1A 3HPNA 1GHCA 3MF9A 1RINA 3E1RA 4AVSA 3PTYA 3CBNA 3TW7A 5IVEA 4G7OF 5F1RA 1JHFA 5F6FA 4BUPA 3BP8A 2E7TA 1C1LA 5C71A 4A12A 3V4QA 3H8RA 3E6MA 1DHKB 1EXIA 4B4CA 3AE4C 3ZIWA 5EWSA 1Z7S1 4O9GA 2DI3A 4MH0E 2Y60A 4RS5B 3URFA 3PNTA 5D4RA 4QKDA 2E1NA 2AS5F 2YB7A 3C8VA 3U1XA 1YC61 2C9KA 2VQAA 4LKEA 1E0EA 4FE4A 5DS9A 1FC3A 2UWJE 4GOEA 5DUKA 3HYIA 1VPCA 1KZHA 1N7SA 2RC4A 3K10A 3BJAA 2MBFA 3M3EA 2E74D 2WA0A 1KD1Q 2VBWA 3T2OA 3AE8C 3S3NA 4I6ZA 4C9YA 1MFTA 1RUJ2 1V0AA 2C4XA 2WAAA 2YKOA 1BC8C 5HPOA 3WTVC 3GTPJ 5FMDA 1KB9D 4P9WA 2DOAA 1H30A 4LHSA 3HM5A 2ZX3A 3UKTA 3OYWA 1MJAA 2OX0A 4O65A 2MW8A 2PP6A 3KDPB 1LHOA 4E70A 1ERDA 3CUQC 2WTEA 3P3PA 2YPRA 5AW7B 2YMYA 1FOWA 5FO9B 3M06A 1PIV2 2D2CD 3NMDA 3GTLJ 2L2OA 2IGNA 4OIOF 4BQQA 1RUE1 1AJYA 2CUJA 1GL2D 2CO5A 1FZPB 4K40A 4LKDA 4ZZ8A 1EC5A 3J81K 2QQ9A 3L74E 3OGRA 2QVOA 1RHI1 1G2CB 3L9JT 1ENQA 4IETA 2KRFA 1CI6A 4Q27A 2DMTA 2W4SA 2FDIA 4RDUA 2BV4A 3M91A 2ZEYA 3JAMZ 4NRPA 3S93A 2F4MB 4WY4A 4UUVA 4HKOA 2YR2A 4PGHA 3N7MA 1VJ2A 1R23A 4JDOA 4MO7A 1S7EA 1XGNA 1XPXA 1MS0A 3MIEA 2XUMA 2DFHA 4ZXKA 3R2PA 3RWNA 3PO3J 4YFKF 2JDKA 4OH8B 1BBT1 2E35A 5FRAA 1QHGA 3LSGA 1WCQA 4GDOA 5DJUB 5T54A 3BTCA 2ZXHA 1OLME 3AL0C 4BK4A 2HXIA 4ZTFA 4AVPA 3HRSA 1G1JA 1NXMA 3A4UA 2MD0A 3NNLA 1NYHA 4H55A 4ZKTB 4XN0A 1F31A 2FQ4A 5DUUA 4TLFA 4EZ4A 2P7JA 2JTVA 3TOJA 1URQA 1B9MA 3RZKA 4S04A 4RGGA 1DP0A 4IVNA 4G9YA 2EF6A 4OHXA 5H6QA 5FMBA 4OI0A 4FPKA 3PUAA 3LSTA 2JB4A 3JRIA 1NTMJ 5LA2A 3FZ3A 2VTXA 5KAFC 1BQPA 4BXFA 5DAQA 1FPN1 5E8AA 3ACFA 3C7GA 5AVUB 1EKEA 3FHAA 1BI1A 2K9QA 2E75D 1G8WA 2ZA9A 2LBFA 1CD3G 5JMCA 2QQLA 3VFZA 4BDYA 3KVAA 1WPKA 1BZWA 2WWYA 3L73E 4BLJA 1HA8A 2IZWA 3CO6C 1QHDA 1QGPA 1NK3P 1RF1C 3DF0A 1W0UA 5JI7A 3L74J 1RUH1 2RQQA 1D5YA 2P5BA 2VTFA 2WZEA 3FLPA 5KHJA 3GG2A 3UNGC 1Q90D 4LO6B 4KMQA 4ABZA 3JU9A 3UK9A 1GQGA 3IB3A 3J9SA 3PJRA 3KYQA 1IRFA 4DOJA 3C7OA 4A6DA 1PJRA 1QEXA 2BBAA 4XVHA 5A32A 1GFF2 1LULA 4EI2A 2M2EA 5M0TA 5JZGA 3BGAA 2Q8DA 1FJLA 1BL0A 3PP5A 4XBNA 4CDWA 2FXAA 1POV1 3KLSA 2N9YB 3CU7A 1EPWA 5D8AC 1NU1J 3RFRA 4RLQA 1Y56A 1UG2A 2A3WA 1MH3A 1W9YA 2JN6A 2QZ3A 2PHWA 4Z2AA 2OQQA 1XU1A 1HW1A 4QPYA 4A7YA 4CEYA 3O6QB 4NWVA 2VBXA 5CCGC 4OHVA 4WWCA 4Q0VA 3LQCA 1HRV3 3OCPA 2FCTA 5F37A 5FRNA 1UIJA 4CYCB 4N53C 4YVSA 4K35A 4GRIA 4J1WA 5DQ0A 4AHYA 3EUHA 4ASNA 5L3BA 2XBO2 4NIIA 3E6DA 3LQRA 1RUH3 1V5EA 4PFOA 5BU8B 4OHWA 1R1UA 1XSDA 2YSRA 3VHNA 2O8QA 4IFFA 4N78D 2I07B 5CFDC 3SITA 4NUBA 1RUC1 4U7BA 5FY5A 4LA3A 3BCCD 4UB6H 2K0GA 3H0GJ 1TT5B 5KHGA 1K42A 5LBFA 4X6AJ 3CCQP 1YYNA 2HWB2 1JTZX 2VNRA 4ON0A 1XRUA 1G2HA 5B5EH 4JVAA 5B5EE 1TMF1 1LHUA 3K7AJ 2HWC2 1GSLA 1OVSA 1RUF1 1GQHA 5FOJB 2QQUA 4FE7A 4TYSA 3GUDA 4XF4A 2IXLA 2R062 3Q8FA 4WX9A 1YQ2A 5CBOA 1T3UA 1JODA 2OUMA 5LBBA 2DMPA 5AW8B 1RHI2 2GNMA 3FMGA 3N3HA 1V9U3 1HDPA 2BBVA 2IBZE 3OMYA 3V6IA 2Y64A 1PYVA 1I39A 5KLVK 2O1QA 3IH4A 2WT0A 1XQNA 2VCMA 5A3UA 3L9FA 1IPKA 2F48A 4D6SA 2RKLA 1OPCA 2OQ7A 5FZEA 3WCSA 5JIUA 1PPJG 3KT7A 1GOGA 2XKPA 4A3LJ 4KA4A 3E3VA 4JX6A 4ET7A 2WNUC 2WZR3 1JMBA 3H1YA 2NRAC 1BMV1 1FV2A 2HOTA 4G6QA 1NTZK 1SFCA 4K3AA 2JMWA 1QJU1 1W8OA 2JQ7A 4C0BA 1N7LA 4RAFA 2VNGA 2HVQA 4AAPA 1LTJA 2PHLA 2X5IA 5FPVA 1CAUA 5DN2A 3U75A 4JF7A 2X1CA 5CFDB 1M1EB 2R3SA 2VQUA 1J83A 3H7YA 1D8KA 2W48A 2I5UA 1OVRA 2DFFA 2EINH 2EA4A 4A5NA 2XL9A 1QOSA 1O57A 1T3JA 3SZGA 2OW4A 4ETSA 3EBRA 3FN9A 2NVTJ 5F5AA 3EYYA 1M57D 1IG0A 3N36A 1O5UA 3GHGC 1FOD2 1V9U1 4OMCA 4E4SA 1M7LA 2BRTA 3O0XA 4LBLA 3B73A 2NPSC 1OVVA 4FPCA 3S0MA 2QNKA 2PMZN 3DEUA 5KBFA 1IRGA 4XYXA 5ED4A 5FFZA 1VQ4P 4S2GA 1URXA 2D3SA 4EOTA 3SKVA 1HB4A 3LFIA 4DYQA 3CWBJ 5A3LA 1RGSA 3H1HG 1QQP2 2YO3A 1CQ9A 3EFGA 2WZR1 4N4NB 1WZXA 5D21A 4N43C 1G9FA 3A3YB 1P9QC 2ZGNA 2SPZA 5DTDA 2RM21 1MJ9A 1EP0A 4LXLA 4GIFA 2W57A 2K86A 3S1NJ 1EA3A 3GTOJ 1CGPA 1W36D 4RAZA 3MV11 3VDDB 1BI0A 2MFZA 3AG1H 3H0DA 3CP2A 4XAEA 3ZN6A 3OYWB 1HV1A 4KDPA 1FP1D 2BGCA 2GN3A 2VJ4A 4DY3A 4HKZH 3OUIA 4WBBA 3IWFA 3P7KA 4AD9A 1RF1B 2L9SA 3L75E 2BEOA 1OQEA 2O3FA 3H1HD 2GNBA 5JI9A 2IGMA 1SLCA 4QX0A 1TE1B 2M45A 3RGUA 2QKMB 5FFXA 2XAGA 2QLZA 3PLQA 4DBRA 3LAGA 3CTAA 1HTLC 5IT9Z 1JO5A 4IEYA 3S57A 1NWQA 2Q1ZB 3W67A 3VN4A 5LATA 2ZYAA 4R8HA 2Q4SA 2M30A 1MMGA 5HBAA 3B5NC 2HBUA 4CTEA 1XD7A 2YO2A 3T4VA 3CDZB 1HKSA 1OKRA 1X1PA 1LGCA 3G7DA 1HB1A 1CAWA 3ILFA 5T52A 1X1BA 2IGKA 5E3NA 2WT7B 4CDUB 2O5RA 2VVDA 3FBYA 2Q8EA 4HSTA 3L2VA 2K40A 4YZ4A 1GU5A 2OJED 4HEA2 5B1BH 2VQHA 3W59A 2JDPA 2R7ZJ 1O3SA 4HX7A 2R073 3VBFC 1SLBA 2R5ZB 2J1UA 5HOOA 1S0CA 5BNOB 1NH3A 5FLMJ 1L7LA 2M5AA 1GVDA 4O3MA 4YM2A 5L3CA 3NAPC 4CDUC 2F5DA 2VZPA 1Z91A 2XRNA 4CCNA 4NIHA 1AV1A 2CK3H 2DFEA 5JI6A 4LMFA 4I0AA 3CLPA 4CDGA 4HMZA 1W0OA 2D5HA 5ICFA 3P8MC 1RL3A 5EXOA 5FMOS 2V1XA 5C8CB 2ISYA 4GDFA 2CAUA 3MD0A 1SP4A 4HOOA 3HDDA 2BU9A 3WTWC 4IHSA 1MMSA 2IYPA 4LO7A 1W3VA 3INAA 3RSNA 2H89C 5A7OA 3X2QH 2A1XA 1JYVA 1QVFO 5J40A 3I4PA 1QOTA 2EILH 1QZEA 2A6VA 4Q0SA 4LR4A 1F5FA 4L92A 4A3FJ 1VR3A 4Q4V1 4URTA 3BG3A 4XF3A 3HE5A 1HKQA 1VQ6P 4OHYA 2ZHKA 1SLIA 3MEXA 3N9NA 3F9KA 4XJUA 3M3YJ 3R0RA 2WWUA 4XCBA 5IVVA 5KXDA 1ODDA 5FO5A 4NDLA 1Q8OA 2HWVA 1MQTA 1VPHA 2YHJA 3OSDA 1KYOH 3F89A 3ACHA 4JTNA 2L9NA 2LSOA 2WFF3 3QQAA 1EY2A 5HODA 1YQ5A 4E4DX 3TL4X 4AU7A 1LOEA 3WP5A 3CMEP 2OBPA 2R041 2HWB1 3B6CA 4IDZA 2Q2EB 1ZYRF 4M6YA 4Z1VA 2ID6A 2JG8C 1YHFA 1HDDC 3DKXA 2JIJA 1VAVA 1SD7A 1JKRC 2QSFX 3WY6A 4CCEA 2IGOA 2KR2A 1HKTA 5J36A 1N2DC 4E7LA 3AMPA 2CU7A 2OYHC 1PHMA 2B9BA 2ZXWH 2Y6GA 4LQRA 1V6JA 4I0BA 5L9BA 5GTIC 1Z67A 2AEYA 3O8HA 5CMZA 1G1IA 3AKRA 4IGOA 1MBFA 2E2JJ 3B5LB 4A7KA 4IV3C 2BHZA 1RR7A 1AR71 1SBFA 2IBZG 4XFCA 2R0QC 3V2QA 1AR92 2DCYA 2WSEH 1FMD1 3USUA 3RKWA 4M3GA 3S1RJ 3LSHA 4BACA 2PLV1 3RGBA 1FC2C 1MPXA 3JCIA 3WDWA 4KL1A 4BIFA 2I74A 1GP4A 1EDJA 4A3KJ 2OA4A 2ZSHB 5GLWA 1VQ9P 2WB1A 5IT9K 4FOQA 3H1IG 3VL9A 4RBOA 3WZ1A 2JPBA 5HCBA 2HYKA 5IVFA 5GZDA 5FZ4A 2M87A 1AKHB 3SHFA 4JGZB 1JJ8C 3Q1MA 2OT7A 3GTMJ 2GIZA 1ETKA 3HEIA 1GLNA 1UYXA 4YFNF 2JDAA 1BE3G 5C3QA 4LJZF 4GGGA 1Y8QB 3ABUA 3ZYBA 4OQ8A 1G2CA 4MXVA 2QQOA 1JGSA 2W25A 2WNVB 2ZX2A 4J19A 2H6CA 1JNMA 4ZJZA 4S2DA 2LVSA 1RYYA 3KEYA 4XKVA 4J25A 3A7OA 1D0ZA 2YXSA 4Q5SF 3NWKA 2P37A 3Q8AA 1F43A 4TT3H 1JN2P 2R7WA 2LROA 3LDRA 5FQ0B 1TZLA 2N1TB 3CIHA 4KT5C 3J7NA 3HD7A 3PVEA 1BKZA 3UIAA 3KPEA 1QGKB 1NTKE 4MO3M 1AWCA 4DPNA 4QLCU 2XOMA 1TMF3 3CC2I 1K9MQ 2VD7A 1J1TA 4BJTA 5H2FC 1IPJA 4UW3A 3NEUA 3V42A 4SLIA 2OYHA 5FUNA 2O0YA 3BR0A 1FYLA 2XVCA 1D4M1 2EQRA 2VL8A 2V9KA 3H1KE 2XAFA 1QJX2 2FYUD 3QOPA 2E7XA 1LOAA 3NAPA 3RYRA 2YDEA 5F5IA 3CC7P 3ZMUA 2P3YA 2XSDC 3SH3A 4F91B 2WAEA 1W39A 2L4AA 3ACIA 1QNTA 2RNJA 4X8NA 1H0BA 1BHGA 2E33A 1NCQB 5CADA 1UY1A 2FSWA 1CAUB 2FU4A 2JKVA 2OYIC 2AXLA 4KU8A 1R1VA 3HTKB 4V2GA 2W00A 4KU7A 3MDPA 3T2QA 4EMSA 3RPUD 3H1ID 4UB8C 2UUZA 3PNAA 4XORA 4GODA 3H1HE 1H0TA 3RPQA 2IBDA 1OIPA 2JDNA 4YFWA 3D5RC 3RTRA 2LRDA 2GUSA 3G6EP 1PGPA 4XLHA 3MZYA 2CQQA 1LQ1A 3SEQA 1XNKA 3GYHX 5A3WA 2R1BA 2PN5A 3NKTA 1H9TA 3IUOA 1V4RA 1OLMA 4P96A 2HZTA 4R1HA 3SXYA 5AVPA 5L73A 3ZMSA 1VAKA 4UW6A 3VD5A 2XGEA 1T2KA 2GN7A 3K77A 4C3HJ 1DQ1A 3OYJA 4A6OA 2LY1A 5AIQA 3DCQA 1EH7A 4HL0A 3M3OA 1HJBA 4BQ1A 2STTA 3CJNA 5KAIE 5T55A 1WMDA 2DA2A 3OYKA 1PZ8A 4IV1B 5DEQA 2B4KA 3ZYFA 4XKCA 3E6CC 5CG9A 1EV7A 3OYEA 3GZ5A 2W1UA 1CZTA 3CCQI 1GOHA 2WL1A 5CHXA 3OGJA 3CCVI 2CUFA 1XBFA 3MKZA 4RS5A 4BBRJ 1Y7BA 4LGWA 1S9HA 1LNWA 3P32A 1ZAOA 2E7WA 3ZXSA 4RR3A 3O2PE 4A3CJ 1RKWA 5F0HA 2QM8A 5FZ7A 3HMYA 5FZOB 3HBZA 2ACJA 3MLKA 5E88A 3JRFA 1ZG1A 1IN8A 5FLVA 1D7MA 4PD4D 2XJPA 2NS0A 3HNBM 2IXHA 2K27A 2LYCA 3AK0A 3VBOA 4PIYA 3JCUC 3C1LA 3VD4A 3GX4X 1OH4A 2TRTA 3ZVXA 3J81Z 4I98B 3KIOA 4XLNF 2V7QJ 3ELKA 1DH3A 2WO7A 1ZRRA 4WXCA 2Y6JA 1W7PD 2DAOA 3LGRA 2V26A 2WLPA 5JSRA 3O1VA 3ACLA 1OOPA 4CDXB 1GZWB 3S7IA 3FC0A 1RJ7A 3MYXA 2NLRA 1Y47A 3VBSA 4NQWA 2BXYA 4G94A 3OJAB 2UY8A 4XQFA 3KZIH 3GDBA 1NQDA 3UYJA 2JX9A 1UAIA 3HOXJ 2MEV2 1SS1A 2GC2A 3TWIA 5ISLA 2EIJH 4IOAF 2VOXA 4FQZA 2C9LY 4GQ7A 2W82A 4N3YB 3I71A 3KT1A 1P92A 2YKQA 2HKXA 3LA3A 3AEGC 2Y0OA 1YYCA 4FO9A 4Q5OA 3MD2A 2KXLA 3NO8A 2QKDA 4L0ZB 4C7NA 4YG6A 1UZYA 3SISA 4QQPA 2Y6HA 2G9WA 1TC3C 2B87B 4H13C 2QJKC 4COZA 5CBNA 4C2MJ 1OCTC 1SLLA 1WWYA 3AFHA 1IZNB 1MQTC 5APAA 4CCMA 1DPUA 4AOCA 4UB8H 3ZXAC 5FPUA 4A3IJ 1WT6A 1HN0A 4IO9F 3WV6A 1T56A 3I0TA 2ZHNA 4NHJA 3AYDA 5E6HA 5EEGA 1YLFA 4DZPA 1PIV3 5FZ1A 1IG7A 2P67A 3RG0A 5FPZA 1SVMA 3VDAA 2K9JA 3OPTA 1QQP3 5C4WC 5J3LA 1ETXA 1FT9A 3FHQA 3LAJA 1MGTA 4YW2A 1SD5A 4PJNA 1TWAJ 2NXNB 3WW1A 4WM8A 4XK4A 1DYKA 3PIOF 2ZX4A 4I3GA 1X36A 5J37A 5FKCA 4OGQC 5IYBJ 3H5AA 3PVNA 1XNDA 3O8ZA 2K9JB 1A6IA 5F3IA 5C9AA 1MJBA 1W6QB 3U11A 5C5TA 5FUIA 2VKEA 4L9BA 5DZEA 2Y30A 5FZ3A 3TNPB 2CHHA 1QPMA 1IFDA 4GA9A 4QU1A 2KNCB 5AVTB 1VRBA 2VJJA 2W5FA 1LDKB 1Z3XA 1X9TA 1ZREA 3SEZA 5LZ6A 4LLLA 2EXJA 1PPJD 1VB4A 5JUVA 3DN7A 1AVBA 1C8M1 1OFNA 2ZBJA 1XMAA 3ME2A 1OBNA 2DFBA 1OF4A 2BYVE 1LECA 4EQQA 1WKYA 3UESA 1SQPG 4XAAA 1T0FC 1GWLA 3UV9A 2VMIA 3TYJA 1AA7A 2E42A 2PTMA 2LBFB 3ECOA 1ZX5A 2H43A 2CY6A 3ON7A 2HQNA 4OHZA 2IEKA 2E53A 1UIXA 3M9AA 3ZLIA 3D5SC 1TT0A 2VXZA 2F5EA 1KQGB 1TMF2 4Y3OA 3OD4A 4OMDA 3TRSB 1O8PA 1YIPA 3TEDA 2M0CA 1F1ZA 2AR6A 3K4NA 2F4OB 2XAUA 2JUGA 3ES1A 4OLLA 3IZOA 3G9RA 1UY0A 4CPGA 4Y28J 4D6TE 4M0NA 5IK5A 3WG2A 2BCCG 4P9GA 5BV6A 2VC9A 3GHGB 1GR3A 4AI1A 3OYNA 4C3IJ 4JGYC 4PJLA 3KX2A 1KILA 2ATFA 1O6UA 5GTHH 3HKZN 1EF4A 3OGVA 4E8CA 2ZT9B 2VECA 2D6LX 4NPLA 1LAJA 4EV0A 1JS9A 4LLOA 1FWZA 2QVSB 3I2DA 3N9MA 2HWD1 4GAZA 1RF0A 5H9RA 4B86A 1AR62 1OFCX 1RETA 4MEYF 4EM0B 5D1IA 4AR2A 4BQ5A 5J8CA 3ZYPA 1T39A 1ZRCA 2Y9YA 3HB9A 5C4XJ 3VOPA 2VU9A 3N9OA 4XF0A 1J58A 3QU3A 2RKHA 5CA6A 1FBMA 3OOUA 2EZLA 2RG4A 4ZTJA 3U78A 5EDNA 5C8WA 3V64A 4HDUA 4HVQA 1NXD1 2ESNA 2OYHB 3WNKA 5FKBA 4X6RB 2ZGTA 3MKWB 3TO9A 1Z0XA 2E36A 2K46A 2IXCA 2K9ZA 4HYEA 2NAZA 4IPAA 1KORA 1IF1A 1R082 3BY6A 5AVSB 4Q4W2 3PNYA 2GA1A 4EN8B 1L3JA 1L2PA 2I1JA 2P3JA 1S4CA 1Q82Q 4Q1RA 1WI3A 3CCYA 5BNQA 1SQ4A 1NE4A 3TO7A 1BSHA 4UV9A 2ARAA 2KMUA 1S8NA 2UY9A 1GQPA 2EV0A 5GTHC 3HAGA 2PMWB 4H0EA 3MQ0A 1XYPA 2RS32 1IDYA 5AVRB 3WG7H 1B4AA 2QA4I 1R1TA 1UX7A 3LIDA 3SDGA 1H0TB 1B1BA 3JRDA 2B5HA 1K04A 4C2UA 6PAXA 3IPVB 2JICA 1DDLA 3ZR8X 1OQDA 4RAYA 4QKNA 5FYUA 5DPNA 5JLXA 2FE3A 3F72A 2A6XA 2YG0A 1PVXA 1IDZA 3NMBA 1GK4A 3OOXA 4XLPF 1X8YA 1QH7A 2A6HF 3AEFC 2WFPA 3LA7A 4QGNA 2K02A 3WD5A 1VF5B 5KTBA 2BUKA 5LHHA 5HLHA 3FXEA 1VF9A 1LPQA 1EV11 2JDZA 2B63J 1NLRA 4AAXA 1U8RA 1O7LA 2ZKNA 4EWEA 1W6NA 3KZIC 4PCRA 5JFRA 5FYVA 2M7AA 4XQDA 2ZAAA 2WSEJ 2XWJB 2YMZA 5L9VA 5FD6A 3HRNA 3PFYA 1BDCA 5C3SA 4FQGA 1HWTC 1LTJB 1S55A 5FP7A 3Q3SA 1YLLA 3WVJA 2Y8KA 1W36C 1BGYG 2ADEA 4N9HA 1LEBA 1N73B 1OLTA 4W97A 3W68A 1LVKA 1JOPA 3W5NA 2KPMA 5DAXA 3W3CA 2XAJA 3RZHA 2W1WA 4XDPA 4DY5A 2V73A 4K8FA 3VD7A 1Y0UA 4U7JA 1DGLA 3FJSA 1OCOH 3ASNH 1RUOA 2GM4A 1PDNC 1LUJB 1WCKA 4CUCA 4URAA 1BSNA 2Z42A 4X8PA 3LDKA 5A7SA 1NCRC 1IQDC 4W1UA 2EIMH 1ZZBA 1OD3A 3L70J 3CXHE 1Z1DA 1NGMB 1LHNA 3T1LA 2D6MA 3R61A 4DXRA 2WAQN 1DYPA 1VQMI 1FZEA 4AIKA 2GC1A 3VZMA 3LSIA 4KN7X 4KH9A 2Q0AA 3WUTA 2OQRA 4B4PA 1GP6A 5BPDA 2FXMA 1KV4A 1WW7A 2WV1A 3P5BA 3VODA 2VI6A 5ANQA 3L2UA 2JJLA 4EE2A 4MQVA 1QJZA 4YPJA 1LT1A 5FZCA 1PGL2 2ZJQF 3TYYA 4LBMA 2FHRA 4YZ5A 4LFUA 1Q1VA 1KS5A 3KHBA 1AR72 3P7NA 2DMQA 3V2PA 3RJPA 2CFOA 1JZ8A 5HLIA 3OW2O 3IC7A 2H1KA 3N9LA 5ILSA 1UMZA 5C8CC 3H3UA 1EUTA 5FP9A 2HOAA 2DA1A 2JWTA 2C5DA 3GZNB 4NE9A 5KAIC 1QJY2 3ZXEA 3MV01 2BY2A 1G9CA 2HOEA 1K79A 3DTEA 3L73G 4LO4B 3SQOA 3IHUA 4ONUA 4L76A 1GL2C 5LLQA 1KITA 2KP6A 4IHWA 2J59M 3A0HE 4ZZDA 4MGRA 1IK7A 3C2BA 4AK3A 4DXTA 4M74A 1W03A 3I3EA 4BQYA 5FO8B 2RDNA 1I1SA 1CPNA 1U0JA 4LBQD 2D5FA 3NV2A 2EICA 3A2AA 4JQFA 1TQ5A 3CCRP 3RJRA 1YOVB 2ZFCA 5I0DA 3II6A 1BI2A 1R1A3 2E5YA 5EG0A 2G0EA 2DF7A 1OYWA 4XCAA 2HVRA 3U2RA 1VQLI 1OLRA 4HV6A 2ZAEB 1KMIZ 4B47A 2FA5A 1VQ7I 1RVF1 3DEWA 4G7ZF 1UOGA 3BVCA 4CDQA 3BDDA 1E3PA 1W6QA 3WF0A 5FOBB 1HOMA 1JTHA 4GJZA 2EJRA 1YQ8A 1FMD2 3N35A 3BUCA 3HQUA 3KCXA 3K69A 3J8F2 3GZAA 1DYOA 1T8ZA 2FD5A 1ASJ3 1S4XA 4UY8I 3F8BA 2GC3A 2Q1FA 4JHTA 5JVVA 5CFCA 4OAZA 4FI9A 4YXWH 2QQAA 1ITYA 1BBYA 1K8AQ 2FYUG 1VBA3 1IK9A 2B7EA 2VB6A 4NBQA 2D2CB 4WZFA 1GZ9A 3BCCG 1B35A 3ASOH 4LHLA 1B8IA 3ETQA 3GJAA 3GXUA 5F3CA 5J96B 3A5TA 4X1EA 3AZWA 1USDA 2B0LA 2DU0A 3REOA 5BUVA 5LY2A 1TVGA 1OXCA 1D8JA 4IHYA 4LT5A 1DGWY 3HQXA 2H0BA 3H32B 1EV12 5CJ4A 3HEFA 4QPIA 4V2WA 5L7OA 1YUDA 4L5JA 2R061 3M1CA 3OIOA 3SH5A 1L4AD 2VUMJ 3UETA 2HPCA 4M73A 4K6BA 1MSFC 3U0ZA 2PXJA 1R22A 1W04A 4Q2FA 4BQOA 1GZCA 2E6VA 1QJFA 5DAPA 3PUIA 1X1DA 3ILRA 3NWTA 5F3EA 3CXHD 2K9NA 3K2AA 3AC0A 3CJIA 3M4FA 5JZGB 4OWRB 2PJRA 3ABTA 3E1IA 2TDXA 4CO8A 4H2AA 1F5JA 3JBG3 5AVWB 2BWAA 4Q26A 2R7DA 3KV5A 2FDGA 1RPWA 2DYSH 1S0BA 2MD5A 5F8PA 2M5AB 4ES9A 2R5ZA 3UJOA 1R58A 1KYWA 1VZ0A 4IOIH 4XIKA 5LBQA 2QQBA 5FPAA 1KQ0A 3ZX7A 1ULFA 2VUCA 4FPHA 4ZYHA 1MNMC 5AVAA 2VE8A 4UVCA 2JE9A 2ZBKA 4M3CE 4BCUA 5TRDA 2ESHA 1UAAA 4KHXA 5BNOA 4PD4H 3NSTA 2A07F 2DCEA 1IS5A 4RQPA 2VVEA 3HC7A 1ZLLA 1XE8A 4HW0A 1CPMA 1ZN2A 4IOCF 1QX8A 1H2NA 3EPZA 4RAGA 1RUD2 2YXRB 3NV4A 4CZSA 2OCCH 4MQ9F 1AR93 1A3KA 2C0WA 2DW3A 5APWA 1R8EA 4TV7A 2D6KA 4LOSA 5DD8A 3IIIA 3D6ZA 4HONA 3F8MA 5CLSA 3ZXFA 2ZMNA 4NN0A 1RVF2 2ZXIA 4IFDK 1O4ZA 2W85A 4W4ZA 3H5RA 2P5KA 3J7AO 3CZJA 3JBG1 1JXNA 3RPUA 1DU0A 2WA4A 4P08A 1WCDJ 4D6TG 1NQJA 1PIXA 5GTHE 3RI4A 2L7ZA 1NHLA 1J2XA 3AP6A 2V79A 3CQOA 3O1TA 5C9AB 2Q1KA 1J3QA 5FZ9A 1U5TC 2W84A 1MV8A 1H2MA 2XQXA 3M1EA 5KCMA 1ENHA 3V5BA 1R9TJ 3N7JA 3W21A 3QP5A 5KR7A 5HS7A 1HXS2 4LLNA 3W6KB 2BOLA 4D7NA 2A3YA 1IFPA 1LU2A 4BXXJ 1SZBA 4MSVA 2GMMA 2L9RA 4HZFA 1RUF2 1OQYA 5EF6A 2E34A 3BG5A 4NC6A 1BR1A 4MHUA 1FTZA 4P9JA 3Q5PA 4GULA 4XKWA 2BPA2 4M9XA 2I45A 2WINB 2FMYA 4LK6A 2VULA 2DK5A 2CWSA 3QYFA 4FP2A 1KDKA 3B94A 3PVOA 3B00A 4YZ3A 4I02A 2DA4A 3EYIA 1UWWA 3K1NA 4ZPIA 2YC2A 4UV8A 4R4XA 2FQ3A 3PLNA 1Y43B 2AXTE 4RQPB 2OZ6A 1FBQA 1UELB 4OAYA 3VBHA 3CF6E 2DBBA 4XE9A 3MGUA 3HRMA 2XGDA 2H8WA 4K3UA 3VBRA 3MFAA 3VYUB 4EEFG 3GZ6A 1YQAA 5T3NA 5D5XB 2WSFH 2FEZA 1U7MA 5CU1A 4M9SA 1VL2A 1QIQA 5JCTA 5EGOA 2W92A 4IUGA 1PFIA 3ZQIA 3BR6A 4PV1D 1G7YA 2V72A 4KG8A 2UWMA 1WJDA 2XWBB 1V9U2 2G4IA 4N4OB 1OA4A 1XYOA 1IQAA 2R32A 1I1EA 1X2MA 2EIDA 4PT6A 5LEKA 2WSSH 3JD72 3C3WA 3OIQA 5DUIA 4F3QA 1UMQA 1USEA 1F4AA 5IK7A 3KV4A 4XZPA 3U59A 1V5FA 2QJYB 2IVJA 2P7CB 3OYLA 4JKKA 3LSPA 2QM7A 2JENA 1W5SA 2VW0A 1X82A 2QENA 1KYZA 1SFNA 3R60A 4P9XA 1USSA 2WUHA 2BGOA 3HD7D 2WN2A 3E97A 4XJAA 2DMUA 4D6RA 2AEJA 4PJYA 4RMNA 1FAVA 2YV8A 2E7QA 2Z2SB 4IEZA 1PVEA 2FYNB 1L7QA 4MADA 1LP1A 3TGNA 5KWRA 1GZLA 3H9GA 2XLAA 4MXWB 1K05A 1ZM1A 1I5PA 1QVUA 2P6HA 1Y9BA 1OI6A 4IEVA 2OU2A 3S1MJ 2CWEA 4ITVA 2W9XA 5KLIC 1C57A 3OPWA 4Q8LA 2A68F 4L8QA 3ZMOA 2ZJ2A 3LA2A 1KZUB 2FMLA 3G2BA 4B29A 1QNYA 1WA6X 1LHVA 1YFHA 4TZDA 1JT6A 2BVBA 3LFKA 1O4XA 2QA4P 3VUOA 2M5WA 1X8EA 2P2KA 4YWAA 3AKTA 1GNHA 3FHZA 4MGZE 1F35A 2H09A 2KISA 5ACA1 3AG4H 1WJBA 1POV0 2OF7A 2MLKA 4M3CB 5FZ0A 1OD5A 1U8BA 4N6JA 3KQGA 2ET7A 1KTMA 3BI3A 4LPLA 3U1AA 2N7GA 1OURA 1R5ID 5F1JA 2XJQA 3HHHA 3H9QA 1X19A 5JZGC 5J3UA 4C30A 1UZZA 2XJUA 4ESJA 1L0LK 4L11A 4MFEA 4HB1A 4LIUA 2Y33A 2FXOA 1WLDA 1KU3A 4P02B 5FYSA 2KZJA 1HGVA 2Y9ZA 2P1JA 3HTSB 3BU7A 3G6JB 1F8VA 2KK7A 4IRHA 1I9RA 2PAKA 2NOJB 4EWDA 3PUSA 2RDRA 4YIIA 1VQ6I 4LB5A 3P9IA 4E7KA 2K4BA 1BCCE 3CCJP 1FPN3 4LMYA 2ITAA 3FLTA 1BJAA 2RN0A 1SLQA 4AYCA 5F5QA 2EV6A 2OTKE 3HT2A 2A6ZA 2Z4EA 3A03A 1ZRTD 4RSUA 3CJRB 4C8DA 4UW4A 2KDOA 3W9AA 3RDIA 3WODF 2B45X 3CDHA 4XETA 1ZVFA 1IN5A 3A0HH 1JZ4A 1VBD2 2JWAA 3TO6A 3H9JA 1SFPA 4AEDC 2LXCB 4W50A 1GTWA 3GWZA 4DT0A 4P9LA 5CFCB 1T33A 5HDKA 2X6YA 1ZRDA 1D1CA 4HVRA 3KZIE 1ZGJA 2RDQA 3J80Z 3G4SP 1U5XA 4EDFA 5FLJA 4DOUA 1IFNA 1DGRN 3HGYA 2QSIA 5AVZB 1KFNA 4HT1T 1S9KD 5BNNB 5KLVD 4GZ9A 1DQ2A 4RFT0 1W4MA 2O03A 2RGVA 2W87A 5AW0B 1MZEA 4XBFA 1I1GA 3ZSMA 1A02J 3G1OA 4YM1A 3H8UA 4N7IA 3ZXGA 4K21A 2ZKZA 1PUFB 2EPFA 1JZ7A 2L7MP 1FIAA 2AUYA 2MH9A 3PU3A 2XASA 2VC0A 4DS0A 1VQ4I 3E5XA 2E26A 4XPVA 1NAEA 1L0ND 1J7KA 4XLFA 3W2VA 4WBAA 4IRIA 2CGPA 3WDUA 4PFPA 1L0LG 2CW0F 1UYZA 3VZKA 3PTRB 3VD9A 3AE3C 1ZBA1 1SQPJ 3CCMP 3NV3A 2BW3B 1SQQD 2HYJA 1PGQA 1IJDB 2ZXEB 1M06G 3H1MA 1B09A 4FCYA 4QX3A 1MNDA 3I3QA 4R4MA 3RI9A 1K83J 3WP3A 1NTZJ 1W5CC 4OI4A 3L71J 3ZN5A 1RH5B 2FOWA 2D97A 2DURA 1L4AC 3FBIB 2C9AA 3WDYA 3PMSA 2POHA 2ZNYA 2UWCA 1DEBA 4QQ2A 2LY2A 5FPLA 3M1HA 3BT9A 2UZKA 2HWC3 2I1KA 2DTRA 3CCEI 3DEMA 2HR3A 5GPAA 3LB9A 2W6BA 3I59A 1G9BA 1SQVK 3DYOA 1QBJA 2OTLP 3K48A 1CF7A 1MMAA 2A5WA 5E8IA 1EZVI 1SVOA 3BTZA 3E7KA 2QRXA 3G71P 2V9PA 2COMA 4KWUA 1W0NA 1UZWA 5I8YA 1N78A 4HLXA 4FQ4A 2JECA 3LIEA 2UURA 2R4GA 2GMEA 4WY4B 2ZVNB 1P2FA 4DOZA 2QE3A 3LSJA 3FK7A 3HUSC 2RJ2A 4GXOA 3D6EA 3H1IE 4Q4ZF 1HQNA 2W7NA 2VC1A 1EXJA 5LWBA 1VB2A 3H0OA 3G1MA 1XX5A 1W8FA 3WR0A 2NMNA 2ZYGA 3ECQA 1AR91 4WK8F 1WMFA 2E71A 1U12A 3I2GA 4XFBA 2YIUC 3WF4A 3CJQB 3ZR6A 1P7IA 2ZKLA 2KSEA 4PF1A 4C46A 4CUBA 2XLGA 1GV5A 3IT8A 1V6NA 3RK3E 3D3AA 4FXKB 2WY8Q 3IH3A 2HWC1 3CO7C 2IRFG 3MFCA 3KPHA 5A3PA 1JHNA 1H1IA 1ZR2A 1VF5C 3ETPA 2QUOA 3VZJA 3DEEA 1MZ5A 4I30A 2VE9A 2KLVA 1KDMA 4XMYA 3QRFF 3BROA 1ZARA 3EWKA 2WSVA 4UXNA 5EZGA 1B72B 1JZ6A 3MZHA 2UYBA 3W2WA 4ESBA 1RTVA 5IP6A 4D7TA 1FNZA 2BFUS 2FZ2A 3A0KA 5FY1A 4AEDA 1JY2N 2J1SA 1PVC2 2Q8KA 2P3KA 3ZQLA 2M9HA 3V0BB 1XMXA 5F0CA 1QLED 2AH2A 5FZMA 1R5SA 3DLLF 1W3XA 2UWBA 5KLVJ 4GB33 5D8AA 5JXIA 1C28A 4PDWB 3W2AA 1WMKA 4Y20B 4Z2WA 1APLC 1IG3A 3ZDSA 1OKOA 5IK8A 1CWPA 2DQRA 3LKJA 1UFMA 4QU2A 2MC4A 2F4PA 4DFSA 1T2KC 5AONA 3RZDJ 1DD3A 3L2YA 1CW5A 2YZ4A 4L5EA 3DYPA 5FZIA 4R52A 1OLQA 2XBO1 5EHDA 3Q0UA 4AGVA 3OS2A 2RM23 2PAEA 5T50A 1PUEE 5CVVA 1H8TB 1VI0A 2QBYB 4U0YA 5EV7A 2Y6KA 3QPLA 1BJZA 1BEV3 1L0NE 5DM6F 1ENXA 2KRHA 4U87A 3S7EA 4IL6C 4QKBA 1U5YA 1TU3F 2VT2A 3RK3C 1W28A 1YFUA 2WYSA 3SDBA 1BGYD 1X9VA 3M70A 4JGYA 3ZDMA 2HWF2 2NN8A 2DTWA 4FTHA 3BCCJ 5D4SA 3J8F1 3RMXA 1MZFA 3I2HA 3NJXA 3B3QE 2BWCA 2HWF3 2Z5IA 2V5DA 4PSXA 2VG9A 4E2GA 2JDUA 4KJZA 2L4MA 1CN1A 3ZPYA 4ATFA 3S32A 3HOUJ 1CQTA 4HDVA 1AYN2 4TTGA 4R9CA 1HCRA 3ZKUA 2FCUA 3GMAA 2XG3A 1W5TA 1ZK8A 3TK1A 5CISA 1NZCA 1STZA 4I2LC 2STWA 2R7OA 5BXXA 5K7PA 3ZQGA 4EGZA 3I8TA 5DYMA 2R1DA 3JSVC 1D0YA 1IO2A 2M1BA 1UY3A 1KFMA 1RB8G 3PUBA 5KLIB 1Y4WA 1QJY3 2R5BA 2X48A 3WG3A 4ANJA 3S2HJ 1K3IA 1SG3A 1KQ9A 3HTUA 5FDBA 2NM1A 1VBB1 3CCLI 3HG9A 1Q3EA 3QH9A 4GT1A 3H1JE 4Z07A 2GIVA 4R9AA 2Y0SA 1YQ3C 2W52A 1Z78A 3CX5H 4BXLA 1PP9E 1LTIC 1LEAA 2E75C 4P9IA 4PJJA 1N1YA 1JY3P 1PO22 3OYBA 3TDZC 1YI7A 3B5ND 1C1FA 4I99C 2EWNA 4M3DA 3OSFA 1VAMA 4AFBA 2BZDA 1OHFA 2WNUB 3J7MA 1BOBA 3H1WA 5JHUA 1OX3A 9ANTA 2X05A 4AFCA 3B5NB 3L2HA 1GV9A 1IKPA 1JI8A 4D7YA 1TQMA 4LK1F 3EHKA 3AP7A 4OUEA 1YO5C 2IW5A 5FR3A 4OMZA 2DODA 4XRFA 1YS7A 2ICWG 5BS6A 3MW3A 4Q48A 4XFFA 1RHI3 2VR4A 1DQUA 5C4WA 4BRYA 2QQKA 2B42B 1LOFC 1R092 3NARA 2E76B 1LVAA 3BCAA 2XKOA 2XL7A 1OYIA 3K46A 3CCLP 1Y39A 4C1WA 4QX8A 2VMFA 4DO0A 3BZCA 1QVGO 2CL2A 1FZCA 1GUUA 2RVAA 1Y1VJ 4RB1A 3GEZA 3BZKA 4UW5A 1W9WA 2X9DA 1DLCA 4FFFA 5B4NA 3H8OA 4GKXA 3L75G 3G1LA 1REDA 1KILC 3NTNA 3JRGA 1M1KQ 2YC4A 3VMXA 2VMCA 5FUPA 5GZCA 1ZG3A 1VQKP 3WQ7A 1K5JA 4IQPA 2Y75A 2FCVA 4DBQA 3D6YA 4ZDLA 4CU7A 1M4WA 2WO3A 4ZXEA 2OCEA 2A73B 1XGSA 2ECCA 3VBUB 1J84A 1J3RA 5L3DA 2XUEA 4YSFA 3ZKYA 2VZ3A 3WU2C 4ZYGA 5C44J 2KT0A 1TQIA 1NTCA 2LXBA 1JTHB 2PQ8A 3AE6C 2Z69A 4TLGA 2DCZA 3WE3A 3A0BH 2QZ2A 5F9TA 1L3LA 2BZTA 1X3WB 4UAPA 2XDJA 3FWEA 2HS5A 3RSJA 1RC6A 2V1DA 3L00A 1KA8A 3N4MA 2VZSA 2CH0A 2CSOA 1RJ8A 3JB4C 1BE3E 4ZNCA 3NFQA 5FLXK 3CZ6A 3K4ZA 2JXAA 4RL7A 1ZG5A 1GU3A 2KJBA 5AIPA 2Q0OA 5JSOA 3B5NA 4BHPA 4CZZA 1Z7S2 3H1LE 5A6XA 4BNCA 1JY2O 2OVUA 1FYUA 2BCCE 4RHV1 1ORKA 4LULA 1SD6A 4XDOA 4E8DA 3RS6A 2ZX0A 1OH3A 4DIQA 3Q8CA 1AR61 1JTYA 1VBE1 2QZ8A 4DNCA 4JQRA 4CU8A 2J1AA 2PHDA 4JRLA 2NPIA 1USTA 3KQRA 1JZ5A 1D4VB 4BEHA 2HG5D 3CEWA 1QDCA 1XE0A 1FXZA 2DCKA 2MHFA 5HDNA 5EIYB 4HPKB 1BW6A 1NY71 3JRCA 3QU6A 3U07A 3KP2A 1VIWB 1XC5A 3ZXKA 4XFHA 4S05A 1IFIA 4D5FA 1AR81 1GZWA 2IS6A 1KB9H 4HBLA 4AIJA 1SACA 1KILD 3GLLA 5IY5H 4RB3C 2IPPA 2XPVA 3RNSA 2ZGUA 1OKQA 5JSPA 4LLGF 3FMRA 1VBB2 2FY8A 5K5QA 1ND3A 1AJKA 1G86A 4E7IA 2BY1A 1RZ4A 4NWWA 4WZCA 2WAFA 2YU9J 2AREA 2QVAA 3SFIA 1F15A 3L2QA 2KZGA 2WAQA 5K1YA 4RA2A 3IAM2 1DQ6A 1JYIA 2E76D 2CGNA 5FYZA 3ECHA 1S7OA 1SQXD 1Q56A 4XMIA 1FPN2 4XF9A 2LDUA 3CZUA 3FXOA 2B8MA 3DF8A 1MUUA 1R081 4BHCA 5KJ7C 3K4BA 4Y15A 4GMP1 3ST7A 3UGHA 2DJNA 3BOQA 1BGYE 5A6ZA 3TNUA 2YU2A 1V55H 2GALA 1TP4A 1O4YA 1A5JA 1AF9A 2EFQA 3ZDVA 5GAHJ 2H8RA 3I2IA 3ORJA 3FKIJ 2FBKA 3AP5A 4FISA 2ZC2A 1U5ZA 4YW3A 4HRIA 3HNYM 1SMVA 1VLNA 4DB5A 2JE8A 5A7WA 3FHIB 2YBSA 1N7SB 3VP9A 3TEYA 2FRHA 3ABLH 1REPC 3HNMA 3VKOA 2QQ8A 2AACA 1IFJA 2P5LC 1QRYA 5F6LB 3FMSA 4WM8B 5AW4B 3EUKL 2Q3IA 1H8AA 1H9WA 3CJIB 4AEKA 1P8JA 4XFJA 4WXDA 3TN93 4BE2A 2J5PA 1ULEA 2WFF1 3E5UA 5ANNA 5LK5A 2DJIA 4OWFA 1IZ3A 3BALA 3POJA 5JHFA 4LHNA 3N7LA 2V1NA 3FHNA 1M90Q 2VONA 4YM3A 3H36A 3ZGKA 3ERED 4YG3A 1WLTA 1YI2P 3HZJA 3I53A 3OY8B 3F5HA 4PD4I 1XXNA 4HKLA 2O8XA 3VBFA 3J7HA 3NXSA 2W39A 5DM7F 1JY2P 1A8MA 5J4VA 3HR9A 4JKLA 1SMYF 5EJ3A 4RHV3 5AFEA 4A93J 1K4SA 3AZZA 4ARXA 1MNEA 2LKMA 3C2UA 4H3WA 3L2RA 3SYTA 1WRGA 4CP0A 3MUY1 1N1SA 3GTKJ 5IK4A 4CRQA 3WG9A 1SANA 2GSYA 3P9KA 1O5LA 3USUB 5KKZC 3WHUA 1YIOA 1M1JA 3M0AA 2FXPA 3KHUA 1PGSA 1G3TA 1N73C 2W08A 4Q4W3 1FJKA 4YEJA 5DCMA 2BW8A 1ACIA 4UUSA 4A6EA 3WG4A 3OAKA 1JKQC 4PIZA 4XRSG 4XOGA 1V6OA 3T8RA 1IRXA 2YGLA 2VOTA 1LFBA 3FWLA 4C1XA 4XFAA 4HVOA 1R1A2 4L5IA 5J09A 2CV0A 2QSGX 4F52A 2BEQD 5TJJA 4XNFA 1N77A 2RVCA 3I56I 4BQXA 5BNPB 1SQBJ 4QDRA 3T3YA 4H0LB 2VW1A 1AXYA 1HJGA 3OYGA 3ABZA 2E2HJ 1FX7A 3HRTA 1W2AX 3IN6A 1VBC2 2JPCA 4CVUA 4ZDOA 2W91A 1XOYA 3W6JB 3BPXA 4AF9A 5F7UA 4MUVA 3S6PA 5BNPA 3Q9OA 2Z5HA 2F6BA 5E79E 1ND2C 3ZMDA 5M3FJ 1E5SA 3RYPA 4EIJA 3FL7A 1OJLA 2ELHA 2GWRA 1KRIA 1X3UA 3A0NA 1EZVD 4OMYA 1QJU3 2OGUA 5KAFE 2EXHA 1MBGA 2M0MA 1PO11 2XHNA 2QBXA 3V65A 4DMIA 2EH3A 4Y22B 3UJQA 1WWXA 4AC0A 1QJU2 3TF5A 4IX7A 2NYXA 2PJPA 2E1OA 1QQP1 3TP3A 4MNUA 4EM1A 5K5GB 4RJTA 4Q47A 2LD5A 1SBDA 3RQ4A 2EFOA 3O3KA 1ENSA 2XNDH 3RQIA 2LFBA 5CCGA 1VQ7P 4W6WA 5SV5A 4P9FA 5IT6A 2N1TC 4BH9A 1D4M3 1UYYA 4XIOA 4BY1J 2QJPC 3JTHA 4P00B 3VBHC 3HBLA 5DD4A 3WW3A 3R4SA 3FXUA 1TG7A 4IEUA 1LNSA 1YO8A 4RQPC 1JBCA 3CUQB 3O8GA 2QQWA 1UF2C 4CYDA 5DG2A 2HGCA 2ME0A 4DGWB 2IVMA 2W68A 4PI0A 2JVGA 2R7UA 4PDKA 1VTNC 3S15J 3MUDA 1NOVA 1PV3A 4B48A 2WT7A 4CDUA 2CQKA 3K9TA 1F9KA 1ULPA 3R4DB 4D7MA 2PHXA 1SMTA 2MABA 3FXRA 1YRNB 2YPDA 1NUKA 4IE7A 3W58A 2ISZA 1W6PB 2ID3A 1JU3A 1IV6A 2YS9A 1CAXB 4S2HA 3ZOIA 1DF0A 4A4AA 2Z5WA 1PO13 1OF3A 1LTBC 2JIGA 1P84E 2RS53 2Y6LA 3S5QA 1WVRA 3FUOA 3VDDC 4HFSA 2K3FA 4CPBA 2ZFWA 3QAHA 3I9V2 2FYNC 3EQLF 3AAFA 5EFWB 4YNIA 3I2OA 1U3EM 1K5MA 3T2TA 3COAC 1YI9A 3RZLA 1ND2A 5F32A 4EN9B 3OEBA 1E5RA 2L91A 1POV3 1SFOJ 3ZN1A 4N53A 3GTQJ 4QSHA 4CXYA 1POGA 2XC7A 3N97A 2ID4A 2RS12 2F5CA 2RMU2 1P84D 2A6WA 1SQVE 2OQ6A 3JXSA 3VMYA 2XF7A 1PMIA 5EGOB 3DXUA 5GLVA 1UIIA 1AHSA 5FIXA 2P3IA 2WNOA 1QY4A 3H32A 2YX7A 4RR3B 3ABMH 1H2KA 4KIBA 4BRYB 5BNNC 1W9FA 4RD7A 5CCHD 4AGRA 2VW2A 4TSVA 4E7HA 4UBGA 5FXZA 3ATGA 1N7SD 4AQ2A 4AVBA 2Q2EA 3BN6A 4XTMA 2EVXA 1QXJA 3GZEA 2JSCA 1IS3A 1JOCA 1U57A 2JR8A 4P5HA 2FFDA 1FZCC 2YC0A 3KS7A 3CUQA 5CVJA 5T5LA 4AEJA 2J1EA 3VLBB 2HTJA 3OSGA 3QD6A 1MS8A 4UB6C 3VHOA 4E27A 3CL3D 2VKHA 3BRVB 3OF1A 1J9IA 3WGGA 1AVYA 4L0YB 3OGSA 4RM2A 2GC0A 2VH9A 2WC2A 3CCVP 1BCXA 3H1CA 3JD73 1RUD1 4PUSA 3H1KG 1YI2I 1MBJA 1RUE2 2LW8A 3IWZA 4K7JA 3G6EI 5F08A 4ATEA 1QL2A 4LJHA 2MKVA 4TWTA 4GKGA 2FYUK 2R44A 1WZ2A 2RQPA 4XXAA 2HBTA 1Y9GA 1FOD3 4Q4V3 4QPIC 3GBWA 1E17A 3DXJF 2WRAA 3AEDC 5IYCJ 5CVRA 3HWJA 1WH5A 4H44D 3SJMA 5C33A 1W8TA 4LUKA 1OXZA 3S1KA 1H1MA 3LWFA 2LF8A 2NZ9A 4QPGC 5CCHC 3F22A 4XW3A 2WT1A 4I7ZB 1HW5A 1RUJ1 4KN4X 3K70C 1HXS1 2Y26A 4A42A 1X4PA 4FVVA 1TBXA 5K0UB 3RI8A 2B9VA 1R5HA 2V7FA 4M4RA 4R4ZA 1RF0C 4CEWB 1NA1B 1YITI 5HLTA 5GADJ 2CPBA 2E43A 2Y0DA 1EAH2 4GMP3 3LSMA 1DPRA 2HDCA 2JB8A 2DUQA 2BVMA 2WMMA 2OTLI 2O6GE 1ND3B 1QXPA 4Q4Y1 1J2JB 1O3QA 4Q8KA 3FF5A 3IL2A 3CI9A 1GNYA 1N7SC 3C7EA 3K4MA 2O01H 4FPJA 1WKMA 3MKYB 5T5JA 4JP0A 4XKBA 1BIAA 1FOYA 3UGGA 2X85A 3THDA 5FLIA 3ZXLA 4NJ4A 2RMU1 4QGMA 1JMMA 1WGPA 1FIPA 5IFTA 2F4LA 3LEIA 1NTKD 2JDIH 3QH7A 5GLTA 2YPJA 2ZJCA 5CAZA 1E2XA 2AYHA 5KJ7D 4PGGA 3CMYA 3S5AA 1XGOA 2HFED 3J7ZI 1ETVA 1ND3C 2XVLA 1O3TA 3SCFA 3L35A 2V4AA 5TSWA 5DDGA 4YRVA 4QXBA 2UU8A 3CMEI 3V8KA 1C8NA 3DWLE 1NG6A 2KB7P 5FZHA 2FJ1A 1VQPP 1LTJC 2EIEA 2EALA 1HW2A 2AC1A 2HU9A 1ETOA 4D8MA 1I6HJ 5KXEA 1NTMG 5GALA 4E2SA 1S9KE 2N8GA 3T0AA 2JT1A 1YS6A 2FBIA 1H8AC 3DECA 4O6JA 3MVPA 3A1YA 5B66E 4QD2A 2DDBA 3KLNA 5BNOC 2P17A 4AI3A 2L9VA 4J1XA 5APXA 3AVSA 5DXDA 1YX3A 1IUFA 2ZYDA 4MHRA 4Y5TA 3GF2A 4CEYC 4CZCA 1NCRA 2RS11 1F5TA 5ABJB 4IE0A 1SFCC 4Q4W1 5SV8A 3NJZA 1XMKA 5IPAA 3I2JA 1X22A 3RBXA 3BG7A 3IAOA 2ZXXA 2DYCA 5KAIH 1PP9D 1JKOC 4LG0A 1LWUB 4YFXF 1T98A 1SBEA 5CYVA 1G9AA 1W6NB 2BTVC 1WCUA 4CDXC 2DA3A 4JC1A 2B89A 3K1MA 4ASKA 1YJ9I 3IKTA 2K1AA 5I0UA 5E79H 1K5MB 5C8CA 2XU6A 1RUH2 3KE2A 2M3AA 5A33B 3POBA 3QCWA 1OCZH 1RUC2 4FASD 5J98B 4DRVA 2E51A 2IYOA 2WSFJ 2Y0IA 4N8MA 3GTGJ 3HOSA 2OYIA 3L74D 1W6MB 2WVRA 1JY3O 2XAHA 5FKMA 4MYEA 4BPZA 2OYIB 3H1IJ 1QO0D 1ENRA 5D5VB 2M3EA 2IBZD 3PM1A 1GMJA 2NRGA 2E1MC 2JEMA 2WS91 1MS9A 1Y8AA 3E5QA 3HKZA 3WDVA 1VQNP 5F04A 1AKHA 3OBAA 1YQ4C 1F9NA 2WO2A 4BJ0A 4BISA 4GH4C 5BPIA 3VBRB 1VMFA 1VE0A 4XUNA 1FP2A 2X1DA 5ACA3 4AM3A 5CQEA 2LOOA 3ZRGA 2KKOA 3HJRA 1RUI2 4I01A 1CR7A 2F5VA 1LB2A 3S17J 1BMV2 3WHCA 2VZOA 1X3ZB 2JKXA 2IA1A 4BHBA 1S5LE 1FMVA 1W90A 1SQBD 4P5YA 1GK6A 4BB3A 1XN7A 5JVTA 3H50A 4YGEA 4BZ4A 4E6KG 4JOMA 1T6SA 2YFZA 1CAXA 1ZBE3 2ZOEB 2OXBA 4CXWA 1G6NA 3GF3A 5LY1A 1AL23 1IUYA 5GKAC 3HXLA 1SQXJ 1VBA1 2N9BA 1T2KD 2D6PA 4CE8A 2KHMA 2HXOA 3CX5D 1OT5A 2O0OA 2LTNA 4LB6B 5E8GA 1WBLA 4QWNA 5FREA 1SCSA 4OQ9A 3MLJA 2VZVA 3EDPA 1UXXX 3D70A 3TGUJ 5KC6A 3SNMA 2R043 4MXWA 1W7PB 5IOYA 1D0GA 3IH2A 1R083 4QPGB 1UU4A 5E89A 2XJVA 2VPVA 2VT3A 1D0XA 1XNTA 3BKZA 2Z99A 3D82A 3OJBA 4B44A 4LK0F 3L70D 4JGZC 2JA6J 1GT0C 2BERA 5FLXZ 5EYYA 3CDIA 5CCGD 3F3XA 2OA2A 4R9DA 2BY3A 2QIWA 1YTZI 1NU1E 4XACA 4FPYA 4KWJA 5FKKA 4AXOA 4QB2A 3BCWA 3QPTA 4XBQA 1TME3 2D3PA 3MCZA 1VQ9I 1I50J 1DZTA 3SMHA 2WQ8A 1FI2A 2YY1A 1JGGA 1T95A 1UG0A 5FFOC 4GFBA 3AL0B 3B69A 5LW9A 4ZZLA 3NAUA 1US3A 3VBUA 3APBA 4OZXA 3K51A 5F5CA 2JUCA 4PLNA 2P6CA 1G3WA 4A7ZA 4PCQA 5E3MA 1X1AA 5CKQA 2N1TD 4ZHNA 4FTBA 2NS8A 2HEYF 3SEEA 1H8TC 3VYTB 2WIIB 5IP7J 1S29A 4XABA 3PMEA 3M8LA 5TISH 2F17A 1YJKA 3BQZA 1NLSA 3BVHA 1FV3A 3OL4A 3ZCOA 4Y4RA 1URQC 2KM2A 1CZVA 2CUZA 2EV5A 5GPCA 1HGZA 2ORZA 1ZW0A 5FY4A 1JCCA 3ZYRA 1IFMA 4JRAA 3MMYB 1SFKA 4OI2A 2HJIA 1PPJE 1CONA 2JDYA 1ZZ6A 4D0QA 4EJRA 1HF9A 1UOJA 4YXDC 1ZTRA 3ABKH 1JE8A 3WDXA 4LTAA 4UB6E 2JG9C 1MBKA 3LIHA 2PLYA 4LNVA 1BN5A 3CESA 1YHQI 2RDPA 2X5IB 3K3OA 1JT0A 2LRPA 4QQLA 4HKWA 3ML6A 3IKWA 2V7QH 3AMNA 3UKNA 3M4OJ 1NTKJ 2CW7A 3ZXJA 1DGRM 4QKFA 5DABA 1TZOA 4ZS2A 4ZYAA 5KNLA 3FWNA 5FMCA 1QGLA 5F0FA 5ERIA 2R3CA 2OYZA 2D6NA 3K70D 2E74B 1ZBA2 5A7WB 1RMU3 3RQ0A 3ITKA 3M3CA 3KEOA 2OPTA 2WS92 4OI1A 2AEZA 1NG7A 3MI8A 3KVBA 3POFA 3GHMA 3H1KJ 1DFQA 3U1KA 4YTPC 2VOWA 1JI6A 1TWGJ 1WJAA 5CKTA 4COUA 1ZELA 1S72I 2Y0CA 3LPFA 5A80A 3VBUC 2HWD3 2UXXA 1LT9B 4ENKA 3AYAA 4B1LA 1VBC1 1UQXA 4LEJA 3TNQA 1ZN5A 5DJTB 1RUG3 3T09A 5IHRA 3CLQA 3H1LG 4BQWA 5KXBA 4BWNA 4V19K 3MUZ1 2DU1A 4IL6X 2L01A 2Q30A 3NKGA 3OYAA 1HLCA 2UXNA 4FFGA 2OIIA 2D2CC 5I8SA 3ZFGB 2Y69H 4RESB 3ISPA 1XYNA 3C1DA 1WFXA 3LOCA 4M71A 3PRJA 2ZMLA 4KNCA 4CCDA 1UHMA 2HPMA 3L72G 5LK7B 4XIDA 5HDGA 4XRMA 2ELKA 3LSEA 4NAOA 4XSZF 1KB9I 2MGQA 3VN0A 4IEOA 4AFDA 2MC3A 5FXXA 2A45H 3RCOA 5AVVB 2FOKA 2EBIA 1RMU1 5C3PA 4HNUA 4CXXA 5JR7B 2Y0MA 2F6CA 2YMKA 2DQLA 2HPCB 5HCFA 2I8DA 1ASJ2 2NVUB 2KIMA 4P14A 2R042 5G05L 4DJGA 4QPIB 2FBEA 5H6RA 2YYOA 4IHTA 1RXGA 2DUPA 4IF4A 1BR4A 3WQ1A 1UN1A 2O9LA 1VQLP 3ZFEB 5KAFH 2KDZA 4KWKA 2FFDB 3GZTB 2YROA 4AZZA 3WCRA 3GTJJ 3D0JA 3PDQA 2BW3A 2BNOA 2ADUA 1WLCA 2DBNA 1SAUA 1ZQ3P 4YGCA 1UHSA 2FNPA 3MW4A 4H13B 4HF1A 1MDMA 3JB8A 1H2LA 3HVDA 4IHVA 4U3FD 3H1LJ 1FY7A 2K7LA 2HI3A 1K5MC 2KIKA 1PP7U 2DXIA 3A7QA 4WVMA 4W80A 2WZPP 2BNMA 2G9FA 3OUHA 3S2WA