2KSEA

Backbone structure of the membrane domain of e. coli histidine kinase receptor qsec, center for structures of membrane proteins (csmp) target 4311c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
186
structure length
77
Chain Sequence
b'MGKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNWEYREDMALAIVAGQLIPWLVALPIMLIIMMVLLGRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein qseC
molecule tags Transferase
source organism Escherichia coli
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
total genus 18
structure length 77
sequence length 186
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08521 2CSK_N Two-component sensor kinase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1040 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Sensor protein qsec. 2kseA00
2KSEA
chains in the Genus database with same CATH superfamily
1YIJP 4WVZA 1LTBC 2NPSC 3B5NB 5AW3B 2WMMA 2OYIB 1KMIZ 3L70J 3NXSA 2KYVA 3NMDA 3H1HE 2XU6A 4IFFA 2E76D 1JY2O 2LXBA 2W6BA 3KYQA 4H44D 3RL0D 3CWBJ 3RK2D 1FBMA 2WTYA 5CCHC 4EI2A 1EXJA 1Y9BA 4I6MC 3LW5J 1RE4A 1RY3A 4TT3H 1X79B 4OVNF 1LP1B 2POHA 4I1LA 1NTZK 4L75A 1NTKD 2QRXA 1SQXE 2Q7CA 1OW6A 1VDFA 2IBZI 3IF4A 4U3FG 1SFCB 2PAJA 1RF1B 1MFZA 2PFXA 3H1LD 1VF5D 1SQQE 4GIFA 4IFMA 1Y47A 3S4RA 1L4AB 1ZR4A 2Y9ZA 1M7LA 1CI6B 2E75B 1OXZA 3A7OA 3GHGA 3VOPA 1FZGA 3CX5I 1KILB 1DEBA 3H1JG 4RO0A 1L0NG 2ZJSE 5KLIC 3P8CE 3L75E 1PP9E 1AJYA 1KB9D 1T6AA 5L8RJ 2FYUG 3G4SP 1SQPD 2C9NY 1W2BO 1LT1A 1JY3N 1IFMA 2JR8A 5E79E 3A0HH 4XFJA 1SFCC 2FXOA 4WY4C 5APQA 1Z56A 1RF1C 2WPSA 1SQPG 1BCCJ 1GK4A 4D6TJ 1JY2N 2V7QH 2Z4EA 1LWUC 1N73C 1FZBA 3K5BA 1BE3G 5KLVK 2KI7B 3M9QA 4ZNCA 2N9YB 1DD4A 2OYOA 2G3AA 1WT6A 3CCLP 2WPVB 4R4MA 2HYNA 1FDMA 2BCCG 3T97B 1BE3D 3UIAA 1ZW0A 2O01H 1JMMA 1IK7A 5KLVD 4GODA 5B66E 5AW2B 1TU3F 3TSIA 2FFDB 5CCHA 1RF1A 2QG4A 2BCCD 3H1IG 3B8EB 1A02F 1JB0J 3M9BA 2P67A 2ZYGA 1X8YA 3H1LE 3CMAP 2KLVA 1DX7A 1R5SA 3O6QB 1YJ9P 1T2KD 1N73B 3VTPC 4WY4B 2O3JA 2E76C 3HE4A 4H44C 2OTLP 2D2CB 3EQ2A 3CCJP 4XA4A 2K9JA 1BGYE 1IFPA 1SQBE 1HJ0A 1JTHB 2FBWC 2LXCB 1PGJA 2WPRA 3H1JD 4OGQC 2ZVOB 3KHUA 2WSCJ 3CL3D 3L71J 4IL6E 1R5LA 3I56P 1GD2E 1ZV8A 4U7JA 2ZT9B 1W5CE 3H1HD 4YXDC 2YKOA 1KB9H 1SFCD 3CCUP 3VP8A 2OYHB 1E79H 1PGPA 2H8PD 1L0LJ 2WQYC 2Q1KA 3H1KG 2KK7A 3HTKB 1MUUA 4NPFX 5AW9B 3ZDMA 1NU1E 5KAFH 3TF5A 1J1DC 4TLFA 1S1CX 4PJ0H 1S72P 2QJYC 3E7KA 3L73J 1VQ4P 3KZIE 1VQLP 1KC8Q 1ZRTE 1QVFO 1IC2A 2JJLA 3HUSB 1GL2B 2Y0DA 1FZEA 1P84H 1LTSC 4QMAA 1KB9E 1M8OB 5AVQB 3L73G 2E43A 1ZLLA 1KYOE 1E5WA 2E74D 1RF0A 2Q3EA 3H1ID 4O9BA 1SVFA 1SP4A 1FZAA 1Q90D 1OFCX 2AXTH 1AQTA 3BCCG 3O6QA 4L74A 2N1TD 3R2PA 1LTTC 1FJKA 1LT9A 1IZNB 1WRGA 2B9BA 2XV5A 3AEGC 2PRRA 4YPCA 1OVRA 2WT7B 2JP3A 3H32A 4LLHA 2QJYB 3RGUA 3RK2C 2YO3A 1NTKJ 1J1DB 2HODB 2KB7P 3PP5A 4AQRD 1H88A 2C9LY 1VQKP 1HGVA 1SQXK 2HLOA 1GL2A 1KQLA 2IDBA 3W68A 3AEAC 1SLQA 3CCVP 1AVOA 2YXRB 2R32A 2JKVA 2K37A 2NPSD 2XNXA 3IAOA 3L71D 1IJDB 2R5DA 3CWBD 4OWFA 2E42A 3H1KD 1Q82Q 1VQ8P 5AVVB 2YKQA 2ZYDA 5BU5A 2G8YA 4WBAA 2RN0A 3C9IA 3LW5H 1PFIA 1G2CB 3L35A 3JSVC 2FYNC 4C7NA 2CK3H 2GA1A 2W27A 4HYTB 1L0LK 3G3ZA 3VMZA 1AQ5A 2PGDA 3M91A 2B87A 3H6PA 1FU1A 3CXHD 3AE1C 3CPWO 4PV1D 1QLED 4HJGH 1QL1A 3L72J 1IFNA 3L73D 1KYOD 5AW8B 5C39A 1NWQA 1JTHA 1NO4A 1YI2P 3IFMA 4GKGA 2N1TC 3R4YA 5APWA 1KD1Q 1NTMD 5KLVE 4H0LB 4DT0A 2ZT9C 3SSUA 2OARA 3TYYA 2ZVNB 3M9HA 5AW7B 3PRJA 3WUVA 1JCDA 4IL6H 3OW2O 1FZCA 2MKVA 3HUSA 1LTGC 3A5TA 2FYUJ 2JDIH 3L72D 3AECC 1HWTC 1LT9C 1ZRTD 2D2CD 3GHGC 3G6EP 1CSBA 2Y0EA 1JY3O 3G9RA 4WY4D 1NKZB 1J2JB 1XTCC 1SQPK 5TISH 3P7KA 2KIKA 3L71G 1RE4C 1JM0A 4Y99B 1NHLA 1SQBJ 2M8RA 3JCUE 3N7NA 4ZMDA 4YXWH 2A45I 1KN7A 5H2FH 1KFNA 1KZUB 5AW5B 1BSNA 1N73A 2O01J 2JWAA 5KAIH 4WY4A 2J58A 4Z1MH 4JYCA 2WITA 3GMAA 3GLMA 5CBNA 1EZVE 1OW8A 2YKPA 1NYHA 1VF5C 4DOJA 1GU4A 3BCCE 2J59M 5CCGC 1LTJC 2Q3IA 3CLQA 1NU1J 2FFDA 1N7SA 5APTA 1K05A 1SQQK 1GTWA 1OVUA 2FKWB 2ZT9D 1FJPA 3S9OA 1YBKA 1JY2P 5AVSB 3A0BH 1G1JA 1UIIA 2Y9YA 2ZXXA 3N4XA 1BCCD 3JCUH 4D6TG 2W6JH 2FYNB 3HE5B 4L73A 1AFOA 1PZQA 3MUDA 2NRGA 1L0NK 1OMIA 1SQVK 1SFCA 5GTIH 1VQPP 2KP8A 4NPEA 3SWFA 3D6YA 1BCCG 1NTZE 3L75J 4ZKPA 2CPSA 2E75C 4A7PA 5CJ4A 1FDIA 1PPJG 3O8ZA 2KUBA 1VQ9P 2HODA 1PPJE 4PD4D 1QX8A 1K8AQ 2KZJA 2XNDH 1S3JA 4ASWA 1BCCE 1NTZG 5AVUB 2Z5HA 2K9YA 3QWOC 4EYYQ 1PGOA 1AV1A 2MJZA 1IFJA 2SPZA 1NTZD 1BGYG 4MN4C 2HPCB 1GW4A 1NAFA 1EXIA 1OZHA 3M0AA 3H32B 3F89A 4H0LC 1DEEG 1YQ4C 5GTIE 3U1CA 1JCCA 2Q9IA 1OX3A 2YIUB 3EFGA 4N78E 1HVVA 3H1LG 5APUA 1YITP 3H1IE 3AE8C 1GL2C 3B5ND 3GW6A 1SQQD 2M3EA 3HUSC 1EZVG 3HD7C 1JNMA 1FOSE 1H0TA 1S2EA 1M56D 2V4HA 1NU1K 1LWUA 1KYOH 3L4FA 5AW4B 1YJNP 3D70A 1OWAA 3U59A 4JYBA 2ZAEB 3CXHH 1XTGB 2O1JA 2FYUD 2YMKA 3A0HE 3AE7C 3PLNA 4PD4E 3SWKA 1KILD 3L71E 3V2NA 4DJGA 1BE3E 2R5BA 2XDJA 1URQD 4OH8B 2YIUC 1PPJD 1SQVJ 1NTZJ 2O01N 3JC22 1EZVI 3AEEC 2XKMA 3BATA 4HKZH 1IK9A 1SS1A 1URQC 5B5EE 1NVOA 5AW0B 1VPCA 5APYA 5KJ7D 2WT7A 2WSEH 3EFFK 1DH3A 3TK1A 1M1JB 2FYUE 1RQVA 3B71A 3RBZA 2AEJA 3AE2C 1PP9G 3L75G 3AE5C 3RK2B 1ZR2A 2BASA 1L0NE 1RF0C 2E76B 4H44B 4LC1A 5GTHH 5KLVG 1BGYD 4YTPC 3Q2YA 1KQSO 2HPCA 1RE3C 2B88A 2ZXEB 3L75D 4IL6X 1NTMK 1NTKK 4B86A 4I7ZB 1PV3A 2P2UA 1S9KE 4N78D 4H13B 5CJ0A 4BRYA 2PP6A 4C7RA 4DZOA 1Q81Q 4AUWA 1SQXG 1KYOI 4W7YA 5KKZB 2W83C 3HTKA 3FWLA 2ZFCA 2K1AA 2M3BA 3RK3B 3H1LJ 4JF7A 5AVTB 2DW3A 1P84D 3AEBC 5APVA 3CX5H 2WSFH 3CCSP 1FAVA 1MZ9A 4GDOA 1YTZT 3H1HG 4GOEA 5KLVJ 4NPDA 4CPGA 2E5YA 3CCEP 3H25A 1CW5A 2HFED 1HBWA 2L5GB 2A45G 1MKMA 1FE6A 1P84I 2FYZA 2VRSA 1FS0E 3GG2A 3Q5PA 2H7HA 2JWDA 3LIDA 1FZCB 4BRYB 1KTMA 1LGHB 1MV8A 3BRTB 5KJ7C 1NAYA 1SQBD 4ZKUA 2N9BA 3KDPB 4HB1A 5DJUB 5KLIB 1URQA 4OGQB 1JO5A 3F5HA 3SFEC 1LTIC 3E1IA 3OJAB 2UWJE 2N1TA 4PV1C 3CX5D 1BDDA 2IBZE 3MGNA 3MUDC 1KQFB 1VQMP 3WUUA 3IN6A 1Y8AA 3MTUE 1GK6A 4UB8E 5AW1B 2WSSH 1M57D 1YTZI 3L73E 3AEFC 3FGAD 3GF7A 2QJKB 1GW3A 2C0XA 2IZ0A 1L4AA 2RMZA 3CXHE 3V2RA 3BRVB 4EIJA 1LTJA 3V5BA 2FFDC 1SQXD 3PJSK 5K5GB 1GU5A 1H89A 3II6A 3CMEP 1EDIA 3ITKA 1QVGO 2R3CA 2YO2A 5CBOA 1QGKB 2O1KA 1JMBA 2J5UA 2WSCH 2WWWA 1NU1G 1LP1A 2YNYA 3MD0A 4H0LD 3B5NA 4R4LA 5E79H 3SWYA 1G2CA 4C7NB 2N1TB 3H1KE 2QEXP 2AEMA 1M1JA 2WPQA 3L37A 1X9VA 2P1JA 4H13D 3A0BE 4BXLA 2FXMA 1JEKA 3L74G 1VQ7P 1LT9B 2W90A 2GM4A 3A3YB 1T3JA 2WSEJ 1SQQJ 5AW6B 3OAKA 2WZ7A 1HUCA 1SQBG 2A45H 3Q1MA 1UIXA 3CD6P 2OYHA 2KNCB 1VQ5P 3CCQP 2YXQB 2H88C 1EC5A 1BSHA 5DJTB 5KAIE 1SQVE 3V2PA 1FZFA 1FZCC 3KZIH 3CC4P 1U57A 1NTME 3U1AA 1K9MQ 3CC7P 3HE5A 2IYOA 3TGUJ 3WUTA 4IOIH 2CPBA 5TISE 1K73Q 2GUSA 4K35A 3D6ZA 1A02J 2RH0A 3FXEA 1NJIQ 3PTZA 3HE4B 3L36A 1S5LE 4D6TE 1NGMB 1FOSF 1ZMEC 2BCCE 2FYUK 1N8RQ 2M0BA 1N7SB 2IBZD 3S1KA 3AE4C 4WB4A 2OTKE 3FXDA 3L72G 4EDFA 3CCRP 3AE3C 3KPEA 2K3RA 3HD7A 3QH9A 2BEQD 1SQPE 2E74B 2I1JA 1KORA 3BVHA 2H89C 2IFMA 2L91A 2P58A 4I7ZC 4KJMA 4W80A 4XE5B 3W67A 1EDKA 3P8CD 1GMJA 5M1BA 3RL0g 2KS1A 1GL2D 3B5NC 3H1KJ 3PHLA 3L74D 1YHQP 3M06A 1Q86Q 1N7SC 3AE6C 4IFDK 4AYCA 1IFDA 2IZ1A 2Q5UA 4UB6E 2JO1A 2P7JA 3H1JE 4LGDE 1DD3A 4PJ0E 3TGUD 5KAFE 2OTJP 1U7JA 1EDJA 1X22A 2Y0CA 1AA0A 1DIPA 3D71A 1SQQG 1M90Q 1URQB 1H8AA 3LIEA 4JQ0D 4U3FE 3VP9A 3KXDA 2OYHC 2E74C 1NTKG 1HTLC 1FDOA 3I5CA 3L74J 3BASA 4JPZB 5GTHE 1HJBA 1USEA 2KOGA 2QJPC 2I1KA 5CHXA 1ZP0C 1VL2A 2HR3A 1L0LE 1OIPA 1RE3A 2E5TA 3H1IJ 3P8MC 4WWIA 3WU2E 3BCCJ 4C46A 3TGUE 3Q5SA 1GDTA 1ZOYC 3CC2P 2E75D 4PD4I 5AVXB 1ZXGA 2W8ZA 1S5LH 2OGUA 4UB8H 2WSFJ 2BCCJ 2FY8A 5H2FE 1QEXA 3MZWB 1YQ3C 2R44A 3AE9C 1FC2C 3NFQA 4L76A 4N3YB 2Q6QA 5APSA 4JBZA 3VMXA 1JOCA 4DCKA 1BE3J 1VF5B 1LJ2A 1PL5A 1PIXA 5BU8B 4N6JA 3CI9A 3C8VA 1X0TA 1L0LD 5AVYB 2JEEA 1CI6A 3A2AA 3RK3E 1KV4A 1SQBK 3ABVC 3AEDC 2R3SA 5AVZB 4RJTA 1U7MA 4D6TD 5EFWB 3V6IA 3TGUG 1L0LG 2OYIA 1BDCA 4RESB 1J1EC 3V4WA 3C1LA 4Y99C 2AEFA 1LWUB 1NOHA 2B87B 1G1IA 1KB9I 3H1JJ 1NTKE 1T8ZA 2K88A 3MHVA 5AVWB 5B5EH 1T2KC 3GHGB 1VQOP 3V2QA 1LTAC 3BCCD 2A06D 1J1EB 3NTNA 3OA7A 5CCHD 2HG5D 2GUVA 1EZVD 5TJHA 3RL0C 4PD4H 4BWNA 2ZYAA 1ZN5A 1RHZB 2A06G 2M5AB 2RKLA 1N7SD 3EWKA 3FX0A 3IR9A 2LKMA 4HH2A 1KILC 1PGQA 4Y28J 1S5LX 5CCGD 2OQQA 1R8EA 3G71P 1OW7A 2AXTE 2QM8A 1KQGB 1L4AD 2QJKC 4GT1A 3WMM0 1L4AC 2BEZF 2W6AA 3VMAA 1K04A 1WMKA 2KZIA 1SQXJ 3CWBG 5CMZA 5APXA 2KLUA 2LR2A 3HD7D 1P84E 2IFNA 1LTJB 2IYPA 2QE7H 2V7QJ 3GF3A 4PV1B 1IO4A 3L70G 3L72E 3E1RA 1VQNP 3USSA 3RK3C 1YJWP 1LNQA 5KKZC 2IX7C 2QJPB 2I8DA 1M1KQ 1PP9D 1D7MA 2Z5IA 1EQ7A 1SQPJ 3KQGA 1W2EA 1PP9J 1RH5B 2ITAA 3M0DA 4W7ZA 2KNCA 3RL0B 1S9KD 1VQ6P 2XZRA 1S4XA 2QSIA 3WU2H 2OYIC 4KT0J 2AXCA 1USDA 4M3LA 1NTMG 2NPSB 1EDLA 2IPPA 4K3AA 1NKNA 3P32A 3PH0A 1SQVG 3MIWA 1L0NJ 1HF9A 1HH0A 1IFIA 1NU1D 1N86A 3V4QA 2NPSA 3CCMP 3Q3DA 3CXHI 2B89A 4GOFA 4RKUJ 1M1JC 1SQVD 4I2LC 2QVAA 3L70E 5KJ7A 3B4SA 4U3FJ 3H1HJ 3HRNA 2KSJA 3L74E 4H13C 3CWBE 1Q2NA 3SFDC 3I55P 3VYIA 3VN0A 1KILE 5AVRB 1CZQA 1QL2A 3T97A 2QM7A 2C0WA 2KSEA 5B66H 3MP7B 5CCGA 2KS1B 3L70D 1H0TB 2A06E 1RQUA 1N2DC 1OVVA 2QA4P 4OGQD 1BGYJ 2YMYA 1HGZA 4KHXA 1T3UA 3HD7B 3TDKA 5KTBA 4U3FD 2WVRA 3VMYA 1GZLA 1AVYA 4EOTA 1JY3P 3CX5E 2KXPB 2NZ2A 2FXPA 2K9JB 2H43A 4ASVA 1YYCA 4UB6H 2M5AA 1NH4A 3TNUA 1KFMA 1NTMJ 3M0DC 1Q7YQ 1N7LA 3TNUB 3RK3D 1KILA 2IBZG 2QIWA 3Q5RA 1L0ND 1JUNA 5BVZA 2D2CC 3RBXA 1MFTA 2P10A 1L2PA 3FWNA
chains in the Genus database with same CATH topology
2KSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSE A; 
#chains in the Genus database with same CATH topology
 1YIJ P;  4WVZ A;  1LTB C;  2NPS C;  3B5N B;  5AW3 B;  2WMM A;  2OYI B;  1KMI Z;  3L70 J;  3NXS A;  2KYV A;  3NMD A;  3H1H E;  2XU6 A;  4IFF A;  2E76 D;  1JY2 O;  2LXB A;  2W6B A;  3KYQ A;  4H44 D;  3RL0 D;  3CWB J;  3RK2 D;  1FBM A;  2WTY A;  5CCH C;  4EI2 A;  1EXJ A;  1Y9B A;  4I6M C;  3LW5 J;  1RE4 A;  1RY3 A;  4TT3 H;  1X79 B;  4OVN F;  1LP1 B;  2POH A;  4I1L A;  1NTZ K;  4L75 A;  1NTK D;  2QRX A;  1SQX E;  2Q7C A;  1OW6 A;  1VDF A;  2IBZ I;  3IF4 A;  4U3F G;  1SFC B;  2PAJ A;  1RF1 B;  1MFZ A;  2PFX A;  3H1L D;  1VF5 D;  1SQQ E;  4GIF A;  4IFM A;  1Y47 A;  3S4R A;  1L4A B;  1ZR4 A;  2Y9Z A;  1M7L A;  1CI6 B;  2E75 B;  1OXZ A;  3A7O A;  3GHG A;  3VOP A;  1FZG A;  3CX5 I;  1KIL B;  1DEB A;  3H1J G;  4RO0 A;  1L0N G;  2ZJS E;  5KLI C;  3P8C E;  3L75 E;  1PP9 E;  1AJY A;  1KB9 D;  1T6A A;  5L8R J;  2FYU G;  3G4S P;  1SQP D;  2C9N Y;  1W2B O;  1LT1 A;  1JY3 N;  1IFM A;  2JR8 A;  5E79 E;  3A0H H;  4XFJ A;  1SFC C;  2FXO A;  4WY4 C;  5APQ A;  1Z56 A;  1RF1 C;  2WPS A;  1SQP G;  1BCC J;  1GK4 A;  4D6T J;  1JY2 N;  2V7Q H;  2Z4E A;  1LWU C;  1N73 C;  1FZB A;  3K5B A;  1BE3 G;  5KLV K;  2KI7 B;  3M9Q A;  4ZNC A;  2N9Y B;  1DD4 A;  2OYO A;  2G3A A;  1WT6 A;  3CCL P;  2WPV B;  4R4M A;  2HYN A;  1FDM A;  2BCC G;  3T97 B;  1BE3 D;  3UIA A;  1ZW0 A;  2O01 H;  1JMM A;  1IK7 A;  5KLV D;  4GOD A;  5B66 E;  5AW2 B;  1TU3 F;  3TSI A;  2FFD B;  5CCH A;  1RF1 A;  2QG4 A;  2BCC D;  3H1I G;  3B8E B;  1A02 F;  1JB0 J;  3M9B A;  2P67 A;  2ZYG A;  1X8Y A;  3H1L E;  3CMA P;  2KLV A;  1DX7 A;  1R5S A;  3O6Q B;  1YJ9 P;  1T2K D;  1N73 B;  3VTP C;  4WY4 B;  2O3J A;  2E76 C;  3HE4 A;  4H44 C;  2OTL P;  2D2C B;  3EQ2 A;  3CCJ P;  4XA4 A;  2K9J A;  1BGY E;  1IFP A;  1SQB E;  1HJ0 A;  1JTH B;  2FBW C;  2LXC B;  1PGJ A;  2WPR A;  3H1J D;  4OGQ C;  2ZVO B;  3KHU A;  2WSC J;  3CL3 D;  3L71 J;  4IL6 E;  1R5L A;  3I56 P;  1GD2 E;  1ZV8 A;  4U7J A;  2ZT9 B;  1W5C E;  3H1H D;  4YXD C;  2YKO A;  1KB9 H;  1SFC D;  3CCU P;  3VP8 A;  2OYH B;  1E79 H;  1PGP A;  2H8P D;  1L0L J;  2WQY C;  2Q1K A;  3H1K G;  2KK7 A;  3HTK B;  1MUU A;  4NPF X;  5AW9 B;  3ZDM A;  1NU1 E;  5KAF H;  3TF5 A;  1J1D C;  4TLF A;  1S1C X;  4PJ0 H;  1S72 P;  2QJY C;  3E7K A;  3L73 J;  1VQ4 P;  3KZI E;  1VQL P;  1KC8 Q;  1ZRT E;  1QVF O;  1IC2 A;  2JJL A;  3HUS B;  1GL2 B;  2Y0D A;  1FZE A;  1P84 H;  1LTS C;  4QMA A;  1KB9 E;  1M8O B;  5AVQ B;  3L73 G;  2E43 A;  1ZLL A;  1KYO E;  1E5W A;  2E74 D;  1RF0 A;  2Q3E A;  3H1I D;  4O9B A;  1SVF A;  1SP4 A;  1FZA A;  1Q90 D;  1OFC X;  2AXT H;  1AQT A;  3BCC G;  3O6Q A;  4L74 A;  2N1T D;  3R2P A;  1LTT C;  1FJK A;  1LT9 A;  1IZN B;  1WRG A;  2B9B A;  2XV5 A;  3AEG C;  2PRR A;  4YPC A;  1OVR A;  2WT7 B;  2JP3 A;  3H32 A;  4LLH A;  2QJY B;  3RGU A;  3RK2 C;  2YO3 A;  1NTK J;  1J1D B;  2HOD B;  2KB7 P;  3PP5 A;  4AQR D;  1H88 A;  2C9L Y;  1VQK P;  1HGV A;  1SQX K;  2HLO A;  1GL2 A;  1KQL A;  2IDB A;  3W68 A;  3AEA C;  1SLQ A;  3CCV P;  1AVO A;  2YXR B;  2R32 A;  2JKV A;  2K37 A;  2NPS D;  2XNX A;  3IAO A;  3L71 D;  1IJD B;  2R5D A;  3CWB D;  4OWF A;  2E42 A;  3H1K D;  1Q82 Q;  1VQ8 P;  5AVV B;  2YKQ A;  2ZYD A;  5BU5 A;  2G8Y A;  4WBA A;  2RN0 A;  3C9I A;  3LW5 H;  1PFI A;  1G2C B;  3L35 A;  3JSV C;  2FYN C;  4C7N A;  2CK3 H;  2GA1 A;  2W27 A;  4HYT B;  1L0L K;  3G3Z A;  3VMZ A;  1AQ5 A;  2PGD A;  3M91 A;  2B87 A;  3H6P A;  1FU1 A;  3CXH D;  3AE1 C;  3CPW O;  4PV1 D;  1QLE D;  4HJG H;  1QL1 A;  3L72 J;  1IFN A;  3L73 D;  1KYO D;  5AW8 B;  5C39 A;  1NWQ A;  1JTH A;  1NO4 A;  1YI2 P;  3IFM A;  4GKG A;  2N1T C;  3R4Y A;  5APW A;  1KD1 Q;  1NTM D;  5KLV E;  4H0L B;  4DT0 A;  2ZT9 C;  3SSU A;  2OAR A;  3TYY A;  2ZVN B;  3M9H A;  5AW7 B;  3PRJ A;  3WUV A;  1JCD A;  4IL6 H;  3OW2 O;  1FZC A;  2MKV A;  3HUS A;  1LTG C;  3A5T A;  2FYU J;  2JDI H;  3L72 D;  3AEC C;  1HWT C;  1LT9 C;  1ZRT D;  2D2C D;  3GHG C;  3G6E P;  1CSB A;  2Y0E A;  1JY3 O;  3G9R A;  4WY4 D;  1NKZ B;  1J2J B;  1XTC C;  1SQP K;  5TIS H;  3P7K A;  2KIK A;  3L71 G;  1RE4 C;  1JM0 A;  4Y99 B;  1NHL A;  1SQB J;  2M8R A;  3JCU E;  3N7N A;  4ZMD A;  4YXW H;  2A45 I;  1KN7 A;  5H2F H;  1KFN A;  1KZU B;  5AW5 B;  1BSN A;  1N73 A;  2O01 J;  2JWA A;  5KAI H;  4WY4 A;  2J58 A;  4Z1M H;  4JYC A;  2WIT A;  3GMA A;  3GLM A;  5CBN A;  1EZV E;  1OW8 A;  2YKP A;  1NYH A;  1VF5 C;  4DOJ A;  1GU4 A;  3BCC E;  2J59 M;  5CCG C;  1LTJ C;  2Q3I A;  3CLQ A;  1NU1 J;  2FFD A;  1N7S A;  5APT A;  1K05 A;  1SQQ K;  1GTW A;  1OVU A;  2FKW B;  2ZT9 D;  1FJP A;  3S9O A;  1YBK A;  1JY2 P;  5AVS B;  3A0B H;  1G1J A;  1UII A;  2Y9Y A;  2ZXX A;  3N4X A;  1BCC D;  3JCU H;  4D6T G;  2W6J H;  2FYN B;  3HE5 B;  4L73 A;  1AFO A;  1PZQ A;  3MUD A;  2NRG A;  1L0N K;  1OMI A;  1SQV K;  1SFC A;  5GTI H;  1VQP P;  2KP8 A;  4NPE A;  3SWF A;  3D6Y A;  1BCC G;  1NTZ E;  3L75 J;  4ZKP A;  2CPS A;  2E75 C;  4A7P A;  5CJ4 A;  1FDI A;  1PPJ G;  3O8Z A;  2KUB A;  1VQ9 P;  2HOD A;  1PPJ E;  4PD4 D;  1QX8 A;  1K8A Q;  2KZJ A;  2XND H;  1S3J A;  4ASW A;  1BCC E;  1NTZ G;  5AVU B;  2Z5H A;  2K9Y A;  3QWO C;  4EYY Q;  1PGO A;  1AV1 A;  2MJZ A;  1IFJ A;  2SPZ A;  1NTZ D;  1BGY G;  4MN4 C;  2HPC B;  1GW4 A;  1NAF A;  1EXI A;  1OZH A;  3M0A A;  3H32 B;  3F89 A;  4H0L C;  1DEE G;  1YQ4 C;  5GTI E;  3U1C A;  1JCC A;  2Q9I A;  1OX3 A;  2YIU B;  3EFG A;  4N78 E;  1HVV A;  3H1L G;  5APU A;  1YIT P;  3H1I E;  3AE8 C;  1GL2 C;  3B5N D;  3GW6 A;  1SQQ D;  2M3E A;  3HUS C;  1EZV G;  3HD7 C;  1JNM A;  1FOS E;  1H0T A;  1S2E A;  1M56 D;  2V4H A;  1NU1 K;  1LWU A;  1KYO H;  3L4F A;  5AW4 B;  1YJN P;  3D70 A;  1OWA A;  3U59 A;  4JYB A;  2ZAE B;  3CXH H;  1XTG B;  2O1J A;  2FYU D;  2YMK A;  3A0H E;  3AE7 C;  3PLN A;  4PD4 E;  3SWK A;  1KIL D;  3L71 E;  3V2N A;  4DJG A;  1BE3 E;  2R5B A;  2XDJ A;  1URQ D;  4OH8 B;  2YIU C;  1PPJ D;  1SQV J;  1NTZ J;  2O01 N;  3JC2 2;  1EZV I;  3AEE C;  2XKM A;  3BAT A;  4HKZ H;  1IK9 A;  1SS1 A;  1URQ C;  5B5E E;  1NVO A;  5AW0 B;  1VPC A;  5APY A;  5KJ7 D;  2WT7 A;  2WSE H;  3EFF K;  1DH3 A;  3TK1 A;  1M1J B;  2FYU E;  1RQV A;  3B71 A;  3RBZ A;  2AEJ A;  3AE2 C;  1PP9 G;  3L75 G;  3AE5 C;  3RK2 B;  1ZR2 A;  2BAS A;  1L0N E;  1RF0 C;  2E76 B;  4H44 B;  4LC1 A;  5GTH H;  5KLV G;  1BGY D;  4YTP C;  3Q2Y A;  1KQS O;  2HPC A;  1RE3 C;  2B88 A;  2ZXE B;  3L75 D;  4IL6 X;  1NTM K;  1NTK K;  4B86 A;  4I7Z B;  1PV3 A;  2P2U A;  1S9K E;  4N78 D;  4H13 B;  5CJ0 A;  4BRY A;  2PP6 A;  4C7R A;  4DZO A;  1Q81 Q;  4AUW A;  1SQX G;  1KYO I;  4W7Y A;  5KKZ B;  2W83 C;  3HTK A;  3FWL A;  2ZFC A;  2K1A A;  2M3B A;  3RK3 B;  3H1L J;  4JF7 A;  5AVT B;  2DW3 A;  1P84 D;  3AEB C;  5APV A;  3CX5 H;  2WSF H;  3CCS P;  1FAV A;  1MZ9 A;  4GDO A;  1YTZ T;  3H1H G;  4GOE A;  5KLV J;  4NPD A;  4CPG A;  2E5Y A;  3CCE P;  3H25 A;  1CW5 A;  2HFE D;  1HBW A;  2L5G B;  2A45 G;  1MKM A;  1FE6 A;  1P84 I;  2FYZ A;  2VRS A;  1FS0 E;  3GG2 A;  3Q5P A;  2H7H A;  2JWD A;  3LID A;  1FZC B;  4BRY B;  1KTM A;  1LGH B;  1MV8 A;  3BRT B;  5KJ7 C;  1NAY A;  1SQB D;  4ZKU A;  2N9B A;  3KDP B;  4HB1 A;  5DJU B;  5KLI B;  1URQ A;  4OGQ B;  1JO5 A;  3F5H A;  3SFE C;  1LTI C;  3E1I A;  3OJA B;  2UWJ E;  2N1T A;  4PV1 C;  3CX5 D;  1BDD A;  2IBZ E;  3MGN A;  3MUD C;  1KQF B;  1VQM P;  3WUU A;  3IN6 A;  1Y8A A;  3MTU E;  1GK6 A;  4UB8 E;  5AW1 B;  2WSS H;  1M57 D;  1YTZ I;  3L73 E;  3AEF C;  3FGA D;  3GF7 A;  2QJK B;  1GW3 A;  2C0X A;  2IZ0 A;  1L4A A;  2RMZ A;  3CXH E;  3V2R A;  3BRV B;  4EIJ A;  1LTJ A;  3V5B A;  2FFD C;  1SQX D;  3PJS K;  5K5G B;  1GU5 A;  1H89 A;  3II6 A;  3CME P;  1EDI A;  3ITK A;  1QVG O;  2R3C A;  2YO2 A;  5CBO A;  1QGK B;  2O1K A;  1JMB A;  2J5U A;  2WSC H;  2WWW A;  1NU1 G;  1LP1 A;  2YNY A;  3MD0 A;  4H0L D;  3B5N A;  4R4L A;  5E79 H;  3SWY A;  1G2C A;  4C7N B;  2N1T B;  3H1K E;  2QEX P;  2AEM A;  1M1J A;  2WPQ A;  3L37 A;  1X9V A;  2P1J A;  4H13 D;  3A0B E;  4BXL A;  2FXM A;  1JEK A;  3L74 G;  1VQ7 P;  1LT9 B;  2W90 A;  2GM4 A;  3A3Y B;  1T3J A;  2WSE J;  1SQQ J;  5AW6 B;  3OAK A;  2WZ7 A;  1HUC A;  1SQB G;  2A45 H;  3Q1M A;  1UIX A;  3CD6 P;  2OYH A;  2KNC B;  1VQ5 P;  3CCQ P;  2YXQ B;  2H88 C;  1EC5 A;  1BSH A;  5DJT B;  5KAI E;  1SQV E;  3V2P A;  1FZF A;  1FZC C;  3KZI H;  3CC4 P;  1U57 A;  1NTM E;  3U1A A;  1K9M Q;  3CC7 P;  3HE5 A;  2IYO A;  3TGU J;  3WUT A;  4IOI H;  2CPB A;  5TIS E;  1K73 Q;  2GUS A;  4K35 A;  3D6Z A;  1A02 J;  2RH0 A;  3FXE A;  1NJI Q;  3PTZ A;  3HE4 B;  3L36 A;  1S5L E;  4D6T E;  1NGM B;  1FOS F;  1ZME C;  2BCC E;  2FYU K;  1N8R Q;  2M0B A;  1N7S B;  2IBZ D;  3S1K A;  3AE4 C;  4WB4 A;  2OTK E;  3FXD A;  3L72 G;  4EDF A;  3CCR P;  3AE3 C;  3KPE A;  2K3R A;  3HD7 A;  3QH9 A;  2BEQ D;  1SQP E;  2E74 B;  2I1J A;  1KOR A;  3BVH A;  2H89 C;  2IFM A;  2L91 A;  2P58 A;  4I7Z C;  4KJM A;  4W80 A;  4XE5 B;  3W67 A;  1EDK A;  3P8C D;  1GMJ A;  5M1B A;  3RL0 g;  2KS1 A;  1GL2 D;  3B5N C;  3H1K J;  3PHL A;  3L74 D;  1YHQ P;  3M06 A;  1Q86 Q;  1N7S C;  3AE6 C;  4IFD K;  4AYC A;  1IFD A;  2IZ1 A;  2Q5U A;  4UB6 E;  2JO1 A;  2P7J A;  3H1J E;  4LGD E;  1DD3 A;  4PJ0 E;  3TGU D;  5KAF E;  2OTJ P;  1U7J A;  1EDJ A;  1X22 A;  2Y0C A;  1AA0 A;  1DIP A;  3D71 A;  1SQQ G;  1M90 Q;  1URQ B;  1H8A A;  3LIE A;  4JQ0 D;  4U3F E;  3VP9 A;  3KXD A;  2OYH C;  2E74 C;  1NTK G;  1HTL C;  1FDO A;  3I5C A;  3L74 J;  3BAS A;  4JPZ B;  5GTH E;  1HJB A;  1USE A;  2KOG A;  2QJP C;  2I1K A;  5CHX A;  1ZP0 C;  1VL2 A;  2HR3 A;  1L0L E;  1OIP A;  1RE3 A;  2E5T A;  3H1I J;  3P8M C;  4WWI A;  3WU2 E;  3BCC J;  4C46 A;  3TGU E;  3Q5S A;  1GDT A;  1ZOY C;  3CC2 P;  2E75 D;  4PD4 I;  5AVX B;  1ZXG A;  2W8Z A;  1S5L H;  2OGU A;  4UB8 H;  2WSF J;  2BCC J;  2FY8 A;  5H2F E;  1QEX A;  3MZW B;  1YQ3 C;  2R44 A;  3AE9 C;  1FC2 C;  3NFQ A;  4L76 A;  4N3Y B;  2Q6Q A;  5APS A;  4JBZ A;  3VMX A;  1JOC A;  4DCK A;  1BE3 J;  1VF5 B;  1LJ2 A;  1PL5 A;  1PIX A;  5BU8 B;  4N6J A;  3CI9 A;  3C8V A;  1X0T A;  1L0L D;  5AVY B;  2JEE A;  1CI6 A;  3A2A A;  3RK3 E;  1KV4 A;  1SQB K;  3ABV C;  3AED C;  2R3S A;  5AVZ B;  4RJT A;  1U7M A;  4D6T D;  5EFW B;  3V6I A;  3TGU G;  1L0L G;  2OYI A;  1BDC A;  4RES B;  1J1E C;  3V4W A;  3C1L A;  4Y99 C;  2AEF A;  1LWU B;  1NOH A;  2B87 B;  1G1I A;  1KB9 I;  3H1J J;  1NTK E;  1T8Z A;  2K88 A;  3MHV A;  5AVW B;  5B5E H;  1T2K C;  3GHG B;  1VQO P;  3V2Q A;  1LTA C;  3BCC D;  2A06 D;  1J1E B;  3NTN A;  3OA7 A;  5CCH D;  2HG5 D;  2GUV A;  1EZV D;  5TJH A;  3RL0 C;  4PD4 H;  4BWN A;  2ZYA A;  1ZN5 A;  1RHZ B;  2A06 G;  2M5A B;  2RKL A;  1N7S D;  3EWK A;  3FX0 A;  3IR9 A;  2LKM A;  4HH2 A;  1KIL C;  1PGQ A;  4Y28 J;  1S5L X;  5CCG D;  2OQQ A;  1R8E A;  3G71 P;  1OW7 A;  2AXT E;  2QM8 A;  1KQG B;  1L4A D;  2QJK C;  4GT1 A;  3WMM 0;  1L4A C;  2BEZ F;  2W6A A;  3VMA A;  1K04 A;  1WMK A;  2KZI A;  1SQX J;  3CWB G;  5CMZ A;  5APX A;  2KLU A;  2LR2 A;  3HD7 D;  1P84 E;  2IFN A;  1LTJ B;  2IYP A;  2QE7 H;  2V7Q J;  3GF3 A;  4PV1 B;  1IO4 A;  3L70 G;  3L72 E;  3E1R A;  1VQN P;  3USS A;  3RK3 C;  1YJW P;  1LNQ A;  5KKZ C;  2IX7 C;  2QJP B;  2I8D A;  1M1K Q;  1PP9 D;  1D7M A;  2Z5I A;  1EQ7 A;  1SQP J;  3KQG A;  1W2E A;  1PP9 J;  1RH5 B;  2ITA A;  3M0D A;  4W7Z A;  2KNC A;  3RL0 B;  1S9K D;  1VQ6 P;  2XZR A;  1S4X A;  2QSI A;  3WU2 H;  2OYI C;  4KT0 J;  2AXC A;  1USD A;  4M3L A;  1NTM G;  2NPS B;  1EDL A;  2IPP A;  4K3A A;  1NKN A;  3P32 A;  3PH0 A;  1SQV G;  3MIW A;  1L0N J;  1HF9 A;  1HH0 A;  1IFI A;  1NU1 D;  1N86 A;  3V4Q A;  2NPS A;  3CCM P;  3Q3D A;  3CXH I;  2B89 A;  4GOF A;  4RKU J;  1M1J C;  1SQV D;  4I2L C;  2QVA A;  3L70 E;  5KJ7 A;  3B4S A;  4U3F J;  3H1H J;  3HRN A;  2KSJ A;  3L74 E;  4H13 C;  3CWB E;  1Q2N A;  3SFD C;  3I55 P;  3VYI A;  3VN0 A;  1KIL E;  5AVR B;  1CZQ A;  1QL2 A;  3T97 A;  2QM7 A;  2C0W A;  2KSE A;  5B66 H;  3MP7 B;  5CCG A;  2KS1 B;  3L70 D;  1H0T B;  2A06 E;  1RQU A;  1N2D C;  1OVV A;  2QA4 P;  4OGQ D;  1BGY J;  2YMY A;  1HGZ A;  4KHX A;  1T3U A;  3HD7 B;  3TDK A;  5KTB A;  4U3F D;  2WVR A;  3VMY A;  1GZL A;  1AVY A;  4EOT A;  1JY3 P;  3CX5 E;  2KXP B;  2NZ2 A;  2FXP A;  2K9J B;  2H43 A;  4ASV A;  1YYC A;  4UB6 H;  2M5A A;  1NH4 A;  3TNU A;  1KFM A;  1NTM J;  3M0D C;  1Q7Y Q;  1N7L A;  3TNU B;  3RK3 D;  1KIL A;  2IBZ G;  2QIW A;  3Q5R A;  1L0N D;  1JUN A;  5BVZ A;  2D2C C;  3RBX A;  1MFT A;  2P10 A;  1L2P A;  3FWN A; 
#chains in the Genus database with same CATH homology
 2KSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...