1OMIA

Crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
224
Chain Sequence
GSEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Listeriolysin regulatory protein
publication title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 72
structure length 224
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1omiA03
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1omiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1omiA01
3SCGA 1D3YA 2B5HA 5DCFA 2P4WA 2PFWA 2F5DA 4KMUX 1R22A 2RVCA 3FHZA 1ZZ7A 4EROA 4IETA 4MHGA 3MYXA 3P9KA 2W57A 4MGKE 4E2GA 2EK5A 2ZMEB 3RTRA 1ZGJA 4P55A 2EV6A 5L3FA 1X8EA 5A2QK 3B73A 4XF4A 1I27A 4AQ6A 4I2OA 4BNCA 5L3BA 4M9SA 2PJPA 1PUEE 3OV8A 1TQPA 1X3UA 4IEYA 4YNIA 5BOXA 2V1DA 1CF7A 2DTRA 4U0WA 4QM9A 1NYWA 3CO2A 3CUOA 2VN2A 1W5SA 2GWRA 1J2XA 4Z82A 2VODA 3PQJA 2V09A 2OQRA 5H20A 5ICGA 1NE4A 1P2FA 3F23A 3IKTA 4BHBA 2IXCA 2K02A 1S7AA 3I4PA 4RGRA 3JW4A 1TQMA 1ZZBA 2ZMEA 3EWKA 4N9HA 5FLJA 3PFIA 3DEUA 5FD5A 4HLTA 2ZJ2A 3H1WA 1IF1A 1KU7A 1L3LA 3Q5FA 2FMYA 2PAKA 4HN0A 2VOOA 4L9TA 2DT5A 3W6KB 3RIRA 3BJOA 5C8WA 2DFIA 4YSFA 2HQRA 1FSEA 4LD5A 1XSDA 1FBSA 5K8SA 3WODF 1KQ0A 3ECHA 3R61A 2ZNZA 2PAMA 5EEGA 1TW2A 4CGZA 2TDXA 2GZWA 3ES1A 2XLAA 2A61A 4RAZA 1GVJA 3J81Z 3UKTA 1B9MA 2XGXA 1U8RA 1ZVFA 5LEJA 3I53A 1U6GA 5J7MA 1YW7A 5E8GA 2B9UA 3OCPA 2PN6A 2P17A 3JTGA 3BY6A 1HW2A 3FXQA 5D5UB 3QRFF 3TOBA 4IERA 3EO6A 2DK8A 5DCMB 1O4TA 5LGTA 2ISZA 5CYVA 2XV4S 4RB3C 5I0RA 4G6DA 3VODA 4M6XA 1FBUA 4I02A 2QDRA 1KU2A 1ZARA 3GX4X 5HS9A 1FZPB 1EP0A 3NQOA 1ON1A 4I09A 2VBXA 4OMYA 1YO5C 2P5VA 5FD6A 2LF7A 3TDZC 3OGJA 4O9EA 4PIZA 5BUVA 2UYAA 2E9QA 3V4GA 3EYIA 2M87A 1BIBA 3DQVC 1PM7A 3BPZA 3J80Z 4WK8F 1OYWA 1R23A 5KHJA 1BI3A 4P9GA 2VOPA 4LLLA 1GQGA 2EWNA 2L4AA 1B4AA 2UY9A 2ACJA 3EYYA 4E70A 1UD1A 1P4AA 2D40A 4FHTA 5HI0A 1SD5A 1K79A 3FMQA 4KU8A 1DGRA 2GQQA 3KLNA 1J5YA 2O3FA 1W4MA 4Q0PA 5DCMA 3SXYA 3FX3A 3HRSA 4GGGA 2XIGA 2FOKA 2GA1A 3D0SA 5JFRA 1PMIA 1ZG3A 1MZBA 3F8MA 3H92A 1FP1D 4ENMA 1KQ8A 4UXAA 3VOEA 4FAHA 6PAXA 1P4WA 2CG4A 4A6EA 5KK1A 2CV6A 4LGWA 4U7BA 5K5RA 1LRHA 3TNPB 4IEQA 4G6QA 2GAUA 2H6CA 4DQ2A 4EGZA 5JR3A 3QP5A 2HFHA 1KYWA 3BDDA 4MV2A 1HXDA 3G3ZA 1FSHA 4PZJA 1BC8C 5HLHA 1XCVA 4QMAA 2CSOA 1A04A 4IHSA 1UIJA 2IVMA 3I7DA 2F5FA 1BIAA 1D8KA 1R58A 4JTOA 3GLXA 1K7AA 5J3UA 3EDPA 3K1MA 4WCGA 1IXSB 3RDIA 2Z69A 1YHFA 2RQPA 3U10A 3TO6A 2UYBA 3KSCA 3BOQA 5I8TA 5HOOA 1XB4A 1QWRA 1ZZ9A 3F22A 2QNKA 1R36A 2YX4A 3RKXA 4RGSA 2W84A 5I0UA 3WE3A 2GXBA 3EBRA 4IRHA 2OZUA 1P4XA 2FSWA 3H8UA 2CFXA 4AVAA 2R7DA 3T0YA 5ILVA 2F5EA 1P92A 3ES4A 1MJ9A 1RGSA 3PLQA 4AVBA 3WTTC 2FEZA 1H9TA 2Y75A 1UPIA 1R7JA 2QQAA 3VFZA 3K2ZA 2Q0OA 4ZYEA 1F1ZA 4UVBA 2WTEA 2XROA 4L9JA 4M71A 3ISPA 1QQIA 4MGIE 2JPBA 1YW9A 1OYIA 2MLKA 3DF8A 4PJYA 3KE2A 5D8LB 3DP7A 1UCXA 5D4SA 3FZVA 2D45A 1FLIA 1K6OA 3LZZA 5LRRA 2ZFWA 1G3TA 2FU4A 2FF4A 2G8YA 1WLTA 5IT9K 2D2WA 4M9ZA 4GYIA 4CHUA 4ZH4F 2DU9A 3RYKA 3IL2A 2RC4A 3GUDA 4Q0SA 3HUGA 1XDSA 3WTVC 3REOA 2XASA 4ONUA 2BBYA 4HV6A 2IA0A 4BAYA 2VBZA 2L3DA 3BPVA 4XBFA 3R4KA 2FXAA 4EWAA 4QGNA 3K9TA 2LNBA 1TBXA 2STWA 4XSZF 4AIKA 4EM2A 1FP2A 2ETEA 3L2CA 3KP3A 1X82A 2DCTA 2EAAA 3IWZA 4YFNF 2WV0A 4OFGA 5HS7A 3GFJA 4O9GA 1JE8A 1LDJA 2FA5A 1RNLA 2IT0A 3GWZA 3S7IA 4QWQA 1JUHA 5I8SA 4LB5A 1DPUA 3DXJF 2K0GA 4XF3A 1P6RA 1J3RA 2P7CB 3SCFA 1T6SA 3ABUA 3L09A 3CEWA 4P9UA 1VR3A 1XRUA 3FJSA 1D8JA 3EQEA 1KU9A 2V1XA 1HSJA 1LJ9A 3V8JA 5BQTA 4D0PA 1JHHA 3WGHA 5F64A 4FBFA 4KN7X 1ZG1A 2FQPA 1ZG5A 4IEVA 2D1VA 4QGMA 4A12A 1W5TA 3BROA 2K9ZA 5LHGA 2DW4A 3NVCA 2QLZA 1VJ2A 2ESNA 4MH0E 4XFGA 3DPLC 3RNSA 3QACA 2EA7A 2QQ9A 4WF2A 4S05A 3BJ6A 4L9VA 2UZKA 5AIPA 5FLXZ 2EJRA 1XGOA 2DK5A 3RJPA 4PGHA 3F8BA 5AONA 4ASNA 3R0JA 3AAFA 1O57A 3ELKA 2J5PA 4LK1F 3RZZA 1KGSA 4A5MA 2OAZA 4KT5C 4TV7A 4LFUA 3T8RA 2NYXA 3HRTA 3WU0A 1S3JA 4WWCA 2IP2A 3ZMZA 1IUYA 1UB9A 3MCZA 4NQWA 1Z1DA 2IPQX 3NEUA 4Y15A 2HQNA 3WGGA 4MEXF 4WX9A 3G73A 4HF2A 4MUVA 2P8TA 1Q1HA 1IXRC 5HVQC 5FB2A 4CXFA 3G7DA 2O1QA 1LVAA 4XEZA 4G7OF 1YLLA 3O2PE 4IVNA 1H1IA 4EJVA 2QVSB 3WW3A 4ON0A 3WW2A 4MEYF 2ZKZA 2BNOA 5I0TA 4KA4A 4I7HA 4H0EA 2ZBKA 3VEPA 2XL9A 1QNTA 3WW4A 1TQIA 2R7FA 1F9NA 2RN7A 3E5UA 3LWCA 2DQLA 1G4DA 2JPCA 3ZMDA 2IXIA 2E1CA 1LNWA 2ETHA 5FO5A 1UW8A 2PTMA 4EGYA 2JRTA 2OA4A 4LUMA 4M74A 3KP7A 2HYFA 5LHIA 4AVPA 1YW8A 1HW5A 3HQXA 1FBQA 4IHTA 1YWKA 1EH7A 1J75A 1J1LA 1JGSA 2OA2A 2JSCA 2VBWA 1SMTA 5D6EA 2UXXA 4YG2F 2FQ3A 2MA3A 1G6NA 5E1XA 2STTA 1F4KA 4KIFA 5HDGA 3WTUC 5K5OA 5JI6A 2E7XA 3UKNA 1ZRCA 1FT9A 4RS8A 3IDCB 2Q4SA 3SHRA 2H94A 5J6XA 4J1XA 2LSOA 2KIMA 4K8FA 2PMUA 3BP8A 3WGIA 2DQRA 3M8FA 1HSTA 3C3VA 2NRAC 1OPCA 1WI9A 2A5YB 1H0MA 2Q1ZB 5FGMA 3HT1A 4MGRA 1HBXG 2XVCA 4KIBA 3IHUA 5I91A 1TTYA 4E2QA 4P9FA 4Q4ZF 2LF8A 1UIKA 5BY5A 5CVJA 5ILUA 1ZHFA 4IEUA 3KP2A 4QX5A 4MQVA 4PDKA 2VPVA 4B09A 2GC1A 3EETA 3NW4A 3NSTA 2V6CA 1W7PD 4RGUA 1YS7A 5FPZA 1NE6A 1ZN2A 1LQ1A 5LGUA 3O14A 1BOAA 2N7GA 3EHKA 4U7DA 5KVRA 3KMHA 1I1GA 2Q8KA 4HX4A 4RB1A 2OZ6A 3ECOA 4HX8A 2QQBA 5EEHA 5FFXA 2IRFG 4WXCA 2IXJA 3M9AA 2L01A 4BHPA 1OYYA 2MBFA 4Q0VA 3LQRA 3MFKA 3L2HA 4Q29A 4UV9A 5ICEA 2IXHA 2B8MA 3HYIA 2ZXJA 5I93A 4I0BA 4KN4X 1SFUA 2BEOA 3M3IA 5DUKA 2NAZA 4IRIA 1IAWA 4L2NA 1YG2A 3CJXA 1KA8A 4QLCU 4LTAA 4ORFA 3T1BA 1BBYA 3L7WA 3K0LA 2DLLA 1TNTA 1T0FA 4IPAA 5ED4A 1YFWA 2L02A 4LK0F 3MZYA 1SMYF 1T98A 2QCSB 4XFCA 1S8NA 1FOKA 3KLOA 1YIOA 3HIFA 1IN6A 5JR7B 4KYWA 1ONVA 2P5KA 3ABTA 2MC3A 1FI2A 2PAEA 3F72A 1YFYA 2GXGA 2JTVA 3V8LA 4ENNA 4IEWA 5DEQA 2XLFA 4OMZA 1U3EM 2ADUA 1IN4A 5DV5A 3LAJA 2Z9OA 2M1BA 1YTYA 2OPKA 3RPQA 1ZZ8A 3CL1A 2VQAA 4HF0A 3ZN1A 5AVPA 2VXZA 1RC6A 3IC7A 4EM1A 3C1DA 2PHDA 1XD7A 3LFKA 1B1BA 1SFEA 4CICA 2C6YA 3RKYA 2HTSA 3SHFA 3T8TA 1XGNA 1EV7A 1KU3A 2HKOA 1TLHB 1F5TA 5K5QA 3EQLF 4PIYA 2HZTA 4XF1A 2CWEA 2R3SA 1DDNA 4HLXA 4ZYDA 4HVQA 2D5FA 2XUBA 1IW7F 2IC1A 2KXLA 3HT2A 4UBGA 2ZCWA 5KHGA 4X6RB 4HW0A 1XMKA 3H7JA 4KWKA 2KIFA 1G3WA 2UWMA 3H3ZA 5DD8A 2IW5A 3R0AA 2O03A 2X0LA 4KFCA 5FCCA 4EWDA 2G7UA 3CO6C 1EY2A 3NL1A 1CAVA 1U78A 1NHAA 3ST7A 2ET1A 3WTWC 4ZYHA 3LAPA 4XFBA 1USTA 4IJAA 4JTNA 1LDDA 4OIPF 4CZZA 1RZ4A 3C7JA 2K7LA 1DPRA 1WMKA 5F6FA 3J80K 1OMIA 4KIGA 2M8EA 3BCWA 2ZO4A 1ZRDA 4YFKF 2HEOA 5D1IA 4UHTA 2RGVA 2RDPA 2HWVA 4M9XA 1QXRA 1Z7UA 5LRSA 4GCVA 4G7HF 2A68F 4OIOF 2GC2A 3HOSA 3VB2A 4QXKA 1O3RA 1IN8A 3ZP5A 3DV8A 2C0ZA 1XE7A 4BHCA 3SXWA 1EYBA 3IDBB 4HSJA 1ZH5A 4WBBA 3I58A 1FWZA 4Y17A 5D5XB 5CVVA 4IF4A 4FX0A 2PQ8A 4XSXF 2RV8A 5JAXA 1MJBA 4XFIA 3FXUA 4HZFA 1LEAA 2EA2A 1S7OA 4BXUA 1X7NA 3U1DA 3L9FA 1ZX5A 3K69A 5IT9Z 3GZ6A 2OU2A 4AIHA 1R1VA 3C18A 4GXOA 1EPZA 2XAHA 1PP7U 1MKMA 1SD4A 2ZNYA 3O6QA 2O8QA 3MWMA 2PA7A 4D7TA 2M5WA 4MTEA 1J0RA 1BI0A 3HSRA 1TNSA 3KZZA 2PLYA 1H9GA 3H1YA 2HR3A 1FY7A 1QO0D 5FLIA 4I01A 4LLNA 2L4MA 4Z2YA 2PYTA 1BJAA 3K1PA 4WXHA 1K78B 3E6DA 3S7EA 5L3GA 4HA8A 1IXCA 5T3NA 2YU3A 2EV5A 1C0WA 2HDCA 1REPC 4O5VA 5E16A 2FNPA 2OD5A 3RKWA 1Q5OA 4J1WA 3SCHA 5E1RA 3KGZA 3IKVA 2G9WA 4RD7A 5D5VB 3Q9VA 1FX7A 2A69F 1DGWA 3M8EA 2KRFA 4R8HA 1I5ZA 1L0OC 4EV0A 1U5TC 4OIQF 1DZRA 4Z07A 4CDGA 2PI0A 3HTSB 1QBJA 3RI4A 3TKYA 3U0ZA 1ZNPA 1RIOH 2XL7A 3CUQC 4HBNA 2DBBA 4IRGA 4HQEA 4WVZA 1K78A 2JT1A 2K27A 4Y13A 1GQHA 5C6CA 1J59A 5D8KB 2BGCA 4L9NA 2D5HA 1FDOA 2XKOA 3CDHA 1MJAA 2ZKLA 2FBKA 1EH6A 1L3JA 2FBHA 3GYDA 3SQNA 3ROUA 2GIVA 4DNCA 3GEZA 3HHGA 2P5LC 2F4PA 2HS5A 3PVBB 3V8KA 2O8XA 1RL3A 3CJNA 3WW1A 1FNNA 5FQ0B 1IN7A 4FT8A 3EJKA 1XMAA 3E97A 1WWXA 4M73A 5L3EA 1RTVA 1S6LA 4LMYA 2LDUA 3ULQB 3WU1B 5BPDA 3H25A 3KP4A 3GF2A 1EH8A 1OFNA 3ZDSA 3P9CA 4RGXA 3IRRA 4L0YB 1QZYA 3ZMTA 1O7FA 2YPRA 2WC2A 2K86A 4HV5A 1V3FA 3T5XA 2M45A 4FX4A 2OZJA 1I6XA 5J48A 1XSVA 3GXOA 3JAMZ 4AVCA 4ENKA 1HQCA 1OKRA 3ML6A 5DD4A 3WTZA 4JV4A 1XN7A 3ERED 2ATFA 4GO1A 5KBFA 2A6HF 1ZAOA 2D1HA 2F5CA 3O6BB 1CAWB 2D93A 3HSFA 3R6SA 3ACLA 2OYZA 4HVOA 1PDNC 2BNMA 2Z99A 3HSEA 5LLQA 5JSRA 3QP6A 1WA4A 2Z2SB 1ZGAA 1ON2A 3LOIA 4DINB 5FQ0A 4IEXA 4MTDA 3TGNA 1Y3TA 4F8AA 4YFXF 5HDNA 1D5VA 4RB0A 1PP8F 1IPJA 3JSOA 1E17A 4HLYA 4EVIA 3N4MA 2AS5F 2DPDA 4PIXA 5ICCA 4LA2A 2FBIA 3Q9SA 1CAUB 3FZ3A 5EFUA 2P6SA 5D6FA 3BJAA 4G8XA 4OOIA 5CVRA 1O3QA 4K2EA 3KGLA 4A0YA 1IRFA 2W24A 4EMSA 2ESHA 3J7AO 2EA4A 4M72A 5CADA 3R60A 3IBMA 5ILSA 2EFNA 3SZTA 1CAWA 4ZYGA 5A2QZ 3HTUA 3M1EA 1G3SA 2HTJA 3GFLA 4MGZE 3FXRA 2VBYA 1WGPA 3CO7C 2FRHA 4ESBA 1Z6RA 4I0AA 4L5IA 4Q48A 3K1NA 1FPQA 4OU0A 1YFUA 2H09A 3LQQA 1E2XA 1QXJA 2A6EF 3KP5A 4ZZDA 2VECA 3KP6A 5CVUA 1XDUA 5EZWA 4A0XA 1O5UA 1DP7P 4E2SA 1B59A 4YARA 5CJ9A 1R00A 4FAGA 4EJTA 4BH9A 5L3CA 3M7GA 2OBPA 3E6BA 2Y48A 4D7SA 3TO9A 1LEBA 1V4RA 1CAUA 1R5GA 4WZCA 1YQAA 4ENJA 1T38A 5HLIA 4AD9A 3WG9A 2DI3A 4EQQA 2P7VB 1SEFA 4L11A 4YIIA 4R79A 1FYMA 4Q0QA 2ELHA 1AJYA 3TOAA 5E8IA 5TRDA 1R1TA 4O6JA 2K4JA 1U12A 2Q30A 1J3PA 1HW1A 5BV6A 1T2KA 1DZTA 3MPBA 3LAGA 3MAJA 2K4BA 4XF0A 2IA2A 4HN1A 3LA2A 2MNGA 1JXSA 3MQ0A 2XRNA 4MX3A 5K1YA 4XLPF 5L3DA 1O3SA 2DO7A 2H0VA 3SMHA 3E5QA 1Y0UA 4PGGA 3I0TA 3OTFA 4NB5A 4EJUA 4ZU5A 2CW0F 4EWEA 2QYOA 4L0ZB 2QBYA 2V9VA 4QGLA 3C3WA 1SD7A 4RB2C 5LBQA 1CX4A 1Z05A 1GXPA 2FMLA 4B29A 2QUFA 4GYGA 2ET7A 2VE8A 4MQ9F 1SAXA 3FM3A 4I3PA 4KU7A 1HKSA 3KEOA 1LB2A 2EFQA 4HBLA 2HOEA 3FMRA 3L00A 4XRFA 3COAC 3QOPA 4CYDA 3JTHA 1XE8A 3LSTA 5D4RA 3DKWA 3FF5A 2O61A 1SQ4A 1BI2A 1YUDA 5DDGA 2GU9A 4EJWA 2XKPA 1ULYA 1IRGA 2YR2A 3BALA 1WQ2A 1FYLA 2COMA 2VC1A 3H7YA 4UVCA 2KJCA 3RPUA 1RUOA 4HF1A 1CAXB 4MGYE 2W25A 3PQKA 4XETA 4KWLA 3NKTA 2V1UA 1MDMB 5KHKA 3O3KA 2UXNA 3GFIA 3W6JB 4CO8A 2IXKA 3KETA 4LJZF 4JQFA 4YIFA 4HQMA 2X4HA 5E20A 1CAVB 1CGPA 2NNNA 3LA7A 3F8NA 1WRJA 3B02A 2V79A 1ZLKA 2YSRA 3QAHA 3U9GA 4IEPA 1VTNC 3FFQA 4ZZLA 2A3SA 3ELNA 1LR5A 1MD0A 3FM5A 5BS6A 5J8FA 5HLGA 4N9IA 3J81K 2CQKA 3KCCA 3V7CA 4XFHA 3N97A 4LUKA 1BC7C 3ZPLA 2GA2A 3QPTA 1CAXA 2H6BA 3FMSA 1GHCA 3FE5A 4LA3A 3GVAA 1T39A 1MDMA 2BV6A 1XSXA 1STZA 1H1MA 3IN6A 1U5TB 4H7LA 1MGTA 3I54A 2DAOA 2O0YA 2EFWA 4AWXB 4RAYA 5JSPA 2GH2A 2I45A 4HYEA 4U88A 5ICFA 5E1ZB 4ZU7A 3D0JA 3CUQB 3F3XA 3KEQA 5FLHA 2PMHA 2KIUA 4A6DA 4MNUA 3QU6A 2MHFA 3E6CC 1NXMA 3SZPA 4F7ZA 4L5JA 1QY4A 3GBFA 1FC3A 2O6GE 4P5OA 2BE5F 3LWFA 3IIAA 2H27A 4PCQA 5CLSA 2E1NA 3USSA 3UKVA 1SFNA 5D5WB 1R5HA 2JZYA 3CTAA 3ZQ7A 2GC3A 3VHRA 5I0SA 3MZHA 4WXDA 2ISYA 5H6RA 3E3VA 4AIJA 1SFXA 4BIFA 1I1SA 3H9AA 1U2WA 3MEXA 1O5LA 3DN7A 1HKQA 1U5TA 2GC0A 5AIQA 1LDKB 1WKMA 3V7RA 3SFZA 4M6YA 2QWWA 2VT3A 3CUQA 1LKNA 4HOBA 3H1MA 5F1RA 4Q47A 1QGPA 2Z5UA 4LG0B 3GZ5A 2OQGA 1Z6TA 1Q3EA 1UCRA 2XAFA 4HAMA 4BQAA 1B6AA 2XAGA 2WFPA 4UVAA 1G3YA 3ZMUA 1QPMA 1YFXA 1UFMA 5LEKA 4G7ZF 1TW3A 2BNNA 3CLPA 4R52A 4EM0B 2AXLA 1V70A 2QJVA 4HMZA 4YYOA 3P9IA 2IXLA 4EJOA 3OD0A 5DYMA 1W7PB 1IN5A 4U0YA 5DUIA 3DL3A 4X6QB 1IZ1A 3HRUA 3FWEA 2L54A 1YLFA 4A0ZA 5TJJA 5E18F 1S29A 1KYZA 2J5OA 1O7LA 2Z33A 5JHUA 3H3UA 4S04A 4AQ2A 4LG0A 1XGSA 3NRVA 5LHHA 1J58A 2MPFA 4KICA 2A07F 1GXQA 3TDUC 2YX7A 3TNQA 3M70A 3F8FA 2QM3A 4JVAA 3LA3A 5KHHA 5I8YA 1ZRFA 5CU1A 4AXOA 2MH9A 2QENA 2XHKA 5FFZA 1HKTA 4YRDA 5IT3A 5E1WA 4HDVA 3JZVA 4IEOA 2FNAA 1RI7A 2G7HA 2PG4A 2RNJA 1Y9QA 5LGNA 3I5UA 1W7PA 4XFAA 2PFBA 4OIRF 3F6OA 4UBHA 3KFWX 3I59B 1WSUA 4QM8A 3FHIB 3F21A 1ZLJA 5JSOA 4BYYA 4G94A 2E7WA 4A5NA 3MDPA 4TLFA 3E6MA 2Q0AA 2PEXA 2PBIA 4HSLA 1VP6A 3BWGA 1AWCA 2MH2A 3RYRA 2HJIA 2CYYA 2NNYA 4UUVA 1ZMEC 3V7SA 2VC0A 3ZMVA 4U0VA 2NS0A 3BPXA 4OINF 3GYHX 3PNAA 5BXXA 4META 1O3TA 1ZYRF 1NZCA 3CF6E 2VONA 2M30A 3GFMA 1TQ5A 2CGPA 4Q5SF 2CAUA 4KNYA 2XAJA 4KDPA 5E17F 2EVXA 3ETQA 1RUNA 2P10A 3HRMA 4I98B 1Z9CA 2UY8A 3JSPA 3OF1A 5FPXA 1ODDA 2IA1A 3I59A 2KJBA 3BU7A 3S0MA 4MZUA 1OI6A 2HKXA 3TO7A 4KL1A 3OOPA 4IEZA 4R1HA 1BN5A 2WWYA 4UXNA 2KKOA 5HDKA 1FDIA 4NVPA 2EFPA 1KQ9A 2QZ8A 5JCTA 4ETSA 3BZ6A 2CO5A 2HYGD 4XFFA 3GW2A 1IPKA 3DPTA 5KHIA 4IESA 3WTXC 4ZU4A 5BPIA 3H50A 4O3MA 2PHLA 4KUMA 2EV0A 5H6QA 3NJZA 3WTYC 2MLGA 1YYVA 2LKPA 3IWFA 4KMFA 3ZN0A 2PQQA 4GULA 1BI1A 3I64A 2MD5A 4LB6B 2Z3YA 3E5XA 2QVOA 3TQNA 5CVIA 5J8CA 5FDBA 4NHJA 3QU3A 2XLGA 1JHFA 1YS6A 1R1UA 1UHMA 4KWJA 1Z91A 2B0LA 4HDUA 2XAQA 3WE2A 1ZREA 4LLGF 3DFGA 3F6VA 3KZYA 1J9IA 1ZZCA 1X8MA 3GO5A 1SD6A 1QZZA 1XGMA 3P7NA 4G9YA 4A2UA 5BPXA 2VE9A 4L18B 5FLXK 3CLOA 4XF9A 2W85A 4JBAA 1Q43A 5BMZA 1AOYA 1UHWA 3RYPA 3ZMSA 1FXZA 2CAVA 2RKHA 4JK1X 1OR7A 3S2WA 3JAMK 4IXAA 4B8XA 1J3QA 1USSA 4OLLA 1BM9A 1OD5A 2IJLA 4UV8A 3WTSC 2P6TA 2F2EA 3IRQA 3D5LA 4UNOA 3F8CA 5ERIA 2BYVE 2HGCA 2Q2EA 4XLNF 1FYKA 2Y0OA 3U11A 4ESJA 4HVRA 5HS8A 1YFHA 4P96A 2EB7A 3EUHA 4HX7A 2FE3A 3U2RA 3I71A 3QPHA 1DUXC 1ZRRA 2VT2A 1CF7B 3BB6A 2DPUA 1ZZ6A 2QBYB 5JVTA 1J7KA 2EFOA 1XCBA 4LLOA 4ESFA 3D82A 2Y0MA 3HHHA 4LEJA 4N0BA 3HOTA 4Q0UA 4LULA 1B9NA
chains in the Genus database with same CATH superfamily
2OV7A 1KD7A 2CQ7A 1T3JA 1JOBA 3CPWO 1L0ND 5DG2A 4D69A 1SFCC 3E7LA 1UHSA 3IH4A 5JPNB 3TEZA 4EROA 2BTVC 3WF4A 1VQLP 3P9KA 2W57A 3J9SA 3RWNA 3AG4H 4CDXB 1ZGJA 3VV1A 1REFA 2EV6A 1X8EA 3QWOC 3MIHA 2YGLA 2ZABA 4WM8B 3AVRA 1OA2A 4UY8I 4CXWA 4AQ6A 1Q82Q 1WJFA 3QYEA 3S5QA 1Q2NA 1OLMA 4K6BA 3VDDA 3OV8A 2YMYA 5E79E 3K46A 2DTRA 1W6QB 4QM9A 1KORA 3ILRA 3BOWA 4RA0A 5LB6A 4Y99B 3OYIA 4AVVA 2NPSA 3I4NJ 2V09A 4AGVA 5H20A 2VM9A 3L2RA 4ANJA 3CCLI 1W6PB 2W1OA 2JE8A 3CCSI 3CC7P 3IKTA 4BHBA 1V0AA 3I3BA 1S7AA 3I4PA 1QIQA 1L4AA 5KWRA 2LTPA 4N90A 5ANQA 3HPHA 4N9HA 3LEGA 2W7NA 1AL22 1W9SA 3LSEA 3DEWA 2AH2A 5F04A 1G9DA 4C7RA 1QDOA 2LYCA 2ZJ2A 2DMUA 3AP6A 1IF1A 1Z21A 1R5ID 1KU7A 3Q5FA 2BDRA 1HF9A 3UV9A 2PAKA 4M6VA 4LR4A 3FKIJ 1BKZA 2WNOA 2DT5A 3BJOA 1RC9A 1H88A 3BTAA 5C8WA 2JEEA 5B5EH 2DFIA 4D94A 1X1CA 5AW1B 1S5LE 4RGAA 1COV3 2VZQA 1XSDA 4YM2A 4IGOA 1HUCA 1TWCJ 3H8XA 1AXYA 1KDKA 1UX6A 5J1YA 3HN1A 3VBOC 2ZNZA 3RWKX 5IK7A 3D70A 4RA2A 1U0AA 1U7JA 2J22A 5F3IA 1ZVFA 5LEJA 2K88A 1U6GA 5J7MA 1YW7A 1RUC1 3LSRA 3BTCA 2CGNA 1PGQA 3BY6A 4ZDLA 2YS9A 2RKLA 2VZUA 2DK8A 5DCMB 1VAMA 2KI7B 2AREA 1FBUA 5CQGA 1QNWA 3A23A 5L73A 3M3EA 2EZLA 2KR2A 4Q4X2 3ENRA 4DUXA 1C57A 1LHNA 2QGUA 4QKBA 2Q1KA 1BCCJ 3NTNA 3OYBA 2A06E 4DXZA 4PIZA 5EZGA 5CJ0A 1PGOA 4Q26A 2ITAA 2PP6A 3JCUC 4HJGH 1D7PM 2K1AA 3K10A 3PM1A 4XOTA 4FPLA 4E70A 1EPWA 3LSKA 4DOZA 1OOPB 5HI0A 3FMQA 4KU8A 1APLC 4XZPA 1J5YA 2E19A 1W4MA 1LFPA 1BEV2 2YFUA 3MLLA 1ETQA 2G9ZA 4Q0PA 2WB1A 2C9NY 1LP1A 3IDAA 3IAQA 2FOKA 3CXHI 3IT8A 3ZIWA 3Q8EA 4ENMA 4IOCF 1VBD2 1VF5D 5DZFA 4AI0A 3POJA 6PAXA 2A6XA 1OCRH 4V2VA 3RJ2X 4ITCA 4M3LA 1N47A 4I30A 4G6TB 2CV6A 4ASWA 5K5RA 1IPSA 4IEQA 4G6QA 3CIHA 3PTRB 2ZMKA 1ZR2A 4RHV1 3QP5A 1KYWA 1FSHA 5F9TA 2ZMLA 1GZLA 1JB0J 3M8LA 1N3PA 2IVMA 2EXHA 1HLCA 2F5FA 2DDUA 1BIAA 1D8KA 1R58A 1RUI1 2HEVF 4EN7B 3CCRI 1IXSB 3DTEA 2RQPA 4OCTA 1BW5A 5I8TA 1XB4A 4C2MJ 3F22A 2QNKA 2MD0A 4QQOA 4H55A 3H8OA 1R36A 3ZXDA 4LXLA 3UGFA 2QQKA 2W84A 1ETXA 2R49A 3C2HA 2ZX2A 4Q1RA 2V73A 4A4AA 4AVAA 2W87A 1T33A 4XUNA 2JN6A 5ILVA 3ES4A 2V5YA 3JB4C 1MJ9A 3PLQA 3U1AA 3B6AA 1PO23 1H9TA 1UPIA 1PJRA 2KL4A 2QQAA 3VFZA 3K2ZA 2VY0A 1WH5A 4RYDA 1VQ6I 3LFIA 3VL8A 4XQ4A 2GIZA 5L9VA 2LTNA 4M71A 3VBFB 1W8OA 1AXZA 2VL8A 3BODA 2KFDA 3CD6I 5IOZA 4MGIE 4BE1A 1OYIA 4UWDA 1UCXA 2WFF1 2GOMA 4K40A 2JXAA 1POV3 1BOBA 5DTDA 2IGOA 3LCPA 4A3KJ 4FPFA 3BC8A 4AC0A 1AJOA 2K9MA 3R4UA 4P9IA 2DFCA 3LZZA 1G9CA 4YIRX 2ZFWA 4FOVA 3AFHA 4ZDOA 2G8YA 1BGYE 5KJ7A 4EYYQ 1KGYA 5DDJ2 2L5QA 1A36A 1ZRTE 3CCQI 2M9HA 3RYKA 4Q0SA 4BEHB 3REOA 2OYIA 2XBO2 3F0CA 2N9BA 1X2MA 3LW5H 1PMHX 4XUPA 5DZEA 2L3DA 3BPVA 5D8AC 4CDQB 4KWUA 3W58A 3PL8A 3S3OA 3K9TA 1RUH2 4WM7A 4K21A 5C3SA 1SQPJ 4AIKA 3ZFGC 3I4MJ 5FIXA 3L2CA 2ZGRA 4IQPA 4UB6E 1IS6A 2W1SA 3GHMA 3WG1A 2VZSA 1X1DA 5C9AB 2WV0A 1K05A 1QU3A 4HXCA 1Q56A 3OW2O 2VOTA 3JXSA 1EV11 3S7IA 4F92B 4OI0A 4XHXA 1SZBA 4LNVA 3CC2P 4QB2A 3BYWA 1QGKB 4QX1A 2XZRA 4UT5A 1DPUA 1ACIA 5FK8A 4Q2FA 4X6AJ 4A3EJ 4YLZA 2R042 3KQRA 3PUQA 1W0UA 2VMEA 4XRSG 1VR3A 1W8FA 1RVF2 3RS6A 3A21A 1KU9A 2V1XA 3V8JA 2UV1A 1MBGA 1HRV3 3HBZA 2NM1A 2JB8A 2VMHA 5F64A 5B5EE 4KN7X 1KILC 1OCZH 1UYXA 2FQPA 1ZG5A 1BGYD 2D1VA 2M0BA 1W5TA 4PV1B 2DV9A 3H1KJ 5LHGA 5AVAA 1ZRTD 2A06G 2MABA 2ESNA 4DPNA 1NT0A 1GV5A 1MZ9A 3DLLF 1WMXA 4S05A 4IV1C 2BY1A 1X3ZB 3W5NA 1DQ5A 3OPTA 4L9VA 1JOJA 3DKXA 3BATA 1RB8G 1ZKGA 3HPNA 1XQNA 2N1TD 5A7WB 5C8CB 3AL0B 1WD4A 1NK2P 1OFCX 1SQXK 4EN9B 5JUVA 4D7MA 5KKZC 3R0JA 2JIGA 3HWJA 4KT5C 1VRH3 2E7QA 2RS53 4LFUA 3M1HA 1PIXA 2NYXA 3WU0A 1B35A 1S3JA 3MZ8A 4WWCA 1QH7A 2QQWA 1IUYA 4EATA 3MD0A 3AEDC 4NQWA 2Y38A 3NEUA 2HQNA 1ND2A 2VMGA 4AZZA 1N1TA 1QJY1 1WJDA 5J96B 4EOTA 3G7DA 4JP0A 1PGW2 2O1QA 3Q9OA 4G7OF 2YROA 2VXRA 1YI7A 5BYNA 2BOLA 2NZ9A 4ITVA 3ZXAC 4K7JA 1QZEA 3WF0A 1W1WE 2HOTA 2QZ2A 4EJVA 4ON0A 3WW2A 3AKQA 2VASA 2ZKZA 3H9GA 5I0TA 4KA4A 2ZBKA 3VEPA 4KH9A 3WXPA 4AHXA 2E1CA 2QFEA 3SLIA 3O1MA 4CUAA 4PT6A 2Y6LA 4CVUA 3OBZA 5FZ6A 3IIIA 4EIJA 4M74A 3PHLA 1YW8A 1PIV2 1FJLA 3L73J 1ZBA1 2ZMNA 3HQXA 1FBQA 1YWKA 2VBPA 1JGSA 3CWBJ 2YKQA 2JSCA 1M8OB 3LSGA 4DZGA 5GPAA 1LOCA 2MA3A 1G6NA 1F4KA 4AK3A 2XDJA 4KIFA 1AU7A 3BR0A 3WTUC 5E79C 3KF5A 3J7AY 3B4SA 3L74E 3VHPA 3GDBA 4ZHNA 3BCBA 1RXFA 1RF1C 1SG3A 2H94A 5J6XA 4J1XA 4BCUA 2LSOA 2QSIA 2KIMA 1OIPA 5E8AA 3BP8A 1L0NJ 2LS6A 3G71P 1ETYA 1HSTA 2NRAC 2X1DA 3TW6A 3ZSJA 1W6MB 1TWAJ 1CI6A 1L7QA 5H9SA 1ND2C 1HBXG 2XVCA 5DJUB 1VQ9I 2D44A 2VD7A 3I2DA 1TTYA 1URQA 3DECA 2KT0A 3GTLJ 4Q4ZF 1C3HA 4COWA 1BGYG 2XPVA 5ILUA 5LW9A 5GZCA 2KHMA 1IUFA 1JYIA 3RZJA 3EETA 3UR3C 2V6CA 3IAPA 1W7PD 4XRMA 2MGQA 1NE6A 1LQ1A 4LOSA 5LGUA 1XU1A 1K6YA 4A7YA 2YFZA 1S5LC 1BOAA 4ZTFA 3N7NA 3NWKA 4NO4A 4U7DA 5KVRA 1VQ8P 4F3QA 4LE3A 1VF5C 4RB1A 2QQBA 3OR1C 5FFXA 1VPHA 1JMMA 4IX7A 4UF0A 2ZEZA 1VBA2 5HODA 4NRMA 1S4CA 4KISA 1OYYA 1SMVA 3JRCA 2DOEA 2KOGA 2IXHA 2B8MA 3HYIA 2HNHA 1AZDA 3L74D 1Y8RB 4FOQA 2E76D 2W95A 2ICWG 1YBKA 2OUJA 3C2BA 2WSCH 2H7HA 4QLCU 2X10A 5IVEA 1UXXX 3ABMH 4LORA 5AW4B 2ZPXA 2Q5TA 1VBC3 3OBRA 1T0FA 3OSFA 5ED4A 2DCJA 1YFWA 1RUC3 2L02A 3VL9A 4NROA 4CCCA 1SMYF 1J09A 4XFCA 3GBGA 1FOKA 4GODA 1PUFA 4CU9A 1NYHA 3VKOA 3CI9A 5JR7B 1JY3O 3LSJA 4DXRA 3CCVP 2M3EA 3K2AA 3MUY1 1FAYA 1PX3A 3TL4X 4Z1VA 2H1LA 2VZ1A 2XH6A 2XLFA 4OMZA 4XIDA 1U3EM 2VG9A 3LAJA 1LOGA 2OPKA 4QPIB 3WG3A 3DCQA 4R4LA 1R1A1 2R6QA 1RUJ3 2VXZA 4EM1A 5A3PA 1BA5A 2WN3A 4QPGB 1ETVA 4FFHA 3HR9A 2J1SA 3NJYA 4V2GA 1B1BA 4D6SA 3O8ZA 1PMJX 4HONA 5FYIA 3E1RA 3UGGA 3SHFA 2Y6HA 2VULA 2XGEA 2J42A 5APTA 2ILMA 4PIYA 3JCIA 4XF1A 1CPNA 1LFUP 2RS32 3RCOA 2C9AA 2W9XA 3T97A 1MZFA 3VKMA 4E4HA 2IZWA 1CJPA 2HYKA 3VBUA 1KONA 1PO13 2UWMA 5I0DA 4RS5B 2W0XA 1HIXA 4FPGA 1KYOI 2G7UA 1VQPI 1EAH2 3TW7A 1U78A 1NHAA 2K5CA 1C4RA 3G1LA 3AZYA 2ET1A 4ZYHA 4Y33A 4IJAA 1GV9A 1LDDA 2R0HA 3W2AA 1T0FC 4OIPF 4CPBD 1V54H 1ND3B 3OYAA 1OMIA 1XTGB 3CBNA 3WY6A 4KIGA 1UY0A 3BCWA 1FEXA 1RUE1 1YNAA 4XJZA 5LBBA 3EUAA 3SKVA 2VJIA 1RF0A 4PQ9A 1FBMA 4PDWB 3N9NA 4P14A 2IS1A 3CJRB 2VOKA 4UW4A 1RJ8A 5LRSA 2IX7C 1GZ9A 3BZCA 3GF7A 1VAVA 4G7HF 3M9BA 2WMMA 4XXPA 1BQPA 4AHWA 4C91A 5DAQA 3LEMA 1SCRA 2C0ZA 4BHCA 5KXCA 5J4VA 2CJJA 4Q4Y1 3WDXA 5HNFA 1H2LA 5IVVA 3L74G 4XSXF 5CFCA 1MS4A 4JDNA 3MUDC 1X7NA 4GKGA 3U1DA 3H32B 1NCRA 3K7AJ 1AR81 5IT9Z 4EEFG 3GZ6A 1LECA 5ISLA 3ACFA 4YXWH 4CEYB 1OHFA 2OU2A 4AIHA 2JVHA 3VD7A 1R1VA 1J1EC 3KB5A 4GXOA 4JDOA 1US2A 4IKFA 2WWJA 3OL3A 5HLTA 4D7TA 4MTEA 3P1IA 4GB32 3W67A 1J0RA 4QT6A 3HSRA 3O1VA 3FXDA 1H9GA 4AAXA 1OVUA 1QO0D 3BG5A 5FLIA 4LLNA 2VVDA 1WW7A 2WJSA 2EAKA 1GUIA 2N1TC 1VLNA 4QDSA 1NHLA 3OS1A 4UB6C 1K78B 3ZSMA 2E6VA 3E6DA 2DMNA 1RJ7A 5CCGD 1AQ5A 1XYOA 2BHYA 2WNUC 3NWTA 4P5YA 1VALA 3UJQA 4Y3OA 1PK6B 1AR92 1JUNA 2FNPA 3ZFFA 4J1WA 4EQVA 3PLNA 1ZBE1 3SCHA 5E1RA 5HNHA 1RYYA 3QOEA 5D5VB 3Q9VA 4IV3C 1J83A 3I5CA 4ZKUA 1FX7A 1Y8AA 1MQTA 5APYA 2W3JA 1YJNI 3IF4A 3GZEA 1I5ZA 3CQZJ 1U5TC 3IPVB 2R92J 3UETA 3OGRA 1IKPA 4S2DA 1D5YA 4XR6A 1WCSA 1PP9E 1S2EA 5B5EC 2YHJA 4PJNA 4P08A 1JOCA 3OBAA 3LFUA 2DWRA 2K27A 2VVFA 3LKJA 3CMAP 5D8KB 2P58A 2W83C 5EFWB 2XKOA 5F7UA 4MG2A 2FBKA 5FBJA 1QKQA 1ASJ2 2BVLA 2KNCA 4GKYA 4B7KA 1Z77A 5CIRA 3GEZA 1RE4A 5IP9J 2HS5A 2K40A 2RM21 1RL3A 1TZLA 4K3AA 1FNNA 1WMFA 2WZEA 2WO3A 4E4DX 3ZOIA 1LE8A 4Y4YA 1TC3C 1ZR4A 2GN7A 4FT8A 1PGJA 2JECA 2KM2A 1XMAA 1NA1B 4A45A 5BNGA 3S17J 4W6YA 2W00A 5IT6A 1S6LA 1BGYJ 2HWB1 2ZGSA 4IEJA 4LMYA 3JRFA 1RR7A 1WLWA 4LG3A 3GF2A 3K4JA 2IBZE 3ZDSA 1FC2C 3WEZA 4LLFA 3U07A 3P9CA 1MVEA 1STMA 1LODA 3VBRC 4QTRA 3M3OA 2Y0DA 5DAXA 2R7QA 2O8KA 4DRVA 5JOZA 1N73C 3AMQA 4HV5A 1VQOP 3MEPA 1V3FA 1QDCA 3T5XA 4FX4A 2OZJA 1FZFA 3GXOA 4N43A 1HQCA 1OKRA 3ML6A 1YTZT 3FXKA 1POGA 3WTZA 1DYKA 1UMZA 3ERED 3HBKA 1F36A 2ATFA 2A6HF 1MQTC 2D1HA 1PP9D 1MMAA 5F5CA 2MC4A 1CAWB 3UGHA 3H0GJ 4QPWA 1Y1WJ 2OYZA 2WWSA 4GALA 1WA4A 2HWC2 2Z2SB 1ON2A 4RJTA 3HL2A 2W91A 2M34A 1F15A 3GTGJ 1OVSA 4IEXA 3CC4P 3TGNA 2VXJA 3RZDJ 5JZGC 5FZIA 3T0BA 5C33A 5HDNA 1D5VA 4AI3A 4RB0A 2K9JB 4HKOA 3BLYA 1EJ9A 2OCCH 1IPJA 3JSOA 1E17A 2YY1A 3EQ2A 1ULOA 2J1VA 2FBIA 1LTJC 3Q9SA 1UOBA 1GU4A 3FZ3A 2FJ1A 1QVFO 2GUVA 2P6SA 3CCEI 4BZ4A 3GTJJ 4OOIA 5LK7B 1O3QA 4K2EA 4A0YA 3MGNA 1AR71 3L70E 2ESHA 4W7ZA 1BR4A 1AYM3 2POHA 1NLRA 5CADA 2WIIB 2E76C 1ZBA3 1H9PA 3PVOA 1SEUA 3ABZA 4CDWB 4ZYGA 1VBB3 1S0JA 3HTUA 3M1EA 1G3SA 3ATGA 5DMYA 3M1CA 1JGGA 1KB9E 3OYEA 2AEZA 3FXRA 3W2VA 1YOVB 3CO7C 2FRHA 3NV3A 4U87A 1UY2A 2EF6A 4ESBA 1Z6RA 2XNXA 3ZYFA 1SQQD 2TBVA 3FXMA 3QQAA 5CBOA 1JUMA 1T95A 4ZZDA 3KP6A 4P1WA 1FATA 3DPRB 3N4XA 1S2KA 5EHDA 1OD3A 3VDCA 1DP7P 5HXVA 2TCTA 4FAGA 5C3RA 4W50A 4BH9A 3AE3C 3OGGA 1UWWA 4D7SA 1LTTC 3TO9A 2KRHA 1V4RA 2D2CB 1R5GA 4WZCA 2JUCA 4ENJA 3OMYA 2DI3A 4EQQA 3B7MA 5AW3B 1ULFA 2IBDA 2WO2A 1DQ6A 1M1KQ 3GF6A 5BU5A 1NTKK 4B43A 1J3PA 1SFYA 1HW1A 1T2KA 4LO5B 1BE3E 2CSGA 3AEFC 3LF7A 4LITA 2A6TA 3DKQA 2K4BA 4GJYA 2TEPA 4XF0A 4HN1A 4C90A 2RAEA 5FZDA 4L73A 1WZXA 1NKNA 3ZMNA 1ZK8A 3LIGA 2XUMA 4JYCA 1V6MA 1D0GA 2QA4I 4Z2WA 1A31A 1AL21 5FAXA 3AXEA 1KQFB 3BI3A 2G19A 1Y0UA 1OWAA 4ZU5A 3L70D 1ACCA 1FOSE 2QBYA 4NIIA 2R7EB 1JYNA 3AL6A 4IHWA 5DXDA 2WT2A 1V9U1 1KB9D 2JJ6A 5B66E 2RMZA 4JQTA 3MIWA 2XJVA 5FRAA 4R9AA 2V9PA 3DYMA 4CDXA 2DTZA 2HYNA 2KSJA 4OHXA 3MHZA 4BLJA 3L00A 3QOPA 1FOD1 3EUHC 4CYDA 1W8HA 1XE8A 1Y8QB 5D4RA 2ZJSE 3FF5A 2KUBA 3S16J 5JOXA 4J25A 1YUDA 2RJLA 5DDGA 2L7ZA 2R063 2F5VA 3L74J 1WI3A 1IQDC 2ADEA 1R5SA 2VOWA 3OYLA 2ZGLA 4DQAA 1AVYA 2JDKA 2PLV3 2O1KA 1DQ0A 1OLRA 1WQ2A 1BE3D 1V5EA 4BMEA 4N3YB 4Q4X1 1GOHA 2DMTA 4IL7A 4PFOA 3PJYA 4XLEA 2ARAA 4J00A 4PD4H 4UVCA 4CDUB 1KS4A 4KG0A 5C4JJ 1MFZA 1T2KC 4UAPA 4HF1A 3HNBM 4XETA 1LTAC 3W6JB 1VFCA 3RK2B 4OWRB 1NCQB 2KS1A 5DN2A 5LBFA 3KETA 3PMSA 4GWMA 1NU1E 2BW3B 4DMIA 4AFCA 5GAHJ 5E89A 1CAVB 5FOBB 1F4AA 3F8NA 4XLCA 2VZRA 2IBZG 3LQCA 2Q8OA 3RQ0A 3KHCA 5KHDA 1GP4A 2YSRA 1BEV1 2GUSA 4DZPA 1VTNC 2YZ4A 3CL3D 4ZZLA 3JD72 1WJBA 1MD0A 1D2QA 1VBD1 1COV2 5J8FA 4BQXA 4CTEA 3VPRA 3M0AA 3M9HA 3OBTA 5T5LA 3WCSA 3KCCA 3V7CA 4K3UA 3INAA 2IFMA 2DF7A 5FY0A 2VTXJ 4YVWB 1GMMA 1CAXA 3WSOA 4CDXC 2WAOA 3SZGA 4HSTA 3HOZJ 1STZA 2XJRA 5CCGC 3IN6A 4WM8C 3I54A 5A3NA 5CB7A 4PJLA 2NOGA 2DW3A 2O14A 4NJ4A 2WT7B 3A1YA 1X9TA 1UQXA 3LW5J 2Y9YA 3CUQB 2HPCB 2IYOA 4BQ5A 1G2CB 4H0LD 3P3NA 1RUE3 4X1EA 4MNUA 2ZOEB 4JGZB 1QY4A 1H8TA 1UU5A 3GBFA 3POWA 2CPSA 2FD8A 3L70G 4YPCA 2RDNA 3W6VA 1NU1D 5EIYB 2F4LA 3O6QB 1R5HA 5F3CA 3CTAA 2R073 3VHRA 2CUJA 3MZHA 3D4KA 3SISA 4WXDA 3CZUA 5H6RA 2ELJA 3OIQA 3AFGA 3ITQA 3HKZN 1I1SA 1O5LA 1EUTA 1ULDA 5GLTA 2JWAA 1W2UA 5L9RA 5AIQA 2P4EA 3PU3A 2DVGA 1MW7A 3V7RA 1JU3A 1S9KD 4BXLA 4Q1PA 1DG6A 1WCUA 2VT3A 2BHZA 2GN3A 1LKNA 4Q47A 3TAYA 4DYQA 3S93A 3GZ5A 1UN1A 1Z6TA 1RY3A 1F31A 3N9MA 4U3FE 2XAFA 2R32A 2GMEA 3I2JA 1GICA 1FZAA 5GLWA 1UY4A 1G3YA 1BE3G 1UFMA 1E3HA 2VTFA 4FQGA 1BVP1 1OUSA 2BNNA 2YBKA 4W65A 5DDJ1 4EM0B 4E6KG 2Z5IA 3HJEA 2IXLA 2VCAA 2ORXA 3HOYJ 1O91A 4L99A 2FXPA 3QWLA 2XF7A 2XBO1 2BPA2 2B42B 4YW6A 5F32A 1IN5A 1UJ8A 1OPOA 4X6QB 1NAEA 1A02F 2M0MA 1USDA 4QKDA 2WT1A 5FWEA 1LTGC 4NWVA 1RUH1 5TJJA 2WKKA 3BR1A 2ZTNA 4IE6A 1OVPA 1UAAA 2H88C 1GK4A 4CA9A 1FAVA 3NRVA 1MZ6A 2OTJP 2MPFA 3OIOA 2A07F 5EPAA 3TDUC 5A3OA 3RJRA 3M70A 1DU6A 1SQVE 1YI2P 3LA3A 3VYUB 4AXOA 2QENA 4ATEA 4X0GA 1JI8A 2ZT9B 1PO22 1YQ8A 4BIOA 4YRDA 2Y69H 5FY5A 2HVRA 3VD4A 1RI7A 1OOPC 2R041 3ZFEB 1G1JA 2Z79A 1XG1A 3B71A 2RNJA 1Y9QA 1W2NA 5LGNA 1D1CA 2FZ1A 1RVF1 2PFBA 2VC9A 5EXOA 3KFWX 3TP0A 1W36D 2H89C 4U3FD 3VBFA 1R082 4OHZA 4YELA 3NWSA 3VBSB 2O1JA 3FXEA 3BTXA 1M06G 4HG2A 3F9KA 3I4IA 2AQFA 4Q4W3 1X1BA 2YO2A 4A5NA 4TLFA 3E6MA 3E1IA 1D0XA 3IR9A 4CZSA 5J47A 1POQA 4AI1A 1LT9B 3O5SA 1FZCB 2Y60A 1NK3P 1S7EA 5J4YA 2NMNA 3O1RA 5KLVK 2CYYA 2I8DA 1ZMEC 2MFZA 3V7SA 5CPRB 3T2QA 3UNPA 1MV8A 3OA7A 3BPXA 4OINF 5DUWA 2P67A 1AXKA 5BXXA 4OQ8A 2BU9A 1ZYRF 2VONA 2M30A 3GFMA 5FPAA 2CAUA 2YU2A 4CDQA 5E17F 2FYNB 2P10A 2HOSA 3HRMA 2WBKA 3AE2C 2UY8A 1TWHJ 3I59A 1GBGA 2GNBA 2KJBA 3QPLA 4KJZA 1RE3A 3TO7A 4NNJA 4C7NA 2QRXA 1MSEC 2VW2A 3RFRA 1D1AA 1BN5A 2I74A 4YGEA 3M3CA 3E1SA 1CIWA 2EFPA 2QZ8A 2D97A 5JCTA 3BZ6A 4XFFA 4AU7A 3GW2A 1PGW1 3PJRA 2ZAEB 3WHCA 3KLSA 3CDIA 1RUG2 4JGYC 1XOYA 5BPIA 5IATA 2PHLA 5C4WC 3VN0A 2WQZC 3V4WA 5H6QA 3N05A 1MS1A 4II3A 4GULA 1QJX2 2XF5A 3C8XA 2MD5A 1PZQA 1QOOA 2ORZA 3VBFC 4R4MA 5CVIA 5FDBA 3U14A 1BMV2 2VZOA 4XW3A 4QU2A 4HNTA 1FU1A 3N9PA 1I9RA 2TRTA 2ECCA 2VBDA 4HDUA 2XAQA 4LLGF 2Q7CA 3F6VA 3KZYA 1ZZCA 1X8MA 2MJZA 1PIV1 3PJQA 3H36A 3WP4A 5BPXA 2NS7A 3P7KA 3ZXJA 1AR73 4XF9A 4D9JA 4JBAA 4TTGA 1A6CA 2GXAA 3RYPA 4EJRA 3S4RA 3LB9A 5T54A 3JB8A 2R5YA 1YTZI 4DS0A 1J3QA 1HBWA 5A7WA 1BM9A 4UV8A 2YMZA 2WSCJ 3HD7B 5C39A 1TE1B 2P6TA 3I2IA 4L92A 3AC0A 4CDQC 3D5LA 1JMUB 4PQQA 1JN2P 3CJIA 1VRH2 4XRSA 1S0BA 2AGSA 1R4NB 5DM7F 1LEMA 3RGBA 4WV8A 1R5LA 1J1DB 2Y0OA 3M8JA 4HVRA 2FYUE 4P00B 1SBDA 3ZN4A 3ZQQA 3WQ1A 2FE3A 3VDDB 3DU6A 3QPHA 5C9AC 4AQRD 1DUXC 5FPUA 4U3FG 2Y2ZA 3BB6A 3NAPC 5BNQA 5JVTA 1VQ7P 2ARCA 3HBLA 3QCWA 4ESFA 2Y0MA 3U37A 2RREA 1LTSC 2QJYB 1ODMA 4Q0UA 2WPQA 2BERA 2NPSB 1B9NA 2R16A 1D3YA 1O4XA 3HGGA 2CNAA 2NQYA 2FDGA 3A2KA 3IAOA 3LOCA 4BGDA 2RNGA 3S1RJ 4MHGA 1L4AB 2HVSA 2LD5A 1IFDA 1NTZK 3MYXA 2NN8A 2EK5A 3T2TA 3RTRA 1KJLA 2VH9A 4P55A 3B73A 5B66C 4XF4A 4RR3A 3HMYA 1L2PA 2M4KA 4BNCA 4GMP0 2PJPA 2WPSA 5M1BA 1PUEE 4PV1C 2JWPA 4YW5A 1X3UA 4YNIA 1G8XA 5BOXA 1CF7A 2RS12 1VBA1 4U0WA 2AYHA 5LA2A 1A8MA 1NYWA 1GLNA 4XQDA 3Q5SA 1SQVG 5AFEA 4AYBN 2VN2A 1XJAA 1W5SA 2W1QA 3VMYA 4QKNA 3FBIB 2VODA 3L70J 1ZW0A 2C4XA 2OQRA 5ICGA 1LT1A 1VNDA 4GOFA 1P2FA 3F23A 5C8CC 2B39A 3QBQA 3AL0C 4UW3A 4H7MA 2FYUD 4LK7A 2K02A 4AR2A 2ZGMA 5FZBA 1TQMA 4COUA 2ZMEA 3EWKA 4LBOA 5FLJA 1G7YA 1HV1A 1LTBC 3SH4A 4DUWA 4H0LC 5BNOA 5EF6A 2W1WA 1W6MA 1SANA 2COBA 4V1PA 3CX5H 1JODA 5F1JA 1HOMA 1TME3 1K04A 1EDJA 4BK4A 2ZYGA 5FY8A 4YSFA 2VI6A 2Z1DA 1W39A 4LD5A 4ET7A 1ZOYC 4FE7A 1KQ0A 3CP2A 4ZONA 5DAPA 4BJ6C 1DLLA 4K35A 1BE3J 3WUTA 2TDXA 3II6A 1K8AQ 4RAZA 1GVJA 2XGXA 3KHBA 1DFQA 3L35A 1QJU3 5E8GA 3OCPA 2PN6A 2P17A 2ZEWA 1W3XA 1AL0G 1EZVG 3JTGA 1T56A 3M0DA 1NTME 3RL0B 4ASLA 3QRFF 1BEV3 3TOBA 2FDFA 1LNQA 3CCUI 2RS31 4Y1YA 3CCLP 1W06A 4RB3C 1FZEA 4G6DA 3N9LA 1TMF2 3T2OA 4I02A 1ZARA 1YQ5A 3GX4X 4EN8B 3V2PA 1EP0A 5APAA 1IZ3A 3RZKA 4YW1A 2KP8A 1ON1A 4I09A 1YJ9I 4OMYA 2CYFA 2XWBB 5JWPA 1MVQA 2K37A 3Q3SA 3OGJA 5BUVA 3LIEA 4ZZ5A 2GDFA 1EAH1 4S0HB 3J80Z 1NJIQ 3MGUA 1VBC2 2D43A 3O8GA 2VOPA 4RQPA 1GQGA 1B4AA 4KBBA 2UY9A 2H8RA 2A3WA 2Q8CA 5B4NA 2Q3EA 2D40A 2M3BA 1HQLA 3RZLA 3FMGA 1DGRA 2L7FP 3M4OJ 5FKOA 3JC22 4IQJA 3K4NA 4HPKA 1XX5A 3SXYA 3FX3A 2M8GX 4GGGA 4BDVB 2GA1A 3D0SA 1PMIA 1AF9A 1AX0A 1U9OA 1DYPA 1HC8A 3H92A 4QPIA 3G4SI 4UXAA 2GNMA 4S2FA 3M4FA 5K0UC 4A6EA 2WSFH 5FPLA 3GLLA 4QPGA 1LRHA 3V0AA 4NAOA 1P84I 2H6CA 4EGZA 1RHI3 2UWJE 2L9LA 2YXRB 1G9FA 5E88A 3P32A 3G3ZA 4PZJA 1C5IA 1IOAA 4L5EA 5HLHA 3Q3DA 1BBT3 2F6CA 1W36C 4OGQB 2CSOA 2LREA 2FX0A 4R4ZA 2F6BA 1UIJA 5CA6A 2W52A 4HNVA 4GWIA 3I7DA 1G2HA 1BVVA 3TMOA 1ENXA 1POV0 2WZ8A 2FYUG 5H9QA 5J3UA 4WCGA 3R4DB 2WY7Q 4AEDA 1QX8A 1JKRC 1YHFA 3KV4A 1PO12 1OCCH 4M00A 1ZZ9A 3OYWB 2ZXXA 3HUSA 4GB31 2YX4A 1JZ6A 4RS5A 3Q8CA 1K5MC 2P37A 3K48A 3VWBA 1LOFA 2W08A 3EBRA 3FLPA 2DVBA 1VF9A 5HCAA 2CFXA 2R7DA 5DDJ3 1S55A 3BCAA 1HKDA 2CQQA 3PO3J 2OYIB 4FXGB 1R7JA 2XBO3 5GTHE 4BQQA 2Q0OA 3L9JT 5APUA 1F1ZA 4UVBA 3W5MA 2WTEA 2EALA 3RMXA 4HL0A 3LPGA 3J7YJ 2E1MC 4WM7B 1AR91 4XDQA 4L9JA 1QJZA 4PDWA 4CP1A 2Q1MA 3KQGA 2D2CD 3PUBA 1YW9A 4QPIC 3DP7A 2DVAA 4C1XA 1ULPA 1K6OA 4UFJA 4QPGC 1MEC2 5LRRA 3CCRP 3HC7A 1UOFA 2Y0IA 2FF4A 3DEMA 3FX0A 2D2WA 4M9ZA 4FPCA 3VP8A 2K2SA 2C9KA 1DYOA 3G1OA 2DU9A 5AC92 3CCMI 1IS3A 3HUGA 2PRRA 1Y9GA 2VJXA 3GM8A 2XASA 3WP3A 4LIUA 2R043 2E5YA 1YX5A 4ONUA 2BBYA 5ABJB 2H8PD 2IA0A 1XPWA 4BAYA 1F9KA 2VBZA 4XBFA 2V6EA 3R4KA 2FXAA 4EWAA 3BRTB 4W7YA 2QQVA 1ASJ1 5IVCA 2W82A 4FQ4A 2YIUB 1JZ4A 3WHBA 1X82A 2DCTA 4QQHA 2A1XA 3IWZA 3B93A 4YFNF 3RPUD 3KM5A 5HS7A 4O9GA 2RN0A 5AW7B 1VQ6P 3LOBA 5GAEJ 4PLNA 2R7OA 4U3FJ 2A05A 1LOFC 1LDJA 1NZIA 2BY2A 3GWZA 5BNNA 1ENSA 5K7HA 4QWQA 1JUHA 2YC2A 5I8SA 4LB5A 4E8CA 4GQ7A 3C2UA 2O5RA 4X8PA 3ZYBA 3CD6P 5CAZA 4XF3A 1ND3C 1J3RA 2NZ2A 2P7CB 3HD8B 2Y9ZA 4P9UA 2IPPA 4OHVA 3H1CA 1CPMA 1NTMG 1WCKA 3I3MA 3CX5E 1UPSA 1LJ9A 5FUPA 2VL4A 1WZ2A 4D0PA 2K9LA 4FPOB 1B35B 2ZGKA 2VE1A 4XKVA 2OT7A 2Q9IA 1ULGA 3CCQP 4FBFA 1AR63 4O7XA 3CXHH 4QGMA 4A12A 3DU5A 3HEFA 3PUSA 1PGSA 2D6PA 1QOTA 1PYVA 3IPVA 3NVCA 2QLZA 1VJ2A 2WDBA 2DYRH 3VKFC 4N8MA 1YYCA 4XAAA 3DPLC 3ZKYA 3RNSA 1U0JA 4WF2A 2HWC1 2JJ7A 3RK2D 3ZQIA 1SQVJ 3VHOA 4IL6H 5FY7A 1NTCA 2A3YA 3M3YJ 2VQ0A 1GNZA 2FKWB 3MIEA 2XVGA 4D6RA 2ZZQA 3CKHA 5HCFA 4CCOA 2JDUA 1UYZA 5AVQB 4AYCA 4PGHA 3S1KA 2WWUA 4CEYC 1JMBA 3ELKA 1FJKA 1KGSA 2OAZA 4CP9B 4GWJA 1OQ1A 3AECC 2B45X 4YPJA 1B09A 4TV7A 3C7OA 3TEWA 4JPZB 4OHYA 2L5GB 3OL4A 2JSPA 5B3SH 3ZMZA 1Y1VJ 4GJZA 3J26N 4LJHA 1PVXA 5J98B 1Z1DA 4Y15A 1C1LA 3MHVA 2DBIA 4WX9A 4BDYA 1TVGA 2Y64A 1Q1HA 3VB9A 1IXRC 3WNPA 2UU8A 2D3RA 1TT5B 4B3XA 5FB2A 4CXFA 3V2QA 3KQ4B 2EH3A 1NA1A 1IFMA 2EZIA 3O0XA 2WNVA 4BQNA 3E0JB 3MLKA 4Q8KA 3UT0A 2R7TA 1H1IA 2Q8DA 3H1HD 3VBHA 3WW3A 2OUHA 4RM3A 4D6TE 2LP0A 4MHUA 4NIDA 1PK6C 1W2BO 4BE0A 1OFSA 1W05A 5B2GB 3WW4A 2GP3A 5CZKA 2LROA 2RN7A 1X9VA 3LWCA 3ZMDA 2ZS6B 4YFWA 2BFUS 5FO5A 1UW8A 1RESA 1RMU3 2OA4A 5M0TA 1E5WA 1NG6A 1URQB 2AZ5A 1TWFJ 2W6AA 3WDTA 5FZ3A 2IZ1A 2ZACA 1H6XA 1SQPK 2DMQA 1EH7A 4XVHA 3AYAA 1J75A 2WO1A 3OGSA 2OA2A 2VBWA 1UMHA 3EFGA 1BHGA 1HX6A 1GNHA 2UXXA 4YG2F 4XJ8A 2KZVA 3SKJE 3GG2A 3QPSA 5K5OA 5JI6A 2K9JA 4F93B 1YE9A 1SFOJ 1XNTA 4EYUA 1WJAA 4RS8A 2RDRA 1GYKA 1XNAA 3JRBA 1H0BA 2E33A 3AYDA 4FPEA 4EE2A 4YZ2A 2NOJB 2VUAA 5F39A 2VGDA 2Q3IA 2IYPA 2BFUL 5CKTA 4K8FA 1BSNA 2PMUA 3WGIA 3C3VA 1OPCA 2PJRB 2I5UA 3B5NB 1H0MA 1AYM2 3ZMOA 2Q1ZB 4LBQA 2VUCA 1OKOA 4AI2A 1VBA3 1VBB2 4JX6A 2EXIA 2DURA 5FZ1A 4P9FA 1WKYA 5DPNA 1FOYA 1BJQA 1UIKA 5CCHA 2QSFX 5CVJA 4D6TD 4IEUA 3KP2A 4QX5A 4PLOA 3WDVA 3M91A 5A1FA 4RLFA 2EIDA 1FDMA 3DPRA 4BQ3A 1XC6A 1ZN2A 3WG7H 1GKBA 3B9IA 1SPPB 2G4IA 1D0YA 1BSHA 2VKVA 2WYSA 4EZ4A 3DTIA 1FZBA 1PUFB 2ELKA 2L9VA 5CKQA 3KMHA 1I1GA 3RKQA 3H1IE 4F52A 5A6QA 4KI5M 3RI9A 2OPTA 4HX8A 2FYUJ 1YQ4C 4K1YA 3PNTA 4BXXJ 2HWD3 2IXJA 2LOOA 1ZP0C 4Q0VA 3LQRA 1HRI3 5ICEA 3LNQA 4MLOA 2ZXJA 3PUFA 2ZT9D 2WV1A 1JJ6C 3JQXA 3M3IA 5DUKA 4CU7A 4IRIA 4H14A 1QOSA 1AX2A 1IAWA 3CJXA 1KA8A 1ZM1A 4LTAA 2NP0A 1VQ9P 3L7WA 2BWAA 4JYBA 1I1EA 1MS5A 1TNTA 1QQP3 4IPAA 3MZYA 2QCSB 1S8NA 4BISA 2LY2A 2HEYF 3JD71 3KLOA 2R7VA 2R3CA 1IN6A 2R5ZB 4YVSB 3T97B 1COV1 2IGNA 1XTAA 2MC3A 2WA4A 2JG9A 3VBUB 4ISQA 2JTVA 3V8LA 2JA6J 1BW6A 2DUOA 4CDWC 2ADUA 2M1BA 3RPQA 4RO0A 2ADDA 5IPAA 1UX7A 2DXIA 1QVGO 1AVBA 5AVPA 3BG3A 1W6OA 2LRDA 4P5HA 4NC8A 2PHDA 1HA8A 1Y0NA 1HJGA 3DPRC 1SFEA 3I2OA 4ZXKA 2RQQA 2WINB 3KWVA 3H1ID 3P8CE 2C6YA 5FPBA 3BQZA 2X29A 3PO2J 4BKXA 1H89C 1EV7A 4XDOA 1TLHB 2PLV2 2D2CC 2ZGUA 2HZTA 2XUEA 2Y6KA 3RBXA 2F4IA 2E35A 3L75D 3TNUB 4ZYDA 3CXHE 2EXJA 4N4OB 2ZJRF 4NHYA 2KXLA 1GDTA 3HT2A 2P6CA 5EP9A 4CDUA 4HW0A 5FRNA 2SBAA 1OLME 3H7JA 4KWKA 1AA7A 2HQAA 1LAJA 5DD8A 1PZ8A 1KZUB 4IL6E 1HXS2 3K77A 1NCQA 3GCXA 3WV6A 4PJMA 4AF9A 1AKHA 3BTZA 3FKJA 4EWDA 2QG4A 2KPMA 2BBVA 5J1UA 1DQ4A 4R4XA 3CO6C 1EY2A 1CAVA 3ST7A 3WTWC 5CFCB 4FPKA 4XFBA 1USTA 2KB7P 2J1AA 4Z92B 1PFIA 2XG3A 3NFQA 4YZ5A 1FPN2 3FUQA 5F6FA 3J80K 5APVA 1SBFA 1JUSA 2VPRA 4KHXA 4BA6A 1ZRDA 1MNMC 3VZLA 4A7KA 5FYMA 4TSVA 4XMIA 3S15J 4YFKF 1NTMJ 5T5OA 1UYYA 2HEOA 1CX1A 4UHTA 1KEXA 3WHUA 3L36A 1HQWA 1PPJE 2LC2A 2HWVA 2DFFA 4YVWA 5GTHC 2OQQA 5EJ3A 2FUG2 2YU1A 4OIOF 2CQNA 1WCDJ 4ES9A 3B94A 5F2WA 4COVA 3MMYB 5C3EJ 1RUD2 2GALA 2AO9A 1XE7A 3SXWA 3OWTA 3OSDA 4Y17A 5D5XB 2WT7A 4YG3A 2PQ8A 2GH8A 5ACA3 1SCSA 3FXUA 2K9QA 3CXHD 4GIFA 3N7KA 1S7OA 1KC8Q 3L9FA 4C0HA 1NTKE 1VQPP 3MKZA 5A33B 2LUWA 2XPWA 3IKWA 4JYKA 5A7PA 5E79H 5L8RJ 2A45H 4CDUC 1EPZA 1U5XA 4XE9A 2AQEA 1SD4A 2ZNYA 3O6QA 1H4GA 2O8QA 3BTJA 3W3CA 1OC1A 2PA7A 1CQTA 3K3OA 4CYCB 3LPFA 1UIXA 3BGAA 1G59A 3CJTB 3SFIA 4NPEA 3ETPA 1TNSA 3RK2C 4QQPA 5CFDC 2NPSD 3H1YA 1PO21 4XE5B 3Q8AA 3HXLA 1BR1A 1N25A 4AHZA 1GOGA 2G9GA 1S0CA 2R4GA 3WUUA 1LU1A 1L4AD 2RDQA 2ZFUA 4WXHA 4ES8A 1JYXA 1XSQA 4AFAA 4C46A 5L3GA 3NV4A 4HA8A 2WPVB 1K83J 1O8SA 1BCCG 2X48A 1M1JC 3LEKA 3N7MA 3VZJA 1C0WA 2QQ8A 2KP6A 2HDCA 2RJKA 5JXIA 4W6WA 2OD5A 1ENHA 3HM5A 3WX5A 4E8DA 3GJAA 4AL9A 4RD7A 4YW3A 4B48A 2EIJH 2ZXWH 3AE6C 2KRFA 4R8HA 5M3MJ 3R0RA 3V65A 2HLEA 2ZGQA 4FTSA 3KHUA 2KD7A 3TKYA 3U0ZA 1NTKD 3WUVA 4NRQA 2JVGA 3CUQC 4HBNA 3PTYA 4IRGA 4M3EA 4XK4A 1B8IB 4DO0A 2CWSA 5C6CA 1J59A 5K4LA 2BGCA 3I2GA 2ZGNA 4L9NA 4UOJA 2DOFA 4JGZC 3CDHA 1MJAA 1SLCA 3TDKA 1WT6A 3A4CA 1L3JA 2W1UA 3O0VA 4GFBA 5FYYA 5L9BA 3GYDA 2ZSIB 3ZCOA 3MIBA 4N43B 3ROUA 1VQ5I 3PVEA 3U4XA 2P5LC 2F4PA 5JXGA 3PVBB 4YEJA 2L91A 4LHKA 2M8RA 1F5FA 2Z16A 3JU9A 2A6YA 3G2BA 1Z7S2 4B7EA 2QQIA 2LMDA 2RDSA 3W20A 1VZ0A 4LGDE 3E97A 1QJX1 2QM7A 1SDDB 5AVXB 2M4GA 1HRV1 5BPDA 2EIMH 3ULQB 3HAGA 3WQ7A 1WGXA 3VBSA 5JI9A 1BMV1 5CYYA 3A0HC 1YJNP 3RL0D 5B1BH 3CDLA 5TJHA 3P3PA 5EWSA 1O7FA 5JHFA 2P3JA 1IZNB 4Q4V2 2IFWA 4NBQA 4C3HJ 2M45A 2X8KA 5J48A 5KLIC 3H5RA 3JAMZ 4ENKA 4HFSA 3LGRA 3ZXLA 4JV4A 1CESA 5KBFA 5IFTA 4JRLA 1YIJI 3L2QA 2D93A 5DUVA 4KT6A 4LKSA 3R6SA 3ACLA 1JY2P 2WZR2 5JVGF 1VMFA 2ZX1A 3TN93 2BNMA 3HSEA 5LLQA 1OCOH 4Y1ZA 2YPJA 1ZGAA 4CU8A 2O8OA 1K5JA 3KZ4C 3WP5A 1G9AA 4SLIA 4QB6A 1ZQ3P 4Y22A 5BNPC 5K5GB 3JSVC 1Y3TA 1VRH1 1GWMA 4XUTA 4LHLA 4F8AA 4MHRA 4YFXF 2KYVA 2JB4A 3RZMA 2DJIA 1PP8F 2KLVA 4BACA 5M5YJ 4PBOA 4EVIA 2QKDA 5A7OA 1FTTA 3H0DA 5EFUA 4FP3A 5D6FA 2F17A 1PPJG 3L72E 3QH6A 2M7AA 4NIGA 3J7AO 2ZT9C 2HI3A 2BQPA 4L74A 3R60A 2R1DA 3SZTA 2O7OA 5A2QZ 3ZFEC 4D1QA 2OUMA 3D71A 1VQMI 2FQ4A 2CV2A 2ENRA 2VW0A 4BDZA 2R7SA 1VQ8I 4OGQD 4I0AA 4L5IA 4Q48A 3HOXJ 2O01N 4OU0A 1MZ5A 4QX8A 3LQQA 5FO8B 2IWGB 3AEEC 1QXJA 1YRZA 3DGTA 1ORKA 1XDUA 1SVMA 4A0XA 1O5UA 4E2SA 4B4RA 1B59A 4YARA 1R00A 2E26A 4LBMA 2D6LX 4RM2A 3IMNA 2IS2A 5APWA 1LEBA 1LT9C 1CAUA 3H1JE 1FZCC 1UAIA 2RS11 4ZTJA 3WG9A 2P7VB 4R9BA 3NNMA 4YIIA 4R79A 2ELHA 1AX1A 5TRDA 1R1TA 3WF3A 4O6JA 2K4JA 2WAEA 3VYRB 2Q30A 1VB4A 3NXSA 3LDBA 4IUGA 5BV6A 4JKMA 1DZTA 5KJ7D 3MPBA 4FETA 3LAGA 1Z67A 3MAJA 3HD7A 4JQ0D 5J09A 3AFKA 1JXSA 2FYNC 3CCEP 2EIKH 5K1YA 3KYDB 1O3SA 2H0VA 4NDLA 3H1KG 1JT6A 3L72D 4PGGA 5IOYA 5BVZA 4D6TJ 4JAAA 2P1JA 4EWEA 2QYOA 4E7IA 4PF1A 1Y47A 3C3WA 3KIOA 4JHZA 2LALA 3WU2H 4PI0A 3PHMA 4UB6H 2JKVA 4C9YA 2J1TA 3NO8A 5LBQA 1GXPA 1BR2A 2FMLA 2B87A 4GYGA 3I3EA 2ET7A 2VE8A 4XURA 4MQ9F 2WSFJ 2VNRA 1EUUA 1IJDB 3FM3A 4KU7A 3D8CA 5LD2C 2WO7A 2KS1B 9ANTA 1IG3A 3HOWJ 1LB2A 4QHOA 4HBLA 5JI7A 1S5LX 5FRMA 1GW4A 1OQEA 5F0HA 4DY5A 4XFJA 4XAEA 5C5TA 3JTHA 4J01A 1LGHB 3H1JD 4OWFA 2KZJA 1X22A 2CK3H 2ZGOA 1NH3A 3PP5A 2HODB 1DCSA 3JD73 1C28A 4KITB 1NH4A 4LLHA 2ZAAA 1QH6A 2QA4P 3POSA 2Z5HA 2DJNA 1PGL1 3TP3A 1O6UA 1CAXB 4MGYE 4C3JJ 1UNBA 3O8HA 3L4FA 3PQKA 4BM8A 4KWLA 1YITI 1Q90D 3C7GA 4FOWA 3OGVA 3GTPJ 1EDIA 1VBC1 1HF0A 4CO8A 2IXKA 4FASD 5HCBA 1NUKA 4LJZF 3L2YA 4YIFA 4HQMA 3POBA 5E20A 3DUIA 2XB5A 2GMMA 3V6IA 2JDIH 2XAUA 4AIDA 2FHRA 2F4OB 4CCEA 4B1RA 1YQCA 1JTYA 3VDDC 3L73G 1ZLKA 2JIJA 3GZAA 3QAHA 3U9GA 4IL6C 2Y0EA 3FFQA 1TME2 4AGGA 2A3SA 3ELNA 3V2NA 3CWBG 1AYN2 1LR5A 1QHDA 1W9YA 1W0OA 1H8TB 5BS6A 4AFDA 5FLVA 1D2SA 4CZCA 2K3PA 2K46A 1MMNA 2NPSC 1RUJ1 3J81K 3H1IJ 2CQKA 3U75A 4D5FA 4LUKA 3V0BB 3SJMA 5FZ9A 2XKMA 1CZQA 2LY9A 3ZPLA 1V6IA 1KYOE 4CH7A 1L4AC 4LA3A 1L0NG 1GP5A 2DOAA 1QJU2 2V9KA 3CHXA 1H1MA 1JZ8A 1MGTA 4AHYA 2DAOA 4CCDA 2BCCD 2EFWA 3AMPA 2HXIA 2GH2A 3A0NA 2I45A 1YI9A 4U88A 2D6KA 5ICFA 1V6KA 4Y24A 3F3XA 1IG0A 2XPUA 1H88C 1PO11 2Y0SA 3HTKA 1CZTA 4FTBA 3E6CC 1NXMA 2NMOA 4F3JA 4L5JA 4P9YA 3J4UH 4M3CB 2O6GE 2QSGX 2BE5F 3LWFA 2WZPP 5C44J 2EICA 2H27A 4PCQA 5CLSA 5FO7B 4GWNA 4CCKA 4MFDA 2GC3A 5HV4A 4OVNF 2RJ2A 2FYZA 5J1XA 2EIBA 4BS9A 3JBG2 4N53A 2WB1N 3E3VA 4JQRA 3K5BA 2VNVA 4UFLA 1U2WA 1HKQA 4BWOA 3GMEA 1ERDA 3B8EB 2ZHLA 3NJXA 3ESWB 2WQ8A 3SFZA 2XJSA 4HEA2 2QWWA 4XOPA 4HOBA 3H1MA 1WLCA 3W59A 2WY8Q 1X36A 2K9NA 4CCJA 5FOJB 3AP5A 3H1JG 4Z8BA 4XKCA 2OQGA 1RKWA 3KXDA 1KYOD 1N86A 4GH4B 1N7SA 5T5JA 5DZGA 4YW2A 1URQD 5KKZB 1RHI2 1MEC1 2CWMA 5FZ0A 1XYNA 1ALYA 3WHTA 3RK3B 3ZYIB 1IFNA 4R52A 3N7JA 2AXLA 1V70A 1BBT2 2QJVA 4RAFA 3S1QJ 4EJOA 5DYMA 2LY1A 4DEVA 1Z3YA 3RL0C 4V2FA 1IZ1A 2B63J 5FZMA 1GLHA 4M4PA 2A45G 1F4HA 1R083 2DT7B 1GANA 1S29A 2J5OA 3BT9A 3VYIA 4FTEA 3OYWA 5JHUA 4C1WA 4S04A 4XBNA 4LG0A 1KRIA 2ZX4A 1Y39A 5LHHA 5A6ZA 3BIEA 3PIPF 2PHRA 3CMEI 2WYFA 4FSJA 1A6IA 1RR8C 2QM3A 2E60A 2YV8A 4XJWA 1ZRFA 3QH7A 3LSHA 2MH9A 2WFF2 3B69A 4JOMA 3LSPA 4HDVA 3A7OA 2N9YB 2HWF3 1X4OA 1ST8A 4DJAA 2W2IA 1VQ4I 3J7ZI 3FXJA 3I5UA 4XFAA 4BQWA 1KN7A 2E63A 1ZLLA 3JRIA 3F6OA 4BQOA 2BOJA 4N7UA 4XMAA 1NG0A 3I59B 1YQ6A 3TSIA 3WU2E 4C7NB 2XWJB 3W68A 5F5AA 5FZAA 1WA6X 3PDQA 3CF2A 4CU6A 2PEXA 4Y4RA 4UYBA 4HSLA 3KT4A 1AWCA 3VMXA 1E79H 4IHVA 3GHGA 2HFED 2AXTH 2MYSA 3OY9A 5FP8A 2X53S 2VC0A 3ZMVA 2B9VA 4M01A 1RUG3 4OGQC 3GYHX 4XJAA 2UUZA 3CNAA 5ABJA 2E1OA 5GALA 1QJX3 1W0PA 1OKQA 2XAJA 2BBAA 1RUNA 3OYCA 3WNMA 3JRGA 4D0QA 4GIQA 1HB1A 3SQOA 4RAGA 1S72I 3OF1A 5FPXA 2IA1A 2YPDA 4ZY9A 4MZUA 4F55A 2X5IA 1A35A 2UWBA 4DXTA 2GP5A 4IEZA 4B3NA 2OF7A 4R1HA 3USUB 1EZVI 2KKOA 2DU0A 1IRZA 1FDIA 1KQ9A 1WMEA 5KJ7C 2CO5A 2O0OA 1N75A 4PD4I 1IPKA 4WY4A 2OYIC 4UW5A 5C3OA 3WTXC 2R5YB 1QA6A 3FHAA 4O3MA 1JY2O 5FY4A 2KK7A 1UYPA 3MFCA 3WTYC 2MLGA 3H42B 4OAYA 3IWFA 3ZN0A 3I64A 2IFRA 3CJIB 4WM7C 2BXZA 4LB6B 3ASIA 1A34A 3I55I 4NHJA 2DFBA 2DYSH 2H43A 1YS6A 3UYJA 1AR62 2LKSA 1LUJB 1T6AA 1FE6A 1Y7BA 3CMGA 3DFGA 3M7AA 1J9IA 3U1KA 5T50A 3PNVA 3AEAC 1ULCA 4G9YA 5FLXK 2QIWA 4NHXA 3LE0A 1EXJA 3KT1A 4XORA 2W85A 2FBEA 1Q43A 5FK7A 2DTWA 2JA7J 2Q8EA 1D0ZA 3ZMSA 1FXZA 2WRAA 4H3WA 1OR7A 3JAMK 3I3QA 1USSA 1SQBE 5M3FJ 1SLBA 5AW8B 5AW5B 4JC1A 1O4YA 4PI2A 4UNOA 4ISRA 5ERIA 1FYKA 1NOHA 3IV5A 4CP9A 4BL0B 4RR3B 3U11A 3DBRB 4XABA 2YIUC 4P96A 2V7QJ 2EB7A 1UOJA 1AYM1 2C0XA 2G9FA 1CF7B 5FTTC 4ARYA 1FMWA 2DPUA 1UZ0A 2RS13 1VBB1 3Q0VA 5DAVA 4C3IJ 1NG7A 1Q1VA 4RDUA 1GV2A 5FZHA 3HOTA 4OZXA 2OYHA 4LULA 2IXIA 2WS93 3SCGA 4ZKTB 1JBCA 2B5HA 5FZ4A 4LKFA 5DCFA 3POFA 2OW4A 4ZDPA 1R22A 3L2WA 2VMIA 3FHZA 1ZZ7A 4IETA 2YGMA 2CMPA 1FMD3 2ZMEB 5FMDA 2L9RA 5A2QK 2WVRA 1I27A 1B35C 1R4MB 5BNOB 3K4KA 2PQSA 1NO4A 4N4NB 1WLDA 3ACHA 1RMU2 1JYTA 5AW6B 5L3BA 3S32A 1GUUA 3Q8BA 3VHNA 4Y1UA 1TQPA 4IEYA 2V1DA 2K85A 4W1UA 3CO2A 3CUOA 5GAGJ 1T6BX 1SQBD 1D1BA 4LOCA 1H8VA 4A42A 3L72J 5K7FA 1HDKA 2GWRA 1J2XA 1H9WA 4HKLA 1R6RA 5FXWA 4Z82A 1HJFA 2P34A 2YC4A 5APXA 3AZVA 2I2SA 3JRHA 3AG3H 1QL2A 3VYSB 5K9YA 3FLRA 3Q0WA 2E74B 2A5ZA 2QQNA 4RGRA 1HB4A 3MLJA 4UUSA 3JW4A 2PMZA 1YJWI 4FO9A 3T0AA 1NAFA 4XZUG 4IFDK 1GZTA 2QEXI 4PFPA 3BZKA 4DOUA 2EZHA 4HLTA 4BBSJ 3I56I 3E7KA 2PJRA 3B5NA 1CD3G 5FYCA 2GOXB 4PSXA 2FMYA 3ASOH 1TMF3 1CQ9A 1I3HA 4QD2A 3MD2A 4RN5A 4XDPA 1I6HJ 4L9TA 2ID4A 3FDYA 4I2LC 1UXZA 4YZ1A 3HE4B 2WSSH 3H1JJ 2HQRA 2HU9A 3OY8A 3F89A 4ABZA 1FBSA 1VAKA 3TBDA 4AVSA 5IAXA 3WODF 3ECHA 3I49A 1W99A 2PAMA 3IAM2 4RQPB 2YG0A 2ZVOB 5LFAA 5FJ8J 2HBUA 2GZWA 2A61A 2R061 3UKTA 4M3DA 1SPPA 5FKBA 1WBLA 5CJ4A 3AZWA 4YGDA 3I53A 2OTLI 2IUWA 1MMGA 2KA3A 2PLV1 1NAYA 1HW2A 3K6GA 2EBIA 3N7LA 2ZA9A 5FZGA 1QXPA 2N1TB 3M07A 4HPKB 1C8M2 5LGTA 1A6QA 1H2KA 2HWD2 1A78A 1U7MA 1URQC 2QDRA 4DUVA 2DCEA 1HRI2 5HS9A 2AXTE 2KDOA 4HOOA 2IGKA 4L9BA 1O4ZA 2EIGA 1HXS1 2DCZA 2P5VA 5FD6A 3A2AA 3TDZC 3V0AB 1DLCA 1Y43B 2UYAA 3EYIA 5LWBA 3DQVC 1OA3A 5F08A 3S2HJ 4CPGA 3BPZA 5CKNA 3HG9A 2X6YA 4WK8F 2PHUA 1FYUA 5KHJA 1BI3A 5FXXA 2E43A 1QQP2 4P9GA 2L9NA 4XL9A 5F3GA 4LLLA 4IV3B 1H30A 4UI9L 4JX5A 3I2KA 2ACJA 1R1A2 4E27A 1WJCA 4V19K 2JD9A 2RR13 1FPN1 2JE7A 3ALQA 1GW3A 2R5ZA 4YVSA 4AEDB 2O3FA 2BVBA 2VQLA 1UKGA 5KAFH 4QDRA 2WAQA 2K9SA 1WCQA 3MKWB 4NPFX 1N1YA 2XIGA 2J59M 3HUSB 4GXLA 4CCMA 3AKTA 1US3A 3PNYA 3AEBC 1FP1D 1KQ8A 2XJUA 3VOEA 1KQGB 3PSFA 2E31A 3IN9A 4QX0A 2XQXA 2E51A 1GZWB 3ILNA 2CG4A 5KK1A 4AI8A 1HVVA 4U7BA 5A32B 3RBZA 1Z0XA 2GAUA 4DQ2A 2LG4A 1KB9H 2QQJA 4MADA 1SQBG 2HFHA 2A7AA 3GW6A 2R30A 1CW5A 4MV2A 1DQ1A 1HXDA 1BC8C 2X1EA 1DBNA 2ZXEB 1XCVA 2A3XA 4QMAA 1QLED 5B4XA 3FK7A 4IHSA 4AG4A 1YJ9P 4AEJA 2JG8A 2R0FA 4M3CF 5AW9B 4JTOA 3GLXA 3TNUA 2JWTA 2Z69A 3T3YA 3SWFA 4L8QA 3TO6A 3VD5A 4XQWA 2UYBA 3KSCA