1QL1A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql1A00
1ZN5A 2XKMA 1QL1A 1IFNA 1QL2A 2IFNA 2IFMA 1IFMA 2KLVA 2KSJA 4IFMA 1PFIA 3IFMA
chains in the Genus database with same CATH superfamily
1D7MA 1U57A 1ZRTD 1Q90D 4IL6H 1GW4A 2FXMA 2KS1B 3LW5J 1T2KC 2O1JA 3RK3D 1NTMK 1OW7A 2P2UA 3HE5B 1SQVJ 2WT7B 5KKZB 2Y9ZA 1KB9I 4DZOA 1L0LK 2J58A 2XV5A 2W6BA 1SQXK 3L71J 4W7ZA 5KAIE 1JUNA 2RH0A 3H1KJ 2E75D 4H13D 1Q82Q 1PP9J 2GUSA 1RF1B 1NTKD 4D6TD 4YTPC 2OQQA 1FE6A 2IFMA 1NU1D 3RK2D 3V2QA 3TGUE 1EDLA 2N1TA 2BEQD 2C0XA 4WWIA 3VYIA 1YIJP 4ZKPA 3CWBJ 2KI7B 1YBKA 2PFXA 1NTZJ 2WPRA 1VQOP 1FZCC 5APUA 2ZYGA 1CI6B 1SVFA 1TU3F 3C1LA 1SQQK 1OIPA 4GT1A 4N78E 5GTHH 1AQTA 1S4XA 4HH2A 3FXDA 1LTTC 2B9BA 4C7RA 2R32A 3EWKA 1JY3P 1PGPA 1SQXE 2M5AB 3FWNA 3HRNA 3M9HA 3GG2A 4JPZB 2Y0EA 2OARA 4WBAA 5APVA 5KLVD 2B88A 1N86A 1QLED 2D2CD 3RL0C 1S5LH 3SFEC 3CX5D 4EDFA 1ZMEC 3R2PA 1L0LG 4R4MA 4EOTA 1PGOA 1NTKG 1URQD 2ZT9B 2OYHA 2ZAEB 1HWTC 2A45I 2NPSB 2P1JA 3F89A 5KTBA 1LT9C 3V4WA 5DJTB 1K73Q 1ZR2A 2A06D 5APXA 3WUVA 2Y0DA 3H32A 2QEXP 1IFIA 1JOCA 2WSFJ 2WPQA 1LT1A 3LIDA 3BRVB 3L35A 3M06A 2C9NY 2FYUJ 1WT6A 5APTA 4AYCA 1EXJA 1HF9A 1URQB 2IBZI 2ZT9D 1H88A 1AA0A 2KOGA 2R5BA 1SQBK 4PD4D 3H1HD 5AVUB 1S5LX 2OYHC 1NTZE 1DEBA 2SPZA 1L0NG 3V2PA 1BSHA 1QGKB 1K8AQ 1BE3J 1AV1A 5AVYB 3GMAA 2GUVA 1KQLA 2YIUC 3TNUB 3H1LD 1JCCA 1L0NK 4C7NB 2FKWB 5GTHE 2ITAA 1BDDA 1N7SA 1URQC 2O1KA 1OMIA 3A0HE 1SQVE 3HUSA 4HB1A 2YIUB 3L73E 5KAIH 2IDBA 3A2AA 2ZVNB 3BCCE 2V7QJ 2I1KA 4DOJA 2RKLA 1NTMD 1PV3A 2J5UA 4IFDK 1S72P 5CCGD 4DJGA 1L0LD 1L0LE 1IFNA 3CX5I 1EZVD 1NTME 2H8PD 2NRGA 1AVYA 1GL2A 1W2EA 1EC5A 1RQVA 1KQFB 2XU6A 1E5WA 1JO5A 5B5EH 4BWNA 1VPCA 3L73D 5TJHA 1IFMA 5TISH 2WZ7A 1GMJA 1M7LA 2BASA 3HE5A 1PPJG 5BVZA 3TK1A 2WT7A 2QSIA 3NTNA 2GM4A 2KSEA 4UB6E 4WY4D 1W5CE 4B86A 1S2EA 1KD1Q 1IFJA 2O01N 2AEJA 2UWJE 2WSFH 3HD7A 1YQ3C 4GOEA 4JYBA 3W68A 3Q3DA 4A7PA 1GW3A 2M3BA 2QE7H 2VRSA 1EZVG 1N2DC 3QH9A 1LTGC 4PV1D 2CPBA 4R4LA 1EDIA 1JY2P 4UB6H 1KB9E 1OWAA 3L72G 2ZYDA 2PAJA 1QX8A 1PP9D 2PGDA 2R3SA 1LGHB 2WMMA 3AE9C 1BGYE 3KDPB 4D6TJ 2WSCH 4ZMDA 1R8EA 1KYOE 1URQA 2C9LY 2KS1A 1KZUB 5KLIC 4UB8H 2K9JB 1N7SC 2L5GB 2Q3IA 2AXCA 1BE3E 2QRXA 4OVNF 3PP5A 1FS0E 1IK7A 2LR2A 4K3AA 2A06G 4I7ZB 2R44A 1J1DC 3VMXA 1H89A 1QL2A 3H1JG 2QM8A 5AW3B 1EDKA 1L4AB 3RL0B 3UIAA 1KYOD 3AE5C 3V4QA 2OYOA 3TNUA 1HGZA 4C7NA 1FZAA 5CHXA 2IPPA 1VQ9P 1FBMA 1HH0A 3CX5E 1N7SB 3S4RA 3VP8A 4PD4H 3CCSP 1S9KE 1GK6A 1X79B 2YKQA 3AEDC 5KLVG 1NWQA 4YXDC 1HGVA 1LTIC 3LIEA 1L0ND 3N4XA 1SS1A 3RL0D 2JDIH 1KN7A 1Y47A 2Q3EA 1JMBA 2IZ1A 1LTJC 2FYUE 3H1KG 3KQGA 3A0HH 3KZIH 4U3FG 1LTBC 3RBZA 1L2PA 1X9VA 2KB7P 3VMAA 3CCLP 1SQPJ 1QEXA 3FGAD 4KHXA 1T3JA 4TLFA 5M1BA 4EYYQ 1NJIQ 2Q7CA 2FYUD 2OYHB 4RJTA 1IJDB 5KKZC 2FXOA 1GK4A 1SQXJ 1XTGB 2W6JH 3RGUA 1RF1A 2LXCB 1OZHA 2N1TB 1EZVE 1T8ZA 1JM0A 2DW3A 2YNYA 3L74J 3IFMA 2O01H 2H89C 3GLMA 4IFFA 4YPCA 2K9JA 2YO3A 1N73C 1Q7YQ 2FYZA 1IK9A 2FYNB 1SQQJ 2POHA 3ITKA 1KFNA 2QIWA 2M3EA 3H1LJ 2JP3A 3M9BA 3CC7P 4U3FD 3RK3C 3H1IG 3A7OA 3HD7D 3IAOA 2ZT9C 1L4AA 1J1DB 5AVSB 1M1JB 1YJ9P 2FY8A 1AQ5A 3L71E 2A06E 1T3UA 2KZIA 3PHLA 5CMZA 1ZLLA 5APQA 3B4SA 4JBZA 5E79H 2KLVA 1FZCB 1MUUA 5APYA 1ZP0C 3PH0A 1VF5D 1SQVG 2YKOA 1S5LE 5L8RJ 3ZDMA 2Q9IA 1GD2E 2NPSA 3JCUE 4L73A 1QVGO 1KB9D 5C39A 1NTMJ 1G2CB 1IZNB 4HYTB 3U1AA 1JMMA 1SQBG 2YXQB 2HG5D 1T6AA 3RK3B 3WU2E 2KNCA 3L75J 1RQUA 2D2CC 1BSNA 1OFCX 1OW6A 1AVOA 3U1CA 2QJKC 5KAFH 1KILD 3CCQP 4HKZH 3RK2B 2FXPA 1UIXA 3G9RA 3O8ZA 1RH5B 3MUDA 1GU5A 3L73J 2AXTH 2WSEJ 1SFCA 1ZOYC 3CXHD 1NU1E 5CCHD 1OVRA 2P67A 3CXHE 1KMIZ 1NTKE 2ZYAA 5CCGC 3U59A 1RHZB 1NHLA 3P7KA 3TGUD 1H8AA 1DD3A 1Q2NA 2LKMA 2ZVOB 1LP1B 1LTJA 2C0WA 3M0AA 1SQBD 2Z5IA 4RKUJ 1MFTA 5AW1B 3RK2C 4ZKUA 4H13C 1LT9A 2PRRA 5CJ4A 4IL6E 1JTHA 1BCCD 1P84E 1SFCD 2D2CB 2YKPA 1VL2A 1LWUA 3L70J 3CWBG 2JJLA 2IBZE 2M8RA 3N7NA 3D6ZA 2WVRA 1GL2D 2JKVA 4MN4C 1OXZA 1PP9G 3L37A 3B5NC 1SLQA 2I8DA 2LXBA 2Y0CA 5DJUB 4N78D 1SQVD 2FYUK 2AEMA 2QJYC 1DX7A 1PL5A 2FYNC 3FX0A 5CCGA 1KILA 2QG4A 3AE6C 3L71D 4PJ0E 3OW2O 1N73B 2B87A 3H1LE 1NTMG 5B66H 2FYUG 2N1TC 4U3FE 1NU1J 4C46A 3HUSB 2A45G 1HVVA 3PJSK 5AW7B 3CWBD 3I56P 2FBWC 1YI2P 1NTZD 2YMYA 1E79H 2L91A 3TYYA 2N9BA 5KJ7C 3KXDA 2W83C 1GU4A 2QM7A 2E74B 3CWBE 1FOSF 2W6AA 4WB4A 1YJWP 1K05A 1YTZI 3GF3A 3CCRP 2IX7C 1MV8A 5GTIH 2KUBA 4H0LD 1AJYA 3EFFK 3D6YA 3L4FA 3L75E 3CMEP 3MUDC 3H1ID 3TDKA 3I55P 1DEEG 3AEEC 3P32A 3S1KA 5CBNA 2KZJA 4K35A 3CLQA 2E74D 3NMDA 2NPSD 1M1KQ 2JR8A 4JQ0D 1USDA 3TF5A 2E5TA 1FDIA 5APWA 2XKMA 3AE7C 1J1EB 5AW2B 1NTZG 1L0NE 2PP6A 1JY2O 1CSBA 4ASVA 1GDTA 1EQ7A 1S9KD 1MZ9A 2H88C 3Q5PA 3F5HA 1X0TA 1BCCE 1P84D 3BCCJ 1WMKA 3O6QB 4U3FJ 2K37A 1YYCA 2WQYC 5AW0B 5AVWB 4GOFA 4I6MC 5KJ7A 1L4AC 1SQBE 2G8YA 5H2FH 4Y28J 1NAYA 1XTCC 3B8EB 3W67A 1RE3C 1FZBA 3Q1MA 3MTUE 3H1IE 2ZFCA 1BE3D 1BDCA 1PZQA 1LWUB 4IL6X 2KK7A 5KLIB 1BGYG 1KILC 5CCHA 4BRYB 3WUUA 5K5GB 1ZR4A 2AXTE 1OX3A 2W8ZA 3A3YB 1QL1A 4XE5B 1KILE 3B71A 3H1HG 2HFED 1ZXGA 4N6JA 4PV1B 3BCCG 4H44D 2HPCB 1IO4A 3GF7A 4OGQD 1OVUA 1ZW0A 3AEBC 3BASA 1YITP 1YHQP 1JY3N 3M0DC 1KILB 1EDJA 2E76D 2P10A 1VQLP 1LP1A 1LTJB 1Y9BA 1NU1K 4AUWA 1SQQE 3WU2H 3PRJA 2XNDH 3I5CA 1KQSO 4ZNCA 1DH3A 3JCUH 3A0BE 3SSUA 1HBWA 3Q2YA 4Y99B 2Y9YA 3RBXA 4H44B 3LW5H 3TGUJ 1FZGA 1RF0A 2N9YB 3CXHI 3AE1C 3MP7B 2HYNA 4U7JA 1NKZB 1M57D 1JY3O 1SQBJ 1SFCC 2WPSA 3II6A 3AECC 1NTZK 2OYIB 1SFCB 1RY3A 4I7ZC 1BCCG 1JCDA 3NFQA 1USEA 1FZCA 2MJZA 2IFNA 1WRGA 2XZRA 1FU1A 3BATA 3VN0A 4RESB 3B5NA 3D70A 2BCCJ 4TT3H 2JO1A 1J1EC 1R5SA 1FZEA 2G3AA 4PD4I 1NTKK 1H0TB 1JB0J 2RN0A 3EFGA 5KLVJ 5AW6B 4W80A 3D71A 2K9YA 2KNCB 1FJPA 4H44C 4IFMA 2JWDA 1PGQA 1KC8Q 1VQ4P 1JNMA 2JEEA 3O6QA 1PFIA 1IC2A 5H2FE 3SFDC 1M1JA 2N1TD 3AEAC 3WUTA 1G1IA 3KZIE 1NOHA 2HR3A 2IBZG 3QWOC 1NKNA 3C8VA 2K88A 3E1RA 3S9OA 1JY2N 3KPEA 5KLVK 3JC22 1ZV8A 2KSJA 3OJAB 3H25A 1N73A 4OWFA 2KXPB 1CI6A 2ZXEB 1L4AD 2WSEH 2E75B 4GIFA 4GKGA 4LC1A 3MD0A 4LLHA 4PD4E 5AW9B 2FFDA 3L72J 2WITA 3CX5H 3H1HJ 1K9MQ 2QJYB 4GODA 5KJ7D 2OGUA 3AE8C 3V2RA 1N7SD 1PGJA 3L74E 4NPDA 4WVZA 3CD6P 3AEFC 1L0NJ 2K1AA 3L70G 1HTLC 2M0BA 3BRTB 2E5YA 2IYOA 3USSA 4EIJA 2OYIC 3CCEP 2WPVB 1R5LA 3AE4C 3H1JD 4LGDE 2NPSC 3G6EP 1CW5A 1SQPG 1BGYD 5EFWB 1K04A 1S1CX 1PP9E 1M1JC 1GZLA 1KFMA 3MHVA 3CCUP 2Q5UA 3C9IA 3H32B 1EXIA 1SP4A 1SQPK 2WSCJ 3Q5RA 4RO0A 3CC4P 3BCCD 1FDMA 3H6PA 1Q81Q 1CZQA 2B87B 2JWAA 3VOPA 3Q5SA 1A02J 3L73G 1P84I 3E7KA 5AW4B 3RL0g 4YXWH 4BXLA 4D6TG 2BCCG 3CL3D 2ZJSE 1L0LJ 5B66E 1VQ5P 1LNQA 1LTAC 2NZ2A 1G1JA 2KYVA 3VMYA 4PJ0H 2E74C 4O9BA 2H43A 1SQQD 1NO4A 2IYPA 2BCCE 4I2LC 2MKVA 2YMKA 3HE4A 3KYQA 1RF1C 2HODB 3HTKA 2H7HA 3IR9A 1A02F 1FOSE 3G4SP 3V6IA 3TSIA 4JYCA 1LWUC 4W7YA 3V5BA 1RF0C 2CK3H 2QJKB 3L36A 3P8MC 3VTPC 2OTKE 4OGQC 3RK3E 3CCVP 1HUCA 1VF5B 4GDOA 1J2JB 4M3LA 3B5ND 5AVRB 1ZRTE 2E43A 1P84H 2ZXXA 3H1JE 1LT9B 4L74A 1VQ7P 3HD7C 1NAFA 2Z4EA 1N7LA 1PPJD 1OVVA 5AW8B 2OTLP 2W90A 1S3JA 3L71G 1RE4A 3M0DA 3L70E 3CMAP 1PPJE 1SQQG 3WMM0 1W2BO 3CPWO 5APSA 1IFPA 3CXHH 4DCKA 3T97B 1VQKP 1FAVA 1KORA 2Q6QA 3B5NB 3SWKA 3TGUG 1Y8AA 3P8CD 1AFOA 1X8YA 5AVZB 1FZFA 1VQ6P 1YJNP 4CPGA 1NGMB 3EQ2A 5CCHC 3ABVC 2B89A 5KAFE 5KLVE 3GHGB 1X22A 2O3JA 1GTWA 1GL2C 5AVTB 1NVOA 2KP8A 1MFZA 3H1KD 4BRYA 1M56D 2BCCD 4KJMA 1NYHA 4EI2A 5BU5A 1JTHB 1FDOA 1M8OB 1NTKJ 3A0BH 3K5BA 3PTZA 1EZVI 4H0LB 4AQRD 1VQ8P 1SQVK 2KIKA 2WSSH 3HE4B 3R4YA 1BCCJ 3HTKB 5BU8B 2HPCA 2P7JA 1Q86Q 2P58A 3L75G 2YO2A 5E79E 3GW6A 3NXSA 3SWFA 1GL2B 3HUSC 1LTSC 4XFJA 1KQGB 1FJKA 2E76C 4H0LC 1LJ2A 4N3YB 3G71P 1SQPD 3CI9A 3E1IA 1KTMA 4NPEA 3IF4A 2QJPC 1JEKA 3PLNA 2J59M 1OW8A 2WWWA 2HLOA 1SQXD 4HJGH 1VDFA 3IN6A 3FXEA 4Z1MH 2FFDC 2OTJP 3VP9A 1MKMA 3L72D 4I1LA 2HODA 2GA1A 3CCJP 3L74D 1DIPA 1RE4C 3SWYA 3MIWA 4OH8B 3GHGA 2E75C 3H1JJ 2FFDB 4NPFX 3JSVC 4QMAA 1BGYJ 4D6TE 2Z5HA 2XDJA 4L76A 1H0TA 2R5DA 3OAKA 1KYOI 3H1IJ 4OGQB 2I1JA 4WY4A 1SQPE 2IZ0A 1T2KD 3H1LG 1IFDA 4L75A 1VQMP 1NH4A 3H1HE 3AE2C 4ASWA 1N8RQ 1KV4A 2M5AA 3L74G 1VQPP 3BVHA 2A45H 1FC2C 4UB8E 5GTIE 4PV1C 1KYOH 1YQ4C 3L75D 5AW5B 4JF7A 1NU1G 2Q1KA 3V2NA 2V7QH 2XNXA 1KB9H 1Z56A 3G3ZA 1DD4A 3CC2P 1PIXA 4WY4C 3VMZA 3M91A 1RE3A 2W27A 5TISE 3H1KE 4DT0A 2AEFA 2BEZF 3M9QA 3GHGC 2KLUA 2YXRB 3A5TA 1VQNP 1SQXG 2CPSA 3AE3C 4KT0J 1HJBA 2K3RA 1ZN5A 3T97A 3OA7A 1UIIA 3P8CE 4XA4A 2O01J 3CCMP 1QVFO 3FWLA 3MZWB 2OYIA 3HD7B 3KHUA 1YTZT 4IOIH 2QVAA 5B5EE 4Y99C 1G2CA 1M90Q 2E42A 5CJ0A 1U7JA 2QJPB 1HJ0A 1VF5C 3L70D 5AVXB 2QA4P 5CBOA 3L72E 5AVVB 4H13B 1BE3G 3AEGC 2V4HA 2WTYA 3MGNA 2RMZA 4WY4B 1U7MA 2E76B 2R3CA 2IBZD 5AVQB
chains in the Genus database with same CATH topology
1T2KC 1GW4A 2FXMA 2O1JA 3RK3D 1NTMK 3HE5B 2P2UA 2WT7B 4DZOA 1L0LK 2J58A 2XV5A 2W6BA 1SQXK 4W7ZA 1JUNA 2GUSA 1RF1B 3V2QA 2IFMA 3RK2D 2N1TA 2C0XA 3VYIA 4ZKPA 2WPRA 5APUA 1CI6B 1SVFA 4GT1A 5CCGC 1SQQK 4N78E 5BU5A 4HH2A 1LTTC 4C7RA 2R32A 1JY3P 3HRNA 3M9HA 4WBAA 5APVA 1GU4A 1FZCC 3RL0C 2OARA 1N86A 3R2PA 4EOTA 2OYHA 1URQD 1HWTC 2A45I 2NPSB 2P1JA 5KTBA 1LT9C 3V4WA 1ZR2A 5APXA 3H32A 1IFIA 1JOCA 2WPQA 3LIDA 3BRVB 3L35A 3M06A 2C9NY 1WT6A 5APTA 4AYCA 1URQB 1H88A 2KOGA 2R5BA 1SQBK 5AVUB 2OYHC 1DEBA 3V2PA 5AVYB 2GUVA 1KQLA 3TNUB 4C7NB 1JCCA 1L0NK 2FKWB 1N7SA 1URQC 2O1KA 3HUSA 3A2AA 2I1KA 4DOJA 4IFDK 5CCGD 1IFNA 2H8PD 1GL2A 1W2EA 2XU6A 1E5WA 1JO5A 1VPCA 1IFMA 2WZ7A 1M7LA 3HE5A 2BASA 2WT7A 5BVZA 2GM4A 3TK1A 3NTNA 4WY4D 4B86A 1IFJA 2WSFH 4JYBA 3HD7A 1GW3A 2M3BA 2VRSA 1N2DC 1LTGC 2CPBA 1JY2P 1OWAA 2PAJA 1LGHB 3KDPB 2WSCH 1URQA 2C9LY 1KZUB 1N7SC 2L5GB 2Q3IA 3PP5A 1H89A 3VMXA 1J1DC 1QL2A 2QM8A 5AW3B 3RL0B 1L4AB 3UIAA 3V4QA 3TNUA 1HGZA 4C7NA 1FZAA 5CHXA 2IPPA 1FBMA 1HH0A 1N7SB 3VP8A 1S9KE 1GK6A 1X79B 2YKQA 1NWQA 1GD2E 1HGVA 1LTIC 3LIEA 3N4XA 3RL0D 1LTJC 3KQGA 3V5BA 1LTBC 2KB7P 1X9VA 4KHXA 1T3JA 2Q7CA 2OYHB 1IJDB 1GK4A 1XTGB 1RF1A 2N1TB 1T8ZA 2YNYA 3IFMA 2O01H 4IFFA 1N73C 2YO3A 2FYZA 1IK9A 2POHA 1KFNA 3M9BA 3RK3C 3A7OA 3HD7D 5AVSB 1AQ5A 1L4AA 1J1DB 1M1JB 5CMZA 1T3UA 1ZLLA 5APQA 2KLVA 1FZCB 1MUUA 5APYA 2Q9IA 2YKOA 2NPSA 3U1AA 4HYTB 1G2CB 1JMMA 3RK3B 2HG5D 3U1CA 1KILD 3RK2B 3O8ZA 3MUDA 1GU5A 1SFCA 5CCHD 2P67A 1H8AA 3U59A 1NHLA 3P7KA 2LKMA 1LTJA 2C0WA 5AW1B 3M0AA 3RK2C 2Z5IA 4ZKUA 1LT9A 5CJ4A 1JTHA 1SFCD 2YKPA 1LWUA 2JJLA 2M8RA 3N7NA 1GL2D 1OXZA 3L37A 3B5NC 1SLQA 4N78D 2FYUK 1DX7A 5CCGA 1KILA 1N73B 2N1TC 4C46A 3HUSB 2A45G 1HVVA 5AW7B 2YMYA 3TYYA 5KJ7C 2N9BA 2QM7A 1FOSF 2W6AA 4WB4A 1YTZI 2IX7C 1MV8A 3L4FA 3P32A 3CLQA 3NMDA 2NPSD 5APWA 2XKMA 1J1EB 5AW2B 2PP6A 1JY2O 1CSBA 1GDTA 1EQ7A 1S9KD 1MZ9A 5AW0B 1YYCA 5KJ7A 5AVWB 4I6MC 1L4AC 1XTCC 3B8EB 1RE3C 1FZBA 3MTUE 2ZFCA 1LWUB 5CCHA 1KILC 1ZR4A 3A3YB 1QL1A 4XE5B 2HFED 1IO4A 4N6JA 2HPCB 3BASA 1JY3N 3M0DC 1KILB 1LTJB 1NU1K 4AUWA 1DH3A 3I5CA 1HBWA 4Y99B 3LW5H 1FZGA 1RF0A 2HYNA 1NKZB 1JY3O 1SFCC 2WPSA 3II6A 1NTZK 2OYIB 1SFCB 1RY3A 1JCDA 3NFQA 1FZCA 2MJZA 2XZRA 3BATA 2IFNA 1WRGA 1FU1A 3VN0A 4RESB 3B5NA 1J1EC 1FZEA 1NTKK 3EFGA 5AW6B 4W80A 1FJPA 4IFMA 1JNMA 2JEEA 1PFIA 1IC2A 1M1JA 2N1TD 1HJBA 1A02F 1G1IA 1NOHA 1NKNA 1JY2N 3KPEA 5KLVK 1ZV8A 2KSJA 3OJAB 1N73A 2ZXEB 1CI6A 4GIFA 1L4AD 2WSEH 4LC1A 4GKGA 4LLHA 3MD0A 2FFDA 5AW9B 2WITA 5KJ7D 3V2RA 1N7SD 1HTLC 3BRTB 4EIJA 2OYIC 1CW5A 4LGDE 2NPSC 1M1JC 1GZLA 1KFMA 2Q5UA 3C9IA 3H32B 1SP4A 1SQPK 1FDMA 3H6PA 1CZQA 3VOPA 1A02J 5AW4B 3CL3D 1LTAC 1G1JA 2KYVA 3VMYA 2H43A 4O9BA 4I2LC 1NO4A 3KYQA 3HE4A 1RF1C 2H7HA 2HODB 3HTKA 3IR9A 1FOSE 3TSIA 4JYCA 1LWUC 4W7YA 1RF0C 3VTPC 3L36A 3P8MC 1HUCA 2E43A 4M3LA 1J2JB 3B5ND 5AVRB 1LT9B 3HD7C 1NAFA 2Z4EA 1N7LA 5AW8B 1RE4A 3M0DA 3WMM0 5APSA 1FAVA 3B5NB 3P8CD 1AFOA 1X8YA 5AVZB 1FZFA 3EQ2A 5CCHC 3GHGB 1GTWA 1GL2C 5AVTB 2KP8A 1MFZA 1JTHB 4AQRD 1SQVK 3HE4B 3HTKB 5BU8B 2HPCA 2P7JA 2YO2A 3NXSA 3SWFA 1GL2B 3HUSC 1LTSC 1FJKA 4N3YB 3E1IA 3CI9A 2J59M 2WWWA 2HLOA 1VDFA 2FFDC 3VP9A 4I1LA 2HODA 1RE4C 3SWYA 3MIWA 4OH8B 3GHGA 2FFDB 2Z5HA 2XDJA 2R5DA 3OAKA 2I1JA 4WY4A 1T2KD 1IFDA 1NH4A 3BVHA 2A45H 5AW5B 4JF7A 3V2NA 2XNXA 1Z56A 3G3ZA 4WY4C 3VMZA 3M91A 1RE3A 2W27A 3M9QA 3GHGC 3A5TA 2CPSA 1ZN5A 3T97A 3OA7A 3P8CE 4XA4A 2OYIA 3HD7B 1YTZT 2E42A 4Y99C 1G2CA 5CJ0A 5AVXB 5AVVB 2WTYA 3MGNA 4WY4B 2R3CA 5AVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZN5 A;  2XKM A;  1QL1 A;  1IFN A;  1QL2 A;  2IFN A;  2IFM A;  1IFM A;  2KLV A;  2KSJ A;  4IFM A;  1PFI A;  3IFM A; 
#chains in the Genus database with same CATH topology
 1D7M A;  1U57 A;  1ZRT D;  1Q90 D;  4IL6 H;  1GW4 A;  2FXM A;  2KS1 B;  3LW5 J;  1T2K C;  2O1J A;  3RK3 D;  1NTM K;  1OW7 A;  2P2U A;  3HE5 B;  1SQV J;  2WT7 B;  5KKZ B;  2Y9Z A;  1KB9 I;  4DZO A;  1L0L K;  2J58 A;  2XV5 A;  2W6B A;  1SQX K;  3L71 J;  4W7Z A;  5KAI E;  1JUN A;  2RH0 A;  3H1K J;  2E75 D;  4H13 D;  1Q82 Q;  1PP9 J;  2GUS A;  1RF1 B;  1NTK D;  4D6T D;  4YTP C;  2OQQ A;  1FE6 A;  2IFM A;  1NU1 D;  3RK2 D;  3V2Q A;  3TGU E;  1EDL A;  2N1T A;  2BEQ D;  2C0X A;  4WWI A;  3VYI A;  1YIJ P;  4ZKP A;  3CWB J;  2KI7 B;  1YBK A;  2PFX A;  1NTZ J;  2WPR A;  1VQO P;  1FZC C;  5APU A;  2ZYG A;  1CI6 B;  1SVF A;  1TU3 F;  3C1L A;  1SQQ K;  1OIP A;  4GT1 A;  4N78 E;  5GTH H;  1AQT A;  1S4X A;  4HH2 A;  3FXD A;  1LTT C;  2B9B A;  4C7R A;  2R32 A;  3EWK A;  1JY3 P;  1PGP A;  1SQX E;  2M5A B;  3FWN A;  3HRN A;  3M9H A;  3GG2 A;  4JPZ B;  2Y0E A;  2OAR A;  4WBA A;  5APV A;  5KLV D;  2B88 A;  1N86 A;  1QLE D;  2D2C D;  3RL0 C;  1S5L H;  3SFE C;  3CX5 D;  4EDF A;  1ZME C;  3R2P A;  1L0L G;  4R4M A;  4EOT A;  1PGO A;  1NTK G;  1URQ D;  2ZT9 B;  2OYH A;  2ZAE B;  1HWT C;  2A45 I;  2NPS B;  2P1J A;  3F89 A;  5KTB A;  1LT9 C;  3V4W A;  5DJT B;  1K73 Q;  1ZR2 A;  2A06 D;  5APX A;  3WUV A;  2Y0D A;  3H32 A;  2QEX P;  1IFI A;  1JOC A;  2WSF J;  2WPQ A;  1LT1 A;  3LID A;  3BRV B;  3L35 A;  3M06 A;  2C9N Y;  2FYU J;  1WT6 A;  5APT A;  4AYC A;  1EXJ A;  1HF9 A;  1URQ B;  2IBZ I;  2ZT9 D;  1H88 A;  1AA0 A;  2KOG A;  2R5B A;  1SQB K;  4PD4 D;  3H1H D;  5AVU B;  1S5L X;  2OYH C;  1NTZ E;  1DEB A;  2SPZ A;  1L0N G;  3V2P A;  1BSH A;  1QGK B;  1K8A Q;  1BE3 J;  1AV1 A;  5AVY B;  3GMA A;  2GUV A;  1KQL A;  2YIU C;  3TNU B;  3H1L D;  1JCC A;  1L0N K;  4C7N B;  2FKW B;  5GTH E;  2ITA A;  1BDD A;  1N7S A;  1URQ C;  2O1K A;  1OMI A;  3A0H E;  1SQV E;  3HUS A;  4HB1 A;  2YIU B;  3L73 E;  5KAI H;  2IDB A;  3A2A A;  2ZVN B;  3BCC E;  2V7Q J;  2I1K A;  4DOJ A;  2RKL A;  1NTM D;  1PV3 A;  2J5U A;  4IFD K;  1S72 P;  5CCG D;  4DJG A;  1L0L D;  1L0L E;  1IFN A;  3CX5 I;  1EZV D;  1NTM E;  2H8P D;  2NRG A;  1AVY A;  1GL2 A;  1W2E A;  1EC5 A;  1RQV A;  1KQF B;  2XU6 A;  1E5W A;  1JO5 A;  5B5E H;  4BWN A;  1VPC A;  3L73 D;  5TJH A;  1IFM A;  5TIS H;  2WZ7 A;  1GMJ A;  1M7L A;  2BAS A;  3HE5 A;  1PPJ G;  5BVZ A;  3TK1 A;  2WT7 A;  2QSI A;  3NTN A;  2GM4 A;  2KSE A;  4UB6 E;  4WY4 D;  1W5C E;  4B86 A;  1S2E A;  1KD1 Q;  1IFJ A;  2O01 N;  2AEJ A;  2UWJ E;  2WSF H;  3HD7 A;  1YQ3 C;  4GOE A;  4JYB A;  3W68 A;  3Q3D A;  4A7P A;  1GW3 A;  2M3B A;  2QE7 H;  2VRS A;  1EZV G;  1N2D C;  3QH9 A;  1LTG C;  4PV1 D;  2CPB A;  4R4L A;  1EDI A;  1JY2 P;  4UB6 H;  1KB9 E;  1OWA A;  3L72 G;  2ZYD A;  2PAJ A;  1QX8 A;  1PP9 D;  2PGD A;  2R3S A;  1LGH B;  2WMM A;  3AE9 C;  1BGY E;  3KDP B;  4D6T J;  2WSC H;  4ZMD A;  1R8E A;  1KYO E;  1URQ A;  2C9L Y;  2KS1 A;  1KZU B;  5KLI C;  4UB8 H;  2K9J B;  1N7S C;  2L5G B;  2Q3I A;  2AXC A;  1BE3 E;  2QRX A;  4OVN F;  3PP5 A;  1FS0 E;  1IK7 A;  2LR2 A;  4K3A A;  2A06 G;  4I7Z B;  2R44 A;  1J1D C;  3VMX A;  1H89 A;  1QL2 A;  3H1J G;  2QM8 A;  5AW3 B;  1EDK A;  1L4A B;  3RL0 B;  3UIA A;  1KYO D;  3AE5 C;  3V4Q A;  2OYO A;  3TNU A;  1HGZ A;  4C7N A;  1FZA A;  5CHX A;  2IPP A;  1VQ9 P;  1FBM A;  1HH0 A;  3CX5 E;  1N7S B;  3S4R A;  3VP8 A;  4PD4 H;  3CCS P;  1S9K E;  1GK6 A;  1X79 B;  2YKQ A;  3AED C;  5KLV G;  1NWQ A;  4YXD C;  1HGV A;  1LTI C;  3LIE A;  1L0N D;  3N4X A;  1SS1 A;  3RL0 D;  2JDI H;  1KN7 A;  1Y47 A;  2Q3E A;  1JMB A;  2IZ1 A;  1LTJ C;  2FYU E;  3H1K G;  3KQG A;  3A0H H;  3KZI H;  4U3F G;  1LTB C;  3RBZ A;  1L2P A;  1X9V A;  2KB7 P;  3VMA A;  3CCL P;  1SQP J;  1QEX A;  3FGA D;  4KHX A;  1T3J A;  4TLF A;  5M1B A;  4EYY Q;  1NJI Q;  2Q7C A;  2FYU D;  2OYH B;  4RJT A;  1IJD B;  5KKZ C;  2FXO A;  1GK4 A;  1SQX J;  1XTG B;  2W6J H;  3RGU A;  1RF1 A;  2LXC B;  1OZH A;  2N1T B;  1EZV E;  1T8Z A;  1JM0 A;  2DW3 A;  2YNY A;  3L74 J;  3IFM A;  2O01 H;  2H89 C;  3GLM A;  4IFF A;  4YPC A;  2K9J A;  2YO3 A;  1N73 C;  1Q7Y Q;  2FYZ A;  1IK9 A;  2FYN B;  1SQQ J;  2POH A;  3ITK A;  1KFN A;  2QIW A;  2M3E A;  3H1L J;  2JP3 A;  3M9B A;  3CC7 P;  4U3F D;  3RK3 C;  3H1I G;  3A7O A;  3HD7 D;  3IAO A;  2ZT9 C;  1L4A A;  1J1D B;  5AVS B;  1M1J B;  1YJ9 P;  2FY8 A;  1AQ5 A;  3L71 E;  2A06 E;  1T3U A;  2KZI A;  3PHL A;  5CMZ A;  1ZLL A;  5APQ A;  3B4S A;  4JBZ A;  5E79 H;  2KLV A;  1FZC B;  1MUU A;  5APY A;  1ZP0 C;  3PH0 A;  1VF5 D;  1SQV G;  2YKO A;  1S5L E;  5L8R J;  3ZDM A;  2Q9I A;  1GD2 E;  2NPS A;  3JCU E;  4L73 A;  1QVG O;  1KB9 D;  5C39 A;  1NTM J;  1G2C B;  1IZN B;  4HYT B;  3U1A A;  1JMM A;  1SQB G;  2YXQ B;  2HG5 D;  1T6A A;  3RK3 B;  3WU2 E;  2KNC A;  3L75 J;  1RQU A;  2D2C C;  1BSN A;  1OFC X;  1OW6 A;  1AVO A;  3U1C A;  2QJK C;  5KAF H;  1KIL D;  3CCQ P;  4HKZ H;  3RK2 B;  2FXP A;  1UIX A;  3G9R A;  3O8Z A;  1RH5 B;  3MUD A;  1GU5 A;  3L73 J;  2AXT H;  2WSE J;  1SFC A;  1ZOY C;  3CXH D;  1NU1 E;  5CCH D;  1OVR A;  2P67 A;  3CXH E;  1KMI Z;  1NTK E;  2ZYA A;  5CCG C;  3U59 A;  1RHZ B;  1NHL A;  3P7K A;  3TGU D;  1H8A A;  1DD3 A;  1Q2N A;  2LKM A;  2ZVO B;  1LP1 B;  1LTJ A;  2C0W A;  3M0A A;  1SQB D;  2Z5I A;  4RKU J;  1MFT A;  5AW1 B;  3RK2 C;  4ZKU A;  4H13 C;  1LT9 A;  2PRR A;  5CJ4 A;  4IL6 E;  1JTH A;  1BCC D;  1P84 E;  1SFC D;  2D2C B;  2YKP A;  1VL2 A;  1LWU A;  3L70 J;  3CWB G;  2JJL A;  2IBZ E;  2M8R A;  3N7N A;  3D6Z A;  2WVR A;  1GL2 D;  2JKV A;  4MN4 C;  1OXZ A;  1PP9 G;  3L37 A;  3B5N C;  1SLQ A;  2I8D A;  2LXB A;  2Y0C A;  5DJU B;  4N78 D;  1SQV D;  2FYU K;  2AEM A;  2QJY C;  1DX7 A;  1PL5 A;  2FYN C;  3FX0 A;  5CCG A;  1KIL A;  2QG4 A;  3AE6 C;  3L71 D;  4PJ0 E;  3OW2 O;  1N73 B;  2B87 A;  3H1L E;  1NTM G;  5B66 H;  2FYU G;  2N1T C;  4U3F E;  1NU1 J;  4C46 A;  3HUS B;  2A45 G;  1HVV A;  3PJS K;  5AW7 B;  3CWB D;  3I56 P;  2FBW C;  1YI2 P;  1NTZ D;  2YMY A;  1E79 H;  2L91 A;  3TYY A;  2N9B A;  5KJ7 C;  3KXD A;  2W83 C;  1GU4 A;  2QM7 A;  2E74 B;  3CWB E;  1FOS F;  2W6A A;  4WB4 A;  1YJW P;  1K05 A;  1YTZ I;  3GF3 A;  3CCR P;  2IX7 C;  1MV8 A;  5GTI H;  2KUB A;  4H0L D;  1AJY A;  3EFF K;  3D6Y A;  3L4F A;  3L75 E;  3CME P;  3MUD C;  3H1I D;  3TDK A;  3I55 P;  1DEE G;  3AEE C;  3P32 A;  3S1K A;  5CBN A;  2KZJ A;  4K35 A;  3CLQ A;  2E74 D;  3NMD A;  2NPS D;  1M1K Q;  2JR8 A;  4JQ0 D;  1USD A;  3TF5 A;  2E5T A;  1FDI A;  5APW A;  2XKM A;  3AE7 C;  1J1E B;  5AW2 B;  1NTZ G;  1L0N E;  2PP6 A;  1JY2 O;  1CSB A;  4ASV A;  1GDT A;  1EQ7 A;  1S9K D;  1MZ9 A;  2H88 C;  3Q5P A;  3F5H A;  1X0T A;  1BCC E;  1P84 D;  3BCC J;  1WMK A;  3O6Q B;  4U3F J;  2K37 A;  1YYC A;  2WQY C;  5AW0 B;  5AVW B;  4GOF A;  4I6M C;  5KJ7 A;  1L4A C;  1SQB E;  2G8Y A;  5H2F H;  4Y28 J;  1NAY A;  1XTC C;  3B8E B;  3W67 A;  1RE3 C;  1FZB A;  3Q1M A;  3MTU E;  3H1I E;  2ZFC A;  1BE3 D;  1BDC A;  1PZQ A;  1LWU B;  4IL6 X;  2KK7 A;  5KLI B;  1BGY G;  1KIL C;  5CCH A;  4BRY B;  3WUU A;  5K5G B;  1ZR4 A;  2AXT E;  1OX3 A;  2W8Z A;  3A3Y B;  1QL1 A;  4XE5 B;  1KIL E;  3B71 A;  3H1H G;  2HFE D;  1ZXG A;  4N6J A;  4PV1 B;  3BCC G;  4H44 D;  2HPC B;  1IO4 A;  3GF7 A;  4OGQ D;  1OVU A;  1ZW0 A;  3AEB C;  3BAS A;  1YIT P;  1YHQ P;  1JY3 N;  3M0D C;  1KIL B;  1EDJ A;  2E76 D;  2P10 A;  1VQL P;  1LP1 A;  1LTJ B;  1Y9B A;  1NU1 K;  4AUW A;  1SQQ E;  3WU2 H;  3PRJ A;  2XND H;  3I5C A;  1KQS O;  4ZNC A;  1DH3 A;  3JCU H;  3A0B E;  3SSU A;  1HBW A;  3Q2Y A;  4Y99 B;  2Y9Y A;  3RBX A;  4H44 B;  3LW5 H;  3TGU J;  1FZG A;  1RF0 A;  2N9Y B;  3CXH I;  3AE1 C;  3MP7 B;  2HYN A;  4U7J A;  1NKZ B;  1M57 D;  1JY3 O;  1SQB J;  1SFC C;  2WPS A;  3II6 A;  3AEC C;  1NTZ K;  2OYI B;  1SFC B;  1RY3 A;  4I7Z C;  1BCC G;  1JCD A;  3NFQ A;  1USE A;  1FZC A;  2MJZ A;  2IFN A;  1WRG A;  2XZR A;  1FU1 A;  3BAT A;  3VN0 A;  4RES B;  3B5N A;  3D70 A;  2BCC J;  4TT3 H;  2JO1 A;  1J1E C;  1R5S A;  1FZE A;  2G3A A;  4PD4 I;  1NTK K;  1H0T B;  1JB0 J;  2RN0 A;  3EFG A;  5KLV J;  5AW6 B;  4W80 A;  3D71 A;  2K9Y A;  2KNC B;  1FJP A;  4H44 C;  4IFM A;  2JWD A;  1PGQ A;  1KC8 Q;  1VQ4 P;  1JNM A;  2JEE A;  3O6Q A;  1PFI A;  1IC2 A;  5H2F E;  3SFD C;  1M1J A;  2N1T D;  3AEA C;  3WUT A;  1G1I A;  3KZI E;  1NOH A;  2HR3 A;  2IBZ G;  3QWO C;  1NKN A;  3C8V A;  2K88 A;  3E1R A;  3S9O A;  1JY2 N;  3KPE A;  5KLV K;  3JC2 2;  1ZV8 A;  2KSJ A;  3OJA B;  3H25 A;  1N73 A;  4OWF A;  2KXP B;  1CI6 A;  2ZXE B;  1L4A D;  2WSE H;  2E75 B;  4GIF A;  4GKG A;  4LC1 A;  3MD0 A;  4LLH A;  4PD4 E;  5AW9 B;  2FFD A;  3L72 J;  2WIT A;  3CX5 H;  3H1H J;  1K9M Q;  2QJY B;  4GOD A;  5KJ7 D;  2OGU A;  3AE8 C;  3V2R A;  1N7S D;  1PGJ A;  3L74 E;  4NPD A;  4WVZ A;  3CD6 P;  3AEF C;  1L0N J;  2K1A A;  3L70 G;  1HTL C;  2M0B A;  3BRT B;  2E5Y A;  2IYO A;  3USS A;  4EIJ A;  2OYI C;  3CCE P;  2WPV B;  1R5L A;  3AE4 C;  3H1J D;  4LGD E;  2NPS C;  3G6E P;  1CW5 A;  1SQP G;  1BGY D;  5EFW B;  1K04 A;  1S1C X;  1PP9 E;  1M1J C;  1GZL A;  1KFM A;  3MHV A;  3CCU P;  2Q5U A;  3C9I A;  3H32 B;  1EXI A;  1SP4 A;  1SQP K;  2WSC J;  3Q5R A;  4RO0 A;  3CC4 P;  3BCC D;  1FDM A;  3H6P A;  1Q81 Q;  1CZQ A;  2B87 B;  2JWA A;  3VOP A;  3Q5S A;  1A02 J;  3L73 G;  1P84 I;  3E7K A;  5AW4 B;  3RL0 g;  4YXW H;  4BXL A;  4D6T G;  2BCC G;  3CL3 D;  2ZJS E;  1L0L J;  5B66 E;  1VQ5 P;  1LNQ A;  1LTA C;  2NZ2 A;  1G1J A;  2KYV A;  3VMY A;  4PJ0 H;  2E74 C;  4O9B A;  2H43 A;  1SQQ D;  1NO4 A;  2IYP A;  2BCC E;  4I2L C;  2MKV A;  2YMK A;  3HE4 A;  3KYQ A;  1RF1 C;  2HOD B;  3HTK A;  2H7H A;  3IR9 A;  1A02 F;  1FOS E;  3G4S P;  3V6I A;  3TSI A;  4JYC A;  1LWU C;  4W7Y A;  3V5B A;  1RF0 C;  2CK3 H;  2QJK B;  3L36 A;  3P8M C;  3VTP C;  2OTK E;  4OGQ C;  3RK3 E;  3CCV P;  1HUC A;  1VF5 B;  4GDO A;  1J2J B;  4M3L A;  3B5N D;  5AVR B;  1ZRT E;  2E43 A;  1P84 H;  2ZXX A;  3H1J E;  1LT9 B;  4L74 A;  1VQ7 P;  3HD7 C;  1NAF A;  2Z4E A;  1N7L A;  1PPJ D;  1OVV A;  5AW8 B;  2OTL P;  2W90 A;  1S3J A;  3L71 G;  1RE4 A;  3M0D A;  3L70 E;  3CMA P;  1PPJ E;  1SQQ G;  3WMM 0;  1W2B O;  3CPW O;  5APS A;  1IFP A;  3CXH H;  4DCK A;  3T97 B;  1VQK P;  1FAV A;  1KOR A;  2Q6Q A;  3B5N B;  3SWK A;  3TGU G;  1Y8A A;  3P8C D;  1AFO A;  1X8Y A;  5AVZ B;  1FZF A;  1VQ6 P;  1YJN P;  4CPG A;  1NGM B;  3EQ2 A;  5CCH C;  3ABV C;  2B89 A;  5KAF E;  5KLV E;  3GHG B;  1X22 A;  2O3J A;  1GTW A;  1GL2 C;  5AVT B;  1NVO A;  2KP8 A;  1MFZ A;  3H1K D;  4BRY A;  1M56 D;  2BCC D;  4KJM A;  1NYH A;  4EI2 A;  5BU5 A;  1JTH B;  1FDO A;  1M8O B;  1NTK J;  3A0B H;  3K5B A;  3PTZ A;  1EZV I;  4H0L B;  4AQR D;  1VQ8 P;  1SQV K;  2KIK A;  2WSS H;  3HE4 B;  3R4Y A;  1BCC J;  3HTK B;  5BU8 B;  2HPC A;  2P7J A;  1Q86 Q;  2P58 A;  3L75 G;  2YO2 A;  5E79 E;  3GW6 A;  3NXS A;  3SWF A;  1GL2 B;  3HUS C;  1LTS C;  4XFJ A;  1KQG B;  1FJK A;  2E76 C;  4H0L C;  1LJ2 A;  4N3Y B;  3G71 P;  1SQP D;  3CI9 A;  3E1I A;  1KTM A;  4NPE A;  3IF4 A;  2QJP C;  1JEK A;  3PLN A;  2J59 M;  1OW8 A;  2WWW A;  2HLO A;  1SQX D;  4HJG H;  1VDF A;  3IN6 A;  3FXE A;  4Z1M H;  2FFD C;  2OTJ P;  3VP9 A;  1MKM A;  3L72 D;  4I1L A;  2HOD A;  2GA1 A;  3CCJ P;  3L74 D;  1DIP A;  1RE4 C;  3SWY A;  3MIW A;  4OH8 B;  3GHG A;  2E75 C;  3H1J J;  2FFD B;  4NPF X;  3JSV C;  4QMA A;  1BGY J;  4D6T E;  2Z5H A;  2XDJ A;  4L76 A;  1H0T A;  2R5D A;  3OAK A;  1KYO I;  3H1I J;  4OGQ B;  2I1J A;  4WY4 A;  1SQP E;  2IZ0 A;  1T2K D;  3H1L G;  1IFD A;  4L75 A;  1VQM P;  1NH4 A;  3H1H E;  3AE2 C;  4ASW A;  1N8R Q;  1KV4 A;  2M5A A;  3L74 G;  1VQP P;  3BVH A;  2A45 H;  1FC2 C;  4UB8 E;  5GTI E;  4PV1 C;  1KYO H;  1YQ4 C;  3L75 D;  5AW5 B;  4JF7 A;  1NU1 G;  2Q1K A;  3V2N A;  2V7Q H;  2XNX A;  1KB9 H;  1Z56 A;  3G3Z A;  1DD4 A;  3CC2 P;  1PIX A;  4WY4 C;  3VMZ A;  3M91 A;  1RE3 A;  2W27 A;  5TIS E;  3H1K E;  4DT0 A;  2AEF A;  2BEZ F;  3M9Q A;  3GHG C;  2KLU A;  2YXR B;  3A5T A;  1VQN P;  1SQX G;  2CPS A;  3AE3 C;  4KT0 J;  1HJB A;  2K3R A;  1ZN5 A;  3T97 A;  3OA7 A;  1UII A;  3P8C E;  4XA4 A;  2O01 J;  3CCM P;  1QVF O;  3FWL A;  3MZW B;  2OYI A;  3HD7 B;  3KHU A;  1YTZ T;  4IOI H;  2QVA A;  5B5E E;  4Y99 C;  1G2C A;  1M90 Q;  2E42 A;  5CJ0 A;  1U7J A;  2QJP B;  1HJ0 A;  1VF5 C;  3L70 D;  5AVX B;  2QA4 P;  5CBO A;  3L72 E;  5AVV B;  4H13 B;  1BE3 G;  3AEG C;  2V4H A;  2WTY A;  3MGN A;  2RMZ A;  4WY4 B;  1U7M A;  2E76 B;  2R3C A;  2IBZ D;  5AVQ B; 
#chains in the Genus database with same CATH homology
 1T2K C;  1GW4 A;  2FXM A;  2O1J A;  3RK3 D;  1NTM K;  3HE5 B;  2P2U A;  2WT7 B;  4DZO A;  1L0L K;  2J58 A;  2XV5 A;  2W6B A;  1SQX K;  4W7Z A;  1JUN A;  2GUS A;  1RF1 B;  3V2Q A;  2IFM A;  3RK2 D;  2N1T A;  2C0X A;  3VYI A;  4ZKP A;  2WPR A;  5APU A;  1CI6 B;  1SVF A;  4GT1 A;  5CCG C;  1SQQ K;  4N78 E;  5BU5 A;  4HH2 A;  1LTT C;  4C7R A;  2R32 A;  1JY3 P;  3HRN A;  3M9H A;  4WBA A;  5APV A;  1GU4 A;  1FZC C;  3RL0 C;  2OAR A;  1N86 A;  3R2P A;  4EOT A;  2OYH A;  1URQ D;  1HWT C;  2A45 I;  2NPS B;  2P1J A;  5KTB A;  1LT9 C;  3V4W A;  1ZR2 A;  5APX A;  3H32 A;  1IFI A;  1JOC A;  2WPQ A;  3LID A;  3BRV B;  3L35 A;  3M06 A;  2C9N Y;  1WT6 A;  5APT A;  4AYC A;  1URQ B;  1H88 A;  2KOG A;  2R5B A;  1SQB K;  5AVU B;  2OYH C;  1DEB A;  3V2P A;  5AVY B;  2GUV A;  1KQL A;  3TNU B;  4C7N B;  1JCC A;  1L0N K;  2FKW B;  1N7S A;  1URQ C;  2O1K A;  3HUS A;  3A2A A;  2I1K A;  4DOJ A;  4IFD K;  5CCG D;  1IFN A;  2H8P D;  1GL2 A;  1W2E A;  2XU6 A;  1E5W A;  1JO5 A;  1VPC A;  1IFM A;  2WZ7 A;  1M7L A;  3HE5 A;  2BAS A;  2WT7 A;  5BVZ A;  2GM4 A;  3TK1 A;  3NTN A;  4WY4 D;  4B86 A;  1IFJ A;  2WSF H;  4JYB A;  3HD7 A;  1GW3 A;  2M3B A;  2VRS A;  1N2D C;  1LTG C;  2CPB A;  1JY2 P;  1OWA A;  2PAJ A;  1LGH B;  3KDP B;  2WSC H;  1URQ A;  2C9L Y;  1KZU B;  1N7S C;  2L5G B;  2Q3I A;  3PP5 A;  1H89 A;  3VMX A;  1J1D C;  1QL2 A;  2QM8 A;  5AW3 B;  3RL0 B;  1L4A B;  3UIA A;  3V4Q A;  3TNU A;  1HGZ A;  4C7N A;  1FZA A;  5CHX A;  2IPP A;  1FBM A;  1HH0 A;  1N7S B;  3VP8 A;  1S9K E;  1GK6 A;  1X79 B;  2YKQ A;  1NWQ A;  1GD2 E;  1HGV A;  1LTI C;  3LIE A;  3N4X A;  3RL0 D;  1LTJ C;  3KQG A;  3V5B A;  1LTB C;  2KB7 P;  1X9V A;  4KHX A;  1T3J A;  2Q7C A;  2OYH B;  1IJD B;  1GK4 A;  1XTG B;  1RF1 A;  2N1T B;  1T8Z A;  2YNY A;  3IFM A;  2O01 H;  4IFF A;  1N73 C;  2YO3 A;  2FYZ A;  1IK9 A;  2POH A;  1KFN A;  3M9B A;  3RK3 C;  3A7O A;  3HD7 D;  5AVS B;  1AQ5 A;  1L4A A;  1J1D B;  1M1J B;  5CMZ A;  1T3U A;  1ZLL A;  5APQ A;  2KLV A;  1FZC B;  1MUU A;  5APY A;  2Q9I A;  2YKO A;  2NPS A;  3U1A A;  4HYT B;  1G2C B;  1JMM A;  3RK3 B;  2HG5 D;  3U1C A;  1KIL D;  3RK2 B;  3O8Z A;  3MUD A;  1GU5 A;  1SFC A;  5CCH D;  2P67 A;  1H8A A;  3U59 A;  1NHL A;  3P7K A;  2LKM A;  1LTJ A;  2C0W A;  5AW1 B;  3M0A A;  3RK2 C;  2Z5I A;  4ZKU A;  1LT9 A;  5CJ4 A;  1JTH A;  1SFC D;  2YKP A;  1LWU A;  2JJL A;  2M8R A;  3N7N A;  1GL2 D;  1OXZ A;  3L37 A;  3B5N C;  1SLQ A;  4N78 D;  2FYU K;  1DX7 A;  5CCG A;  1KIL A;  1N73 B;  2N1T C;  4C46 A;  3HUS B;  2A45 G;  1HVV A;  5AW7 B;  2YMY A;  3TYY A;  5KJ7 C;  2N9B A;  2QM7 A;  1FOS F;  2W6A A;  4WB4 A;  1YTZ I;  2IX7 C;  1MV8 A;  3L4F A;  3P32 A;  3CLQ A;  3NMD A;  2NPS D;  5APW A;  2XKM A;  1J1E B;  5AW2 B;  2PP6 A;  1JY2 O;  1CSB A;  1GDT A;  1EQ7 A;  1S9K D;  1MZ9 A;  5AW0 B;  1YYC A;  5KJ7 A;  5AVW B;  4I6M C;  1L4A C;  1XTC C;  3B8E B;  1RE3 C;  1FZB A;  3MTU E;  2ZFC A;  1LWU B;  5CCH A;  1KIL C;  1ZR4 A;  3A3Y B;  1QL1 A;  4XE5 B;  2HFE D;  1IO4 A;  4N6J A;  2HPC B;  3BAS A;  1JY3 N;  3M0D C;  1KIL B;  1LTJ B;  1NU1 K;  4AUW A;  1DH3 A;  3I5C A;  1HBW A;  4Y99 B;  3LW5 H;  1FZG A;  1RF0 A;  2HYN A;  1NKZ B;  1JY3 O;  1SFC C;  2WPS A;  3II6 A;  1NTZ K;  2OYI B;  1SFC B;  1RY3 A;  1JCD A;  3NFQ A;  1FZC A;  2MJZ A;  2XZR A;  3BAT A;  2IFN A;  1WRG A;  1FU1 A;  3VN0 A;  4RES B;  3B5N A;  1J1E C;  1FZE A;  1NTK K;  3EFG A;  5AW6 B;  4W80 A;  1FJP A;  4IFM A;  1JNM A;  2JEE A;  1PFI A;  1IC2 A;  1M1J A;  2N1T D;  1HJB A;  1A02 F;  1G1I A;  1NOH A;  1NKN A;  1JY2 N;  3KPE A;  5KLV K;  1ZV8 A;  2KSJ A;  3OJA B;  1N73 A;  2ZXE B;  1CI6 A;  4GIF A;  1L4A D;  2WSE H;  4LC1 A;  4GKG A;  4LLH A;  3MD0 A;  2FFD A;  5AW9 B;  2WIT A;  5KJ7 D;  3V2R A;  1N7S D;  1HTL C;  3BRT B;  4EIJ A;  2OYI C;  1CW5 A;  4LGD E;  2NPS C;  1M1J C;  1GZL A;  1KFM A;  2Q5U A;  3C9I A;  3H32 B;  1SP4 A;  1SQP K;  1FDM A;  3H6P A;  1CZQ A;  3VOP A;  1A02 J;  5AW4 B;  3CL3 D;  1LTA C;  1G1J A;  2KYV A;  3VMY A;  2H43 A;  4O9B A;  4I2L C;  1NO4 A;  3KYQ A;  3HE4 A;  1RF1 C;  2H7H A;  2HOD B;  3HTK A;  3IR9 A;  1FOS E;  3TSI A;  4JYC A;  1LWU C;  4W7Y A;  1RF0 C;  3VTP C;  3L36 A;  3P8M C;  1HUC A;  2E43 A;  4M3L A;  1J2J B;  3B5N D;  5AVR B;  1LT9 B;  3HD7 C;  1NAF A;  2Z4E A;  1N7L A;  5AW8 B;  1RE4 A;  3M0D A;  3WMM 0;  5APS A;  1FAV A;  3B5N B;  3P8C D;  1AFO A;  1X8Y A;  5AVZ B;  1FZF A;  3EQ2 A;  5CCH C;  3GHG B;  1GTW A;  1GL2 C;  5AVT B;  2KP8 A;  1MFZ A;  1JTH B;  4AQR D;  1SQV K;  3HE4 B;  3HTK B;  5BU8 B;  2HPC A;  2P7J A;  2YO2 A;  3NXS A;  3SWF A;  1GL2 B;  3HUS C;  1LTS C;  1FJK A;  4N3Y B;  3E1I A;  3CI9 A;  2J59 M;  2WWW A;  2HLO A;  1VDF A;  2FFD C;  3VP9 A;  4I1L A;  2HOD A;  1RE4 C;  3SWY A;  3MIW A;  4OH8 B;  3GHG A;  2FFD B;  2Z5H A;  2XDJ A;  2R5D A;  3OAK A;  2I1J A;  4WY4 A;  1T2K D;  1IFD A;  1NH4 A;  3BVH A;  2A45 H;  5AW5 B;  4JF7 A;  3V2N A;  2XNX A;  1Z56 A;  3G3Z A;  4WY4 C;  3VMZ A;  3M91 A;  1RE3 A;  2W27 A;  3M9Q A;  3GHG C;  3A5T A;  2CPS A;  1ZN5 A;  3T97 A;  3OA7 A;  3P8C E;  4XA4 A;  2OYI A;  3HD7 B;  1YTZ T;  2E42 A;  4Y99 C;  1G2C A;  5CJ0 A;  5AVX B;  5AVV B;  2WTY A;  3MGN A;  4WY4 B;  2R3C A;  5AVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...