1OMIA

Crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
224
Chain Sequence
GSEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
total genus 72
structure length 224
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1omiA03
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1omiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1omiA01
1V70A 1OYYA 2LSOA 3ECHA 3RKWA 4MV2A 4Z07A 1UFMA 2P6TA 3M8FA 4N9HA 5I0TA 1QPMA 1UIJA 2EA2A 2PTMA 3JZVA 4P9FA 1KGSA 2ZMEB 3JW4A 4KU7A 1U3EM 5ILVA 5JAXA 2F2EA 4HVQA 2BV6A 3EWKA 4LLNA 1IUYA 4RGRA 4GO1A 3FHIB 3CF6E 2IXJA 5D5VB 3HT2A 4N0BA 4QGMA 3MWMA 1RNLA 5DDGA 1S29A 1ZRDA 1O3RA 1Z1DA 5CLSA 3GEZA 1LJ9A 1WQ2A 3P9IA 3H9AA 2HWVA 1G3SA 2GA2A 1TW3A 3RIRA 4EVIA 2QBYB 1NZCA 5HVQC 1KQ9A 2J5OA 2A61A 3CO6C 4HLYA 4PCQA 3VEPA 3WGIA 3EYYA 1YQAA 4HSJA 3UKVA 2D1VA 1F4KA 1GQHA 4KWKA 3TO9A 1EY2A 3KETA 2O03A 2VODA 5K8SA 5D6FA 1SMTA 3CO2A 5E1RA 4L9JA 1XN7A 3FFQA 3SFZA 4LB5A 2PQ8A 2GU9A 3ZMVA 3FMQA 2O61A 3LA2A 2QCSB 1BJAA 2FRHA 4UVBA 5FD6A 2BNMA 3WU0A 2XIGA 3NRVA 1MGTA 2GAUA 3JSPA 4GYIA 4QX5A 5H20A 2M1BA 5FD5A 4HF1A 2PBIA 4JBAA 4HQMA 1FX7A 3KE2A 3AAFA 5DUKA 3RNSA 3GZ5A 1QQIA 3BJOA 1CGPA 1H1IA 1W5SA 2C0ZA 2OU2A 1Y0UA 4RB2C 5IT9Z 5K5RA 1BC7C 1FBUA 4LB6B 4G94A 2KIFA 3MQ0A 2Z33A 4HX4A 2Y0OA 4J1XA 5HLGA 2WTEA 4LD5A 4XF0A 2MA3A 3WGHA 5DCFA 1YIOA 2RNJA 3QU6A 1UHMA 2HKXA 2QVOA 5E8GA 1UCRA 4WXHA 3HIFA 4NVPA 1OR7A 2GC1A 3WTUC 5LGNA 5LHGA 2OQGA 4RB1A 2GZWA 3S7IA 4UVCA 3CUQA 3B73A 1CAXA 1IXCA 3WU1B 2HDCA 3ACLA 3ES1A 4WVZA 5JSRA 1U2WA 3ECOA 5HS7A 4Z2YA 2IP2A 2COMA 3B02A 2PHDA 2W24A 1FPQA 1MZBA 3WTSC 2F5CA 3R6SA 4LULA 1MJAA 4M72A 1IPKA 4H7LA 2CAUA 2ISYA 2W84A 2WC2A 3BB6A 4UV9A 3TKYA 3O2PE 3KGZA 2J5PA 1TTYA 1IRGA 3K0LA 5J8CA 4HOBA 4ZYDA 1ZAOA 4KN7X 4P9GA 4BHCA 2GQQA 1FWZA 3HRMA 1JHHA 3LQRA 2XL9A 4XFBA 4NHJA 3WW1A 1LB2A 5CU1A 1SFNA 1G3TA 1B4AA 1K78A 1H9GA 1GHCA 1W5TA 2BNNA 1F5TA 1J75A 3SXWA 2PFBA 5CVUA 4O9GA 3T8RA 4JTOA 1IF1A 3CUQB 3EYIA 5BPDA 3BDDA 4B09A 3FJSA 4IRGA 1NHAA 1J2XA 2P5VA 4LA2A 2E1CA 3IHUA 1YFHA 1NE6A 2ELHA 3IC7A 2IPQX 3O3KA 4MGKE 1S6LA 4JV4A 2MNGA 3ZMUA 2YX7A 1TQ5A 1BI2A 3J80Z 2Z5UA 1QGPA 2ZCWA 4XSXF 3J81Z 1JUHA 2D5HA 2YR2A 3WTXC 2GWRA 1BOAA 2VPVA 4G6DA 3HSRA 1YLFA 1W4MA 2XASA 3CL1A 4IXAA 3IRRA 2VXZA 2DCTA 3BU7A 4ENJA 2Q8KA 5EFUA 4S05A 1R1VA 2ZXJA 5HOOA 4G7OF 5AONA 4RB3C 4LJZF 3RYKA 1J0RA 4WF2A 5EEHA 4KUMA 3MEXA 4AVBA 1RC6A 1WKMA 1IXRC 4OOIA 2K27A 1FNNA 1O4TA 3E6DA 1XSVA 2W85A 2CG4A 2HKOA 3H7YA 2NS0A 1XE8A 4HX8A 2FBHA 3JTHA 1ZARA 2P17A 1Z91A 4HSLA 4L9TA 1YYVA 5FGMA 3VHRA 1G6NA 1JE8A 4QWQA 4MGRA 4A0ZA 3TNQA 4ESJA 5HLHA 2DW4A 3E5QA 2ET7A 2OD5A 3P9CA 5L3EA 4XFHA 5E17F 1XSXA 1FYLA 1XGMA 1TQMA 2QQBA 3OGJA 2B0LA 3QP6A 2EV0A 3F8MA 1ZREA 2Z2SB 4IERA 2Q0OA 3V8LA 2L02A 2XUBA 2B5HA 1KYZA 1ZGJA 1LDKB 4XSZF 2MD5A 3K2ZA 1V4RA 4U0VA 1XCBA 3BP8A 3DF8A 3U10A 2TDXA 4IVNA 3H50A 1W7PB 2QENA 3F23A 2PQQA 4Q48A 4FX4A 4KICA 1ZZ6A 5JR3A 4U7DA 2PHLA 4LUMA 4MGYE 2UYAA 1LNWA 3NVCA 2IXHA 4HQEA 4XEZA 2QQAA 2KJBA 1KU7A 2YSRA 3M8EA 2XVCA 2JZYA 2ZMEA 5FFZA 4KDPA 3FXRA 1PM7A 4CXFA 1FT9A 2STTA 1TBXA 3T1BA 3L9FA 1W7PD 3QAHA 1IZ1A 4A0XA 1F1ZA 4RAZA 2KIMA 4CDGA 4IPAA 2RV8A 1D8JA 3IIAA 4HLTA 3E5UA 4QLCU 3LAPA 2GC3A 2VBXA 3KP6A 2QDRA 2QUFA 1PMIA 3GW2A 4R79A 4M73A 4Y15A 1YTYA 4ZZDA 2GH2A 4O9EA 2BNOA 3QACA 5AIPA 1IN4A 1XMAA 5KHGA 1RUOA 4BIFA 3WTTC 3EUHA 1OYIA 2CO5A 1T39A 1HKQA 3W6KB 3HOTA 5BS6A 3Q5FA 3WGGA 1B9MA 4Q0QA 3S2WA 4XFCA 2ESNA 4Q0VA 4HV6A 4EGYA 1XD7A 4ZH4F 5D8KB 3MZYA 1X82A 3FZVA 4R1HA 4BYYA 3NKTA 1QZYA 2E7XA 4KMFA 3D5LA 3I53A 4CYDA 2W57A 4M9ZA 2VBWA 5DUIA 3TOAA 2CWEA 3SHRA 1J58A 2XV4S 4AWXB 1IN6A 4H0EA 3GWZA 3TGNA 3G73A 1T38A 1P4WA 3R0JA 4IEXA 2V6CA 1KU9A 2V79A 2P10A 3IBMA 1XDUA 3ELKA 3IDBB 4RAYA 4WK8F 1HW1A 1R5GA 3GFMA 4BQAA 1EH8A 1IN7A 1BC8C 4ENNA 2OQRA 4CHUA 5LRRA 3GF2A 1OFNA 2EK5A 4IF4A 1WSUA 2FBIA 4ETSA 2AXLA 1ZZCA 5HDNA 2IXIA 2UYBA 1MKMA 1RGSA 4EJVA 1OKRA 5D4SA 5C8WA 3M3IA 3O6BB 3CLPA 1YWKA 1BI1A 4HF0A 2LKPA 4PJYA 5JCTA 4D7TA 3RYRA 2KKOA 4MEXF 4KL1A 3SHFA 1TLHB 3FZ3A 3K9TA 3R60A 3LA7A 2PLYA 4UUVA 4QMAA 4HA8A 5BPXA 5ED4A 1FP2A 4EWAA 3KZZA 4KA4A 4Q0PA 3KFWX 5H6QA 1O5LA 2PG4A 1C0WA 3H7JA 3HQXA 2MLGA 4XF3A 4MUVA 1OYWA 4RGXA 4MGIE 2BGCA 2HYGD 4EROA 5I91A 4UVAA 4BXUA 1UD1A 2K0GA 4OFGA 1IN8A 3CJXA 4EQQA 4PGHA 2ADUA 1VP6A 4I3PA 1QNTA 4TLFA 4EJTA 4I2OA 2HYFA 3BALA 3CO7C 3I71A 4YFXF 4WXCA 2VE9A 3TO6A 2EFOA 3LWFA 1DPRA 2O8QA 2XKPA 2OA2A 4KIGA 1TQPA 1CAUA 2IRFG 4G6QA 5J6XA 2KIUA 1SD5A 1EPZA 2FMYA 4ASNA 5BQTA 2DPDA 1Y3TA 3F3XA 3KCCA 1P4AA 1I6XA 1BIAA 2L4AA 2XAHA 2P7VB 4MNUA 2P8TA 4M6XA 4IEOA 2XAJA 4ZZLA 3BY6A 3BWGA 4KT5C 5FFXA 1HSTA 4XLPF 4KFCA 5JVTA 4ZU7A 2H0VA 4U0YA 3KEOA 3C1DA 4HN1A 1EH7A 1O3SA 5D5UB 2F5FA 1B1BA 3U2RA 1LEAA 2L01A 3WW4A 4M6YA 4QXKA 5J48A 2EV5A 1YUDA 2HJIA 1I5ZA 5JI6A 5CVVA 2IA0A 5D4RA 4K8FA 4HLXA 3OF1A 2IXLA 2O0YA 1FDIA 2NRAC 1ODDA 3SCHA 1SEFA 3CUQC 1Q43A 1O7FA 1ZZ9A 1MJBA 3N4MA 5HS9A 4ENKA 5AVPA 3WW2A 2M45A 3DEUA 1XE7A 4XF1A 1ZRCA 3KZYA 1KQ0A 2MBFA 2V1XA 5FLJA 4KWJA 4PIXA 3V8JA 4RGSA 3RKXA 2Q4SA 3J81K 3MPBA 3VOEA 4I0AA 5I93A 2RC4A 4IEUA 3ES4A 2M8EA 2X0LA 1PP8F 3KP5A 4XLNF 4YYOA 4HAMA 4RGUA 2EFPA 2IA2A 2IW5A 2XL7A 1U5TA 1ULYA 1ZH5A 2R7FA 5JHUA 2IJLA 2L3DA 3V4GA 1HKTA 2QWWA 4LGWA 2A07F 2DO7A 2JPBA 4U0WA 4GULA 2Z9OA 2DI3A 3MDPA 1BI0A 3T8TA 3QP5A 1FYKA 1HSJA 3BZ6A 3USSA 1RIOH 3SXYA 3QPTA 1Q5OA 1YFYA 5CVRA 4MTEA 2XHKA 5D6EA 1EV7A 3RYPA 1FI2A 2ZNZA 1P4XA 2UWMA 5FLXZ 4UBGA 3NL1A 1ONVA 2VONA 4OMYA 1FSEA 1XGOA 1Z9CA 2VT3A 1CAXB 2UY9A 1YG2A 1ZLKA 2OYZA 1RTVA 3RZZA 4YRDA 1YFWA 2X4HA 1B59A 1P6RA 2RKHA 3EJKA 1ZGAA 3F6OA 3Q9SA 4YFKF 2L4MA 4WZCA 5LEKA 1IAWA 4MZUA 2D5FA 2DK8A 4S04A 1J3PA 1UW8A 2VN2A 5EEGA 2GC0A 3L09A 3E6MA 4A2UA 5FO5A 2DQRA 3GFIA 5JR7B 1R23A 3IN6A 2N7GA 2HQNA 2G7UA 5T3NA 3PNAA 4A0YA 5K5OA 1J59A 2ATFA 3KEQA 2ZJ2A 3FX3A 5E16A 2IXKA 1FDOA 1T98A 3SCFA 4EM0B 3DQVC 3COAC 1SD7A 2NYXA 3QPHA 3RTRA 2YU3A 3OTFA 3HOSA 4I02A 2QBYA 5CJ9A 1JXSA 1U12A 1CF7B 3RI4A 2H27A 1D8KA 2KJCA 4I98B 3J7AO 4K2EA 3EDPA 3O6QA 4AVAA 1P92A 5JSOA 2UZKA 4QM8A 2EFNA 3BPZA 3HSFA 1VJ2A 4AD9A 4EWDA 3H1MA 5HLIA 4OMZA 4UHTA 1LKNA 4A6DA 3GFJA 4LG0A 1K6OA 1JHFA 4Q4ZF 1MD0A 4WXDA 2VE8A 2YPRA 3JSOA 2E9QA 4G7HF 1I27A 2BBYA 1BI3A 1ZZ8A 4IEVA 1UIKA 2FNPA 3H8UA 1I1SA 4I7HA 3H25A 2LDUA 5KVRA 5L3FA 1AOYA 4XFGA 1UCXA 5FCCA 4P55A 2O1QA 4QGNA 1HW5A 1TNSA 4FHTA 3FXUA 5ERIA 4CICA 1R36A 2YX4A 3U0ZA 2FQ3A 1K78B 2LNBA 1BBYA 5FQ0B 4HDVA 2Z3YA 2HEOA 1YFXA 1CAWA 3MFKA 4XRFA 4LLOA 3HTSB 4OINF 2XAFA 4ZU5A 5D8LB 4IRIA 2QVSB 2PJPA 1SAXA 1R22A 4WX9A 5E1WA 3NJZA 3WE2A 1D3YA 2CAVA 3T0YA 1P2FA 3GLXA 1OPCA 3GYHX 4TV7A 3LQQA 4AVPA 1Z6RA 4P9UA 2VT2A 2HTJA 3HRSA 3PLQA 5BMZA 1QZZA 4XETA 4KIBA 3M70A 4LK0F 2ET1A 2HOEA 2QLZA 3MCZA 1RUNA 5CVIA 4L18B 4ZYHA 1H0MA 5I0UA 3H3UA 2NNYA 4ON0A 3PQKA 3JAMK 3HTUA 3IWFA 2XLFA 4D0PA 3WTZA 3KP7A 4EJWA 2Q2EA 2FBKA 2LF7A 1LVAA 2MLKA 2JTVA 2HZTA 4HBLA 4YG2F 1FLIA 3HUGA 1JGSA 1L3JA 3HRTA 3FWEA 1ZRFA 1KQ8A 4IETA 2QZ8A 1J3QA 1A04A 2VBZA 1HW2A 2HTSA 2PAMA 1J9IA 5J7MA 4X6QB 3J80K 1VTNC 1ZN2A 3DXJF 3GZ6A 3KSCA 1ZMEC 3SCGA 3DN7A 2Q1ZB 4OIOF 2P6SA 1CF7A 4HN0A 1ZZBA 3DL3A 4UV8A 4HMZA 2P4WA 2ZO4A 3O14A 2KXLA 4L5IA 3I58A 4E70A 2JSCA 4KNYA 2A6HF 5HDGA 5JFRA 3DPTA 3D82A 5F1RA 2OA4A 3UKTA 3RPQA 2RVCA 3DV8A 2XROA 4AXOA 3K1MA 2HFHA 3S0MA 5CVJA 5F6FA 4QM9A 4GGGA 1SD4A 1USSA 3I7DA 4DNCA 2H6BA 3G3ZA 4R8HA 2MC3A 3CUOA 4BHPA 1U5TB 4PGGA 4EV0A 4A6EA 3GX4X 1D5VA 2Y48A 1O3TA 1TNTA 3KP3A 4M9SA 5C6CA 1Z05A 4MEYF 4ENMA 3G7DA 4J1WA 2WV0A 1YW9A 3KLNA 3EO6A 1FC3A 2A6EF 2BE5F 3DP7A 1SMYF 1CAVA 2AS5F 3BPVA 2QNKA 1O7LA 1QWRA 2GC2A 3EQLF 2V9VA 2Y0MA 3M7GA 2D93A 2Q0AA 1ZHFA 3ABUA 4DINB 3VODA 3M9AA 1QXRA 1ZVFA 1FY7A 3BROA 4IEYA 4AIJA 2IC1A 1UB9A 1XRUA 3ELNA 2DK5A 1FXZA 4HF2A 5CADA 3LAJA 3M1EA 3W6JB 1KA8A 2EAAA 1EH6A 3FM3A 4MHGA 2P7CB 1S7OA 5ILUA 4JTNA 1ON1A 3EBRA 2H94A 2W25A 5J8FA 2RDPA 4WWCA 2B8MA 6PAXA 5KHIA 3FE5A 3F8FA 1E17A 5E8IA 5J3UA 3V7SA 3NW4A 4G9YA 1MDMA 3OD0A 2PA7A 2O3FA 1ZG1A 3HHHA 2XAGA 1R7JA 1UHWA 1VR3A 3BPXA 4NQWA 4IEPA 1J3RA 4XF4A 3MZHA 1E2XA 3R61A 3CDHA 1XCVA 2WFPA 2MHFA 1AWCA 5BV6A 1SQ4A 2IT0A 1DGRA 4IEQA 2P5LC 4O3MA 2IA1A 3PQJA 3R0AA 1O57A 1Y9QA 3KGLA 2F4PA 3T5XA 1T2KA 3K69A 2QYOA 4CO8A 4E2SA 2G9WA 4FT8A 4X6RB 4AQ6A 1U5TC 2VC1A 3ERED 1U78A 4IEWA 3LA3A 2PMHA 3ZN0A 2JT1A 1GQGA 3TOBA 2QM3A 3ZMDA 1NE4A 2EFWA 5L3CA 2CW0F 3ML6A 3N97A 1SD6A 4U7BA 1I1GA 5D5XB 2FEZA 2M5WA 1WWXA 4JVAA 1TQIA 1WRJA 2ESHA 3V7RA 2HGCA 5HI0A 3HHGA 4LMYA 5HDKA 4N9IA 2VOOA 2FA5A 3F72A 3LSTA 2IVMA 1J1LA 4HW0A 1KYWA 4Y13A 3C3VA 2ETHA 3L2HA 1STZA 4RD7A 3VFZA 2DPUA 1S3JA 2M87A 4XBFA 5LGUA 3E6CC 4L0ZB 3I5UA 1REPC 2OZ6A 3GVAA 2XRNA 4A12A 4WBBA 1KU3A 2E1NA 3HRUA 5DYMA 1R1TA 3R4KA 3TQNA 2FSWA 4XFAA 3V8KA 1U6GA 2DLLA 1H9TA 3Q9VA 2PYTA 1WA4A 4Q5SF 2FQPA 1R1UA 2L54A 1FBQA 1NXMA 1X7NA 3H92A 1W7PA 1XSDA 2OBPA 2UXXA 1S8NA 1R58A 1B6AA 4BH9A 1R5HA 1WGPA 4P96A 1R00A 5CYVA 3LFKA 3GFLA 5I0SA 5TRDA 4AQ2A 4MH0E 4HBNA 3ISPA 1ZRRA 1NYWA 5E1XA 3F22A 4MTDA 3BCWA 1UPIA 1CAVB 3H1WA 4OU0A 5ILSA 2XLGA 3HYIA 3ZMSA 1USTA 3L7WA 1L0OC 4LEJA 2DBBA 2FNAA 5DEQA 3LZZA 4KU8A 3WW3A 2K4JA 2A3SA 2JRTA 3E6BA 1ZNPA 4IEZA 4IHTA 1G3YA 1KU2A 2PEXA 5DCMB 2KRFA 3CTAA 5DD4A 3DFGA 4PDKA 2D1HA 5AIQA 1ZYRF 4MQ9F 4YFNF 3IKTA 2PAEA 2A69F 5IT3A 4KN4X 2UXNA 2OPKA 2ZBKA 1YHFA 3ZDSA 1YW8A 1RZ4A 1XGNA 2G7HA 2PN6A 3QRFF 1DZRA 1PUEE 3TDUC 4FAGA 2RQPA 3F8NA 1X8EA 5E20A 4LUKA 3WG9A 1S7AA 4HVRA 2V09A 3LAGA 4YARA 3F8BA 3ZPLA 3NEUA 5KHJA 4HYEA 1T6SA 3DPLC 4I09A 5K5QA 4OIRF 1QO0D 2CQKA 4LG0B 4Q0UA 2GA1A 5FQ0A 2H09A 4YIFA 4KWLA 2E7WA 1IPJA 3BJAA 3NSTA 4IHSA 1CX4A 4UBHA 3IL2A 2DQLA 1SFUA 1K7AA 3QU3A 4BNCA 4R52A 5LRSA 3C7JA 4XFFA 5I8SA 3C18A 4OIPF 4FX0A 4PZJA 4G8XA 5BY5A 2K4BA 4Q29A 5LHIA 3ST7A 1GVJA 5D5WB 5I8TA 3SZTA 3I59A 4KIFA 3PVBB 2F5EA 4O6JA 5E18F 4MGZE 4EM2A 5I0RA 3SZPA 3I59B 4L5JA 1LR5A 3I0TA 3E97A 5BXXA 5JSPA 1BN5A 2M30A 1T0FA 2V1DA 3RDIA 3GXOA 4WCGA 4HDUA 2D40A 2F5DA 4LLGF 3E3VA 1HQCA 3FM5A 3REOA 1FBSA 1TW2A 4ZYEA 4ZU4A 5FPXA 4AIKA 3ZN1A 1SFXA 4LA3A 3KP4A 2EV6A 4O5VA 3D0SA 2D2WA 4LK1F 3NQOA 3ABTA 4HZFA 5F64A 5H6RA 1FYMA 3WODF 3ZMZA 3WTVC 3KMHA 3WE3A 1Q1HA 2PAKA 5DCMA 3JAMZ 1CAWB 1DPUA 4PIYA 4EJOA 2STWA 1Z6TA 1F9NA 5E1ZB 3EHKA 1IW7F 1V3FA 3TDZC 5ICEA 3UKNA 3ULQB 4UNOA 5EZWA 4F7ZA 2A68F 2EA4A 3U1DA 3LWCA 1OD5A 3CLOA 3F8CA 4JK1X 3FMSA 3BJ6A 3VB2A 2FF4A 2XGXA 1RL3A 3FXQA 2K9ZA 5DV5A 2K7LA 1YLLA 2Z99A 3MYXA 2O6GE 5D1IA 1HXDA 3SMHA 5FLXK 4FBFA 2DTRA 1O3QA 3FF5A 5HS8A 2DU9A 2CSOA 2HS5A 2CYYA 5BOXA 5FDBA 4L0YB 5LHHA 3JTGA 3EETA 2GXBA 2CFXA 3LOIA 1XDSA 3GBFA 4ORFA 4L9VA 3ZMTA 2EA7A 3SQNA 4XF9A 3KP2A 4EGZA 1OI6A 3S7EA 4E2QA 1QXJA 4EWEA 1YFUA 1RI7A 1O5UA 1IXSB 4UXNA 5ICGA 2GXGA 2WWYA 3D0JA 5LGTA 2Y75A 2H6CA 3L2CA 1AJYA 4QGLA 1PDNC 3DKWA 3EQEA 2K86A 4LLLA 3V7CA 4OLLA 4B8XA 3RPUA 4CGZA 1SFEA 4P5OA 5FLIA 2K02A 2HQRA 2D45A 2MH2A 1BIBA 4Q0SA 1EP0A 2VOPA 5LLQA 1DGWA 3FMRA 4Q47A 3IWZA 4PIZA 5FB2A 4GYGA 5BUVA 1ZG3A 1YW7A 2EFQA 1WI9A 2PMUA 3GYDA 4M9XA 5LEJA 3WTYC 4KYWA 4A5NA 1BM9A 2OAZA 4GXOA 1G4DA 2V1UA 1U8RA 2XLAA 4CZZA 3K1PA 4B29A 4ZYGA 4U88A 1K79A 1DUXC 2LF8A 3H1YA 4LFUA 3GUDA 3F21A 4MX3A 3ROUA 1FP1D 3ZP5A 4YIIA 1GXPA 1LEBA 4XFIA 1QBJA 3CEWA 3PFIA 3IDCB 1YO5C 4IESA 5I8YA 1LDJA 5L3BA 1XB4A 4M74A 1DDNA 3MAJA 5K1YA 1FOKA 4G7ZF 5L3GA 1OMIA 2DAOA 3OV8A 2I45A 2Q30A 2EB7A 4A5MA 1HBXG 4MQVA 4JQFA 3WTWC 1ZLJA 5TJJA 3I64A 2MPFA 2ISZA 4HV5A 4BHBA 2PFWA 2PI0A 4ESFA 2Z69A 3U9GA 2UY8A 1LDDA 1FZPB 4L2NA 4DQ2A 3IRQA 1L3LA 2BYVE 1QY4A 2VECA 1X8MA 2OZUA 4I0BA 2EJRA 1J5YA 2DFIA 2GIVA 5IT9K 2C6YA 1X3UA 2A5YB 2FOKA 2QJVA 4E2GA 1G3WA 4L9NA 2VC0A 2CGPA 2B9UA 3IKVA 2JPCA 2EWNA 5ICCA 2NAZA 4I01A 1DP7P 4EM1A 5FLHA 2HR3A 2VBYA 2FE3A 2DT5A 1IRFA 1YS7A 4M71A 4EJUA 4IJAA 4Y17A 3OCPA 2FXAA 1LRHA 4YSFA 1WLTA 3FHZA 4EMSA 4FAHA 5DD8A 1Z7UA 2ACJA 1EYBA 2ZFWA 2XKOA 5KHKA 3TO7A 4META 3BOQA 1J7KA 3I4PA 5LBQA 2O8XA 3GO5A 4IRHA 4D7SA 3OOPA 3H3ZA 4HVOA 1XGSA 2ZNYA 4UXAA 2R3SA 1B9NA 2EVXA 4AIHA 5KHHA 3L00A 1HKSA 1WMKA 3HT1A 2ZKZA 2R7DA 3HSEA 4OIQF 3RKYA 3F6VA 1ZG5A 4L11A 4LTAA 2IXCA 4RS8A 4Z82A 1XMKA 2NNNA 1YS6A 4ONUA 1CAUB 2FU4A 4YNIA 3E5XA 3ETQA 3RJPA 1H1MA 1FSHA 2P5KA 3QOPA 4NB5A 3ZQ7A 3TNPB 4KMUX 2RN7A 3P7NA 5ICFA 2ETEA 5KK1A 2BEOA 1MDMB 3KLOA 4RB0A 1DZTA 2CV6A 4AVCA 2G8YA 5L3DA 2MH9A 5KBFA 3U11A 3C3WA 4GCVA 3K1NA 2ZKLA 2XAQA 4BAYA 3CJNA 1IN5A 4F8AA 5FPZA 2OZJA 1PP7U 2FMLA 3I54A 1ZZ7A 4ESBA 5A2QK 4HX7A 1MJ9A 1ON2A 3P9KA 2QQ9A 2RGVA 5BPIA 1Q3EA 1ZX5A 1GXQA 5A2QZ 2VQAA 1LQ1A
chains in the Genus database with same CATH superfamily
1TWHJ 3BYWA 3C7OA 5ABJA 2LSOA 2O3JA 3WF2A 2IS1A 2Z5IA 1GANA 2P2KA 4MV2A 4Z07A 3M8FA 4N9HA 1H2KA 1QPMA 1UIJA 2LOOA 3POBA 5FP3A 1JEKA 2VZOA 4AFBA 2HVSA 3B5ND 3GW6A 1VAMA 1KGSA 2L7ZA 3OYBA 1U5IA 3H9JA 3KVAA 5JAXA 3TB0A 3EWKA 1GZ9A 2Q8CA 4RGRA 3FHIB 2R7RA 1CW5A 2CW7A 2IXJA 5D5VB 2B87B 4N0BA 4SLIA 2WO7A 4ZS3A 5C7GA 2VQGA 4P9IA 1ZRDA 5CLSA 1ZXGA 3GEZA 5CISA 1YI9A 4Z8BA 1QLED 5E88A 3RZDJ 2ZGQA 4EVIA 1KYOI 2GBYA 5BNQA 1FZCB 1NZCA 5HVQC 1QDOA 2RS31 5B3SH 3DBLB 2J5OA 2MGQA 2A61A 3Q2YA 1TE1B 4P9YA 1LFBA 1VBA2 3VEPA 4GRIA 1KTMA 3IDAA 1XBFA 1SLTA 4OMCA 1I50J 3UKVA 1LJ7A 3TO9A 4MHUA 3KETA 4YZ5A 5D6FA 1SMTA 4LO7A 4CUAA 2VMIA 2YB7A 2KMUA 4JHZA 3WDTA 2WWJA 5DAVA 4D6TG 4RKUJ 4KJMA 3TP3A 4RS5C 5H2FH 4QX7A 1K4TA 2J1AA 1X1PA 3OPTA 5FYYA 4KJZA 2FRHA 4BS9A 3RK2C 4UVBA 5FD6A 1GW3A 2BNMA 1GBGA 5T5OA 2GAUA 1PP9G 4YVSB 3JSPA 3AKTA 3L9JT 1K5MB 3CBNA 2GMMA 4JBAA 3LD8A 4HQMA 4PI2A 3S9OA 3KE2A 3MMYB 4Q4W2 2XWJB 1HJGA 2W83C 4HFSA 3BJOA 1H1IA 1W5SA 1BJZA 3RK3E 2OU2A 1Y0UA 1GMMA 3BG9A 3BIWE 4LB6B 2ZYAA 3M9QA 2CUJA 3MQ0A 4FE4A 4RL7A 4HX4A 5DS9A 1NCRB 2WTEA 2L0KA 3V4WA 1YIOA 5FOBB 3I97A 1UHMA 2QVOA 1UCRA 1J1EB 4JRAA 4NVPA 3WTUC 3FHNA 4PLMA 5LGNA 5LHGA 3L73E 3T30A 1OR7C 5LZ6A 1WJFA 1APLC 3CUQA 3B73A 1L0LJ 3AP5A 2HDCA 3LSPA 4FASD 3ES1A 4Y1VA 3WXPA 2HH9A 2F17A 3BTIA 4Z2YA 2QQ8A 2M0MA 1HDDC 2YU9J 1N8RQ 1UYYA 1QVUA 3H3VK 3MP7B 4FPLA 3ZN6A 3ZFGB 1JOBA 5JXJA 3AG3H 3L70J 2XC7A 1X1BA 1YEWA 2RR12 2VMGA 1UZWA 3K48A 3KZIC 2QSIA 3WQ7A 2VUMJ 1U57A 1QH6A 3V56A 1LGCA 2A75A 5FJKA 3CJIA 5C3OA 3WG1A 1MQTA 3BR5A 2NZ9A 1SFCC 3F89A 4JGZA 3P1IA 2RJLA 1TTYA 2EZLA 2JD9A 5DAPA 3VMYA 1OCRH 1V6KA 2B42B 4BHCA 4FETA 1P84H 1FWZA 5CQGA 1JHHA 3IH3A 1UZVA 1YQCA 4NHJA 2WSCJ 3W2VA 1G3TA 4AUWA 5GADJ 1COV1 2JG9A 1LTSC 1H9GA 4IX7A 2BNNA 1F5TA 4ZTJA 5B5EE 2VY0A 5JXIA 4YG0A 3SEZA 4BXLA 2DJIA 3ZKYA 5DDJ2 3WG4A 1EA3A 2ZZQA 4B09A 2M0BA 4IRGA 1F4HA 2CSGA 4LA2A 2E1CA 2D3RA 4MLOA 1YFHA 1JZ3A 4XLFA 2VASA 2ELHA 3IC7A 1LGNA 1RMU3 4A4AA 2O0OA 3VKLA 1MUUA 2RG4A 3RZMA 4B1MA 2C5DA 2MNGA 4JV4A 1W2AX 1Y7BA 1TQ5A 4XHBA 5FY8A 3T2OA 4LBMA 3W59A 1RJ7A 1QGPA 3OYAA 4XSXF 4OHWA 1IGOA 3J81Z 4XOTA 2YR2A 1NG7A 1R1ZA 2GWRA 2RS33 4LIVA 4BGDA 3HSRA 1SQQK 3RK3B 2XASA 4P5YA 3QOEA 4IXAA 4YG3A 3BU7A 4OZOA 4ENJA 3LSHA 3K4MA 2WB1N 1R1VA 2WINB 5JXHA 1BSNA 4GIFA 1C8NA 1S1CX 3VKFC 4LJZF 4RB3C 3WZ1A 2V72A 5EEHA 1BLZA 5J40A 1FNNA 2R5YB 2PLV2 5FXZA 2CQ7A 2CG4A 1OLQA 3FK7A 5FK8A 3WHUA 3H7YA 1EDJA 3L74G 4ABZA 1YYVA 5FGMA 4CYCA 3VHRA 1JE8A 1AR73 1W6NB 5JUVA 4MGRA 1S9KE 2ZJCA 5T5LA 2OD5A 3P9CA 5L3EA 2VMHA 2CU5A 1FYLA 4CEYC 2DCEA 2WPSA 2DUPA 4CDXA 4L75A 2RV9A 3D5SC 5DUWA 3F8MA 2VVDA 4IERA 2XUBA 4KHXA 1ZGJA 4WV8A 3K2ZA 5C4XJ 5EG0A 1CX1A 3M0AA 4R4LA 1BE3E 3OD4A 2V1NA 1B8IB 3H50A 1W7PB 2QENA 4BCUA 4D8MA 2VW0A 5CFCC 2ZAEB 2IUWA 1Z3YA 2V7QH 4KICA 5JR3A 4U7DA 2HLEA 3V65A 3VBSB 2IXHA 3MICA 3Q8CA 2YG0A 1U0JA 2XVCA 1S2KA 1I9RA 2NLRA 2WABA 2W8ZA 1FT9A 4Z1MH 1TBXA 3T1BA 1RUD1 3QAHA 4OQ8A 3S5AA 1RR7A 4RAZA 3A7QA 2RV8A 2ZSIB 3SKJE 3ZXAC 3IIAA 4FTBA 5A7PA 3WNPA 3KYCB 1L0NE 3LAPA 2J1SA 3VL9A 3B3QE 2RM22 4OHZA 2EAKA 3HNMA 1KXGA 3B4SA 1XMAA 2VL4A 3KF3A 1R4MB 3GMAA 3ZX7A 3P8CD 3GBGA 3HOTA 4URTA 3CXHD 1PGSA 1RUF3 4K3AA 1SPPA 3OYWA 1FAVA 5CYYA 5FMOL 2DMNA 4X0GA 4YW3A 3PMEA 4EGYA 2AEZA 4ZH4F 3MZYA 3BASA 1X82A 2H7HA 4DJAA 4ZC3A 4B7KA 1CONA 5CA6A 1DQ4A 3FZVA 1IS5A 1H2NA 2E7XA 4KMFA 3D5LA 5GZGA 3ZM8A 3KWVA 2BZTA 2VOVA 2RS13 4BY7J 1VQ5I 3VZMA 1FPN1 1VF5B 2E5TA 4CA9A 5GLTA 2OTJI 1RVF1 3CCUI 2LW8A 3TNUB 1P4WA 1HB1A 2V6CA 2P10A 3IBMA 5GKAC 4YW5A 1R5GA 3ONQA 4JAAA 3PTZA 3I4IA 2DOEA 4CHUA 3VBFC 1OFNA 1BVP1 1SPPB 1JCCA 4C8DA 3S3OA 1NTZD 2ZYGA 4E7IA 4HH2A 2DUQA 5HDNA 4CDWC 2PMZA 4IHWA 4IFMA 4A69C 2P5BA 1OKRA 3M3IA 3H1LE 3EMRA 1HXS3 1BI1A 2CWSA 1DU0A 2LKPA 3CCJP 2JE9A 2QCOA 5JCTA 3AZWA 1VL2A 4D7TA 5FXWA 2KKOA 3G6EP 5FY4A 4QDRA 1TLHB 3CJRB 2KSEA 3Q8BA 4DEQA 4OH8B 3FZ3A 1N7SD 4CDWB 3PH0A 1ND3B 2OTKE 3BVCA 5M1BA 3Q0VA 4CZCA 2O01H 5ED4A 1WKYA 4H0LC 4KA4A 4RQPC 1A6QA 2YIUC 3KFWX 1GZLA 2QEXP 4OUSA 4AW7A 2WQYC 2CS3A 4M3BA 4XLEA 4H44D 1KYOD 4MUVA 3N9LA 5DDJ3 5BNPC 4LLHA 2HYGD 5FYVA 1X19A 5ABJC 2VXDA 1IN8A 2KDOA 4PGHA 1EZVI 3AL6A 2ZJPF 1J1TA 4C2UA 4I3PA 1QNTA 1OSGA 1JY3N 4P9WA 3UGHA 3BALA 3VDDA 3I71A 4YFXF 1D7MA 4CDXB 1Y9MA 3CCEP 2EFOA 2ZFUA 1W9FA 5CB7A 2XKPA 2ZX2A 4NIIA 1XMXA 3MUDC 2OA2A 1TQPA 1CAUA 2IRFG 5GLZA 5J6XA 4AFAA 5LBEA 1PX3A 3M0DC 2IBZD 2AQEA 2VNGA 4XUPA 2V26A 1RMU2 5A32A 1LOAA 2FMYA 2LXCB 4ASNA 2E5YA 3F2ZA 1I6XA 1BIAA 1BMV1 4DIQA 2P7VB 4MNUA 4D5CA 2R5YA 1ZBA3 4BACA 1RE4C 1F5FA 3M2MA 2DT7B 2KRHA 3QH9A 5ACA3 3Q8FA 2DDBA 2DFEA 2VH9A 3WDUA 2XF6A 4XLPF 1BK1A 2BHZA 4ZU7A 4U0YA 3KEOA 1A31A 4XBNA 4OGQB 1R1A1 1CIYA 2W39A 1ZP0C 3WW4A 4FO9A 4MFEA 4M6YA 1RRJA 3CPWO 1I5ZA 2R043 4ZHNA 1M1JB 2XUMA 3T0AA 5D4RA 4K8FA 2I2SA 4N43A 1EJ9A 2O0YA 2NRAC 4BJTA 2KI7B 2RDSA 1SEFA 1W2TA 1TZLA 1Q43A 1ZZ9A 1JTZX 1JOCA 2VTXA 5HS9A 4DOZA 4ENKA 5IW0A 2DMTA 3WW2A 4HYTB 5EJ3A 4JKLA 1XE7A 1R6RA 4XAEA 5FLJA 3V8JA 2GMPA 3J81K 3MPBA 4YM1A 3L74E 5F32A 2WSUA 5E3OA 5FZGA 2M8EA 5EJCA 3IKWA 4GB32 2X0LA 5C39A 1XJAA 4S2HA 5AVXB 2R7WA 3OYWB 4YYOA 2EFPA 3OAKA 5H2FE 1ULYA 3DYPA 2R7FA 1PIV1 3EPZA 2BFUL 5C8CC 3BOPA 2D98A 2XNXA 5FY0A 3QD6A 2VPLA 3BZCA 2DO7A 4U0WA 2YHJA 4PFPA 4LE3A 3G4SP 2Z9OA 4AVVA 2EIEA 2FCUA 2WV1A 3T8TA 2K1AA 3QP5A 1YQ2A 4LKSA 3WUCA 4KI5M 1WMXA 3H1KE 2HWB1 2CK3H 2G19A 2OCCH 3K5BA 4DB5A 1RIOH 1WLCA 3SXYA 3QPTA 4MTEA 5AC91 4N78D 3FK6A 2LTPA 4RLQA 3RYPA 5EV7A 1KFUL 5SV8A 3WHBA 1W04A 2ADDA 3PJRA 2WFF1 2P3JA 4EN0A 4UBGA 3NL1A 1QEXA 1UZ0A 1ONVA 4AHYA 3KHCA 4OMYA 3A5TA 1URXA 1FSEA 2VB6A 1Z9CA 1VBA1 3OSGA 1IPSA 1GU5A 1IO4A 1MZ5A 1YG2A 1ZLKA 1H1AA 3B5NC 2Y6JA 4D0QA 1V55H 1UU6A 4PD4H 3H1JE 1PP9E 1X9PA 2LVSA 1OURA 2JQ7A 1MPXA 3T09A 2QQPA 2R30A 4CDQC 4HPQA 1NUKA 2RKHA 1E5HA 5FKCA 1P84I 1HRI1 3HUGB 1QHGA 1O8PA 2E43A 4AU7A 3CMMA 3V2NA 3WU2E 4HKLA 3S1RJ 2V4HA 5LEKA 1BR4A 1OCCH 3VDAA 2FCVA 3SFDC 5FYHA 3A0HE 2GC0A 2RHPA 2JRMA 3E1F1 3HPGA 4ES9A 2F4LA 3CCSI 5L9BA 4AI8A 2FOWA 1R23A 5FMBA 3I5CA 2G7UA 2G3AA 3PNAA 5K5OA 3R05A 1LGHB 2ATFA 2PHFA 3OR1C 3D4KA 3KEQA 1EXJA 5DZGA 4RS5A 2IXKA 4YW6A 1T98A 1L4AC 1UXXX 2IFNA 1PO12 3L70D 3RZLA 3RTRA 3PLNA 3AC0A 3GTJJ 2X85A 3KF5A 4Y26A 1SQPE 4WB4A 4GJYA 2ECBA 1T3UA 4Q1PA 2KSJA 3FHQA 3PFYA 2XB5A 1CF7B 1VQ7P 3O1MA 1VQ4P 1DD4A 5FWJA 2VQTA 4I98B 1U5ZA 3EDPA 5GTIH 4AVAA 5JSOA 2ES3A 2JE8A 1FU1A 2QQUA 2EZKA 3BPZA 1HWTC 1BDCA 3ZYGA 1PFIA 5K0UC 4M3EA 5HLIA 4OMZA 4UHTA 1PZ7A 2OGUA 2VM9A 3CWBE 1JHFA 4WXDA 1JT0A 2VE8A 2W48A 1K04A 3JSOA 3V4QA 3AMMA 4G7HF 5DUVA 1ZV8A 3MLLA 1W36D 2O8OA 3WCSA 2K9LA 3BTLA 1YITP 3GBWA 2LG4A 3A0NA 1PV3A 1W5CC 5L3FA 3KQRA 5C3EJ 4P55A 4OHYA 1O59A 1W8FA 4N53A 3KV4A 3HOXJ 4FHTA 2YXRB 4CICA 2YX4A 1LGBA 5CNAA 4XJ9A 1ZA4A 2JG9B 2QQMA 1POV3 1LT9C 1BBYA 1HF9A 1NCQA 1YIJP 4FOQA 4XC9A 1XTCC 4MG2A 2E53A 5J4VA 3PURA 2GSYA 1JMUB 3GTLJ 3ZXLA 2R072 4ZU5A 1AYM3 5D8LB 3INAA 5JOYA 2PJPA 4QAWA 4B47A 2IBDA 3TF5A 3NJZA 1G8WA 2CUFA 2CAVA 1I3AA 1OPCA 3GYHX 1SQVD 4TV7A 5DG1A 1TT0A 2NOJB 2VT2A 1O91A 2VKHA 3HRSA 1TG7A 4FQZA 1S72I 1R64A 3OGSA 1QZZA 1JYWA 2X53S 2HOEA 2ID4A 4ZYHA 1H0MA 1Z7LA 5J4YA 5I0UA 4CSWA 1X1CA 2NNYA 3PQKA 3HTUA 3KEYA 2XLFA 2FBKA 2MLKA 1OCOH 4HBLA 3CDIA 1K83J 4IQ4A 3U1KA 5FZLA 1JGSA 3C8XA 2WWSA 4YW1A 5C71A 5FJ8J 3S6PA 1KQ8A 1SCSA 3BTJA 4HL0A 1BOBA 2QZ8A 2WT1A 1A04A 3VN4A 2VBZA 2ZA9A 1UU5A 2XVKA 2B87A 1J9IA 5J7MA 2UUZA 1VTNC 1ZN2A 3DXJF 5KLIB 5A7WA 4FOVA 2KS1A 2Q1ZB 1CQTA 2EIJH 2Q9IA 3M4OJ 1ZZBA 4UV8A 1Q8VA 2CRGA 3O14A 2DN0A 4XTMA 1R081 1RUJ2 2JSCA 5KHDA 4CP9A 1OVPA 3JBG3 5JFRA 3RMXA 2MSYA 2BGPA 1SVLA 5F1RA 2XONA 2K88A 2OA4A 5TISE 2OPWA 5M3MJ 1UELB 4BXFA 4AXOA 2DYRH 3GHGC 1W6MB 1H4HA 2HFHA 3ZN5A 4XM3A 2VZUA 1AR61 1BE3J 2EZIA 3LEIA 3I7DA 1JT6A 4FTEA 2X10A 2K3RA 4R8HA 2VNOA 3L70E 3ACIA 1LFUP 5FJHA 1W6PB 3V0AA 1N7SB 3SEEA 2BCCE 1M57D 2J7MA 4IL7A 4BOWA 1O3TA 4XILA 1SLBA 1TNTA 2YV8A 1Z05A 1OA4A 4ENMA 4J1WA 3MIWA 5JLWA 1YW9A 4FPYA 2PRRA 4BQ2A 2A6EF 3H5AA 3L72D 4CXWA 1YJ9P 2AS5F 2P7JA 1RH5B 2HWE3 1PO22 3CX5D 3OYIA 3BN6A 1W03A 1WCDJ 2ZGKA 4KG0A 2R061 3HOYJ 2GC2A 1S0BA 4EEFG 3FBYA 3M7GA 3NAPC 5C4WC 2VKVA 3ZR6A 4PBOA 1DQ6A 3ABUA 4EDFA 1YI2I 1EXIA 2FY8A 3L2QA 1AR72 1GL2A 4XIDA 1ZVFA 1KJRA 4H0LB 2R5ZA 3KX2A 1UMZA 3BROA 3LPFA 3MFAA 2BUKA 2E35A 4AIJA 1RUI2 4RR3C 1LE8B 3ELNA 5JVVA 4HK9A 2DMQA 1MVEA 4HG6B 4M01A 2EAAA 4JX4A 3E7LA 2DURA 4JTNA 1ON1A 2W25A 2P58A 3WINE 2W95A 4NDLA 4NC8A 5F3CA 2RDPA 2Y38A 2B8MA 1I6HJ 6PAXA 3ACHA 5KHIA 3GZEA 4XK4A 4BQ5A 1V6NA 3F8FA 1QGKB 2B4KA 3V7SA 4JYKA 4Q4X1 1R4NB 4JBZA 3DCFA 1FS0E 2O3FA 3WEZA 1LTJC 1BEV1 3HHHA 1R7JA 1VR3A 2GUSA 1PVC1 2CUEA 3P6BA 4BB3A 1J3RA 4AI0A 3MZHA 1E2XA 3PL8A 1GWMA 2WYSA 3UK9A 2MHFA 5M5YJ 1WH7A 2IT0A 1DGWX 4PF1A 2IA1A 3HOUJ 2WITA 5AW6B 3PQJA 1BKZA 3SNMA 1V6OA 3DPRB 1O57A 3W3CA 4JZRA 1T2KA 2BEZF 5DZFA 3K69A 3WP5A 1K6YA 1XS9A 4ZTFA 1MEC2 1HRV1 1ZRIA 4FT8A 4X6RB 1U5TC 2AEYA 2WSEH 3OYLA 2ID3A 1U78A 2IEKA 4TZDA 4XMYA 3LA3A 3QCWA 2JT1A 1J2JB 2O9LA 4K40A 3A23A 5A3UA 5KWRA 5AW2B 5L3CA 2CW0F 4IGOA 3ZYJB 2M5WA 3HL2A 2XPJA 2M4KA 3PVNA 2NVUB 4ZDOA 1MQTB 4H13C 4HXCA 2HGCA 3HBKA 1W9SA 4DS0A 4WBAA 5HDKA 1QJY3 3LSTA 4HW0A 1KYWA 4P5HA 4AR2A 3VKOA 4BDYA 1P7JA 1STZA 4RD7A 1VBD2 3VFZA 5LGUA 4LPLA 4Y7NJ 2XAUA 4QDQA 3GVAA 2XRNA 3O8HA 4A12A 1FOD3 4WBBA 2H89C 1R1TA 3PTRB 3R4KA 4V2FA 4PT6A 4RLFA 2FSWA 3K4ZA 4ZS2A 1QGLA 3V8KA 3NNJA 1W8NA 1U6GA 1O4YA 1AR83 3L35A 1X4OA 1R1UA 4J6GA 5FYMA 3S57A 1XYPA 3ZVXA 1W2BO 2JDAA 1XSDA 4X8NA 2YMZA 3ZGKA 5FRMA 5FUIA 1ZELA 1W6MA 4LBQA 1UX6A 1PJRA 2FYNC 2BXYA 1R58A 1B6AA 1POGA 4P96A 2N9YB 1DYOA 1R00A 2UWBA 3AP7A 5KC5A 5TRDA 4Q4Y1 5EF6A 1JU3A 3ISPA 5DJTB 4ZNCA 3OYEA 2BW8A 3C2BA 1YI7A 3H1JJ 1UPIA 5ILSA 4QU1A 2WZR1 2OC6A 3S2HJ 1NA1B 1F9KA 2XLGA 3HYIA 3GZNB 2JDKA 3LCPA 2I8DA 4P9XA 2N1TA 4HNTA 5DEQA 1X22A 4KU8A 2K4JA 5LCWL 2JG8C 2JRTA 2JG9C 4BDVB 3AE8C 4QHBA 5GTIE 1GNYA 2HEYF 4GOFA 2M3BA 1PO21 4OVNF 1FOXA 3PUIA 2W87A 4D6QA 1L4AD 4DNYA 2P67A 3CMGA 3G2BA 1FATA 4MQ9F 2AENA 5CBNA 2DA5A 5L9VA 4YFNF 1JKRC 2PAEA 1A34A 5IT3A 5FPAA 5K7FA 2LBFA 2OPKA 1OVSA 2FDFA 1XGNA 2WA4A 2RQPA 3F8NA 4DYCA 2IBZE 1H0TA 2QJPC 2V09A 4DOUA 1SLIA 2VZQA 4QQPA 3N7LA 4ZZ5A 4BQ3A 2WPRA 1OT5A 1PPJG 1QJU3 2J1UA 3II6A 5K5QA 2IYPA 4OIRF 1VBC3 2CQKA 2GNBA 2WB1A 1MR5A 4Q0UA 4IV1A 1WCKA 3UYJA 1D4M3 4RQPA 3THCA 3AMQA 2VUCA 1LTTC 1PGPA 1TWFJ 1HDKA 3AKZA 5CCHA 1SFUA 3DXTA 5ACA2 3O1SA 4R52A 4P08A 4DZJA 2W68A 3C18A 2Q6QA 4ARXA 3L75G 3H1LG 1IQDC 5BY5A 2K4BA 3X29B 1OH3A 2F5VA 5F08A 3CC7I 1UO9A 5E3MA 1A02J 5A3MA 2PHRA 1NKGA 1MZ9A 3SZTA 3I59A 3D6YA 1YYCA 1C1FA 5A33B 5E18F 1T0FC 4EM2A 3I0TA 2HWE2 3E97A 5FZ3A 3PIPF 1SQVJ 5BYNA 1JM0A 5C70A 1OVUA 3PUFA 4P02B 4M3LA 1S9HA 1SFPA 1MMDA 4LLGF 2PHWA 3AZYA 3FM5A 1FBSA 3UL2A 5FPXA 1LHUA 5ANQA 3ZN1A 4LA3A 4Q5OA 2YU2A 4O5VA 5FRAA 5T5PA 3N35A 3CNAA 3BG7A 2LR8A 2D2WA 2X1DA 2QKMB 4AFCA 2AO9A 2HODA 4QHZA 1OPMA 5H6RA 1FYMA 2E34A 3RQ0A 5IVEA 4NC7A 3WTVC 2VJJA 4EOTA 1KS4A 1Q1HA 2PAKA 3JQWA 2KISA 3NWTA 4PIYA 5DN2A 2STWA 3NV1A 2ZEWA 1V3FA 1CPNA 5ICEA 4S2FA 4UNOA 2A70A 3RRDA 5CKNA 3N36A 1NTMD 2A68F 2EA4A 3U1DA 2XPVA 1S2EA 3RZJA 3VB2A 1VE0A 3CCSP 1BEV2 4BQQA 2ZABA 4A3ZA 2K7LA 2Z99A 1XE0A 3PSIA 5D1IA 3SMHA 1Y9BA 4Z2AA 4D7NA 2C9NY 1SFYA 3F0CA 1OC1A 3W5NA 3FF5A 5BOXA 5LHHA 1KQFB 3JTGA 2MKVA 2CFXA 3ASOH 4BQ4A 4ORFA 4GWNA 4RAGA 4EGZA 1IFJA 1EAH1 4JCKA 5GZFA 4EWEA 2D97A 2WT0A 4LQRA 3U07A 1IXSB 1KFNA 5ICGA 4XONA 2X1CA 2WWYA 3D0JA 1NOHA 1JZ7A 2FDKA 5F3IA 2Y31A 1OXCA 4QGLA 4DBQA 3S1KA 1AA0A 3N9PA 3N4XA 1OZHA 3V7CA 2A5ZA 3ALQA 1OVVA 1SQBJ 1GVDA 3DU6A 2LS6A 2FHRA 4L74A 2D45A 4BMEA 4NJ4A 1N7LA 1ASJ2 1DGWA 4A6OA 3FMRA 2K40A 3H1JD 3QWLA 2WZPP 1EUTA 5FB2A 1X4PA 1ZG3A 1YW7A 3KXDA 2ARCA 3OOUA 2YS9A 4L9BA 1WI9A 2J59M 1WVRA 4XE5B 3KB5A 1E0EA 2YBPA 4GXOA 1LESA 1G4DA 2V1UA 2RS53 1JY2N 2XLAA 3H1YA 4PV1B 3VKNA 4LFUA 4OZXA 3ROUA 3ZXFA 2WL1A 3ZXKA 2AHQA 1AU7A 3VBHB 3S8PA 2VZTA 4Q4Y3 1NTZK 5AVYB 3LFUA 5L3BA 4IL6H 3MAJA 3VD9A 1ZTRA 1OMIA 3BTXA 1K3IA 2Q30A 1VQNI 1UX7A 4A5MA 2BASA 1HBXG 2KA3A 1AR81 3H1HG 4ZDPA 2E36A 2WTYA 2ISZA 4HV5A 4XKWA 2ZX0A 4IHVA 4WVVA 5EDNA 2PI0A 2DFFA 4NAMA 3VYIA 3P3NA 4ESFA 2Z69A 2P2UA 1LDDA 1W8TA 3I2OA 1FZPB 4CDUC 3OYCA 1SQBK 4PJ0E 3KS7A 1N3OA 2BYVE 4A3GJ 5BNNB 2E33A 2VECA 3VTPC 1BYHA 1ND2A 2EJRA 4RA0A 2DFIA 2ICWG 3SH4A 1VZ0A 4EJRA 2BCCG 2A5YB 3MFCA 2FOKA 3PM1A 4CCKA 2VC0A 1QH7A 2EXKA 5KLVE 2NAZA 4EM1A 2HR3A 1N2DC 2FE3A 3IP4B 2DVDA 1MZ6A 1HV1A 2DA6A 1W8HA 2VIXA 4M71A 1RF1B 4WY4C 3OCPA 4M4PA 4RAFA 3I2JA 4MO3M 1AYM1 5ERLA 3TEYA 2L9LA 4EMSA 2AXTH 2HYXA 2YO2A 5DD8A 4G12A 2ACJA 2QKLB 2E2JJ 2O14A 2JWPA 3HWJA 4WM7B 4HNVA 1D0HA 3C7HA 4META 3BOQA 4Q2FA 3TEZA 1QHHD 4IRHA 3H3ZA 2AREA 4Q8KA 1XGSA 4GKYA 1B9NA 4ZJZA 2ZGTA 4ZYAA 2R7TA 3HOBA 2A6VA 3HT1A 2ZKZA 1D4M2 2CHHA 2RMU1 3I3BA 5IVFA 3G71P 5A1LA 5T50A 4OULA 1H8AA 4B48A 1K12A 3LSGA 4HG2A 3RZOJ 1GZTA 4UB8C 3WMM0 1REEA 2A73B 1DEBA 1K05A 4KT6A 1HTLC 4CYCB 3SSUA 1FSHA 3ZYHA 3NFQA 4LK6A 3TNPB 1BR1A 1J1DB 2TNFA 1Y1WJ 2ETEA 2W52A 2HEVF 5C9AB 3KLOA 5FZ1A 2WY7Q 5B2GB 4YVSC 1DQUA 1BMV2 4XOGA 2LM3A 4GCVA 2CL2A 5CBOA 5C5TA 2XAQA 4DXZA 4QB1A 3CJTB 3NMDA 3HEFA 4U3FJ 2OZJA 1QXPA 1SQXE 1AJKA 1W8ZA 1MJ9A 1DIWA 3A4CA 1RVF2 1ZX5A 1PK6C 3BT9A 4K1ZA 3N05A 2VQAA 2FX0A 1AX0A 1YJNI 5D8AA 2WSEJ 2A6ZA 1GL2D 3K46A 2OVUA 1WUVA 5GZDA 1DGRM 2WIIB 5T5JA 3H9GA 1N73B 2PTMA 4Z92B 4L8QA 2ZMEB 3QWOC 3KDPB 1UY2A 2W90A 2N8GA 2BV6A 4I76A 2NVTJ 2Y0DA 1IUYA 5LATA 1W90A 2A7AA 3AJYA 3A21A 3AFKA 2L7MP 3HT2A 3IPVA 3JD73 1S29A 3BC8A 1S4XA 1ENXA 5FZ0A 3P9IA 1NH3A 1NHLA 2GA2A 2FDJA 3TGUD 4H7MA 2FQ4A 5HNHA 2QBYB 3CCEI 1LTAC 3VPRA 5HODA 4FPOB 2E42A 3FFZA 1G9FA 1RHI2 5D2AA 4HLYA 1RUI3 4PCQA 1SQPD 5FIXA 3OUJA 1YQAA 1R083 4Z1VA 2JJ7A 5KAIC 2HWB3 4ZXEA 1S5LE 2BPA2 4XLCA 1EAH3 4GQ7A 3CZ6A 1JKOC 3FFQA 4LB5A 2GU9A 2VCAA 3GMEA 2CV1A 2IFMA 3FMQA 2BJSA 5JOXA 4HNUA 1OA2A 1IDZA 1AV1A 1QVGO 2QCSB 2VZPA 2JUGA 2PX9A 5AW1B 5CJ4A 2XIGA 2FZ2A 4AFDA 2VE1A 2XKMA 1DQ5A 1P84D 4GYIA 5H20A 1KB9I 1OCZH 2J5UA 3M1CA 5A6QA 5FD5A 2JR8A 4QX1A 4URAA 4CUCA 1U9OA 1FX7A 5FZ7A 3ECQA 3AAFA 5DUKA 3GZ5A 2QA4I 1MBHA 3ZXSA 3NJVA 3PTYA 1PNGA 2C0ZA 5IT9Z 1BC7C 2E7TA 5KTBA 3H1KG 4G94A 3MTUE 4W97A 4YW4A 2BRTA 2WQZC 2DVBA 5HLGA 4LD5A 3M06A 1V0AA 4UFIA 2JIJA 3QU6A 4CCMA 5F04A 1VBE2 4FPGA 5E8GA 4WXHA 3HIFA 2WAQN 2UWAA 1OR7A 5CFDB 4ZXKA 3CF2A 4B44A 1XQNA 3O1RA 3PUQA 2FXMA 3MV11 3G6JB 2R041 2VTFA 2GZWA 1CAXA 1IXCA 3WU1B 1BCCE 2ILMA 5KXDA 1QNYA 5T54A 3H1IJ 1ZOYC 5JSRA 1U2WA 4COVA 1KQLA 3ECOA 5KAFC 1NTZE 1VIWB 2W5FA 5FPVA 5C9AA 2X09A 3JXSA 2IP2A 3GCMA 2PHDA 4EZHA 1NTKG 3NO8A 2HG5D 1H8TC 1FPQA 1T6BX 4ZONA 4DT0A 1RUC2 1SQQD 4YM2A 1OD3A 3WTSC 2IFRA 5ACA1 1MJAA 2HU9A 2O01N 4C30A 2JDHA 1AA7A 3WUUA 4Q4X3 1P8JA 5K0UB 4H7LA 2CAUA 2E1OA 3FXOA 1SG3A 5HXVA 5EEAA 4HANA 3K2OA 2WYFA 1FIAA 1LNSA 3NV4A 3CI9A 4FCAA 3WV6A 5APTA 3I3DA 1JUSA 3TKYA 3O2PE 4FQGA 4FTHA 3TL4X 1EF4A 1RUJ3 4OGQC 2EZHA 4HOBA 2ZGLA 1FYUA 5DJUB 1W06A 2RS12 3VBHC 4QPOA 1ZAOA 4KN7X 1E57A 1D4M1 1RUF2 1VMFA 1ZYBA 3NV3A 2FUG2 1IO2A 1MBEA 3P8CE 2XL9A 1UOJA 4DQAA 2Q1MA 1B4AA 4TN7A 1GHCA 3S2DJ 3U14A 5AVZB 1W5TA 3Q5RA 3SXWA 1H2MA 3V2QA 1URQD 3ZQIA 3T8RA 1IF1A 1KZHA 4F52A 2PXJA 4CCLA 3AFGA 2HPCA 5B66E 3DEMA 4YGBA 4PBPA 1M1KQ 2W94A 4CCDA 2KD7A 4OCTA 1YX5A 1VQMP 3DLLF 1S0EA 2L5QA 3O3KA 3KZIE 1S6LA 4PJJA 3I3LA 3ZMUA 5A3LA 2Z1DA 5CCGC 1BI2A 2Z5UA 1K8AQ 4BM8A 1NAYA 4RYDA 1N3QA 1JUHA 4WY4B 2VPVA 3PNVA 3H6PA 3GLMA 2NM1A 4M00A 3MIEA 1YLFA 3VBRA 1HRI3 1WJ5A 1PIXA 2DCTA 2H0BA 3C9IA 4M0HA 3H1CA 4PUSA 5EFUA 5HOOA 1RYYA 3MGUA 1FZCC 3RYKA 5L19A 1J0RA 4Z2WA 4KUMA 4L97A 1TNFA 4AVBA 3RJRA 1RC6A 1IXRC 3I2HA 4F3QA 3A4UA 1VQOP 3E6DA 1OQEA 1XNAA 2J42A 4U3FE 2W85A 2DCYA 5FZDA 3I2KA 2FZ1A 2WAAA 4KGQA 1XE8A 2WAOA 2FBHA 2DMUA 1ZARA 2P17A 3CESA 4L9TA 2R7UA 2MEV2 3Q1MA 5JZGA 2DW3A 5HLHA 5JVGF 3AEDC 3GM8A 3E5QA 4AVZA 4QU2A 4A41A 4IZZA 1XSXA 3K3NA 1TQMA 1IS3A 3OGJA 1WGXA 1ZREA 2B7EA 1NU1G 4FP3A 1GWLA 2B5HA 3JCIA 4XSZF 3OEBA 5CEHA 1V4RA 1XCBA 3BP8A 3CZUA 3DF8A 1VBB1 3VBUC 2PQQA 5C8CA 3RI9A 4FX4A 1CESA 2M7AA 4A3EJ 2PHLA 4MGYE 1BK0A 2UYAA 2IX7C 5F2WA 3H42B 1KDKA 1TME2 3M8EA 2ZMEA 4KDPA 3FXRA 1PM7A 4CXFA 1OKQA 4N7UA 4JC1A 2JVHA 2KIMA 5J1UA 5K5GB 3L75D 1C5HA 3MVPA 1D8JA 2QVAA 3D3AA 1WBLA 3O1UA 1A02F 4N7IA 3LQCA 3MZ8A 4XE9A 1Q7YQ 1ZBA2 2K37A 2QUFA 3M07A 3GW2A 4R79A 4M73A 4LE4A 4XBLA 4Y15A 2WO1A 4O9EA 4ZZDA 1L7QA 1IN4A 4GMP3 4C7NA 4BIFA 3WTTC 1EAH2 4GB31 2XDVA 1T39A 3CMEI 4OHVA 2XSJC 4EN8B 3W6KB 1UY3A 5BS6A 4Q4X2 5FKNA 5DM7F 2D5VA 5KLVJ 3OIPA 2D2CC 4C9YA 4Q0VA 3KZIH 1BEV3 5IPAA 4CCJA 3GG2A 4BYYA 3LIDA 3NKTA 1KQGB 5KR7A 2SLIA 3I53A 1T08B 2W57A 3T3YA 3CXHI 4M9ZA 4XABA 5KJ7C 3DWLE 4TLGA 3SJMA 4CTEA 3PJQA 3QH6A 4QKNA 1KZUB 4MYEA 2HQ5A 5FBJA 3TOAA 5J3LA 2AZ5A 2RH0A 5EHDA 2X05A 1J58A 4AWXB 3GWZA 4AAPA 3G73A 4YVWC 4RGGA 3L75E 5EYRA 3POIA 4IEXA 2V79A 5FO9B 3ACGA 3ELKA 5FMDA 1EH8A 1HUCA 1BC8C 4RA2A 2OQRA 5LRRA 3T2QA 3GF2A 3SWFA 4QPWA 3MKYB 2EK5A 4BWNA 2O1JA 4IF4A 5F39A 2AXLA 3TYJA 3SC7X 5KC6A 4KG8A 2UYBA 1ETOA 5AW0B 4EJVA 3WNOA 5D4SA 3GALA 1MS1A 1VDFA 1YWKA 3O0WA 1KYOE 1FZCA 4PJLA 4INDA 2E76D 2BWCA 3H0OA 1BGYJ 4KL1A 2A6WA 3FN9A 1QZEA 1NA1A 2PLYA 4QMAA 3BIEA 2NPSD 3PVOA 4ZKPA 1A3KA 2BY2A 3BR2A 5H6QA 1O5LA 2X6WA 1JGGA 2KUBA 2VNVA 3IM0A 4E7HA 3DKQA 5A3PA 3HQXA 1W9YA 3U21A 4XF3A 3JRDA 5KLIC 4MGIE 3RJ2X 4EROA 4BK4A 4JPZB 1DH3A 1QJU2 1MSEC 5HV4A 2Y6KA 2Y60A 4E6KG 2JA5J 1L4AB 1VP6A 2D3SA 2VKDA 5FZOA 4TLFA 5CPRB 3TEDA 4I2OA 2A6YA 3UGGA 1HB2A 1G2CA 2PFXA 2WAEA 3TO6A 4ARYA 4DUWA 3RQIA 2L5GB 3GNEA 2I1JA 2Y2ZA 3EUKL 1JH5A 4G6QA 3EB7A 4QPGB 3RBZA 4IDZA 2KIUA 1SD5A 1H6YA 1LTJB 4LHNA 2DPDA 2WSVA 1N1SA 4UB8H 1UF2C 2BW3A 2RS11 2L4AA 2A6XA 4HK8A 3OWTA 1VQ9I 4CZSA 3MHVA 3L4FA 4LBKA 2Q2EB 3HE4B 5IYDJ 1KILB 4KT5C 1HSTA 4KGGA 3SQOA 3UKGA 5E6HA 2R7QA 5AFEA 1NCQB 4EN6B 1OHFA 5D5UB 3OYHA 3L1PA 1BJQA 1L0NJ 4ZZ8A 2F5FA 1LEAA 5GLVA 4EI2A 5IAVA 4FPHA 1K73Q 2O01J 4NOTA 2EV5A 2QM7A 3OPZA 1YUDA 4RM2A 3GZTB 5CVVA 1NTKD 4R9BA 3LSEA 2FYUK 1Z67A 3BCCJ 3KQ4B 2IXLA 1STMA 3ILNA 3SCHA 3ILRA 1DU3D 1MJBA 4RM3A 2WPVB 4OI1A 1PGL2 3HXLA 5AVPA 3LKJA 2M45A 3DEUA 2ZJSE 1A6IA 4DRVA 4QKFA 1FMVA 4QB2A 1FZEA 4KWJA 1A35A 2XGEA 3KYLA 1W8UA 1BW5A 5TSWA 3CC7P 2B9BA 4XQDA 4FFFA 1PGJA 3PUAA 1LCLA 4CVUA 3UGFA 3L2UA 3ES4A 5DTDA 1NTME 2OYOA 2M3EA 4BIOA 4JGYC 2NVXJ 2JDNA 3ABMH 3NMBA 3BU0A 2XL7A 1U5TA 1ZH5A 2WA0A 5JHUA 1XG1A 3P3PA 1T8IA 3BTYA 4OWRB 4P9JA 3ZFFB 2HYJA 1LHNA 4JGZC 4MXVA 3V4GA 4LGWA 2WNEA 2CW8A 1SQQJ 2A07F 4FPFA 3BTCA 3QPSA 3MDPA 2VBDA 4DUVA 1RXFA 1BI0A 1W6NA 1FYKA 1HSJA 3I2FA 3T1MA 4FE7A 2RDNA 1H0BA 2W6AA 1Q5OA 4XXAA 1Z77A 5CVRA 5B66C 4JF7A 2X6OA 4K21A 1X58A 4IKFA 5D6EA 2XJQA 2XR4A 2BVMA 3GDBA 1MEC1 1W39A 4LBOA 1NLSA 3ABLH 2E75B 1F43A 2DVFA 3V64A 2VONA 3FUOA 2W1UA 1WI3A 3AYCA 2O7OA 3BZKA 3L72J 3AKQA 1XOYA 2UY9A 4IGQA 3FGAD 3USUB 2GNMA 1YFWA 1X36A 5EGOA 2W3JA 1B59A 4NO4A 4I6ZA 5FZ8A 4XAAA 3F6OA 3Q9SA 2FCTA 1OOPB 1XNKA 3HC7A 3HOZJ 1RF0A 1PGW1 2DWRA 3VMZA 3BG5A 1IAWA 5FZOB 3GTOJ 3C2UA 2DK8A 2E31A 2TRTA 2VN2A 1RE4A 1FZAA 1YQ8A 4XLHA 3NV2A 1WD3A 2FDHA 3NAPB 2BXZA 4Y99C 1W0NA 5D8AC 3GFIA 1ND3C 5T3NA 4A0YA 1J1EC 3SYTA 1J59A 5T52A 1IOAA 1Y47A 3TMOA 3FX3A 2N1TC 5IAXA 1CZSA 1VBA3 3AKPA 4EM0B 3DQVC 3Q3SA 1QJX2 1RUH2 2NYXA 1ASJ1 1PGL1 3FXKA 2DA4A 2YU3A 3OTFA 3HOSA 3TBDA 1GUUA 2VZSA 5DZEA 4I02A 1COV3 2M4GA 3FKIJ 2YFZA 3TGUE 1VQ8P 5H9PA 2OS2A 2QBYA 5CJ9A 1JXSA 1U12A 3Q9OA 2L2OA 1IGNA 4Q4V1 3TGUJ 2R062 1EDIA 3ZXGA 1UG2A 4BQ1A 2UZKA 4Q8LA 4QQHA 1ST8A 1S0DA 2VTXJ 4EWDA 3H1MA 2ZMEC 1F2NA 1KILD 1GUIA 4COYA 4AGGA 2VCBA 1K45A 1MD0A 1JHNA 1XNTA 4AQTA 1HCRA 3URFA 2BBYA 1ZZ8A 1PIV3 5EWSA 2GP3A 2FNPA 3ZQFA 1I1SA 1FZGA 5A3NA 5FMCA 4AFMA 3GTPJ 4GXLA 2LDUA 5KVRA 4XFGA 1TVGA 2W7NA 1CD3G 4KNCA 5GAHJ 4XZUG 1HW5A 3RL0C 5ERIA 5J1RA 3U0ZA 1SBFA 4IQPA 1K78B 4RBOA 3JD72 2ZYDA 4YTPC 2IFWA 5FQ0B 4S0HB 1YFXA 5A1FA 4OYUA 5C3RA 1D0ZA 1SQBG 5FZFA 3MFKA 2RMU2 2JX9A 1W0OA 4UOJA 4L5EA 4LLOA 1NCRA 4OINF 3OBTA 3HOWJ 1AVBA 1VQKI 2QVSB 3MUZ1 4FVVA 1SAXA 3AM2A 2MC4A 1R22A 5K9YA 4M3DA 3WE2A 1D3YA 5FOJB 3F9KA 3GLXA 4HB1A 3IB3A 1SLLA 3ZQGA 4NBQA 1QQP2 4AC0A 3LQQA 1POQA 1RB8G 1VQNP 3BGAA 2HTJA 3PLQA 4KIBA 2ET1A 4BUPA 5CVIA 2R0HA 4JDMA 2VW2A 1RKTA 3CCYA 5C4JJ 3JAMK 3B69A 1UZZA 3IH4A 4D0PA 4EJWA 2YPJA 2HZTA 3ORJA 2E76B 3HRTA 3FWEA 3U1CA 1B35B 4DGWB 1XSRA 5IK7A 4IETA 5F6KA 5JLVA 1B35A 1PGOA 2WSSH 3KPHA 1HW2A 2Q1FA 3J80K 2DCJA 2R16A 2ME6A 1ZMEC 3CWBG 2P6SA 2B39A 1K9MQ 2FKWB 1QQP1 1DP3A 1DU6A 5F7UA 3DL3A 1SLAA 4B4CA 2ZO4A 4RSUA 2FFDA 2I07B 3I58A 4Q4W1 1IK7A 2A6HF 4XFJA 1N78A 2VZ1A 4BY1J 5EXOA 3K7AJ 2ZAAA 4YGCA 1SQVG 3NTNA 3H1HE 1TWAJ 2XROA 3K1MA 2QEXI 1BXHA 1AVYA 1O8SA 5BNOB 1ZKGA 5CVJA 3FBNB 5GTHH 2OT7A 4PV1D 5DDJ1 1WLDA 4QM9A 4GGGA 1NZIA 1VF9A 4D6TD 4I2LC 4DNCA 2OIIA 3WG2A 2PAJA 4UAPA 2MC3A 5LWBA 1U5TB 1TZOA 3K70C 2RR13 4OVEA 2O5RA 4ATEA 4HJGH 1URQA 1LECA 4Q4W3 3GX4X 2ZT9C 4NRQA 1DBNA 4UFMA 4E4HA 1IK9A 1ZRTD 4PD4E 4C1WA 2W46A 4MEYF 4HOOA 1D1AA 5C3PA 5KLVG 3ZIWA 2WV0A 4KITB 3OSFA 3ZIXA 3HE5B 3KLNA 4EYUA 3DP7A 4XDOA 3VHNA 5AC92 1Q81Q 2E60A 1O4ZA 1OCPA 4U2AA 2QQIA 4Y22A 2FD8A 3PHMA 1AKHA 5C44J 4OI2A 3M3OA 4RO0A 1QWRA 3WD5A 3EQLF 2H88C 1R5ID 2D93A 4UT5A 3M9AA 2BBVA 5FZIA 4B86A 1RF1A 5H2FC 1NTKK 3HPNA 1AYN3 3T1LA 1FXZA 1R092 1QJX1 5CADA 2DTWA 3VD4A 3HUSC 3M1EA 3W6JB 1KA8A 3FM3A 1DG6A 4MHGA 2P7CB 2B46X 2WS93 4M3CF 2IS4A 3LIEA 1S7OA 1V5FA 3VD5A 4CDXC 1USDA 4M3GA 5F8PA 4Y52J 3J9SA 4CCNA 5BNNA 3BATA 3OL4A 1QA6A 3FE5A 4CXXA 5J3UA 4LKEA 2BW3B 3NW4A 1REFA 5IYBJ 1JN2P 5K7HA 1PGW2 3CJIB 1SFCA 3KD4A 1UHWA 4II2A 1VQKP 4NQWA 3HD7A 1AL0G 4XF4A 3KPEA 4BLIA 1BDDA 1FDMA 2WFPA 2P6HA 4I30A 1BCXA 5APVA 5JIUA 1MBKA 5A7SA 4O3MA 1Y9QA 5APYA 4OUMA 4TT3H 3J7MA 2JB8A 4AQSA 3KZ4C 5FTTC 3T5XA 1D5YA 1FC2C 1QF3A 1VAKA 2QYOA 2DXIA 4IE7A 3MLJA 4CCCA 1SQXG 2J22A 1ULPA 1C28A 2XWBB 2EXJA 5LA1A 4UF0B 3TOBA 5DM6F 1RUD3 2C9KA 2YC0A 1NE4A 3SFIA 3N97A 3ML6A 5BU8B 5LY1A 5CHXA 4U7BA 2KLVA 4N53C 1U8BA 1UMHA 2H8WA 1QVFO 1ZM1A 1RR8C 3X2QH 1KS5A 3S93A 4KQ7A 3A0BE 3V2PA 3MIDA 5CFDC 3L71E 3CP8A 2HYKA 4XIOA 2QJYB 1PIV2 4N9IA 2VOOA 2FA5A 3M4FA 1J1LA 2FYUG 4Y13A 1DD3A 3C3VA 4D69A 1MZFA 5JOWA 2XZRA 2HODB 1UQXA 4KISA 1WT6A 5K4LA 2RS52 3E6CC 1J09A 1KU3A 3TQNA 1NOVA 2L9RA 2DLLA 5A1AA 1H9TA 2PYTA 1GOGA 3H5NA 4YXDC 2FQPA 5CIRA 5B5EH 4KT0J 1NXMA 1V6IA 3H92A 3U4XA 5J1XA 5HLTA 1W7PA 1ORKA 4A3MJ 1IHMA 2OBPA 4BE1A 3CCLP 4XLAA 3T4VA 3USUA 1VNDA 4BH9A 5CYVA 5BNGA 1HLVA 3LFKA 3GFLA 1MSFC 1ZRTE 4L99A 4PSWA 5DUXA 1LHOA 1US2A 1Y56A 2G1MA 3LFMA 1NYWA 3G9RA 2KQRA 5K0UA 2IVJA 3BCWA 1CAVB 4OU0A 1AL21 5GLWA 1TU3F 3ZMSA 2YBKA 1NTZG 1UY4A 1UOBA 4LEJA 4Y24A 1VQ9P 3S17J 4IEZA 1G3YA 3PNYA 2VOKA 5DCMB 4IGPA 3LW5J 1IG0A 4NR1A 1YXWA 3DFGA 1MMGA 2D1HA 3MZWB 2NYYA 1ZYRF 1ND2B 2ARAA 1JMMA 3ZR5A 4OAYA 1FJPA 3IKTA 3NNMA 3I55I 3UETA 3WDVA 2A69F 4YWAA 2ZMLA 4KN4X 3S4RA 3M3EA 2ZBKA 3G1LA 1LOEA 4O65A 3QRFF 1JI6A 1PUEE 3Q3DA 2ELJA 3TDUC 1BCCD 4FSJA 1YC61 1VQ5P 3MLKA 2NS8A 1OISA 4LUKA 3WG9A 2NPSA 3JCUC 1OWAA 5FZAA 5F1JA 3LAGA 3W21A 4YARA 2NVQJ 1HOMA 1EUUA 2BGOA 2JJ6A 1GU3A 3DYMA 4HYEA 1T6SA 3DPLC 2XJSA 1QO0D 5FP9A 3LSKA 1KILE 2QQNA 4K8RB 3CCRI 1DDLA 1AVOA 2KL4A 3ZN6B 4K35A 1JYXA 2H09A 1RIRA 1PUFB 4YIFA 1MNMC 4RHV3 5F3EA 2DDAA 1IPJA 3OOXA 3BJAA 3NSTA 3CL3D 4IHSA 4RN5A 1CX4A 2A06E 2XMLA 4GWJA 2LY1A 1K7AA 1S7EA 2PJRA 2M8RA 5BNPA 5LRSA 1UY1A 4QQ2A 4OIPF 5C3QA 1FMD1 3ZFEA 2E1MB 1YQ5A 4BLJA 1N1VA 1GW4A 1RQVA 2KDZA 5D5WB 1MZEA 2KR2A 3DKYA 5JI9A 3MD2A 1OVRA 5KAFE 1V6MA 4CRQA 4KIFA 1OH4A 4NWWA 2FJ1A 2GOXB 4WM7C 4MGZE 3SEQA 4L5JA 2VRSA 1CJPA 5EYXA 3VUOA 3WDWA 3IPVB 1NY72 3AE1C 5T55A 1U9NA 1WZ2A 1BN5A 1LENA 2V1DA 3RDIA 1GQPA 1N1TA 2D40A 2F5DA 5LK5A 2V4AA 1XU1A 3E3VA 3ZYRA 1T56A 3LB9A 5JR2A 3TP0A 1TW2A 4ZU4A 2HXOA 2E74D 1LOBA 2FXPA 1IQAA 3KP4A 4RDUA 2E32A 1VAVA 3ZPOA 1JCDA 3QLQA 4LK1F 3NQOA 3RK2B 2LP0A 4HZFA 5F64A 1VQ8I 4PFOA 3WODF 1Y43B 2WNUA 3ZMZA 2D2CD 3OGRA 1N77A 3EFGA 3JAMZ 3GJAA 1DPUA 4EJOA 5E1ZB 2QUOA 2H43A 4AEDC 3CMAI 2EH3A 3H1IG 1LWUC 3OGVA 2GOMA 3I9V2 5EZWA 2SBAA 3LDKA 1JTYA 1LTBC 1WW6A 4F7ZA 1KJLA 1OD5A 3CLOA 3F8CA 3WF0A 3VBSC 3FMSA 1YIJI 3BJ6A 1M8OB 2GUVA 2FF4A 3HTKB 1Q8SA 3U37A 4ASVA 4JX5A 3WQBA 2RKLA 1SLCA 4EATA 1QOTA 2RDRA 4GKXA 5HS8A 2CSOA 3OS0A 2CYYA 2WT2A 5FDBA 1NY71 4H4KC 2QSHX 3EETA 3CMYA 1XDSA 1ZBE1 4L73A 1K5MC 4L9VA 3ZMTA 4JGYA 3T2TA 2JKBA 1E79H 3S7EA 5LW9A 4NHYA 1XTAA 4U3FG 1QXJA 4GZ9A 3H1HD 4UXNA 3UNGC 1FJKA 3I3EA 4XKCA 3WQ0A 1HH0A 5LGTA 2VXRA 5AW4B 3FWLA 3L2CA 3VSKA 4XJUA 2Z16A 2OUJA 3DKWA 3B5LB 4Y22B 1WCMJ 3EQEA 2K86A 4LLLA 5IOYA 4OLLA 4B8XA 3ZQLA 4MVTA 4D6SA 1HB3A 1SFEA 4K3UA 5FKBA 5APXA 2K02A 4QXBA 1WJDA 1NU1E 4PD4I 1AQ5A 4Q0SA 3IWZA 4UFLA 2V7FA 2XU6A 4E8CA 5BUVA 3RZHA 1KB9H 2EFQA 3GYDA 2HWD1 2D6NA 1JJ6C 2QE3A 1U8RA 4CZZA 2HBTA 5SV5A 1K79A 3GHGA 4MX3A 4DYQA 1FP1D 1ACCA 4DUXA 3SEPA 3M3CA 4XFIA 1QBJA 1JUMA 3CEWA 3HGGA 1VRBA 3CC2P 4ISRA 2WY8Q 1KEXA 2CV0A 4QQLA 3CCJI 4IESA 1GL2C 2JG8A 4Y20A 3RVHA 5JXGA 1XB4A 4BKXA 3KCXA 1QL2A 5JZGB 4PHZA 2D6PA 5L3GA 5CCGD 2Q7CA 4UF0A 1WMDA 2IGKA 2I45A 4AF9A 5E3LA 4JQFA 2JUCA 2L9VA 1AL22 4AE2A 1NO4A 3ITKA 2KIKA 4QKBA 4BHBA 2GXAA 2LC2A 4XN0A 1S0CA 3KV5A 1XNDA 2Y6GA 5F27A 2HPIA 4A3LJ 3ZMNA 3VDCA 4DQ2A 3NQHA 4EN7B 5DABA 1EV13 2QKDA 3T08A 2ARXA 3S3MA 1V9U1 3BPSA 1X8MA 2OZUA 2UV1A 4UFHA 4DJGA 1FEXA 2C6YA 2QJVA 4L9NA 1CZTA 3LSJA 2W6JH 1K61A 2JPCA 2QJYC 5EQUA 2JDPA 4CPBD 4I01A 1MFTA 2VBYA 2JSPA 1ETYA 2DT5A 1IRFA 2CNAA 1YS7A 3VB9A 2DA3A 4EJUA 1XU2A 1CZVA 4BWOA 2FXAA 1JTHB 2A45I 5ANNA 3NWSA 1L0LG 2D6LX 3AP6A 4CDUA 2JKXA 3FC0A 5L7OB 3QYEA 4V1PA 3A03A 5LBQA 4D7SA 3MW2A 1LEDA 2VUAA 2ZT9D 1GD2E 2KLUA 5FUPA 1W36C 2EVXA 5KHHA 4A45A 1HKSA 1G9DA 1WMKA 3HSEA 2AXTC 1LPQA 3RKYA 3FHAA 3WT3A 1JW6A 2LMDA 2PJRB 4XDQA 3J7AY 4LTAA 4PJNA 3AEFC 4QHOA 1BR2A 1R5LA 4PV1C 3HZJA 3RGBA 1J84A 1LOFA 4YNIA 2R7VA 1SVOA 2WNUB 3U78A 2RVAA 3RJPA 1CPMA 3PIJA 3TOJA 2V5DA 3ME2A 5F0CA 3AYEA 4OWFA 1EKEA 3RCOA 4FTSA 4NB5A 3ZQ7A 1V6LA 2Q5UA 5FYUA 3VBRB 5FYSA 1RHI1 1AR92 2VXJA 3ASNH 2WLPA 2AYHA 3IT8A 3HKZN 1X9TA 4G9SB 3AKRA 1DZTA 4BMBA 5J1YA 3SISA 1RUH3 4R4MA 3U11A 3C3WA 2KFDA 2UU8A 3K1NA 4CP9B 1N7SC 3GJBA 3CJNA 1W5CE 4LBJA 4AYCA 5FPZA 4YM0A 1L0NK 2FMLA 2DDUA 3OYDA 1ZZ7A 1VQLI 5APWA 2EIBA 4XUOA 4DO0A 2K9QA 2RGVA 4U3FD 4YG6A 1Q3EA 2OUHA 1JYCA 2D6OX 3UIAA 3CMAP 3BR6A 1V70A 1OYYA 5J96B 4IHXA 3ECHA 3HNYM 1CSBA 3KLSA 1RINA 1UFMA 5I0TA 4IFFA 1ZA7A 5CJ0A 3BTAA 2XSDC 4ASMB 1FNZA 3JZVA 3KV9A 4P9FA 1Q86Q 1V5EA 3T0DA 1GDTA 2L9NA 4KU7A 4ZKUA 1LU2A 4W7YA 1OOPA 4LLNA 4GO1A 3CF6E 5FWEA 4QGMA 4BU2A 1RNLA 2LBFB 4LBNA 3VKMA 5HCAA 1HRI2 2OF7A 1JY3O 1H8VA 1WQ2A 1RQUA 3H9AA 2KB7P 1G3SA 3UV9A 3L71J 2VZ3A 3RIRA 3ATGA 2AACA 2ZEXA 1F35A 3I3QA 1YYNA 4IO9F 3PIOF 1SACA 1ZBE2 3AE6C 3AKSA 4AZZA 1IC2A 3HKZA 1SQPK 3WGIA 1Z0HA 4E7ZA 2D1VA 1TWCJ 3JBG2 2V4VA 2WPQA 5AW3B 1GQHA 1EY2A 1YJLA 3WU2C 1QDCA 4I0WB 4P00B 1NQJA 4BRYA 1ETQA 1W2NA 3IAOA 4BRYB 3GZAA 1NU1J 2XOMA 2PQ8A 4H13B 2RMZA 2NP0A 2JDZA 5L36A 2EILH 2O61A 1FZBA 2DOAA 2JB4A 1JTHA 3WU0A 1GKBA 3TRSB 5GZEA 5FZMA 1MGTA 2E7AA 4AG4A 2KT0A 4HF1A 4LITA 2EIKH 1VPCA 3WCRA 3RPUD 1SFOJ 5C4WA 2YPDA 3DCQA 3RNSA 3KVBA 4YZ1A 3Q0WA 1QQIA 3FXEA 3LIGA 4SBVA 3PJSK 1CGPA 1GYKA 2EXHA 3RMYA 1YJKA 5F6LB 5EIYB 4RB2C 2LY9A 5K5RA 3B6CA 1Q8PA 4OGQD 1WW7A 3I2DA 3CCQP 2KIFA 2Z33A 3OY8A 2MEV1 2BERA 4J1XA 4XF0A 3DBHB 2MA3A 5BNNC 3WGHA 2KXPB 2RNJA 3VDBA 2HKXA 3MIBA 2VQHA 2HFED 4M3CB 3M3QA 3VBFA 4RB1A 2BU9A 2C9LY 2XDJA 1NAFA 3S7IA 1D0YA 2YUEA 1FV2A 3ACLA 3U75A 1W28A 3JRGA 2KP8A 4JP0A 5FY1A 3DLAA 3J8F1 1M56D 2HWF1 2WSFH 3N9QA 3J8F3 1AZDA 2W24A 2JG8B 1WMEA 4JX0A 5A7NA 2VL8A 2DVAA 2F5CA 3R6SA 2A06D 1GFF2 4M72A 1PHMA 1IPKA 3GF3A 1DIPA 2E75C 3CJIC 3WUVA 1VBD3 2ISYA 2XJUA 2I10A 3ZRGA 1FIPA 4U7JA 4PK4A 3KGZA 1WHUA 2VVFA 3O1PA 2WKKA 1JZ6A 1IRGA 4H44B 5J8CA 2E2IJ 3JD71 2X5IB 5IVBA 4P9GA 4NHXA 1U5XA 1OFSA 4DY5A 2GQQA 1JZ2A 1X50A 3HRMA 2R3CA 3LQRA 3TN93 3OUIA 4XFBA 3AE7C 2XJRA 3WW1A 1FMD3 3M3YJ 2R49A 1NT0A 5DG2A 3VBUB 3N9NA 5IK4A 1SFNA 1AQTA 2OYHB 3O0XA 1J75A 3N7MA 4NNJA 2PFBA 3ZYPA 4O9GA 1NH4A 4JTOA 3CUQB 3EYIA 5IYYA 5BPDA 3VSLA 3BDDA 3BCCG 3FJSA 4DCKA 1J2XA 3BODA 1H88C 4RR3B 3B00A 3IHUA 3V0BB 2EF6A 4H3WA 2IPQX 1YJWP 3BLYA 3U1XA 5GTIC 3L72G 3CLQA 1JYIA 3HD7D 5A80A 5JMOA 2ZCWA