2KSEA

Backbone structure of the membrane domain of e. coli histidine kinase receptor qsec, center for structures of membrane proteins (csmp) target 4311c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
186
structure length
77
Chain Sequence
b'MGKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNWEYREDMALAIVAGQLIPWLVALPIMLIIMMVLLGRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein qseC
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 18
structure length 77
sequence length 186
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08521 2CSK_N Two-component sensor kinase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1040 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Sensor protein qsec. 2kseA00
2KSEA
chains in the Genus database with same CATH superfamily
3CWBJ 2JDIH 4U3FJ 5KLIC 3V2NA 5H2FE 1NTME 1SLQA 3NMDA 2ZT9B 3AE7C 3G4SP 3A5TA 3H32A 4Y99C 2V4HA 3GHGB 1MFZA 2B89A 3L72D 2J58A 1N7SC 2KSEA 2E76B 2XV5A 1IFNA 2KB7P 2YIUB 1S9KE 5E79H 2M0BA 2WPRA 3TGUD 1G1IA 4BRYB 1U7MA 2YO3A 3E1RA 2R3CA 3RK3D 3B8EB 4LC1A 1BE3J 2NPSD 2QEXP 3O6QA 1NTKK 3CMEP 1VQ8P 5EFWB 1W2BO 3L74J 1SQQG 2E74C 5KJ7C 1IK9A 1EZVG 1PGOA 3N7NA 4W7YA 1P84I 2FYNC 2C0XA 1RH5B 4GOFA 1X8YA 3U1CA 4H0LD 4TLFA 2FYUE 1L4AD 1NTMG 1ZW0A 1YJNP 4WY4C 5AW6B 1SQQD 3S1KA 3P8MC 5CCGA 2BEQD 2WPQA 5KLIB 1EZVD 1IFIA 3H6PA 2IPPA 4EOTA 1LGHB 1HWTC 2E5TA 1M1JB 1Y8AA 3D6YA 2RKLA 3G71P 2OGUA 1NTMD 4Y99B 1P84D 4I6MC 1OVUA 3KZIE 1L0LE 1SQVE 3H25A 4I1LA 3L71J 3CCUP 3CX5H 4KHXA 4KJMA 3MP7B 3H1IJ 1S9KD 2QJKC 1OXZA 3T97A 5K5GB 3KXDA 1PFIA 5KLVJ 3A0BH 3SWKA 3TDKA 1FOSF 2E74B 2JR8A 1JEKA 2FYUG 1SQXE 2FYNB 3GF3A 1Q7YQ 2HPCB 1QVFO 4EDFA 1FZCA 2H43A 1FU1A 4WY4B 1N8RQ 4DJGA 3GW6A 2D2CD 1EXIA 5CCHD 4OGQD 1UIXA 3M9HA 1OX3A 2QM7A 2FYUD 3M9BA 2PGDA 2Q5UA 3RK2D 1T3JA 5APVA 2FY8A 2YKOA 2JO1A 1L0LG 3P8CE 4TT3H 3R4YA 3EFFK 3AEEC 4QMAA 1AFOA 3CD6P 2YKPA 1L0LD 5AW7B 1SQVD 4IL6H 1SFCA 1A02J 3K5BA 1NU1J 1E79H 2NRGA 4XE5B 1A02F 1KQGB 2QJKB 1RF0A 3RL0B 2A45G 2LKMA 5APQA 2IYOA 1BGYE 2K3RA 5CJ4A 5C39A 1SQXG 1RF1A 2B87A 3D70A 1VQLP 1KQLA 1LTBC 5BU5A 1SQQJ 4R4LA 1JTHB 3M91A 1QEXA 1FZBA 3WMM0 1AA0A 1PP9J 1HGZA 2LXBA 1SQPK 4Y28J 1YBKA 4DZOA 1SQXD 4C7NA 3B5ND 2JKVA 1G2CA 1PPJE 1VDFA 2FFDA 4U7JA 1KB9I 1EDKA 2M8RA 4ASWA 3BASA 5CCGC 1GD2E 1YHQP 3HE5A 2Z4EA 2O01J 1URQB 3TF5A 1HJ0A 4AQRD 2OYHA 4R4MA 4I7ZC 3U59A 1S5LX 2WT7B 3P8CD 1HTLC 3CCLP 4PD4I 1KFMA 2W8ZA 1VQ7P 3IAOA 4YTPC 1XTCC 2E75C 4IFDK 2HFED 3SWYA 3HUSA 3L70E 1X79B 1IFPA 1J1EC 4WVZA 2WSSH 2N9BA 1CI6A 2KS1B 2Q3IA 2AEJA 1HGVA 2B88A 1NWQA 1KYOI 4W7ZA 3WU2E 3I56P 1DD3A 3W68A 2B9BA 3O6QB 5KAIH 1SQBJ 3QH9A 3AE6C 3RGUA 2IX7C 1G1JA 2KZIA 1PPJG 3CX5I 1J1DC 2WPVB 1P84H 1PL5A 3L37A 2FYUK 3I5CA 4K3AA 4O9BA 3MUDA 1NKNA 4GODA 1FZCC 1L0NJ 3H1JE 2O01H 1PPJD 2AXTE 1JO5A 3A7OA 4AYCA 1EDLA 2QJPC 1BCCE 4I7ZB 3CXHI 1L0LK 1SQVK 3HTKA 1VQ5P 2QRXA 2OYIA 3KHUA 1GK6A 3L73E 1NVOA 1XTGB 1QLED 2C9NY 1IZNB 1S72P 4UB8E 3L75E 2CK3H 3GLMA 4H44C 2FKWB 3HD7D 2K9JA 5AVTB 2ZXXA 2FBWC 1SFCC 1J1EB 1YI2P 2AEMA 4EI2A 3FGAD 4PV1C 3L70D 2N1TB 1N86A 1RF0C 3T97B 3Q5SA 5TISH 5B66H 1USEA 1YYCA 2AXCA 2ITAA 4M3LA 2L5GB 3AEDC 1J1DB 1PGQA 1NAFA 1K04A 1OMIA 5APUA 2ZVOB 3AE4C 3H1JG 1NHLA 1FZCB 1WMKA 3FX0A 3KZIH 5M1BA 1BCCG 5AVQB 5DJUB 4ZKUA 2FFDC 3PLNA 4IL6X 2ZXEB 1VQ6P 3H1JD 2WVRA 3AEGC 2QJPB 3RL0D 1KD1Q 1KILA 3L73G 2GUSA 1YTZT 2K9YA 4H13C 1LWUA 1BCCD 2OYHC 3L75G 1JY3N 2GUVA 1SQPE 2RN0A 3NFQA 1JOCA 3USSA 1BDDA 4H44B 3L73D 1SFCB 1U7JA 2A45H 5DJTB 3L72G 2W27A 3L75D 3HUSC 4PV1B 5GTHH 1YQ4C 3CL3D 1K73Q 2UWJE 3TGUG 3GMAA 4DT0A 1NTZJ 1URQD 2HR3A 1R5SA 2B87B 3SFDC 3CC4P 4UB6E 1FAVA 3CMAP 4HB1A 1GTWA 2KYVA 1GL2D 3LW5J 5AW4B 3AE2C 1CSBA 4C7NB 2P1JA 2W6JH 3ZDMA 1NTKJ 2NPSA 2KOGA 3CCEP 3BCCJ 3H1HJ 2FFDB 1EZVI 1KB9H 1K8AQ 1MUUA 4N3YB 2H8PD 2BCCJ 2HLOA 1SQPG 2OTLP 4H13B 5AW2B 2OYHB 3OJAB 3KQGA 2SPZA 4PD4H 2WQYC 1DEBA 1OW7A 1L4AA 1Z56A 1RQVA 3VMXA 4L73A 3JC22 2OYIC 2K1AA 1M8OB 2WZ7A 1SQPD 1DX7A 2K37A 3AE5C 3EQ2A 5KAFH 5BVZA 1SP4A 3HUSB 2YXRB 2ZFCA 1FZFA 1FE6A 2KP8A 5APWA 1Q90D 1X9VA 3JSVC 1CI6B 3PJSK 1NH4A 1KYOH 2OQQA 1MKMA 3Q3DA 1RE3A 3JCUE 1LTGC 1N7SB 3NXSA 3AE8C 3C8VA 3CC2P 2YKQA 1FJPA 1RHZB 3LW5H 3V4QA 2Q9IA 4YPCA 3H1JJ 1NJIQ 1JY2N 3H1LE 1J2JB 1AQTA 2PRRA 1FZAA 4N6JA 1MZ9A 5AW8B 4LGDE 1BCCJ 3CCVP 5CMZA 1K9MQ 3PRJA 1GDTA 3Q1MA 2Q6QA 1QL1A 2N1TD 2O1KA 1KC8Q 3CXHH 1S2EA 1H0TB 2IDBA 1KILC 2Y0EA 1T2KC 4AUWA 1R5LA 2IZ1A 2HYNA 3M0DC 1LWUC 5APTA 3CCJP 3F89A 1H8AA 2OYIB 4CPGA 5B5EH 5CCHA 2KUBA 1VF5C 3E1IA 2YO2A 1Q86Q 3WU2H 2ZYAA 1WRGA 2QJYC 5GTIH 3L72J 1YJ9P 3PTZA 2K9JB 2C9LY 1SQVG 3IFMA 3VN0A 1GU5A 3KDPB 2L91A 2JJLA 3TGUJ 4D6TE 2WSCJ 5E79E 1CZQA 2MKVA 4HYTB 1VQPP 1NYHA 1W5CE 3NTNA 5CJ0A 3V6IA 2WWWA 3H1LG 1JMMA 1YQ3C 1S5LE 1M1KQ 2XZRA 1NOHA 2A45I 2G3AA 4DCKA 1N7LA 3B4SA 3EWKA 2E42A 1ZRTE 4HH2A 1JY3O 1ZN5A 1K05A 3U1AA 3H1LD 1VQNP 2HODA 1ZP0C 2Q1KA 1U57A 3RK3C 2NPSC 1FDIA 1LNQA 1PZQA 3CWBE 2ZT9D 4WWIA 1NAYA 4GT1A 4U3FE 3Q2YA 3GHGA 2C0WA 3FWNA 2KK7A 1LWUB 3B5NA 3CCSP 5AVWB 4MN4C 1AVYA 4NPDA 4ZMDA 1VF5B 1NTMJ 2FXMA 3N4XA 2E76D 4H0LC 4RJTA 1L4AC 1JNMA 4WB4A 2QJYB 4EYYQ 1FZEA 4IFFA 1YJWP 3Q5RA 2AEFA 4PJ0H 3M0AA 3OW2O 4BRYA 3G3ZA 4A7PA 1MV8A 1FC2C 3MTUE 4K35A 2WSCH 1QVGO 1M56D 2I8DA 3KYQA 3CCRP 3H32B 2IBZE 3PH0A 4L75A 4D6TD 3H1KE 1RE3C 1VPCA 1EDIA 1RE4A 3C1LA 1DD4A 1BGYG 1SVFA 1RY3A 3L74E 1HF9A 3A0BE 1PV3A 1JCCA 4NPEA 3A0HH 1ZRTD 3QWOC 3RK3B 3CWBG 2NPSB 1KQSO 1KTMA 2E5YA 4U3FG 3LIDA 2KLUA 3R2PA 1M1JA 1BGYD 1VQOP 3LIEA 2BEZF 1HVVA 3L35A 3AEBC 3MIWA 1DEEG 2FYUJ 1FS0E 5H2FH 1OFCX 4IOIH 3CCMP 1ZR2A 3CWBD 2HG5D 2KZJA 1BDCA 5APYA 4U3FD 1N7SD 5KTBA 1T6AA 4H0LB 1L4AB 2H88C 2WITA 2D2CC 3CCQP 1SQBK 5CCHC 4OGQC 5AVSB 3L71E 5BU8B 3RK2C 1L0LJ 1S4XA 2IBZG 1JY2O 1SQVJ 3P7KA 2PP6A 1EDJA 3WUTA 3H1KG 1DH3A 4RESB 3H1IE 1LT9A 4IL6E 1GW3A 2E75B 4ZKPA 3L70G 1LT1A 2E74D 5KJ7D 2IBZD 2YXQB 3FWLA 4BWNA 3HD7A 1ZMEC 5KLVE 1ZLLA 2HPCA 1FOSE 3H1KD 4BXLA 4DOJA 1AVOA 2FXPA 4WY4D 1RQUA 2Y9YA 3OA7A 2G8YA 2J59M 3V4WA 1IJDB 3CPWO 1SQXJ 5AW9B 3S9OA 2XNXA 3G9RA 1RF1C 3VOPA 1YITP 3L4FA 1KQFB 2OARA 3RL0g 2QIWA 1PGJA 1R8EA 5TJHA 1EC5A 2WSFJ 1LTIC 3L36A 4Z1MH 2JWDA 3UIAA 2KNCA 4IFMA 3B5NC 2H89C 5AVUB 2D2CB 3MGNA 1JCDA 3GG2A 2K88A 4GIFA 3V2PA 3VMAA 3RK2B 2XDJA 1Q81Q 3H1IG 5AW0B 3L71D 2KLVA 1E5WA 1LP1A 3F5HA 3SSUA 1USDA 1NU1E 3VYIA 4L74A 5KKZC 5AVRB 2IYPA 5KLVG 2GM4A 5AW1B 5CBNA 3WUVA 3H1ID 1T8ZA 4JF7A 2IFMA 1T2KD 3CC7P 1BGYJ 1RE4C 1JUNA 2R5BA 2R5DA 5KLVD 3HE4A 3E7KA 3AECC 3KPEA 5KAIE 1PP9E 2M3BA 5AVVB 2DW3A 2HODB 1URQA 2QA4P 3RBXA 1P84E 4NPFX 1RF1B 2WSFH 1JMBA 1Y9BA 2QE7H 1M1JC 2WT7A 3AE1C 3ABVC 3G6EP 2ZYGA 2JEEA 1GL2A 4XFJA 1IFMA 3B5NB 1WT6A 2KXPB 4WBAA 1ZV8A 2R3SA 1G2CB 1NTZK 3MUDC 4YXWH 3BATA 2Z5HA 2R44A 2POHA 1HBWA 2XNDH 1NU1G 1S5LH 2BASA 3HE5B 2PAJA 2KS1A 3CLQA 2WSEJ 3H1KJ 1GK4A 5KKZB 2FYZA 2PFXA 1KFNA 2V7QJ 1NU1D 3L70J 1LT9C 2M5AA 4OH8B 3VP9A 4HKZH 4GDOA 3CI9A 1PP9G 1AV1A 2I1KA 4JPZB 1FZGA 3VMZA 5TISE 1SQBE 3HD7C 3WUUA 2A06E 5AVZB 1YIJP 3AE3C 1S3JA 5B66E 1UIIA 2P67A 3D71A 1VL2A 2OYOA 5CCGD 3AEAC 1GU4A 1PP9D 3PP5A 1FDMA 1X0TA 2MJZA 1LTJA 2YMKA 1L0NE 3TSIA 2RH0A 2E43A 1FBMA 3D6ZA 1Q82Q 2O01N 1KV4A 2Q3EA 3HRNA 3B71A 2QM8A 2E75D 3EFGA 1QX8A 3W67A 4C7RA 2OTJP 1N73A 2P10A 3VP8A 2LR2A 2WSEH 1VQKP 4B86A 3OAKA 2N1TA 1JM0A 4JYBA 1LTSC 3L73J 3RL0C 2V7QH 3L75J 3TNUA 3HTKB 2JP3A 1M90Q 2KI7B 1KN7A 1LT9B 2JWAA 1ZR4A 1SQBG 2FXOA 2GA1A 2WMMA 4EIJA 2A06G 3V5BA 5KLVK 1YTZI 2KSJA 3M9QA 1KMIZ 5GTHE 2P2UA 1SS1A 3V2RA 3HD7B 4ZNCA 1JY3P 2O1JA 2ZVNB 5CBOA 1DIPA 2I1JA 3C9IA 2ZAEB 1SQBD 4OVNF 2A06D 1L0NG 3IR9A 3TK1A 2XKMA 2IZ0A 1W2EA 3M06A 1BSHA 2R32A 3PHLA 1URQC 2QVAA 4N78E 2AXTH 3Q5PA 4I2LC 1L0ND 1M57D 4KT0J 2Q7CA 2W6AA 1GL2C 2W6BA 5APSA 1KB9E 5AVXB 4RO0A 2KNCB 4H44D 3BVHA 3ITKA 1QGKB 3A2AA 1SFCD 4L76A 1IFDA 2W83C 2CPSA 1EXJA 3V2QA 3II6A 4PD4E 4PV1D 4UB8H 1NU1K 3MHVA 1OWAA 1SQPJ 1KILB 1LP1B 3FXEA 1M7LA 1OVRA 1NGMB 5KAFE 2RMZA 4OWFA 2YMYA 2Y9ZA 1SQQK 2Z5IA 1NTZE 1KYOE 4D6TG 3HE4B 2Y0DA 3I55P 1L2PA 1NTMK 3CX5E 2O3JA 1NTKE 1BE3E 4H13D 3BCCE 3H1HE 1LTJC 1TU3F 2H7HA 4N78D 1IC2A 5CHXA 1FJKA 1GL2B 2BCCE 1OZHA 1IO4A 1HJBA 1CW5A 1KB9D 1PIXA 1GMJA 5L8RJ 3CXHE 1H89A 1VQ9P 1JY2P 1IK7A 2N9YB 2NZ2A 1N73C 3FXDA 2KIKA 4YXDC 3P32A 2N1TC 4PD4D 5B5EE 1N7SA 3IN6A 1X22A 5GTIE 1NTZG 3BRTB 3TYYA 3SFEC 1LJ2A 2IBZI 4GOEA 2M5AB 1N2DC 1NO4A 1KORA 1S1CX 4UB6H 2Y0CA 1NTZD 2YNYA 4HJGH 1AJYA 1NTKG 1ZOYC 1KYOD 1H88A 1BE3G 3BCCG 3H1HG 1PGPA 1BSNA 4LLHA 1L0NK 3GF7A 1MFTA 2LXCB 2QSIA 5KJ7A 1KILE 3H1LJ 1H0TA 2BCCG 3L74G 3CX5D 1VQ4P 1QL2A 1LTJB 1NTKD 4JBZA 5AW5B 1IFJA 2P7JA 1JB0J 1EQ7A 1BE3D 3BCCD 2VRSA 3H1HD 4WY4A 4ASVA 1OW8A 2W90A 2WTYA 2BCCD 4JQ0D 3BRVB 3L74D 3VMYA 2OTKE 3VTPC 1ZXGA 1N73B 1LTAC 3MD0A 3CXHD 1GZLA 2ZT9C 2QG4A 3L72E 2WPSA 2M3EA 4C46A 5AVYB 3GHGC 1D7MA 1Q2NA 3L71G 3TNUB 1T3UA 4PJ0E 1SQXK 2XU6A 2E76C 3TGUE 1VQMP 4OGQB 2YIUC 3AEFC 3JCUH 1HH0A 1FDOA 2J5UA 4D6TJ 3RK3E 4RKUJ 1GW4A 3AE9C 1KZUB 3SWFA 1OIPA 4W80A 4XA4A 3O8ZA 2IFNA 2P58A 5AW3B 1JTHA 1OW6A 1LTTC 1AQ5A 5APXA 1Y47A 1KILD 3M0DA 3IF4A 2ZYDA 3A3YB 1OVVA 3A0HE 4JYCA 3S4RA 4GKGA 1SQQE 3MZWB 1VF5D 2CPBA 1HUCA 1EZVE 2ZJSE 3RBZA 1NKZB
chains in the Genus database with same CATH topology
2KSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSE A; 
#chains in the Genus database with same CATH topology
 3CWB J;  2JDI H;  4U3F J;  5KLI C;  3V2N A;  5H2F E;  1NTM E;  1SLQ A;  3NMD A;  2ZT9 B;  3AE7 C;  3G4S P;  3A5T A;  3H32 A;  4Y99 C;  2V4H A;  3GHG B;  1MFZ A;  2B89 A;  3L72 D;  2J58 A;  1N7S C;  2KSE A;  2E76 B;  2XV5 A;  1IFN A;  2KB7 P;  2YIU B;  1S9K E;  5E79 H;  2M0B A;  2WPR A;  3TGU D;  1G1I A;  4BRY B;  1U7M A;  2YO3 A;  3E1R A;  2R3C A;  3RK3 D;  3B8E B;  4LC1 A;  1BE3 J;  2NPS D;  2QEX P;  3O6Q A;  1NTK K;  3CME P;  1VQ8 P;  5EFW B;  1W2B O;  3L74 J;  1SQQ G;  2E74 C;  5KJ7 C;  1IK9 A;  1EZV G;  1PGO A;  3N7N A;  4W7Y A;  1P84 I;  2FYN C;  2C0X A;  1RH5 B;  4GOF A;  1X8Y A;  3U1C A;  4H0L D;  4TLF A;  2FYU E;  1L4A D;  1NTM G;  1ZW0 A;  1YJN P;  4WY4 C;  5AW6 B;  1SQQ D;  3S1K A;  3P8M C;  5CCG A;  2BEQ D;  2WPQ A;  5KLI B;  1EZV D;  1IFI A;  3H6P A;  2IPP A;  4EOT A;  1LGH B;  1HWT C;  2E5T A;  1M1J B;  1Y8A A;  3D6Y A;  2RKL A;  3G71 P;  2OGU A;  1NTM D;  4Y99 B;  1P84 D;  4I6M C;  1OVU A;  3KZI E;  1L0L E;  1SQV E;  3H25 A;  4I1L A;  3L71 J;  3CCU P;  3CX5 H;  4KHX A;  4KJM A;  3MP7 B;  3H1I J;  1S9K D;  2QJK C;  1OXZ A;  3T97 A;  5K5G B;  3KXD A;  1PFI A;  5KLV J;  3A0B H;  3SWK A;  3TDK A;  1FOS F;  2E74 B;  2JR8 A;  1JEK A;  2FYU G;  1SQX E;  2FYN B;  3GF3 A;  1Q7Y Q;  2HPC B;  1QVF O;  4EDF A;  1FZC A;  2H43 A;  1FU1 A;  4WY4 B;  1N8R Q;  4DJG A;  3GW6 A;  2D2C D;  1EXI A;  5CCH D;  4OGQ D;  1UIX A;  3M9H A;  1OX3 A;  2QM7 A;  2FYU D;  3M9B A;  2PGD A;  2Q5U A;  3RK2 D;  1T3J A;  5APV A;  2FY8 A;  2YKO A;  2JO1 A;  1L0L G;  3P8C E;  4TT3 H;  3R4Y A;  3EFF K;  3AEE C;  4QMA A;  1AFO A;  3CD6 P;  2YKP A;  1L0L D;  5AW7 B;  1SQV D;  4IL6 H;  1SFC A;  1A02 J;  3K5B A;  1NU1 J;  1E79 H;  2NRG A;  4XE5 B;  1A02 F;  1KQG B;  2QJK B;  1RF0 A;  3RL0 B;  2A45 G;  2LKM A;  5APQ A;  2IYO A;  1BGY E;  2K3R A;  5CJ4 A;  5C39 A;  1SQX G;  1RF1 A;  2B87 A;  3D70 A;  1VQL P;  1KQL A;  1LTB C;  5BU5 A;  1SQQ J;  4R4L A;  1JTH B;  3M91 A;  1QEX A;  1FZB A;  3WMM 0;  1AA0 A;  1PP9 J;  1HGZ A;  2LXB A;  1SQP K;  4Y28 J;  1YBK A;  4DZO A;  1SQX D;  4C7N A;  3B5N D;  2JKV A;  1G2C A;  1PPJ E;  1VDF A;  2FFD A;  4U7J A;  1KB9 I;  1EDK A;  2M8R A;  4ASW A;  3BAS A;  5CCG C;  1GD2 E;  1YHQ P;  3HE5 A;  2Z4E A;  2O01 J;  1URQ B;  3TF5 A;  1HJ0 A;  4AQR D;  2OYH A;  4R4M A;  4I7Z C;  3U59 A;  1S5L X;  2WT7 B;  3P8C D;  1HTL C;  3CCL P;  4PD4 I;  1KFM A;  2W8Z A;  1VQ7 P;  3IAO A;  4YTP C;  1XTC C;  2E75 C;  4IFD K;  2HFE D;  3SWY A;  3HUS A;  3L70 E;  1X79 B;  1IFP A;  1J1E C;  4WVZ A;  2WSS H;  2N9B A;  1CI6 A;  2KS1 B;  2Q3I A;  2AEJ A;  1HGV A;  2B88 A;  1NWQ A;  1KYO I;  4W7Z A;  3WU2 E;  3I56 P;  1DD3 A;  3W68 A;  2B9B A;  3O6Q B;  5KAI H;  1SQB J;  3QH9 A;  3AE6 C;  3RGU A;  2IX7 C;  1G1J A;  2KZI A;  1PPJ G;  3CX5 I;  1J1D C;  2WPV B;  1P84 H;  1PL5 A;  3L37 A;  2FYU K;  3I5C A;  4K3A A;  4O9B A;  3MUD A;  1NKN A;  4GOD A;  1FZC C;  1L0N J;  3H1J E;  2O01 H;  1PPJ D;  2AXT E;  1JO5 A;  3A7O A;  4AYC A;  1EDL A;  2QJP C;  1BCC E;  4I7Z B;  3CXH I;  1L0L K;  1SQV K;  3HTK A;  1VQ5 P;  2QRX A;  2OYI A;  3KHU A;  1GK6 A;  3L73 E;  1NVO A;  1XTG B;  1QLE D;  2C9N Y;  1IZN B;  1S72 P;  4UB8 E;  3L75 E;  2CK3 H;  3GLM A;  4H44 C;  2FKW B;  3HD7 D;  2K9J A;  5AVT B;  2ZXX A;  2FBW C;  1SFC C;  1J1E B;  1YI2 P;  2AEM A;  4EI2 A;  3FGA D;  4PV1 C;  3L70 D;  2N1T B;  1N86 A;  1RF0 C;  3T97 B;  3Q5S A;  5TIS H;  5B66 H;  1USE A;  1YYC A;  2AXC A;  2ITA A;  4M3L A;  2L5G B;  3AED C;  1J1D B;  1PGQ A;  1NAF A;  1K04 A;  1OMI A;  5APU A;  2ZVO B;  3AE4 C;  3H1J G;  1NHL A;  1FZC B;  1WMK A;  3FX0 A;  3KZI H;  5M1B A;  1BCC G;  5AVQ B;  5DJU B;  4ZKU A;  2FFD C;  3PLN A;  4IL6 X;  2ZXE B;  1VQ6 P;  3H1J D;  2WVR A;  3AEG C;  2QJP B;  3RL0 D;  1KD1 Q;  1KIL A;  3L73 G;  2GUS A;  1YTZ T;  2K9Y A;  4H13 C;  1LWU A;  1BCC D;  2OYH C;  3L75 G;  1JY3 N;  2GUV A;  1SQP E;  2RN0 A;  3NFQ A;  1JOC A;  3USS A;  1BDD A;  4H44 B;  3L73 D;  1SFC B;  1U7J A;  2A45 H;  5DJT B;  3L72 G;  2W27 A;  3L75 D;  3HUS C;  4PV1 B;  5GTH H;  1YQ4 C;  3CL3 D;  1K73 Q;  2UWJ E;  3TGU G;  3GMA A;  4DT0 A;  1NTZ J;  1URQ D;  2HR3 A;  1R5S A;  2B87 B;  3SFD C;  3CC4 P;  4UB6 E;  1FAV A;  3CMA P;  4HB1 A;  1GTW A;  2KYV A;  1GL2 D;  3LW5 J;  5AW4 B;  3AE2 C;  1CSB A;  4C7N B;  2P1J A;  2W6J H;  3ZDM A;  1NTK J;  2NPS A;  2KOG A;  3CCE P;  3BCC J;  3H1H J;  2FFD B;  1EZV I;  1KB9 H;  1K8A Q;  1MUU A;  4N3Y B;  2H8P D;  2BCC J;  2HLO A;  1SQP G;  2OTL P;  4H13 B;  5AW2 B;  2OYH B;  3OJA B;  3KQG A;  2SPZ A;  4PD4 H;  2WQY C;  1DEB A;  1OW7 A;  1L4A A;  1Z56 A;  1RQV A;  3VMX A;  4L73 A;  3JC2 2;  2OYI C;  2K1A A;  1M8O B;  2WZ7 A;  1SQP D;  1DX7 A;  2K37 A;  3AE5 C;  3EQ2 A;  5KAF H;  5BVZ A;  1SP4 A;  3HUS B;  2YXR B;  2ZFC A;  1FZF A;  1FE6 A;  2KP8 A;  5APW A;  1Q90 D;  1X9V A;  3JSV C;  1CI6 B;  3PJS K;  1NH4 A;  1KYO H;  2OQQ A;  1MKM A;  3Q3D A;  1RE3 A;  3JCU E;  1LTG C;  1N7S B;  3NXS A;  3AE8 C;  3C8V A;  3CC2 P;  2YKQ A;  1FJP A;  1RHZ B;  3LW5 H;  3V4Q A;  2Q9I A;  4YPC A;  3H1J J;  1NJI Q;  1JY2 N;  3H1L E;  1J2J B;  1AQT A;  2PRR A;  1FZA A;  4N6J A;  1MZ9 A;  5AW8 B;  4LGD E;  1BCC J;  3CCV P;  5CMZ A;  1K9M Q;  3PRJ A;  1GDT A;  3Q1M A;  2Q6Q A;  1QL1 A;  2N1T D;  2O1K A;  1KC8 Q;  3CXH H;  1S2E A;  1H0T B;  2IDB A;  1KIL C;  2Y0E A;  1T2K C;  4AUW A;  1R5L A;  2IZ1 A;  2HYN A;  3M0D C;  1LWU C;  5APT A;  3CCJ P;  3F89 A;  1H8A A;  2OYI B;  4CPG A;  5B5E H;  5CCH A;  2KUB A;  1VF5 C;  3E1I A;  2YO2 A;  1Q86 Q;  3WU2 H;  2ZYA A;  1WRG A;  2QJY C;  5GTI H;  3L72 J;  1YJ9 P;  3PTZ A;  2K9J B;  2C9L Y;  1SQV G;  3IFM A;  3VN0 A;  1GU5 A;  3KDP B;  2L91 A;  2JJL A;  3TGU J;  4D6T E;  2WSC J;  5E79 E;  1CZQ A;  2MKV A;  4HYT B;  1VQP P;  1NYH A;  1W5C E;  3NTN A;  5CJ0 A;  3V6I A;  2WWW A;  3H1L G;  1JMM A;  1YQ3 C;  1S5L E;  1M1K Q;  2XZR A;  1NOH A;  2A45 I;  2G3A A;  4DCK A;  1N7L A;  3B4S A;  3EWK A;  2E42 A;  1ZRT E;  4HH2 A;  1JY3 O;  1ZN5 A;  1K05 A;  3U1A A;  3H1L D;  1VQN P;  2HOD A;  1ZP0 C;  2Q1K A;  1U57 A;  3RK3 C;  2NPS C;  1FDI A;  1LNQ A;  1PZQ A;  3CWB E;  2ZT9 D;  4WWI A;  1NAY A;  4GT1 A;  4U3F E;  3Q2Y A;  3GHG A;  2C0W A;  3FWN A;  2KK7 A;  1LWU B;  3B5N A;  3CCS P;  5AVW B;  4MN4 C;  1AVY A;  4NPD A;  4ZMD A;  1VF5 B;  1NTM J;  2FXM A;  3N4X A;  2E76 D;  4H0L C;  4RJT A;  1L4A C;  1JNM A;  4WB4 A;  2QJY B;  4EYY Q;  1FZE A;  4IFF A;  1YJW P;  3Q5R A;  2AEF A;  4PJ0 H;  3M0A A;  3OW2 O;  4BRY A;  3G3Z A;  4A7P A;  1MV8 A;  1FC2 C;  3MTU E;  4K35 A;  2WSC H;  1QVG O;  1M56 D;  2I8D A;  3KYQ A;  3CCR P;  3H32 B;  2IBZ E;  3PH0 A;  4L75 A;  4D6T D;  3H1K E;  1RE3 C;  1VPC A;  1EDI A;  1RE4 A;  3C1L A;  1DD4 A;  1BGY G;  1SVF A;  1RY3 A;  3L74 E;  1HF9 A;  3A0B E;  1PV3 A;  1JCC A;  4NPE A;  3A0H H;  1ZRT D;  3QWO C;  3RK3 B;  3CWB G;  2NPS B;  1KQS O;  1KTM A;  2E5Y A;  4U3F G;  3LID A;  2KLU A;  3R2P A;  1M1J A;  1BGY D;  1VQO P;  3LIE A;  2BEZ F;  1HVV A;  3L35 A;  3AEB C;  3MIW A;  1DEE G;  2FYU J;  1FS0 E;  5H2F H;  1OFC X;  4IOI H;  3CCM P;  1ZR2 A;  3CWB D;  2HG5 D;  2KZJ A;  1BDC A;  5APY A;  4U3F D;  1N7S D;  5KTB A;  1T6A A;  4H0L B;  1L4A B;  2H88 C;  2WIT A;  2D2C C;  3CCQ P;  1SQB K;  5CCH C;  4OGQ C;  5AVS B;  3L71 E;  5BU8 B;  3RK2 C;  1L0L J;  1S4X A;  2IBZ G;  1JY2 O;  1SQV J;  3P7K A;  2PP6 A;  1EDJ A;  3WUT A;  3H1K G;  1DH3 A;  4RES B;  3H1I E;  1LT9 A;  4IL6 E;  1GW3 A;  2E75 B;  4ZKP A;  3L70 G;  1LT1 A;  2E74 D;  5KJ7 D;  2IBZ D;  2YXQ B;  3FWL A;  4BWN A;  3HD7 A;  1ZME C;  5KLV E;  1ZLL A;  2HPC A;  1FOS E;  3H1K D;  4BXL A;  4DOJ A;  1AVO A;  2FXP A;  4WY4 D;  1RQU A;  2Y9Y A;  3OA7 A;  2G8Y A;  2J59 M;  3V4W A;  1IJD B;  3CPW O;  1SQX J;  5AW9 B;  3S9O A;  2XNX A;  3G9R A;  1RF1 C;  3VOP A;  1YIT P;  3L4F A;  1KQF B;  2OAR A;  3RL0 g;  2QIW A;  1PGJ A;  1R8E A;  5TJH A;  1EC5 A;  2WSF J;  1LTI C;  3L36 A;  4Z1M H;  2JWD A;  3UIA A;  2KNC A;  4IFM A;  3B5N C;  2H89 C;  5AVU B;  2D2C B;  3MGN A;  1JCD A;  3GG2 A;  2K88 A;  4GIF A;  3V2P A;  3VMA A;  3RK2 B;  2XDJ A;  1Q81 Q;  3H1I G;  5AW0 B;  3L71 D;  2KLV A;  1E5W A;  1LP1 A;  3F5H A;  3SSU A;  1USD A;  1NU1 E;  3VYI A;  4L74 A;  5KKZ C;  5AVR B;  2IYP A;  5KLV G;  2GM4 A;  5AW1 B;  5CBN A;  3WUV A;  3H1I D;  1T8Z A;  4JF7 A;  2IFM A;  1T2K D;  3CC7 P;  1BGY J;  1RE4 C;  1JUN A;  2R5B A;  2R5D A;  5KLV D;  3HE4 A;  3E7K A;  3AEC C;  3KPE A;  5KAI E;  1PP9 E;  2M3B A;  5AVV B;  2DW3 A;  2HOD B;  1URQ A;  2QA4 P;  3RBX A;  1P84 E;  4NPF X;  1RF1 B;  2WSF H;  1JMB A;  1Y9B A;  2QE7 H;  1M1J C;  2WT7 A;  3AE1 C;  3ABV C;  3G6E P;  2ZYG A;  2JEE A;  1GL2 A;  4XFJ A;  1IFM A;  3B5N B;  1WT6 A;  2KXP B;  4WBA A;  1ZV8 A;  2R3S A;  1G2C B;  1NTZ K;  3MUD C;  4YXW H;  3BAT A;  2Z5H A;  2R44 A;  2POH A;  1HBW A;  2XND H;  1NU1 G;  1S5L H;  2BAS A;  3HE5 B;  2PAJ A;  2KS1 A;  3CLQ A;  2WSE J;  3H1K J;  1GK4 A;  5KKZ B;  2FYZ A;  2PFX A;  1KFN A;  2V7Q J;  1NU1 D;  3L70 J;  1LT9 C;  2M5A A;  4OH8 B;  3VP9 A;  4HKZ H;  4GDO A;  3CI9 A;  1PP9 G;  1AV1 A;  2I1K A;  4JPZ B;  1FZG A;  3VMZ A;  5TIS E;  1SQB E;  3HD7 C;  3WUU A;  2A06 E;  5AVZ B;  1YIJ P;  3AE3 C;  1S3J A;  5B66 E;  1UII A;  2P67 A;  3D71 A;  1VL2 A;  2OYO A;  5CCG D;  3AEA C;  1GU4 A;  1PP9 D;  3PP5 A;  1FDM A;  1X0T A;  2MJZ A;  1LTJ A;  2YMK A;  1L0N E;  3TSI A;  2RH0 A;  2E43 A;  1FBM A;  3D6Z A;  1Q82 Q;  2O01 N;  1KV4 A;  2Q3E A;  3HRN A;  3B71 A;  2QM8 A;  2E75 D;  3EFG A;  1QX8 A;  3W67 A;  4C7R A;  2OTJ P;  1N73 A;  2P10 A;  3VP8 A;  2LR2 A;  2WSE H;  1VQK P;  4B86 A;  3OAK A;  2N1T A;  1JM0 A;  4JYB A;  1LTS C;  3L73 J;  3RL0 C;  2V7Q H;  3L75 J;  3TNU A;  3HTK B;  2JP3 A;  1M90 Q;  2KI7 B;  1KN7 A;  1LT9 B;  2JWA A;  1ZR4 A;  1SQB G;  2FXO A;  2GA1 A;  2WMM A;  4EIJ A;  2A06 G;  3V5B A;  5KLV K;  1YTZ I;  2KSJ A;  3M9Q A;  1KMI Z;  5GTH E;  2P2U A;  1SS1 A;  3V2R A;  3HD7 B;  4ZNC A;  1JY3 P;  2O1J A;  2ZVN B;  5CBO A;  1DIP A;  2I1J A;  3C9I A;  2ZAE B;  1SQB D;  4OVN F;  2A06 D;  1L0N G;  3IR9 A;  3TK1 A;  2XKM A;  2IZ0 A;  1W2E A;  3M06 A;  1BSH A;  2R32 A;  3PHL A;  1URQ C;  2QVA A;  4N78 E;  2AXT H;  3Q5P A;  4I2L C;  1L0N D;  1M57 D;  4KT0 J;  2Q7C A;  2W6A A;  1GL2 C;  2W6B A;  5APS A;  1KB9 E;  5AVX B;  4RO0 A;  2KNC B;  4H44 D;  3BVH A;  3ITK A;  1QGK B;  3A2A A;  1SFC D;  4L76 A;  1IFD A;  2W83 C;  2CPS A;  1EXJ A;  3V2Q A;  3II6 A;  4PD4 E;  4PV1 D;  4UB8 H;  1NU1 K;  3MHV A;  1OWA A;  1SQP J;  1KIL B;  1LP1 B;  3FXE A;  1M7L A;  1OVR A;  1NGM B;  5KAF E;  2RMZ A;  4OWF A;  2YMY A;  2Y9Z A;  1SQQ K;  2Z5I A;  1NTZ E;  1KYO E;  4D6T G;  3HE4 B;  2Y0D A;  3I55 P;  1L2P A;  1NTM K;  3CX5 E;  2O3J A;  1NTK E;  1BE3 E;  4H13 D;  3BCC E;  3H1H E;  1LTJ C;  1TU3 F;  2H7H A;  4N78 D;  1IC2 A;  5CHX A;  1FJK A;  1GL2 B;  2BCC E;  1OZH A;  1IO4 A;  1HJB A;  1CW5 A;  1KB9 D;  1PIX A;  1GMJ A;  5L8R J;  3CXH E;  1H89 A;  1VQ9 P;  1JY2 P;  1IK7 A;  2N9Y B;  2NZ2 A;  1N73 C;  3FXD A;  2KIK A;  4YXD C;  3P32 A;  2N1T C;  4PD4 D;  5B5E E;  1N7S A;  3IN6 A;  1X22 A;  5GTI E;  1NTZ G;  3BRT B;  3TYY A;  3SFE C;  1LJ2 A;  2IBZ I;  4GOE A;  2M5A B;  1N2D C;  1NO4 A;  1KOR A;  1S1C X;  4UB6 H;  2Y0C A;  1NTZ D;  2YNY A;  4HJG H;  1AJY A;  1NTK G;  1ZOY C;  1KYO D;  1H88 A;  1BE3 G;  3BCC G;  3H1H G;  1PGP A;  1BSN A;  4LLH A;  1L0N K;  3GF7 A;  1MFT A;  2LXC B;  2QSI A;  5KJ7 A;  1KIL E;  3H1L J;  1H0T A;  2BCC G;  3L74 G;  3CX5 D;  1VQ4 P;  1QL2 A;  1LTJ B;  1NTK D;  4JBZ A;  5AW5 B;  1IFJ A;  2P7J A;  1JB0 J;  1EQ7 A;  1BE3 D;  3BCC D;  2VRS A;  3H1H D;  4WY4 A;  4ASV A;  1OW8 A;  2W90 A;  2WTY A;  2BCC D;  4JQ0 D;  3BRV B;  3L74 D;  3VMY A;  2OTK E;  3VTP C;  1ZXG A;  1N73 B;  1LTA C;  3MD0 A;  3CXH D;  1GZL A;  2ZT9 C;  2QG4 A;  3L72 E;  2WPS A;  2M3E A;  4C46 A;  5AVY B;  3GHG C;  1D7M A;  1Q2N A;  3L71 G;  3TNU B;  1T3U A;  4PJ0 E;  1SQX K;  2XU6 A;  2E76 C;  3TGU E;  1VQM P;  4OGQ B;  2YIU C;  3AEF C;  3JCU H;  1HH0 A;  1FDO A;  2J5U A;  4D6T J;  3RK3 E;  4RKU J;  1GW4 A;  3AE9 C;  1KZU B;  3SWF A;  1OIP A;  4W80 A;  4XA4 A;  3O8Z A;  2IFN A;  2P58 A;  5AW3 B;  1JTH A;  1OW6 A;  1LTT C;  1AQ5 A;  5APX A;  1Y47 A;  1KIL D;  3M0D A;  3IF4 A;  2ZYD A;  3A3Y B;  1OVV A;  3A0H E;  4JYC A;  3S4R A;  4GKG A;  1SQQ E;  3MZW B;  1VF5 D;  2CPB A;  1HUC A;  1EZV E;  2ZJS E;  3RBZ A;  1NKZ B; 
#chains in the Genus database with same CATH homology
 2KSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...