1QL1A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql1A00
1QL2A 2IFNA 3IFMA 4IFMA 1ZN5A 2XKMA 2IFMA 2KSJA 1PFIA 1QL1A 2KLVA 1IFNA 1IFMA
chains in the Genus database with same CATH superfamily
2OQQA 1J1EC 2YIUC 3A3YB 3I55P 1T2KC 2YO2A 1W5CE 3CLQA 4N3YB 2FFDB 1Z56A 1SP4A 3LIDA 4NPDA 4XE5B 3EFGA 1IFMA 1KILB 1H89A 1TU3F 5TISH 4LC1A 1NVOA 1PP9E 1M1JA 1EZVG 2N1TD 1KYOE 1DH3A 1S4XA 3GF7A 3AE2C 3CMAP 2Z5IA 3RK2D 3EWKA 2E75B 1VQPP 1JUNA 1N2DC 2ZAEB 4EYYQ 2LR2A 3U59A 1GW3A 2ZXEB 5L8RJ 4N78E 2OTJP 3NFQA 1SQXE 3GHGC 4H13B 3LW5H 2JJLA 3LIEA 4HB1A 1E79H 1SQVG 2R5BA 1BE3D 1PL5A 4UB8H 3SWFA 2N1TC 1NKZB 3RK2C 3Q2YA 1KILE 2FYUG 4U7JA 3AE8C 3BASA 3FWLA 4WWIA 1S2EA 1OVVA 1ZLLA 1BE3J 2AXTH 1Q86Q 3KXDA 5AVTB 2O01J 1JY3P 1FDOA 2BCCE 4HKZH 1Y8AA 2IFMA 3L72E 4XFJA 4RKUJ 1PGJA 2KSJA 2BEQD 3H1KD 4GOEA 2QSIA 3A2AA 2A06E 1J1EB 2YIUB 1ZR2A 1JMBA 1FZAA 2YMKA 3A7OA 1EDLA 1BGYD 5APQA 2XV5A 4YPCA 3H32B 2FKWB 3H1KJ 2KXPB 1KQLA 3OW2O 1IK7A 1NTKE 1S5LE 4Y28J 5AVWB 2P7JA 1BGYJ 2JR8A 1LTJC 4M3LA 2XKMA 2ZYDA 1SFCD 1M7LA 1PPJE 5H2FH 4WY4C 1EXJA 1L0ND 3WMM0 5C39A 2KUBA 2P1JA 1OIPA 3TNUA 3RL0g 4WVZA 1CW5A 1ZXGA 1FBMA 1FS0E 1H88A 2N9YB 1MUUA 3GHGB 5GTHE 1N7SA 1VQOP 1DD4A 1SFCC 5BU8B 2N1TB 3NMDA 1L0NJ 3Q5RA 2QJPC 2I1JA 2W90A 1RE4A 3RK2B 1JM0A 1PIXA 1JTHA 1WRGA 1NHLA 3H1JD 1MZ9A 4PD4D 1FDIA 3RBXA 3AE5C 1CSBA 3R2PA 1H0TA 3SWYA 1KYOH 2WSSH 1NTMD 3V2NA 2SPZA 1YTZT 3M91A 4O9BA 3MHVA 4DJGA 4OH8B 2IZ0A 1YQ3C 2FYZA 3FGAD 4AUWA 1RE3A 3G3ZA 2G3AA 1PGOA 2WTYA 2L91A 1OVRA 1LTAC 4DOJA 2WSCH 1Q7YQ 2J5UA 1GU5A 4OGQD 1YYCA 4U3FG 5KLIC 2R3CA 1NJIQ 3A0BE 1JOCA 1BE3E 4EI2A 3PLNA 4JYBA 2OYIA 3OAKA 1HJBA 1LTJB 2JO1A 1NO4A 2HODB 1SQQD 5E79E 4I2LC 1SQPD 4WY4B 3H1LD 2P10A 3KYQA 3VMYA 1IFPA 3HUSA 3GF3A 2PGDA 5M1BA 1KD1Q 2QJYC 4U3FJ 1NTZE 4R4LA 3FWNA 1BDCA 1HGVA 2Q3IA 3H1HJ 3FX0A 3HTKB 1U57A 3VP8A 3L71J 1HUCA 4BRYB 1NYHA 4YTPC 1VQ8P 3EFFK 3H1KE 1SFCB 1G2CB 2QJPB 5AVZB 3M9BA 1XTCC 1JNMA 1S5LH 2K9JA 4LGDE 1E5WA 5KJ7D 5KAFE 1MKMA 1LT9A 1OX3A 2KNCA 1RQUA 3L75E 1IFDA 1OMIA 4DZOA 2MJZA 2H89C 2Y0DA 3CCLP 1KZUB 1JY3N 1S9KD 5GTHH 3QH9A 1S5LX 1K73Q 2JWAA 4BWNA 2Q3EA 1L0NE 4RJTA 3JCUE 3QWOC 2RMZA 4IFDK 3CWBD 1KV4A 3VMAA 2OTLP 4UB6E 5KLIB 1KQFB 1PFIA 3L73D 2FXPA 3IFMA 5K5GB 3AEEC 3MIWA 2JEEA 3G4SP 1AVYA 1BSHA 1PP9G 2R3SA 1NH4A 3CCMP 3H1JE 1L4AD 1M1KQ 1D7MA 2B9BA 1NTZK 4PD4E 4EIJA 1EXIA 4RO0A 1JY2N 1SQBG 3PJSK 1WMKA 2QJYB 4MN4C 1NTME 5APXA 3KHUA 4D6TG 3RL0D 1ZOYC 3HD7A 1KQGB 3N7NA 1T3JA 2W6BA 4C7RA 1NU1K 3KZIE 2E5YA 3V2QA 4PJ0E 1SQBJ 2AEMA 3VP9A 1LWUC 1ZMEC 5AW8B 4ZNCA 5E79H 3BRTB 3RL0C 2BCCG 5APWA 4W7ZA 1SVFA 4QMAA 3TGUG 2QJKC 4IL6E 1HJ0A 2A06G 3BCCE 1UIXA 4ASVA 2YKQA 1N73C 1BSNA 1SQQE 1KFNA 1WT6A 1SQPE 2MKVA 1AFOA 3H1LE 1X0TA 1FOSF 4WB4A 3P8CD 2L5GB 1Q81Q 1VQMP 3AEFC 4B86A 1HF9A 2FFDA 2CPBA 5KAFH 2QA4P 3HE4B 1VQ5P 1FJPA 5KAIE 3TGUJ 4TLFA 1DEEG 4Z1MH 3RK3D 5CCGC 3WUTA 1P84D 1HBWA 1PPJG 2CPSA 2OYHC 2ZFCA 1NTMK 2K88A 4L74A 2WPVB 3OJAB 2M3BA 3RK3C 1YHQP 3JCUH 3V2PA 2FBWC 1L4AB 2A45H 1GZLA 1NAFA 1NWQA 5AW9B 4UB6H 1S9KE 3BVHA 2C9LY 2NPSD 1KMIZ 1OVUA 3L70G 1X79B 1RF0A 1LWUB 2PRRA 3D6ZA 2KZIA 1K05A 2YKOA 1Y47A 2M5AB 1MV8A 3CWBE 1JO5A 2J59M 1HTLC 3RL0B 4PD4H 5KKZC 5DJTB 1URQA 1JY3O 5APSA 3L73E 1KB9D 3IR9A 1SQQK 1RF1C 1SQPK 2QJKB 3GG2A 2M3EA 1N73B 2NPSC 1EZVD 2Q9IA 5KLVK 3SFEC 1YTZI 3VOPA 2BEZF 2P67A 3L37A 4KJMA 3KZIH 4EDFA 4PJ0H 3E1RA 3H32A 1QL1A 4AQRD 1ZV8A 2Q5UA 1QVFO 3T97A 3CPWO 2IBZD 1SQVD 1PV3A 1JY2O 1Q2NA 3SFDC 3KDPB 2FYUD 2GUVA 4H44D 1GW4A 2OYHB 1G1IA 3W67A 2M0BA 1G1JA 1BCCE 4IL6H 3L36A 1SQVJ 1NKNA 2M8RA 3P7KA 1NTZG 4GODA 3TF5A 1USEA 1GDTA 2FYUJ 1ZRTD 3CCUP 3GHGA 2IX7C 2OARA 3RK3B 1LTTC 2QM7A 5B5EE 1AA0A 2N1TA 1GL2D 3B71A 1VQ6P 2IYPA 2QIWA 2V7QJ 1R5LA 4OVNF 5KAIH 5AVRB 3P8CE 1SLQA 3M9HA 4IL6X 1NU1G 3L75G 1L0LG 2NZ2A 2C0XA 1GMJA 3IAOA 5KKZB 5B66E 3Q1MA 1GL2C 4JPZB 3BATA 2QG4A 1RF1B 1GD2E 3O8ZA 3RK3E 1QX8A 4L76A 3HRNA 2NPSB 1SQXK 3H1IG 3L35A 1NU1J 4A7PA 3VN0A 2E5TA 1L0LJ 2WSFH 4JBZA 3S1KA 2KK7A 2WSEH 5AW4B 3CMEP 3L74G 1LTJA 1ZR4A 2HODA 3M0DC 3MP7B 2HR3A 2E74D 1YJ9P 1FZEA 5GTIH 4WY4A 5AVYB 3IF4A 1NTMG 1T8ZA 1EDJA 3HTKA 4BRYA 2HYNA 5AW2B 4H44B 3L74J 3CC7P 1SFCA 1G2CA 2E74C 2AXCA 5AVSB 3CXHD 2RH0A 1EZVE 1NTKK 1LNQA 4C7NB 3P32A 1NGMB 3GW6A 1EDIA 3ABVC 4TT3H 4U3FD 1JB0J 1KYOI 1FZCC 1A02F 1GL2B 1Y9BA 1FAVA 2IBZE 1SQVE 2R32A 3H1HD 4IOIH 3L71D 5AVUB 3RBZA 3LW5J 3CCRP 4OGQC 2HLOA 3BCCG 2WPRA 2FYUE 3A0HE 1GK6A 3MUDC 1SQPG 4RESB 1JCDA 1QGKB 3II6A 5B5EH 3CC4P 3K5BA 1FZGA 2Y0CA 1KTMA 5KLVG 1M90Q 2OYOA 5AW0B 3R4YA 2E76D 2JKVA 1QL2A 2DW3A 3O6QB 2OGUA 4I7ZC 3U1CA 2W83C 3B5ND 3GMAA 3E7KA 2KS1B 1LTIC 1BGYE 4YXWH 1M56D 2FY8A 5AW7B 5B66H 1R8EA 2W8ZA 5CCHD 2HG5D 1AVOA 2I8DA 2W6JH 1P84H 3AE9C 2ITAA 2I1KA 3B5NC 1HH0A 2H8PD 1MFTA 5KJ7C 3F5HA 3C8VA 1AQ5A 1YI2P 1IFNA 5AVXB 4XA4A 1LTSC 3JSVC 2PP6A 5CCHC 1N86A 2E74B 1YBKA 2WMMA 5AW1B 1U7JA 1NOHA 1PGPA 1H8AA 3VYIA 1K9MQ 1T6AA 2W27A 2H7HA 5AVQB 3AEAC 3D70A 2R44A 3CWBG 5EFWB 5CBNA 3Q3DA 1FZCB 2HPCB 3G9RA 4BXLA 1M57D 1LT1A 4OGQB 2IZ1A 1PP9D 1ZP0C 3CL3D 1KB9H 2K1AA 3CCEP 2C0WA 1SQBD 1SQXG 4GIFA 3VMXA 4ASWA 3CX5H 1VPCA 1OWAA 1PP9J 1VDFA 1L4AC 4D6TD 3HE4A 1ZW0A 4I7ZB 3NXSA 1EQ7A 1CI6B 1NAYA 3PH0A 3L4FA 1DEBA 3FXEA 3CXHE 1IFIA 2O01H 1DIPA 4D6TJ 1QEXA 1BCCG 1SQXJ 2B87B 2KLUA 3M06A 2E75D 3A0HH 2E76B 3L72G 3HE5B 3CI9A 4U3FE 1AV1A 3B5NB 2GM4A 1L0NK 3FXDA 5BU5A 2KOGA 3H1HE 3L71E 1EZVI 3TGUD 2D2CD 2WT7B 3M9QA 2XNXA 2WPQA 1N8RQ 1AQTA 2BCCJ 1VQNP 2YXQB 1NTKG 4L75A 5BVZA 1LWUA 2POHA 2M5AA 2IBZI 1VL2A 1KILA 1EDKA 1R5SA 3AEDC 1S72P 4AYCA 1KN7A 2D2CC 4W7YA 1URQD 2W6AA 4I6MC 1VF5D 1YQ4C 5CJ4A 3G6EP 1X8YA 1PGQA 1N73A 4DCKA 1GU4A 2IYOA 4GT1A 4K3AA 3KQGA 1XTGB 1LP1B 2ZXXA 1LTGC 3MZWB 2LXCB 1VF5C 1A02J 1M1JC 2YXRB 2VRSA 2ZVNB 1VQ4P 3USSA 1VQLP 5CCGA 2H43A 1MFZA 2OYHA 1X9VA 3UIAA 5APVA 2O1JA 3L70D 1W2EA 4HH2A 3MD0A 2LXBA 5GTIE 1AJYA 1UIIA 3B4SA 5CBOA 2J58A 3CX5D 3L70J 1FJKA 2A45I 2AEJA 1M8OB 3V5BA 2XDJA 3KPEA 3OA7A 1SQBE 1L2PA 3CXHH 3PHLA 2G8YA 1BE3G 3PRJA 3V2RA 5CMZA 4D6TE 3CD6P 2IBZG 3U1AA 4PD4I 2D2CB 5APTA 1IC2A 1OW6A 2NRGA 1RF1A 1OW8A 1VQ9P 4ZMDA 3AE1C 2QRXA 2NPSA 2P2UA 2IPPA 4JF7A 2BASA 1J1DC 3Q5SA 1KFMA 2QEXP 2JP3A 1HVVA 1NTZD 3D6YA 3H1KG 4H44C 1DX7A 2YNYA 3TDKA 1N7SD 1URQB 2JWDA 3V4WA 1VF5B 1M1JB 4KHXA 1T3UA 3CXHI 3TSIA 2Q6QA 3TGUE 1BGYG 3VMZA 2Q1KA 1FZFA 1NTZJ 2KYVA 2KZJA 2Y9ZA 1OW7A 2Y0EA 4OWFA 3AECC 1IJDB 5CHXA 1NU1D 1N7SC 4H0LD 4WY4D 2RN0A 3D71A 1S3JA 3L75D 3TK1A 1VQKP 1EC5A 1L0LD 4C46A 1OXZA 1BDDA 1RE4C 3T97B 3SSUA 1P84E 3CCJP 2O01N 1JY2P 2WZ7A 4Y99C 3AEBC 1S1CX 3CCSP 2XNDH 3P8MC 3H6PA 1L0NG 1SQBK 3MTUE 5KTBA 3L75J 2WPSA 3H1ID 4H0LC 4C7NA 2A45G 2XU6A 2KLVA 2R5DA 4DT0A 4PV1D 3H25A 4R4MA 2ZYGA 4K35A 1GL2A 3H1IJ 1RE3C 4WBAA 2FXOA 3H1JG 4JYCA 3L74D 3Q5PA 1YIJP 3NTNA 3RGUA 1CZQA 4PV1C 1J1DB 3L70E 1IK9A 1ZN5A 2ZJSE 2OYIC 1KB9E 1LJ2A 1JEKA 3H1JJ 3O6QA 2Z4EA 4GOFA 2PFXA 3CX5E 2KS1A 3HUSC 3TNUB 3M0DA 1NTMJ 2WITA 3PTZA 2Q7CA 1N7SB 2IDBA 4W80A 1RH5B 5CJ0A 1JTHB 4LLHA 2E43A 2CK3H 3H1HG 3L71G 1SQQG 1QLED 3WU2E 1HWTC 4Y99B 3WUUA 1LT9C 2WQYC 3H1LG 1H0TB 3BCCD 1Q90D 4GDOA 4H0LB 1OFCX 5AW6B 3C9IA 2PAJA 3TYYA 1KORA 4NPFX 3M0AA 3I56P 1ZRTE 3F89A 3WUVA 1U7MA 5KLVD 2H88C 2N9BA 1QVGO 3PP5A 4ZKPA 2JDIH 3BCCJ 1OZHA 2ZT9D 1FZCA 1SQQJ 4IFMA 2HPCA 1SQPJ 3H1LJ 1HGZA 2KIKA 4ZKUA 1DD3A 2V4HA 1N7LA 3AE6C 3MUDA 5KLVJ 3C1LA 2E76C 3G71P 2YMYA 3B8EB 4PV1B 1NU1E 3E1IA 1K8AQ 2ZT9C 1L0LE 2QE7H 2OYIB 1FC2C 1RY3A 3HD7D 3BRVB 2K9YA 1LGHB 1CI6A 3ITKA 3HUSB 2GUSA 3H1IE 1SQVK 4GKGA 2KI7B 1RQVA 3VTPC 2E42A 3MGNA 2B87A 4HYTB 2WVRA 1FOSE 1X22A 2FYUK 3L73G 3HD7C 3HE5A 1P84I 2QVAA 1IO4A 2WSFJ 2IFNA 3B5NA 5KJ7A 3GLMA 1JMMA 2K9JB 1KYOD 2K3RA 1LT9B 4YXDC 5CCHA 3L74E 3SWKA 1RHZB 5AW5B 2KNCB 2FYNC 3S9OA 4CPGA 1IFJA 3EQ2A 2WT7A 2Z5HA 2WSEJ 3CWBJ 5DJUB 3N4XA 5TISE 1YJWP 3CCQP 4N78D 5APYA 3L73J 1W2BO 2C9NY 2KSEA 1SQXD 3AE4C 2QM8A 2OTKE 2FXMA 1FZBA 1KILD 3V6IA 3ZDMA 4NPEA 1K04A 1KQSO 2K37A 3A0BH 4UB8E 2FFDC 1L0LK 3WU2H 3AE3C 2WSCJ 3I5CA 3V4QA 1BCCD 1KB9I 1SS1A 2BCCD 4I1LA 2RKLA 1LP1A 3L72D 2XZRA 2ZT9B 2V7QH 1KILC 2LKMA 4H13D 3AE7C 1L4AA 2ZYAA 3CX5I 2HFED 2A06D 2ZVOB 2AXTE 4EOTA 3S4RA 3W68A 1FU1A 1LTBC 1BCCJ 2E75C 1KC8Q 2O3JA 2KP8A 3L72J 1J2JB 5CCGD 3A5TA 4IFFA 1YJNP 1FE6A 5APUA 3AEGC 1NTKD 4H13C 5AVVB 4HJGH 5KLVE 3HD7B 2YO3A 2WWWA 2GA1A 3JC22 1USDA 1PPJD 2YKPA 2Y9YA 2AEFA 2UWJE 1GTWA 1YITP 4JQ0D 1NTKJ 1RF0C 2B88A 3CC2P 2FYNB 5TJHA 4N6JA 4KT0J 1IZNB 1T2KD 4L73A 1GK4A 3IN6A 1FDMA 1PZQA 3CCVP 1URQC 2B89A 5H2FE 2KB7P 1VQ7P 5AW3B 1Q82Q 1JCCA 2O1KA 2P58A
chains in the Genus database with same CATH topology
5AVUB 1J1EC 1IJDB 3A3YB 5CHXA 2HLOA 1N7SC 4WY4D 5APXA 2WPRA 3TK1A 1GK6A 1T2KC 4C46A 2YO2A 1OXZA 4RESB 1JCDA 1RE4C 3CLQA 3RL0D 3II6A 4N3YB 3HD7A 2FFDB 3N7NA 1Z56A 1T3JA 1JY2P 1FZGA 2WZ7A 4Y99C 2W6BA 4C7RA 1SP4A 1NU1K 3P8MC 3H6PA 3V2QA 5AW0B 3LIDA 4XE5B 3EFGA 1SQBK 3MTUE 5KTBA 1IFMA 1QL2A 1KILB 3VP9A 2WPSA 1H89A 4C7NA 3U1CA 1LWUC 4LC1A 3B5ND 5AW8B 2A45G 1LTIC 1M1JA 2N1TD 2XU6A 2KLVA 1DH3A 2R5DA 3BRTB 3RL0C 5AW7B 2Z5IA 3RK2D 5APWA 5CCHD 1JUNA 1N2DC 4W7ZA 1SVFA 2HG5D 3U59A 1GL2A 1RE3C 1GW3A 4WBAA 2ZXEB 4N78E 4JYCA 1N73C 2YKQA 1WT6A 1KFNA 3NFQA 3GHGC 3LW5H 2JJLA 3LIEA 2I1KA 3B5NC 1AFOA 2R5BA 1HH0A 2H8PD 5KJ7C 3NTNA 3SWFA 1FOSF 2N1TC 4WB4A 3P8CD 2L5GB 1AQ5A 1IFNA 1NKZB 5AVXB 1CZQA 1LTSC 4XA4A 2PP6A 3RK2C 4B86A 1J1DB 5CCHC 1IK9A 1ZN5A 2FFDA 1N86A 2CPBA 3BASA 2OYIC 5AW1B 3HE4B 1NOHA 1FJPA 1H8AA 3VYIA 1ZLLA 2W27A 2H7HA 2Z4EA 5AVQB 3RK3D 5CCGC 5AVTB 1HBWA 1JY3P 2CPSA 3HUSC 2IFMA 2OYHC 2ZFCA 1FZCB 1NTMK 3TNUB 3M0DA 2KSJA 2HPCB 3A2AA 1J1EB 2WITA 1ZR2A 1FZAA 3A7OA 2Q7CA 1N7SB 3OJAB 2M3BA 3CL3D 4W80A 3RK3C 5APQA 5CJ0A 2XV5A 3V2PA 1JTHB 2C0WA 4LLHA 2E43A 3H32B 2FKWB 1L4AB 2A45H 4GIFA 3VMXA 1HWTC 1GZLA 1KQLA 1NAFA 4Y99B 5AW9B 1NWQA 1LT9C 1S9KE 3BVHA 1VPCA 1OWAA 5AVWB 1VDFA 1L4AC 2P7JA 2C9LY 2NPSD 3HE4A 1X79B 1RF0A 1LWUB 5AW6B 1LTJC 3C9IA 2PAJA 4M3LA 3TYYA 2XKMA 3NXSA 2YKOA 1EQ7A 3M0AA 1CI6B 1MV8A 1SFCD 1M7LA 3L4FA 1JO5A 1DEBA 2J59M 1HTLC 1IFIA 3RL0B 2O01H 4WY4C 2N9BA 1URQA 1JY3O 3PP5A 5APSA 3WMM0 4ZKPA 3IR9A 1SQQK 2P1JA 1RF1C 1FZCA 1SQPK 3TNUA 4IFMA 1CW5A 2HPCA 3M06A 1FBMA 1HGZA 1H88A 1N73B 3HE5B 2NPSC 1MUUA 4ZKUA 2Q9IA 3CI9A 3GHGB 1N7SA 3B5NB 5KLVK 2GM4A 1YTZI 1N7LA 3VOPA 1L0NK 3MUDA 5BU5A 1SFCC 5BU8B 2N1TB 3NMDA 2KOGA 2YMYA 3B8EB 2I1JA 1RE4A 2P67A 3L37A 3RK2B 1JTHA 1WRGA 3H32A 1NHLA 3E1IA 1MZ9A 1QL1A 4AQRD 2WT7B 3M9QA 2XNXA 1ZV8A 2OYIB 2Q5UA 2WPQA 3T97A 1CSBA 1RY3A 3R2PA 3SWYA 3HD7D 3BRVB 1JY2O 5BVZA 1LWUA 1LGHB 3V2NA 3KDPB 2POHA 2GUVA 1CI6A 1YTZT 1GW4A 3HUSB 2OYHB 1G1IA 1KILA 3M91A 4O9BA 2GUSA 4OH8B 1G1JA 4AYCA 1SQVK 4GKGA 2FYZA 3L36A 4W7YA 1NKNA 1URQD 2M8RA 2W6AA 4I6MC 3P7KA 3VTPC 2E42A 3MGNA 5CJ4A 1X8YA 4HYTB 4AUWA 1FOSE 1RE3A 3G3ZA 2FYUK 2WTYA 1N73A 3HD7C 1GDTA 3HE5A 1GU4A 4GT1A 1LTAC 4DOJA 2WSCH 2IX7C 2OARA 3GHGA 3RK3B 1IO4A 2IFNA 3B5NA 1LTTC 2QM7A 3KQGA 5KJ7A 1GU5A 1XTGB 2N1TA 1GL2D 1JMMA 1YYCA 1LT9B 1LTGC 5CCHA 2R3CA 5AW5B 1JOCA 1IFJA 3EQ2A 2WT7A 2Z5HA 4JYBA 2OYIA 1A02J 1M1JC 5AVRB 3P8CE 1SLQA 3N4XA 3OAKA 3M9HA 1HJBA 1LTJB 2VRSA 1NO4A 4N78D 2HODB 5APYA 2C0XA 2C9NY 4I2LC 5CCGA 4WY4B 2QM8A 3KYQA 3VMYA 1GL2C 2H43A 1MFZA 3HUSA 3BATA 2OYHA 2FXMA 1X9VA 1FZBA 3UIAA 1RF1B 5APVA 1GD2E 1KILD 2O1JA 1W2EA 4HH2A 3O8ZA 3MD0A 3HRNA 1HGVA 2NPSB 2Q3IA 1SQXK 3HTKB 3VP8A 3L35A 1HUCA 1SFCB 3VN0A 1G2CB 2FFDC 1L0LK 5AVZB 2WSFH 3I5CA 2J58A 3V4QA 4I1LA 3M9BA 1XTCC 1JNMA 4LGDE 1E5WA 5KJ7D 1FJKA 2XZRA 2A45I 1LT9A 1KILC 2LKMA 3V5BA 2XDJA 1L4AA 3KPEA 2HFED 2WSEH 5AW4B 3OA7A 4EOTA 1IFDA 1FU1A 4DZOA 1LTJA 1ZR4A 1LTBC 2MJZA 2HODA 3M0DC 1FZEA 2KP8A 5CMZA 3V2RA 1J2JB 4WY4A 3U1AA 5CCGD 3A5TA 5APTA 4IFFA 5AVYB 1KZUB 1IC2A 1RF1A 5APUA 1JY3N 1S9KD 1T8ZA 5AVVB 3HD7B 2NPSA 3HTKA 2P2UA 2YO3A 2WWWA 2IPPA 2HYNA 5AW2B 4JF7A 2BASA 1J1DC 1SFCA 1KFMA 4IFDK 1G2CA 2YKPA 5AVSB 1HVVA 1NTKK 1GTWA 1PFIA 4C7NB 1DX7A 1RF0C 2YNYA 1N7SD 3P32A 1URQB 4N6JA 3IFMA 3V4WA 1M1JB 1T2KD 4KHXA 3MIWA 2JEEA 1GK4A 1T3UA 3TSIA 1FDMA 1NH4A 1URQC 3VMZA 1L4AD 2KB7P 1NTZK 1FZCC 1A02F 5AW3B 4EIJA 1FZFA 1GL2B 1FAVA 1JY2N 1JCCA 2KYVA 2R32A 2O1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QL2 A;  2IFN A;  3IFM A;  4IFM A;  1ZN5 A;  2XKM A;  2IFM A;  2KSJ A;  1PFI A;  1QL1 A;  2KLV A;  1IFN A;  1IFM A; 
#chains in the Genus database with same CATH topology
 2OQQ A;  1J1E C;  2YIU C;  3A3Y B;  3I55 P;  1T2K C;  2YO2 A;  1W5C E;  3CLQ A;  4N3Y B;  2FFD B;  1Z56 A;  1SP4 A;  3LID A;  4NPD A;  4XE5 B;  3EFG A;  1IFM A;  1KIL B;  1H89 A;  1TU3 F;  5TIS H;  4LC1 A;  1NVO A;  1PP9 E;  1M1J A;  1EZV G;  2N1T D;  1KYO E;  1DH3 A;  1S4X A;  3GF7 A;  3AE2 C;  3CMA P;  2Z5I A;  3RK2 D;  3EWK A;  2E75 B;  1VQP P;  1JUN A;  1N2D C;  2ZAE B;  4EYY Q;  2LR2 A;  3U59 A;  1GW3 A;  2ZXE B;  5L8R J;  4N78 E;  2OTJ P;  3NFQ A;  1SQX E;  3GHG C;  4H13 B;  3LW5 H;  2JJL A;  3LIE A;  4HB1 A;  1E79 H;  1SQV G;  2R5B A;  1BE3 D;  1PL5 A;  4UB8 H;  3SWF A;  2N1T C;  1NKZ B;  3RK2 C;  3Q2Y A;  1KIL E;  2FYU G;  4U7J A;  3AE8 C;  3BAS A;  3FWL A;  4WWI A;  1S2E A;  1OVV A;  1ZLL A;  1BE3 J;  2AXT H;  1Q86 Q;  3KXD A;  5AVT B;  2O01 J;  1JY3 P;  1FDO A;  2BCC E;  4HKZ H;  1Y8A A;  2IFM A;  3L72 E;  4XFJ A;  4RKU J;  1PGJ A;  2KSJ A;  2BEQ D;  3H1K D;  4GOE A;  2QSI A;  3A2A A;  2A06 E;  1J1E B;  2YIU B;  1ZR2 A;  1JMB A;  1FZA A;  2YMK A;  3A7O A;  1EDL A;  1BGY D;  5APQ A;  2XV5 A;  4YPC A;  3H32 B;  2FKW B;  3H1K J;  2KXP B;  1KQL A;  3OW2 O;  1IK7 A;  1NTK E;  1S5L E;  4Y28 J;  5AVW B;  2P7J A;  1BGY J;  2JR8 A;  1LTJ C;  4M3L A;  2XKM A;  2ZYD A;  1SFC D;  1M7L A;  1PPJ E;  5H2F H;  4WY4 C;  1EXJ A;  1L0N D;  3WMM 0;  5C39 A;  2KUB A;  2P1J A;  1OIP A;  3TNU A;  3RL0 g;  4WVZ A;  1CW5 A;  1ZXG A;  1FBM A;  1FS0 E;  1H88 A;  2N9Y B;  1MUU A;  3GHG B;  5GTH E;  1N7S A;  1VQO P;  1DD4 A;  1SFC C;  5BU8 B;  2N1T B;  3NMD A;  1L0N J;  3Q5R A;  2QJP C;  2I1J A;  2W90 A;  1RE4 A;  3RK2 B;  1JM0 A;  1PIX A;  1JTH A;  1WRG A;  1NHL A;  3H1J D;  1MZ9 A;  4PD4 D;  1FDI A;  3RBX A;  3AE5 C;  1CSB A;  3R2P A;  1H0T A;  3SWY A;  1KYO H;  2WSS H;  1NTM D;  3V2N A;  2SPZ A;  1YTZ T;  3M91 A;  4O9B A;  3MHV A;  4DJG A;  4OH8 B;  2IZ0 A;  1YQ3 C;  2FYZ A;  3FGA D;  4AUW A;  1RE3 A;  3G3Z A;  2G3A A;  1PGO A;  2WTY A;  2L91 A;  1OVR A;  1LTA C;  4DOJ A;  2WSC H;  1Q7Y Q;  2J5U A;  1GU5 A;  4OGQ D;  1YYC A;  4U3F G;  5KLI C;  2R3C A;  1NJI Q;  3A0B E;  1JOC A;  1BE3 E;  4EI2 A;  3PLN A;  4JYB A;  2OYI A;  3OAK A;  1HJB A;  1LTJ B;  2JO1 A;  1NO4 A;  2HOD B;  1SQQ D;  5E79 E;  4I2L C;  1SQP D;  4WY4 B;  3H1L D;  2P10 A;  3KYQ A;  3VMY A;  1IFP A;  3HUS A;  3GF3 A;  2PGD A;  5M1B A;  1KD1 Q;  2QJY C;  4U3F J;  1NTZ E;  4R4L A;  3FWN A;  1BDC A;  1HGV A;  2Q3I A;  3H1H J;  3FX0 A;  3HTK B;  1U57 A;  3VP8 A;  3L71 J;  1HUC A;  4BRY B;  1NYH A;  4YTP C;  1VQ8 P;  3EFF K;  3H1K E;  1SFC B;  1G2C B;  2QJP B;  5AVZ B;  3M9B A;  1XTC C;  1JNM A;  1S5L H;  2K9J A;  4LGD E;  1E5W A;  5KJ7 D;  5KAF E;  1MKM A;  1LT9 A;  1OX3 A;  2KNC A;  1RQU A;  3L75 E;  1IFD A;  1OMI A;  4DZO A;  2MJZ A;  2H89 C;  2Y0D A;  3CCL P;  1KZU B;  1JY3 N;  1S9K D;  5GTH H;  3QH9 A;  1S5L X;  1K73 Q;  2JWA A;  4BWN A;  2Q3E A;  1L0N E;  4RJT A;  3JCU E;  3QWO C;  2RMZ A;  4IFD K;  3CWB D;  1KV4 A;  3VMA A;  2OTL P;  4UB6 E;  5KLI B;  1KQF B;  1PFI A;  3L73 D;  2FXP A;  3IFM A;  5K5G B;  3AEE C;  3MIW A;  2JEE A;  3G4S P;  1AVY A;  1BSH A;  1PP9 G;  2R3S A;  1NH4 A;  3CCM P;  3H1J E;  1L4A D;  1M1K Q;  1D7M A;  2B9B A;  1NTZ K;  4PD4 E;  4EIJ A;  1EXI A;  4RO0 A;  1JY2 N;  1SQB G;  3PJS K;  1WMK A;  2QJY B;  4MN4 C;  1NTM E;  5APX A;  3KHU A;  4D6T G;  3RL0 D;  1ZOY C;  3HD7 A;  1KQG B;  3N7N A;  1T3J A;  2W6B A;  4C7R A;  1NU1 K;  3KZI E;  2E5Y A;  3V2Q A;  4PJ0 E;  1SQB J;  2AEM A;  3VP9 A;  1LWU C;  1ZME C;  5AW8 B;  4ZNC A;  5E79 H;  3BRT B;  3RL0 C;  2BCC G;  5APW A;  4W7Z A;  1SVF A;  4QMA A;  3TGU G;  2QJK C;  4IL6 E;  1HJ0 A;  2A06 G;  3BCC E;  1UIX A;  4ASV A;  2YKQ A;  1N73 C;  1BSN A;  1SQQ E;  1KFN A;  1WT6 A;  1SQP E;  2MKV A;  1AFO A;  3H1L E;  1X0T A;  1FOS F;  4WB4 A;  3P8C D;  2L5G B;  1Q81 Q;  1VQM P;  3AEF C;  4B86 A;  1HF9 A;  2FFD A;  2CPB A;  5KAF H;  2QA4 P;  3HE4 B;  1VQ5 P;  1FJP A;  5KAI E;  3TGU J;  4TLF A;  1DEE G;  4Z1M H;  3RK3 D;  5CCG C;  3WUT A;  1P84 D;  1HBW A;  1PPJ G;  2CPS A;  2OYH C;  2ZFC A;  1NTM K;  2K88 A;  4L74 A;  2WPV B;  3OJA B;  2M3B A;  3RK3 C;  1YHQ P;  3JCU H;  3V2P A;  2FBW C;  1L4A B;  2A45 H;  1GZL A;  1NAF A;  1NWQ A;  5AW9 B;  4UB6 H;  1S9K E;  3BVH A;  2C9L Y;  2NPS D;  1KMI Z;  1OVU A;  3L70 G;  1X79 B;  1RF0 A;  1LWU B;  2PRR A;  3D6Z A;  2KZI A;  1K05 A;  2YKO A;  1Y47 A;  2M5A B;  1MV8 A;  3CWB E;  1JO5 A;  2J59 M;  1HTL C;  3RL0 B;  4PD4 H;  5KKZ C;  5DJT B;  1URQ A;  1JY3 O;  5APS A;  3L73 E;  1KB9 D;  3IR9 A;  1SQQ K;  1RF1 C;  1SQP K;  2QJK B;  3GG2 A;  2M3E A;  1N73 B;  2NPS C;  1EZV D;  2Q9I A;  5KLV K;  3SFE C;  1YTZ I;  3VOP A;  2BEZ F;  2P67 A;  3L37 A;  4KJM A;  3KZI H;  4EDF A;  4PJ0 H;  3E1R A;  3H32 A;  1QL1 A;  4AQR D;  1ZV8 A;  2Q5U A;  1QVF O;  3T97 A;  3CPW O;  2IBZ D;  1SQV D;  1PV3 A;  1JY2 O;  1Q2N A;  3SFD C;  3KDP B;  2FYU D;  2GUV A;  4H44 D;  1GW4 A;  2OYH B;  1G1I A;  3W67 A;  2M0B A;  1G1J A;  1BCC E;  4IL6 H;  3L36 A;  1SQV J;  1NKN A;  2M8R A;  3P7K A;  1NTZ G;  4GOD A;  3TF5 A;  1USE A;  1GDT A;  2FYU J;  1ZRT D;  3CCU P;  3GHG A;  2IX7 C;  2OAR A;  3RK3 B;  1LTT C;  2QM7 A;  5B5E E;  1AA0 A;  2N1T A;  1GL2 D;  3B71 A;  1VQ6 P;  2IYP A;  2QIW A;  2V7Q J;  1R5L A;  4OVN F;  5KAI H;  5AVR B;  3P8C E;  1SLQ A;  3M9H A;  4IL6 X;  1NU1 G;  3L75 G;  1L0L G;  2NZ2 A;  2C0X A;  1GMJ A;  3IAO A;  5KKZ B;  5B66 E;  3Q1M A;  1GL2 C;  4JPZ B;  3BAT A;  2QG4 A;  1RF1 B;  1GD2 E;  3O8Z A;  3RK3 E;  1QX8 A;  4L76 A;  3HRN A;  2NPS B;  1SQX K;  3H1I G;  3L35 A;  1NU1 J;  4A7P A;  3VN0 A;  2E5T A;  1L0L J;  2WSF H;  4JBZ A;  3S1K A;  2KK7 A;  2WSE H;  5AW4 B;  3CME P;  3L74 G;  1LTJ A;  1ZR4 A;  2HOD A;  3M0D C;  3MP7 B;  2HR3 A;  2E74 D;  1YJ9 P;  1FZE A;  5GTI H;  4WY4 A;  5AVY B;  3IF4 A;  1NTM G;  1T8Z A;  1EDJ A;  3HTK A;  4BRY A;  2HYN A;  5AW2 B;  4H44 B;  3L74 J;  3CC7 P;  1SFC A;  1G2C A;  2E74 C;  2AXC A;  5AVS B;  3CXH D;  2RH0 A;  1EZV E;  1NTK K;  1LNQ A;  4C7N B;  3P32 A;  1NGM B;  3GW6 A;  1EDI A;  3ABV C;  4TT3 H;  4U3F D;  1JB0 J;  1KYO I;  1FZC C;  1A02 F;  1GL2 B;  1Y9B A;  1FAV A;  2IBZ E;  1SQV E;  2R32 A;  3H1H D;  4IOI H;  3L71 D;  5AVU B;  3RBZ A;  3LW5 J;  3CCR P;  4OGQ C;  2HLO A;  3BCC G;  2WPR A;  2FYU E;  3A0H E;  1GK6 A;  3MUD C;  1SQP G;  4RES B;  1JCD A;  1QGK B;  3II6 A;  5B5E H;  3CC4 P;  3K5B A;  1FZG A;  2Y0C A;  1KTM A;  5KLV G;  1M90 Q;  2OYO A;  5AW0 B;  3R4Y A;  2E76 D;  2JKV A;  1QL2 A;  2DW3 A;  3O6Q B;  2OGU A;  4I7Z C;  3U1C A;  2W83 C;  3B5N D;  3GMA A;  3E7K A;  2KS1 B;  1LTI C;  1BGY E;  4YXW H;  1M56 D;  2FY8 A;  5AW7 B;  5B66 H;  1R8E A;  2W8Z A;  5CCH D;  2HG5 D;  1AVO A;  2I8D A;  2W6J H;  1P84 H;  3AE9 C;  2ITA A;  2I1K A;  3B5N C;  1HH0 A;  2H8P D;  1MFT A;  5KJ7 C;  3F5H A;  3C8V A;  1AQ5 A;  1YI2 P;  1IFN A;  5AVX B;  4XA4 A;  1LTS C;  3JSV C;  2PP6 A;  5CCH C;  1N86 A;  2E74 B;  1YBK A;  2WMM A;  5AW1 B;  1U7J A;  1NOH A;  1PGP A;  1H8A A;  3VYI A;  1K9M Q;  1T6A A;  2W27 A;  2H7H A;  5AVQ B;  3AEA C;  3D70 A;  2R44 A;  3CWB G;  5EFW B;  5CBN A;  3Q3D A;  1FZC B;  2HPC B;  3G9R A;  4BXL A;  1M57 D;  1LT1 A;  4OGQ B;  2IZ1 A;  1PP9 D;  1ZP0 C;  3CL3 D;  1KB9 H;  2K1A A;  3CCE P;  2C0W A;  1SQB D;  1SQX G;  4GIF A;  3VMX A;  4ASW A;  3CX5 H;  1VPC A;  1OWA A;  1PP9 J;  1VDF A;  1L4A C;  4D6T D;  3HE4 A;  1ZW0 A;  4I7Z B;  3NXS A;  1EQ7 A;  1CI6 B;  1NAY A;  3PH0 A;  3L4F A;  1DEB A;  3FXE A;  3CXH E;  1IFI A;  2O01 H;  1DIP A;  4D6T J;  1QEX A;  1BCC G;  1SQX J;  2B87 B;  2KLU A;  3M06 A;  2E75 D;  3A0H H;  2E76 B;  3L72 G;  3HE5 B;  3CI9 A;  4U3F E;  1AV1 A;  3B5N B;  2GM4 A;  1L0N K;  3FXD A;  5BU5 A;  2KOG A;  3H1H E;  3L71 E;  1EZV I;  3TGU D;  2D2C D;  2WT7 B;  3M9Q A;  2XNX A;  2WPQ A;  1N8R Q;  1AQT A;  2BCC J;  1VQN P;  2YXQ B;  1NTK G;  4L75 A;  5BVZ A;  1LWU A;  2POH A;  2M5A A;  2IBZ I;  1VL2 A;  1KIL A;  1EDK A;  1R5S A;  3AED C;  1S72 P;  4AYC A;  1KN7 A;  2D2C C;  4W7Y A;  1URQ D;  2W6A A;  4I6M C;  1VF5 D;  1YQ4 C;  5CJ4 A;  3G6E P;  1X8Y A;  1PGQ A;  1N73 A;  4DCK A;  1GU4 A;  2IYO A;  4GT1 A;  4K3A A;  3KQG A;  1XTG B;  1LP1 B;  2ZXX A;  1LTG C;  3MZW B;  2LXC B;  1VF5 C;  1A02 J;  1M1J C;  2YXR B;  2VRS A;  2ZVN B;  1VQ4 P;  3USS A;  1VQL P;  5CCG A;  2H43 A;  1MFZ A;  2OYH A;  1X9V A;  3UIA A;  5APV A;  2O1J A;  3L70 D;  1W2E A;  4HH2 A;  3MD0 A;  2LXB A;  5GTI E;  1AJY A;  1UII A;  3B4S A;  5CBO A;  2J58 A;  3CX5 D;  3L70 J;  1FJK A;  2A45 I;  2AEJ A;  1M8O B;  3V5B A;  2XDJ A;  3KPE A;  3OA7 A;  1SQB E;  1L2P A;  3CXH H;  3PHL A;  2G8Y A;  1BE3 G;  3PRJ A;  3V2R A;  5CMZ A;  4D6T E;  3CD6 P;  2IBZ G;  3U1A A;  4PD4 I;  2D2C B;  5APT A;  1IC2 A;  1OW6 A;  2NRG A;  1RF1 A;  1OW8 A;  1VQ9 P;  4ZMD A;  3AE1 C;  2QRX A;  2NPS A;  2P2U A;  2IPP A;  4JF7 A;  2BAS A;  1J1D C;  3Q5S A;  1KFM A;  2QEX P;  2JP3 A;  1HVV A;  1NTZ D;  3D6Y A;  3H1K G;  4H44 C;  1DX7 A;  2YNY A;  3TDK A;  1N7S D;  1URQ B;  2JWD A;  3V4W A;  1VF5 B;  1M1J B;  4KHX A;  1T3U A;  3CXH I;  3TSI A;  2Q6Q A;  3TGU E;  1BGY G;  3VMZ A;  2Q1K A;  1FZF A;  1NTZ J;  2KYV A;  2KZJ A;  2Y9Z A;  1OW7 A;  2Y0E A;  4OWF A;  3AEC C;  1IJD B;  5CHX A;  1NU1 D;  1N7S C;  4H0L D;  4WY4 D;  2RN0 A;  3D71 A;  1S3J A;  3L75 D;  3TK1 A;  1VQK P;  1EC5 A;  1L0L D;  4C46 A;  1OXZ A;  1BDD A;  1RE4 C;  3T97 B;  3SSU A;  1P84 E;  3CCJ P;  2O01 N;  1JY2 P;  2WZ7 A;  4Y99 C;  3AEB C;  1S1C X;  3CCS P;  2XND H;  3P8M C;  3H6P A;  1L0N G;  1SQB K;  3MTU E;  5KTB A;  3L75 J;  2WPS A;  3H1I D;  4H0L C;  4C7N A;  2A45 G;  2XU6 A;  2KLV A;  2R5D A;  4DT0 A;  4PV1 D;  3H25 A;  4R4M A;  2ZYG A;  4K35 A;  1GL2 A;  3H1I J;  1RE3 C;  4WBA A;  2FXO A;  3H1J G;  4JYC A;  3L74 D;  3Q5P A;  1YIJ P;  3NTN A;  3RGU A;  1CZQ A;  4PV1 C;  1J1D B;  3L70 E;  1IK9 A;  1ZN5 A;  2ZJS E;  2OYI C;  1KB9 E;  1LJ2 A;  1JEK A;  3H1J J;  3O6Q A;  2Z4E A;  4GOF A;  2PFX A;  3CX5 E;  2KS1 A;  3HUS C;  3TNU B;  3M0D A;  1NTM J;  2WIT A;  3PTZ A;  2Q7C A;  1N7S B;  2IDB A;  4W80 A;  1RH5 B;  5CJ0 A;  1JTH B;  4LLH A;  2E43 A;  2CK3 H;  3H1H G;  3L71 G;  1SQQ G;  1QLE D;  3WU2 E;  1HWT C;  4Y99 B;  3WUU A;  1LT9 C;  2WQY C;  3H1L G;  1H0T B;  3BCC D;  1Q90 D;  4GDO A;  4H0L B;  1OFC X;  5AW6 B;  3C9I A;  2PAJ A;  3TYY A;  1KOR A;  4NPF X;  3M0A A;  3I56 P;  1ZRT E;  3F89 A;  3WUV A;  1U7M A;  5KLV D;  2H88 C;  2N9B A;  1QVG O;  3PP5 A;  4ZKP A;  2JDI H;  3BCC J;  1OZH A;  2ZT9 D;  1FZC A;  1SQQ J;  4IFM A;  2HPC A;  1SQP J;  3H1L J;  1HGZ A;  2KIK A;  4ZKU A;  1DD3 A;  2V4H A;  1N7L A;  3AE6 C;  3MUD A;  5KLV J;  3C1L A;  2E76 C;  3G71 P;  2YMY A;  3B8E B;  4PV1 B;  1NU1 E;  3E1I A;  1K8A Q;  2ZT9 C;  1L0L E;  2QE7 H;  2OYI B;  1FC2 C;  1RY3 A;  3HD7 D;  3BRV B;  2K9Y A;  1LGH B;  1CI6 A;  3ITK A;  3HUS B;  2GUS A;  3H1I E;  1SQV K;  4GKG A;  2KI7 B;  1RQV A;  3VTP C;  2E42 A;  3MGN A;  2B87 A;  4HYT B;  2WVR A;  1FOS E;  1X22 A;  2FYU K;  3L73 G;  3HD7 C;  3HE5 A;  1P84 I;  2QVA A;  1IO4 A;  2WSF J;  2IFN A;  3B5N A;  5KJ7 A;  3GLM A;  1JMM A;  2K9J B;  1KYO D;  2K3R A;  1LT9 B;  4YXD C;  5CCH A;  3L74 E;  3SWK A;  1RHZ B;  5AW5 B;  2KNC B;  2FYN C;  3S9O A;  4CPG A;  1IFJ A;  3EQ2 A;  2WT7 A;  2Z5H A;  2WSE J;  3CWB J;  5DJU B;  3N4X A;  5TIS E;  1YJW P;  3CCQ P;  4N78 D;  5APY A;  3L73 J;  1W2B O;  2C9N Y;  2KSE A;  1SQX D;  3AE4 C;  2QM8 A;  2OTK E;  2FXM A;  1FZB A;  1KIL D;  3V6I A;  3ZDM A;  4NPE A;  1K04 A;  1KQS O;  2K37 A;  3A0B H;  4UB8 E;  2FFD C;  1L0L K;  3WU2 H;  3AE3 C;  2WSC J;  3I5C A;  3V4Q A;  1BCC D;  1KB9 I;  1SS1 A;  2BCC D;  4I1L A;  2RKL A;  1LP1 A;  3L72 D;  2XZR A;  2ZT9 B;  2V7Q H;  1KIL C;  2LKM A;  4H13 D;  3AE7 C;  1L4A A;  2ZYA A;  3CX5 I;  2HFE D;  2A06 D;  2ZVO B;  2AXT E;  4EOT A;  3S4R A;  3W68 A;  1FU1 A;  1LTB C;  1BCC J;  2E75 C;  1KC8 Q;  2O3J A;  2KP8 A;  3L72 J;  1J2J B;  5CCG D;  3A5T A;  4IFF A;  1YJN P;  1FE6 A;  5APU A;  3AEG C;  1NTK D;  4H13 C;  5AVV B;  4HJG H;  5KLV E;  3HD7 B;  2YO3 A;  2WWW A;  2GA1 A;  3JC2 2;  1USD A;  1PPJ D;  2YKP A;  2Y9Y A;  2AEF A;  2UWJ E;  1GTW A;  1YIT P;  4JQ0 D;  1NTK J;  1RF0 C;  2B88 A;  3CC2 P;  2FYN B;  5TJH A;  4N6J A;  4KT0 J;  1IZN B;  1T2K D;  4L73 A;  1GK4 A;  3IN6 A;  1FDM A;  1PZQ A;  3CCV P;  1URQ C;  2B89 A;  5H2F E;  2KB7 P;  1VQ7 P;  5AW3 B;  1Q82 Q;  1JCC A;  2O1K A;  2P58 A; 
#chains in the Genus database with same CATH homology
 5AVU B;  1J1E C;  1IJD B;  3A3Y B;  5CHX A;  2HLO A;  1N7S C;  4WY4 D;  5APX A;  2WPR A;  3TK1 A;  1GK6 A;  1T2K C;  4C46 A;  2YO2 A;  1OXZ A;  4RES B;  1JCD A;  1RE4 C;  3CLQ A;  3RL0 D;  3II6 A;  4N3Y B;  3HD7 A;  2FFD B;  3N7N A;  1Z56 A;  1T3J A;  1JY2 P;  1FZG A;  2WZ7 A;  4Y99 C;  2W6B A;  4C7R A;  1SP4 A;  1NU1 K;  3P8M C;  3H6P A;  3V2Q A;  5AW0 B;  3LID A;  4XE5 B;  3EFG A;  1SQB K;  3MTU E;  5KTB A;  1IFM A;  1QL2 A;  1KIL B;  3VP9 A;  2WPS A;  1H89 A;  4C7N A;  3U1C A;  1LWU C;  4LC1 A;  3B5N D;  5AW8 B;  2A45 G;  1LTI C;  1M1J A;  2N1T D;  2XU6 A;  2KLV A;  1DH3 A;  2R5D A;  3BRT B;  3RL0 C;  5AW7 B;  2Z5I A;  3RK2 D;  5APW A;  5CCH D;  1JUN A;  1N2D C;  4W7Z A;  1SVF A;  2HG5 D;  3U59 A;  1GL2 A;  1RE3 C;  1GW3 A;  4WBA A;  2ZXE B;  4N78 E;  4JYC A;  1N73 C;  2YKQ A;  1WT6 A;  1KFN A;  3NFQ A;  3GHG C;  3LW5 H;  2JJL A;  3LIE A;  2I1K A;  3B5N C;  1AFO A;  2R5B A;  1HH0 A;  2H8P D;  5KJ7 C;  3NTN A;  3SWF A;  1FOS F;  2N1T C;  4WB4 A;  3P8C D;  2L5G B;  1AQ5 A;  1IFN A;  1NKZ B;  5AVX B;  1CZQ A;  1LTS C;  4XA4 A;  2PP6 A;  3RK2 C;  4B86 A;  1J1D B;  5CCH C;  1IK9 A;  1ZN5 A;  2FFD A;  1N86 A;  2CPB A;  3BAS A;  2OYI C;  5AW1 B;  3HE4 B;  1NOH A;  1FJP A;  1H8A A;  3VYI A;  1ZLL A;  2W27 A;  2H7H A;  2Z4E A;  5AVQ B;  3RK3 D;  5CCG C;  5AVT B;  1HBW A;  1JY3 P;  2CPS A;  3HUS C;  2IFM A;  2OYH C;  2ZFC A;  1FZC B;  1NTM K;  3TNU B;  3M0D A;  2KSJ A;  2HPC B;  3A2A A;  1J1E B;  2WIT A;  1ZR2 A;  1FZA A;  3A7O A;  2Q7C A;  1N7S B;  3OJA B;  2M3B A;  3CL3 D;  4W80 A;  3RK3 C;  5APQ A;  5CJ0 A;  2XV5 A;  3V2P A;  1JTH B;  2C0W A;  4LLH A;  2E43 A;  3H32 B;  2FKW B;  1L4A B;  2A45 H;  4GIF A;  3VMX A;  1HWT C;  1GZL A;  1KQL A;  1NAF A;  4Y99 B;  5AW9 B;  1NWQ A;  1LT9 C;  1S9K E;  3BVH A;  1VPC A;  1OWA A;  5AVW B;  1VDF A;  1L4A C;  2P7J A;  2C9L Y;  2NPS D;  3HE4 A;  1X79 B;  1RF0 A;  1LWU B;  5AW6 B;  1LTJ C;  3C9I A;  2PAJ A;  4M3L A;  3TYY A;  2XKM A;  3NXS A;  2YKO A;  1EQ7 A;  3M0A A;  1CI6 B;  1MV8 A;  1SFC D;  1M7L A;  3L4F A;  1JO5 A;  1DEB A;  2J59 M;  1HTL C;  1IFI A;  3RL0 B;  2O01 H;  4WY4 C;  2N9B A;  1URQ A;  1JY3 O;  3PP5 A;  5APS A;  3WMM 0;  4ZKP A;  3IR9 A;  1SQQ K;  2P1J A;  1RF1 C;  1FZC A;  1SQP K;  3TNU A;  4IFM A;  1CW5 A;  2HPC A;  3M06 A;  1FBM A;  1HGZ A;  1H88 A;  1N73 B;  3HE5 B;  2NPS C;  1MUU A;  4ZKU A;  2Q9I A;  3CI9 A;  3GHG B;  1N7S A;  3B5N B;  5KLV K;  2GM4 A;  1YTZ I;  1N7L A;  3VOP A;  1L0N K;  3MUD A;  5BU5 A;  1SFC C;  5BU8 B;  2N1T B;  3NMD A;  2KOG A;  2YMY A;  3B8E B;  2I1J A;  1RE4 A;  2P67 A;  3L37 A;  3RK2 B;  1JTH A;  1WRG A;  3H32 A;  1NHL A;  3E1I A;  1MZ9 A;  1QL1 A;  4AQR D;  2WT7 B;  3M9Q A;  2XNX A;  1ZV8 A;  2OYI B;  2Q5U A;  2WPQ A;  3T97 A;  1CSB A;  1RY3 A;  3R2P A;  3SWY A;  3HD7 D;  3BRV B;  1JY2 O;  5BVZ A;  1LWU A;  1LGH B;  3V2N A;  3KDP B;  2POH A;  2GUV A;  1CI6 A;  1YTZ T;  1GW4 A;  3HUS B;  2OYH B;  1G1I A;  1KIL A;  3M91 A;  4O9B A;  2GUS A;  4OH8 B;  1G1J A;  4AYC A;  1SQV K;  4GKG A;  2FYZ A;  3L36 A;  4W7Y A;  1NKN A;  1URQ D;  2M8R A;  2W6A A;  4I6M C;  3P7K A;  3VTP C;  2E42 A;  3MGN A;  5CJ4 A;  1X8Y A;  4HYT B;  4AUW A;  1FOS E;  1RE3 A;  3G3Z A;  2FYU K;  2WTY A;  1N73 A;  3HD7 C;  1GDT A;  3HE5 A;  1GU4 A;  4GT1 A;  1LTA C;  4DOJ A;  2WSC H;  2IX7 C;  2OAR A;  3GHG A;  3RK3 B;  1IO4 A;  2IFN A;  3B5N A;  1LTT C;  2QM7 A;  3KQG A;  5KJ7 A;  1GU5 A;  1XTG B;  2N1T A;  1GL2 D;  1JMM A;  1YYC A;  1LT9 B;  1LTG C;  5CCH A;  2R3C A;  5AW5 B;  1JOC A;  1IFJ A;  3EQ2 A;  2WT7 A;  2Z5H A;  4JYB A;  2OYI A;  1A02 J;  1M1J C;  5AVR B;  3P8C E;  1SLQ A;  3N4X A;  3OAK A;  3M9H A;  1HJB A;  1LTJ B;  2VRS A;  1NO4 A;  4N78 D;  2HOD B;  5APY A;  2C0X A;  2C9N Y;  4I2L C;  5CCG A;  4WY4 B;  2QM8 A;  3KYQ A;  3VMY A;  1GL2 C;  2H43 A;  1MFZ A;  3HUS A;  3BAT A;  2OYH A;  2FXM A;  1X9V A;  1FZB A;  3UIA A;  1RF1 B;  5APV A;  1GD2 E;  1KIL D;  2O1J A;  1W2E A;  4HH2 A;  3O8Z A;  3MD0 A;  3HRN A;  1HGV A;  2NPS B;  2Q3I A;  1SQX K;  3HTK B;  3VP8 A;  3L35 A;  1HUC A;  1SFC B;  3VN0 A;  1G2C B;  2FFD C;  1L0L K;  5AVZ B;  2WSF H;  3I5C A;  2J58 A;  3V4Q A;  4I1L A;  3M9B A;  1XTC C;  1JNM A;  4LGD E;  1E5W A;  5KJ7 D;  1FJK A;  2XZR A;  2A45 I;  1LT9 A;  1KIL C;  2LKM A;  3V5B A;  2XDJ A;  1L4A A;  3KPE A;  2HFE D;  2WSE H;  5AW4 B;  3OA7 A;  4EOT A;  1IFD A;  1FU1 A;  4DZO A;  1LTJ A;  1ZR4 A;  1LTB C;  2MJZ A;  2HOD A;  3M0D C;  1FZE A;  2KP8 A;  5CMZ A;  3V2R A;  1J2J B;  4WY4 A;  3U1A A;  5CCG D;  3A5T A;  5APT A;  4IFF A;  5AVY B;  1KZU B;  1IC2 A;  1RF1 A;  5APU A;  1JY3 N;  1S9K D;  1T8Z A;  5AVV B;  3HD7 B;  2NPS A;  3HTK A;  2P2U A;  2YO3 A;  2WWW A;  2IPP A;  2HYN A;  5AW2 B;  4JF7 A;  2BAS A;  1J1D C;  1SFC A;  1KFM A;  4IFD K;  1G2C A;  2YKP A;  5AVS B;  1HVV A;  1NTK K;  1GTW A;  1PFI A;  4C7N B;  1DX7 A;  1RF0 C;  2YNY A;  1N7S D;  3P32 A;  1URQ B;  4N6J A;  3IFM A;  3V4W A;  1M1J B;  1T2K D;  4KHX A;  3MIW A;  2JEE A;  1GK4 A;  1T3U A;  3TSI A;  1FDM A;  1NH4 A;  1URQ C;  3VMZ A;  1L4A D;  2KB7 P;  1NTZ K;  1FZC C;  1A02 F;  5AW3 B;  4EIJ A;  1FZF A;  1GL2 B;  1FAV A;  1JY2 N;  1JCC A;  2KYV A;  2R32 A;  2O1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...