1OMIA

Crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
224
Chain Sequence
b'GSEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Listeriolysin regulatory protein
publication title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 72
structure length 224
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1omiA03
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1omiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1omiA01
3R4KA 3F72A 3UKTA 1YLFA 3WGHA 4FAGA 1XGOA 4LTAA 5BUVA 1KQ8A 4IEWA 3EBRA 1ZRDA 1W5TA 5L3EA 1ZH5A 1H9TA 3GO5A 2NAZA 1SD4A 2GC2A 2NNNA 4FHTA 4UV9A 5LGUA 3RYPA 3DP7A 3WTZA 5ICCA 2OPKA 5ILUA 3TO6A 2FSWA 4KNYA 1O3SA 4L0ZB 3H1MA 1UCXA 5FLXZ 4XF0A 2MBFA 2DPDA 3MZHA 1HKSA 3FXQA 1TTYA 1LNWA 2CQKA 1USSA 3E5UA 5LRSA 3DV8A 2L3DA 3MZYA 3B02A 5K8SA 3OTFA 5C8WA 2VOPA 3T0YA 4RAZA 5LEKA 4PJYA 1D3YA 1TBXA 2G7HA 1IN4A 2DQLA 1F4KA 1J5YA 3ML6A 1YO5C 1R1UA 4G8XA 5D4RA 2KIUA 2DK5A 1NXMA 4JTOA 2W84A 3M70A 5E8GA 2AXLA 3COAC 4J1WA 3DQVC 4M73A 3PNAA 3BZ6A 3F22A 3BJOA 3C7JA 5E8IA 5FLXK 1BI0A 1WA4A 5H20A 1LEAA 5DD4A 1EV7A 3RKXA 2PEXA 2CFXA 3WU0A 1UW8A 1IN6A 1U5TB 4EQQA 2E7XA 1CGPA 3NSTA 4OU0A 1SD7A 2Z5UA 4AQ6A 1JHFA 5BV6A 1ZVFA 3IWZA 2H09A 3WW1A 3KGZA 5JHUA 1SFNA 1IRFA 2GAUA 1UCRA 2QWWA 3JTGA 4BXUA 2FNPA 2PG4A 1IN5A 4Z07A 4BNCA 4IEXA 2UXXA 1EH6A 2F5DA 2D45A 2XAQA 1DP7P 3ULQB 5HDGA 3BP8A 1MJAA 4L11A 2MHFA 1Z1DA 2EV0A 3P9CA 1IUYA 1HQCA 4JBAA 2K86A 4AVPA 2V09A 2HQNA 4LUMA 1P2FA 2HTJA 5D5XB 2VONA 3DEUA 2HEOA 2VXZA 4LB5A 2HGCA 2VECA 1UPIA 2PFBA 1B9NA 3M3IA 1B59A 3JAMZ 1GXPA 4TV7A 2VBZA 4MGRA 1Q43A 3HRUA 2QBYB 2XIGA 1Q1HA 2STTA 3IRRA 3RDIA 5D5UB 4LLNA 5HS8A 3R60A 5BY5A 3WW2A 2KJCA 1T0FA 3I5UA 2FBKA 3FMSA 4P96A 2CG4A 1SAXA 2PFWA 5FFZA 3OV8A 1OKRA 4J1XA 1O4TA 1TQIA 1FDOA 4H7LA 5DUKA 3OGJA 1FYKA 2P4WA 1CF7B 3H8UA 5KHJA 1J3RA 1FLIA 3GLXA 3V8KA 2MC3A 1ZZ6A 4OLLA 4Q29A 4OIQF 3V7CA 4HBNA 1R1TA 5BPIA 2KXLA 4HVOA 4JV4A 4ONUA 4YFNF 4OIPF 5JAXA 1FI2A 4YARA 1LJ9A 3I71A 3IWFA 4WK8F 3ABTA 4IEPA 2UXNA 2GXBA 1U8RA 2DLLA 3W6KB 4PZJA 4WXCA 1QPMA 5CLSA 3QOPA 1FC3A 3MAJA 2DU9A 1DGRA 5J48A 1KGSA 2GWRA 2M45A 1YW7A 1Q5OA 2IXKA 1O7LA 4LG0A 3ZN1A 1YUDA 1MKMA 3H9AA 1ZZ9A 3E6DA 4XFHA 1XDSA 3F8FA 1GQGA 5H6RA 2XROA 3WTXC 3KETA 1CAXA 4CICA 3RZZA 2QQBA 3TOAA 2L4AA 2ZO4A 1LVAA 3CUQC 5I0RA 2Q2EA 1IRGA 4WX9A 3E97A 2QUFA 2PAKA 1ZARA 4L18B 3CJNA 1RTVA 1Z05A 3V7SA 2M87A 1J3QA 4OFGA 4HQEA 2P5VA 4HOBA 4LGWA 5CVRA 4HX8A 2JZYA 1ZRCA 3CDHA 4I7HA 4KL1A 1TLHB 4MGZE 4DQ2A 1BC7C 5F1RA 5BOXA 1SFXA 4EJUA 4Q0VA 5LHGA 5IT3A 3F8BA 3S2WA 1RGSA 5HLGA 1S8NA 2QVOA 4KA4A 1FWZA 3D0SA 1CAWB 3NL1A 4ZZLA 3SZTA 2BGCA 1MJ9A 2D5HA 2RC4A 4Q0PA 2HYGD 4AVCA 5EEHA 1KU2A 4IEVA 3T5XA 4OOIA 1BI1A 4NQWA 2D40A 4ESFA 2K27A 4S04A 1Z91A 1DPRA 3R0AA 3CUQA 3JSOA 2FNAA 2BV6A 3NQOA 4IRHA 4LEJA 1T6SA 1DPUA 1U78A 3ZMZA 3WW4A 5HLIA 1RUNA 2YX4A 3DF8A 1XCVA 1HW2A 4GYIA 3J80Z 1JE8A 2EWNA 1K78B 5AONA 1XE8A 2IP2A 2LSOA 2BNOA 2JSCA 4L9JA 4XETA 2FXAA 2R7FA 4NVPA 1S7OA 5CVIA 4Z2YA 3N4MA 4WXDA 4ZZDA 4A0ZA 2P5KA 5K5OA 5ILSA 1R5GA 1J3PA 2ADUA 3KE2A 3IIAA 3IL2A 5KHKA 3F8NA 1XN7A 4EJOA 3FF5A 1UHMA 1D8KA 4ZYDA 3VODA 1B6AA 1O3QA 3U2RA 5J8CA 3KZYA 1G4DA 4OMZA 1YIOA 3J80K 4CO8A 3P9KA 2YR2A 3BPZA 3WG9A 2P7VB 5DCFA 2ISZA 4MTDA 4EM1A 4AVAA 2EFWA 2LDUA 2G9WA 3LA7A 4AIHA 3LQRA 2UYAA 2VE8A 3ERED 3LWFA 5L3DA 4IEZA 3EUHA 3HSRA 4MEYF 5FD6A 2CYYA 3GZ5A 1P6RA 1ZGAA 1TQMA 3CO7C 4EM2A 1IZ1A 1W7PD 1PP8F 4LD5A 2VN2A 4XRFA 5ED4A 1U12A 4QGLA 2F5FA 3DFGA 4IEYA 5JSPA 3KSCA 3F8CA 1GVJA 1ZAOA 3CJXA 2C0ZA 2K4BA 2DO7A 4KUMA 4CDGA 1WI9A 1UIKA 5J6XA 1IXRC 5CVUA 3WW3A 1O3RA 1HSTA 3ZMVA 1JUHA 3U9GA 3HTSB 4UUVA 5LLQA 2EV6A 1EH7A 5CVVA 2V1XA 2HKOA 3GW2A 2F2EA 4MEXF 3CF6E 3VFZA 2L4MA 1ZGJA 3TNQA 2DBBA 3K1PA 4X6QB 5K1YA 1EH8A 2Q0OA 4P5OA 2YSRA 2HWVA 2ESNA 3IKVA 5CYVA 1Z7UA 3DKWA 3REOA 5I8SA 2CW0F 2PAEA 3MCZA 5HDNA 3ISPA 3V8JA 4HZFA 4BH9A 4G6QA 4HA8A 1WRJA 4EM0B 3BDDA 5HI0A 1P4WA 3ES4A 1BI3A 5EFUA 2YX7A 4HVQA 2X4HA 1VR3A 2PTMA 4HX7A 3O14A 2XHKA 2WWYA 2ZFWA 1J9IA 2QQ9A 3I59A 3OOPA 1IF1A 2O03A 3C3VA 2ACJA 1X82A 1LQ1A 4LK1F 1GHCA 4A2UA 2PYTA 4EROA 2F5EA 4ASNA 2CAVA 2J5PA 4PIYA 3FHZA 1OYWA 2MH2A 2VC1A 1Z9CA 1YFWA 1MJBA 2GC3A 5D6FA 4IEOA 3RJPA 4O9GA 3GFMA 3FM3A 2O1QA 4D0PA 4A12A 5ICEA 3KLNA 2QDRA 4AVBA 3H3UA 2FA5A 1P4AA 4K8FA 3SQNA 3GX4X 4KU8A 3FMQA 4IRGA 1L3JA 3EQEA 4GO1A 2IXCA 3GXOA 4HW0A 4PCQA 3HSFA 2HZTA 1WWXA 1XCBA 1QQIA 2VOOA 2K4JA 3R6SA 2V1DA 3OCPA 1FP1D 1R5HA 2DW4A 1BC8C 3BPXA 5KHGA 1OPCA 4LFUA 2IRFG 1R1VA 2MNGA 2KIFA 4XBFA 3CLPA 2K0GA 4JQFA 2XLGA 2P7CB 2VC0A 5L3GA 5ERIA 4UV8A 1UB9A 1RIOH 6PAXA 4YRDA 2JTVA 3ZMUA 1OR7A 2A69F 2IW5A 4P9GA 4KWJA 1YS7A 3TDUC 2ZMEA 3GFJA 4G6DA 3S7IA 4EGZA 2D93A 3F6OA 4AWXB 4RGSA 3Q9VA 1SQ4A 1MDMB 4MGIE 3DPLC 1MZBA 4EJTA 1S7AA 4L9NA 5I0SA 1S6LA 5DYMA 1R58A 2DFIA 1NE4A 1ODDA 4I0BA 2MLGA 3GFLA 1L0OC 2QM3A 2Z2SB 5DEQA 4M72A 3KP2A 4Q47A 3SXWA 1QGPA 3HRSA 4YFKF 5DV5A 4HV6A 4CXFA 4QGNA 3K9TA 1OMIA 2QLZA 1NE6A 4XFBA 4L9TA 3TOBA 4M6YA 4MGYE 1U6GA 2ZJ2A 3CLOA 2XL9A 4BHPA 3ELNA 1LR5A 3ZMDA 4KIBA 2Y0OA 2RV8A 3SMHA 2E1NA 1LRHA 3IKTA 1ZRRA 1ULYA 1D8JA 3O2PE 2R7DA 4MTEA 5D6EA 2IXIA 2Y0MA 4KN7X 2XV4S 1F1ZA 2PBIA 3BJAA 2FEZA 3MEXA 3TQNA 4ZU7A 3LAJA 1ON1A 5JSRA 2K9ZA 5E18F 2PMUA 5CU1A 1UHWA 4XFAA 2A68F 5LRRA 3EYYA 3SHRA 3TO9A 2DK8A 2L54A 2M1BA 2KKOA 5JI6A 2EA7A 1KYWA 1MGTA 1I1SA 3TNPB 2YU3A 4MNUA 2WC2A 4IETA 4F7ZA 3KGLA 4O9EA 4Y17A 4IEQA 1H9GA 4JK1X 4Q4ZF 1F5TA 2DTRA 3UKVA 2ZBKA 3GWZA 1LDJA 4HLXA 5CADA 2QQAA 3HHGA 3HTUA 2LNBA 2OA2A 3FJSA 1I6XA 2LF7A 1LDKB 1I27A 2Q0AA 3RKWA 3BB6A 2CV6A 4M9XA 2GIVA 5D5VB 4IXAA 3FXUA 1PM7A 4PDKA 3IN6A 4ESBA 1YFHA 2ZNYA 5FQ0B 1CAUA 4LA3A 5KVRA 4PIXA 3I54A 4CZZA 5KHHA 3ZQ7A 4L2NA 3V7RA 3F3XA 3USSA 4UNOA 3JAMK 1FBSA 4BAYA 4U0WA 2ZKZA 2EFQA 2XAGA 2GH2A 3CO6C 4AIKA 4UVAA 2HS5A 2IT0A 3I4PA 4OIRF 2STWA 4B29A 4AD9A 2N7GA 2GC1A 4QGMA 4AQ2A 5AVPA 1Z6RA 4UHTA 5DCMA 3LQQA 3U0ZA 4D7SA 2UY8A 5CVJA 4FX4A 3WGIA 4HN1A 5D5WB 1CAVB 4IERA 5FLHA 1ZLKA 4KWKA 1E17A 5DD8A 4GGGA 2IXLA 2VT2A 3GZ6A 2V79A 1RC6A 2HYFA 5FD5A 1PP7U 3PVBB 3FFQA 2DCTA 1H0MA 3BWGA 2F5CA 4IVNA 2D2WA 2QENA 2RGVA 4HDVA 1K79A 3M9AA 5D8LB 5EZWA 4UBGA 1OD5A 2XASA 5E1WA 2Q8KA 1U5TC 2FBIA 1R00A 2OQRA 5KBFA 1P4XA 4A6EA 1KQ0A 2NRAC 4XSXF 4M6XA 2GXGA 2IA2A 1Z6TA 2AS5F 3HUGA 3TDZC 1QNTA 1J1LA 4IPAA 3P9IA 2FBHA 1RNLA 4M9SA 3EHKA 3CTAA 4HMZA 5LHHA 1QY4A 2QNKA 3RYKA 5LEJA 4EJWA 2EFOA 1IW7F 4Z82A 1XSDA 3LOIA 3R0JA 3WU1B 3L2CA 5TRDA 2K7LA 2L02A 1YTYA 3WTSC 3MQ0A 3SXYA 3EQLF 4KICA 2JPBA 4EWEA 1HW5A 1RL3A 2E9QA 2XKOA 2PHLA 3HSEA 3VB2A 1O3TA 1I1GA 1GQHA 1BJAA 3QP5A 1O5LA 4N9HA 4HBLA 3H25A 4ENMA 2W24A 4RGUA 4HF2A 1O5UA 2BYVE 2GC0A 3F21A 2JRTA 2JPCA 1G6NA 1U5TA 4G7HF 1T39A 3BY6A 1YW8A 2GQQA 4GYGA 3M8FA 4ZU4A 1XSVA 1FDIA 4XF4A 1R23A 3GYHX 4JVAA 1O57A 1SD6A 1ZN2A 3SFZA 1D5VA 4R52A 4O3MA 1VJ2A 2ELHA 2BE5F 1TW2A 4QLCU 2NNYA 2OZJA 1W7PB 1WSUA 2DI3A 2K02A 1T38A 1YLLA 2YPRA 1NHAA 5BMZA 2OAZA 2ETHA 4UBHA 1ZZCA 1X3UA 2GA2A 1IN7A 3BJ6A 1AWCA 3J81Z 2PA7A 2B0LA 4EVIA 3JZVA 4A6DA 3KZZA 2E7WA 1TNTA 3GVAA 4M71A 4KFCA 2NS0A 3WTTC 5FFXA 4QXKA 4ENJA 3RPQA 5E17F 1DGWA 2IJLA 4YIFA 1ZRFA 4BHCA 2A6EF 5JR7B 5EEGA 3EWKA 1KQ9A 2RN7A 3ZDSA 2H94A 2QBYA 4UXNA 4EWDA 4MQ9F 1B4AA 4KMUX 2D1HA 3O6BB 4RAYA 5HLHA 2GZWA 4GCVA 3IC7A 3J81K 2PAMA 2BNMA 2Y75A 5FLJA 3DN7A 5KK1A 4HDUA 4N9IA 1ZZ7A 1USTA 2W85A 4XEZA 4QMAA 2L01A 3H1YA 3L9FA 2EFNA 2MLKA 4XSZF 4KN4X 2EB7A 1CF7A 2NYXA 4HQMA 3FMRA 4WWCA 3I64A 3UKNA 2XRNA 3HQXA 1BIAA 4KWLA 5JCTA 4Q48A 4PIZA 3T1BA 4LJZF 1U2WA 4Y15A 4L0YB 2HOEA 3D0JA 3JW4A 4NB5A 3F8MA 4QM9A 4EJVA 4LLLA 2HJIA 2UYBA 4HYEA 5TJJA 3VHRA 1NYWA 2JT1A 1XMAA 2RVCA 3H7JA 1UFMA 5L3CA 2O61A 1G3TA 3KFWX 5IT9Z 5J7MA 2ZKLA 1EY2A 2H27A 5C6CA 1XD7A 4M74A 2P10A 2D5FA 3ES1A 1CAVA 3FXRA 3WTWC 2CAUA 4R1HA 3I7DA 2MH9A 4HAMA 3ECHA 3NRVA 3ZP5A 1IAWA 4S05A 5HVQC 4WBBA 3KP5A 3WTUC 4D7TA 1H1MA 4MH0E 1ZX5A 4JTNA 3GEZA 1FXZA 2Z33A 2P5LC 4Q0SA 2CWEA 1FPQA 4XF9A 3PQKA 2COMA 1W4MA 1J58A 3ELKA 4QX5A 2UZKA 1FYMA 2R3SA 3LAPA 2Q1ZB 3G73A 1XGNA 4E2QA 4A5MA 1OFNA 3M1EA 2GU9A 1KU7A 4IRIA 1HKQA 3N97A 1QXRA 4I2OA 3O6QA 3L00A 2FF4A 2EA4A 1SEFA 2XVCA 3IDBB 4HN0A 1UD1A 1ZZBA 4RGXA 3BOQA 3EO6A 4RD7A 3WODF 4LG0B 3BU7A 2HQRA 5T3NA 3R61A 1JXSA 2EJRA 3TGNA 1CAWA 4LLOA 2XGXA 3G3ZA 3BPVA 4ETSA 4NHJA 1VTNC 3GYDA 3K69A 2J5OA 5E1XA 1CAXB 4DNCA 1WKMA 3I53A 4EV0A 3RPUA 2EAAA 4RB0A 4HF0A 3H7YA 3MWMA 4U0VA 1FSEA 4EMSA 3VOEA 4Q0UA 3MYXA 3EETA 1ON2A 4ESJA 2M8EA 1V70A 3EJKA 3HRTA 2RDPA 1P92A 4BQAA 3F6VA 5FLIA 1SFEA 4IEUA 3KLOA 4WF2A 1ZG3A 4P9UA 2A07F 1K78A 1NZCA 1CX4A 2VQAA 3PFIA 2IA0A 3ACLA 2PMHA 3ETQA 1UIJA 2TDXA 4P55A 3SHFA 3QRFF 4XLPF 3H3ZA 1QXJA 2ETEA 4ZH4F 3KCCA 3DPTA 4XFIA 1HW1A 4G9YA 1J0RA 3LA3A 3E6MA 4YFXF 1W7PA 3BCWA 3RKYA 5J8FA 4META 5I91A 4XFGA 4LULA 1T98A 5FB2A 1ZNPA 2WFPA 1R36A 1FZPB 1YS6A 2PHDA 3HRMA 2H6CA 3U10A 2KRFA 4YG2F 5JSOA 3U1DA 1FBUA 3CUQB 4G7OF 1YFUA 2V6CA 4WXHA 1VP6A 3SCGA 1ONVA 1IXSB 3ABUA 4YYOA 1HBXG 2VBYA 4FT8A 5I8TA 4FX0A 2I45A 3K1NA 2Y48A 3TKYA 2Q4SA 2VBXA 4HSLA 1E2XA 2FE3A 2LF8A 4I3PA 1ZG5A 3QPTA 4ORFA 3F23A 4M9ZA 1YFYA 1S3JA 4XFFA 1Y0UA 2RQPA 1XSXA 1G3SA 1PUEE 3HT1A 4FBFA 4YNIA 2XLFA 3MFKA 2UWMA 1WLTA 5BXXA 2MPFA 5E1RA 2QVSB 3B73A 3Q9SA 2A61A 4I98B 3HT2A 2FRHA 1QO0D 1XGSA 4HF1A 3MDPA 2XAHA 2QJVA 4O6JA 1LKNA 4WVZA 4ON0A 1SFUA 4YSFA 5L3BA 4P9FA 2HR3A 5JR3A 2PQ8A 4U7BA 4UVCA 2Q30A 3ZMSA 5LBQA 3SCFA 5D4SA 2VBWA 5K5RA 4LUKA 1J59A 3RIRA 2EK5A 1TQPA 4E2GA 3T8TA 3QU3A 4L5IA 4A5NA 1W5SA 4PGGA 4N0BA 5ILVA 1XDUA 3KMHA 1BBYA 5FO5A 1K6OA 2PI0A 1DZTA 1X8EA 2M30A 2WTEA 3QPHA 3V4GA 1JGSA 2B5HA 5E20A 4CYDA 3E3VA 2ZCWA 4OINF 3FWEA 4I02A 3PLQA 3WTYC 1GXQA 5JVTA 3RNSA 3WTVC 2B8MA 1STZA 1T2KA 1YWKA 1J75A 2P17A 4E70A 4CGZA 3QP6A 1A04A 4G94A 2E1CA 3LSTA 3M7GA 4I09A 2H0VA 3FZVA 2IC1A 2IXHA 3FE5A 1WGPA 3FM5A 1KU3A 4LK0F 3BROA 3FHIB 3NVCA 3WE2A 4MGKE 1BOAA 3HOSA 2OBPA 5BPDA 1REPC 2EV5A 3NJZA 3EYIA 4HSJA 3K0LA 2FMLA 1U3EM 2FQPA 1QZYA 2XKPA 4YIIA 2XLAA 1J7KA 3LA2A 1TNSA 4TLFA 1S29A 4HLYA 1FY7A 2LKPA 2O8QA 3IRQA 4IHSA 1SD5A 5I93A 5LHIA 2D1VA 5I8YA 2Z9OA 5K5QA 1EP0A 4R8HA 1XRUA 3IDCB 1WMKA 1X8MA 3SZPA 1SMTA 3H50A 4L5JA 1TQ5A 1YYVA 1LB2A 1BN5A 4G7ZF 2A5YB 1R7JA 2BBYA 1ZREA 3HIFA 2G8YA 1K7AA 4UXAA 5HDKA 1B1BA 1FBQA 4QWQA 4I0AA 2RKHA 5ICFA 1IPJA 3EDPA 4PGHA 2PLYA 2VE9A 4WCGA 3K1MA 1MD0A 3IBMA 1Y9QA 3KEQA 3D5LA 2MA3A 1QWRA 3I59B 1BI2A 4FAHA 2XUBA 4E2SA 1YHFA 3QACA 4MZUA 2O0YA 3GFIA 1JHHA 3U11A 2CO5A 3GF2A 1ZLJA 5ICGA 2IA1A 1FX7A 2M5WA 3V8LA 5FPXA 5AIPA 1I5ZA 2CGPA 4XLNF 2KIMA 3ROUA 3S0MA 2MD5A 3OF1A 3Q5FA 2V9VA 1BM9A 3WE3A 4XF1A 4XFCA 3H1WA 1OYYA 2VT3A 5D8KB 4KIGA 1MDMA 5BQTA 4IF4A 3LWCA 1DZRA 1PDNC 5H6QA 3D82A 4GULA 2QYOA 5FPZA 3E6CC 4KYWA 3L7WA 3CO2A 5A2QZ 3DL3A 2O8XA 3C1DA 1HXDA 4MUVA 4ZYGA 1YQAA 1YG2A 3KEOA 2B9UA 2OZ6A 1C0WA 2Z3YA 5HS9A 1XMKA 4BHBA 1ZMEC 5HOOA 4ENKA 4F8AA 5I0TA 2Z99A 1R22A 3TO7A 3K2ZA 2IXJA 4KMFA 2RNJA 2DAOA 2FQ3A 5FGMA 4U0YA 1FP2A 4Q0QA 1EPZA 3I0TA 1IPKA 1O7FA 4ENNA 2ESHA 2IPQX 4O5VA 4LB6B 4DINB 5FDBA 2BNNA 2HTSA 3QU6A 2ZMEB 1XE7A 2VODA 5A2QK 3BALA 1B9MA 1TW3A 3L09A 4X6RB 2VPVA 2XAFA 3ECOA 1L3LA 4B09A 5E16A 1OYIA 2Z69A 1FOKA 4KU7A 2X0LA 3ST7A 2W25A 3G7DA 1BIBA 2QZ8A 2P6TA 1LDDA 3JTHA 4RB1A 3FZ3A 1RZ4A 3CEWA 1FYLA 4LA2A 4IHTA 1F9NA 1AJYA 2O6GE 3ZN0A 3OD0A 1HKTA 3KP4A 2DQRA 4EGYA 2XAJA 1G3YA 5FCCA 4A0XA 4H0EA 3HHHA 3W6JB 2HKXA 2QCSB 3NW4A 4OIOF 3CUOA 4IESA 4RB2C 3NEUA 4CHUA 4GXOA 4KT5C 5L3FA 2GA1A 3QAHA 5CJ9A 4LMYA 2HDCA 1H1IA 1OI6A 5DDGA 2O3FA 3VEPA 2IVMA 2XL7A 5FQ0A 2FOKA 2KJBA 1FNNA 1LEBA 1KYZA 4MHGA 2ATFA 4Y13A 1AOYA 3I58A 3IHUA 2A3SA 1HSJA 4EWAA 4ZYEA 3WGGA 1J2XA 5HS7A 4Q5SF 2C6YA 1KU9A 1EYBA 4L9VA 2ET7A 3JSPA 3MPBA 4U7DA 4MQVA 2FU4A 3T8RA 4MX3A 3P7NA 3RI4A 1RUOA 3GBFA 2OYZA 4UVBA 2ZNZA 3H92A 4OMYA 2DPUA 2V1UA 3L2HA 1SMYF 3J7AO 4BIFA 5KHIA 3RTRA 1PMIA 4HVRA 2OU2A 3PQJA 4WZCA 4HX4A 1XGMA 3C18A 3HOTA 1ZG1A 1KA8A 5F64A 1DDNA 2ET1A 4KDPA 3ZPLA 2EVXA 2FMYA 2PN6A 2UY9A 4BYYA 4LLGF 5D1IA 1V4RA 1ZYRF 3KP6A 3NKTA 1CAUB 3FX3A 5AIQA 3HYIA 5BS6A 3LFKA 5BPXA 5I0UA 4XF3A 1IN8A 4HV5A 2HFHA 1RI7A 1FT9A 2A6HF 5IT9K 3SCHA 4I01A 1Y3TA 2G7UA 2OZUA 3S7EA 2ZXJA 2OD5A 5DUIA 1G3WA 4ZU5A 2DT5A 1XB4A 1Q3EA 2OQGA 3M8EA 3KP7A 4KIFA 4B8XA 4R79A 5E1ZB 3CL1A 2CSOA 2PQQA 3KP3A 2OA4A 2H6BA 1IXCA 2BEOA 5LGNA 5DCMB 4AIJA 3ZMTA 1DUXC 3E5XA 2WV0A 3C3WA 2ISYA 1V3FA 1QBJA 3E6BA 1FSHA 4A0YA 4AXOA 2F4PA 1YW9A 4RGRA 2P6SA 1WQ2A 3DXJF 3LAGA 1ZZ8A 5LGTA 2W57A 4ZYHA 2P8TA 3AAFA 4QM8A 5F6FA 4K2EA 5JFRA 2PJPA 3O3KA 2EFPA 4IJAA 1YFXA 3LZZA 3E5QA 2EA2A 1ZHFA 3GUDA 4RB3C 4MV2A 1X7NA 1QZZA 5J3UA 4RS8A 4HLTA 3RYRA 4U88A
chains in the Genus database with same CATH superfamily
2HWC3 5FUIA 5FPVA 2LALA 3POFA 3Q8AA 2NPSD 4JYCA 3UKTA 4LTAA 2IYOA 2CS3A 3EBRA 1ZRDA 1W5TA 2H0BA 4HK8A 3GO5A 3AJZA 4P9LA 1SD4A 2XNDH 3FXDA 4FHTA 2ID4A 4XHXA 5LGUA 3WTZA 5IVVA 5KAFH 5EJ1B 1NTMK 4EEFG 2MBFA 3MZHA 4IW3A 2CQKA 1Y39A 3E5UA 3MZYA 3C1LA 2R49A 2Z42A 1O91A 4ISQA 1PVXA 4PQQA 2VOPA 1F31A 1JEKA 4B4PA 4PJYA 3WNNA 1SMVA 5J1XA 4Z6YA 3J4UH 4ZZ8A 1FZEA 5D4RA 1RUC2 3K5BA 3Q2YA 5FZ9A 2RMU2 1SQBJ 3LGRA 2YY1A 1UG2A 5H9RA 5E8GA 1Z7S3 3COAC 2DFEA 3C7OA 3VKMA 4GIFA 1EF4A 3BCCJ 1X19A 4XXAA 3PNAA 1ZYBA 3BJOA 2BCCJ 3LSHA 5SV5A 3BOPA 3C8XA 2BDRA 3RKXA 5IYCJ 4L0PA 1IN6A 4XLCA 1U5TB 2E7XA 4RGAA 3OAKA 5FZ8A 5A6ZA 1I50J 1JXNA 3NSTA 3ZIWA 4GD4A 2DTYA 2WNVA 1LPQA 1ZVFA 3IWZA 2W1SA 1ULOA 3WW1A 3L2QA 5CFCC 5JHUA 4AW7A 1IRFA 4MADA 2QWWA 1NTZD 1LECA 5J1RA 1KD1Q 5GTHC 1U9OA 2UXXA 3ZXEA 1EH6A 3MIBA 1D4M3 3CJRB 5F0FA 2CGOA 5F6LB 2VCMA 1HRV2 3H1LG 1OLTA 3ULQB 4LOTA 5IHRA 1QNYA 3B00A 4FTBA 1Z56A 3BRVB 2GNTA 1Z1DA 2MHFA 2E75C 1MUUA 2D3SA 1OD3A 2UURA 1XNBA 2KSEA 3GZUC 3M4OJ 4AHWA 1HB1A 4CCMA 4LBJA 1UPSA 3DEUA 2L9NA 3S4RA 5B1AH 1ULEA 4QKDA 2VECA 1UPIA 2PFBA 4C7NB 3OYHA 2LM3A 1FJKA 2VOXA 2VBZA 1Q43A 3HRUA 2A6WA 2IFNA 4BQQA 2QBYB 4UUSB 1BEV2 1XXNA 1NTMD 3O1UA 1QJZA 4I76A 1W6QB 3NQHA 2P58A 4LLNA 5HS8A 5CEHA 1U8BA 2KJCA 5IFTA 3I5UA 2FBKA 1WT6A 1AR82 3NV4A 1NA1A 3TF5A 4J01A 4OWFA 3N7KA 4AFCA 1FOSE 5GAGJ 1R8EA 3OSFA 2NQYA 5FFZA 1OKRA 1O4TA 1R091 4H7LA 2Z5IA 3VMXA 4OHZA 3Q9OA 3S8PA 1CF7B 1LTJA 1FLIA 3V8KA 4YXDC 4X0GA 3A4UA 5IAXA 3PNVA 4Y99C 2D6PA 5EIYB 5BPIA 4HVOA 2IBZG 4QHZA 4YFNF 1LCLA 2A73B 3L74J 1E79H 1FI2A 4Q26A 2WA3A 3IWFA 4WK8F 2UXNA 4QQ2A 3S30A 4PZJA 3DEEA 1QPMA 5CLSA 2WZ8A 1TME2 4O61A 1W28A 1FC3A 2DFFA 2HWF1 2DDAA 2OCEA 2RS11 1PP9G 4M3GA 3ASNH 5J48A 2PJRA 4SLIA 1EAH1 3PIJA 1PV3A 2ELKA 5A7QA 3AP7A 4Y20B 1YUDA 4AI2A 3H9AA 3HJRA 1ZZ9A 3BGAA 3E6DA 3CMAP 2JECA 1G86A 4XFHA 4NWWA 1IGOA 5H6RA 1K6YA 2QTWB 3WTXC 3FKIJ 1RQVA 2XUMA 4EN9B 1XNCA 5FWJA 3RZZA 3BR6A 1UZWA 4F92B 4OMCA 1D2QA 3RRDA 2VPRA 2YXQB 1LVAA 2KLVA 5FZDA 2MEV3 4B7KA 1IRGA 4CXXA 3O0XA 4WX9A 3B5NC 1ZARA 3OA7A 4AI8A 3F89A 4MXWA 2R93J 4TXWA 5AW2B 1YJWI 3V7SA 4U3FJ 2M87A 3BTXA 4ISRA 4YVWA 1KITA 1NUKA 4HOBA 1MZ9A 1VQ6P 4XL9A 1W9WA 2QEXI 4RAGA 4HX8A 1S0CA 3ZMNA 2JZYA 4QDQA 3CDHA 5AVRB 1TLHB 4MGZE 5HBAA 3S57A 1BC7C 4IDZA 4PT6A 3J8F2 2QQMA 2Q8CA 5C4WC 5BOXA 1E5HA 1TU3F 1IRXA 5A70A 3FBNB 5AFEA 3VTPC 1WLDA 3FUOA 5IWFA 3UK9A 4RAFA 2B42B 1ZBA1 4QAWA 2QF7A 4RMNA 3LSJA 5C3RA 5A3MA 3GTLJ 3USUA 2VQGA 1L0NJ 2V4VA 4OVEA 4AVCA 1AJKA 5APYA 1W2BO 5FJHA 4I0WB 2VZUA 5L7OA 3HOXJ 2K27A 1XNAA 2NVYJ 1L2PA 2M8GX 4GKGA 1SQBD 4M3DA 2KIQA 1U78A 5K9YA 1IRZA 2YX4A 4CPBA 4AK3A 4GYIA 1HUCA 2BCCD 1L0LG 4HKZH 3WHUA 5D8AB 1W6PA 4YGBA 5FXZA 1OUSA 5AONA 1XE8A 2BNOA 1ZELA 4UB8C 2A06D 4L9JA 2JG8B 2FXAA 3RL0C 1RUC1 4NVPA 2XBO2 3DPRB 4CDQC 5IFPA 1C57A 2ARAA 3CCRP 4ZZDA 2ZJCA 4A0ZA 2P5KA 3JB8A 5K5OA 2TCTA 1W99A 4AVTA 1J3PA 4U36A 5L19A 1GV2A 5ABJA 1FZFA 3LE0A 2DV9A 1YTZI 2DCEA 4ZYDA 3VODA 2G9FA 1O3QA 2VUMJ 1JY2O 3AEDC 4MYEA 5J8CA 1HQNA 2PXJA 3OYIA 1G4DA 2JUCA 3C7HA 2KD7A 3UESA 3VHPA 4CO8A 2UV1A 4A41A 4MG2A 3L71E 4V2GA 2P3IA 2V4HA 2IVIB 4FQ4A 3WU2E 4W6YA 3M3QA 4S2DA 1VQ7I 2ISZA 1GWKA 2XNXA 1S4XA 2VXDA 4HKWA 2WKKA 3E0JB 3LA7A 4AIHA 3ERED 1HRV1 1JS9A 2E53A 1X9TA 2EZHA 2KZJA 3EUHA 2WRAA 1GW3A 2VUAA 3DXTA 3M0AA 5ED4A 4QGLA 5FXWA 4F52A 3P7KA 1N7SB 4IEYA 4NAOA 5JSPA 3KSCA 1ZAOA 4PUSA 3KPEA 3P32A 2KP6A 2WYFA 2DO7A 1H89C 4DEQA 3CMAI 5J6XA 1IXRC 3SZGA 1O3RA 1GU4A 1S0IA 2QJPC 3TGUJ 2Y8KA 4IFMA 4COZA 5A32A 5CVVA 1NU1K 1JY3N 1SP4A 3KYLA 3VFZA 3OS2A 3B69A 1ERDA 2WZEA 4IOAF 1YX3A 1QJX3 3OBAA 5CYVA 5E79E 3MIHA 2E71A 3W2WA 4NN0A 1NAFA 2DFHA 3FXOA 1FNYA 3REOA 1MV8A 4N7UA 3MCZA 5C9AC 1RUJ3 3V8JA 4H4KC 3V0AA 5F5QA 1VQ6I 4BH9A 5FLVA 2C0XA 3L2RA 2P1BA 4HA8A 4UB6H 2A71A 5CBOA 3IMMA 1H6YA 5ISLA 3PUFA 5EFUA 2WSCH 5AVUB 4HVQA 2X4HA 2ZXIA 4BJTA 2O7OA 3OYMA 1XMXA 2VKHA 3H1HE 1XBFA 3UT0A 2NPSB 2H8RA 3PM1A 3K2OA 1ZTRA 2X09A 3HUSA 3JRFA 4PIYA 1OYWA 1BMV2 4N78D 2MH2A 2VC1A 4MGSA 5JOZA 4KBBA 2ZMEC 1YFWA 3OYLA 1MJBA 2K3FA 4U3FD 5EYXA 2R7UA 3FM3A 3CZUA 4L74A 3NO8A 3NARA 3ZFFC 5H2FE 5ICEA 5F6KA 2KP8A 1LOFA 3BQYA 3GX4X 2DTWA 2C1FA 1T6BX 3A02A 1L3JA 4OQ9A 4NPMA 2FY8A 4GMP0 2NRGA 3S3NA 4GJZA 2VOOA 3K6GA 4BQ2A 5LA9A 4K8RB 4DGWB 2LYCA 1RQUA 4O9BA 5KHGA 1XPWA 1L0ND 5JMCA 3O0VA 3AE3C 2IRFG 2MNGA 2KIFA 3J8F1 1S1AA 2BERA 1NU1D 2K0GA 4AWDA 2XOMA 2VC0A 1YTZT 4FPFA 2KK7A 1UB9A 4DJGA 1POV1 1PGJA 3POWA 4A7KA 4D3WA 4MOAA 5EF6A 1Y7BA 2OV7A 2IW5A 3CPWO 1YS7A 3TDUC 5EZHA 3TEZA 1FZCB 1PX4A 1MBEA 5GLVA 1LHWA 1GU5A 5LWBA 2F5VA 4EGZA 1W04A 1ALYA 1RF0C 3RZMA 3FK7A 5F2WA 5FROA 1SQ4A 1JHNA 1SFPA 2EZIA 3CX5I 5CG9A 1MZBA 4EJTA 3EXUA 2WPRA 3CX5H 3SH4A 2CSGA 2R0QC 2JEEA 2DFIA 1NE4A 2ZX3A 5HXMA 3UYJA 2MLGA 2OGUA 1L0OC 1WJFA 2QM3A 2Z2SB 4LC1A 1EC5A 3KP2A 4Q47A 3DXUA 3HRSA 3M1HA 2BV4A 5KXEA 1CN1A 4HV6A 2M7BA 4QGNA 1OMIA 1NE6A 2VUJA 5A3OA 3C8VA 2A6ZA 4MGYE 5CKNA 1A6QA 2XL9A 1RUF3 2OYOA 1LR5A 3ZMDA 1VQKP 2ARBA 1LRHA 3IKTA 2VMIA 3CCLP 1ZRRA 3GGLA 1RUI3 4JKKA 1V00A 3TB0A 1P9QC 5IP7J 4OZOA 1F1ZA 2VOKA 2FEZA 4ZU7A 4AM3A 5JSRA 4Q27A 4YIRX 2A68F 5KLIB 1ULFA 1SVFA 4PFPA 2WNUB 2ZEYA 2GNBA 1OVUA 2VXRA 2O1KA 2HQAA 5GPCA 3ZFGA 2J42A 2VW2A 2EA7A 2JDUA 3MBWA 5FYTA 2FDJA 2N1TC 5ANNA 3RZKA 1H9GA 4Q4ZF 3MD0A 3TGUD 1NKGA 1NTZE 3OYEA 3U37A 3HHGA 3HTUA 1LHNA 4WM8C 4JQRA 4UOJA 4BB3A 2Q0AA 1GK4A 2YKPA 3V6IA 2HYXA 2PHWA 4LLHA 4UF0B 4IXAA 3WZ1A 3BODA 3D6YA 3CJIA 2NN8A 5EJ3A 3KZIC 3MTUE 2PHFA 4ESBA 1YFHA 2IX7C 1VMHA 1OISA 1YJLA 4PIXA 1RE4C 1O59A 2IWGB 4QU1A 3WVJA 1JHJA 3LSPA 1TP4A 3USSA 4AFAA 4UNOA 3JAMK 4XJ9A 1QDCA 1URQC 2Q1KA 3WDVA 3KV4A 4IHXA 3HL2A 2P0WA 2GH2A 4UVAA 2HS5A 5J1UA 3I4PA 2EIJH 2IT0A 4B29A 2WA0A 1PGL2 2N7GA 3KQGA 1EV11 2GC1A 1NTME 4FOVA 3DCQA 4UHTA 3E1SA 5LBFA 2W6BA 3U0ZA 1BGYJ 4FXKB 4RR3C 3R4UA 1R083 1PO22 3ZPOA 1GP5A 5CZKA 5FLHA 1JTHB 2HFED 3AMQA 4WVMB 3H36A 4FPKA 1E17A 3MKWB 1Q8SA 3GTQJ 5FXVA 3QWLA 3CKHA 2VT2A 4IE4A 2QA4P 5DQ0A 1RC6A 4XNFA 5FD5A 4S2FA 2K9NA 3PMSA 1H0MA 1OCPA 1X1PA 5TSWA 1QA6A 2CNAA 1X2NA 2DYSH 3AMNA 1WMDA 2ZGOA 5EZWA 4CEYC 4UBGA 2KZVA 4XDPA 3BOWA 1BMV1 3VV1A 3R4YA 1U5TC 1R00A 3TOJA 3Q8EA 2M4GA 2OYHA 2H43A 3TEXA 1KQ0A 1J1EB 1DBNA 1F36A 4M6XA 4UFIA 1UOGA 1IS6A 1BE3E 3CCJP 1KTMA 1K5JA 3O6QB 1BR1A 3TDZC 5BNQA 5FOBB 2R5DA 2GUVA 4JGYA 4XJWA 3OUIA 1E0EA 1KILA 2GM4A 3RYKA 4DBQA 3LIHA 2GMPA 4W50A 4R4LA 1OOPA 1VQ9P 2HWB3 1RMU2 2PHRA 3WU1B 3L2CA 3L73G 3MW2A 2L02A 1YTYA 5D21A 1BW5A 1LGCA 4I7ZB 1X36A 3OOXA 2CTVA 5F5IA 4PLNA 1S5LH 1VQKI 2JX9A 4IGOA 3BU0A 2E74D 4EWEA 1HW5A 3CCLI 1RL3A 1MQTA 2XR4A 3HSEA 1SC7A 1UY2A 1X9VA 2W91A 4HFSA 1W36D 1WFXA 2LD5A 3QP5A 1JJ6C 4IHWA 1EZVI 2DVAA 3JCIA 4BPZA 4BJ6C 5DAXA 4HBLA 2YU9J 2GN3A 1GK6A 2ZEXA 4FETA 4FP3A 4YW1A 2W24A 4RGUA 5DUXA 1J83A 2GC0A 4F91B 3ZYGA 3K77A 4PV1D 3O1SA 4NHMA 4CRQA 1SFCA 1NK2P 3OYWA 3J7NA 3CIHA 5ANQA 3MO4A 3M8FA 4LBMA 1XSVA 1FDIA 4XF4A 1ZR4A 2E35A 1W9TA 1MS8A 3GYHX 1O57A 1V0AA 2XJRA 4QD2A 3AK0A 4AL9A 2TNFA 1KYOI 1MMDA 4QLCU 3I2JA 2OZJA 1KYOH 2OW4A 5C8CC 3P1IA 2YXRB 1T38A 4H7MA 3OEBA 3ZYRA 4AOCA 4UBHA 4NR1A 4ITCA 1IN7A 3BJ6A 3OIOA 1SQBE 4NJ4A 1OX3A 4LR4A 4EVIA 3JZVA 3AZXA 1TNTA 4QDRA 1IDYA 3GVAA 1C3HA 2HEYF 1S9KD 2BCCE 2LKMA 4QXKA 1DGWA 5A3NA 5JI9A 4DXSA 5APWA 2HH9A 1S0BA 4LK6A 1VDFA 4Y5TA 1ZRFA 1WMFA 2POHA 1IFDA 5JR7B 3QPSA 3RJ2X 2RN7A 3OIPA 1OXZA 4UXNA 4EWDA 4MQ9F 1FJLA 1MBJA 1DP3A 3CC7P 4NRQA 2WYSA 2X1EA 2D1HA 2CFOA 3IIIA 4GCVA 2BNMA 1W9YA 2Y75A 2KNCB 5FLJA 3DN7A 2KUBA 4N9IA 1IZ3A 2IFRA 4QMAA 3I2KA 3N7MA 4HPKB 4CXWA 3H1YA 2V72A 4JZRA 4XSZF 1BK1A 2RDQA 4KN4X 3U14A 5BNPB 4A3GJ 2NYXA 5HCFA 3T1MA 4MN4C 5DS9A 4H55A 2XRNA 4PHZA 3UKNA 2EAKA 5AC93 1BIAA 2HPCB 2QA4I 4Q48A 2TUNA 4LJZF 1U2WA 4L0YB 1F35A 5JLXA 4LLLA 3VBFA 5L9RA 4KISA 4H0LC 5TJJA 5DJUB 3AMHA 5L3CA 1TT0A 2LY1A 3KFWX 5IT9Z 4ZDPA 3R0RA 2WAAA 1EY2A 1XD7A 1FMD3 2P10A 3HPGA 1QJY3 4NC8A 2LVSA 2AH2A 2E7TA 5KAFE 3RCOA 1QH6A 3T3YA 3GMAA 2E63A 1T6GC 5TJHA 1RUH2 2CAUA 4R1HA 1BGYD 2JA7J 1RESA 4HAMA 2W0XA 2KL4A 2LTPA 1OFCX 2WLPA 1H0BA 2X05A 1IG3A 4S05A 5KXDA 2J1TA 5IOZA 4WBBA 2VH9A 5LFAA 5IK5A 2WBKA 1VQ9I 2FCUA 4S2GA 2HXOA 1N1VA 1AKHB 4E7KA 4GDFA 2XJSA 4JTNA 4RS5C 2P5LC 1PGL1 5J36A 3EMRA 1ZM1A 3PQKA 2FUG2 3KVAA 1RUD3 1W4MA 1ACIA 3PJSK 1ZA4A 2ZX1A 1D1CA 2HWD1 2XJVA 4ZONA 3ZN6A 2R3SA 1BCCJ 2L7ZA 2XSJC 1PO21 3N9PA 2DBIA 4A5MA 4LHNA 1VQ5P 1XU1A 2H8WA 2A3XA 1KU7A 4HYTB 3SISA 3N97A 2JG8C 3FK6A 2VXJA 2WABA 4ZKTB 4IUGA 4QX3A 5FZ6A 1QVUA 1ETVA 5FYVA 4XOGA 1A8MA 3OYKA 1FNZA 4RD7A 3POEA 2HQRA 1SHWB 4F3JA 2W48A 3R61A 1IC2A 3W68A 1CAWA 4LLOA 3G3ZA 3BPVA 3LL7A 3K69A 4AEKA 2E26A 2BTVC 4IV1A 3FWNA 1WH7A 1ZRIA 5E3NA 5A6XA 3I53A 2FXPA 2OTKE 2EAAA 1MH3A 4FXGB 3PFYA 2KYVA 3UKGA 4RB0A 2OUHA 3WX5A 3LW5J 1AR92 1BDCA 3WF4A 4MXVA 3VOEA 4Z92B 3EETA 1MZFA 2M8EA 1V70A 4U3FE 3AXEA 3RK2D 5JZGB 1X1AA 3BR0A 1SFEA 3JC22 4BJ0A 2X9DA 3KLOA 1QQP1 2WNVC 3ZXKA 1S5LX 1K78A 5FP7A 4CCLA 4CSWA 3M9QA 2PMHA 2ECCA 3GNEA 1VAMA 3ZYJB 1UIJA 3OL4A 2TDXA 1T56A 4P55A 3K3OA 3ATGA 1N7SC 1LTIC 5IATA 5E3OA 3QRFF 4XLPF 1SQXJ 2WAFA 4FE4A 4ZH4F 3KCCA 3V2RA 3VBOB 2HODB 1F5JA 4DZOA 3JU9A 4G9YA 2ZYDA 4ZC3A 2VL4A 4XQFA 3CC7I 3CD6P 3RKYA 4META 1DQ4A 2YYOA 5I91A 4XFGA 4CTEA 2X85A 1SPPA 4E7JA 2V7FA 1L0NE 3SH5A 1V6KA 4XBLA 2VTXA 1ZNPA 4CP9A 3PSIA 1NU1E 1OCZH 3U21A 3CWBJ 2BZTA 5A80A 3CCEI 1Y47A 1FBUA 3CUQB 1I9RA 2V6CA 2RJKA 5CYYA 4PSXA 4YYOA 1S4CA 4FX0A 3TKYA 2NOGA 1MEC2 1E2XA 2W08A 4I3PA 1CX1A 3HQUA 2H1KA 2JWDA 3OG2A 4A3LJ 3U75A 1V5EA 3T97A 1NT0A 1T2KC 1EPWA 1WH5A 3HT1A 4FBFA 4A3EJ 4XTPA 2WV1A 4FVVA 4HSTA 3V4WA 2IXSA 1Y0NA 1SCSA 1XTCC 2Z16A 2MPFA 5GALA 3CMGA 2QVSB 3B73A 2DCKA 1D0YA 4YW5A 2XH6A 4IQJA 1XGSA 1CI6B 1HA8A 2X5IA 2NVUB 5L3BA 4P9FA 2AGSA 4UVCA 1B72A 3TRSB 2VBWA 3IP4B 1J59A 2EK5A 1TQPA 4E2GA 1OSGA 3RJRA 4BIOA 1GNYA 4CPBD 1UZZA 2JKVA 2CUEA 5TISH 4YELA 2JDNA 3AYAA 1BBYA 2ZFUA 2WADA 3NAUA 1X8EA 1R5ID 2WTEA 5F5CA 2ZCWA 1VQ5I 2HVRA 1QOTA 3FWEA 1L7LA 1MACA 3TP3A 5JXJA 3AG4H 2DOAA 4XKVA 4BLJA 1SQXK 1KONA 3ZMOA 3UJQA 3HOYJ 3FLRA 2P17A 2OPTA 2M5AB 2C9KA 2AXTH 1JYTA 4G94A 2E1CA 1D4VB 4CUGA 1FAYA 3TEWA 2ORXA 2H0VA 3FE5A 1WGPA 3TGUE 1KU3A 2JP3A 1SG3A 3FHIB 5DABA 2Z1DA 3HOSA 2VAUA 5BPDA 1REPC 4YVWC 2RREA 2VMFA 2EV5A 3NJVA 2G3AA 3K0LA 1U3EM 2VMEA 2FQPA 2XKPA 2XLAA 2RKLA 1TNSA 2W94A 4K3UA 2FFDB 5L36A 1SQPJ 1Q8OA 1RUH1 3RZOJ 1FZCC 1BCCD 3G6JB 4DZPA 2WO7A 1WZXA 5GZEA 5FO9B 2X51A 4R8HA 4QTRA 1X8MA 3KD4A 3WEZA 2RAEA 1SMTA 1TQ5A 4LO5B 1BN5A 1R7JA 3LCPA 2BBYA 1KB9D 2FYNB 3C2BA 2Y0IA 1N78A 4UXAA 2W92A 5FP9A 1B1BA 2LROA 2QZ2A 2MD0A 4EI2A 1FBQA 2RKHA 3A0NA 3FHAA 2FYUJ 3A7QA 2Y26A 2A6XA 5IP9J 2VE9A 3CDIA 4QPGA 3D5LA 1X1CA 1QWRA 2KB7P 1BI2A 2BEZF 4IGQA 4AQRD 4NIHA 2XUBA 2RN0A 2XVKA 4JF7A 4MZUA 1KS4A 3SFEC 3GFIA 4QX8A 5CNAA 4IX7A 3U11A 2CO5A 3GF2A 5ICGA 4Q4W2 3QWOC 2P2UA 4UFKA 2BWCA 4LBQB 5JIUA 1OW6A 1GR3A 2MD5A 3OF1A 2F4MB 1BR2A 2VJ4A 2V9VA 4LORA 1BM9A 2XGDA 3WE3A 3WNPA 3MIEA 2OYIB 2A70A 1A36A 3ABMH 3H1WA 1OYYA 2JK3A 4DJAA 4XIOA 5D8KB 4KIGA 5A6YA 4X8NA 3WP6A 4S0HB 2WNUC 5JIAA 1AR91 2L7MP 1SQXD 1DZRA 1M1JA 3L2YA 1Y4WA 3CO2A 5FMOS 1V9U3 1S55A 4AEDC 3L4FA 3AP5A 3POJA 5GKAC 3ZR6A 3BZKA 2WS92 4ZYGA 1YQAA 5EG0B 2QQ8A 3CCVP 1KFXL 5IVEA 1VF5C 1AX0A 2XF7A 5HS9A 2GNMA 4BHBA 1J1TA 5HOOA 5T55A 1DDLA 1R22A 3CWBD 4IO9F 1MMSA 1VMFA 3EFGA 1AL0G 3GDBA 4DY5A 2NZ2A 2RS53 3MKLA 5K7HA 4JGZB 2DAOA 1SQPK 4ENNA 1GL2A 3TBIA 5FDBA 3PP5A 1XE7A 2VODA 3BALA 1TW3A 3H32B 3B94A 3B8EB 4I6ZA 4X6RB 2YIUB 1JGGA 1UX6A 3IAM2 4B09A 1JYXA 1FOKA 1NCRC 1T3UA 1YRNA 1LULA 3RQ0A 3H35A 1VBC2 4ZKPA 4A6OA 1JZ2A 4UB6E 3FMGA 3U1XA 3G7DA 2QZ8A 2P6TA 3CEWA 1FYLA 1DLLA 4LA2A 3WF2A 1MEC1 3VWBA 3GXUA 3G1MA 1REFA 3WUTA 1PGW1 1VBE2 1UN1A 4YLZA 2CU7A 2DJNA 3AEEC 1HKTA 3KP4A 5FYCA 4ASKA 3L2UA 3QODA 3ETPA 3H1KJ 1ZA7A 5FCCA 5JMOA 5HCBA 5F37A 3HHHA 3W6JB 3RSJA 1X4PA 3NW4A 3U1CA 4IESA 4LNVA 2KFDA 2KDOA 3S3OA 2Y34A 2R5ZA 5L3FA 2GA1A 2B87A 1IJWC 1DYPA 5DDGA 1VNDA 2GBYA 2G4IA 1HH0A 2KJBA 4ASVA 4C30A 2BPA2 4Y13A 1ZOYC 2JB8A 2EIBA 1HSJA 4EWAA 4ZYEA 3WGGA 4Q5SF 2WPSA 3EQ2A 2DVGA 2C6YA 2XB5A 3H42B 1J1EC 3PUBA 4K3AA 3JSPA 4U7DA 4HK9A 2FU4A 4N3YB 3P7NA 1GW4A 3RI4A 2QQIA 2VQTA 3GBFA 3L75J 3HAGA 4Q4X1 3HUSC 3TW6A 4UVBA 5FBJA 2XPUA 2VW1A 2D43A 5HV0A 3THTA 1RUG2 1MMAA 1LFBA 4LO4B 1UOJA 4GWNA 3ZYBA 1SMYF 3UJOA 3K48A 3P3NA 3J7AO 3VZLA 4BIFA 4DRVA 1B8IB 1YIPA 4P9JA 5C5TA 5M0TA 1UYZA 5KHIA 2R7XA 1ULCA 3D1NI 2J1SA 1UF2C 1SQPD 5APVA 1XGMA 1MZ5A 2B39A 4Y28J 5F64A 4LMFA 4M3FA 1DDNA 2ET1A 4KDPA 1HV0A 5CIRA 2FMYA 4B7EA 1LOFC 4LLGF 1KC8Q 5D1IA 1UO9A 4CYCB 1V4RA 1R4MB 3KP6A 1CAUB 1W6NA 2XZRA 4GFBA 2YPJA 3LFKA 1FTTA 4J6GA 1LTJB 3H8XA 2KR2A 3AG1H 3I3LA 4XF3A 2K46A 1FT9A 1N1YA 2BY0A 3JCUC 5EFWB 1RR8C 1EUTA 1HXS3 3S7EA 5DUIA 1G3WA 2RS32 4ZU5A 3TL4X 2KZGA 4KIFA 4B8XA 2WO1A 3CL1A 2FYUD 4LG3A 1AR71 4BEHB 2CUZA 1BVVA 2H6BA 5LGNA 1V6IA 5IPAA 1VQ4P 1AV1A 3PU3A 1RHZB 2Y38A 1UYXA 4HEA2 1EDJA 2DA5A 3WP3A 3K4AA 1YO8A 3JRHA 2ISYA 1JZ7A 1V3FA 3OJBA 4NRPA 1K4TA 3ZQGA 2F4PA 1A3KA 3O1RA 1GOGA 5LGTA 3BG9A 4ZYHA 4QM8A 4ET7A 1JCDA 1F8VA 5JFRA 4XQWA 2PJPA 2EFPA 4IJAA 2IDBA 2WT2A 2AACA 1RF1A 1JZ3A 3NTNA 3UGFA 4QPQA 3QLQA 1VBB2 3GUDA 5DG1A 2QQVA 1O4ZA 3IAS2 3OYAA 3FDYA 4HLTA 4I3GA 3RYRA 5KXCA 2XGXA 4MXWB 3F72A 2R043 5C7GA 1SS1A 2L9SA 4BLIA 4D5FA 1H9TA 1KDKA 3L71G 2NNNA 4RO0A 3OR2C 3RYPA 5ICCA 2OPKA 3HN3A 2JMWA 3IPVB 3OPZA 1UCXA 3R2PA 2JKBA 1W2UA 1TTYA 3DV8A 2L3DA 1C28A 1SFOJ 4C7RA 1NKZB 3S1MJ 4LBOA 1F9KA 3T0YA 1IS5A 4RAZA 5LEKA 5BNPC 1Q2NA 1FPN2 1WJDA 4NIDA 2WS91 3MI8A 1YO5C 2XF5A 3ERMA 4G8XA 5IT6A 4BE2A 3DKQA 4JTOA 4PJLA 3O5SA 2W84A 1XOYA 3L72G 1GZWA 3MUDA 1BCXA 2P81A 3NWKA 4J1WA 1WI3A 2ZXHA 3BZ6A 1GV9A 1SQVJ 3F22A 1KFMA 3DBRB 4ZYAA 5A3PA 5KLVG 1BI0A 3MKYB 1WA4A 5DD4A 3CHXA 1HJBA 2VC9A 1UW8A 3OR1C 5FIXA 1EXIA 1X58A 1W6PB 1CGPA 3T08A 4OU0A 1KILD 1ND2B 1XB9A 2XJQA 1JHFA 3K46A 5BV6A 1X0TA 3KGZA 4TWTA 3H1KD 5B1BH 1IOAA 1VBC1 5HCHA 2FNPA 5EHDA 4C1WA 4EZHA 1T95A 1IN5A 4BNCA 1IV8A 3JUUA 4NROA 1HB3A 4YTPC 1RETA 2WR9A 3ITQA 2R7VA 2D45A 5FZ4A 4A45A 2XAQA 4I1LA 1LGBA 5J4YA 4E7ZA 1DP7P 2BFUS 2OPWA 4Q8LA 3WNKA 3OUHA 1Y9BA 5FKBA 3RK3C 5GTIE 1R093 5IYYA 3POGA 1QMJA 3SLIA 3K7AJ 3NJYA 1N25A 4YXWH 4HONA 5FPUA 4GH4B 3GTJJ 3BQZA 2LS6A 2RR12 3H1HG 1OURA 2BP6A 5FZ7A 3S1RJ 1SFCD 3F95A 2EIDA 2HEOA 4H2AA 4Q1RA 4LB5A 1TVGA 2V5DA 4Z1VA 1B9NA 3M3IA 5FMCA 3AEAC 4DO0A 1WWYA 4MGRA 3WNOA 3L75D 3JB4C 4AR2A 1Q1HA 2TRTA 4COWA 1VQ4I 2STTA 3H1LJ 3IRRA 3RDIA 2VTXJ 3R60A 5BY5A 4GT1A 4H3WA 4QQOA 2ZXXA 3S93A 5CFCA 4W6XA 1FTZA 4LE4A 4YZ1A 3FMSA 4P96A 3N4XA 3WDTA 5FYZA 1SVOA 4MO3M 2P6CA 1M4WA 3H1JJ 2DDBA 1TQIA 1FDOA 3NMBA 5DUKA 3OGJA 1FYKA 1GP4A 2P4WA 2QG4A 2ZXEB 5KHJA 3S17J 4LKEA 3ZPYA 3GLXA 3ILNA 2WFF2 2MC3A 2CYFA 4HBNA 3V7CA 4L75A 1RUG1 2KXLA 1C1LA 2ZGMA 2PLV2 2AEMA 2VI6A 3T4HB 4OIPF 2E5NA 1W3XA 1ZBE1 1YRZA 4XIDA 2KMUA 5JUVA 5HNFA 1SQVK 1E5SA 4FTHA 2DLLA 4AZZA 4DUVA 1EZVE 3B4SA 3PSFA 1COV3 1DF0A 1OA2A 2DJIA 2ZEZA 2DODA 3AZYA 3MAJA 3GHGA 3MZWB 2O14A 3MF9A 4TSVA 2R7OA 1ND3B 4JGYC 3B7MA 1WJEA 5ERLA 2GWRA 1YW7A 1QHGA 5EYRA 2J1RA 2A45G 4LG0A 4XJZA 1NTCA 4AU7A 1ULPA 2W52A 2ZFCA 3M8JA 1GQGA 1PZ8A 2C6SA 4GB31 3T0DA 2WQZC 2XROA 1L4AC 1GT0C 1FMVA 1CAXA 2RS31 5M5WJ 3AFKA 3LEIA 4LE3A 1WD3A 3RG0A 4YRVA 3CP8A 5ACA2 4AVZA 4LBKA 1I5PA 1K5MB 4YG6A 2JG9B 2OKXA 2EXKA 2IFWA 1LE8B 4QPIB 3CUQC 2ZC2A 4A3KJ 4JOMA 3E97A 5F3IA 2PAKA 1B35C 3W3CA 1QVGO 5A7OA 2E5TA 3BG6A 3VMAA 3CJNA 4C3HJ 1Z05A 3SDGA 2Q5UA 3POIA 1PP9J 3HGGA 4G4FA 1UU6A 1X2MA 2A05A 2H7HA 2B7EA 4LGWA 3S16J 3BLYA 5CVRA 4OI4A 1S2EA 3BASA 4I7HA 5T5JA 4DQ2A 5F1RA 3MHVA 1G9DA 3QH6A 1KB9E 4AVSA 4RFRB 2Y2ZA 2KIKA 1VBB1 2DVDA 2WZ7A 4EJUA 4H14A 4DPNA 5IT3A 4UI9L 1N3PA 3ACHA 4X6AJ 1HCRA 1S8NA 2QVOA 2LXBA 4M4PA 1KQFB 3NL1A 5B66H 3IN9A 1AHDP 1PHMA 4Y5Z0 2RC4A 3RZHA 1W2EA 5B4NA 1GV5A 3MLLA 1XYNA 3SJMA 3RMYA 2Q6QA 1BVP1 2O8KA 2D5VA 2D40A 4ESFA 1RJ8A 4FPOB 4Y22A 4K1ZA 1DPRA 1UIIA 4E7SA 2BRTA 4IRHA 4BQWA 3B5NA 3M3OA 5E6HA 2HWC2 5HLIA 1DZQA 5T5PA 1RUNA 2PMZN 4RM3A 4PDWA 1SQVD 3ZRGA 2NLRA 3J7YJ 1JO5A 1FPN1 4CDUA 3J7LA 3G6EP 2J58A 1XE0A 2LSOA 1IV6A 3AXDA 3A0HE 3VSKA 1PPJG 2R7FA 4BQ4A 3VDDB 1SQXE 2JB4A 1NQDA 2W6AA 4Z2YA 1UY0A 5C4WA 3RZGA 3KQRA 1KN7A 3KF3A 3IIAA 2PHXA 3IL2A 3BTLA 3F8NA 3WT3A 1XN7A 1UXXX 4AGRA 4XOTA 4BWNA 3Q8FA 3KZYA 4H13D 3PUQA 2VRSA 5DTDA 1E3OC 5A3TA 3CWBE 1Z7S2 4BMBA 4FCYA 1Z3YA 3LFMA 1HRI3 4LO6B 3ZQHA 4DUWA 4GKXA 3VD7A 2WWUA 2YR2A 2ZGSA 1CZTA 3R05A 1I1EA 4D6SA 1NTMG 4MTDA 1SZBA 2FXMA 2EFWA 3LSIA 3PTZA 2G9WA 1Z67A 1ODMA 3LQRA 3ZQLA 3TEDA 3SEQA 3L37A 3PO3J 2WT7B 1IQDC 4P9WA 1JOCA 1FZBA 5HCAA 1XNDA 5L3DA 4D6TJ 1W9FA 4OI2A 3HSRA 2FYNC 1JUSA 2CYYA 3GZ5A 1P6RA 1APNA 3SQOA 1TQMA 1W6MB 3CO7C 1E3PA 1X50A 1U5ZA 1IZ1A 3MLJA 1DYOA 2QSIA 2KZIA 2AEZA 2F5FA 3DFGA 1BSNA 2RR11 4BDYA 2E2JJ 2VMDA 3VUOA 2Z4FA 3H1LD 1D4M2 2NOJB 4PJNA 3I4NJ 4NWVA 4PD4I 1UIKA 3WW3A 2A7AA 1CJPA 4JC1A 3ZMVA 4PD4H 3HTSB 5GPAA 3QBQA 4EE2A 4UUVA 5A1LA 1RXGA 3H1JD 4RL7A 3TBDA 2HKOA 4ANJA 3F2ZA 4MEXF 4QSHA 1RE3A 2DBBA 4UT5A 1HIXA 4XN3A 1YOVB 5FP8A 1KQLA 3HTKB 4XMAA 3DEMA 3MUY1 3VBRA 1EH8A 2VPLA 1BE3G 4P5OA 2HWVA 2ESNA 1Z7UA 3DKWA 4JPZB 5CBNA 4FTEA 1OCRH 5C3OA 4E8DA 3CZJA 2CW0F 2PAEA 1O8PA 3HNYM 4B3NA 4HZFA 4M3EA 3AEFC 4G6QA 1WRJA 4CXYA 3HBLA 1P4WA 2WFF1 2ADDA 4TTGA 1QX8A 1AYM1 1NX9A 5CFDA 1MNMC 1JYIA 1WMEA 2PTMA 5FTTC 2FXOA 1YX5A 3S2HJ 2O5RA 1J9IA 4M00A 3IV5A 4AUWA 1OVRA 4P5YA 4W6WA 3C3VA 3WCSA 1JY3O 5H9QA 2IBZD 2VOWA 3HGYA 2OF7A 2PYTA 3J8F3 1NXD1 4EROA 2F5EA 3WU2H 2P6HA 1SQPE 2AYHA 2Q8EA 1ENRA 2P37A 1PP9D 3HNBM 2O01N 2R3CA 3N36A 2YIUC 4GAZA 1OPMA 2CUJA 1MS1A 2VJJA 2O1QA 1ODNA 2E1MB 5ACA1 1AR63 4HNVA 2R7WA 5L9BA 2Y0CA 3KLNA 2QDRA 4Y1YA 4A93J 1P4AA 2IS6A 2X53S 3SQNA 4EJRA 2R5BA 3DU5A 3LDKA 2A6TA 4IRGA 3RFRA 4HW0A 2FYUE 1LP1B 3HSFA 2ZT9D 2YNYA 4N4NB 3ZDMA 2WZR3 4A44A 1VL2A 2DW4A 3OYGA 3B6AA 1OPCA 4LFUA 4W7YA 2MEV2 3OUJA 4PK4A 4Z2AA 3D5SC 3ZXSA 3CLPA 3BZCA 4CU9A 3SSUA 5L3GA 5E79H 5ERIA 4E8CA 4YRDA 5KC5A 3P8MC 3IMNA 4MGQA 1DP0A 3VP8A 3ZN5A 4KWJA 3AG3H 2JDIH 4XUOA 2ZMEA 4A69C 3DECA 3GFJA 1HLCA 2ZXWH 2VULA 5BNOC 1D0XA 3L9JT 3S7IA 4WY4D 2QJYB 4QWNA 3ZFFA 1LWUA 4AWXB 3Q9VA 4JQ0D 2Y0EA 2QQJA 2BOJA 3A0BE 4MGIE 3ZXDA 2K9LA 3D8CA 3HRNA 2FCTA 2VZVA 4H44C 5I0SA 2HWC1 1IFPA 4FPCA 4NHYA 1S6LA 4C8DA 2VJ5A 5DYMA 1R58A 2AXTE 2QQKA 3BYWA 1OZHA 2VNOA 4KBZA 4OI1A 2C26A 5J47A 2EF6A 1HBWA 4TLGA 2DVFA 1HJ0A 5M3MJ 2YO2A 1SFCB 3VKFC 3ILFA 4EDFA 3S5AA 1XTAA 3VBSA 2OQ7A 3K9TA 2QLZA 4G3YC 3HOZJ 3MFCA 4EYYQ 1GLHA 4M6YA 1TE1B 1XG1A 3PIGA 3LSDA 3ELNA 4KIBA 5H2FH 2RV8A 3KX2A 3SMHA 2E1NA 3ITKA 1M56D 3EUAA 5FMBA 1D8JA 2FZ2A 3O2PE 4ZJZA 3M06A 3ZFEB 2R7DA 2AHQA 1CZVA 3KS7A 3VP9A 4FO9A 4EN8B 4D6TD 2IXIA 3AYCA 4KN7X 2XV4S 2JO1A 2E7AA 2HDDA 3MEXA 3TQNA 1JKOC 2D6OX 1ON1A 3NNLA 2K9ZA 5E18F 2PMUA 1PM4A 4E4ZA 3SHRA 3D3AA 4YZ4A 2CW7A 2DK8A 4BQ1A 5JI6A 1HQWA 4OGQD 5HLTA 1I1SA 1KILE 3TNPB 4MNUA 2WC2A 3KGLA 3LOCA 4Y17A 2F4LA 1EV13 1LNSA 2BW3B 4Y3OA 3CMEP 4CU6A 1OUXA 1VQOP 5FYHA 3W20A 1FMWA 2XDVA 1AQTA 2OA2A 1I6XA 2A45H 1G8XA 2XKMA 1AX2A 2KLOA 1R1ZA 2LF7A 1LDKB 2KISA 1W8FA 1WRGA 2VE1A 3RKWA 2CV6A 1LOEA 3HN1A 2EBIA 3FXUA 1R1A3 4PDKA 3IN6A 1HF9A 3H3LA 4BS9A 3QPLA 2CV2A 2X48A 3ZXFA 5CQGA 5FQ0B 3MKZA 2DCYA 1XS9A 2ZAHA 2E2IJ 1W0TA 3I3DA 1LKXA 3QH9A 2VR4A 4CZZA 1SVLA 3ZM8A 4XORA 3F3XA 1LTAC 1FBSA 4OAYA 3DUIA 4QPGC 3UV9A 4U2AA 4U0WA 2EFQA 4BBSJ 2XAGA 5B5EC 1BXHA 3VBFB 5AW4B 3CO6C 4R4XA 3I49A 4PF1A 4D1QA 2STWA 5IOYA 3L75E 2WWJA 1CQTA 1OH4A 4AQ2A 5AVPA 1GKBA 5DCMA 4D7SA 3HD7A 5JPMB 4FX4A 3WGIA 2YS9A 5D5WB 4HN1A 1G2HA 4LBNA 4CEWA 4IERA 1K45A 4WM8A 4KWKA 2EIMH 1GZ9A 1Y9GA 5DD8A 4D7MA 3PL8A 2V26A 4GGGA 3ABVC 5FZ3A 1RUJ2 2L2OA 4IV3B 1K61A 4IEJA 3O7OA 2V79A 2HEVF 1W2OA 2CH0A 4YW6A 3RBXA 1RKTA 1FU1A 3V56A 3ZN4A 4N7IA 5FZHA 1N86A 1RE4A 4E4DX 1OD5A 2XASA 5BNGA 3ZN6B 1S5LC 1NU1G 2ZA9A 2HOAA 4CU7A 4XMYA 4Z8BA 4F93B 5CKQA 3V2QA 3MVPA 1EUUA 1ND2C 2GXGA 3D6EA 5GLTA 4M01A 2R1DA 1QNTA 1J1LA 1VBA3 1J84A 3P9IA 1JTZX 5DN2A 1JY2P 1GL2C 2QNKA 4EJWA 1IW7F 2V4JC 4CA0A 3CF5F 4AI9A 3D5RC 2RG4A 3LOIA 5LBEA 1N77A 5TRDA 1G9CA 5FYBA 4JYBA 3AG2H 4KICA 2K85A 4IV1B 4GH4C 2JPBA 2M8RA 2PHUA 2MEV1 4YGDA 2E9QA 4YW7A 2XKOA 4BACA 1BJZA 4IE6A 1O3TA 1GQHA 2R073 1WD4A 1BJAA 1O5LA 4K1YA 5F8PA 4H13B 4QKFA 2XRLA 1OW7A 3GLMA 1FV2A 3TEYA 3OSGA 4B4QA 2OX0A 4E4HA 3HE5B 1H88A 2WN3A 4ENMA 3NNJA 5GLUA 3Q5SA 2E36A 3F21A 2JRTA 1KV4A 2JPCA 1G6NA 1VI0A 1XC5A 1U5TA 3PHLA 1EKEA 3OPWA 4G7HF 2QQWA 1AA0A 3J7MA 1T39A 4RBOA 4XMIA 2MW8A 4GYGA 4ZU4A 3VHOA 3A01B 1F2NA 3L73J 1ZN2A 3BTZA 5FY0A 3CMEI 1VQOI 4CDWB 2ELHA 3FISA 1FAVA 4O7XA 3APBA 3POBA 3HQRA 3PJYA 4NPLA 5FZ1A 1J1DB 2R1BA 5EGOB 4QDSA 2K02A 2JRMA 4B1RA 5BMZA 2OAZA 2WQ4A 1ZZCA 1X3UA 3KYDB 1RUE3 3PNYA 1AWCA 1IJDB 2Z4EA 4YZ3A 3AZWA 5APXA 5I0DA 4A3CJ 4LT5A 4A6DA 1QVTA 1UMZA 5DUWA 2QZ3A 1NJIQ 1SQVE 3IDAA 3WTTC 2XPVA 5EXOA 4UB8H 2LW8A 5H9PA 3CMMA 1ND3C 3RPQA 1GSLA 1WCDJ 5A7SA 2DMPA 5IVYA 5C5UA 4C7NA 1SDWA 2IJLA 4YIFA 4BHCA 1NOVA 4KT0J 1D1AA 5JLWA 3ZDSA 2QBYA 4UUSA 4D5CA 1H2KA 3T97B 1F4HA 2NYYA 2M4KA 2HBUA 5HLHA 2JEMA 1EDIA 3IC7A 1RUF2 5AVYB 2WSEH 2QE3A 2KXPB 5KK1A 4JX4A 4HDUA 1K5MC 3IZOA 1USTA 4QPIC 1U0JA 3L9FA 1WMXA 4X8PA 2X5IB 2MLKA 3LDRA 4Y5SA 1CF7A 3O12A 4HPQA 2K5CA 2QIWA 3FMRA 1LT9B 3I64A 3EFFK 2YKOA 3VD5A 2L5GB 3GF6A 3JBG1 4KWLA 5JCTA 5KJ7D 3T2PA 4PIZA 3THCA 1LU2A 3MPPG 5FZOB 3ZVXA 4Y15A 2HWD3 2E60A 2HOEA 1UG0A 3D0JA 3ILRA 3ACGA 3SNMA 3JW4A 3AC0A 4QM9A 1FC2C 5FKKA 1ZGWA 2HJIA 3C9IA 2X6YA 4XONA 4HYEA 2LTNA 1NYWA 3VHRA 2JT1A 1UFMA 2F17A 5JOWA 2E76C 5J7MA 2V6EA 2ZKLA 1JNMA 1R64A 1SLIA 4Y20A 3VKNA 4NBQA 1HLVA 5JXHA 3H1LE 4JKMA 3I7DA 5EV7A 2WAQN 3NRVA 2AZ5A 1CWPA 1IAWA 4KNCA 1JT6A 5HVQC 2D2CC 2LFBA 1PGQA 3H1JE 1H1MA 5M3FJ 1ZX5A 2FHRA 3GEZA 1FXZA 2Z33A 1FPQA 2ID3A 3MN2A 4D7NA 5F32A 1EQ7A 2COMA 3AE8C 3A1YA 2ZT9B 3ELKA 2D6MA 1FYMA 3I4IA 2VBPA 2W5FA 4XQ4A 2KDZA 3LAPA 3K4MA 5FY7A 3EYPA 1QKQA 3II6A 2K2SA 4E2QA 1OFNA 3CMYA 1XX5A 1QXRA 4I2OA 4C2TA 3A22A 1QQP3 3VDDC 3L00A 1RUJ1 2EA4A 1KRIA 5KAIE 2QJKC 4HN0A 5IK4A 4OHYA 3GCWA 3BOQA 2VMHA 2PMZA 4AGVA 2PN5A 2JDPA 3EO6A 1NTZK 1R082 5T3NA 2WINB 4W80A 4WY4B 1GTWA 3TN91 1VTNC 5AFBA 1AL21 1UXZA 3A3YB 1IO2A 3F0CA 4DNCA 3OYFA 1MZ6A 1HC8A 1XSRA 1Q1VA 2IBZE 1ZLLA 3MUDC 2E75D 4XKBA 4SBVA 1POQA 4EV0A 3RPUA 1R71A 3CNAA 1YJKA 4C46A 1K04A 1UKRA 4U0VA 1C4RA 1FSEA 1MSFC 1ON2A 4QXHA 2HWE1 2WLQA 1PP9E 2E43A 1CONA 3O8ZA 3KYQA 2RDPA 5FLIA 2ZABA 2DT6A 3U59A 4WF2A 5FYYA 4P9UA 5D8AA 4R9CA 1DQ6A 1NZCA 1CX4A 3I5CA 3PFIA 3ACLA 5F39A 3AKRA 2JG8A 3ZOIA 3DYMA 1N1TA 3ETQA 1O4YA 1W6OB 2YBKA 4BRYA 4BQOA 3G9RA 3DPRA 4NHLA 1QIQA 3VDAA 2WITA 3RWKX 2OT7A 3TW7A 1W5CE 3K4BA 1NCQB 4XBQA 4RHV3 3G1LA 1W7PA 2VIXA 3BCWA 4NO4A 5J8FA 2HWB2 4PF5A 4PJMA 1VRBA 3MFAA 3RKQA 1T98A 1VQNP 3SEZA 1HF0A 2WFPA 4YGCA 4XRMA 4K20A 5E89A 1YS6A 2PHDA 1YJWP 2H6CA 4NQWB 2ICWG 3FUQA 5FZFA 4C0BA 5FY9A 1ACCA 2NS8A 3RI9A 3I2FA 4G7OF 1VP6A 2XVGA 3SCGA 2QEXP 3KV5A 5FR3A 2JDHA 1HBXG 4FT8A 4QU2A 2HLEA 2I45A 2LK2A 3BTJA 2Q4SA 1N73B 2FE3A 5AVZB 2W1UA 2BVLA 2LF8A 1ZG5A 3DCFA 2Q9IA 1DQ0A 3FXEA 2ZMKA 1YFYA 4XFFA 1Y0UA 2RQPA 1PUEE 5L73A 5TISC 4YNIA 3MFKA 1QXPA 3ZCOA 2UWMA 5BXXA 1PUFB 1N7SA 2HEWF 1PX3A 1E3HA 4Q4Y2 1JODA 3GJBA 1DQ1A 4HF1A 2YMZA 3TSIA 5J09A 1W2AX 2QJVA 3FKJA 1AYN3 4O6JA 4EATA 1JYWA 4ON0A 1SFUA 4HG2A 4HH2A 2VZPA 2HR3A 1PYVA 2NS7A 4U7BA 2Q30A 5GP9A 3IR9A 3WD5A 3SCFA 1XNKA 5D4SA 1LT1A 3B5ND 4LUKA 1NG6A 3RIRA 4YM3A 4AHZA 1J09A 1QVFO 2K37A 4L5IA 3BIWE 4CP2A 1LOGA 1PK6B 1VB4A 2ZHLA 4N0BA 3GHGC 5FO5A 3W9AA 2PI0A 2Q7CA 3NKGA 1TNRA 4XKCA 2B9SA 4ZNCA 2M30A 3K70C 4IE0A 3LPGA 5B2GB 4CYDA 5LA2A 4D6TE 1XC6A 1MBHA 3GCMA 1TMF3 3RNSA 1NH4A 1T2KA 1QOSA 1AX1A 1DD3A 5DZEA 2JN6A 4CGZA 3QP6A 3LSTA 3ZYFA 2ZTNA 4DS0A 2QSFX 4Y4YA 5B66E 4I09A 4YVSC 3FZVA 2LKSA 3E1IA 2YKQA 4P1WA 2IXHA 4DOJA 5H9SA 4LK0F 2BBAA 4L92A 2DT7B 2A6YA 2I8DA 1SQBK 1NAEA 1G9BA 3BC8A 2W27A 1VQ7P 1VBD3 3EYIA 2ES3A 2FMLA 3MMYB 2DURA 2CJJA 1DEBA 3VBHB 4V2VA 4TLFA 4HLYA 1G2CB 3A21A 5K7FA 2RHPA 2WT1A 1U57A 3IRQA 2DA6A 4W65A 1ETYA 5CKTA 2D1VA 1RR7A 1HVVA 1Y8QB 2IZWA 5I8YA 5K5QA 4D7YA 1BA5A 2QJYC 2M3BA 3IDCB 2QQOA 1A02F 3UL2A 1FMD2 3RL0D 1QJY2 1UZYA 1IFJA 5CCHC 1REDA 2A5YB 1PO13 5IW0A 4PI0A 1JZ8A 2G8YA 1U5YA 1YJNP 5EJCA 5HDKA 4QWQA 4XILA 1FOD3 2VCCA 3RL0g 2ZAAA 4PGHA 1MD0A 3H9GA 1Y9QA 3O1PA 2CQQA 5CMZA 2MA3A 3I59B 3VBUC 3EB7A 4BQNA 1YHFA 1VQNI 3CU7A 3QACA 4JBZA 4CA9A 1OF4A 2W68A 3DU6A 3AE9C 4PDWC 4JDNA 1ZLJA 4CDUC 2X29A 1BDDA 4XLFA 2WTYA 5AIPA 1I5ZA 2FDFA 4XLNF 2GP5A 2JDAA 1FZCA 1LJ7A 1VPCA 1AVOA 3LEGA 4FPEA 5LY1A 4GMP1 3K51A 1YQ8A 1JYCA 5BQTA 2DMUA 5H6QA 3D82A 2VB6A 2QYOA 5FPZA 4KYWA 3L7WA 1K73Q 5A2QZ 4L9BA 3VMYA 1D0ZA 1ETWA 3C1DA 4INDA 4N43B 5AVAA 4N53B 2B9UA 4IL6E 2K9MA 1MEC3 2CHHA 4PD4E 4NNJA 1OKOA 1DHKB 1ZMEC 3QYFA 3O1MA 3Q0UA 4AFMA 1KQSO 2Z99A 1TZOA 2XONA 1JMMA 5I0TA 3BG7A 1NTKJ 1JU4A 1UQXA 1WW7A 2IXJA 1RYYA 4BJ5C 3BCCD 2Y6LA 2B4KA 4KMFA 1I6HJ 1UY1A 5FGMA 5L8RJ 5FKLA 1EPZA 1YQ4C 1IPKA 3N7LA 2ESHA 3KPHA 1JUPA 4XKWA 3S3MA 3VOPA 4DINB 5A2QK 5DAPA 1B9MA 1KQRA 3L09A 3RSNA 1XYOA 1Y1WJ 3WDWA 2XAFA 3ECOA 5AW7B 2RMU1 3I2HA 5E16A 2AREA 1KS5A 3ASOH 1MS5A 5C4XJ 5F08A 1NGMB 2DTZA 3MW4A 3PIOF 1BIBA 5IK7A 5GM0A 4HSRA 3U1KA 2E42A 2WNUA 3JTHA 3HG9A 5F3EA 3GM8A 4PJ0E 4ZMDA 1RZ4A 2L0KA 4LKDA 1P84D 4AEDA 3VZKA 1SVMA 1UMQA 1YYNA 4P5HA 1RE3C 5K0UC 1PGOA 4XAAA 4Q4X3 3PO2J 4G6TB 1G3YA 4BE0A 3VBRC 1C8M3 1UOFA 2HKXA 4BDVB 1EZVG 5A3WA 3OYDA 4DEVA 4OIOF 2XUEA 4RB2C 1YITI 5DG2A 1N8RQ 2VMGA 4Q4Y1 2WO3A 4AI0A 2MJZA 2FKWB 4UF0A 2RM22 5BNNC 3M3YJ 3DEWA 2R30A 3JR9A 1RITA 4B47A 1QHHD 3ZSMA 2EH3A 5BU5A 3IH4A 3FBMA 2XL7A 2KT0A 1M06G 3NAPC 3T4VA 5FMOL 1LEBA 3BVCA 5CFDC 3FGAD 5IK8A 4KWUA 1AOYA 2SBAA 4OHVA 5AW6B 3IHUA 2WL1A 2H89C 1J2XA 1NCRA 1A78A 2Y69H 3SFDC 1EYBA 3AP4A 4L9VA 2UU8A 4A3BJ 4XHBA 1YJNI 3L36A 1SEUA 3MPBA 5HODA 1I3HA 3AM2A 1L0NK 2GN7A 1AR73 1FATA 1CESA 1BEV1 1SFYA 1AF9A 3JQXA 1F4AA 4RQPB 3OS0A 4NDLA 1BKZA 1WW6A 1GOHA 4BY1J 1JTHA 4DW6A 3L74D 4WVMA 1AR81 3BTAA 1C5IA 1K12A 1MPXA 1PMIA 4XQDA 4DFSA 2OU2A 4WZCA 5FYMA 5APUA 3NNMA 1ZG1A 1KA8A 1WCQA 1LHOA 2EVXA 1BW6A 1WW4A 3HB9A 5AIQA 4NPDA 1DU3D 4BU2A 1HJFA 3FXMA 4HV5A 2WAOA 2HFHA 3A2KA 2E75B 3L70G 3V5BA 2G7UA 1C5HA 3ENRA 1Q3EA 2K9YA 2OQGA 3M8EA 2ZXQA 3KP7A 2FBWC 4JX5A 1TME1 1IZNB 1GD2E 1R49A 2OA4A 4GOFA 3KLSA 4CDXB 1GWMA 1RIRA 1TL8A 1QJY1 3LF7A 4AIJA 3PVEA 4AAXA 2WV0A 3C3WA 2R6QA 4RLFA 1OQYA 1J1DC 3I97A 1FSHA 4A0YA 3VMZA 4AXOA 3AE1C 2PAJA 2P6SA 3DXJF 4DBRA 4P9IA 3AAFA 2P8TA 4BWOA 1X79B 3W6VA 5F6FA 1SQXG 4K2EA 2OUMA 4DZJA 4RA2A 3O3KA 2LXCB 1LWUC 1IG0A 2EA2A 3KB5A 5F04A 4HT1T 1ZHFA 1YQ2A 4ZZ5A 4RB3C 4CCOA 2R7QA 1QZZA 3ABZA 2UUZA 1H6XA 1SDDB 4U88A 3S5QA 2Y6FA 3ALQA 4BE3A 1X9PA 3AL0B 4Y99B 3WGHA 4FAGA 2GOMA 1OKQA 4QQPA 1X1DA 3WXPA 5BUVA 3DPUA 4MGTA 1ZH5A 1NYHA 3WUDA 2NAZA 2W47A 3VBSC 2M7AA 5HNHA 2N1TD 3DP7A 3RQ4A 5ILUA 1ULGA 3TO6A 2FSWA 4KNYA 1O3SA 4L0ZB 1VQ8P 3HUGB 3H1MA 2JD4A 4S2HA 2DPDA 5GTHE 1Z78A 1HKSA 3FXQA 1LNWA 1POGA 4BK4A 5LRSA 5EDNA 1U9NA 2HOSA 1NTKD 1VBC3 3B02A 2CK3H 5K8SA 3OTFA 4B86A 1D3YA 2P2KA 5FYIA 2FZ1A 5DJTB 1TBXA 2G7HA 1LT9C 1IN4A 2DQLA 1F4KA 2JA8J 3GZNB 3ML6A 4RGKA 4OMDA 2CRGA 1R1UA 1D2SA 2KIUA 2ZVOB 4COVA 2NXNB 1SQQJ 1W05A 3M70A 2FQ4A 2AXLA 2WB1A 1NG0A 3DQVC 2ZX0A 4M73A 4TT3H 2VVEA 1URQD 1V9U2 1HX6A 4YM1A 5E3MA 1LEAA 5LB6A 4WBAA 1W8NA 2E19A 5KKZC 4LKSA 3WU0A 2IBDA 1ZKGA 4EQQA 3OYBA 1UU4A 4LQRA 1IS3A 1SD7A 2Z5UA 3T09A 2XBO1 1I39A 2CWSA 4AQ6A 3KHCA 3V0BB 2H09A 3O0WA 1DCSA 2J7MA 1UY3A 3IDEA 5M5XJ 3M4FA 1UCRA 2WZPP 3JTGA 4BXUA 4DNYA 4BXFA 5FZ0A 1Y8AA 4Z07A 1EA3A 2KNCA 3AP9A 2IS1A 5C44J 1QOOA 3MZ8A 2F5DA 2CQNA 2G1MA 3L72J 2AEJA 2G0EA 1DIPA 4HPKA 1LOBA 5LASA 4IE7A 3BP8A 1MJAA 3K10A 3N7NA 5BNPA 2EV0A 2W39A 1HQCA 2WAQA 2LMDA 2E7QA 1ENQA 5KLVJ 2SPZA 2HPCA 2DMTA 1W90A 2HQNA 4LUMA 1P2FA 1D0HA 2ZBJA 4LITA 4AQSA 4EYUA 3RBZA 1Z7LA 1OQEA 4URAA 5FZIA 1ZBE3 4AUXA 3ACIA 4NPEA 1YJ9P 2VXZA 1JZ5A 1R6RA 2RM21 4ZY9A 1W06A 2QM8A 3HD7C 1ENSA 3JAMZ 2ZVNB 4PJJA 4RN5A 3BR3A 5FO8B 4TV7A 2VNVA 1SQPG 2EQRA 5APSA 4CEWC 4FPJA 4BCUA 2MYSA 1G8WA 4XA4A 4TYSA 5D5UB 5APAA 4K35A 2QKMB 1T0FA 3GALA 4CDQB 4GB33 2CG4A 4QHOA 2LG4A 3JD72 4C2UA 2WN2A 3VN4A 2BHYA 1AKHA 3A2AA 3H1HJ 1S2BA 2LBFB 2JUGA 3I9V2 1MVQA 1ZZ6A 1DG6A 4OLLA 2FYUG 3