1QL1A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql1A00
2IFMA 1QL1A 1IFMA 2XKMA 1PFIA 1ZN5A 1IFNA 3IFMA 2KLVA 1QL2A 2IFNA 4IFMA 2KSJA
chains in the Genus database with same CATH superfamily
1YBKA 1RF0A 3V4WA 3CWBD 1H0TA 2IZ0A 1LTBC 4GKGA 3CXHE 1RE4A 2IBZI 2K37A 4L73A 4PJ0H 2HYNA 3EQ2A 3H1LJ 3L36A 3RBXA 3CCVP 1IO4A 3A7OA 3K5BA 2OYHB 1NKNA 3NMDA 2AXCA 1BGYE 3V2PA 4BWNA 2OYIB 3JC22 1KTMA 5DJUB 1J1DB 2IYPA 4I7ZC 3VMZA 3Q2YA 2M3EA 1BSNA 2OTKE 3TYYA 3MZWB 2HODB 5APVA 1FZBA 2A06G 5TISE 2I8DA 3FX0A 3U1AA 2IX7C 3AE8C 2YO2A 1FJKA 3L74G 4ZNCA 1KB9H 1VQKP 3SWFA 3OA7A 1BCCJ 1R8EA 3L70J 2NPSC 1AA0A 2JR8A 4N3YB 2C9LY 5AVRB 1OFCX 1EDKA 1RY3A 3VMXA 1M57D 5BVZA 3H1LG 3P32A 1SQPG 2JJLA 1NTKK 1JCCA 1Y9BA 3WU2H 1KQGB 1URQB 2H8PD 4O9BA 1VQ5P 1FDOA 1A02F 2D2CB 1NTMD 2FFDB 1FE6A 3GHGB 1RF1C 2BASA 1PFIA 2GUSA 2MJZA 2W6JH 3H1JJ 4UB8E 3VMAA 1JNMA 4D6TD 1U7MA 2ZT9D 2KNCA 1FBMA 1GW3A 2SPZA 3GHGC 3HRNA 4GIFA 3A2AA 4N6JA 3O8ZA 1J2JB 2A45I 3Q3DA 1J1DC 3CXHD 1VQ4P 2WSEH 3S4RA 1HGVA 2O01N 3L72D 1DH3A 3BCCJ 1M56D 3MGNA 1L0LG 3H1KG 1OMIA 1J1EC 3JCUE 4H0LB 1YITP 3L70G 1BCCD 1CSBA 3U1CA 2CPBA 3O6QB 3L72E 3OJAB 2PFXA 1IK9A 2JWAA 3GG2A 4H0LC 1FOSF 1FZAA 3CPWO 2E42A 4JQ0D 4BRYA 2RN0A 2J59M 2YMYA 2KB7P 3L73D 5H2FH 3RK3B 4R4MA 1HF9A 3CCUP 4I2LC 1SQBD 2I1JA 4M3LA 4U7JA 5AVVB 2LKMA 4ASVA 1L0NJ 3PP5A 3CCJP 1NU1K 3H1KE 1Y8AA 5TJHA 3W67A 1KYOH 3IN6A 1RQUA 1EZVG 1URQC 1KB9I 1S5LH 1KD1Q 5KJ7C 1PGPA 2A45H 2KLVA 1CZQA 3BCCE 3HD7C 2FFDC 1G2CA 1AV1A 1EDLA 4IFMA 1LTSC 1VF5D 2KI7B 1Q86Q 5EFWB 1XTCC 2OYHC 3IAOA 4DT0A 1L0LJ 4GDOA 1KB9D 2KP8A 1M1JC 4WY4A 3Q1MA 2OYIC 1RF1B 2P7JA 1SQPJ 2AEJA 2E75D 1T2KD 4ZKPA 3KYQA 1FZGA 1K04A 3VP8A 5KLIB 1IFJA 4H13C 5CBNA 1SFCB 3H1JG 3A0BH 4PJ0E 1TU3F 2R5BA 4U3FJ 1GK6A 3RL0B 5KLIC 1XTGB 3L4FA 1NJIQ 2HLOA 2QJPC 3H32A 2WSCJ 3BVHA 3M9BA 2QIWA 1L0NG 1NAFA 1KYOI 2KXPB 3BCCG 3WUTA 3BATA 2M0BA 1VQ7P 1RE3A 2Q1KA 2YNYA 4WY4C 2OYIA 1NU1E 3B5NA 1X22A 4JYCA 2RKLA 1PV3A 4N78E 1DD3A 1ZOYC 3LW5J 1SFCD 2MKVA 1S9KD 1JUNA 1PPJD 4KT0J 1BDDA 1USDA 1KILD 5AW8B 3B5NC 5KLVD 4EOTA 3H25A 3RK3E 4YPCA 2JP3A 2QRXA 3PLNA 1NTME 1H88A 2KSJA 3TNUB 2K88A 2FXMA 5CJ0A 1LTAC 5AVTB 3H1KJ 4C7NB 4EDFA 2NRGA 1LTIC 3I56P 1W2BO 2Q5UA 1KILE 1LWUA 1GL2D 3D6YA 4H13B 5CCHC 2WSFJ 3CX5I 1S5LX 2IFMA 3BRVB 1NWQA 3HD7D 5KLVK 3HUSB 3P7KA 4UB8H 2YO3A 3N4XA 1FU1A 1OZHA 2WSEJ 1SQXJ 3T97B 4BXLA 3CD6P 2IYOA 2FFDA 3HD7A 4I7ZB 2N1TD 1L2PA 2FYUG 2O01H 1DEEG 1JEKA 1DEBA 3B4SA 1G1IA 1IJDB 1FS0E 2WPVB 3CLQA 3M91A 2PP6A 1NTZE 4L76A 4HH2A 1S2EA 4PV1B 5AW0B 1SQQJ 4YXWH 2O1KA 4IFDK 3MUDC 1RE4C 1LGHB 2QG4A 3TGUE 2OQQA 3M0AA 4PV1C 5AW6B 2H88C 1NHLA 1SQVJ 2UWJE 2R3SA 2YIUB 1FDIA 3JSVC 3RK3C 1ZV8A 1K73Q 3IR9A 2JEEA 1VQMP 1H8AA 4H44B 2HFED 3OAKA 1LP1B 1NTMK 2IBZD 1SQXE 1NO4A 2CPSA 2JWDA 2ZT9B 5GTIH 1SVFA 2O3JA 5AW9B 3G71P 3GLMA 3ZDMA 2ZYAA 3B5ND 4YXDC 2D2CD 5AW5B 1S5LE 1EDJA 3BCCD 2LXBA 2Z4EA 2KS1A 1DIPA 1KZUB 1OIPA 3MUDA 1KMIZ 1YQ4C 3G4SP 3L74J 1KB9E 1RQVA 1Q2NA 5AW2B 2A45G 1G2CB 2XNXA 3KDPB 3L73E 5BU5A 3CXHH 1E5WA 1NKZB 5CCGA 4KJMA 1KORA 2AEFA 1EC5A 5B5EH 2P2UA 5KAFH 2XU6A 2ZXEB 4WY4B 1FJPA 1RF1A 2GM4A 2KUBA 4C46A 1OX3A 2E5TA 3H1IG 2M5AA 1K8AQ 4WY4D 3CCLP 1OVVA 5AVUB 2J58A 4UB6E 1BGYD 3AE1C 1NTKG 2WT7B 1X8YA 3KZIH 2WWWA 3AE7C 3WUVA 5B66H 3F89A 3IFMA 1QEXA 1MV8A 1PPJE 3H32B 4PV1D 2Y9ZA 1T6AA 4RO0A 4W80A 1IC2A 2BCCE 2W83C 1SQQG 3D6ZA 1Q7YQ 2K1AA 4I6MC 4N78D 3RL0g 1ZXGA 3VMYA 3VOPA 3CCRP 1PP9E 1EZVE 1CI6B 1JTHB 2Y0DA 4WB4A 1W5CE 4L74A 2B88A 2FYUD 3B5NB 3D70A 1IFIA 1SQXG 4OWFA 2E75C 4U3FD 1T2KC 1HJBA 1IFMA 5CHXA 1GL2B 2CK3H 3LW5H 3P8MC 5CMZA 5CCHD 2NPSD 3OW2O 3F5HA 2JKVA 3H1IJ 2AEMA 3CMEP 3L70E 5KJ7D 2E43A 3CWBJ 1NU1G 5BU8B 4GODA 1YJ9P 1SFCC 1NTKJ 2YKQA 1GMJA 2FYUK 4PD4E 1SQVG 2NPSA 1N73A 1BDCA 1KILB 1VPCA 3RL0C 4ZKUA 2N1TC 2OARA 3AE4C 3II6A 1SQPE 2LR2A 1QGKB 1RF0C 3VP9A 1VQPP 1AQ5A 1Y47A 4B86A 4OH8B 3A3YB 2YIUC 1ZP0C 2A06E 2JDIH 2N1TB 3MTUE 3BASA 3HUSA 3CXHI 3A5TA 2C0WA 2W6BA 2QEXP 2N9YB 3G6EP 1WMKA 5AW7B 2KIKA 3HD7B 2XNDH 3P8CD 1YTZI 2WSCH 1LT9B 5E79E 4EI2A 1YI2P 2YKOA 4H13D 1M90Q 2L91A 3Q5RA 1NTKE 3RL0D 5CJ4A 1M1JB 3T97A 1FZCC 3U59A 3CWBE 1VDFA 3ITKA 3W68A 2D2CC 3H1ID 3L75E 4IOIH 1SQQE 1IFDA 4WBAA 3Q5SA 1N7LA 1NYHA 1W2EA 1NTZJ 1WRGA 3L72J 1GU4A 1BGYG 4WWIA 3CCEP 3G3ZA 1LP1A 1GD2E 3V2RA 4EYYQ 5APSA 4HKZH 4D6TG 1PIXA 3QWOC 2BEZF 2FYUE 2E74B 2GA1A 2G8YA 2WPSA 5AVQB 1GZLA 3CMAP 1AVYA 1FOSE 1P84H 2XDJA 4LC1A 1JO5A 3HUSC 1SQQD 2AXTH 5KLVE 2E74C 1VF5C 2V7QJ 1FZFA 1KFNA 3EFGA 2M3BA 3TK1A 1HBWA 2DW3A 3CWBG 1SQXD 2IFNA 5APUA 1LTTC 5B5EE 1QVFO 4WVZA 4DCKA 1VQLP 3RK3D 1FZCA 2QSIA 3L37A 1VQ9P 2KNCB 2KOGA 2OTJP 1BE3E 1HGZA 2B87A 2HG5D 3FWNA 1MFTA 2R5DA 3ABVC 3UIAA 4NPEA 3TF5A 3Q5PA 4IL6H 2A06D 4H0LD 1LT9C 4JF7A 2HPCA 3SFEC 3D71A 2Q3IA 3L73J 4LLHA 2XV5A 4CPGA 1SQXK 1YHQP 5APTA 2WT7A 3LIDA 1N73B 1NU1J 1LTGC 3FGAD 3HE5A 3L35A 1ZW0A 1OWAA 3HTKA 2Q9IA 1DD4A 3L74D 1USEA 2WPQA 4OVNF 2PAJA 3S1KA 4Z1MH 3I55P 3CX5D 1EDIA 3L75D 5KAFE 2YKPA 3USSA 1MUUA 1URQD 1LNQA 2QA4P 4NPFX 3S9OA 1JM0A 1NTZG 1X79B 3H1HD 1N2DC 4GOFA 1GW4A 2JO1A 2W6AA 4L75A 4UB6H 3V2QA 4JPZB 2OTLP 1OXZA 3KZIE 5CCGD 5GTHE 1JMMA 1SQBJ 5B66E 1M8OB 5K5GB 1ZR4A 2OYHA 3NTNA 1K05A 3AE5C 1NTMG 1EQ7A 1GK4A 1L0LE 1PP9J 1RHZB 3CC4P 1R5SA 1L4AC 3M9QA 3AEFC 3H1HJ 4HJGH 2O1JA 5KLVJ 4U3FE 1IZNB 1KILA 1X9VA 1ZLLA 2HODA 1FC2C 2OYOA 1SQBE 3I5CA 3L72G 3E1RA 1L0LD 3VTPC 1NGMB 1LT1A 1NVOA 1QL2A 2K3RA 3AE9C 3L70D 1KV4A 4I1LA 3SWYA 2R3CA 3G9RA 3GW6A 1GU5A 1AQTA 4GOEA 5AVYB 3LIEA 1JY3O 1PL5A 5C39A 1OVRA 3L73G 1GL2C 5GTIE 2HR3A 1DX7A 3PH0A 1SQBG 3CI9A 1NH4A 2WQYC 3AEDC 1NTMJ 1URQA 2QM7A 5APYA 1GDTA 1L4AA 3GHGA 1EZVD 1KQLA 4H44D 5H2FE 1EZVI 2KK7A 2YMKA 1HJ0A 3MD0A 1NTZK 1P84E 1ZRTD 2E76B 2ITAA 2AXTE 3TNUA 3H1JE 1JCDA 4C7NA 2QJYC 1HTLC 4HYTB 3KHUA 3H1LE 1LWUB 3IF4A 4TT3H 2POHA 3MP7B 5KKZC 3L75G 1YJWP 1UIIA 1U7JA 3A0HE 1YYCA 2V7QH 1LWUC 3H1JD 3O6QA 1L0ND 3M0DC 2R32A 1LTJA 3EWKA 3GF7A 1NTZD 3H1HG 1U57A 2IPPA 2ZT9C 1S72P 3SSUA 1BCCE 2Y9YA 1ZR2A 1JY3P 1WT6A 2P67A 1FZCB 2H89C 4PD4H 1IK7A 2B89A 1PZQA 1SQVK 3NFQA 1YIJP 1N73C 3KQGA 3R2PA 1SQQK 2G3AA 3PTZA 2Y0EA 3FXDA 1D7MA 1CW5A 1L0NK 1PP9G 1RH5B 2M8RA 3H6PA 4YTPC 3RGUA 2FYNC 4RKUJ 1PPJG 2J5UA 2W8ZA 2Z5HA 4IL6X 4W7ZA 1BE3J 3HE5B 2BCCG 2XZRA 3KXDA 3M0DA 5DJTB 5KAIH 5KLVG 3CC7P 4XE5B 5E79H 5AW3B 2WITA 1SQPK 3AECC 1E79H 2E5YA 3L71D 3CCQP 1Q82Q 2ZJSE 1ZN5A 3PHLA 1M1KQ 3WU2E 1KC8Q 3CX5H 2H7HA 1SS1A 1LJ2A 2GUVA 3H1IE 1N7SD 2ZVNB 2KS1B 1HVVA 1HWTC 4Y99B 2WVRA 1BGYJ 1JY3N 4IFFA 3TSIA 5CCGC 2H43A 3HE4B 4JBZA 4AQRD 4D6TJ 3NXSA 1N7SA 2WTYA 4DJGA 2Z5IA 1SQVE 2Q6QA 3E1IA 3N7NA 5AVXB 3B8EB 3H1HE 2E75B 1AJYA 2BCCJ 2M5AB 2P1JA 4XFJA 1N7SC 1LTJC 2WPRA 4AYCA 4ZMDA 1OW6A 3CCSP 2IBZG 1NAYA 1T3UA 3PJSK 1VF5B 1YQ3C 1PGQA 2K9JB 1T3JA 2O01J 2QJPB 5APWA 5GTHH 3QH9A 3V4QA 2FXPA 2WZ7A 4QMAA 3RK2D 5CCHA 2I1KA 2QJKB 4RESB 5AVSB 3L75J 3VN0A 2PRRA 1KILC 1P84D 1JTHA 1ZRTE 2NZ2A 2VRSA 3AEAC 2QJYB 2WSFH 4IL6E 2BEQD 3AE2C 1QVGO 4OGQC 1AFOA 2Y0CA 1VQ8P 5KKZB 3AE3C 1BE3G 1Z56A 1H0TB 3TGUD 2E76C 3TDKA 2IBZE 3JCUH 1FZEA 1L0LK 3L74E 1N86A 1L4AB 3MHVA 2KYVA 3C1LA 3PRJA 1KQFB 3SFDC 4C7RA 3AEBC 3RK2B 1PP9D 1FAVA 1KYOD 1OW7A 1MKMA 5APXA 1X0TA 3AEGC 3GMAA 1IFPA 4R4LA 2BCCD 1A02J 1S1CX 1EXIA 1MFZA 1S4XA 4PD4I 3RK2C 2B9BA 1OW8A 3A0BE 1RE3C 1NTKD 2KLUA 3L71G 1QX8A 3FWLA 3M9HA 1K9MQ 1KYOE 3V5BA 1BSHA 1JOCA 5AVZB 2FXOA 4GT1A 1G1JA 2OGUA 4LGDE 3P8CE 2XKMA 2N1TA 4TLFA 4RJTA 5KJ7A 1AVOA 2WMMA 5TISH 3SWKA 3V6IA 1L4AD 2KZJA 1LTJB 4HB1A 1J1EB 2L5GB 5L8RJ 3WUUA 1HUCA 2K9YA 2QJKC 3AEEC 1VQ6P 1JY2O 2QVAA 1KFMA 1LT9A 1Q81Q 4K35A 1GTWA 3EFFK 2FYNB 3C9IA 3L71E 4D6TE 3M06A 1JY2N 1VL2A 2KZIA 1M1JA 3BRTB 3CL3D 1QLED 2P10A 3E7KA 3FXEA 1PGJA 4NPDA 5AW1B 1JMBA 5KAIE 2Q7CA 4U3FG 4ASWA 3VYIA 5KTBA 2FBWC 2LXCB 2Q3EA 2E74D 4DOJA 3CCMP 2ZAEB 2YXRB 2IDBA 3CX5E 1SQBK 2IZ1A 2W27A 3CC2P 1YJNP 2RH0A 4Y99C 1NU1D 1H89A 1UIXA 2W90A 1SQVD 1MZ9A 1QL1A 2ZFCA 1VQNP 4KHXA 1FDMA 2V4HA 1KQSO 1SP4A 1S9KE 2WSSH 3B71A 4A7PA 2FKWB 4MN4C 1VQOP 4XA4A 1BE3D 4Y28J 3TGUG 1SLQA 4BRYB 1OVUA 1R5LA 1JY2P 1HH0A 1YTZT 1T8ZA 2KSEA 3HE4A 4DZOA 1CI6A 1N7SB 4JYBA 3H1LD 5AVWB 5CBOA 1SQPD 1Q90D 2ZYGA 2FY8A 3GF3A 2QM8A 1L0NE 1S3JA 2B87B 2FYZA 2N9BA 2P58A 2ZVOB 2ZYDA 3AE6C 3C8VA 3R4YA 4PD4D 3RBZA 5M1BA 2PGDA 2YXQB 3A0HH 1M7LA 1GL2A 1NOHA 3KPEA 2HPCB 4OGQD 1EXJA 1N8RQ 3WMM0 1ZMEC 1KN7A 1IFNA 2K9JA 2C0XA 2QE7H 2R44A 3HTKB 5AW4B 2C9NY 3MIWA 4OGQB 2E76D 1PGOA 2FYUJ 3L71J 3H1KD 2NPSB 3V2NA 4K3AA 4EIJA 1JB0J 2ZXXA 5APQA 4AUWA 4W7YA 1BCCG 1P84I 1SFCA 4H44C 3TGUJ 2RMZA
chains in the Genus database with same CATH topology
1RF0A 3V4WA 1LTBC 4GKGA 1RE4A 1IO4A 2HYNA 3EQ2A 3L36A 3A7OA 2OYHB 1NKNA 3NMDA 3V2PA 2OYIB 1J1DB 3VMZA 3TYYA 2HODB 5APVA 1FZBA 3U1AA 2IX7C 2YO2A 1FJKA 3SWFA 3OA7A 2NPSC 4N3YB 5AVRB 1RY3A 3VMXA 5BVZA 3P32A 2JJLA 1NTKK 1JCCA 1URQB 2H8PD 4O9BA 1A02F 2FFDB 3GHGB 1RF1C 2BASA 1PFIA 2GUSA 2MJZA 1JNMA 4GIFA 1FBMA 1GW3A 3HRNA 3GHGC 4N6JA 3A2AA 3O8ZA 1J2JB 2A45I 2GM4A 1J1DC 2WSEH 1DH3A 1HGVA 3MGNA 1J1EC 1CSBA 3U1CA 2CPBA 3OJAB 1FOSF 1IK9A 1FZAA 2E42A 2J59M 2YMYA 2KB7P 3RK3B 4I2LC 2I1JA 4M3LA 5AVVB 2LKMA 3PP5A 1NU1K 1URQC 5KJ7C 2A45H 2KLVA 1CZQA 3HD7C 2FFDC 1G2CA 4IFMA 1LTSC 1XTCC 2OYHC 2KP8A 1M1JC 4WY4A 2OYIC 1RF1B 2P7JA 1T2KD 4ZKPA 3KYQA 1FZGA 3VP8A 1IFJA 1SFCB 2R5BA 1GK6A 3RL0B 1XTGB 3L4FA 2HLOA 3H32A 3BVHA 3M9BA 1NAFA 3BATA 1RE3A 2YNYA 4WY4C 2OYIA 3B5NA 4JYCA 4N78E 1SFCD 1S9KD 1JUNA 1KILD 5AW8B 3B5NC 4EOTA 1H88A 2KSJA 3TNUB 2FXMA 5CJ0A 1LTAC 5AVTB 4C7NB 1LTIC 2Q5UA 1LWUA 1GL2D 5CCHC 2IFMA 3BRVB 1NWQA 3HD7D 5KLVK 3HUSB 3P7KA 2YO3A 3N4XA 1FU1A 2FFDA 3HD7A 2N1TD 2O01H 3CLQA 1DEBA 1G1IA 1IJDB 4XE5B 3M91A 2PP6A 4HH2A 5AW0B 2O1KA 4IFDK 1RE4C 1LGHB 5AW6B 3M0AA 1NHLA 3RK3C 1H8AA 1ZV8A 3IR9A 2JEEA 2HFED 3OAKA 1NTMK 1NO4A 2CPSA 1SVFA 5AW9B 3B5ND 5AW5B 2Z4EA 1KZUB 3MUDA 5AW2B 2A45G 1G2CB 2XNXA 3KDPB 5BU5A 5CCGA 1E5WA 1NKZB 2P2UA 2XU6A 2ZXEB 4WY4B 1RF1A 4C46A 4WY4D 5AVUB 2J58A 2WT7B 1X8YA 2WWWA 3IFMA 1MV8A 2E43A 3H32B 4W80A 1IC2A 4I6MC 4N78D 3VMYA 3VOPA 1JTHB 1CI6B 4WB4A 3B5NB 1IFIA 1T2KC 1HJBA 1IFMA 5CHXA 1GL2B 3LW5H 5CMZA 3P8MC 5CCHD 2NPSD 5KJ7D 5BU8B 1SFCC 2YKQA 2FYUK 2NPSA 1KILB 1VPCA 3RL0C 4ZKUA 2N1TC 2OARA 3II6A 3VP9A 1RF0C 1AQ5A 4B86A 4OH8B 3A3YB 2N1TB 3MTUE 3BASA 3HUSA 3A5TA 2C0WA 2W6BA 5AW7B 3HD7B 3P8CD 1YTZI 2WSCH 1LT9B 2YKOA 3RL0D 1M1JB 3T97A 1FZCC 3U59A 1VDFA 1IFDA 1N7LA 1W2EA 1WRGA 1GU4A 3G3ZA 1GD2E 3V2RA 5APSA 1FOSE 2WPSA 5AVQB 1JO5A 1GZLA 2XDJA 4LC1A 3HUSC 1FZFA 1KFNA 3EFGA 2M3BA 3TK1A 1HBWA 2IFNA 5APUA 1LTTC 3RK3D 1FZCA 3L37A 2KOGA 1HGZA 2HG5D 2R5DA 3UIAA 1FJPA 4JF7A 1LT9C 2HPCA 2Q3IA 4LLHA 2XV5A 1SQXK 5APTA 2WT7A 3LIDA 1N73B 1LTGC 3HE5A 3L35A 1OWAA 3HTKA 2Q9IA 2WPQA 2PAJA 2YKPA 1MUUA 1URQD 1X79B 1N2DC 3V2QA 1GW4A 2W6AA 1OXZA 1ZR4A 1JMMA 2OYHA 3NTNA 1EQ7A 1GK4A 1L4AC 3M9QA 2O1JA 1KILA 1X9VA 1ZLLA 2HODA 3I5CA 1QL2A 4I1LA 3SWYA 2R3CA 1GU5A 3LIEA 1JY3O 1GL2C 1DX7A 3CI9A 1NH4A 5APYA 1URQA 2QM7A 1GDTA 1L4AA 3GHGA 1KQLA 3MD0A 1NTZK 3TNUA 1JCDA 4C7NA 1HTLC 4HYTB 1LWUB 2POHA 1YYCA 1LWUC 3M0DC 2R32A 1LTJA 2IPPA 1FZCB 1ZR2A 1JY3P 1WT6A 2P67A 1N73C 1SQVK 3NFQA 3KQGA 3R2PA 1SQQK 1CW5A 1L0NK 2M8RA 5KJ7A 3H6PA 3VTPC 2C9LY 4W7ZA 2Z5HA 1N73A 3HE5B 2XZRA 3M0DA 5AW3B 2WITA 1SQPK 1ZN5A 2GUVA 1N7SD 1HVVA 1HWTC 4Y99B 1JY3N 4IFFA 3TSIA 5CCGC 2H43A 3HE4B 4AQRD 2WTYA 3NXSA 1N7SA 2Z5IA 3E1IA 3N7NA 5AVXB 3B8EB 2P1JA 1N7SC 1LTJC 2WPRA 4AYCA 5CCGD 1T3UA 5APWA 1T3JA 2WZ7A 3RK2D 5CCHA 2I1KA 4RESB 5AVSB 3VN0A 1KILC 1JTHA 2VRSA 3V4QA 2WSFH 1AFOA 1Z56A 1FZEA 1L0LK 1N86A 1L4AB 2KYVA 4C7RA 3RK2B 1FAVA 5APXA 1A02J 1MFZA 3RK2C 1RE3C 3M9HA 3V5BA 1JOCA 5AVZB 4GT1A 4LGDE 1G1JA 3P8CE 2XKMA 2N1TA 1L4AD 1LTJB 1J1EB 2L5GB 1HUCA 1JY2O 1KFMA 1LT9A 1GTWA 3C9IA 3M06A 1JY2N 3BRTB 4WBAA 1M1JA 3CL3D 5AVYB 5AW1B 3V2NA 2Q7CA 3VYIA 5KTBA 4DOJA 1SQBK 2W27A 4Y99C 1H89A 1MZ9A 1QL1A 2ZFCA 4KHXA 1FDMA 1SP4A 1S9KE 2FKWB 4XA4A 1SLQA 4DZOA 1YTZT 1JY2P 1HH0A 3HE4A 1T8ZA 1CI6A 1N7SB 4JYBA 5AVWB 2QM8A 2N9BA 2FYZA 5CJ4A 2H7HA 3KPEA 2HPCB 1M7LA 1GL2A 1NOHA 3WMM0 1IFNA 2C0XA 5AW4B 3HTKB 2C9NY 3MIWA 2NPSB 4EIJA 5APQA 4AUWA 4W7YA 1SFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFM A;  1QL1 A;  1IFM A;  2XKM A;  1PFI A;  1ZN5 A;  1IFN A;  3IFM A;  2KLV A;  1QL2 A;  2IFN A;  4IFM A;  2KSJ A; 
#chains in the Genus database with same CATH topology
 1YBK A;  1RF0 A;  3V4W A;  3CWB D;  1H0T A;  2IZ0 A;  1LTB C;  4GKG A;  3CXH E;  1RE4 A;  2IBZ I;  2K37 A;  4L73 A;  4PJ0 H;  2HYN A;  3EQ2 A;  3H1L J;  3L36 A;  3RBX A;  3CCV P;  1IO4 A;  3A7O A;  3K5B A;  2OYH B;  1NKN A;  3NMD A;  2AXC A;  1BGY E;  3V2P A;  4BWN A;  2OYI B;  3JC2 2;  1KTM A;  5DJU B;  1J1D B;  2IYP A;  4I7Z C;  3VMZ A;  3Q2Y A;  2M3E A;  1BSN A;  2OTK E;  3TYY A;  3MZW B;  2HOD B;  5APV A;  1FZB A;  2A06 G;  5TIS E;  2I8D A;  3FX0 A;  3U1A A;  2IX7 C;  3AE8 C;  2YO2 A;  1FJK A;  3L74 G;  4ZNC A;  1KB9 H;  1VQK P;  3SWF A;  3OA7 A;  1BCC J;  1R8E A;  3L70 J;  2NPS C;  1AA0 A;  2JR8 A;  4N3Y B;  2C9L Y;  5AVR B;  1OFC X;  1EDK A;  1RY3 A;  3VMX A;  1M57 D;  5BVZ A;  3H1L G;  3P32 A;  1SQP G;  2JJL A;  1NTK K;  1JCC A;  1Y9B A;  3WU2 H;  1KQG B;  1URQ B;  2H8P D;  4O9B A;  1VQ5 P;  1FDO A;  1A02 F;  2D2C B;  1NTM D;  2FFD B;  1FE6 A;  3GHG B;  1RF1 C;  2BAS A;  1PFI A;  2GUS A;  2MJZ A;  2W6J H;  3H1J J;  4UB8 E;  3VMA A;  1JNM A;  4D6T D;  1U7M A;  2ZT9 D;  2KNC A;  1FBM A;  1GW3 A;  2SPZ A;  3GHG C;  3HRN A;  4GIF A;  3A2A A;  4N6J A;  3O8Z A;  1J2J B;  2A45 I;  3Q3D A;  1J1D C;  3CXH D;  1VQ4 P;  2WSE H;  3S4R A;  1HGV A;  2O01 N;  3L72 D;  1DH3 A;  3BCC J;  1M56 D;  3MGN A;  1L0L G;  3H1K G;  1OMI A;  1J1E C;  3JCU E;  4H0L B;  1YIT P;  3L70 G;  1BCC D;  1CSB A;  3U1C A;  2CPB A;  3O6Q B;  3L72 E;  3OJA B;  2PFX A;  1IK9 A;  2JWA A;  3GG2 A;  4H0L C;  1FOS F;  1FZA A;  3CPW O;  2E42 A;  4JQ0 D;  4BRY A;  2RN0 A;  2J59 M;  2YMY A;  2KB7 P;  3L73 D;  5H2F H;  3RK3 B;  4R4M A;  1HF9 A;  3CCU P;  4I2L C;  1SQB D;  2I1J A;  4M3L A;  4U7J A;  5AVV B;  2LKM A;  4ASV A;  1L0N J;  3PP5 A;  3CCJ P;  1NU1 K;  3H1K E;  1Y8A A;  5TJH A;  3W67 A;  1KYO H;  3IN6 A;  1RQU A;  1EZV G;  1URQ C;  1KB9 I;  1S5L H;  1KD1 Q;  5KJ7 C;  1PGP A;  2A45 H;  2KLV A;  1CZQ A;  3BCC E;  3HD7 C;  2FFD C;  1G2C A;  1AV1 A;  1EDL A;  4IFM A;  1LTS C;  1VF5 D;  2KI7 B;  1Q86 Q;  5EFW B;  1XTC C;  2OYH C;  3IAO A;  4DT0 A;  1L0L J;  4GDO A;  1KB9 D;  2KP8 A;  1M1J C;  4WY4 A;  3Q1M A;  2OYI C;  1RF1 B;  2P7J A;  1SQP J;  2AEJ A;  2E75 D;  1T2K D;  4ZKP A;  3KYQ A;  1FZG A;  1K04 A;  3VP8 A;  5KLI B;  1IFJ A;  4H13 C;  5CBN A;  1SFC B;  3H1J G;  3A0B H;  4PJ0 E;  1TU3 F;  2R5B A;  4U3F J;  1GK6 A;  3RL0 B;  5KLI C;  1XTG B;  3L4F A;  1NJI Q;  2HLO A;  2QJP C;  3H32 A;  2WSC J;  3BVH A;  3M9B A;  2QIW A;  1L0N G;  1NAF A;  1KYO I;  2KXP B;  3BCC G;  3WUT A;  3BAT A;  2M0B A;  1VQ7 P;  1RE3 A;  2Q1K A;  2YNY A;  4WY4 C;  2OYI A;  1NU1 E;  3B5N A;  1X22 A;  4JYC A;  2RKL A;  1PV3 A;  4N78 E;  1DD3 A;  1ZOY C;  3LW5 J;  1SFC D;  2MKV A;  1S9K D;  1JUN A;  1PPJ D;  4KT0 J;  1BDD A;  1USD A;  1KIL D;  5AW8 B;  3B5N C;  5KLV D;  4EOT A;  3H25 A;  3RK3 E;  4YPC A;  2JP3 A;  2QRX A;  3PLN A;  1NTM E;  1H88 A;  2KSJ A;  3TNU B;  2K88 A;  2FXM A;  5CJ0 A;  1LTA C;  5AVT B;  3H1K J;  4C7N B;  4EDF A;  2NRG A;  1LTI C;  3I56 P;  1W2B O;  2Q5U A;  1KIL E;  1LWU A;  1GL2 D;  3D6Y A;  4H13 B;  5CCH C;  2WSF J;  3CX5 I;  1S5L X;  2IFM A;  3BRV B;  1NWQ A;  3HD7 D;  5KLV K;  3HUS B;  3P7K A;  4UB8 H;  2YO3 A;  3N4X A;  1FU1 A;  1OZH A;  2WSE J;  1SQX J;  3T97 B;  4BXL A;  3CD6 P;  2IYO A;  2FFD A;  3HD7 A;  4I7Z B;  2N1T D;  1L2P A;  2FYU G;  2O01 H;  1DEE G;  1JEK A;  1DEB A;  3B4S A;  1G1I A;  1IJD B;  1FS0 E;  2WPV B;  3CLQ A;  3M91 A;  2PP6 A;  1NTZ E;  4L76 A;  4HH2 A;  1S2E A;  4PV1 B;  5AW0 B;  1SQQ J;  4YXW H;  2O1K A;  4IFD K;  3MUD C;  1RE4 C;  1LGH B;  2QG4 A;  3TGU E;  2OQQ A;  3M0A A;  4PV1 C;  5AW6 B;  2H88 C;  1NHL A;  1SQV J;  2UWJ E;  2R3S A;  2YIU B;  1FDI A;  3JSV C;  3RK3 C;  1ZV8 A;  1K73 Q;  3IR9 A;  2JEE A;  1VQM P;  1H8A A;  4H44 B;  2HFE D;  3OAK A;  1LP1 B;  1NTM K;  2IBZ D;  1SQX E;  1NO4 A;  2CPS A;  2JWD A;  2ZT9 B;  5GTI H;  1SVF A;  2O3J A;  5AW9 B;  3G71 P;  3GLM A;  3ZDM A;  2ZYA A;  3B5N D;  4YXD C;  2D2C D;  5AW5 B;  1S5L E;  1EDJ A;  3BCC D;  2LXB A;  2Z4E A;  2KS1 A;  1DIP A;  1KZU B;  1OIP A;  3MUD A;  1KMI Z;  1YQ4 C;  3G4S P;  3L74 J;  1KB9 E;  1RQV A;  1Q2N A;  5AW2 B;  2A45 G;  1G2C B;  2XNX A;  3KDP B;  3L73 E;  5BU5 A;  3CXH H;  1E5W A;  1NKZ B;  5CCG A;  4KJM A;  1KOR A;  2AEF A;  1EC5 A;  5B5E H;  2P2U A;  5KAF H;  2XU6 A;  2ZXE B;  4WY4 B;  1FJP A;  1RF1 A;  2GM4 A;  2KUB A;  4C46 A;  1OX3 A;  2E5T A;  3H1I G;  2M5A A;  1K8A Q;  4WY4 D;  3CCL P;  1OVV A;  5AVU B;  2J58 A;  4UB6 E;  1BGY D;  3AE1 C;  1NTK G;  2WT7 B;  1X8Y A;  3KZI H;  2WWW A;  3AE7 C;  3WUV A;  5B66 H;  3F89 A;  3IFM A;  1QEX A;  1MV8 A;  1PPJ E;  3H32 B;  4PV1 D;  2Y9Z A;  1T6A A;  4RO0 A;  4W80 A;  1IC2 A;  2BCC E;  2W83 C;  1SQQ G;  3D6Z A;  1Q7Y Q;  2K1A A;  4I6M C;  4N78 D;  3RL0 g;  1ZXG A;  3VMY A;  3VOP A;  3CCR P;  1PP9 E;  1EZV E;  1CI6 B;  1JTH B;  2Y0D A;  4WB4 A;  1W5C E;  4L74 A;  2B88 A;  2FYU D;  3B5N B;  3D70 A;  1IFI A;  1SQX G;  4OWF A;  2E75 C;  4U3F D;  1T2K C;  1HJB A;  1IFM A;  5CHX A;  1GL2 B;  2CK3 H;  3LW5 H;  3P8M C;  5CMZ A;  5CCH D;  2NPS D;  3OW2 O;  3F5H A;  2JKV A;  3H1I J;  2AEM A;  3CME P;  3L70 E;  5KJ7 D;  2E43 A;  3CWB J;  1NU1 G;  5BU8 B;  4GOD A;  1YJ9 P;  1SFC C;  1NTK J;  2YKQ A;  1GMJ A;  2FYU K;  4PD4 E;  1SQV G;  2NPS A;  1N73 A;  1BDC A;  1KIL B;  1VPC A;  3RL0 C;  4ZKU A;  2N1T C;  2OAR A;  3AE4 C;  3II6 A;  1SQP E;  2LR2 A;  1QGK B;  1RF0 C;  3VP9 A;  1VQP P;  1AQ5 A;  1Y47 A;  4B86 A;  4OH8 B;  3A3Y B;  2YIU C;  1ZP0 C;  2A06 E;  2JDI H;  2N1T B;  3MTU E;  3BAS A;  3HUS A;  3CXH I;  3A5T A;  2C0W A;  2W6B A;  2QEX P;  2N9Y B;  3G6E P;  1WMK A;  5AW7 B;  2KIK A;  3HD7 B;  2XND H;  3P8C D;  1YTZ I;  2WSC H;  1LT9 B;  5E79 E;  4EI2 A;  1YI2 P;  2YKO A;  4H13 D;  1M90 Q;  2L91 A;  3Q5R A;  1NTK E;  3RL0 D;  5CJ4 A;  1M1J B;  3T97 A;  1FZC C;  3U59 A;  3CWB E;  1VDF A;  3ITK A;  3W68 A;  2D2C C;  3H1I D;  3L75 E;  4IOI H;  1SQQ E;  1IFD A;  4WBA A;  3Q5S A;  1N7L A;  1NYH A;  1W2E A;  1NTZ J;  1WRG A;  3L72 J;  1GU4 A;  1BGY G;  4WWI A;  3CCE P;  3G3Z A;  1LP1 A;  1GD2 E;  3V2R A;  4EYY Q;  5APS A;  4HKZ H;  4D6T G;  1PIX A;  3QWO C;  2BEZ F;  2FYU E;  2E74 B;  2GA1 A;  2G8Y A;  2WPS A;  5AVQ B;  1GZL A;  3CMA P;  1AVY A;  1FOS E;  1P84 H;  2XDJ A;  4LC1 A;  1JO5 A;  3HUS C;  1SQQ D;  2AXT H;  5KLV E;  2E74 C;  1VF5 C;  2V7Q J;  1FZF A;  1KFN A;  3EFG A;  2M3B A;  3TK1 A;  1HBW A;  2DW3 A;  3CWB G;  1SQX D;  2IFN A;  5APU A;  1LTT C;  5B5E E;  1QVF O;  4WVZ A;  4DCK A;  1VQL P;  3RK3 D;  1FZC A;  2QSI A;  3L37 A;  1VQ9 P;  2KNC B;  2KOG A;  2OTJ P;  1BE3 E;  1HGZ A;  2B87 A;  2HG5 D;  3FWN A;  1MFT A;  2R5D A;  3ABV C;  3UIA A;  4NPE A;  3TF5 A;  3Q5P A;  4IL6 H;  2A06 D;  4H0L D;  1LT9 C;  4JF7 A;  2HPC A;  3SFE C;  3D71 A;  2Q3I A;  3L73 J;  4LLH A;  2XV5 A;  4CPG A;  1SQX K;  1YHQ P;  5APT A;  2WT7 A;  3LID A;  1N73 B;  1NU1 J;  1LTG C;  3FGA D;  3HE5 A;  3L35 A;  1ZW0 A;  1OWA A;  3HTK A;  2Q9I A;  1DD4 A;  3L74 D;  1USE A;  2WPQ A;  4OVN F;  2PAJ A;  3S1K A;  4Z1M H;  3I55 P;  3CX5 D;  1EDI A;  3L75 D;  5KAF E;  2YKP A;  3USS A;  1MUU A;  1URQ D;  1LNQ A;  2QA4 P;  4NPF X;  3S9O A;  1JM0 A;  1NTZ G;  1X79 B;  3H1H D;  1N2D C;  4GOF A;  1GW4 A;  2JO1 A;  2W6A A;  4L75 A;  4UB6 H;  3V2Q A;  4JPZ B;  2OTL P;  1OXZ A;  3KZI E;  5CCG D;  5GTH E;  1JMM A;  1SQB J;  5B66 E;  1M8O B;  5K5G B;  1ZR4 A;  2OYH A;  3NTN A;  1K05 A;  3AE5 C;  1NTM G;  1EQ7 A;  1GK4 A;  1L0L E;  1PP9 J;  1RHZ B;  3CC4 P;  1R5S A;  1L4A C;  3M9Q A;  3AEF C;  3H1H J;  4HJG H;  2O1J A;  5KLV J;  4U3F E;  1IZN B;  1KIL A;  1X9V A;  1ZLL A;  2HOD A;  1FC2 C;  2OYO A;  1SQB E;  3I5C A;  3L72 G;  3E1R A;  1L0L D;  3VTP C;  1NGM B;  1LT1 A;  1NVO A;  1QL2 A;  2K3R A;  3AE9 C;  3L70 D;  1KV4 A;  4I1L A;  3SWY A;  2R3C A;  3G9R A;  3GW6 A;  1GU5 A;  1AQT A;  4GOE A;  5AVY B;  3LIE A;  1JY3 O;  1PL5 A;  5C39 A;  1OVR A;  3L73 G;  1GL2 C;  5GTI E;  2HR3 A;  1DX7 A;  3PH0 A;  1SQB G;  3CI9 A;  1NH4 A;  2WQY C;  3AED C;  1NTM J;  1URQ A;  2QM7 A;  5APY A;  1GDT A;  1L4A A;  3GHG A;  1EZV D;  1KQL A;  4H44 D;  5H2F E;  1EZV I;  2KK7 A;  2YMK A;  1HJ0 A;  3MD0 A;  1NTZ K;  1P84 E;  1ZRT D;  2E76 B;  2ITA A;  2AXT E;  3TNU A;  3H1J E;  1JCD A;  4C7N A;  2QJY C;  1HTL C;  4HYT B;  3KHU A;  3H1L E;  1LWU B;  3IF4 A;  4TT3 H;  2POH A;  3MP7 B;  5KKZ C;  3L75 G;  1YJW P;  1UII A;  1U7J A;  3A0H E;  1YYC A;  2V7Q H;  1LWU C;  3H1J D;  3O6Q A;  1L0N D;  3M0D C;  2R32 A;  1LTJ A;  3EWK A;  3GF7 A;  1NTZ D;  3H1H G;  1U57 A;  2IPP A;  2ZT9 C;  1S72 P;  3SSU A;  1BCC E;  2Y9Y A;  1ZR2 A;  1JY3 P;  1WT6 A;  2P67 A;  1FZC B;  2H89 C;  4PD4 H;  1IK7 A;  2B89 A;  1PZQ A;  1SQV K;  3NFQ A;  1YIJ P;  1N73 C;  3KQG A;  3R2P A;  1SQQ K;  2G3A A;  3PTZ A;  2Y0E A;  3FXD A;  1D7M A;  1CW5 A;  1L0N K;  1PP9 G;  1RH5 B;  2M8R A;  3H6P A;  4YTP C;  3RGU A;  2FYN C;  4RKU J;  1PPJ G;  2J5U A;  2W8Z A;  2Z5H A;  4IL6 X;  4W7Z A;  1BE3 J;  3HE5 B;  2BCC G;  2XZR A;  3KXD A;  3M0D A;  5DJT B;  5KAI H;  5KLV G;  3CC7 P;  4XE5 B;  5E79 H;  5AW3 B;  2WIT A;  1SQP K;  3AEC C;  1E79 H;  2E5Y A;  3L71 D;  3CCQ P;  1Q82 Q;  2ZJS E;  1ZN5 A;  3PHL A;  1M1K Q;  3WU2 E;  1KC8 Q;  3CX5 H;  2H7H A;  1SS1 A;  1LJ2 A;  2GUV A;  3H1I E;  1N7S D;  2ZVN B;  2KS1 B;  1HVV A;  1HWT C;  4Y99 B;  2WVR A;  1BGY J;  1JY3 N;  4IFF A;  3TSI A;  5CCG C;  2H43 A;  3HE4 B;  4JBZ A;  4AQR D;  4D6T J;  3NXS A;  1N7S A;  2WTY A;  4DJG A;  2Z5I A;  1SQV E;  2Q6Q A;  3E1I A;  3N7N A;  5AVX B;  3B8E B;  3H1H E;  2E75 B;  1AJY A;  2BCC J;  2M5A B;  2P1J A;  4XFJ A;  1N7S C;  1LTJ C;  2WPR A;  4AYC A;  4ZMD A;  1OW6 A;  3CCS P;  2IBZ G;  1NAY A;  1T3U A;  3PJS K;  1VF5 B;  1YQ3 C;  1PGQ A;  2K9J B;  1T3J A;  2O01 J;  2QJP B;  5APW A;  5GTH H;  3QH9 A;  3V4Q A;  2FXP A;  2WZ7 A;  4QMA A;  3RK2 D;  5CCH A;  2I1K A;  2QJK B;  4RES B;  5AVS B;  3L75 J;  3VN0 A;  2PRR A;  1KIL C;  1P84 D;  1JTH A;  1ZRT E;  2NZ2 A;  2VRS A;  3AEA C;  2QJY B;  2WSF H;  4IL6 E;  2BEQ D;  3AE2 C;  1QVG O;  4OGQ C;  1AFO A;  2Y0C A;  1VQ8 P;  5KKZ B;  3AE3 C;  1BE3 G;  1Z56 A;  1H0T B;  3TGU D;  2E76 C;  3TDK A;  2IBZ E;  3JCU H;  1FZE A;  1L0L K;  3L74 E;  1N86 A;  1L4A B;  3MHV A;  2KYV A;  3C1L A;  3PRJ A;  1KQF B;  3SFD C;  4C7R A;  3AEB C;  3RK2 B;  1PP9 D;  1FAV A;  1KYO D;  1OW7 A;  1MKM A;  5APX A;  1X0T A;  3AEG C;  3GMA A;  1IFP A;  4R4L A;  2BCC D;  1A02 J;  1S1C X;  1EXI A;  1MFZ A;  1S4X A;  4PD4 I;  3RK2 C;  2B9B A;  1OW8 A;  3A0B E;  1RE3 C;  1NTK D;  2KLU A;  3L71 G;  1QX8 A;  3FWL A;  3M9H A;  1K9M Q;  1KYO E;  3V5B A;  1BSH A;  1JOC A;  5AVZ B;  2FXO A;  4GT1 A;  1G1J A;  2OGU A;  4LGD E;  3P8C E;  2XKM A;  2N1T A;  4TLF A;  4RJT A;  5KJ7 A;  1AVO A;  2WMM A;  5TIS H;  3SWK A;  3V6I A;  1L4A D;  2KZJ A;  1LTJ B;  4HB1 A;  1J1E B;  2L5G B;  5L8R J;  3WUU A;  1HUC A;  2K9Y A;  2QJK C;  3AEE C;  1VQ6 P;  1JY2 O;  2QVA A;  1KFM A;  1LT9 A;  1Q81 Q;  4K35 A;  1GTW A;  3EFF K;  2FYN B;  3C9I A;  3L71 E;  4D6T E;  3M06 A;  1JY2 N;  1VL2 A;  2KZI A;  1M1J A;  3BRT B;  3CL3 D;  1QLE D;  2P10 A;  3E7K A;  3FXE A;  1PGJ A;  4NPD A;  5AW1 B;  1JMB A;  5KAI E;  2Q7C A;  4U3F G;  4ASW A;  3VYI A;  5KTB A;  2FBW C;  2LXC B;  2Q3E A;  2E74 D;  4DOJ A;  3CCM P;  2ZAE B;  2YXR B;  2IDB A;  3CX5 E;  1SQB K;  2IZ1 A;  2W27 A;  3CC2 P;  1YJN P;  2RH0 A;  4Y99 C;  1NU1 D;  1H89 A;  1UIX A;  2W90 A;  1SQV D;  1MZ9 A;  1QL1 A;  2ZFC A;  1VQN P;  4KHX A;  1FDM A;  2V4H A;  1KQS O;  1SP4 A;  1S9K E;  2WSS H;  3B71 A;  4A7P A;  2FKW B;  4MN4 C;  1VQO P;  4XA4 A;  1BE3 D;  4Y28 J;  3TGU G;  1SLQ A;  4BRY B;  1OVU A;  1R5L A;  1JY2 P;  1HH0 A;  1YTZ T;  1T8Z A;  2KSE A;  3HE4 A;  4DZO A;  1CI6 A;  1N7S B;  4JYB A;  3H1L D;  5AVW B;  5CBO A;  1SQP D;  1Q90 D;  2ZYG A;  2FY8 A;  3GF3 A;  2QM8 A;  1L0N E;  1S3J A;  2B87 B;  2FYZ A;  2N9B A;  2P58 A;  2ZVO B;  2ZYD A;  3AE6 C;  3C8V A;  3R4Y A;  4PD4 D;  3RBZ A;  5M1B A;  2PGD A;  2YXQ B;  3A0H H;  1M7L A;  1GL2 A;  1NOH A;  3KPE A;  2HPC B;  4OGQ D;  1EXJ A;  1N8R Q;  3WMM 0;  1ZME C;  1KN7 A;  1IFN A;  2K9J A;  2C0X A;  2QE7 H;  2R44 A;  3HTK B;  5AW4 B;  2C9N Y;  3MIW A;  4OGQ B;  2E76 D;  1PGO A;  2FYU J;  3L71 J;  3H1K D;  2NPS B;  3V2N A;  4K3A A;  4EIJ A;  1JB0 J;  2ZXX A;  5APQ A;  4AUW A;  4W7Y A;  1BCC G;  1P84 I;  1SFC A;  4H44 C;  3TGU J;  2RMZ A; 
#chains in the Genus database with same CATH homology
 1RF0 A;  3V4W A;  1LTB C;  4GKG A;  1RE4 A;  1IO4 A;  2HYN A;  3EQ2 A;  3L36 A;  3A7O A;  2OYH B;  1NKN A;  3NMD A;  3V2P A;  2OYI B;  1J1D B;  3VMZ A;  3TYY A;  2HOD B;  5APV A;  1FZB A;  3U1A A;  2IX7 C;  2YO2 A;  1FJK A;  3SWF A;  3OA7 A;  2NPS C;  4N3Y B;  5AVR B;  1RY3 A;  3VMX A;  5BVZ A;  3P32 A;  2JJL A;  1NTK K;  1JCC A;  1URQ B;  2H8P D;  4O9B A;  1A02 F;  2FFD B;  3GHG B;  1RF1 C;  2BAS A;  1PFI A;  2GUS A;  2MJZ A;  1JNM A;  4GIF A;  1FBM A;  1GW3 A;  3HRN A;  3GHG C;  4N6J A;  3A2A A;  3O8Z A;  1J2J B;  2A45 I;  2GM4 A;  1J1D C;  2WSE H;  1DH3 A;  1HGV A;  3MGN A;  1J1E C;  1CSB A;  3U1C A;  2CPB A;  3OJA B;  1FOS F;  1IK9 A;  1FZA A;  2E42 A;  2J59 M;  2YMY A;  2KB7 P;  3RK3 B;  4I2L C;  2I1J A;  4M3L A;  5AVV B;  2LKM A;  3PP5 A;  1NU1 K;  1URQ C;  5KJ7 C;  2A45 H;  2KLV A;  1CZQ A;  3HD7 C;  2FFD C;  1G2C A;  4IFM A;  1LTS C;  1XTC C;  2OYH C;  2KP8 A;  1M1J C;  4WY4 A;  2OYI C;  1RF1 B;  2P7J A;  1T2K D;  4ZKP A;  3KYQ A;  1FZG A;  3VP8 A;  1IFJ A;  1SFC B;  2R5B A;  1GK6 A;  3RL0 B;  1XTG B;  3L4F A;  2HLO A;  3H32 A;  3BVH A;  3M9B A;  1NAF A;  3BAT A;  1RE3 A;  2YNY A;  4WY4 C;  2OYI A;  3B5N A;  4JYC A;  4N78 E;  1SFC D;  1S9K D;  1JUN A;  1KIL D;  5AW8 B;  3B5N C;  4EOT A;  1H88 A;  2KSJ A;  3TNU B;  2FXM A;  5CJ0 A;  1LTA C;  5AVT B;  4C7N B;  1LTI C;  2Q5U A;  1LWU A;  1GL2 D;  5CCH C;  2IFM A;  3BRV B;  1NWQ A;  3HD7 D;  5KLV K;  3HUS B;  3P7K A;  2YO3 A;  3N4X A;  1FU1 A;  2FFD A;  3HD7 A;  2N1T D;  2O01 H;  3CLQ A;  1DEB A;  1G1I A;  1IJD B;  4XE5 B;  3M91 A;  2PP6 A;  4HH2 A;  5AW0 B;  2O1K A;  4IFD K;  1RE4 C;  1LGH B;  5AW6 B;  3M0A A;  1NHL A;  3RK3 C;  1H8A A;  1ZV8 A;  3IR9 A;  2JEE A;  2HFE D;  3OAK A;  1NTM K;  1NO4 A;  2CPS A;  1SVF A;  5AW9 B;  3B5N D;  5AW5 B;  2Z4E A;  1KZU B;  3MUD A;  5AW2 B;  2A45 G;  1G2C B;  2XNX A;  3KDP B;  5BU5 A;  5CCG A;  1E5W A;  1NKZ B;  2P2U A;  2XU6 A;  2ZXE B;  4WY4 B;  1RF1 A;  4C46 A;  4WY4 D;  5AVU B;  2J58 A;  2WT7 B;  1X8Y A;  2WWW A;  3IFM A;  1MV8 A;  2E43 A;  3H32 B;  4W80 A;  1IC2 A;  4I6M C;  4N78 D;  3VMY A;  3VOP A;  1JTH B;  1CI6 B;  4WB4 A;  3B5N B;  1IFI A;  1T2K C;  1HJB A;  1IFM A;  5CHX A;  1GL2 B;  3LW5 H;  5CMZ A;  3P8M C;  5CCH D;  2NPS D;  5KJ7 D;  5BU8 B;  1SFC C;  2YKQ A;  2FYU K;  2NPS A;  1KIL B;  1VPC A;  3RL0 C;  4ZKU A;  2N1T C;  2OAR A;  3II6 A;  3VP9 A;  1RF0 C;  1AQ5 A;  4B86 A;  4OH8 B;  3A3Y B;  2N1T B;  3MTU E;  3BAS A;  3HUS A;  3A5T A;  2C0W A;  2W6B A;  5AW7 B;  3HD7 B;  3P8C D;  1YTZ I;  2WSC H;  1LT9 B;  2YKO A;  3RL0 D;  1M1J B;  3T97 A;  1FZC C;  3U59 A;  1VDF A;  1IFD A;  1N7L A;  1W2E A;  1WRG A;  1GU4 A;  3G3Z A;  1GD2 E;  3V2R A;  5APS A;  1FOS E;  2WPS A;  5AVQ B;  1JO5 A;  1GZL A;  2XDJ A;  4LC1 A;  3HUS C;  1FZF A;  1KFN A;  3EFG A;  2M3B A;  3TK1 A;  1HBW A;  2IFN A;  5APU A;  1LTT C;  3RK3 D;  1FZC A;  3L37 A;  2KOG A;  1HGZ A;  2HG5 D;  2R5D A;  3UIA A;  1FJP A;  4JF7 A;  1LT9 C;  2HPC A;  2Q3I A;  4LLH A;  2XV5 A;  1SQX K;  5APT A;  2WT7 A;  3LID A;  1N73 B;  1LTG C;  3HE5 A;  3L35 A;  1OWA A;  3HTK A;  2Q9I A;  2WPQ A;  2PAJ A;  2YKP A;  1MUU A;  1URQ D;  1X79 B;  1N2D C;  3V2Q A;  1GW4 A;  2W6A A;  1OXZ A;  1ZR4 A;  1JMM A;  2OYH A;  3NTN A;  1EQ7 A;  1GK4 A;  1L4A C;  3M9Q A;  2O1J A;  1KIL A;  1X9V A;  1ZLL A;  2HOD A;  3I5C A;  1QL2 A;  4I1L A;  3SWY A;  2R3C A;  1GU5 A;  3LIE A;  1JY3 O;  1GL2 C;  1DX7 A;  3CI9 A;  1NH4 A;  5APY A;  1URQ A;  2QM7 A;  1GDT A;  1L4A A;  3GHG A;  1KQL A;  3MD0 A;  1NTZ K;  3TNU A;  1JCD A;  4C7N A;  1HTL C;  4HYT B;  1LWU B;  2POH A;  1YYC A;  1LWU C;  3M0D C;  2R32 A;  1LTJ A;  2IPP A;  1FZC B;  1ZR2 A;  1JY3 P;  1WT6 A;  2P67 A;  1N73 C;  1SQV K;  3NFQ A;  3KQG A;  3R2P A;  1SQQ K;  1CW5 A;  1L0N K;  2M8R A;  5KJ7 A;  3H6P A;  3VTP C;  2C9L Y;  4W7Z A;  2Z5H A;  1N73 A;  3HE5 B;  2XZR A;  3M0D A;  5AW3 B;  2WIT A;  1SQP K;  1ZN5 A;  2GUV A;  1N7S D;  1HVV A;  1HWT C;  4Y99 B;  1JY3 N;  4IFF A;  3TSI A;  5CCG C;  2H43 A;  3HE4 B;  4AQR D;  2WTY A;  3NXS A;  1N7S A;  2Z5I A;  3E1I A;  3N7N A;  5AVX B;  3B8E B;  2P1J A;  1N7S C;  1LTJ C;  2WPR A;  4AYC A;  5CCG D;  1T3U A;  5APW A;  1T3J A;  2WZ7 A;  3RK2 D;  5CCH A;  2I1K A;  4RES B;  5AVS B;  3VN0 A;  1KIL C;  1JTH A;  2VRS A;  3V4Q A;  2WSF H;  1AFO A;  1Z56 A;  1FZE A;  1L0L K;  1N86 A;  1L4A B;  2KYV A;  4C7R A;  3RK2 B;  1FAV A;  5APX A;  1A02 J;  1MFZ A;  3RK2 C;  1RE3 C;  3M9H A;  3V5B A;  1JOC A;  5AVZ B;  4GT1 A;  4LGD E;  1G1J A;  3P8C E;  2XKM A;  2N1T A;  1L4A D;  1LTJ B;  1J1E B;  2L5G B;  1HUC A;  1JY2 O;  1KFM A;  1LT9 A;  1GTW A;  3C9I A;  3M06 A;  1JY2 N;  3BRT B;  4WBA A;  1M1J A;  3CL3 D;  5AVY B;  5AW1 B;  3V2N A;  2Q7C A;  3VYI A;  5KTB A;  4DOJ A;  1SQB K;  2W27 A;  4Y99 C;  1H89 A;  1MZ9 A;  1QL1 A;  2ZFC A;  4KHX A;  1FDM A;  1SP4 A;  1S9K E;  2FKW B;  4XA4 A;  1SLQ A;  4DZO A;  1YTZ T;  1JY2 P;  1HH0 A;  3HE4 A;  1T8Z A;  1CI6 A;  1N7S B;  4JYB A;  5AVW B;  2QM8 A;  2N9B A;  2FYZ A;  5CJ4 A;  2H7H A;  3KPE A;  2HPC B;  1M7L A;  1GL2 A;  1NOH A;  3WMM 0;  1IFN A;  2C0X A;  5AW4 B;  3HTK B;  2C9N Y;  3MIW A;  2NPS B;  4EIJ A;  5APQ A;  4AUW A;  4W7Y A;  1SFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...