1OMIA

Crystal structure of prfa,the transcriptional regulator in listeria monocytogenes
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
233
structure length
224
Chain Sequence
GSEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Listeriolysin regulatory protein
publication title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
total genus 72
structure length 224
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1omiA03
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1omiA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1omiA01
4WF2A 4XSZF 1IW7F 2CWEA 3VODA 3LA2A 3LSTA 3C3VA 3D82A 3TQNA 3V7RA 4M72A 2N7GA 2VOPA 5IT9Z 2UY8A 3GFLA 1R5HA 2V1UA 5E1XA 2EK5A 2PMUA 5I0RA 2Y0OA 1OYWA 4NQWA 3FMSA 1Y3TA 2C0ZA 4IERA 1UB9A 1KU7A 3HIFA 4G6DA 4IRIA 2D45A 4UBGA 3HT1A 4L5JA 2VBZA 2PBIA 3LA7A 4HLXA 5DV5A 1LDJA 1FT9A 4KIGA 4IEQA 3TO9A 2QUFA 5E1RA 3HSRA 5HS7A 4L0YB 2EV0A 3M1EA 3HQXA 1REPC 2XLAA 2HKOA 1ZAOA 4Z82A 2W84A 1XGNA 2DQRA 2NAZA 4HQMA 4E2SA 1EH6A 3JW4A 1WQ2A 2O1QA 1BBYA 4KIFA 4MX3A 4E70A 1LQ1A 1I5ZA 1SD4A 2L54A 1P4AA 3CDHA 2WTEA 4EM0B 1W7PD 2DBBA 2D40A 4RB2C 3TDZC 3F8CA 4GXOA 1O7FA 4HBNA 4MTDA 3SZTA 2YSRA 2LKPA 1UW8A 2M8EA 1R22A 4WXHA 2OYZA 4M6YA 2JRTA 1LKNA 1YFUA 2BV6A 5L3EA 3MQ0A 2ETHA 3ABUA 3ZMZA 2EV5A 4Y17A 2XV4S 2PAKA 3GFMA 4U7BA 1FX7A 1Z1DA 4HW0A 2OD5A 2M87A 3ES4A 1FY7A 3H50A 2XAGA 4ZU7A 2CAUA 4KT5C 1J75A 4M74A 3O14A 2FOKA 2R7DA 2BEOA 1J0RA 2PJPA 3QP6A 4ENKA 1XCVA 4HN1A 1B9MA 3RPQA 4EJWA 4YIIA 3GYDA 2CAVA 3BWGA 4IF4A 5KHIA 3SXWA 3E6MA 4K2EA 4WVZA 3T8TA 1ZX5A 3M3IA 2D93A 1O7LA 4LLGF 3CO6C 4L18B 4Q0QA 2BBYA 3U10A 4N9IA 3OGJA 4N0BA 3TO7A 1ZZ9A 1OMIA 3RYKA 5FLJA 2IXIA 2IXJA 3TOAA 4MGZE 4MQVA 2MPFA 2EA7A 4I0BA 2RV8A 2Q4SA 3EQLF 5LEKA 3FX3A 1OFNA 3OOPA 1G6NA 3QU3A 1Z6RA 1QPMA 1KQ8A 2HJIA 2ZBKA 2LDUA 5CYVA 4QGLA 4UVAA 1W4MA 4IJAA 1U5TA 5HDNA 4KFCA 1IN6A 5F1RA 3J7AO 3VOEA 1R00A 3CUQB 2B0LA 2JPBA 2PMHA 2NNYA 3LAGA 2ACJA 2AXLA 3VHRA 2NS0A 2ISYA 5D8KB 3EETA 3LZZA 4EV0A 4R1HA 2G8YA 1QZZA 1YLFA 1RIOH 1S3JA 5EEHA 3CUQC 5HDKA 3K0LA 2VODA 1EV7A 4OMYA 4ASNA 4P55A 2E1NA 1DDNA 2XIGA 3K1PA 1TLHB 3ETQA 3Q5FA 4EJTA 4J1WA 2Q1ZB 4U88A 1T98A 3E5QA 1KYZA 3ZPLA 4O5VA 5H6QA 1BC8C 2MLGA 1O57A 4WXCA 1PMIA 1DP7P 1FLIA 4YRDA 1SD6A 2QVOA 4HVRA 3KP2A 2PYTA 5KHHA 3GF2A 4XFFA 3FFQA 4WZCA 3HOSA 2MH9A 3IDCB 5HLGA 1IN5A 1BIAA 3M70A 2MHFA 3C18A 2I45A 4LLNA 3CL1A 2VBWA 2BNMA 2H09A 3M7GA 3QOPA 4ZU5A 2H0VA 4LEJA 2MC3A 3KP3A 1ONVA 1XSVA 5CU1A 4CICA 4OFGA 5ERIA 3T1BA 4HDVA 4LTAA 1YFWA 5BUVA 2QM3A 3BROA 3BOQA 4KWLA 1I1SA 4MTEA 1OYIA 2QQAA 3L00A 1XDSA 3JZVA 4PJYA 2GAUA 1PP7U 5BQTA 4F8AA 5E17F 4LG0B 5FLXK 3BU7A 2PFWA 5LHIA 5FCCA 2TDXA 1XD7A 5DUIA 4CO8A 4LK1F 3HSEA 4XF0A 1FBSA 4IEYA 4OMZA 4AIKA 4IEWA 2H27A 1ON2A 4CGZA 5EFUA 2FMYA 3FXQA 1ULYA 2ZO4A 5D8LB 4HSLA 1HKSA 4JK1X 2K9ZA 2XGXA 2E7XA 1ZRRA 4B8XA 1FXZA 2QDRA 5JAXA 3ULQB 2X4HA 4MQ9F 2Q0AA 2XKPA 4M73A 1UHWA 2R7FA 2JZYA 1BI3A 5FB2A 1W5TA 1IXCA 3Q9SA 2QQ9A 1G3YA 4RB3C 1FWZA 2FMLA 1H0MA 4G9YA 2QJVA 1CF7B 3ZDSA 4AVPA 1QQIA 2L4MA 3FM3A 1QWRA 2PA7A 4EM2A 4UVBA 4HBLA 3RNSA 3F3XA 2NYXA 4I01A 3DPTA 3NQOA 4XF3A 1U6GA 3ECOA 1KU3A 4MEYF 1W7PB 5K5QA 4LA3A 1ZHFA 4UV9A 4EM1A 4A5MA 1NZCA 1ZZCA 2WV0A 1UPIA 2A6HF 2VE9A 3H1YA 3MDPA 5FLIA 5H6RA 2L4AA 5E18F 2VONA 4Q0SA 1T0FA 3GZ5A 4S05A 5K8SA 2A07F 2UYAA 1ZZBA 2IVMA 2PTMA 3KP7A 3H3UA 4ESFA 3K9TA 5HLHA 1MGTA 1FBQA 3WGHA 4EMSA 2ET1A 3ZP5A 4HQEA 4MGIE 2ADUA 3GW2A 4LJZF 1MJAA 2M5WA 1BI1A 4F7ZA 5L3FA 1SFUA 2FA5A 1PM7A 2A68F 2G7UA 2RQPA 4BNCA 1YHFA 1Q3EA 3BPZA 2RC4A 2IRFG 2VQAA 4AXOA 2GZWA 3J80Z 1EH8A 2D5HA 3LA3A 3H7YA 2VC1A 1R1VA 4HX8A 4JTNA 2DK8A 1O3RA 4I0AA 1HXDA 1X3UA 1SAXA 1LVAA 1ZREA 1C0WA 2BNOA 4TLFA 4ENNA 3WTZA 2HS5A 1L3JA 5ILVA 1X8EA 3T5XA 1YW8A 5BS6A 4NVPA 2DW4A 5IT9K 1OD5A 4XF4A 4GYIA 5LEJA 5C8WA 5DCMB 4UXAA 2E1CA 4QX5A 4OIOF 1ZRFA 1HSTA 1DZTA 3KCCA 3U11A 4CYDA 1EY2A 4XLNF 4FAGA 1HKTA 1GQGA 3CTAA 2RNJA 2KJBA 4RGRA 4LG0A 4KL1A 2B5HA 1XGSA 4HYEA 2PHLA 2L01A 2OA4A 3EBRA 5H20A 4O9EA 3IHUA 2M1BA 2FNAA 4R79A 2XL9A 5J6XA 5CVUA 1ZVFA 4ZU4A 3H1WA 1HSJA 4M6XA 4L9VA 2FF4A 4P96A 4A2UA 3WGGA 3BB6A 2O8QA 2P6TA 1QGPA 2A69F 5KK1A 2DTRA 5JFRA 3HYIA 1YTYA 3ZN0A 2DT5A 1O3QA 1TBXA 2FNPA 1WGPA 3D0JA 1FOKA 3RPUA 3GEZA 4ZH4F 1YQAA 1TQ5A 1R5GA 1SFNA 1FP2A 4ENMA 3DL3A 2STTA 1J7KA 4KDPA 4IEXA 5FPXA 3C1DA 2WC2A 1B9NA 1B4AA 4UUVA 3OCPA 3HUGA 1VTNC 1K7AA 5L3CA 1CF7A 1JE8A 3I64A 4MHGA 2CGPA 5BMZA 1ZNPA 1J3PA 4LD5A 3KGLA 1U12A 4YIFA 1KU2A 2XROA 2QVSB 3ACLA 3KP4A 5A2QZ 3WU1B 5AIQA 3KETA 1T38A 1PP8F 3KMHA 4K8FA 2Y0MA 5J3UA 1W7PA 4LK0F 1R1TA 3LAPA 4QXKA 5E20A 5LGNA 2W85A 3QPTA 3GBFA 5LHHA 1CAVB 3IKTA 3M9AA 3E5UA 3LQQA 3WW3A 3WTUC 2VPVA 4ORFA 3QACA 1SD7A 1SMYF 5J7MA 2P5KA 2VN2A 2UXNA 4HVQA 3BDDA 3I71A 1KQ0A 2OAZA 5CVRA 1YW7A 1SFXA 4O9GA 2KRFA 4HA8A 2DPDA 1FDOA 4EWAA 1AOYA 1F9NA 1Z9CA 1CAXB 1T2KA 1NE4A 3NVCA 4BHBA 1ZMEC 2F5EA 2O3FA 3K1NA 1ZZ8A 4JVAA 2HGCA 1D5VA 4A5NA 1GQHA 4GCVA 1IPJA 1LEBA 2FBHA 2XHKA 1CX4A 2FRHA 5TJJA 1VJ2A 3BY6A 1IF1A 1QZYA 4BH9A 3E3VA 4XF9A 4YARA 3F6OA 3GX4X 5CVJA 5HS9A 1BC7C 3G3ZA 5LGUA 3L09A 3ZQ7A 3JSPA 1BI2A 3KZYA 3I0TA 5K5RA 1JUHA 1IAWA 5D5WB 1RC6A 3WW2A 4J1XA 2FXAA 1XSDA 4Q5SF 4A0ZA 1BI0A 5DCMA 1FI2A 3HRTA 1J2XA 4AD9A 5E8GA 4ZYHA 4HLTA 2F2EA 2EWNA 1VR3A 5KBFA 4ON0A 2XAJA 1TQIA 4P9UA 4QMAA 3ISPA 2PQ8A 3S7EA 1RTVA 3GFJA 1I6XA 3M8EA 3FMRA 2GIVA 5CJ9A 2CG4A 3DN7A 2HKXA 5D5VB 3U1DA 4X6QB 3LWFA 5FQ0B 3RKWA 4WK8F 2ZXJA 1SD5A 3FM5A 1KGSA 1OPCA 2HOEA 3UKVA 3V7CA 3JSOA 1IRFA 3REOA 4M71A 3W6KB 3MPBA 1V3FA 4D7TA 3L7WA 2G9WA 2Y75A 5D5XB 3KGZA 1WMKA 2KIUA 1H1MA 2HDCA 1HW5A 4KIBA 4JQFA 3JAMZ 4IRGA 1RGSA 4XFBA 1P2FA 3F6VA 2W57A 4IHTA 2IXLA 2CFXA 2F5FA 2G7HA 3QPHA 2ZFWA 4ZYDA 3E6CC 2XLFA 1NYWA 3DF8A 4O3MA 3CEWA 3H92A 3MEXA 1G4DA 1IPKA 1ZLJA 5HDGA 5I0TA 5KHKA 4UHTA 1XMKA 4ENJA 2V1XA 4L9JA 2XAFA 2DU9A 4G7HF 1B6AA 4E2GA 1U2WA 2P10A 1LB2A 2ETEA 5D1IA 4EVIA 2O61A 1JGSA 2UWMA 1SEFA 4YNIA 5DCFA 4HV5A 3ZMTA 1SQ4A 2ZJ2A 4XLPF 2Y48A 2MBFA 1F4KA 3B02A 1CAVA 4META 4RD7A 2LF7A 5AVPA 1MJBA 1Q1HA 2P7CB 1K79A 4I2OA 2FBIA 3IC7A 1BJAA 3PVBB 3J81K 1LRHA 3V8KA 1RL3A 2MNGA 3GZ6A 1XB4A 5L3DA 3WG9A 2ELHA 5K5OA 5E1ZB 1IRGA 4OINF 3IRQA 2XAQA 1LEAA 1X8MA 1GHCA 1R58A 1YLLA 2ZCWA 3T0YA 3FWEA 2Z9OA 2KJCA 3WW1A 3ELNA 2DO7A 4HF0A 4IRHA 2A61A 4L5IA 4BQAA 3I59B 4IEUA 5TRDA 3TNQA 3IN6A 1OKRA 1XE7A 2QLZA 1ZGAA 4LA2A 2BGCA 3I54A 2IT0A 1CGPA 3CLPA 4HVOA 4AWXB 3H7JA 3BJAA 5I8YA 2VC0A 4I7HA 2F5DA 4UV8A 2PQQA 4LMYA 5BPXA 2RVCA 1KU9A 2HFHA 1WRJA 2MD5A 4L0ZB 1EPZA 5BPIA 3KP6A 1WWXA 3IDBB 4LULA 3SMHA 3FMQA 4FBFA 1QXJA 3N97A 3I5UA 3KP5A 1J3QA 2EJRA 1J9IA 3BCWA 4GO1A 4DQ2A 2HYGD 2PG4A 5JR7B 2GC2A 3GVAA 1DZRA 4G8XA 3I53A 1AWCA 4ESJA 1ZG5A 3NL1A 4TV7A 2XL7A 3J80K 4XETA 3TOBA 5L3GA 4UVCA 3QP5A 4RAZA 4RB0A 4IEZA 5FQ0A 2DK5A 1IZ1A 2EFNA 2M45A 3WE2A 2D1VA 1RNLA 3Q9VA 2VOOA 2L02A 5DYMA 1ZG3A 2Q30A 1OR7A 3R60A 2LF8A 1TQPA 1A04A 3HSFA 1Q43A 1NHAA 4E2QA 4L11A 2O03A 1SFEA 2DPUA 1YIOA 2O0YA 4HAMA 2CO5A 5LGTA 3G73A 4I3PA 4OLLA 3MWMA 1GXQA 3VB2A 1LR5A 4Z2YA 4OIPF 2V9VA 3P9CA 5JSRA 3L2CA 2Z2SB 5EZWA 1F1ZA 1MDMB 4Z07A 5FFZA 1PUEE 2STWA 3F8NA 4XFHA 1S7AA 3KLOA 4UNOA 3IRRA 4LB6B 2QBYB 3RDIA 4AQ6A 5E16A 3O2PE 4MV2A 2CYYA 1ZGJA 3F72A 3FHZA 1UIKA 1USTA 6PAXA 3RKYA 1RUNA 3CUQA 3HRUA 3WTYC 1FYMA 3H1MA 2ISZA 3FZVA 3NEUA 3IBMA 3E6BA 4MEXF 1P4WA 2HQNA 3OTFA 1IXRC 2IPQX 2MH2A 1O5LA 4B29A 2IJLA 1V4RA 2KXLA 5D6EA 5ED4A 2PLYA 2WFPA 2ESHA 1BIBA 2YU3A 1HBXG 2D1HA 3NW4A 4XRFA 4L2NA 4RS8A 1RZ4A 3WE3A 2J5PA 4HOBA 3RJPA 2CSOA 3O6BB 1FC3A 2E7WA 4S04A 3OD0A 3L2HA 1WA4A 2QWWA 3RIRA 4QM9A 4M9ZA 2IA0A 5A2QK 4YFNF 2ESNA 2IC1A 2XASA 4IXAA 2YX7A 3I59A 1ZRDA 3DXJF 4QLCU 2FSWA 3BP8A 4U0YA 2L3DA 2B9UA 4KU7A 3F22A 1QNTA 1TNTA 2M30A 2EA2A 3ABTA 4IEOA 2ZMEB 3PFIA 3IWZA 3ZMUA 2ZKZA 1T6SA 3ELKA 4JTOA 5JHUA 1Z91A 3DPLC 4P5OA 3WTTC 4Q47A 1KA8A 2R3SA 2Q2EA 5AONA 4IESA 4KA4A 3SHFA 3RZZA 3S2WA 1B59A 4BHCA 1TW3A 3E5XA 5DUKA 1DGWA 2XKOA 4BXUA 4Q0VA 4AVCA 5I8TA 5L3BA 2IXHA 3K69A 4NHJA 2ZKLA 4N9HA 5I0SA 4Q48A 2FBKA 1FP1D 5DD8A 3RYRA 4KWJA 1KQ9A 5DDGA 4U7DA 2VT2A 5FPZA 4Q0PA 2H6CA 4ZYGA 3MFKA 4KN7X 5ILUA 2YX4A 1HW1A 1Y9QA 4PZJA 2DCTA 1MZBA 2K86A 1G3SA 4AVBA 2VBXA 2OBPA 3BJOA 1DUXC 1XDUA 4G94A 2AS5F 1BOAA 1OYYA 3FF5A 1FDIA 3F21A 3O3KA 4M9SA 5JSOA 2PAEA 3F8BA 4PIXA 1XGOA 3PQKA 3MZHA 4MH0E 4KMUX 4GULA 1D8KA 3KEOA 4KYWA 1UD1A 5BXXA 4HN0A 4HZFA 5D5UB 1MDMA 4H0EA 3BPXA 3K1MA 4Q0UA 3FE5A 2J5OA 1ZLKA 2EA4A 1R1UA 2QBYA 4MZUA 4H7LA 1Z7UA 3FJSA 2D5FA 4EGYA 2UZKA 2LNBA 4B09A 1HKQA 4D7SA 2QENA 5CLSA 3NJZA 4G7ZF 3FHIB 4HF2A 1UFMA 3LOIA 3D0SA 2RDPA 3USSA 4YG2F 2F5CA 2YPRA 2XLGA 1H9GA 5E8IA 4DINB 4RB1A 1Y0UA 3JAMK 1SMTA 1YG2A 4I09A 2GC3A 3S7IA 3QU6A 5HOOA 4HLYA 1LDKB 3TDUC 3H9AA 4PIZA 1S8NA 1XE8A 3CO7C 3V8JA 3OF1A 3CLOA 2K4BA 4WBBA 2K27A 2NRAC 3EO6A 3OV8A 1L0OC 3DP7A 5JR3A 5K1YA 4KUMA 1X7NA 3IL2A 2P4WA 4IVNA 1I27A 1LJ9A 3MZYA 3HT2A 3FXUA 2K7LA 2BNNA 2XVCA 4PGGA 2F4PA 5BOXA 3I58A 3P7NA 1MJ9A 3BZ6A 3JTGA 3DEUA 2NNNA 2ZMEA 3DQVC 3GXOA 2RN7A 2DI3A 3F8MA 3E97A 1ODDA 4Q4ZF 1NXMA 4RGSA 5BV6A 3S0MA 4BIFA 5C6CA 1FZPB 4HF1A 3WU0A 3NSTA 4KMFA 3R61A 3CUOA 1ZN2A 4PDKA 3WGIA 1RUOA 1W5SA 4KWKA 3EYIA 4Q29A 3P9KA 4G6QA 3HHGA 5FD6A 2GXBA 3R0JA 4U0VA 2KIFA 4MUVA 2XUBA 4YSFA 2YR2A 5D4RA 2LSOA 4A6EA 5FFXA 4X6RB 1WI9A 2IA1A 3F8FA 1FYKA 2QNKA 3VEPA 3JTHA 1G3WA 4QGNA 2DQLA 1GVJA 1J5YA 4LFUA 3GWZA 5J8CA 3O6QA 3SCHA 3UKTA 5ICEA 2GA2A 3RKXA 3TGNA 3KZZA 4EWDA 3ZMVA 3GUDA 1D3YA 4A6DA 3SXYA 2QYOA 4YFKF 5CADA 5ICGA 1RI7A 4AVAA 1IN8A 4QM8A 4G7OF 4YYOA 1IXSB 4U0WA 1P4XA 4R8HA 4UXNA 5LLQA 4GGGA 1BN5A 2GU9A 1S6LA 2COMA 2V79A 4ONUA 1H1IA 4D0PA 1J59A 2O6GE 2CV6A 3IIAA 3R4KA 3IWFA 3C7JA 5J8FA 2HWVA 4XFIA 2VBYA 1K78B 4EWEA 2P17A 1FPQA 4AIHA 4JBAA 2D2WA 2GC0A 2JTVA 4ZYEA 2HYFA 3M8FA 4Y13A 4LUMA 5JCTA 5I8SA 5F6FA 4PCQA 5E1WA 3G7DA 3H3ZA 2B8MA 2P5LC 1CAXA 3CF6E 2K0GA 5FLHA 1U3EM 5HI0A 3PLQA 3RI4A 3WTWC 4JV4A 3KLNA 5HVQC 5LRRA 3D5LA 4HDUA 4HX4A 2EFPA 3V7SA 1FBUA 2PI0A 4RGUA 1I1GA 2Z33A 4ZZDA 2P7VB 3EQEA 3NKTA 5D4SA 4QWQA 2A5YB 2XRNA 1TW2A 1XN7A 3LWCA 5KVRA 1IN7A 1UHMA 4HX7A 2IP2A 4KN4X 1ZG1A 3EHKA 2PN6A 1PDNC 1ZH5A 2ATFA 5T3NA 5FGMA 1BM9A 4AIJA 2HTSA 2VECA 4HMZA 4IEVA 1XCBA 1XMAA 4KNYA 2OZ6A 4KICA 3SQNA 1R7JA 3W6JB 1MKMA 2FEZA 4XFCA 3TNPB 2VXZA 1STZA 4I98B 5LRSA 3U2RA 5LHGA 3MYXA 3MCZA 3ES1A 3H25A 2P8TA 2EAAA 3GLXA 5KHGA 1J1LA 5FDBA 1QBJA 2GC1A 5BY5A 1P6RA 5AIPA 3QRFF 5LBQA 3U0ZA 3SHRA 4P9GA 4EROA 2RGVA 4CXFA 2DFIA 4PIYA 1XSXA 3ST7A 4EJVA 1ZRCA 5ILSA 1O4TA 5ICFA 1YO5C 5JSPA 3E6DA 3HRMA 4AQ2A 4BHPA 2GA1A 1EYBA 2V09A 3CO2A 3FZ3A 1UIJA 1XRUA 3CJNA 2EVXA 4CDGA 4UBHA 4XFAA 4PGHA 1DGRA 2FE3A 1T39A 1UCRA 4CHUA 3KEQA 4M9XA 1TQMA 3SZPA 1YUDA 1YW9A 1P92A 2XAHA 2VT3A 3KSCA 2Z3YA 4FX4A 2HTJA 3IKVA 1U78A 3BJ6A 4NB5A 3COAC 1QY4A 1U8RA 1FNNA 1J58A 1TTYA 5I93A 3SCGA 2EFOA 1J3RA 5JVTA 2EFQA 5F64A 2FU4A 3I4PA 2H94A 2FQPA 3KFWX 3U9GA 3J81Z 4A0YA 1R23A 3MAJA 1FYLA 5IT3A 3VFZA 3GO5A 2RKHA 2O8XA 1CAUB 2CQKA 4WXDA 3K2ZA 3HTSB 2BYVE 3N4MA 1JXSA 2V1DA 2OPKA 3PQJA 2KKOA 5JI6A 2K4JA 1O3SA 2OU2A 1EH7A 4XF1A 5DD4A 3FXRA 1FSEA 2PEXA 2QZ8A 2HZTA 2OZJA 1IUYA 4IETA 2ZNZA 3HOTA 2IW5A 1CAWB 1YFHA 2EB7A 4LB5A 4I02A 1S29A 4WWCA 1K78A 3ECHA 4IPAA 4L9TA 3WTXC 1Z05A 1ZZ6A 5FO5A 2X0LA 3SFZA 2JPCA 1FSHA 2QCSB 1ZYRF 4MGRA 4HV6A 4EJUA 4LLLA 5DEQA 4XBFA 3GFIA 4RGXA 1YS6A 4KU8A 2OZUA 3LQRA 4FT8A 4FHTA 1E2XA 4CZZA 1VP6A 4EGZA 4EQQA 2Z69A 1D8JA 3T8RA 5KHJA 1QO0D 2IXKA 3CJXA 3I7DA 1WKMA 2UXXA 3EUHA 4A12A 2EFWA 4EJOA 1ON1A 1GXPA 2HQRA 1YFXA 2FQ3A 3BPVA 1HW2A 2UY9A 4OU0A 4OIQF 1YFYA 3DFGA 3TO6A 4OIRF 3WTVC 3HTUA 3ZMDA 5EEGA 3DV8A 4MNUA 2CW0F 5FLXZ 4LUKA 4FX0A 2GWRA 5FD5A 3F23A 1ZARA 1JHHA 1MD0A 2C6YA 4ESBA 1QXRA 3WTSC 2HR3A 4IHSA 3EYYA 2PAMA 3ML6A 2Z99A 1Q5OA 2EV6A 3ZN1A 3DKWA 3GYHX 2OA2A 4MGKE 1DPRA 3H8UA 4BYYA 1WSUA 1XGMA 1USSA 2OQGA 2VE8A 1H9TA 4XFGA 4BAYA 3R6SA 3ERED 1ZZ7A 1YYVA 1WLTA 3BALA 5I0UA 2MA3A 1V70A 4Y15A 1YS7A 3NRVA 2Z5UA 2W24A 2K02A 2DLLA 3LFKA 4FAHA 3AAFA 4LLOA 1HQCA 5J48A 3RTRA 1O3TA 2PHDA 4LGWA 3TKYA 4GYGA 2JT1A 3UKNA 2E9QA 2OQRA 2IXCA 5D6FA 2JSCA 4R52A 1TNSA 2GXGA 2GQQA 5CVVA 4ETSA 4IEPA 1Z6TA 2A3SA 4L9NA 2H6BA 2WWYA 2BE5F 1AJYA 4XSXF 1G3TA 3RYPA 2KIMA 2P6SA 2P5VA 3KE2A 1EP0A 3EWKA 3B73A 2V6CA 1O5UA 2UYBA 4QGMA 5ICCA 3EDPA 1CAUA 5BPDA 3HHHA 2ET7A 5CVIA 2Q0OA 3P9IA 3LAJA 2QQBA 2PFBA 3QAHA 1KYWA 4WCGA 4XEZA 2A6EF 1IN4A 4P9FA 1S7OA 5HLIA 3EJKA 1NE6A 4DNCA 2DAOA 3PNAA 2Q8KA 3V8LA 1CAWA 3HRSA 3R0AA 1X82A 1L3LA 1K6OA 2HEOA 4RAYA 1R36A 4O6JA 3ROUA 2ZNYA 3WW4A 3V4GA 1U5TB 3SCFA 1LNWA 1B1BA 3ZMSA 5HS8A 1F5TA 1LDDA 4WX9A 1OI6A 1E17A 2GH2A 2W25A 4YFXF 4A0XA 5I91A 4HSJA 1UCXA 3L9FA 4MGYE 2MLKA 4OOIA 1JHFA 4ZZLA 1YWKA 3C3WA 3WODF 1U5TC 2IA2A 1DPUA
chains in the Genus database with same CATH superfamily
3VBOA 2CHHA 5A33B 2J22A 4LR4A 3HTKB 1FPN2 1AYM3 4JQRA 1M1JC 2QM7A 3H35A 3V7RA 1JODA 1YTZI 4YZ1A 4YM3A 1IQDC 2UY8A 2JKXA 1ND2B 1KYOE 2AGSA 2PMUA 1C5HA 5FY7A 3I2FA 4N4NB 1AYM2 3IDEA 2JG8C 1OYWA 1YJLA 5IATA 1UQXA 4ZYAA 1Y3TA 5L9VA 2FHRA 5FMOL 1JKPC 3RPUD 2OTLP 3LA7A 5DV5A 4HLXA 3CC7I 3ZR5A 4MIMA 1FIAA 5E1RA 3VBHB 3OYCA 4L0YB 5HCAA 4CP9B 2OGUA 3B6CA 2EXIA 5CPRB 2EV0A 3MV11 1FZCA 1N47A 2TEPA 1BZWA 3TK1A 4OI1A 1NCRC 2IGNA 3L74E 1TME3 4AM3A 3JW4A 1WQ2A 1L0NJ 2GXAA 1W39A 4KIFA 3OYMA 2E76C 1HRI3 1QJU3 4II2A 4E70A 3PIPF 4MX3A 4AI2A 2ZT9B 2JG9B 1TME2 4PD4D 1P4AA 2LKMA 1ZKGA 1JUMA 5A3LA 1TZLA 1W7PD 1NOHA 1QJU2 3GMEA 4KT6A 1HRI2 4IXLA 5FR3A 2DBBA 2D40A 2JDAA 3F8CA 2JSPA 2ZGSA 4R9DA 1O7FA 2VMGA 3D5OA 5G04L 2F6BA 4LBKA 1PK6B 3AEBC 1GBGA 2M8EA 1R22A 2L7FP 2OYZA 4M6YA 2JRTA 4XLHA 3LOBA 1OH4A 2ETHA 4L74A 1RF0A 4YW3A 1VMHA 4DYQA 3HNYM 1T2KD 2XR4A 1X1CA 4A93J 2CPBA 2XAGA 3FC0A 3H50A 4AG4A 3A01A 1J75A 1A6CA 1TMF3 3OOXA 2XWBB 2M0CA 3Q3DA 3N3HA 1GWLA 4RFRB 3WG2A 4ENKA 1XCVA 3VD5A 4EJWA 3GYDA 2HOSA 2N1TA 3IP4B 2HODA 1TMF2 1MMDA 1BE3D 4QX7A 2B88A 3E6MA 4K2EA 2WWJA 1Q56A 1HKDA 1ZX5A 2HDWA 4LLGF 3CO6C 3SH5A 4LORA 3FISA 5LY1A 2W9XA 1HGVA 2WPSA 4CEWA 4CCEA 1OR7C 5B5EC 3VMAA 3A03A 3CCJP 1W6QA 4UYBA 1CESA 3JR9A 4JGYB 3N9QA 2IXIA 4MGZE 2EA7A 1WVRA 1W0NA 1D1CA 1OFNA 2CJJA 1JZ7A 2B45X 3QYEA 1K4TA 4A3MJ 2LDUA 5CYVA 3RCOA 3VSLA 4UVAA 5L8RJ 4DRRA 1W4MA 1DP3A 1HC8A 2JKBA 5APWA 5F2SA 3VOEA 2W5FA 4JX6A 2PMHA 3LAGA 4DRVA 1LHUA 4A3XA 3RSJA 4KGQA 4OUSA 2LTPA 1SVLA 4EV0A 1YLFA 5A33A 5FPAA 3PO2J 1J2JB 3HTKA 3NTNA 5HDKA 3K0LA 2CV1A 4HK8A 2VODA 2QSIA 1BQPA 4M6VA 3SFIA 1WLWA 2VJJA 4N8MA 4UFLA 1RKWA 4ANJA 3OG2A 4A3BJ 2D5VA 1ND2A 2A71A 2HEWF 1LFUP 3TW7A 4IV1B 1BEV1 4EJTA 1COV3 4J1WA 2Q1ZB 4C8DA 2R7RA 4U88A 3HN3A 1NX9A 4FXKB 3DWLE 2LY1A 3BR0A 2MD0A 4AQSA 2GBYA 1R64A 2MLGA 4RAFA 3C2BA 1COV2 2W90A 1LWUB 4QSHA 1OVVA 3L73D 2V9KA 1SD6A 1VQLI 2QVOA 4QX0A 3FUQA 3VBHA 2M3BA 2IX7C 4CP9A 2A5WA 4XFFA 4BS9A 1CWPA 3HOSA 4NROA 2ZGLA 3ZFGC 4Y4RA 1WW7A 2KL4A 1PVC3 5F6LB 1ASJ3 3ZR8X 2M2EA 5CFDC 3CL1A 1YIJI 1NTZE 2H0VA 1NY71 4IL6X 4I6ZA 3KP3A 2VBPA 3IH3A 3PJQA 1H4GA 4BK5A 4P14A 1PVC2 1ASJ2 4O7XA 1N86A 2A70A 5FOJB 4CICA 5ERIA 3ZQFA 1X1DA 4HDVA 2JXAA 1OHFA 3G2BA 4CPGA 3APBA 4WB4A 3BOQA 4PDWB 2PMZA 4KWLA 1P84I 4OUEA 1PK6A 4KJMA 1FMD2 5BQTA 4F8AA 3OYJA 4D7YA 1QJY1 4LG0B 5FLXK 2VCBA 5LHIA 3GHGB 1GR3A 3TN91 2FZ2A 4OVNF 1PIV3 3I55I 2EIGA 4DJAA 3CXHE 3CCQI 1C4RA 4KQ7A 1SP4A 4LK1F 3HSEA 3CCSI 5AW9B 1V0AA 1ULGA 1FBSA 2YFUA 2YZ4A 2H27A 1ON2A 1ENSA 5EFUA 5JOZA 2CV0A 2A6WA 3OS2A 3I8TA 1ULYA 1PIV2 4FFIA 2ZO4A 2UV1A 1CIYA 4HSLA 3L37A 4JK1X 1MW7A 2E7XA 5FZOB 1GMMA 1OLME 4PJLA 4RQPB 4PF1A 3RMXA 2Q0AA 1MBKA 4FPGA 1LKXA 1MFZA 3GTMJ 4IHWA 1JYVA 2ARAA 5E79E 1FE6A 1W5TA 2YO3A 2OF7A 1G3YA 4YG0A 4RB3C 5FY4A 3AP6A 4JGYA 2QJVA 1CF7B 1EZVG 1YBKA 4AVPA 3JC22 3QWOC 3PIOF 2L4MA 1QWRA 4F3JA 3DPRC 4WVMB 3S5QA 3CIHA 4EM2A 5B2GB 2V5YA 4XKVA 2AZ5A 1TE1B 3HEFA 2DFCA 4QHBA 2JRMA 3DPTA 1U6GA 2YS9A 4X8PA 4MEYF 1W5CC 4LA3A 2ZB9A 1NZCA 2WV0A 2WT7A 5KJ7A 1UPIA 4XXPA 2A6HF 2DA1A 2VE9A 3H1YA 2OS2A 1P7JA 4R4ZA 5H6RA 1KEXA 2JX9A 3GZ5A 4S05A 1QGLA 3DU5A 4LQRA 2VKVA 4UB8E 2A07F 3NNMA 3N9NA 4D3WA 2BUKA 4ESFA 5JOWA 2J58A 5F1JA 4IV1A 1I1EA 3E1F1 2ET1A 1RRJA 3ZX7A 4BXXJ 1OFSA 3N7LA 4A3IJ 1DYKA 4F7ZA 1HRV1 2FA5A 1XOYA 3DBLB 2G7UA 4BNCA 4LBOA 1LWUA 3FBIB 2VJ5A 2IRFG 3UL2A 4JKKA 1EH8A 1W0OA 2D5HA 3HWJA 3L71J 3VTPC 5A7PA 3H8XA 4EZHA 2GUSA 1O3RA 3WU2E 2W6BA 4NO4A 1SAXA 2WS91 1NA1C 1MQTA 3IMMA 4BGDA 4AGVA 1BR2A 3LOCA 1Y9BA 1Y7BA 1R1A1 2HS5A 1GW4A 1KQRA 1L3JA 3IH4A 1MMAA 2YIUB 5ILVA 2D6OX 3CC4P 4Q2FA 4N53B 4E7SA 4B44A 4XDPA 5GTHC 1IK7A 2KXPB 2E75C 1X8EA 4AGGA 1YW8A 5BS6A 3A4UA 4CU9A 4XLCA 4XF4A 9ANTA 5DCMB 1NG0A 1W9YA 4RN5A 5LB6A 3CCUI 4OIOF 4PDWA 1DZTA 1I3HA 1PYVA 2CUJA 4CYDA 3L72J 3BCCD 3M9BA 5AW6B 1GU5A 2NPSD 3AE4C 3RVHA 2RNJA 4UB6E 1KTMA 4LG0A 1YJWP 2E1MB 3GHGA 2E63A 4SBVA 2W6JH 4FASD 1OCZH 2L01A 2HG5D 5J98B 3DXUA 5J6XA 4BQ2A 1ZVFA 1HSJA 2DVGA 1OIPA 1T2XA 1K9MQ 5A3NA 1YI9A 4L5EA 3VLBB 2FF4A 1UMQA 3CESA 4A2UA 2P6TA 3K4ZA 4DUXA 5K0UB 2CWMA 3QCWA 4DXZA 5JFRA 5KWRA 1VB2A 3HYIA 2E5YA 3ZN0A 1WCQA 4HNVA 5BNPC 5F5AA 1V6NA 5FZOA 2DT5A 3AMHA 3HD8B 1D1AA 1R5GA 4ENMA 2KS1B 3DL3A 2WPRA 1J7KA 2R5BA 4IEXA 2KLOA 3C1DA 4IOCF 2W08A 2WC2A 5AVZB 1YRNB 4ASWA 4UUVA 2VD7A 3OPWA 2GMMA 4PLOA 2M3EA 3OCPA 4ES9A 1OPMA 1K7AA 1V6JA 5GLTA 1CF7A 4YZ3A 1RUD1 2MC4A 4LD5A 3MHVA 1ZA4A 4WVMA 2DJNA 3GCXA 3W59A 3JBG1 2BEZF 2YKPA 1CZVA 4BM8A 2VZ1A 5A32B 4PSXA 4CCMA 4YPJA 2AYHA 3QWLA 2KB7P 3VUOA 3AE6C 3WU1B 5AIQA 2MEV3 2YC0A 2Y0MA 3BQZA 4YW7A 4KBZA 1RHI1 4AFBA 3D71A 2DWRA 1GKBA 3ZQCA 2W85A 5AW5B 2E5NA 1M1JB 2RS51 5HCBA 2BY3A 4E4DX 2MEV2 3WDWA 5J1RA 4AK3A 3WTUC 2VPVA 3QPLA 5J7MA 2P5KA 1JYWA 3J7MA 4HVQA 1KQ0A 2FDHA 2RDQA 1ND3C 3V6IA 1QLED 1VBA3 4F93B 4HA8A 2VOVA 1F9NA 1NE4A 5FPVA 3GF7A 1R5SA 1ZMEC 2EF6A 3MPPG 2J1UA 2XJVA 1FV2A 2AUYA 2W1OA 5J1XA 1OXZA 3GBWA 4LO5B 3GJAA 3ZMOA 5H9SA 1NCRB 2CGOA 3IAQA 3KWVA 1QKQA 3LSEA 2O01J 2QQMA 5FZBA 3PU8A 1MNMC 5FO7B 3KVBA 4BY1J 1AL0G 3AVRA 1VQ9P 2ZYAA 1D2SA 4D5FA 3ZQ7A 1H8TC 3OBAA 1JUHA 4E7KA 2P1JA 4N53A 2LVSA 5J40A 3LDRA 2P3JA 5EFWB 1H88C 2WAOA 2ZAEB 5DCMA 1FI2A 4XJUA 1IO4A 3TP0A 4AD9A 1J1TA 1V6IA 4CZSA 1QJZA 3HG9A 4ZYHA 1VR3A 1S72P 1S4CA 3RRDA 2O8KA 1MEC2 1CSBA 4Y3OA 4K1ZA 2H89C 2GIVA 2ZJRF 1QF3A 3BG7A 2HKXA 2Y8KA 3T2OA 2OTJI 1YITP 5FQ0B 3ZFFB 1HB3A 1Y43B 2ZXJA 3AYEA 3FM5A 3H1LJ 1VE0A 3CC2I 1AKHB 2WV1A 3UKVA 3B9IA 3OD4A 3V0AA 5T50A 1IFNA 1DFQA 3L7WA 2XBO3 2CUZA 2VXDA 2Y75A 4GT1A 1WMKA 4YW5A 2E2HJ 3RJRA 2M7AA 4TTGA 4HK9A 1YQ3C 1R71A 1HX6A 2KS1A 3IAOA 2XBO2 3RWNA 1P2FA 4Z92B 3PIJA 2IXLA 2CFXA 2F5FA 2G7HA 1OT5A 1YRNA 3E6CC 1NYWA 3ZQQA 1T8ZA 3RL0g 1NTKE 3CEWA 2K40A 3MEXA 3NV2A 3LEMA 3QQAA 1PX4A 2E33A 3A02A 1SDWA 2W68A 5A32A 4IX7A 2JA5J 2XAFA 1B6AA 1U2WA 3Q8EA 2DXIA 3TGUE 2ETEA 1BGYE 4LHKA 2O61A 4D9JA 5GAHJ 1HJBA 3GZTB 3KV6A 5JVVA 1MS1A 1M1JA 4XLPF 2Y48A 3B02A 4RD7A 1MS9A 4KMQA 2LF7A 5AVPA 4QAWA 2YC4A 2WNVC 1YRZA 1QEXA 4N78D 3ZIWA 2DCEA 5A1AA 3J81K 1MH4A 3V8KA 4XJZA 5T5LA 4YPCA 3U75A 4FFHA 2HWC2 1NCQB 5GM0A 1FZFA 2L9RA 2P58A 2Y6GA 4MSVA 5E1ZB 3QOEA 1IRGA 4X8NA 1YLLA 3GBGA 1APNA 3WW1A 3ZFGB 3ELNA 2D2CC 1P8JA 1NCRA 4HF0A 4B1RA 5CFDB 3CDZB 4GB31 1HDKA 4MGTA 2VZ3A 3B93A 1OKRA 5FMBA 2OT7A 4YTPC 1CGPA 2E74D 4HVOA 5TISH 4Q26A 4XJ9A 4OHWA 4XAAA 4CCDA 2VC0A 4AR2A 3RQ4A 4UV8A 3ILRA 1KZHA 4Y5TA 2PQQA 3ZQGA 4XW3A 1JU3A 1ULPA 3MUY1 2HFHA 1HB1A 2EAKA 1WH7A 1RUG3 3KP6A 2KLVA 1IC8A 3SMHA 3FMQA 5SV8A 1FPN1 3OY8B 3N97A 1ZW0A 4HH2A 1LGNA 4LGDE 1JTZX 3AL0C 1J9IA 4XLAA 2D6KA 4DQ2A 1ZYBA 2PG4A 2CQ7A 2DOEA 1AYM1 2XQXA 1USDA 5AW1B 1DZRA 3I53A 1AWCA 4BRYB 2ZX2A 3BCCG 1JTHB 2JK3A 3OUIA 3NL1A 2A6XA 4KHXA 4TV7A 5JXHA 2W1WA 5FZ6A 4XETA 2HLEA 2B89A 4UVCA 3JD73 1MBEA 5FQ0A 1OLRA 2DK5A 3X29B 1AQTA 3T1LA 1AKHA 2Q8EA 3BTCA 4IQ4A 2QSGX 3WE2A 3JD72 4QXCA 2D1VA 1BW6A 2K9JA 1J1EC 1ZG3A 2Q30A 1OR7A 4K21A 3R60A 5FKLA 2DT7B 3HSFA 1NHAA 3T4HB 3FKJA 2WRAA 4L11A 1D0GA 2O03A 1ULFA 2O0YA 1TME1 4HAMA 5M3FJ 1HH0A 3CX5E 5LGTA 1ULEA 2QZ2A 1PZ7A 1ZOYC 2IZ0A 3B5NC 1RJ8A 2DFHA 1GXQA 1QIQA 1QJU1 1HRI1 5BNOC 4Z2YA 3A0HC 1USEA 1OA2A 2FZ1A 4XZPA 1M7LA 2LR2A 3F8NA 4GJZA 4UNOA 1SQPJ 3DKQA 1Y56A 1FOSE 1A8MA 3O2PE 1ZGJA 3FHZA 2Z5WA 5FP8A 1FOD3 1ETYA 1L4AD 4DY3A 5KLIC 2J1EA 1VF5C 1FYMA 2ISZA 3FZVA 3NEUA 2O0OA 1FOD2 3E6BA 4QKDA 4W4ZA 1SLLA 2CS3A 4YGDA 1W2EA 1IXRC 3JCUE 3I56I 4M0NA 4OULA 2K37A 3BTIA 1TMF1 5D6EA 1VAVA 2FYUD 2R7ZJ 3PLNA 1HB4A 2VIXA 4JPZB 2WFPA 2P2KA 1NCQA 1HBXG 4DYRA 2YO2A 3K4KA 2ZGQA 5KLVK 2XSJC 3L2HA 3TEYA 3ZFGA 2B39A 3KZIH 5CFDA 5AFEA 4D6QA 5DS9A 1NK2P 2M5AB 2IS1A 1RUH3 3DXJF 2R7EB 3CHXA 2L3DA 4KGGA 2XUMA 4HJGH 2DVBA 5FPLA 2E75B 4XLEA 2YXRB 4O9BA 5LZ6A 3L35A 2AR6A 3VDCA 2OYIB 3WG3A 4IEOA 3IWZA 1VBC1 3ELKA 5CYYA 2E26A 4JTOA 1Z91A 4XKWA 2WADA 4NIIA 3OUJA 2NM1A 4RFT0 4XLFA 3P5BA 1B59A 3OY8A 2NS7A 4OWRB 1TW3A 5DUKA 2NVYJ 2AXTE 2P6CA 2FXPA 2ZBJA 3OGRA 5JIUA 4W6XA 1WCSA 2H8RA 3KYDB 2R92J 5CKQA 2ARXA 2BDRA 2VKEA 3PUHA 3H5AA 4Q48A 1JTHA 3RYRA 2JWAA 3WLUA 1VBE3 3IAPA 4Q0PA 3A0BE 3H42B 4KN7X 3U14A 3CF2A 2YU9J 2X1EA 1AR72 1HW1A 4IW3A 4W1UA 4RA0A 3SH3A 1VBE2 5HPOA 4MO3M 1ULCA 1VBB3 1DQ6A 2J1RA 4UY8I 1W2BO 4K9SA 1H2LA 2AXCA 2FCUA 3CKHA 2AS5F 1KDMA 1FDIA 2R063 1OQEA 3O6QB 3AP5A 1VBB2 3F21A 1PX3A 2IVIB 3QH6A 1J09A 5JSOA 1PVC1 1ASJ1 3H5NA 2R062 3HBZA 3ZSJA 2W92A 3DKYA 3PHMA 4XBQA 2G3AA 1ZXGA 2CY6A 4GULA 1VRBA 1U7MA 4KYWA 5E79C 3DYMA 2D3PA 3SEQA 5L19A 3R0RA 2X6WA 3LNQA 5E3OA 3LKJA 3I4MJ 2IBDA 1WCDJ 2EA4A 5EDNA 1FMD1 2IS2A 5KKZC 2QBXA 1Z7UA 2D5FA 4EGYA 3U37A 3MF6A 4YEJA 3RL0C 4GKGA 1BK0A 1T6BX 4B09A 3AG1H 2ME0A 1YC61 1UXXX 3NRUA 3MKYB 2QENA 3LB9A 5CLSA 4X0GA 1UYXA 4G7ZF 1T95A 3O5SA 2BOLA 2BVLA 3MIEA 1ND3B 2VOXA 4Y28J 3USSA 3KIOA 2VQUA 3LD8A 2F5CA 3N9OA 4GAZA 2A45H 5E8IA 1ENXA 3SEZA 2ZSHB 2YC2A 5JDBA 2IBZG 3S7IA 3H1IG 1LDKB 4UB8C 4XACA 1OFCX 3MVPA 1SBEA 2K4BA 2A6YA 2RJ2A 2ZJCA 3ONQA 3EO6A 2JDPA 4E7IA 2BOIA 2CUEA 3RK3B 1S7EA 4KUMA 1IKQA 1F15A 3D70A 1X7NA 1UOGA 1AR81 5F3GA 3DBRB 1US2A 1UZCA 4C30A 1LJ9A 3MZYA 4C3IJ 3CMMA 3PSFA 3CWBD 3URFA 5DDJ3 3WQ1A 5JLVA 1H8TB 2X51A 2F4PA 5IHRA 3P7NA 1SQVD 3INAA 3DTEA 4XIOA 3WU2C 3K70C 1REFA 5DDJ2 3JTGA 2OYIA 4MXWB 4M0HA 2NNNA 2WQZC 1BXHA 1RUJ3 1SPPB 1S9KD 3P8MC 3LFUA 1GT0C 1XU1A 3FLRA 4CPBD 3SWKA 4XRMA 3AMNA 1WMXA 4RGSA 5T55A 4QX8A 5BV6A 2CK3H 3KQRA 4BQ1A 1FZPB 1EZVE 1TNRA 4DB5A 3WU0A 5A6ZA 4MO7A 2O14A 3UK9A 5FY0A 5M5WJ 4CDXB 4PDKA 3OOUA 4DFSA 2R3CA 1TL8A 2ID3A 3VYSB 2QZ3A 4QPYA 1GZ9A 2VE1A 5CAZA 3EYIA 4Y1ZA 3P9KA 4G6QA 1ITYA 4UB6C 1EZVI 4BE0A 4C1XA 3A0NA 2CMPA 4B48A 5E3NA 2XUBA 2ZTNA 3AXEA 3LSKA 2YR2A 5D4RA 3G4SP 2BFUS 5C5TA 1YJNI 3KT7A 3MUZ1 4A3FJ 3JTHA 4PQQA 2VVDA 2ZMLA 3C7HA 2GNDA 4RM2A 1GVJA 4PV1D 1A6QA 3GWZA 4LFUA 1EDKA 3O6QA 1VMFA 3HPNA 3ALQA 3VZJA 4EWDA 1GZLA 1A34A 2PAJA 1V9U2 1FOWA 2HYXA 4PUSA 1W6PB 3GUDA 4XTMA 1BDCA 3E7KA 2XSDC 2JR8A 3SXYA 3B9CA 2VI6A 5C4WC 2OPWA 4COZA 2X8KA 4AVAA 5FRNA 2QJKB 4G7OF 1QHDA 1BK1A 1BA5A 1FU1A 1BN5A 1SBFA 1KC8Q 1LFBA 1IGOA 2WZ8A 3EXUA 3MFCA 3OYIA 4HSRA 1VQOP 3CD6I 4NPMA 2EZIA 4D0PA 5IK4A 1POV1 1RHZB 4BJ6C 3R4KA 1ENRA 1HQWA 2ITAA 3C7JA 1ND3A 1DP0A 2HWVA 3D6ZA 4AIHA 1FOXA 2VXJA 3M8FA 2P1BA 1C28A 2WO7A 4DZJA 3PNTA 1ZK8A 1W9WA 4PD4E 5E1WA 3H3ZA 1JW6A 1CAXA 1RUE2 4NHLA 1Z21A 3B01A 3NNFA 5J96B 4JV4A 4AEDC 3KLNA 2D2CB 1K04A 2FBEA 2QJYC 1YYCA 4ASVA 3W5NA 2HWB3 5KAIH 1FBUA 1WMFA 2ZA9A 2PI0A 4LIVA 4NPLA 2Z33A 2FKWB 2P81A 4ZZDA 4U3FD 4HPKB 4M3CF 4H13C 2K88A 3FDYA 2HWB2 4WVWA 2XRNA 1TW2A 1CONA 2N1TD 3M0AA 3LWCA 1WD3A 2FQ4A 1H8TA 4AYCA 4HX7A 1YI2P 5L73A 4QHOA 4V2FA 5GTIE 3EHKA 1JJ8C 1H88A 3U1CA 5T3NA 3J7LA 3A22A 4E7LA 4MXWA 5IJRA 3WZ1A 2OZ6A 1NU1D 1BE3E 2HOAA 3SQNA 1SPPA 3ZCOA 4G4FA 2EINH 3CCMP 2KFDA 1VQPP 1MZ6A 1RXFA 4FOYA 3AL0B 5CCGC 4LKEA 2KRHA 2DF7A 2ME6A 3C9IA 4BACA 4R9BA 1AU7A 2FUG2 1XC5A 1SS1A 1IGNA 3UNPA 2GC1A 2FY8A 2VLAA 1Q81Q 1WPKA 4CDXA 4AUXA 1H9PA 3VHNA 3SEPA 4JOMA 4P9GA 4EROA 2VVFA 2RGVA 3VHOA 5HCFA 3J8F3 3ST7A 1DIPA 4Z2WA 2AC1A 4DPNA 5KXCA 3HDDA 3PP5A 3HRMA 3ABZA 1J1EB 4AIDA 3HOVJ 4BHPA 2ZJSE 3BVHA 4IE4A 2AACA 1K12A 1R8EA 5GZDA 3DEMA 2EVXA 3LMMA 4XFAA 2TUNA 3KHCA 3FBYA 2EIMH 5FLMJ 1EDIA 3VDDC 4D6TJ 1VQ8P 5AW0B 3AZYA 3MFAA 3KEQA 2VZQA 1UZWA 4FOQA 3B5NB 1M4WA 1YW9A 2K2SA 2GH8A 4PJ0H 4QB2A 2Z3YA 3HNBM 4DT0A 3IKVA 3SEEA 4I6MC 1W6PA 1U8RA 1WJEA 2OXBA 3FXKA 1Z3XA 3LSDA 4LKDA 2EFOA 1HCRA 1OF3A 5JVTA 2FU4A 4XVHA 4D69A 2A3WA 4YFZA 2JWTA 3V5BA 2H94A 4QPGC 5FKBA 3H1JG 2XB0X 2FQPA 4JX0A 4AHZA 1R23A 1FYLA 5KLIB 3GO5A 1VF5B 1MEC1 3GTGJ 3L73E 1JXNA 2W1QA 3PQJA 4NOTA 1GZTA 5JI6A 4AU7A 2OU2A 1O3SA 1UX7A 2WNVA 4XF1A 4QQOA 5DD4A 1FSEA 2ZT9D 3LE0A 2PEXA 5KC5A 5C8CC 2QZ8A 4A44A 3T0AA 4IEJA 1OA3A 4MVTA 5CMZA 4IETA 1QQP1 3HOTA 4DGWB 1L0LD 2IWGB 2DVFA 2EB7A 2DDBA 4LB5A 1F2NA 1S29A 2WSVA 2QSHX 1Y0NA 4L9TA 1VAMA 4RYDA 2Z5IA 4DYCA 3I2GA 2YUSA 4H3WA 2OW4A 2LC2A 4C9YA 4EYYQ 5GALA 2M8GX 2WFF3 1SLAA 1SFCC 2XBO1 2P6HA 4NAOA 5AW3B 5EZHA 2DJIA 3H1KD 1GP4A 4B86A 4Y99C 1VP6A 5FXZA 3ITQA 2Z69A 2WFF2 3T8RA 5KHJA 4HPKA 3GDBA 3K4MA 1RINA 2JJ6A 4EJOA 3HN1A 1ON1A 1GXPA 2HQRA 1GV2A 1XMXA 2WZR1 5CG9A 3DFGA 3TO6A 4NPRA 4A3EJ 3ZMDA 3S3MA 2CW0F 1NKGA 1DDLA 2ZKNA 5FD5A 1ZARA 3AFHA 2KZVA 4UW6A 3HB9A 2C6YA 2J1TA 5AFBA 2R1DA 5B66C 2PAMA 2XC7A 2VMEA 5FOBB 3D4KA 2QUOA 4P5YA 3WNLA 5FPBA 4BMBA 1KDKA 4MGKE 1QHGA 1MZEA 2HWC1 1RMU3 2M3AA 4BYYA 1WSUA 1USSA 1UY2A 5T5JA 1FX5A 2NOGA 5FZAA 2OQGA 2Q1MA 2VZPA 1GWKA 1FNYA 3ERED 1ACCA 2B9VA 1UZVA 3BALA 1OF4A 4AE2A 3BR6A 2MA3A 1AA7A 4ZZ5A 4XC9A 3A23A 3Q0VA 5KJ7D 1DLLA 1PZ8A 1QNWA 2BCCJ 3C7FA 2DLLA 3AKZA 5A1LA 2VMIA 3AAFA 2P3IA 2F4LA 4BY7J 3H1HD 2UWCA 1AXZA 2PRRA 2IXCA 4C90A 3HMYA 4R52A 1PP9G 1SHWB 2VQHA 3B5NA 4IEPA 2A3SA 4P9JA 5BNOA 2H6BA 4E4ZA 2BE5F 3HQRA 2N9YB 3U59A 3DYOA 3RYPA 2Y0DA 2KIMA 1C3HA 1KV4A 1H0TB 3ERMA 3VYIA 3WSOA 3DCFA 2G19A 4IKFA 4CCOA 1OCRH 2UYBA 5LBBA 3KF3A 3RQIA 1K5MB 1YX3A 3UGGA 2VQLA 2BASA 2ET7A 1SVOA 2W1UA 4G9SB 1PFIA 4IL6H 4GWIA 2PHFA 2PFBA 4IFDK 4D0QA 3HRNA 2OPTA 4A3ZA 4WCGA 4OUMA 4P9FA 3SFEC 3L9JT 5EF6A 3WY6A 4QX3A 3MZWB 1S7OA 2DAOA 2Y0IA 4I1LA 2FXMA 3JRFA 1DBNA 4BQQA 2ZJPF 1W8HA 2WT2A 4HANA 3MIGA 2EH3A 1AZDA 1YYNA 3JD71 2LS6A 3J26N 5JPMB 1U5TB 3SCFA 5DXDA 3F9KA 3CCYA 1E17A 3POGA 3JCUC 3V56A 1GV5A 4YFXF 2JO1A 4HSJA 1WCMJ 1UCXA 3L9FA 2ZS6B 2AEMA 1VMJA 1JHFA 2P5BA 2WMMA 2AENA 4WY4C 3AYDA 1IW7F 2CWEA 3BCCE 3LA2A 3H8RA 1XBFA 1XNAA 4H7MA 5JI7A 2E71A 3CCRI 4K6BA 2N7GA 3T30A 4J19A 1HGZA 1EV11 2RHPA 2DA5A 3SFDC 1W9SA 5I0RA 4ZONA 4G12A 3FMSA 4BPZA 4IERA 2WYFA 1UB9A 3L70J 3HPGA 2O1JA 3LW5H 2VBZA 2PBIA 3QD6A 4KIGA 1BCCD 4XNFA 3HSRA 5HS7A 3L2UA 1UL9A 1W6OB 4GZ9A 4W80A 4HG2A 3M1EA 1M90Q 3OEAA 3ZQLA 5B5EH 2HKOA 1X50A 2DQRA 3AMPA 1ULOA 2OUHA 1LUJB 3GALA 5F5IA 2DYSH 1DF0A 1VI0A 5BVZA 1KB9H 1SD4A 1FBMA 3MW2A 3NWKA 4EM0B 3PU3A 5LASA 4AVTA 4RB2C 1CQ9A 2IGMA 1R49A 2ZGRA 3ON7A 2VUAA 3SZTA 5EGOB 2LKPA 5EG0B 1AL23 5FP9A 3HE4B 3UKGA 1PPJD 1UW8A 1HXS3 2FJ1A 1O91A 1HTLC 1PGL2 3DTKA 2MG4A 3PFYA 4AWDA 3ABUA 1SQXK 1P7IA 2EV5A 3L2YA 4Y17A 4S2FA 3UJOA 1AL22 4FTHA 2KHMA 4U7BA 1Z1DA 2V6EA 3I4IA 2WQ8A 1SQBG 1HXS2 3BG9A 1ULDA 2H43A 2KA3A 2ZXWH 5FXXA 3I49A 5J1UA 5C4WB 5J47A 4UFKA 1J0RA 4M3BA 1Y39A 3QP6A 4A69C 3WR0A 1H0TA 3RPQA 3RMYA 4BCUA 3VGIA 4IF4A 2Y9YA 2NOJB 1U5YA 1RC9A 5IWFA 1LNQA 4XZUG 4EI2A 3M3IA 1L0ND 1O7LA 3AL6A 3W21A 3CPWO 1VRH1 1W36D 5FY1A 1JYIA 1PJRA 4RS5B 3OGJA 2P37A 1IZ3A 1ZZ9A 5FLJA 3AJYA 1IO2A 2VTXJ 3THCA 1HDDC 2IXJA 2JDZA 5A3MA 1W0TA 2RV8A 1KFMA 2WT1A 1ZLLA 3OOPA 1XU2A 3QU3A 1KQ8A 5B3SH 2HJIA 1PUFB 1AR71 4QGLA 2XGCA 1RE4C 1V00A 4XDOA 1JY3P 2VBBA 4AEDB 1U5TA 4PI2A 1OVSA 2QJYB 1Z0HA 2ZGKA 1SQXJ 2PLV3 2LKXA 1W2UA 5F1RA 4CDWC 2JDIH 2IPPA 3CUQB 2B0LA 4CCCA 3T3YA 2JPBA 1VBB1 1YXWA 4B8EA 5HV4A 2A3YA 2AXLA 3VHRA 1I3AA 3ZN5A 2ZXQA 3EETA 2PLV2 2G8YA 4H13B 2HWD3 1RIOH 2NXNB 2C24A 2R061 3MF9A 4A45A 3DBHB 5DJUB 5L36A 4GDOA 1LTJC 2HWD2 1REEA 3K1PA 5BU8B 1TLHB 5KNLA 3QODA 2P4EA 3ETQA 3JRHA 3LDKA 1T98A 3S32A 4CXWA 4QU2A 5A3UA 1LECA 5LBCA 1ZBA3 4O5VA 4XAEA 2K85A 3G6JB 3AG3H 4N6JA 1K6YA 4XQWA 1VPCA 2R7QA 3CCLI 1ZBA2 4HVRA 1Q86Q 2BVVA 3GF2A 5A7WB 1MS5A 2Q8CA 2E31A 3ASNH 5HLGA 1XX5A 4YGBA 1XS9A 2FYUK 3PUSA 5D21A 1G9BA 5C7GA 2I45A 4LLNA 2DBNA 3OPTA 1RJ7A 2BOJA 3M7GA 3WG4A 2A6ZA 1VQ6P 4GMP3 4XUQA 4FPKA 3X2QH 1N7SC 3DTIA 1L2PA 1EPWA 3J7ZI 5CBLA 1KXGA 4UFJA 4W6YA 3UNGC 4LTAA 1ETWA 4QDRA 1S0JA 5L7OC 4N4OB 2TCTA 5BUVA 1SBDA 2QM3A 3VDDB 2WY7Q 4QX1A 5EGOA 5EG0A 1IG0A 4LKSA 3HE4A 3L00A 3K4DA 1UIXA 1XDSA 4PJYA 2DCJA 4B3NA 2IS4A 5BU5A 2B7YA 5E17F 1VQKI 3VMZA 1JBCA 1XNDA 1WI3A 5FYTA 3H1HG 3I3LA 3H1IE 3PJSK 4N78E 5C4WA 2FMYA 4OQ9A 3BIWE 1KD1Q 1JGGA 2K9ZA 5BYNA 2JN6A 2WNOA 2WSSH 2WTYA 2H7HA 1WZXA 2IBZI 5JAXA 1KONA 4OAYA 4BUPA 5J1YA 1UF2C 3MICA 3VD7A 4M73A 4OMDA 2XMLA 2XVLA 1R6RA 5C8CB 2VCMA 3KCYA 1NK3P 3H0OA 2O01H 2BGOA 1CI6B 1V55H 4ZJZA 1H0MA 5E89A 3ZDSA 3ILNA 2P3KA 2VMDA 4FPYA 1LTSC 1W6MB 4Q27A 4P9XA 5FFOC 1S55A 4AAPA 2ZSIB 1PUFA 5FP4A 2QVAA 3F3XA 4I01A 4IGQA 2IFRA 3NAPC 2LG4A 5GTHH 2OIIA 3D1NI 4AEDA 2F5VA 1KU3A 4U7JA 4UV9A 5APSA 2RS33 3VBSC 4CEYB 4Y99B 1E5RA 3IMNA 4XCAA 2I07B 2ILMA 5C9AC 5FLIA 1V9U1 2L4AA 5E18F 4NMIA 4Q0SA 2RS32 4Q5OA 4YG6A 1AJOA 3SKVA 1PO22 1IFIA 2WSEJ 2Y0SN 2ENRA 4AF9A 2UYAA 2IVMA 1E3PA 2PTMA 1QVUA 2KM2A 3ACIA 3BG3A 4F55A 4OCTA 5IUQA 5DUXA 1MS4A 2EXHA 2FMDA 1MGTA 3WGHA 1PGW2 4HYTB 5GZCA 2ADUA 3GW2A 4LJZF 3WQ0A 4DXTA 2OYHC 3D5SC 1BI1A 2JUGA 1UYYA 1Q3EA 5CCGA 2RC4A 3SNMA 5GTIC 1AVYA 2VQAA 4BDZA 1KB9D 2GZWA 2ZEZA 5DZEA 4XKBA 2UUZA 5A7WA 5J36A 5H9RA 3LA3A 2Z79A 5GKAC 3BRTB 1X3UA 3RG0A 1LVAA 3OY9A 4S2HA 1JY2P 2Y31A 2BNOA 4ENNA 1EF4A 3WTZA 2GMPA 4ZS3A 1TP4A 2IXSA 2R49A 3BVCA 3L2WA 1OW7A 1RUE1 1VQ7P 1NAYA 4P08A 1UN1A 2JUCA 4TLGA 2L7KA 2TBVA 4Y1VA 3H0DA 2DYCA 1F31A 4NRMA 4GYIA 3N05A 5C8WA 4OMCA 2ZMEC 3VDDA 1ZRFA 2DYRH 2W95A 4ZMDA 4QHZA 1QZEA 3U11A 3HBLA 3T97B 1EY2A 2XVKA 2HXIA 3IT8A 1F5FA 1RETA 4PBPA 1SQVK 2KJBA 1XGSA 4KG0A 1JZ2A 1QVGO 2PHLA 3HQUA 3EBRA 5H20A 2OKXA 2M1BA 2FNAA 2LM3A 2JECA 3H1WA 4L9VA 4HL0A 1JM0A 2C5DA 1UU5A 1LTBC 5F3IA 1DU3D 2O8QA 1QGPA 1H30A 2F17A 2ZHNA 2A69F 3L71D 2DTRA 4YIRX 3BC8A 4ASKA 5KCMA 1ZRIA 3WDYA 2KD7A 2R93J 2M0BA 5CJ4A 4LBQD 3LSRA 1N77A 2Y38A 2DCKA 1FOKA 3GEZA 1YQAA 3AECC 1JHJA 4R9CA 4G6TB 1G7YA 2XJPA 5FY5A 3UGFA 5FLVA 5FPXA 3MZ8A 4GKYA 4AL9A 5C8CA 1GDTA 1B9NA 4CP2A 2JVHA 1B4AA 1OC1A 1CI6A 1BEV3 5H2FC 5L3CA 1NTZG 4LHSA 3I64A 4MHGA 1GFF2 5BMZA 1W6MA 4NN0A 1SZBA 3EMRA 3L72D 1WT6A 1BEV2 1JS9A 1DEBA 2QVSB 1DQ4A 3BTZA 1VDFA 3QLQA 3LPGA 2L9VA 5A2QZ 4AI9A 3KETA 2PELA 1SFCA 1T38A 1PP8F 3KMHA 1GZCA 4LK0F 5GAEJ 1V6LA 3KZ4C 2JDNA 3QPTA 3GBFA 5LHHA 1KILD 4E8CA 3M9AA 1T08B 3S57A 4ORFA 2FDGA 3QACA 5KAFC 1UYZA 3OGVA 1SD7A 3W3CA 2Q5TA 1W9TA 4XDQA 3T2QA 2VN2A 2OAZA 5CVRA 4Y26A 4O9GA 3P3PA 2DPDA 3NMDA 1GOGA 1V6OA 3I97A 1AOYA 3HPHA 1Z9CA 4BHBA 1DQ2A 1B72B 2CPSA 1OOPC 2XV5A 1YX5A 1UMZA 3G9RA 4JVAA 1LJ7A 4Y20B 3L75J 4NRPA 3BOPA 4A5NA 2QQUA 1GQHA 4GCVA 2XZRA 4CCNA 2AHQA 1QJY3 3M3EA 2XHKA 1KRIA 4K40A 2FRHA 1AV1A 4B4RA 5FV3A 2SBAA 4WM7B 1EC5A 3BY6A 3ETPA 1IF1A 1D0ZA 1OX3A 3CMEP 3E3VA 3W6VA 4XF9A 2E5TA 4YARA 5CHXA 1ODNA 3W5MA 3N9MA 1BC7C 2NVUB 5LGUA 1W2NA 3F95A 2B4KA 2D6NA 1IAWA 3AEEC 1XE0A 1OCCH 1JMMA 5APTA 1DH3A 2SPZA 2FXAA 1JOCA 1MZFA 5GZFA 2IFNA 2PFXA 3AYCA 4Q5SF 4NC7A 4Q8KA 5JXJA 2A6TA 1VQ4P 2X1DA 3WHBA 2R7UA 2WFF1 4HLTA 3TRSB 2OTLI 1HBWA 3T97A 2XAJA 3ISPA 3ZM8A 3AM2A 1I6XA 1AVBA 1MPXA 3M2MA 1Y8QB 1O8PA 3LSMA 1LOBA 3T09A 1OUSA 1YQ2A 2CG4A 1T56A 2K3RA 2JIJA 3VD9A 2OUMA 1NU1K 2D98A 2Z5HA 2V4VA 5LA9A 1ZQ3P 1SD5A 1KGSA 4C2TA 1OPCA 1V5EA 1IRFA 4M71A 3W6KB 4WWIA 1RUI1 1M56D 2ICWG 3KM5A 4CTEA 2H8PD 1YO8A 5TISE 4LE3A 2VTXA 1I6HJ 2ZGMA 4JQFA 3LSGA 3RK2B 4IRGA 1RGSA 4XFBA 4ASMB 2JJ7A 1LTTC 2W57A 3CDIA 1RESA 4ZYDA 2AO9A 5LY2A 2R30A 2XLFA 1W06A 4FP3A 1J83A 1W0UA 1F4HA 5EXOA 3HOXJ 4BWOA 3CWBE 1IPKA 1TWFJ 1G4DA 1H6XA 1HRV3 4P5HA 3JUUA 1S4XA 4OHVA 2GIZA 3NJYA 4IGOA 4UHTA 1AVOA 5GPAA 4CDWB 1XYPA 2JIGA 1SQVE 1TEIA 4ENJA 4L9JA 3QH7A 3HJEA 3OYKA 3WUTA 2P10A 4U2AA 4LBMA 1UO9A 2W2IA 5D1IA 3PIGA 1SEFA 4YNIA 5DCFA 1S9KE 3ZMTA 1UXZA 1WMDA 2ZJ2A 4RLFA 2VNGA 3OMYA 4EN7B 1GNYA 1R1A3 4XM3A 2HPMA 1LTJB 3H1LD 1ONAA 1Q1HA 2P7CB 4QPOA 3OUHA 4DZGA 1K79A 2Z16A 4I2OA 1UPSA 2DBIA 1BJAA 2O7OA 3CCJI 1R1A2 5H9QA 3MKZA 2YHJA 2HWF3 1Y1VJ 1RL3A 4AVZA 2MNGA 4NHYA 1BDDA 1IRZA 4CU7A 1ZTRA 3FBNB 1B72A 2ELHA 4B3AA 1D0HA 5K5OA 5J3LA 4Y20A 2C9KA 2HWF2 5DAQA 2XAQA 4DOJA 1JH5A 1RE3C 1X8MA 1GHCA 4UFIA 4DY5A 3T0YA 2WBMA 1SLTA 4N43C 4QPIC 1GL2C 4V1PA 4QD2A 1JZ8A 2EQRA 3P5JA 1PP9E 2DO7A 1L0LK 2BZTA 1RPWA 1QPIA 3I59B 5C3SA 4GH4C 2QLZA 3OL3A 3V2PA 2IT0A 1N7SB 1LHOA 4GJYA 3CLPA 3RZMA 1ENQA 2F5DA 2VXRA 2QQWA 3A0HH 1SG3A 1GICA 4U36A 3VZNA 4L0ZB 1LOGA 5BPIA 4H2AA 3WG1A 5JWPA 5D8AB 1M8OB 2VUDA 3SISA 3KPHA 1D4M1 2W00A 4NR1A 3PTYA 3BODA 1RUD3 1QL2A 5M1BA 5E6HA 3OYWB 2B63J 4G8XA 3JBG3 3OA7A 4NC8A 5JVGF 2BEQD 3FXDA 2V26A 3RKQA 3FXLA 4XN3A 2QDNA 5L3GA 4CP0A 3QP5A 5DAPA 4RB0A 1I50J 1LTGC 1PGPA 2EFNA 3PRJA 2FXOA 2YXSA 3KZIE 1H2KA 1K4SA 2FOWA 3RK3D 3OSGA 2VOOA 3P1IA 4DQAA 2KI7B 3TYJA 2R4GA 4MYEA 2F4OB 3L71G 2F48A 2I8DA 2JVGA 3LEGA 2HVSA 3TYYA 3CP8A 4IOAF 1GD2E 3T1MA 4UOJA 1SFEA 3CDLA 5FZ7A 4U3FE 3G73A 4BXFA 4C0BA 2JA6J 2V9VA 3P9CA 1RE4A 2DA3A 3L2CA 4JRAA 5JSRA 2WPVB 2DCZA 3GLMA 4B4QA 3VP9A 1MDMB 1WFXA 1X1PA 4Z07A 4CDWA 2STWA 1FZGA 4XFHA 1FOYA 5IK7A 2WA0A 3BR5A 2QBYB 3VBSB 1W3XA 2EIDA 1PGL1 2CYYA 5DJTB 1H4HA 1UIKA 1P84H 2DMNA 1USTA 3RKYA 1RUNA 1HXS1 3HRUA 5E3MA 1DGLA 4LITA 3WTYC 1LTJA 4ZY9A 3BTJA 5FKKA 2WO2A 2XWJB 2HQNA 3B4SA 5DG1A 5DN2A 3OTFA 2C4XA 2ZMNA 2IJLA 3WHCA 1Q8QA 1X9VA 2KXLA 1BHGA 1PL5A 2OYHB 1QJFA 3MIBA 4HRIA 1NVOA 4ES8A 1NO4A 3UT0A 5HXMA 3JRIA 4XRFA 1U5XA 4RS8A 4YZ2A 4HOBA 3POBA 2CSOA 1ORKA 3O6BB 4EQVA 4FE4A 3RIRA 1X0TA 1NGMB 2CDPA 5FYZA 2XUEA 3KV4A 2HZDA 5A2QK 3JRCA 2ESNA 1AR63 2YX7A 3I59A 5CBOA 1SQPD 5LCWL 4QLCU 1N7SA 3ILFA 3H36A 1JKOC 2YFZA 3S4RA 2JB8A 3F22A 3PVEA 1AR62 2M30A 4HEA2 2I10A 3K4LA 3ABTA 2ZMEB 3PFIA 5FKNA 5JR2A 4Y4YA 5JHUA 3DPLC 1MUUA 5BNNC 1FZCB 2CUFA 2PLV1 1GU3A 1KA8A 2R3SA 5AONA 3TGUG 4O61A 1NLQA 1BGYG 4KA4A 3U1KA 3JREA 2ZYDA 4BEHA 3EB7A 4BHCA 3SWFA 1OCPA 2LH9A 1DGWA 2XKOA 4Q0VA 2L5QA 4E27A 4M3EA 5I8TA 3WF4A 3OYWA 3N36A 5IVJA 2DT6A 1TWGJ 2UWAA 2FBKA 4J6GA 5DDGA 5IT6A 2VT2A 1O59A 3L36A 1L0LE 1Y9MA 1MACA 1QOOA 3VYTB 4RESB 2NQYA 2YX4A 1ZBA1 2ZXHA 2DMTA 2QA4P 2E2JJ 1Y9QA 4PZJA 2KZIA 3CC4I 4LBNA 1Y4WA 2K86A 4JHTA 4AVBA 4AFDA 4LT5A 2H1KA 5EHDA 1BOAA 1OYYA 3FF5A 4DBRA 3A01B 2D3RA 1S0CA 3H1KE 4HKOA 5E88A 3SSUA 1BCXA 4XOTA 2PHUA 4PIXA 3I2KA 2B9BA 2G9ZA 2HODB 3WDTA 1VALA 3RZHA 4P9WA 3KEOA 2BY2A 1YJWI 3HOUJ 4GMP1 2Y6JA 1WCUA 3MLJA 4S0HB 4NPDA 2Y64A 5D5UB 1MDMA 1SACA 3K1MA 3MI8A 3WU2H 1LAJA 3FE5A 1ZLKA 5IW0A 1FZEA 5FYBA 3OWTA 3M9HA 1OH3A 3M0DC 2WWUA 1R1UA 2QBYA 1L7RA 3VBSA 4LKFA 2E51A 2E74C 5FKMA 4URTA 5F7UA 5C9AA 1GP5A 4ZDOA 3BIEA 1EDLA 3ZOBA 4F83A 1SANA 1XG1A 3MBWA 3NJZA 3THDA 4PBOA 3AZXA 2DUQA 2OCCH 3KT4A 1VBD3 2POHA 2RDPA 4M3CB 2LRPA 2YPRA 2XLGA 1OQDA 3SDBA 1H9GA 1OOPB 3VBFC 1L0NK 4GODA 1DYOA 4AW7A 4E9KA 4I09A 2OYHA 1VBD2 3QU6A 3AZVA 1KJLA 4ARYA 1FPN3 2JJLA 1S8NA 4UB6H 1GANA 1XE8A 2YBPA 2QJPB 3CLOA 3CI9A 4GALA 4MFEA 3B5ND 3W68A 1H8AC 3H1HE 1SDDB 2P4WA 3HT2A 1I27A 3ABMH 2YROA 2LR8A 1NTMJ 3GHMA 2PHWA 3FXUA 3ITKA 2QQVA 2VOWA 2BNNA 2XVCA 2YXQB 1R092 1UIIA 1W99A 1W8FA 3M3OA 1VQ5P 4F91B 3DEUA 5F39A 1KYOI 2XPVA 3CJIC 2ZMEA 4C3JJ 3GXOA 1VF5D 2KQRA 2RN7A 5D2AA 3F8MA 1WJAA 4ABZA 2QEXP 2RS31 1PO21 3CP2A 2J5UA 4BIFA 1Y1WJ 5F27A 3NSTA 4XJ8A 4FQGA 2W91A 5B4NA 1ZN2A 1PGW1 1WHUA 4S2GA 3RZKA 2R44A 3POJA 3GMAA 4D6SA 1VPHA 2VO5A 3ZN4A 1N75A 5FD6A 5AW7B 1X3WB 3R0JA 5KAIE 1VQ9I 4K20A 4QKNA 4EN0A 4YSFA 2ZXEB 4FOWA 2LSOA 4A6EA 3H1IJ 1UG2A 2HVRA 3CD6P 4FXGB 3ZYGA 2ID6A 3OGSA 1UZYA 3HJRA 2RNGA 3UKTA 2Q3EA 4QDQA 3JCIA 5M5XJ 2GA2A 3KX2A 4AEJA 1CX1A 3ZXSA 3KZZA 3VYUB 1O4YA 1U5IA 1H0BA 3DEEA 3S1NJ 3HKZN 2NLRA 1S72I 2OC6A 5GP9A 3J7NA 4KI5M 3K4CA 4UT5A 3CQZJ 1P84D 1W28A 3HM5A 2M4GA 5CIRA 3G6EP 1RITA 4ZZ8A 4YFKF 5K7HA 2NS8A 3BG6A 2WAQA 4ZKUA 4J00A 2B9SA 1YIPA 1X58A 1YITI 1IXSB 2R16A 3HR9A 1IG3A 3W9AA 3A0KA 1URQD 2L0KA 1NKNA 2GU9A 4HNTA 1S5LC 1UAIA 1FJLA 1BCCE 1S0GA 4GIFA 1G8WA 4ONUA 3SDGA 1CR7A 1J59A 4H0LC 2CV6A 2IS6A 1LULA 3GTLJ 3ATGA 2ZGUA 4M3CA 3NJXA 1QXPA 1JUPA 2VBYA 2L2OA 3I9V2 3OYHA 1IRXA 1VBC3 3CCEP 1FPQA 1OOPA 4YG3A 2IFMA 2JTVA 2KUBA 2HYFA 5JCTA 3P7KA 4I7ZB 5I8SA 4YW4A 5LW9A 2ZHKA 3G7DA 3RGBA 1OSGA 2WT7B 1GL2B 1VBC2 3C8XA 3CF6E 4QPIB 5F8PA 2K0GA 5FLHA 3ZKYA 3PLQA 3RI4A 3DXTA 4XBLA 2UWJE 4Y24A 4XR6A 1WBFA 5LRRA 3D5LA 4HDUA 5A80A 5K4LA 2N8GA 1R5LA 2VZVA 3MV01 2EFPA 3V7SA 5AW8B 1PPJE 2A05A 4GH4B 4XXAA 5EV7A 1I1GA 2ARBA 2ZXXA 5AVUB 2P7VB 3NWSA 2VZRA 5C3OA 2LP0A 2XONA 4IHXA 2DDUA 3M1CA 2BJSA 1T0FC 2Y69H 3AE8C 3DF0A 5KVRA 1IN7A 3PUAA 4PHZA 5DG2A 2HBTA 5LA2A 2PN6A 1PDNC 3M9QA 2ATFA 2C9AA 1NZIA 2YKOA 2EZKA 2VECA 4HMZA 3V0BB 3KPEA 2ID4A 3ZYIB 3KD4A 3S1RJ 1R7JA 1MKMA 4AGRA 4AFCA 2H8WA 2RR12 5APAA 4ZTFA 4DIQA 4XFCA 1L0NE 2VXZA 1MQTB 5CG8A 4I98B 3E1RA 2WPQA 1HIXA 3H25A 2YGMA 4CUAA 1J1LA 1UOBA 4CCJA 1P6RA 3U0ZA 1FJPA 4FPFA 4ARXA 4CCKA 3WF0A 3ZLIA 1XSXA 4BWNA 1GWMA 4EJVA 1FMD3 4DNYA 1YO5C 1PZ9A 3E6DA 1SLBA 3VWBA 2M9HA 1NG6A 1X1AA 4F3QA 3BUCA 3ZDMA 2XAUA 1XRUA 2P34A 4D5CA 4RKUJ 3KS7A 5BNQA 5AVYB 1DGRA 2Y9ZA 4I99C 2MW8A 2FCVA 2FE3A 1T39A 3MLLA 4BXSV 2TRTA 1CZQA 1LHNA 1YUDA 1P92A 3TL4X 3BOWA 5L9BA 2VT3A 4HB1A 4KISA 4A41A 1U78A 2Y6KA 4XJWA 5TISC 3COAC 4N90A 3LW5J 1TTYA 4CXXA 5I93A 1Y9GA 2V72A 1J3RA 2GP3A 4A3LJ 2CGNA 3CXHI 2EFQA 3OB8A 5TJHA 3ZQIA 2HYJA 2Q1KA 1GSLA 4LIUA 3J81Z 2P3YA 1AR83 1IKPA 3VFZA 1LTEA 3AEGC 3JXSA 2QQOA 4RR3C 2O8XA 1CAUB 3HTSB 1UYPA 1KQGB 2I5UA 2V1DA 2QSFX 2VZOA 4IL7A 3HOYJ 1FAVA 5B66H 3C2UA 1EH7A 3O1UA 1AR82 5AVXB 2WB1A 4K8RB 3NV1A 1FATA 1SFKA 4RGKA 2ZNZA 2IW5A 1CAWB 3UR3C 1YFHA 4EATA 5KLVG 1PMJX 5FZ9A 2QQJA 2EZHA 3OBZA 5F0HA 3WTXC 4D6TD 1ZZ6A 2O8OA 5FZGA 2L9NA 2W6AA 1NT0A 4P9LA 2X0LA 3SFZA 1RE3A 2QCSB 5ANNA 4OWFA 3WNKA 4GRIA 1S0BA 4P02B 4QPIA 1GL2A 1DQ5A 4HV6A 2NVQJ 4EJUA 1K45A 1L7QA 1HDPA 3RS6A 4XBFA 3GFIA 5IAXA 3H0GJ 1YS6A 3LQRA 1PVXA 2W27A 3KHBA 5FYIA 4GWNA 2FD8A 4GH4A 4EQQA 1D8JA 3MIFA 4AZZA 4D7NA 4EOTA 1DU0A 3CJXA 3A4CA 2C9NY 3I7DA 1R9TJ 1STMA 5DM7F 5HLTA 4UFHA 3IUOA 2GNMA 1HW2A 2VBDA 4OU0A 3TP3A 5BNNB 3HTUA 1O4XA 4UW5A 4PV1C 4MNUA 2M8RA 4OH8B 4IL6E 2I1JA 4LUKA 3V0BA 2GWRA 4RGGA 1VQNP 1JHHA 4Y52J 3SWYA 3PSIA 1D1BA 4ESBA 1QXRA 1W03A 5KXDA 3EYYA 3H1JJ 5LA1A 2Z99A 1Q5OA 1X2NA 4GD4A 4NIGA 2UURA 3Q5RA 1X4PA 4Y1YA 3ZN1A 2PJRB 2E43A 4QWNA 3DKWA 4Q4V2 2EPFA 4MOAA 3M07A 1WRGA 3KV9A 1NHLA 5FUNA 1N73C 2VE8A 3OYDA 5APXA 3OBTA 4BAYA 1ZR2A 1JKQC 1YYVA 3FGAD 5GADJ 2HWF1 5I0UA 3FKIJ 3W20A 5IVCA 3MIHA 4BISA 3LPFA 5FMCA 3NRVA 2Z5UA 3SLIA 4TN7A 3OIPA 2ZMKA 3TEDA 3LFKA 1POV3 3M91A 3RBZA 3K3OA 1W05A 3HZJA 1Y8AA 2PHDA 2YBSA 4LGWA 5KTBA 1MR5A 1WJBA 2F4IA 3TKYA 1JZ4A 3UKNA 3VL8A 4XYXA 3MHZA 5D6FA 2JSCA 1TNSA 3ZGKA 5CVVA 2GQQA 1Z6TA 4TWTA 4WZFA 2X5IC 4L9NA 5IAVA 4QKFA 3FXMA 3RJ2X 1A8DA 2BXZA 3ZSLA 1LGCA 2VQ0A 2WNUC 2LY9A 1G3TA 3V0AB 2DU1A 2Q6QA 2DTYA 2P6SA 3KE2A 1Z7S3 1SQQJ 3B73A 4YXWH 2XJRA 1WLCA 4P9IA 1OQ1A 5B5EE 1FMVA 3U21A 1CJDA 5ICCA 1BE3G 4JYBA 3KQGA 1Z7S2 1RYYA 3EDPA 1CAUA 2QKMB 3HHHA 3NNLA 4OVEA 5ACA3 1W8WA 2V73A 1KB9E 2ZGTA 2I1KA 3LAJA 3CCRP 2QQBA 4Y5Z0 1OISA 1KYWA 4L92A 4XEZA 1IN4A 2V5DA 4MHUA 1JYCA 3RZJA 3VN0A 4DNCA 4KJZA 3A2KA 3PNAA 3VBFB 5ACA2 2JDKA 2BCCD 1XNKA 2F4MB 1K05A 1CAWA 3R0AA 1EQ7A 2YKQA 3BT9A 3VZOA 1KB9I 1SLCA 1XSRA 2RREA 3ROUA 2ZNYA 3ZMNA 4CXYA 3WUDA 1LDDA 1OI6A 4AFMA 4LMFA 2W25A 1BOBA 5I91A 2E34A 2K5CA 3K75B 1GOFA 2K9SA 4OOIA 2WZEA 2X6YA 2VR4A 2JDMA 1YWKA 3C3WA 3WODF 4BE3A 2IA2A 1RF1C 1DPUA 4WF2A 4XSZF 1JTYA 5C39A 2JG8B 3HGYA 3VODA 1GVDA 3LSTA 3C3VA 3D82A 3TQNA 1CN1A 2L5GB 4WVVA 1EA3A 2VOPA 5IT9Z 4RJTA 4QB6A 2ZX1A 2V1UA 1BLZA 4W65A 2EK5A 1PP9J 3CJIB 3ZXFA 3NXSA 4I30A 4FCYA 4G6DA 1XXNA 4CVUA 5BNNA 4BQ5A 3S3NA 2E60A 1LOFC 1DQ0A 3JB8A 1VQMP 3L71E 1S9HA 4B47A 2FYZA 1YTZT 1LDJA 1FT9A 4IEQA 3TO9A 2QUFA 5EEAA 2IVJA 2E76B 4P9YA 3BU0A 4BE1A 3L73G 2QFEA 1MMGA 1VB4A 3KYLA 2XLAA 3A3YB 4Z82A 1ZAOA 4RBOA 2W84A 1XGNA 4HQMA 3VBHC 5IYBJ 4E2SA 1EH6A 2PJRA 2WKKA 5ABJC 3DLLF 1IV8A 1BBYA 2WZPP 1LQ1A 4AYUA 3AKSA 1IJDB 4DOUA 2L54A 4DBQA 2WTEA 2DUOA 3L72E 1RKTA 4NWVA 1MEC3 4GXOA 2R0QC 3CJTB 4IQJA 1H8VA 1WJDA 2JG9C 2BBVA 5K7PA 2YSRA 3AEFC 1M1KQ 5HBAA 1AX2A 3MUDC 2YUEA 3P3NA 5EJ1B 5JOYA 2BV6A 1KORA 4KG8A 5DM6F 1QQP3 2CH0A 2XV4S 1B8IB 1LENA 4E7ZA 1FX7A 1KILE 3L70D 3AL5A 3ES4A 2XJQA 1YHQP 4YGEA 1AR61 2WSEH 4ZU7A 4XQFA 2CAUA 4M74A 5L9RA 4AOCA 5FYYA 3O14A 2FOKA 1QQP2 5EJZB 2R7DA 1NLRA 1Z67A 2A06D 2PJPA 1EDJA 2W83C 2K9JB 2CAVA 3BWGA 3M0DA 1F9KA 5KHIA 3W2AA 3SXWA 2M0MA 4WVZA 1S2EA 1L7LA 1Q8OA 1ZBE1 3S3OA 2D7FA 3FHAA 4Q0QA 4CU8A 2BBYA 2R072 5IPAA 3U10A 4N9IA 4H0LB 1WWYA 2KSJA 2JENA 2WITA 4N0BA 5FJ8J 5LD2C 4IE5A 3UGHA 1OMIA 5B1BH 3RYKA 1K73Q 3OR2C 4XRSG 2CV2A 4JGZC 4HNUA 2WZR3 2MPFA 2Q4SA 2CDOA 3VBFA 2VQTA 2JEMA 5F32A 2X6OA 1G6NA 4KT0J 1QPMA 5CZKA 5FKCA 2FD5A 4JGYC 4ZC3A 2WZR2 3EQ2A 5IVYA 4XL9A 4IJAA 4Y22B 4JCKA 1FOSF 3ZXGA 2XF6A 3J7AO 2LFBA 4IGPA 4COVA 3QBQA 2NNYA 3ABLH 2GLOA