1QL1A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql1A00
1IFNA 1IFMA 1QL1A 1ZN5A 2KLVA 2IFMA 2XKMA 1QL2A 2IFNA 2KSJA 3IFMA 4IFMA 1PFIA
chains in the Genus database with same CATH superfamily
3CCEP 2OGUA 4PV1B 5KLIB 1ZXGA 3HE5A 2OYHA 1AJYA 2XNDH 1QVFO 2I1JA 1RY3A 1PZQA 1NKNA 1KD1Q 5GTHH 3VP8A 3U59A 1HF9A 5APVA 2CPSA 1BCCG 2Q5UA 2WZ7A 3CCSP 1VF5D 4K35A 3BATA 3HRNA 2KUBA 4YPCA 3L73G 3H1HJ 1YITP 2JR8A 3U1AA 1FZFA 2O3JA 2IZ0A 1ZR2A 5CCHD 3TGUJ 1FZAA 2ZXXA 5APSA 3AE4C 1M1KQ 2QM7A 2G8YA 2OYIB 2JDIH 1ZRTE 3M91A 1OVUA 1IFJA 1N86A 1KILC 1YHQP 2Y0CA 1NH4A 4EIJA 3SFDC 3CC4P 1PPJG 2YNYA 2I1KA 1NHLA 3HUSC 4WY4B 1MUUA 4W7ZA 3TNUB 2YIUB 1BE3J 4L76A 5KAFH 2AEMA 2O01H 1H0TB 3Q5RA 2BCCJ 4UB6H 5CCHA 2FFDC 5CMZA 2W90A 2FYUE 3WUUA 2QM8A 1SQPK 1P84H 3L70E 2YO2A 2D2CB 1J1EB 4Y99B 3H1KJ 2R5BA 1SQPG 3E7KA 4B86A 3L72D 1ZR4A 4GT1A 1SQVE 1K9MQ 3WU2H 4GIFA 4KT0J 4O9BA 3V2NA 2XNXA 2ZVOB 3V4QA 1NTKG 3S9OA 3CPWO 3VMXA 3KXDA 1AVYA 5APUA 1KYOE 4D6TJ 1JY3O 2GA1A 3BCCG 1NTME 1VQ8P 2I8DA 1DEBA 2WSFJ 2NPSC 1HWTC 5AW8B 1L0LK 2Q3IA 2E74C 4N3YB 3L73J 4Y28J 1OW6A 1KFMA 1L0LG 1NGMB 3VOPA 1N8RQ 3NFQA 3GLMA 3V5BA 4HH2A 3F5HA 1KQSO 2R44A 1GK6A 5AVTB 2N1TC 1X22A 1KILD 1FZBA 2B89A 2R3SA 2AXTE 2WITA 3MIWA 3B71A 1M7LA 1OVVA 1CZQA 4AUWA 5BU5A 2E42A 1N7SC 2E43A 3B4SA 2WSEH 3QH9A 4EDFA 3CX5H 3RK3E 1K05A 1Q82Q 3KZIE 1J2JB 4I2LC 2K9JB 4AYCA 2QJKB 1FZCC 2JWDA 1SFCC 1USDA 4C7NB 3FX0A 5KLVD 5APXA 4PJ0H 1ZN5A 1KILA 1XTGB 3GF7A 1S1CX 1RF1C 4L73A 1NTZJ 2JP3A 5APQA 1SQPJ 3MGNA 3RGUA 5E79H 4XE5B 3MZWB 1FDIA 1VQLP 3AEEC 4ZNCA 1URQB 2FFDA 3H1LD 1N2DC 1S4XA 2M5AA 3HD7C 3G6EP 1VQ5P 1XTCC 1ZP0C 1LTIC 1YBKA 3GG2A 3RL0D 3KDPB 3W68A 2E74D 3BCCJ 1LJ2A 3CXHD 3B5NB 2IZ1A 4OGQD 4WB4A 1YIJP 1L0ND 1NU1D 2FXOA 3Q5SA 4NPDA 1G1JA 1PL5A 2M8RA 3GHGC 2IPPA 2AEFA 2PGDA 1L0LJ 3HE5B 1X9VA 1SQXK 1IFMA 2OYHB 5CCGC 1VDFA 3H1IG 2E76D 1N7SD 4IFDK 1NJIQ 1FZEA 1MFTA 5AW9B 2KLUA 1JTHA 1IO4A 2QJYC 5APTA 2P7JA 2WPSA 2W6BA 3N7NA 4OVNF 1BGYD 3L72E 2E75D 2A06D 1YQ3C 3JCUE 2WT7A 3CCVP 4H0LD 2R5DA 2HODA 1ZOYC 3O6QA 2Y0EA 3BVHA 3A7OA 1PV3A 1N7SA 5B66H 4U3FE 3V4WA 1ZRTD 2GM4A 3OW2O 3AECC 1QEXA 1DIPA 1DX7A 1Q90D 3M0AA 3IN6A 1KORA 3WMM0 1EC5A 5CJ4A 2WPRA 1Q81Q 3MUDC 3IFMA 4RJTA 2V7QJ 1WRGA 2FYNB 3HD7D 2KSEA 3A2AA 4IFMA 2A45G 3TF5A 4U7JA 1JY3N 2HG5D 2KK7A 1JUNA 1KILE 1H89A 4ZKPA 1L4AC 1S5LX 3L70D 3RK2C 1LTSC 4N78D 1LT9C 2ZT9B 3A0HE 3PRJA 3F89A 2HPCA 1CI6A 1EXJA 2AXCA 5AW0B 1LWUC 2KS1A 1EQ7A 3T97B 1NAFA 1S3JA 3AEGC 4JPZB 3HD7A 2Y9ZA 1GL2C 1S9KD 3L71D 1KB9H 1ZLLA 4MN4C 1SQXJ 3M9BA 3G3ZA 3TGUG 3CWBD 5KLVE 2HFED 1S5LH 2YO3A 3EFGA 1AQ5A 3W67A 3GHGA 2ZVNB 3AE9C 2WSFH 5B5EE 1X8YA 1PGPA 2OTKE 1EDLA 2ZYAA 2H8PD 2POHA 3MTUE 1N73A 2J58A 2HR3A 2B87B 5KJ7D 3H1LE 1AA0A 1LTJB 3HE4B 1VQKP 3AE5C 1RQUA 3I5CA 3MD0A 1VQPP 5AVQB 1GZLA 2K88A 1M56D 5KAIE 2K1AA 3Q2YA 2M3EA 1PPJD 1L0NE 2XV5A 4HB1A 2KLVA 3LIEA 1NU1E 2ZT9C 4I1LA 4XFJA 2CK3H 3A0BH 2L91A 4DZOA 3FXEA 2KYVA 4H13D 2FYUK 1OW7A 3CL3D 3H6PA 1JOCA 1Y8AA 1VQ6P 2C0WA 2P2UA 2WVRA 2FYUG 1LP1B 5KJ7A 1M8OB 1PP9J 1H88A 1SQVK 2JKVA 2WMMA 4IL6E 1RE3C 1IFDA 1GU4A 3N4XA 1RQVA 3V2PA 1SQVG 4D6TG 1X79B 3MUDA 3PP5A 1IK9A 3CCJP 1GL2D 4DOJA 1BGYE 1WT6A 1NTKD 3OAKA 2M5AB 1NTMK 2PP6A 4PD4H 1W5CE 2A06E 1N7LA 2QJPB 1HGVA 2JEEA 1LGHB 4I7ZB 1LT9A 5AVRB 2QVAA 2XDJA 3PTZA 1KC8Q 2JWAA 3KQGA 1SQQE 2OTJP 1LWUA 2KIKA 2IBZG 1HH0A 1SS1A 4N6JA 2YMYA 3L75E 3VTPC 1Q86Q 1GL2A 3I55P 1JM0A 3G9RA 4WWIA 3JSVC 4LC1A 1SQBE 4LLHA 1K04A 4PV1C 5KLIC 3AEBC 4XA4A 3S4RA 4ZMDA 1P84D 1NKZB 4OGQB 3PHLA 3H1JD 1NTZK 1WMKA 1FJKA 1RE4C 1L2PA 1HGZA 4N78E 3A3YB 1RH5B 1EZVG 3TDKA 1MZ9A 1NTZG 1CW5A 3M0DC 2W83C 4TT3H 1K73Q 2WT7B 4W7YA 1EXIA 2HODB 2FYUJ 3O6QB 3CMAP 1S9KE 2RMZA 3L71E 1RF0C 2QG4A 1OX3A 3EWKA 1YYCA 1FDOA 1G2CA 1HUCA 3CWBE 3ZDMA 5K5GB 1X0TA 1M1JB 5H2FE 2OYIC 1SQVJ 4U3FD 1BCCE 3FXDA 5CBNA 5AVSB 4H44B 1YTZT 2YKQA 2E75B 1T6AA 1VQ9P 2V7QH 4L75A 1SLQA 1FOSE 1P84I 4GKGA 3M06A 4WY4C 2YIUC 2G3AA 4H0LB 5KKZB 3E1IA 1NTMJ 3AEDC 1RE3A 4GOFA 4UB8H 2Z5IA 1PGOA 2QE7H 3AE2C 5L8RJ 2HPCB 5GTIE 2D2CC 2IDBA 1J1EC 1PPJE 5TISH 2KS1B 4Y99C 1JB0J 2H89C 3CX5D 4BXLA 2W6AA 1VL2A 3L74D 1USEA 2Z4EA 1GDTA 3FWLA 4QMAA 1GU5A 3H1ID 5AVXB 2W27A 3JC22 3TSIA 3SWFA 3P32A 1VPCA 3CC2P 1E79H 5GTHE 1YI2P 3NXSA 3L72G 3HUSA 1U7JA 3TYYA 5AW7B 5CBOA 4DCKA 1A02J 1U7MA 3BRVB 1NTKE 1IC2A 1NAYA 1UIXA 5DJTB 2IYPA 3EFFK 3VMYA 1Q2NA 3CX5I 3BRTB 4EI2A 4JBZA 1JY3P 2NPSD 5CHXA 1T2KC 2C0XA 3L37A 3AE8C 2W8ZA 4BWNA 3G4SP 1KFNA 2IX7C 3P8MC 1FU1A 1RF0A 5KAFE 2A45H 2N1TD 3WUTA 1OVRA 2QJKC 2DW3A 1T8ZA 3CXHH 4UB6E 2LKMA 4IL6X 4GOEA 2GUVA 1DD4A 2YXQB 2ZFCA 1P84E 1SQXG 3H1JE 1OWAA 2NPSA 1IZNB 3RK3B 1HJBA 3TNUA 3WU2E 5KLVK 1SFCD 1DD3A 3H1HD 3NMDA 5AW3B 3CCQP 3OJAB 2QSIA 3TGUD 1R5LA 5APWA 5KLVG 2N1TA 1URQC 2XZRA 5KTBA 1NVOA 2FY8A 4TLFA 2WWWA 2A45I 1MKMA 3P7KA 3CCUP 1JY2O 1SVFA 3B5NC 3L72J 3WUVA 5BVZA 1LTBC 2FXPA 1SQQD 2E5TA 1VF5B 4YXWH 3L75D 2IFNA 1BE3D 1FZCA 3H1LG 5AVUB 1SFCA 2RN0A 1SQBD 2LXCB 2BCCD 1T2KD 1L0NK 2OYHC 1NU1K 1HVVA 4U3FJ 2FYZA 1LT1A 3FWNA 4DJGA 1L0NG 1RF1A 1PP9G 1R8EA 1KQLA 1KZUB 2M3BA 3H1KD 2K37A 2O1JA 3II6A 1LTTC 3KPEA 1FOSF 3RBZA 2Z5HA 3CX5E 3Q1MA 4K3AA 3HTKA 3L74E 5CCGD 1EDKA 3IAOA 1Y47A 3H1IE 2C9NY 1H8AA 3Q5PA 1AV1A 1KB9D 3CCRP 3NTNA 1VQ4P 2KNCA 2PFXA 5AW6B 2BASA 4PJ0E 2ITAA 3USSA 4D6TD 1IK7A 1AVOA 2N9YB 1BCCD 1IFIA 2WQYC 4DT0A 3D6ZA 1BGYG 3RBXA 5E79E 2WSSH 4BRYA 1DEEG 2P10A 2QEXP 3L73D 2CPBA 2K9JA 1URQD 1EDIA 2A06G 2KP8A 2OQQA 2FYNC 5CCGA 3G71P 3KYQA 5AW1B 5KLVJ 4C7NA 1OMIA 1E5WA 2IFMA 1KYOH 5APYA 3TK1A 3U1CA 1HBWA 2Q3EA 3PLNA 2K9YA 2P58A 2AEJA 1KTMA 2FBWC 1JCCA 1IFPA 2KXPB 1KB9I 3PJSK 4HYTB 2Q6QA 3H1LJ 3CLQA 1URQA 3CI9A 2ZJSE 2AXTH 3AE1C 1L4AD 2V4HA 3RK2D 2LXBA 1KILB 3VMZA 1L0NJ 3L70G 3P8CD 1NU1J 2BEZF 4YXDC 3D71A 1GW4A 3HUSB 3AE6C 1SQPD 1R5SA 2VRSA 3AEFC 3KZIH 4C7RA 2C9LY 3A5TA 1GTWA 2FKWB 3R2PA 2JJLA 2FFDB 2B9BA 3H1HE 3SFEC 4PD4D 3L71G 2IBZI 1HTLC 3TGUE 1OZHA 1FJPA 3SWYA 5BU8B 3CWBG 4YTPC 3AE3C 1LTJC 3RL0g 1L4AA 1QL2A 1EDJA 3BCCD 3LW5J 4R4MA 1NTMG 4AQRD 5B66E 1YTZI 2YKPA 1BGYJ 4GDOA 4OH8B 3BASA 3L36A 4RKUJ 3O8ZA 1OFCX 2P67A 3L4FA 2QA4P 1L0LD 5C39A 2KZJA 2KOGA 1BE3E 3GMAA 3R4YA 1EZVI 1T3JA 2BCCE 2NPSB 1JY2N 4JF7A 3RL0B 1JTHB 2E74B 1SQQJ 3UIAA 2ZT9D 3FGAD 1YJ9P 3GW6A 3H1KE 4PD4I 3L75J 4CPGA 2YXRB 1G1IA 4C46A 3QWOC 1BSHA 1SQBJ 1PGQA 3H32A 2N1TB 2XU6A 1GW3A 2B88A 3CCMP 4ASVA 1JEKA 2H7HA 4WVZA 3MHVA 1KB9E 2BEQD 3VMAA 2E76B 3L70J 1QGKB 2ZAEB 1N7SB 2Q9IA 1S5LE 2QJPC 4I7ZC 4D6TE 1NTKK 1D7MA 4R4LA 3SWKA 1FZCB 1SFCB 2WPVB 3T97A 4Z1MH 3L73E 1ZW0A 1Q7YQ 3JCUH 3L71J 2H88C 1KMIZ 4LGDE 3CC7P 2LR2A 3CWBJ 4EOTA 1KN7A 1RF1B 1QVGO 1BCCJ 1GK4A 3RL0C 1LTGC 2HLOA 3L35A 2KSJA 3SSUA 2NRGA 1VQOP 4OGQC 2IBZE 1ZMEC 3HTKB 1NO4A 1CI6B 5CJ0A 1AQTA 5M1BA 3A0BE 1M57D 3VYIA 2Q7CA 1JO5A 4W80A 1Y9BA 2WSCJ 3HD7B 2W6JH 2B87A 2KNCB 4PV1D 1LTAC 1VQNP 4OWFA 3GF3A 1LTJA 3HE4A 2J5UA 2OYOA 4EYYQ 5AVYB 1SQXD 3V6IA 2E76C 3H1JG 3LIDA 3VP9A 2HYNA 1JMBA 3A0HH 3P8CE 3GHGB 4BRYB 3E1RA 1EZVE 2O1KA 1GMJA 1NTZE 1J1DB 1SQPE 1M1JC 4H44C 4HJGH 1OXZA 1N73B 2E75C 1OW8A 2IYOA 1U57A 3D6YA 1MFZA 4PD4E 1KQFB 1LP1A 2QJYB 4H0LC 4IOIH 1CSBA 5KKZC 5B5EH 1RE4A 4U3FG 3BCCE 4ZKUA 3D70A 3EQ2A 2RKLA 3CCLP 1NTKJ 3M0DA 5EFWB 4WY4D 2YKOA 2Y0DA 1FS0E 5AVZB 5AW2B 1L0LE 2WTYA 2KZIA 5AVVB 1QL1A 2ZYGA 1GD2E 4HKZH 1PP9D 5KAIH 2QRXA 2D2CD 2OYIA 1FC2C 3AEAC 2N9BA 1PIXA 4KHXA 3K5BA 3ITKA 1J1DC 1VQ7P 1UIIA 2XKMA 1FE6A 3L74G 3VN0A 3M9HA 2O01J 1N73C 4H13B 2YMKA 4NPEA 4WY4A 1PGJA 1YJWP 1W2EA 1L4AB 1YQ4C 1H0TA 1DH3A 3RK2B 2ZXEB 2E5YA 1YJNP 3H1JJ 1BDDA 4JQ0D 2M0BA 4IL6H 2RH0A 1LT9B 1NYHA 4H44D 2SPZA 3LW5H 1T3UA 1LWUB 4GODA 1QX8A 2PAJA 1AFOA 1HJ0A 3CXHI 3IR9A 1GL2B 1OIPA 4A7PA 1MV8A 4I6MC 1NOHA 2MJZA 3PH0A 5KJ7C 1BSNA 1QLED 2PRRA 4RESB 3H25A 4UB8E 1KQGB 1M1JA 3CMEP 3V2QA 1VQMP 1M90Q 1NU1G 3C8VA 3ABVC 5AW4B 2J59M 5TISE 2R3CA 3H32B 2GUSA 1FBMA 4M3LA 3RK3C 4H13C 3AE7C 1TU3F 3M9QA 5TJHA 3C1LA 2FYUD 2FXMA 1G2CB 3IF4A 1NWQA 1SQXE 1FZGA 2Y9YA 3V2RA 3C9IA 2P1JA 2WSEJ 2L5GB 1SQVD 4JYCA 2UWJE 1IFNA 3L74J 3OA7A 3I56P 3H1HG 3H1IJ 4NPFX 2WPQA 1VF5C 1JNMA 1W2BO 2R32A 2JO1A 1KV4A 2K3RA 1S72P 1KYOD 1JMMA 1NTMD 5CCHC 5H2FH 1SQQK 3B5ND 1A02F 2MKVA 1SP4A 3Q3DA 5DJUB 3CD6P 1JY2P 2OTLP 1SQQG 2IBZD 2NZ2A 4JYBA 3KHUA 1Z56A 2KB7P 1SQBK 1RHZB 2O01N 4RO0A 3L75G 1BE3G 4ASWA 4L74A 2OARA 2WSCH 2Q1KA 4IFFA 1SQBG 3S1KA 2BCCG 1IJDB 4KJMA 1BDCA 5AW5B 3B8EB 3CXHE 1JCDA 1PP9E 1LNQA 1K8AQ 1PFIA 5GTIH 4WBAA 2KI7B 2QIWA 3H1KG 3B5NA 1ZV8A 1FAVA 1FDMA 1EZVD 3RK3D 2H43A 1NTZD 1KYOI 1S2EA 5AVWB 3MP7B 2ZYDA
chains in the Genus database with same CATH topology
1JY3P 1JY3N 2NPSD 5CHXA 1T2KC 2HG5D 2C0XA 1FZCB 3HE5A 1JUNA 1SFCB 1H89A 3L37A 4ZKPA 3T97A 1L4AC 3RK2C 2OYHA 1LTSC 4N78D 2I1JA 1LT9C 1KFNA 4LGDE 1RY3A 2IX7C 3P8MC 1NKNA 3VP8A 3U59A 1FU1A 5APVA 4EOTA 2HPCA 1CI6A 1RF0A 1RF1B 2A45H 2CPSA 5AW0B 2N1TD 1LWUC 1EQ7A 2Q5UA 1GK4A 3RL0C 2WZ7A 1LTGC 2HLOA 1T8ZA 3L35A 2KSJA 1NAFA 3HD7A 3BATA 2LKMA 3HRNA 2GUVA 1GL2C 1S9KD 2ZFCA 1ZLLA 3HTKB 1NO4A 3U1AA 1FZFA 1CI6B 1OWAA 3M9BA 3G3ZA 5CJ0A 1ZR2A 2NPSA 2HFED 5CCHD 1FZAA 2YO3A 5APSA 3VYIA 2Q7CA 3EFGA 1AQ5A 1JO5A 4W80A 3HD7B 2QM7A 3RK3B 3GHGA 1HJBA 2OYIB 2WSFH 3TNUA 1LTAC 5KLVK 1SFCD 1LTJA 1X8YA 3M91A 3NMDA 3HE4A 1IFJA 5AW3B 5AVYB 1N86A 2H8PD 1KILC 3OJAB 2POHA 3MTUE 3LIDA 1NH4A 3VP9A 4EIJA 5APWA 2HYNA 1N73A 2N1TA 1URQC 2XZRA 2YNYA 5KTBA 2I1KA 2J58A 1NHLA 3HUSC 3P8CE 3GHGB 4WY4B 1MUUA 4W7ZA 3TNUB 5KJ7D 2O1KA 1J1DB 1LTJB 3HE4B 2O01H 1M1JC 2WWWA 2A45I 3P7KA 3I5CA 3MD0A 1JY2O 1SVFA 5AVQB 3B5NC 1GZLA 5BVZA 1OXZA 1LTBC 5CCHA 1N73B 2FFDC 5CMZA 2QM8A 1SQPK 2XV5A 2KLVA 2YO2A 3LIEA 4I1LA 1MFZA 2IFNA 1J1EB 4Y99B 1FZCA 4DZOA 5AVUB 2R5BA 1SFCA 2KYVA 2FYUK 1CSBA 3CL3D 3H6PA 4B86A 1ZR4A 1JOCA 4GT1A 1L0NK 1T2KD 2OYHC 1NU1K 4GIFA 1HVVA 1RE4A 4ZKUA 4O9BA 3V2NA 2C0WA 2P2UA 2XNXA 2FYZA 3EQ2A 1RF1A 5KJ7A 1KQLA 3V4QA 1KZUB 1H88A 1SQVK 3M0DA 2M3BA 2O1JA 3II6A 1LTTC 3KPEA 4WY4D 1FOSF 3VMXA 2YKOA 5AVZB 1RE3C 5AW2B 1IFDA 1GU4A 2Z5HA 3N4XA 2WTYA 3V2PA 5APUA 1X79B 3MUDA 3PP5A 5AVVB 1JY3O 1IK9A 3HTKA 1QL1A 5CCGD 1GD2E 1DEBA 1GL2D 4DOJA 2NPSC 1HWTC 1WT6A 2C9NY 5AW8B 1L0LK 2Q3IA 1H8AA 4N3YB 3OAKA 3NTNA 2OYIA 2N9BA 1NTMK 2PP6A 5AW6B 2BASA 4KHXA 1KFMA 1N7LA 3VOPA 1J1DC 1HGVA 2XKMA 2JEEA 3NFQA 1LGHB 3V5BA 3VN0A 4HH2A 3M9HA 1LT9A 1GK6A 1IFIA 5AVTB 5AVRB 1N73C 2N1TC 2XDJA 4WY4A 1KILD 1FZBA 3MIWA 2WITA 1M7LA 3KQGA 2CPBA 1LWUA 1W2EA 1URQD 1HH0A 1L4AB 1DH3A 3RK2B 1CZQA 2ZXEB 4AUWA 2KP8A 4N6JA 5BU5A 5CCGA 2YMYA 3KYQA 1N7SC 2E43A 2E42A 2WSEH 3VTPC 5AW1B 1GL2A 1LT9B 4C7NA 1E5WA 2IFMA 5APYA 3TK1A 3U1CA 3LW5H 4LC1A 1HBWA 4LLHA 1T3UA 1J2JB 4I2LC 4AYCA 1LWUB 2PAJA 1FZCC 1AFOA 4XA4A 1SFCC 1NKZB 3IR9A 1GL2B 4C7NB 1JCCA 1MV8A 1NTZK 5APXA 4I6MC 1FJKA 1ZN5A 1RE4C 1HGZA 4N78E 3A3YB 1KILA 1XTGB 1NOHA 2MJZA 4HYTB 1RF1C 1MZ9A 5KJ7C 3CLQA 1URQA 5APQA 1CW5A 3M0DC 3MGNA 3CI9A 4XE5B 4RESB 2WT7B 4W7YA 1M1JA 2HODB 1L4AD 3RK2D 3V2QA 1KILB 3VMZA 1S9KE 3P8CD 1RF0C 5AW4B 2J59M 1URQB 2R3CA 3H32B 2FFDA 1GW4A 1N2DC 3HUSB 1YYCA 1G2CA 2GUSA 1HUCA 1FBMA 2VRSA 4M3LA 3HD7C 3RK3C 1XTCC 1LTIC 1M1JB 2OYIC 4C7RA 3RL0D 2C9LY 3A5TA 5AVSB 3KDPB 1GTWA 3M9QA 3B5NB 1YTZT 2FKWB 4WB4A 2YKQA 3R2PA 2JJLA 2FFDB 2FXMA 1G2CB 1NWQA 1FZGA 3V2RA 1SLQA 1G1JA 1FOSE 1HTLC 2M8RA 3C9IA 4GKGA 3GHGC 3M06A 2IPPA 3SWYA 1FJPA 2P1JA 4WY4C 5BU8B 2L5GB 4JYCA 1LTJC 3HE5B 1L4AA 1QL2A 1X9VA 1SQXK 1IFNA 1IFMA 3E1IA 2OYHB 4AQRD 1RE3A 1YTZI 3OA7A 5CCGC 2Z5IA 2YKPA 1VDFA 2WPQA 4OH8B 3BASA 1JNMA 1N7SD 2R32A 3L36A 4IFDK 2HPCB 3O8ZA 1FZEA 2P67A 5AW9B 1J1EC 3L4FA 4Y99C 1JTHA 1IO4A 5APTA 2KOGA 2P7JA 2W6AA 1JMMA 2WPSA 2W6BA 1T3JA 3N7NA 5CCHC 2Z4EA 1GDTA 1SQQK 3B5ND 1GU5A 1A02F 1SP4A 2NPSB 1JY2N 1JY2P 4JF7A 5AVXB 3RL0B 1JTHB 2W27A 3UIAA 3TSIA 4JYBA 1Z56A 3SWFA 2KB7P 1SQBK 3P32A 1VPCA 2WT7A 2R5DA 2HODA 2OARA 2WSCH 1G1IA 4C46A 3BVHA 3NXSA 4IFFA 3A7OA 1N7SA 3V4WA 1IJDB 3H32A 2GM4A 3HUSA 3TYYA 5AW5B 2N1TB 2XU6A 3B8EB 1GW3A 5AW7B 1A02J 1DX7A 1JCDA 3M0AA 3BRVB 3WMM0 1PFIA 2H7HA 1IC2A 5CJ4A 2WPRA 4WBAA 3IFMA 3B5NA 1ZV8A 1FAVA 1FDMA 1WRGA 1N7SB 3HD7D 2Q9IA 3RK3D 2H43A 3A2AA 3VMYA 4IFMA 2A45G 1NTKK 3BRTB 5AVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFN A;  1IFM A;  1QL1 A;  1ZN5 A;  2KLV A;  2IFM A;  2XKM A;  1QL2 A;  2IFN A;  2KSJ A;  3IFM A;  4IFM A;  1PFI A; 
#chains in the Genus database with same CATH topology
 3CCE P;  2OGU A;  4PV1 B;  5KLI B;  1ZXG A;  3HE5 A;  2OYH A;  1AJY A;  2XND H;  1QVF O;  2I1J A;  1RY3 A;  1PZQ A;  1NKN A;  1KD1 Q;  5GTH H;  3VP8 A;  3U59 A;  1HF9 A;  5APV A;  2CPS A;  1BCC G;  2Q5U A;  2WZ7 A;  3CCS P;  1VF5 D;  4K35 A;  3BAT A;  3HRN A;  2KUB A;  4YPC A;  3L73 G;  3H1H J;  1YIT P;  2JR8 A;  3U1A A;  1FZF A;  2O3J A;  2IZ0 A;  1ZR2 A;  5CCH D;  3TGU J;  1FZA A;  2ZXX A;  5APS A;  3AE4 C;  1M1K Q;  2QM7 A;  2G8Y A;  2OYI B;  2JDI H;  1ZRT E;  3M91 A;  1OVU A;  1IFJ A;  1N86 A;  1KIL C;  1YHQ P;  2Y0C A;  1NH4 A;  4EIJ A;  3SFD C;  3CC4 P;  1PPJ G;  2YNY A;  2I1K A;  1NHL A;  3HUS C;  4WY4 B;  1MUU A;  4W7Z A;  3TNU B;  2YIU B;  1BE3 J;  4L76 A;  5KAF H;  2AEM A;  2O01 H;  1H0T B;  3Q5R A;  2BCC J;  4UB6 H;  5CCH A;  2FFD C;  5CMZ A;  2W90 A;  2FYU E;  3WUU A;  2QM8 A;  1SQP K;  1P84 H;  3L70 E;  2YO2 A;  2D2C B;  1J1E B;  4Y99 B;  3H1K J;  2R5B A;  1SQP G;  3E7K A;  4B86 A;  3L72 D;  1ZR4 A;  4GT1 A;  1SQV E;  1K9M Q;  3WU2 H;  4GIF A;  4KT0 J;  4O9B A;  3V2N A;  2XNX A;  2ZVO B;  3V4Q A;  1NTK G;  3S9O A;  3CPW O;  3VMX A;  3KXD A;  1AVY A;  5APU A;  1KYO E;  4D6T J;  1JY3 O;  2GA1 A;  3BCC G;  1NTM E;  1VQ8 P;  2I8D A;  1DEB A;  2WSF J;  2NPS C;  1HWT C;  5AW8 B;  1L0L K;  2Q3I A;  2E74 C;  4N3Y B;  3L73 J;  4Y28 J;  1OW6 A;  1KFM A;  1L0L G;  1NGM B;  3VOP A;  1N8R Q;  3NFQ A;  3GLM A;  3V5B A;  4HH2 A;  3F5H A;  1KQS O;  2R44 A;  1GK6 A;  5AVT B;  2N1T C;  1X22 A;  1KIL D;  1FZB A;  2B89 A;  2R3S A;  2AXT E;  2WIT A;  3MIW A;  3B71 A;  1M7L A;  1OVV A;  1CZQ A;  4AUW A;  5BU5 A;  2E42 A;  1N7S C;  2E43 A;  3B4S A;  2WSE H;  3QH9 A;  4EDF A;  3CX5 H;  3RK3 E;  1K05 A;  1Q82 Q;  3KZI E;  1J2J B;  4I2L C;  2K9J B;  4AYC A;  2QJK B;  1FZC C;  2JWD A;  1SFC C;  1USD A;  4C7N B;  3FX0 A;  5KLV D;  5APX A;  4PJ0 H;  1ZN5 A;  1KIL A;  1XTG B;  3GF7 A;  1S1C X;  1RF1 C;  4L73 A;  1NTZ J;  2JP3 A;  5APQ A;  1SQP J;  3MGN A;  3RGU A;  5E79 H;  4XE5 B;  3MZW B;  1FDI A;  1VQL P;  3AEE C;  4ZNC A;  1URQ B;  2FFD A;  3H1L D;  1N2D C;  1S4X A;  2M5A A;  3HD7 C;  3G6E P;  1VQ5 P;  1XTC C;  1ZP0 C;  1LTI C;  1YBK A;  3GG2 A;  3RL0 D;  3KDP B;  3W68 A;  2E74 D;  3BCC J;  1LJ2 A;  3CXH D;  3B5N B;  2IZ1 A;  4OGQ D;  4WB4 A;  1YIJ P;  1L0N D;  1NU1 D;  2FXO A;  3Q5S A;  4NPD A;  1G1J A;  1PL5 A;  2M8R A;  3GHG C;  2IPP A;  2AEF A;  2PGD A;  1L0L J;  3HE5 B;  1X9V A;  1SQX K;  1IFM A;  2OYH B;  5CCG C;  1VDF A;  3H1I G;  2E76 D;  1N7S D;  4IFD K;  1NJI Q;  1FZE A;  1MFT A;  5AW9 B;  2KLU A;  1JTH A;  1IO4 A;  2QJY C;  5APT A;  2P7J A;  2WPS A;  2W6B A;  3N7N A;  4OVN F;  1BGY D;  3L72 E;  2E75 D;  2A06 D;  1YQ3 C;  3JCU E;  2WT7 A;  3CCV P;  4H0L D;  2R5D A;  2HOD A;  1ZOY C;  3O6Q A;  2Y0E A;  3BVH A;  3A7O A;  1PV3 A;  1N7S A;  5B66 H;  4U3F E;  3V4W A;  1ZRT D;  2GM4 A;  3OW2 O;  3AEC C;  1QEX A;  1DIP A;  1DX7 A;  1Q90 D;  3M0A A;  3IN6 A;  1KOR A;  3WMM 0;  1EC5 A;  5CJ4 A;  2WPR A;  1Q81 Q;  3MUD C;  3IFM A;  4RJT A;  2V7Q J;  1WRG A;  2FYN B;  3HD7 D;  2KSE A;  3A2A A;  4IFM A;  2A45 G;  3TF5 A;  4U7J A;  1JY3 N;  2HG5 D;  2KK7 A;  1JUN A;  1KIL E;  1H89 A;  4ZKP A;  1L4A C;  1S5L X;  3L70 D;  3RK2 C;  1LTS C;  4N78 D;  1LT9 C;  2ZT9 B;  3A0H E;  3PRJ A;  3F89 A;  2HPC A;  1CI6 A;  1EXJ A;  2AXC A;  5AW0 B;  1LWU C;  2KS1 A;  1EQ7 A;  3T97 B;  1NAF A;  1S3J A;  3AEG C;  4JPZ B;  3HD7 A;  2Y9Z A;  1GL2 C;  1S9K D;  3L71 D;  1KB9 H;  1ZLL A;  4MN4 C;  1SQX J;  3M9B A;  3G3Z A;  3TGU G;  3CWB D;  5KLV E;  2HFE D;  1S5L H;  2YO3 A;  3EFG A;  1AQ5 A;  3W67 A;  3GHG A;  2ZVN B;  3AE9 C;  2WSF H;  5B5E E;  1X8Y A;  1PGP A;  2OTK E;  1EDL A;  2ZYA A;  2H8P D;  2POH A;  3MTU E;  1N73 A;  2J58 A;  2HR3 A;  2B87 B;  5KJ7 D;  3H1L E;  1AA0 A;  1LTJ B;  3HE4 B;  1VQK P;  3AE5 C;  1RQU A;  3I5C A;  3MD0 A;  1VQP P;  5AVQ B;  1GZL A;  2K88 A;  1M56 D;  5KAI E;  2K1A A;  3Q2Y A;  2M3E A;  1PPJ D;  1L0N E;  2XV5 A;  4HB1 A;  2KLV A;  3LIE A;  1NU1 E;  2ZT9 C;  4I1L A;  4XFJ A;  2CK3 H;  3A0B H;  2L91 A;  4DZO A;  3FXE A;  2KYV A;  4H13 D;  2FYU K;  1OW7 A;  3CL3 D;  3H6P A;  1JOC A;  1Y8A A;  1VQ6 P;  2C0W A;  2P2U A;  2WVR A;  2FYU G;  1LP1 B;  5KJ7 A;  1M8O B;  1PP9 J;  1H88 A;  1SQV K;  2JKV A;  2WMM A;  4IL6 E;  1RE3 C;  1IFD A;  1GU4 A;  3N4X A;  1RQV A;  3V2P A;  1SQV G;  4D6T G;  1X79 B;  3MUD A;  3PP5 A;  1IK9 A;  3CCJ P;  1GL2 D;  4DOJ A;  1BGY E;  1WT6 A;  1NTK D;  3OAK A;  2M5A B;  1NTM K;  2PP6 A;  4PD4 H;  1W5C E;  2A06 E;  1N7L A;  2QJP B;  1HGV A;  2JEE A;  1LGH B;  4I7Z B;  1LT9 A;  5AVR B;  2QVA A;  2XDJ A;  3PTZ A;  1KC8 Q;  2JWA A;  3KQG A;  1SQQ E;  2OTJ P;  1LWU A;  2KIK A;  2IBZ G;  1HH0 A;  1SS1 A;  4N6J A;  2YMY A;  3L75 E;  3VTP C;  1Q86 Q;  1GL2 A;  3I55 P;  1JM0 A;  3G9R A;  4WWI A;  3JSV C;  4LC1 A;  1SQB E;  4LLH A;  1K04 A;  4PV1 C;  5KLI C;  3AEB C;  4XA4 A;  3S4R A;  4ZMD A;  1P84 D;  1NKZ B;  4OGQ B;  3PHL A;  3H1J D;  1NTZ K;  1WMK A;  1FJK A;  1RE4 C;  1L2P A;  1HGZ A;  4N78 E;  3A3Y B;  1RH5 B;  1EZV G;  3TDK A;  1MZ9 A;  1NTZ G;  1CW5 A;  3M0D C;  2W83 C;  4TT3 H;  1K73 Q;  2WT7 B;  4W7Y A;  1EXI A;  2HOD B;  2FYU J;  3O6Q B;  3CMA P;  1S9K E;  2RMZ A;  3L71 E;  1RF0 C;  2QG4 A;  1OX3 A;  3EWK A;  1YYC A;  1FDO A;  1G2C A;  1HUC A;  3CWB E;  3ZDM A;  5K5G B;  1X0T A;  1M1J B;  5H2F E;  2OYI C;  1SQV J;  4U3F D;  1BCC E;  3FXD A;  5CBN A;  5AVS B;  4H44 B;  1YTZ T;  2YKQ A;  2E75 B;  1T6A A;  1VQ9 P;  2V7Q H;  4L75 A;  1SLQ A;  1FOS E;  1P84 I;  4GKG A;  3M06 A;  4WY4 C;  2YIU C;  2G3A A;  4H0L B;  5KKZ B;  3E1I A;  1NTM J;  3AED C;  1RE3 A;  4GOF A;  4UB8 H;  2Z5I A;  1PGO A;  2QE7 H;  3AE2 C;  5L8R J;  2HPC B;  5GTI E;  2D2C C;  2IDB A;  1J1E C;  1PPJ E;  5TIS H;  2KS1 B;  4Y99 C;  1JB0 J;  2H89 C;  3CX5 D;  4BXL A;  2W6A A;  1VL2 A;  3L74 D;  1USE A;  2Z4E A;  1GDT A;  3FWL A;  4QMA A;  1GU5 A;  3H1I D;  5AVX B;  2W27 A;  3JC2 2;  3TSI A;  3SWF A;  3P32 A;  1VPC A;  3CC2 P;  1E79 H;  5GTH E;  1YI2 P;  3NXS A;  3L72 G;  3HUS A;  1U7J A;  3TYY A;  5AW7 B;  5CBO A;  4DCK A;  1A02 J;  1U7M A;  3BRV B;  1NTK E;  1IC2 A;  1NAY A;  1UIX A;  5DJT B;  2IYP A;  3EFF K;  3VMY A;  1Q2N A;  3CX5 I;  3BRT B;  4EI2 A;  4JBZ A;  1JY3 P;  2NPS D;  5CHX A;  1T2K C;  2C0X A;  3L37 A;  3AE8 C;  2W8Z A;  4BWN A;  3G4S P;  1KFN A;  2IX7 C;  3P8M C;  1FU1 A;  1RF0 A;  5KAF E;  2A45 H;  2N1T D;  3WUT A;  1OVR A;  2QJK C;  2DW3 A;  1T8Z A;  3CXH H;  4UB6 E;  2LKM A;  4IL6 X;  4GOE A;  2GUV A;  1DD4 A;  2YXQ B;  2ZFC A;  1P84 E;  1SQX G;  3H1J E;  1OWA A;  2NPS A;  1IZN B;  3RK3 B;  1HJB A;  3TNU A;  3WU2 E;  5KLV K;  1SFC D;  1DD3 A;  3H1H D;  3NMD A;  5AW3 B;  3CCQ P;  3OJA B;  2QSI A;  3TGU D;  1R5L A;  5APW A;  5KLV G;  2N1T A;  1URQ C;  2XZR A;  5KTB A;  1NVO A;  2FY8 A;  4TLF A;  2WWW A;  2A45 I;  1MKM A;  3P7K A;  3CCU P;  1JY2 O;  1SVF A;  3B5N C;  3L72 J;  3WUV A;  5BVZ A;  1LTB C;  2FXP A;  1SQQ D;  2E5T A;  1VF5 B;  4YXW H;  3L75 D;  2IFN A;  1BE3 D;  1FZC A;  3H1L G;  5AVU B;  1SFC A;  2RN0 A;  1SQB D;  2LXC B;  2BCC D;  1T2K D;  1L0N K;  2OYH C;  1NU1 K;  1HVV A;  4U3F J;  2FYZ A;  1LT1 A;  3FWN A;  4DJG A;  1L0N G;  1RF1 A;  1PP9 G;  1R8E A;  1KQL A;  1KZU B;  2M3B A;  3H1K D;  2K37 A;  2O1J A;  3II6 A;  1LTT C;  3KPE A;  1FOS F;  3RBZ A;  2Z5H A;  3CX5 E;  3Q1M A;  4K3A A;  3HTK A;  3L74 E;  5CCG D;  1EDK A;  3IAO A;  1Y47 A;  3H1I E;  2C9N Y;  1H8A A;  3Q5P A;  1AV1 A;  1KB9 D;  3CCR P;  3NTN A;  1VQ4 P;  2KNC A;  2PFX A;  5AW6 B;  2BAS A;  4PJ0 E;  2ITA A;  3USS A;  4D6T D;  1IK7 A;  1AVO A;  2N9Y B;  1BCC D;  1IFI A;  2WQY C;  4DT0 A;  3D6Z A;  1BGY G;  3RBX A;  5E79 E;  2WSS H;  4BRY A;  1DEE G;  2P10 A;  2QEX P;  3L73 D;  2CPB A;  2K9J A;  1URQ D;  1EDI A;  2A06 G;  2KP8 A;  2OQQ A;  2FYN C;  5CCG A;  3G71 P;  3KYQ A;  5AW1 B;  5KLV J;  4C7N A;  1OMI A;  1E5W A;  2IFM A;  1KYO H;  5APY A;  3TK1 A;  3U1C A;  1HBW A;  2Q3E A;  3PLN A;  2K9Y A;  2P58 A;  2AEJ A;  1KTM A;  2FBW C;  1JCC A;  1IFP A;  2KXP B;  1KB9 I;  3PJS K;  4HYT B;  2Q6Q A;  3H1L J;  3CLQ A;  1URQ A;  3CI9 A;  2ZJS E;  2AXT H;  3AE1 C;  1L4A D;  2V4H A;  3RK2 D;  2LXB A;  1KIL B;  3VMZ A;  1L0N J;  3L70 G;  3P8C D;  1NU1 J;  2BEZ F;  4YXD C;  3D71 A;  1GW4 A;  3HUS B;  3AE6 C;  1SQP D;  1R5S A;  2VRS A;  3AEF C;  3KZI H;  4C7R A;  2C9L Y;  3A5T A;  1GTW A;  2FKW B;  3R2P A;  2JJL A;  2FFD B;  2B9B A;  3H1H E;  3SFE C;  4PD4 D;  3L71 G;  2IBZ I;  1HTL C;  3TGU E;  1OZH A;  1FJP A;  3SWY A;  5BU8 B;  3CWB G;  4YTP C;  3AE3 C;  1LTJ C;  3RL0 g;  1L4A A;  1QL2 A;  1EDJ A;  3BCC D;  3LW5 J;  4R4M A;  1NTM G;  4AQR D;  5B66 E;  1YTZ I;  2YKP A;  1BGY J;  4GDO A;  4OH8 B;  3BAS A;  3L36 A;  4RKU J;  3O8Z A;  1OFC X;  2P67 A;  3L4F A;  2QA4 P;  1L0L D;  5C39 A;  2KZJ A;  2KOG A;  1BE3 E;  3GMA A;  3R4Y A;  1EZV I;  1T3J A;  2BCC E;  2NPS B;  1JY2 N;  4JF7 A;  3RL0 B;  1JTH B;  2E74 B;  1SQQ J;  3UIA A;  2ZT9 D;  3FGA D;  1YJ9 P;  3GW6 A;  3H1K E;  4PD4 I;  3L75 J;  4CPG A;  2YXR B;  1G1I A;  4C46 A;  3QWO C;  1BSH A;  1SQB J;  1PGQ A;  3H32 A;  2N1T B;  2XU6 A;  1GW3 A;  2B88 A;  3CCM P;  4ASV A;  1JEK A;  2H7H A;  4WVZ A;  3MHV A;  1KB9 E;  2BEQ D;  3VMA A;  2E76 B;  3L70 J;  1QGK B;  2ZAE B;  1N7S B;  2Q9I A;  1S5L E;  2QJP C;  4I7Z C;  4D6T E;  1NTK K;  1D7M A;  4R4L A;  3SWK A;  1FZC B;  1SFC B;  2WPV B;  3T97 A;  4Z1M H;  3L73 E;  1ZW0 A;  1Q7Y Q;  3JCU H;  3L71 J;  2H88 C;  1KMI Z;  4LGD E;  3CC7 P;  2LR2 A;  3CWB J;  4EOT A;  1KN7 A;  1RF1 B;  1QVG O;  1BCC J;  1GK4 A;  3RL0 C;  1LTG C;  2HLO A;  3L35 A;  2KSJ A;  3SSU A;  2NRG A;  1VQO P;  4OGQ C;  2IBZ E;  1ZME C;  3HTK B;  1NO4 A;  1CI6 B;  5CJ0 A;  1AQT A;  5M1B A;  3A0B E;  1M57 D;  3VYI A;  2Q7C A;  1JO5 A;  4W80 A;  1Y9B A;  2WSC J;  3HD7 B;  2W6J H;  2B87 A;  2KNC B;  4PV1 D;  1LTA C;  1VQN P;  4OWF A;  3GF3 A;  1LTJ A;  3HE4 A;  2J5U A;  2OYO A;  4EYY Q;  5AVY B;  1SQX D;  3V6I A;  2E76 C;  3H1J G;  3LID A;  3VP9 A;  2HYN A;  1JMB A;  3A0H H;  3P8C E;  3GHG B;  4BRY B;  3E1R A;  1EZV E;  2O1K A;  1GMJ A;  1NTZ E;  1J1D B;  1SQP E;  1M1J C;  4H44 C;  4HJG H;  1OXZ A;  1N73 B;  2E75 C;  1OW8 A;  2IYO A;  1U57 A;  3D6Y A;  1MFZ A;  4PD4 E;  1KQF B;  1LP1 A;  2QJY B;  4H0L C;  4IOI H;  1CSB A;  5KKZ C;  5B5E H;  1RE4 A;  4U3F G;  3BCC E;  4ZKU A;  3D70 A;  3EQ2 A;  2RKL A;  3CCL P;  1NTK J;  3M0D A;  5EFW B;  4WY4 D;  2YKO A;  2Y0D A;  1FS0 E;  5AVZ B;  5AW2 B;  1L0L E;  2WTY A;  2KZI A;  5AVV B;  1QL1 A;  2ZYG A;  1GD2 E;  4HKZ H;  1PP9 D;  5KAI H;  2QRX A;  2D2C D;  2OYI A;  1FC2 C;  3AEA C;  2N9B A;  1PIX A;  4KHX A;  3K5B A;  3ITK A;  1J1D C;  1VQ7 P;  1UII A;  2XKM A;  1FE6 A;  3L74 G;  3VN0 A;  3M9H A;  2O01 J;  1N73 C;  4H13 B;  2YMK A;  4NPE A;  4WY4 A;  1PGJ A;  1YJW P;  1W2E A;  1L4A B;  1YQ4 C;  1H0T A;  1DH3 A;  3RK2 B;  2ZXE B;  2E5Y A;  1YJN P;  3H1J J;  1BDD A;  4JQ0 D;  2M0B A;  4IL6 H;  2RH0 A;  1LT9 B;  1NYH A;  4H44 D;  2SPZ A;  3LW5 H;  1T3U A;  1LWU B;  4GOD A;  1QX8 A;  2PAJ A;  1AFO A;  1HJ0 A;  3CXH I;  3IR9 A;  1GL2 B;  1OIP A;  4A7P A;  1MV8 A;  4I6M C;  1NOH A;  2MJZ A;  3PH0 A;  5KJ7 C;  1BSN A;  1QLE D;  2PRR A;  4RES B;  3H25 A;  4UB8 E;  1KQG B;  1M1J A;  3CME P;  3V2Q A;  1VQM P;  1M90 Q;  1NU1 G;  3C8V A;  3ABV C;  5AW4 B;  2J59 M;  5TIS E;  2R3C A;  3H32 B;  2GUS A;  1FBM A;  4M3L A;  3RK3 C;  4H13 C;  3AE7 C;  1TU3 F;  3M9Q A;  5TJH A;  3C1L A;  2FYU D;  2FXM A;  1G2C B;  3IF4 A;  1NWQ A;  1SQX E;  1FZG A;  2Y9Y A;  3V2R A;  3C9I A;  2P1J A;  2WSE J;  2L5G B;  1SQV D;  4JYC A;  2UWJ E;  1IFN A;  3L74 J;  3OA7 A;  3I56 P;  3H1H G;  3H1I J;  4NPF X;  2WPQ A;  1VF5 C;  1JNM A;  1W2B O;  2R32 A;  2JO1 A;  1KV4 A;  2K3R A;  1S72 P;  1KYO D;  1JMM A;  1NTM D;  5CCH C;  5H2F H;  1SQQ K;  3B5N D;  1A02 F;  2MKV A;  1SP4 A;  3Q3D A;  5DJU B;  3CD6 P;  1JY2 P;  2OTL P;  1SQQ G;  2IBZ D;  2NZ2 A;  4JYB A;  3KHU A;  1Z56 A;  2KB7 P;  1SQB K;  1RHZ B;  2O01 N;  4RO0 A;  3L75 G;  1BE3 G;  4ASW A;  4L74 A;  2OAR A;  2WSC H;  2Q1K A;  4IFF A;  1SQB G;  3S1K A;  2BCC G;  1IJD B;  4KJM A;  1BDC A;  5AW5 B;  3B8E B;  3CXH E;  1JCD A;  1PP9 E;  1LNQ A;  1K8A Q;  1PFI A;  5GTI H;  4WBA A;  2KI7 B;  2QIW A;  3H1K G;  3B5N A;  1ZV8 A;  1FAV A;  1FDM A;  1EZV D;  3RK3 D;  2H43 A;  1NTZ D;  1KYO I;  1S2E A;  5AVW B;  3MP7 B;  2ZYD A; 
#chains in the Genus database with same CATH homology
 1JY3 P;  1JY3 N;  2NPS D;  5CHX A;  1T2K C;  2HG5 D;  2C0X A;  1FZC B;  3HE5 A;  1JUN A;  1SFC B;  1H89 A;  3L37 A;  4ZKP A;  3T97 A;  1L4A C;  3RK2 C;  2OYH A;  1LTS C;  4N78 D;  2I1J A;  1LT9 C;  1KFN A;  4LGD E;  1RY3 A;  2IX7 C;  3P8M C;  1NKN A;  3VP8 A;  3U59 A;  1FU1 A;  5APV A;  4EOT A;  2HPC A;  1CI6 A;  1RF0 A;  1RF1 B;  2A45 H;  2CPS A;  5AW0 B;  2N1T D;  1LWU C;  1EQ7 A;  2Q5U A;  1GK4 A;  3RL0 C;  2WZ7 A;  1LTG C;  2HLO A;  1T8Z A;  3L35 A;  2KSJ A;  1NAF A;  3HD7 A;  3BAT A;  2LKM A;  3HRN A;  2GUV A;  1GL2 C;  1S9K D;  2ZFC A;  1ZLL A;  3HTK B;  1NO4 A;  3U1A A;  1FZF A;  1CI6 B;  1OWA A;  3M9B A;  3G3Z A;  5CJ0 A;  1ZR2 A;  2NPS A;  2HFE D;  5CCH D;  1FZA A;  2YO3 A;  5APS A;  3VYI A;  2Q7C A;  3EFG A;  1AQ5 A;  1JO5 A;  4W80 A;  3HD7 B;  2QM7 A;  3RK3 B;  3GHG A;  1HJB A;  2OYI B;  2WSF H;  3TNU A;  1LTA C;  5KLV K;  1SFC D;  1LTJ A;  1X8Y A;  3M91 A;  3NMD A;  3HE4 A;  1IFJ A;  5AW3 B;  5AVY B;  1N86 A;  2H8P D;  1KIL C;  3OJA B;  2POH A;  3MTU E;  3LID A;  1NH4 A;  3VP9 A;  4EIJ A;  5APW A;  2HYN A;  1N73 A;  2N1T A;  1URQ C;  2XZR A;  2YNY A;  5KTB A;  2I1K A;  2J58 A;  1NHL A;  3HUS C;  3P8C E;  3GHG B;  4WY4 B;  1MUU A;  4W7Z A;  3TNU B;  5KJ7 D;  2O1K A;  1J1D B;  1LTJ B;  3HE4 B;  2O01 H;  1M1J C;  2WWW A;  2A45 I;  3P7K A;  3I5C A;  3MD0 A;  1JY2 O;  1SVF A;  5AVQ B;  3B5N C;  1GZL A;  5BVZ A;  1OXZ A;  1LTB C;  5CCH A;  1N73 B;  2FFD C;  5CMZ A;  2QM8 A;  1SQP K;  2XV5 A;  2KLV A;  2YO2 A;  3LIE A;  4I1L A;  1MFZ A;  2IFN A;  1J1E B;  4Y99 B;  1FZC A;  4DZO A;  5AVU B;  2R5B A;  1SFC A;  2KYV A;  2FYU K;  1CSB A;  3CL3 D;  3H6P A;  4B86 A;  1ZR4 A;  1JOC A;  4GT1 A;  1L0N K;  1T2K D;  2OYH C;  1NU1 K;  4GIF A;  1HVV A;  1RE4 A;  4ZKU A;  4O9B A;  3V2N A;  2C0W A;  2P2U A;  2XNX A;  2FYZ A;  3EQ2 A;  1RF1 A;  5KJ7 A;  1KQL A;  3V4Q A;  1KZU B;  1H88 A;  1SQV K;  3M0D A;  2M3B A;  2O1J A;  3II6 A;  1LTT C;  3KPE A;  4WY4 D;  1FOS F;  3VMX A;  2YKO A;  5AVZ B;  1RE3 C;  5AW2 B;  1IFD A;  1GU4 A;  2Z5H A;  3N4X A;  2WTY A;  3V2P A;  5APU A;  1X79 B;  3MUD A;  3PP5 A;  5AVV B;  1JY3 O;  1IK9 A;  3HTK A;  1QL1 A;  5CCG D;  1GD2 E;  1DEB A;  1GL2 D;  4DOJ A;  2NPS C;  1HWT C;  1WT6 A;  2C9N Y;  5AW8 B;  1L0L K;  2Q3I A;  1H8A A;  4N3Y B;  3OAK A;  3NTN A;  2OYI A;  2N9B A;  1NTM K;  2PP6 A;  5AW6 B;  2BAS A;  4KHX A;  1KFM A;  1N7L A;  3VOP A;  1J1D C;  1HGV A;  2XKM A;  2JEE A;  3NFQ A;  1LGH B;  3V5B A;  3VN0 A;  4HH2 A;  3M9H A;  1LT9 A;  1GK6 A;  1IFI A;  5AVT B;  5AVR B;  1N73 C;  2N1T C;  2XDJ A;  4WY4 A;  1KIL D;  1FZB A;  3MIW A;  2WIT A;  1M7L A;  3KQG A;  2CPB A;  1LWU A;  1W2E A;  1URQ D;  1HH0 A;  1L4A B;  1DH3 A;  3RK2 B;  1CZQ A;  2ZXE B;  4AUW A;  2KP8 A;  4N6J A;  5BU5 A;  5CCG A;  2YMY A;  3KYQ A;  1N7S C;  2E43 A;  2E42 A;  2WSE H;  3VTP C;  5AW1 B;  1GL2 A;  1LT9 B;  4C7N A;  1E5W A;  2IFM A;  5APY A;  3TK1 A;  3U1C A;  3LW5 H;  4LC1 A;  1HBW A;  4LLH A;  1T3U A;  1J2J B;  4I2L C;  4AYC A;  1LWU B;  2PAJ A;  1FZC C;  1AFO A;  4XA4 A;  1SFC C;  1NKZ B;  3IR9 A;  1GL2 B;  4C7N B;  1JCC A;  1MV8 A;  1NTZ K;  5APX A;  4I6M C;  1FJK A;  1ZN5 A;  1RE4 C;  1HGZ A;  4N78 E;  3A3Y B;  1KIL A;  1XTG B;  1NOH A;  2MJZ A;  4HYT B;  1RF1 C;  1MZ9 A;  5KJ7 C;  3CLQ A;  1URQ A;  5APQ A;  1CW5 A;  3M0D C;  3MGN A;  3CI9 A;  4XE5 B;  4RES B;  2WT7 B;  4W7Y A;  1M1J A;  2HOD B;  1L4A D;  3RK2 D;  3V2Q A;  1KIL B;  3VMZ A;  1S9K E;  3P8C D;  1RF0 C;  5AW4 B;  2J59 M;  1URQ B;  2R3C A;  3H32 B;  2FFD A;  1GW4 A;  1N2D C;  3HUS B;  1YYC A;  1G2C A;  2GUS A;  1HUC A;  1FBM A;  2VRS A;  4M3L A;  3HD7 C;  3RK3 C;  1XTC C;  1LTI C;  1M1J B;  2OYI C;  4C7R A;  3RL0 D;  2C9L Y;  3A5T A;  5AVS B;  3KDP B;  1GTW A;  3M9Q A;  3B5N B;  1YTZ T;  2FKW B;  4WB4 A;  2YKQ A;  3R2P A;  2JJL A;  2FFD B;  2FXM A;  1G2C B;  1NWQ A;  1FZG A;  3V2R A;  1SLQ A;  1G1J A;  1FOS E;  1HTL C;  2M8R A;  3C9I A;  4GKG A;  3GHG C;  3M06 A;  2IPP A;  3SWY A;  1FJP A;  2P1J A;  4WY4 C;  5BU8 B;  2L5G B;  4JYC A;  1LTJ C;  3HE5 B;  1L4A A;  1QL2 A;  1X9V A;  1SQX K;  1IFN A;  1IFM A;  3E1I A;  2OYH B;  4AQR D;  1RE3 A;  1YTZ I;  3OA7 A;  5CCG C;  2Z5I A;  2YKP A;  1VDF A;  2WPQ A;  4OH8 B;  3BAS A;  1JNM A;  1N7S D;  2R32 A;  3L36 A;  4IFD K;  2HPC B;  3O8Z A;  1FZE A;  2P67 A;  5AW9 B;  1J1E C;  3L4F A;  4Y99 C;  1JTH A;  1IO4 A;  5APT A;  2KOG A;  2P7J A;  2W6A A;  1JMM A;  2WPS A;  2W6B A;  1T3J A;  3N7N A;  5CCH C;  2Z4E A;  1GDT A;  1SQQ K;  3B5N D;  1GU5 A;  1A02 F;  1SP4 A;  2NPS B;  1JY2 N;  1JY2 P;  4JF7 A;  5AVX B;  3RL0 B;  1JTH B;  2W27 A;  3UIA A;  3TSI A;  4JYB A;  1Z56 A;  3SWF A;  2KB7 P;  1SQB K;  3P32 A;  1VPC A;  2WT7 A;  2R5D A;  2HOD A;  2OAR A;  2WSC H;  1G1I A;  4C46 A;  3BVH A;  3NXS A;  4IFF A;  3A7O A;  1N7S A;  3V4W A;  1IJD B;  3H32 A;  2GM4 A;  3HUS A;  3TYY A;  5AW5 B;  2N1T B;  2XU6 A;  3B8E B;  1GW3 A;  5AW7 B;  1A02 J;  1DX7 A;  1JCD A;  3M0A A;  3BRV B;  3WMM 0;  1PFI A;  2H7H A;  1IC2 A;  5CJ4 A;  2WPR A;  4WBA A;  3IFM A;  3B5N A;  1ZV8 A;  1FAV A;  1FDM A;  1WRG A;  1N7S B;  3HD7 D;  2Q9I A;  3RK3 D;  2H43 A;  3A2A A;  3VMY A;  4IFM A;  2A45 G;  1NTK K;  3BRT B;  5AVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...