2KSEA

Backbone structure of the membrane domain of e. coli histidine kinase receptor qsec, center for structures of membrane proteins (csmp) target 4311c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
186
structure length
77
Chain Sequence
MGKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNWEYREDMALAIVAGQLIPWLVALPIMLIIMMVLLGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein qseC
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 77
sequence length 186
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08521 2CSK_N Two-component sensor kinase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1040 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Sensor protein qsec. 2kseA00
2KSEA
chains in the Genus database with same CATH superfamily
1S5LE 2ZVOB 4HKZH 4JPZB 1VQLP 2OQQA 1M90Q 1PP9J 2HFED 3CPWO 2YNYA 3TK1A 3TYYA 3CI9A 3E1RA 2IYOA 3P7KA 3CMEP 5CMZA 3SFEC 3AEFC 2M5AA 4LGDE 2K9YA 1AJYA 1N7SA 3BCCJ 3PH0A 1SQXG 3GMAA 2Q1KA 4BXLA 3RGUA 1FZFA 3L75E 4OH8B 1DD4A 1VQ8P 3VMZA 3Q2YA 1IC2A 3C8VA 2JP3A 1SQPE 2E74C 3AEAC 3GHGB 3L74E 2AXTH 5KLVJ 1IFIA 2I1KA 2Y0EA 4GKGA 2IBZG 1N86A 3M0AA 4UB6H 1NAFA 3RK2C 3L35A 4I1LA 1K8AQ 3CL3D 1HGVA 1NTKG 1VPCA 4ZNCA 1NKNA 1LT1A 1NWQA 2XU6A 3II6A 1HUCA 2QSIA 3Q5PA 2GUSA 4YTPC 2NPSA 2KSEA 2Y9YA 3V4WA 1LNQA 3CX5I 2KSJA 3L71G 1GDTA 1WRGA 2AXCA 1PFIA 2E5YA 3KZIH 5KLVK 3HD7C 3F5HA 2YKOA 2ZT9B 2XNXA 3H32A 3G4SP 3BCCG 3H1HD 3CWBE 2N1TB 4PV1D 2E5TA 3S4RA 1JM0A 2WZ7A 1SQVE 5H2FH 1Q81Q 5K5GB 2R5BA 2WPRA 3LW5J 3UIAA 3QH9A 3N4XA 1BGYG 4I2LC 3JC22 5AW1B 1VQOP 4NPDA 2WSCJ 2W8ZA 5KAIE 3HE4A 2H88C 3O8ZA 2IZ0A 2YIUC 5B5EE 1IFJA 3RK2D 1GU4A 1R5LA 1ZW0A 1JMMA 4AQRD 1NGMB 3P32A 3RBZA 1DEBA 2KOGA 3MGNA 1BCCJ 3KQGA 3KHUA 1ZR2A 1M1JB 1BDDA 3HUSB 2SPZA 1HBWA 1S9KE 1EDKA 2PGDA 1L0NE 1VQPP 2P58A 1M1KQ 1X79B 1OVRA 3F89A 1PL5A 3VOPA 2ZT9C 4TLFA 1RF1B 1VQMP 2QM7A 3H1JE 1OWAA 3JCUH 3FXDA 5KJ7A 2KP8A 2N1TC 3WUTA 1PV3A 2FFDB 1SP4A 3PTZA 1KYOE 1T8ZA 2WMMA 2J59M 2XZRA 1L4AA 3L73D 1KQFB 2M8RA 1LTIC 2BASA 1QL1A 1OX3A 5APQA 1KC8Q 3CC7P 4K35A 3AEDC 1LT9B 1PP9D 5KLIC 1SVFA 1LTJC 1GTWA 1EZVE 3Q5SA 3L70G 5AW9B 1NVOA 2IDBA 4H44B 2QJYC 1N73B 1X0TA 4U3FG 2E75B 2KK7A 1U57A 1NYHA 1FU1A 1L0LE 5TJHA 4WBAA 2CK3H 2P10A 1NTMG 5DJTB 3TGUJ 1JOCA 3KYQA 3V2QA 1NH4A 4D6TE 1R5SA 1YIJP 2ZT9D 4GDOA 5AW0B 2O01N 3V2RA 1RF1C 3D6YA 1KFMA 1JTHA 1EC5A 4CPGA 5AW3B 5KLVD 2K9JB 2N1TD 4TT3H 4L76A 3LW5H 1KD1Q 3AE9C 3MHVA 3H1LE 2WSCH 1OFCX 3U59A 3H1IE 3NXSA 1H0TA 2WT7A 1PPJD 4N78E 5BU5A 5CCGC 1LTGC 1KILB 1L0LG 1NU1G 2K3RA 3W68A 1N73C 1OW6A 2E75C 1URQC 2G3AA 2FYNC 1FDOA 2QVAA 1SQBJ 1FC2C 1W2EA 2QJPB 2ZYDA 1OW8A 1NTZJ 3VMXA 1K9MQ 2XKMA 3U1AA 1RF0C 1S1CX 1K05A 4N6JA 2WTYA 5B66H 1SS1A 1J2JB 3WU2H 3GW6A 4WY4B 5AVZB 4EOTA 2E76C 2Q3IA 1KV4A 3CD6P 1DH3A 3BATA 1SQBK 2Z5HA 2JR8A 1Q82Q 3CXHI 1LWUA 1NTZK 2AEFA 3CLQA 4GIFA 1MFTA 1J1EB 1BCCD 1UIIA 2HLOA 3VMAA 2A06E 1FJPA 4RO0A 1HWTC 3TF5A 3IAOA 2FY8A 3VP8A 1YHQP 2AXTE 2OYHC 1H89A 3TNUA 1U7JA 3CX5D 4UB8H 2C0XA 1EQ7A 4KHXA 2E75D 4XA4A 2YO2A 4EI2A 1JY2N 5C39A 3CCMP 1M7LA 1SQQJ 2W6AA 2LR2A 2KXPB 1CW5A 3B5NA 2FXMA 1MV8A 3CC2P 3OW2O 5AVUB 2Q5UA 1JY2P 2J58A 2WPVB 5APYA 2FYUK 3LIDA 1BDCA 2N9BA 4JYCA 1MKMA 4EIJA 3AECC 2KS1B 4ASVA 3AE8C 1G1IA 3H1HG 1SQQK 5GTHE 2IZ1A 1GK6A 2ZJSE 5CCHC 3L72J 1SQXE 3O6QA 1RQVA 1VDFA 3MZWB 1SFCC 3TGUD 4RESB 1G2CA 1FJKA 1KILD 1ZV8A 2WPQA 2WPSA 4NPFX 1ZOYC 4DOJA 3VTPC 2M5AB 1AQTA 2IBZE 3MUDC 5AVRB 2KIKA 5CJ4A 1HF9A 1N7SB 4IFMA 3MD0A 1NTKE 1JMBA 5GTIE 2YMYA 3USSA 3MIWA 1PP9E 1ZRTD 2B9BA 1HJBA 4LLHA 4U7JA 1YTZI 4O9BA 2CPSA 1N2DC 3RK3B 3L71E 1FZCC 1P84E 1FBMA 2V7QH 1U7MA 3D71A 3Q3DA 1KB9E 1VQNP 3C1LA 1WMKA 4PV1C 1VF5C 4AUWA 2BCCJ 2JWAA 1ZR4A 3BCCE 3ITKA 3A5TA 3L4FA 1H8AA 4PD4E 2NPSB 2P7JA 5CCHD 3M0DC 1AVYA 2OYIC 1PGOA 3L75J 1SQBD 4H0LB 1CI6A 3L73G 5KLVE 1HJ0A 3TSIA 1BGYE 2GM4A 4Y99C 1SFCD 1FDIA 1NTZD 1KFNA 3M06A 3H32B 5KAFE 3HD7A 3L74J 3KDPB 4B86A 1NJIQ 1PP9G 1GU5A 5BVZA 1OXZA 1Q2NA 2QE7H 1G1JA 1YQ3C 3W67A 2AEMA 3AE2C 1IFNA 1QL2A 3WUVA 3HRNA 2Z4EA 1VQ6P 4IL6H 3B71A 1M56D 5AW2B 1SQPK 2D2CB 3HE4B 1KQLA 1EXIA 3MP7B 2KNCA 2QRXA 1HVVA 2Q7CA 4C46A 1VF5D 5APTA 3EQ2A 1H88A 3HTKA 3N7NA 2AEJA 1T2KD 1QGKB 4WWIA 3CCJP 1GL2B 5KLVG 4EDFA 3R2PA 1QVFO 5APVA 3VP9A 4ZKPA 3GHGC 3CXHH 1GW3A 3RL0B 4PJ0H 1XTGB 1SQQD 3A0HE 2M3BA 1JO5A 1EZVI 2XDJA 2O1KA 4YPCA 4YXWH 3RL0g 1PPJG 3L70E 1N7SD 5CJ0A 1FZGA 3NFQA 5APXA 1S5LH 2Q9IA 2N1TA 5AVSB 1L4AB 4HYTB 1IK9A 4U3FE 2YXQB 4JBZA 3A7OA 2H8PD 2ZFCA 1SQVK 1NTME 2Y9ZA 3I56P 3CX5E 1FOSF 3L72D 2OTLP 2XNDH 2E43A 4WB4A 4C7NB 1LTJA 2WQYC 5APUA 2R3CA 3CXHD 3CCQP 4QMAA 1LTAC 3GF3A 1Y9BA 5AW6B 2A45I 3E1IA 3NMDA 2YKPA 1GL2C 3A0BE 1X9VA 4W7ZA 1LGHB 4L75A 4H0LD 3PRJA 1YBKA 3M91A 4H13B 5TISE 1L0NK 2LXBA 1BCCG 5L8RJ 5KJ7C 3V4QA 1RF1A 1NU1E 2QA4P 1Q7YQ 3I55P 1M1JC 3HUSC 2V4HA 1IFDA 2BCCD 3P8CE 1JNMA 2WSEH 3T97A 3SWFA 1J1DB 2KUBA 1VQ7P 5E79E 1H0TB 2D2CD 2WT7B 2FXOA 4DZOA 3L75D 1YTZT 1YJNP 2FFDC 1S3JA 5CCGA 3CCRP 4EYYQ 1E5WA 5KKZB 3L74D 2L5GB 1GL2D 2LXCB 4M3LA 2B87A 1URQA 1Y8AA 1S4XA 4RKUJ 4JYBA 1JCDA 4OGQB 1T6AA 1L0LK 1JEKA 4XE5B 1JB0J 1LT9C 3RL0D 1PGQA 3G3ZA 3H1LJ 3V5BA 4H13C 2R44A 4BWNA 5KAIH 2L91A 1QX8A 3AE3C 3P8MC 2I1JA 4H44C 1RF0A 4R4MA 5KJ7D 5B5EH 3BRVB 4BRYA 1X22A 3TGUG 1N7LA 4KJMA 5M1BA 1L4AD 4JQ0D 1EDJA 2OTJP 2O3JA 1EDIA 1EDLA 1LWUB 1J1DC 3CWBD 3WMM0 1JY2O 3Q5RA 3Q1MA 3TNUB 2V7QJ 2ZVNB 4DT0A 2W90A 2OYHA 1W5CE 2RKLA 4L73A 1KYOH 1NKZB 1K73Q 4C7RA 2B88A 1MFZA 1PIXA 3B5NB 3H1HE 1PZQA 4DJGA 2FYUJ 4H13D 1BE3J 2P2UA 2FXPA 1KILC 1M57D 2K1AA 4H44D 1DD3A 4UB6E 3EWKA 1SQBG 1S9KD 2H89C 5CBOA 3KXDA 1L0ND 1NTZG 4Z1MH 4I7ZB 1ZMEC 2QJPC 5AW7B 3B8EB 3FXEA 1KZUB 1RE3C 3HE5A 3VYIA 1YI2P 5BU8B 3O6QB 1IJDB 1SLQA 2KB7P 2NRGA 3KZIE 3IR9A 1P84I 4WY4C 2G8YA 1KB9I 1G2CB 1K04A 2GUVA 4L74A 2J5UA 2ZXXA 2HPCB 1SFCA 5APWA 2FYZA 3L37A 2PP6A 4A7PA 1OIPA 2QJKB 1VL2A 2A45H 3VMYA 4PD4I 1VQKP 1PGPA 1TU3F 1EZVD 5H2FE 2FYUG 2QEXP 3A3YB 1BE3G 1J1EC 3AEEC 3L72E 1UIXA 3B5NC 4JF7A 3NTNA 2JJLA 2P67A 1FZBA 3QWOC 1S72P 4AYCA 3H1KJ 3V2PA 1W2BO 1SQXJ 2E74B 1S2EA 3H25A 3M9QA 4WVZA 2ZYGA 3L73E 3L36A 3CC4P 1SQQG 1FZCA 4XFJA 2UWJE 2KI7B 1JCCA 1LP1A 3U1CA 1LTBC 3MTUE 2IFNA 3EFFK 1CZQA 1KQGB 2RMZA 3BVHA 1NTKJ 1RE4C 5CHXA 1QVGO 1QEXA 1CI6B 2B89A 3M0DA 1SQXK 4WY4D 2OYIA 4HJGH 2QG4A 2HODA 3OA7A 3V6IA 3H1LD 3HD7B 3JCUE 1KQSO 3L71J 3D6ZA 2E42A 2PRRA 2BCCE 1T2KC 3AEGC 4OWFA 1NHLA 3L72G 3H1ID 2KLUA 2QJKC 2IPPA 2R3SA 4N78D 4ZKUA 3AE6C 3TDKA 3B5ND 3H1KG 1FZEA 5KTBA 1NTKK 3EFGA 2JWDA 2W83C 1IK7A 1SQPJ 3AEBC 1NOHA 3D70A 2QIWA 3AE7C 1AVOA 4R4LA 3CCLP 2KNCB 5AVVB 3IN6A 1BGYJ 2MKVA 2W6JH 1JUNA 1N7SC 2YIUB 3HTKB 1BSNA 3CCSP 1PPJE 1D7MA 1YJWP 4IFFA 4IL6X 1T3UA 2H7HA 1OMIA 1ZP0C 2OARA 3RK3C 2WSEJ 1FAVA 4GODA 1RH5B 2BCCG 3GHGA 2Q6QA 1GZLA 1IZNB 1VQ4P 1IFPA 2FYUD 1BE3D 1KYOI 1AQ5A 1OVUA 1NO4A 2WSFH 5DJUB 3H6PA 4W7YA 3CWBJ 4GOEA 2A06D 3L75G 2NPSC 1KTMA 2HR3A 1FDMA 2BEQD 1LTSC 4W80A 1GW4A 2WWWA 5GTHH 1SQVJ 1SQPG 2R32A 5AVTB 2ZYAA 4H0LC 3L74G 1VQ5P 2JDIH 1EXJA 2KZIA 2YO3A 2XV5A 1GK4A 3VN0A 1FOSE 2E74D 2M3EA 1NAYA 1AV1A 5CBNA 4DCKA 5KLIB 1LTJB 1FE6A 2YKQA 1MZ9A 1S5LX 1USEA 3IFMA 1BCCE 2R5DA 1FZAA 4MN4C 2QJYB 3AE5C 3BRTB 3LIEA 3L70J 5GTIH 1X8YA 2PAJA 5EFWB 3OAKA 1GL2A 2O01J 3RK3D 4U3FJ 1YYCA 2O1JA 3CCEP 3GG2A 3G6EP 2D2CC 1IFMA 1L0NJ 3A2AA 3JSVC 1NTMJ 1P84H 5B66E 3WU2E 3HD7D 3CWBG 1KB9H 1HTLC 2FBWC 3H1JJ 3H1KD 3M9BA 2IFMA 1SQXD 4OVNF 1E79H 3SWYA 1SQVG 2DW3A 2GA1A 1GD2E 2VRSA 2NPSD 4HH2A 1DEEG 2JEEA 4PD4H 4N3YB 3RL0C 1M1JA 4ZMDA 3HUSA 3T97B 3RBXA 2C9LY 1L2PA 1XTCC 1ZLLA 2IBZD 4NPEA 1JTHB 1NTMK 2C9NY 1NTKD 3AE1C 1WT6A 5KAFH 3G71P 3WUUA 4K3AA 2I8DA 4HB1A 4UB8E 4C7NA 1L4AC 2FFDA 5AW5B 4Y28J 2K37A 3L71D 1OW7A 1P84D 1KN7A 3TGUE 2B87B 1URQB 1L0LJ 1NU1J 1KILE 1L0NG 1KB9D 1YQ4C 2ZAEB 1KORA 2FYNB 1DIPA 2OYOA 3OJAB 2P1JA 5AVXB 1QLED 1T3JA 3BCCD 3H1JG 1IO4A 1LT9A 3B4SA 4D6TJ 3ABVC 2HYNA 1PGJA 4PD4D 4RJTA 1SQPD 2KLVA 1ZRTE 3SFDC 4BRYB 3PJSK 1RQUA 1N73A 2E76B 1USDA 1BGYD 3CMAP 2ITAA 3AE4C 1NU1K 1FS0E 1Y47A 3FWLA 3A0HH 1EZVG 3H1IJ 4IOIH 2Z5IA 2BEZF 1BSHA 1OVVA 2WSSH 1GMJA 2K9JA 2OYHB 2POHA 1SQBE 3M9HA 2RH0A 2CPBA 1MUUA 1YJ9P 3FWNA 2O01H 2LKMA 2RN0A 3SWKA 1JY3O 1NTZE 4YXDC 3G9RA 4ASWA 3R4YA 5APSA 1YITP 4D6TG 2PFXA 2Y0CA 3BASA 1SQVD 3CX5H 3SSUA 3PLNA 1RHZB 1ZN5A 2M0BA 4GOFA 1KILA 3KPEA 1R8EA 5KKZC 5AVQB 2A45G 2C0WA 2KYVA 3FGAD 3H1LG 2OGUA 4OGQC 1LJ2A 1VQ9P 1LTTC 3HE5B 3A0BH 3S1KA 5AVYB 3H1IG 4GT1A 3GF7A 2FYUE 1RE3A 1N8RQ 2WVRA 1BE3E 3PP5A 3L70D 4KT0J 1HH0A 2W27A 3CCUP 3H1HJ 5TISH 2WITA 3C9IA 4U3FD 1JY3N 2HG5D 2IBZI 4WY4A 2JKVA 1SFCB 2JO1A 5CCGD 1NTMD 5AW8B 5AVWB 2W6BA 1SQQE 3V2NA 1JY3P 3H1JD 2YMKA 2K88A 5AW4B 1Q90D 1URQD 3I5CA 1LWUC 5CCHA 1KYOD 1Z56A 1Q86Q 4IL6E 2IYPA 3E7KA 5E79H 1DX7A 2Y0DA 2KZJA 2QM8A 1RY3A 1A02J 2NZ2A 1FZCB 2MJZA 3FX0A 4LC1A 1AA0A 3ZDMA 1LP1B 2E76D 1ZXGA 2WSFJ 3IF4A 1CSBA 3MUDA 4PV1B 3RK3E 1VF5B 2Q3EA 2OTKE 4OGQD 1AFOA 3CCVP 2H43A 2IX7C 2A06G 1KMIZ 3CXHE 4PJ0E 1L0LD 1HGZA 1NU1D 1OZHA 3H1KE 2ZXEB 2OYIB 2FKWB 3GLMA 1RE4A 4I6MC 2HODB 1A02F 3P8CD 4IFDK 4Y99B 2YXRB 3RK2B 1M8OB 3PHLA 4D6TD 3K5BA 3L73J 4I7ZC 2HPCA 2KS1A 2N9YB 3S9OA
chains in the Genus database with same CATH topology
2KSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSE A; 
#chains in the Genus database with same CATH topology
 1S5L E;  2ZVO B;  4HKZ H;  4JPZ B;  1VQL P;  2OQQ A;  1M90 Q;  1PP9 J;  2HFE D;  3CPW O;  2YNY A;  3TK1 A;  3TYY A;  3CI9 A;  3E1R A;  2IYO A;  3P7K A;  3CME P;  5CMZ A;  3SFE C;  3AEF C;  2M5A A;  4LGD E;  2K9Y A;  1AJY A;  1N7S A;  3BCC J;  3PH0 A;  1SQX G;  3GMA A;  2Q1K A;  4BXL A;  3RGU A;  1FZF A;  3L75 E;  4OH8 B;  1DD4 A;  1VQ8 P;  3VMZ A;  3Q2Y A;  1IC2 A;  3C8V A;  2JP3 A;  1SQP E;  2E74 C;  3AEA C;  3GHG B;  3L74 E;  2AXT H;  5KLV J;  1IFI A;  2I1K A;  2Y0E A;  4GKG A;  2IBZ G;  1N86 A;  3M0A A;  4UB6 H;  1NAF A;  3RK2 C;  3L35 A;  4I1L A;  1K8A Q;  3CL3 D;  1HGV A;  1NTK G;  1VPC A;  4ZNC A;  1NKN A;  1LT1 A;  1NWQ A;  2XU6 A;  3II6 A;  1HUC A;  2QSI A;  3Q5P A;  2GUS A;  4YTP C;  2NPS A;  2KSE A;  2Y9Y A;  3V4W A;  1LNQ A;  3CX5 I;  2KSJ A;  3L71 G;  1GDT A;  1WRG A;  2AXC A;  1PFI A;  2E5Y A;  3KZI H;  5KLV K;  3HD7 C;  3F5H A;  2YKO A;  2ZT9 B;  2XNX A;  3H32 A;  3G4S P;  3BCC G;  3H1H D;  3CWB E;  2N1T B;  4PV1 D;  2E5T A;  3S4R A;  1JM0 A;  2WZ7 A;  1SQV E;  5H2F H;  1Q81 Q;  5K5G B;  2R5B A;  2WPR A;  3LW5 J;  3UIA A;  3QH9 A;  3N4X A;  1BGY G;  4I2L C;  3JC2 2;  5AW1 B;  1VQO P;  4NPD A;  2WSC J;  2W8Z A;  5KAI E;  3HE4 A;  2H88 C;  3O8Z A;  2IZ0 A;  2YIU C;  5B5E E;  1IFJ A;  3RK2 D;  1GU4 A;  1R5L A;  1ZW0 A;  1JMM A;  4AQR D;  1NGM B;  3P32 A;  3RBZ A;  1DEB A;  2KOG A;  3MGN A;  1BCC J;  3KQG A;  3KHU A;  1ZR2 A;  1M1J B;  1BDD A;  3HUS B;  2SPZ A;  1HBW A;  1S9K E;  1EDK A;  2PGD A;  1L0N E;  1VQP P;  2P58 A;  1M1K Q;  1X79 B;  1OVR A;  3F89 A;  1PL5 A;  3VOP A;  2ZT9 C;  4TLF A;  1RF1 B;  1VQM P;  2QM7 A;  3H1J E;  1OWA A;  3JCU H;  3FXD A;  5KJ7 A;  2KP8 A;  2N1T C;  3WUT A;  1PV3 A;  2FFD B;  1SP4 A;  3PTZ A;  1KYO E;  1T8Z A;  2WMM A;  2J59 M;  2XZR A;  1L4A A;  3L73 D;  1KQF B;  2M8R A;  1LTI C;  2BAS A;  1QL1 A;  1OX3 A;  5APQ A;  1KC8 Q;  3CC7 P;  4K35 A;  3AED C;  1LT9 B;  1PP9 D;  5KLI C;  1SVF A;  1LTJ C;  1GTW A;  1EZV E;  3Q5S A;  3L70 G;  5AW9 B;  1NVO A;  2IDB A;  4H44 B;  2QJY C;  1N73 B;  1X0T A;  4U3F G;  2E75 B;  2KK7 A;  1U57 A;  1NYH A;  1FU1 A;  1L0L E;  5TJH A;  4WBA A;  2CK3 H;  2P10 A;  1NTM G;  5DJT B;  3TGU J;  1JOC A;  3KYQ A;  3V2Q A;  1NH4 A;  4D6T E;  1R5S A;  1YIJ P;  2ZT9 D;  4GDO A;  5AW0 B;  2O01 N;  3V2R A;  1RF1 C;  3D6Y A;  1KFM A;  1JTH A;  1EC5 A;  4CPG A;  5AW3 B;  5KLV D;  2K9J B;  2N1T D;  4TT3 H;  4L76 A;  3LW5 H;  1KD1 Q;  3AE9 C;  3MHV A;  3H1L E;  2WSC H;  1OFC X;  3U59 A;  3H1I E;  3NXS A;  1H0T A;  2WT7 A;  1PPJ D;  4N78 E;  5BU5 A;  5CCG C;  1LTG C;  1KIL B;  1L0L G;  1NU1 G;  2K3R A;  3W68 A;  1N73 C;  1OW6 A;  2E75 C;  1URQ C;  2G3A A;  2FYN C;  1FDO A;  2QVA A;  1SQB J;  1FC2 C;  1W2E A;  2QJP B;  2ZYD A;  1OW8 A;  1NTZ J;  3VMX A;  1K9M Q;  2XKM A;  3U1A A;  1RF0 C;  1S1C X;  1K05 A;  4N6J A;  2WTY A;  5B66 H;  1SS1 A;  1J2J B;  3WU2 H;  3GW6 A;  4WY4 B;  5AVZ B;  4EOT A;  2E76 C;  2Q3I A;  1KV4 A;  3CD6 P;  1DH3 A;  3BAT A;  1SQB K;  2Z5H A;  2JR8 A;  1Q82 Q;  3CXH I;  1LWU A;  1NTZ K;  2AEF A;  3CLQ A;  4GIF A;  1MFT A;  1J1E B;  1BCC D;  1UII A;  2HLO A;  3VMA A;  2A06 E;  1FJP A;  4RO0 A;  1HWT C;  3TF5 A;  3IAO A;  2FY8 A;  3VP8 A;  1YHQ P;  2AXT E;  2OYH C;  1H89 A;  3TNU A;  1U7J A;  3CX5 D;  4UB8 H;  2C0X A;  1EQ7 A;  4KHX A;  2E75 D;  4XA4 A;  2YO2 A;  4EI2 A;  1JY2 N;  5C39 A;  3CCM P;  1M7L A;  1SQQ J;  2W6A A;  2LR2 A;  2KXP B;  1CW5 A;  3B5N A;  2FXM A;  1MV8 A;  3CC2 P;  3OW2 O;  5AVU B;  2Q5U A;  1JY2 P;  2J58 A;  2WPV B;  5APY A;  2FYU K;  3LID A;  1BDC A;  2N9B A;  4JYC A;  1MKM A;  4EIJ A;  3AEC C;  2KS1 B;  4ASV A;  3AE8 C;  1G1I A;  3H1H G;  1SQQ K;  5GTH E;  2IZ1 A;  1GK6 A;  2ZJS E;  5CCH C;  3L72 J;  1SQX E;  3O6Q A;  1RQV A;  1VDF A;  3MZW B;  1SFC C;  3TGU D;  4RES B;  1G2C A;  1FJK A;  1KIL D;  1ZV8 A;  2WPQ A;  2WPS A;  4NPF X;  1ZOY C;  4DOJ A;  3VTP C;  2M5A B;  1AQT A;  2IBZ E;  3MUD C;  5AVR B;  2KIK A;  5CJ4 A;  1HF9 A;  1N7S B;  4IFM A;  3MD0 A;  1NTK E;  1JMB A;  5GTI E;  2YMY A;  3USS A;  3MIW A;  1PP9 E;  1ZRT D;  2B9B A;  1HJB A;  4LLH A;  4U7J A;  1YTZ I;  4O9B A;  2CPS A;  1N2D C;  3RK3 B;  3L71 E;  1FZC C;  1P84 E;  1FBM A;  2V7Q H;  1U7M A;  3D71 A;  3Q3D A;  1KB9 E;  1VQN P;  3C1L A;  1WMK A;  4PV1 C;  1VF5 C;  4AUW A;  2BCC J;  2JWA A;  1ZR4 A;  3BCC E;  3ITK A;  3A5T A;  3L4F A;  1H8A A;  4PD4 E;  2NPS B;  2P7J A;  5CCH D;  3M0D C;  1AVY A;  2OYI C;  1PGO A;  3L75 J;  1SQB D;  4H0L B;  1CI6 A;  3L73 G;  5KLV E;  1HJ0 A;  3TSI A;  1BGY E;  2GM4 A;  4Y99 C;  1SFC D;  1FDI A;  1NTZ D;  1KFN A;  3M06 A;  3H32 B;  5KAF E;  3HD7 A;  3L74 J;  3KDP B;  4B86 A;  1NJI Q;  1PP9 G;  1GU5 A;  5BVZ A;  1OXZ A;  1Q2N A;  2QE7 H;  1G1J A;  1YQ3 C;  3W67 A;  2AEM A;  3AE2 C;  1IFN A;  1QL2 A;  3WUV A;  3HRN A;  2Z4E A;  1VQ6 P;  4IL6 H;  3B71 A;  1M56 D;  5AW2 B;  1SQP K;  2D2C B;  3HE4 B;  1KQL A;  1EXI A;  3MP7 B;  2KNC A;  2QRX A;  1HVV A;  2Q7C A;  4C46 A;  1VF5 D;  5APT A;  3EQ2 A;  1H88 A;  3HTK A;  3N7N A;  2AEJ A;  1T2K D;  1QGK B;  4WWI A;  3CCJ P;  1GL2 B;  5KLV G;  4EDF A;  3R2P A;  1QVF O;  5APV A;  3VP9 A;  4ZKP A;  3GHG C;  3CXH H;  1GW3 A;  3RL0 B;  4PJ0 H;  1XTG B;  1SQQ D;  3A0H E;  2M3B A;  1JO5 A;  1EZV I;  2XDJ A;  2O1K A;  4YPC A;  4YXW H;  3RL0 g;  1PPJ G;  3L70 E;  1N7S D;  5CJ0 A;  1FZG A;  3NFQ A;  5APX A;  1S5L H;  2Q9I A;  2N1T A;  5AVS B;  1L4A B;  4HYT B;  1IK9 A;  4U3F E;  2YXQ B;  4JBZ A;  3A7O A;  2H8P D;  2ZFC A;  1SQV K;  1NTM E;  2Y9Z A;  3I56 P;  3CX5 E;  1FOS F;  3L72 D;  2OTL P;  2XND H;  2E43 A;  4WB4 A;  4C7N B;  1LTJ A;  2WQY C;  5APU A;  2R3C A;  3CXH D;  3CCQ P;  4QMA A;  1LTA C;  3GF3 A;  1Y9B A;  5AW6 B;  2A45 I;  3E1I A;  3NMD A;  2YKP A;  1GL2 C;  3A0B E;  1X9V A;  4W7Z A;  1LGH B;  4L75 A;  4H0L D;  3PRJ A;  1YBK A;  3M91 A;  4H13 B;  5TIS E;  1L0N K;  2LXB A;  1BCC G;  5L8R J;  5KJ7 C;  3V4Q A;  1RF1 A;  1NU1 E;  2QA4 P;  1Q7Y Q;  3I55 P;  1M1J C;  3HUS C;  2V4H A;  1IFD A;  2BCC D;  3P8C E;  1JNM A;  2WSE H;  3T97 A;  3SWF A;  1J1D B;  2KUB A;  1VQ7 P;  5E79 E;  1H0T B;  2D2C D;  2WT7 B;  2FXO A;  4DZO A;  3L75 D;  1YTZ T;  1YJN P;  2FFD C;  1S3J A;  5CCG A;  3CCR P;  4EYY Q;  1E5W A;  5KKZ B;  3L74 D;  2L5G B;  1GL2 D;  2LXC B;  4M3L A;  2B87 A;  1URQ A;  1Y8A A;  1S4X A;  4RKU J;  4JYB A;  1JCD A;  4OGQ B;  1T6A A;  1L0L K;  1JEK A;  4XE5 B;  1JB0 J;  1LT9 C;  3RL0 D;  1PGQ A;  3G3Z A;  3H1L J;  3V5B A;  4H13 C;  2R44 A;  4BWN A;  5KAI H;  2L91 A;  1QX8 A;  3AE3 C;  3P8M C;  2I1J A;  4H44 C;  1RF0 A;  4R4M A;  5KJ7 D;  5B5E H;  3BRV B;  4BRY A;  1X22 A;  3TGU G;  1N7L A;  4KJM A;  5M1B A;  1L4A D;  4JQ0 D;  1EDJ A;  2OTJ P;  2O3J A;  1EDI A;  1EDL A;  1LWU B;  1J1D C;  3CWB D;  3WMM 0;  1JY2 O;  3Q5R A;  3Q1M A;  3TNU B;  2V7Q J;  2ZVN B;  4DT0 A;  2W90 A;  2OYH A;  1W5C E;  2RKL A;  4L73 A;  1KYO H;  1NKZ B;  1K73 Q;  4C7R A;  2B88 A;  1MFZ A;  1PIX A;  3B5N B;  3H1H E;  1PZQ A;  4DJG A;  2FYU J;  4H13 D;  1BE3 J;  2P2U A;  2FXP A;  1KIL C;  1M57 D;  2K1A A;  4H44 D;  1DD3 A;  4UB6 E;  3EWK A;  1SQB G;  1S9K D;  2H89 C;  5CBO A;  3KXD A;  1L0N D;  1NTZ G;  4Z1M H;  4I7Z B;  1ZME C;  2QJP C;  5AW7 B;  3B8E B;  3FXE A;  1KZU B;  1RE3 C;  3HE5 A;  3VYI A;  1YI2 P;  5BU8 B;  3O6Q B;  1IJD B;  1SLQ A;  2KB7 P;  2NRG A;  3KZI E;  3IR9 A;  1P84 I;  4WY4 C;  2G8Y A;  1KB9 I;  1G2C B;  1K04 A;  2GUV A;  4L74 A;  2J5U A;  2ZXX A;  2HPC B;  1SFC A;  5APW A;  2FYZ A;  3L37 A;  2PP6 A;  4A7P A;  1OIP A;  2QJK B;  1VL2 A;  2A45 H;  3VMY A;  4PD4 I;  1VQK P;  1PGP A;  1TU3 F;  1EZV D;  5H2F E;  2FYU G;  2QEX P;  3A3Y B;  1BE3 G;  1J1E C;  3AEE C;  3L72 E;  1UIX A;  3B5N C;  4JF7 A;  3NTN A;  2JJL A;  2P67 A;  1FZB A;  3QWO C;  1S72 P;  4AYC A;  3H1K J;  3V2P A;  1W2B O;  1SQX J;  2E74 B;  1S2E A;  3H25 A;  3M9Q A;  4WVZ A;  2ZYG A;  3L73 E;  3L36 A;  3CC4 P;  1SQQ G;  1FZC A;  4XFJ A;  2UWJ E;  2KI7 B;  1JCC A;  1LP1 A;  3U1C A;  1LTB C;  3MTU E;  2IFN A;  3EFF K;  1CZQ A;  1KQG B;  2RMZ A;  3BVH A;  1NTK J;  1RE4 C;  5CHX A;  1QVG O;  1QEX A;  1CI6 B;  2B89 A;  3M0D A;  1SQX K;  4WY4 D;  2OYI A;  4HJG H;  2QG4 A;  2HOD A;  3OA7 A;  3V6I A;  3H1L D;  3HD7 B;  3JCU E;  1KQS O;  3L71 J;  3D6Z A;  2E42 A;  2PRR A;  2BCC E;  1T2K C;  3AEG C;  4OWF A;  1NHL A;  3L72 G;  3H1I D;  2KLU A;  2QJK C;  2IPP A;  2R3S A;  4N78 D;  4ZKU A;  3AE6 C;  3TDK A;  3B5N D;  3H1K G;  1FZE A;  5KTB A;  1NTK K;  3EFG A;  2JWD A;  2W83 C;  1IK7 A;  1SQP J;  3AEB C;  1NOH A;  3D70 A;  2QIW A;  3AE7 C;  1AVO A;  4R4L A;  3CCL P;  2KNC B;  5AVV B;  3IN6 A;  1BGY J;  2MKV A;  2W6J H;  1JUN A;  1N7S C;  2YIU B;  3HTK B;  1BSN A;  3CCS P;  1PPJ E;  1D7M A;  1YJW P;  4IFF A;  4IL6 X;  1T3U A;  2H7H A;  1OMI A;  1ZP0 C;  2OAR A;  3RK3 C;  2WSE J;  1FAV A;  4GOD A;  1RH5 B;  2BCC G;  3GHG A;  2Q6Q A;  1GZL A;  1IZN B;  1VQ4 P;  1IFP A;  2FYU D;  1BE3 D;  1KYO I;  1AQ5 A;  1OVU A;  1NO4 A;  2WSF H;  5DJU B;  3H6P A;  4W7Y A;  3CWB J;  4GOE A;  2A06 D;  3L75 G;  2NPS C;  1KTM A;  2HR3 A;  1FDM A;  2BEQ D;  1LTS C;  4W80 A;  1GW4 A;  2WWW A;  5GTH H;  1SQV J;  1SQP G;  2R32 A;  5AVT B;  2ZYA A;  4H0L C;  3L74 G;  1VQ5 P;  2JDI H;  1EXJ A;  2KZI A;  2YO3 A;  2XV5 A;  1GK4 A;  3VN0 A;  1FOS E;  2E74 D;  2M3E A;  1NAY A;  1AV1 A;  5CBN A;  4DCK A;  5KLI B;  1LTJ B;  1FE6 A;  2YKQ A;  1MZ9 A;  1S5L X;  1USE A;  3IFM A;  1BCC E;  2R5D A;  1FZA A;  4MN4 C;  2QJY B;  3AE5 C;  3BRT B;  3LIE A;  3L70 J;  5GTI H;  1X8Y A;  2PAJ A;  5EFW B;  3OAK A;  1GL2 A;  2O01 J;  3RK3 D;  4U3F J;  1YYC A;  2O1J A;  3CCE P;  3GG2 A;  3G6E P;  2D2C C;  1IFM A;  1L0N J;  3A2A A;  3JSV C;  1NTM J;  1P84 H;  5B66 E;  3WU2 E;  3HD7 D;  3CWB G;  1KB9 H;  1HTL C;  2FBW C;  3H1J J;  3H1K D;  3M9B A;  2IFM A;  1SQX D;  4OVN F;  1E79 H;  3SWY A;  1SQV G;  2DW3 A;  2GA1 A;  1GD2 E;  2VRS A;  2NPS D;  4HH2 A;  1DEE G;  2JEE A;  4PD4 H;  4N3Y B;  3RL0 C;  1M1J A;  4ZMD A;  3HUS A;  3T97 B;  3RBX A;  2C9L Y;  1L2P A;  1XTC C;  1ZLL A;  2IBZ D;  4NPE A;  1JTH B;  1NTM K;  2C9N Y;  1NTK D;  3AE1 C;  1WT6 A;  5KAF H;  3G71 P;  3WUU A;  4K3A A;  2I8D A;  4HB1 A;  4UB8 E;  4C7N A;  1L4A C;  2FFD A;  5AW5 B;  4Y28 J;  2K37 A;  3L71 D;  1OW7 A;  1P84 D;  1KN7 A;  3TGU E;  2B87 B;  1URQ B;  1L0L J;  1NU1 J;  1KIL E;  1L0N G;  1KB9 D;  1YQ4 C;  2ZAE B;  1KOR A;  2FYN B;  1DIP A;  2OYO A;  3OJA B;  2P1J A;  5AVX B;  1QLE D;  1T3J A;  3BCC D;  3H1J G;  1IO4 A;  1LT9 A;  3B4S A;  4D6T J;  3ABV C;  2HYN A;  1PGJ A;  4PD4 D;  4RJT A;  1SQP D;  2KLV A;  1ZRT E;  3SFD C;  4BRY B;  3PJS K;  1RQU A;  1N73 A;  2E76 B;  1USD A;  1BGY D;  3CMA P;  2ITA A;  3AE4 C;  1NU1 K;  1FS0 E;  1Y47 A;  3FWL A;  3A0H H;  1EZV G;  3H1I J;  4IOI H;  2Z5I A;  2BEZ F;  1BSH A;  1OVV A;  2WSS H;  1GMJ A;  2K9J A;  2OYH B;  2POH A;  1SQB E;  3M9H A;  2RH0 A;  2CPB A;  1MUU A;  1YJ9 P;  3FWN A;  2O01 H;  2LKM A;  2RN0 A;  3SWK A;  1JY3 O;  1NTZ E;  4YXD C;  3G9R A;  4ASW A;  3R4Y A;  5APS A;  1YIT P;  4D6T G;  2PFX A;  2Y0C A;  3BAS A;  1SQV D;  3CX5 H;  3SSU A;  3PLN A;  1RHZ B;  1ZN5 A;  2M0B A;  4GOF A;  1KIL A;  3KPE A;  1R8E A;  5KKZ C;  5AVQ B;  2A45 G;  2C0W A;  2KYV A;  3FGA D;  3H1L G;  2OGU A;  4OGQ C;  1LJ2 A;  1VQ9 P;  1LTT C;  3HE5 B;  3A0B H;  3S1K A;  5AVY B;  3H1I G;  4GT1 A;  3GF7 A;  2FYU E;  1RE3 A;  1N8R Q;  2WVR A;  1BE3 E;  3PP5 A;  3L70 D;  4KT0 J;  1HH0 A;  2W27 A;  3CCU P;  3H1H J;  5TIS H;  2WIT A;  3C9I A;  4U3F D;  1JY3 N;  2HG5 D;  2IBZ I;  4WY4 A;  2JKV A;  1SFC B;  2JO1 A;  5CCG D;  1NTM D;  5AW8 B;  5AVW B;  2W6B A;  1SQQ E;  3V2N A;  1JY3 P;  3H1J D;  2YMK A;  2K88 A;  5AW4 B;  1Q90 D;  1URQ D;  3I5C A;  1LWU C;  5CCH A;  1KYO D;  1Z56 A;  1Q86 Q;  4IL6 E;  2IYP A;  3E7K A;  5E79 H;  1DX7 A;  2Y0D A;  2KZJ A;  2QM8 A;  1RY3 A;  1A02 J;  2NZ2 A;  1FZC B;  2MJZ A;  3FX0 A;  4LC1 A;  1AA0 A;  3ZDM A;  1LP1 B;  2E76 D;  1ZXG A;  2WSF J;  3IF4 A;  1CSB A;  3MUD A;  4PV1 B;  3RK3 E;  1VF5 B;  2Q3E A;  2OTK E;  4OGQ D;  1AFO A;  3CCV P;  2H43 A;  2IX7 C;  2A06 G;  1KMI Z;  3CXH E;  4PJ0 E;  1L0L D;  1HGZ A;  1NU1 D;  1OZH A;  3H1K E;  2ZXE B;  2OYI B;  2FKW B;  3GLM A;  1RE4 A;  4I6M C;  2HOD B;  1A02 F;  3P8C D;  4IFD K;  4Y99 B;  2YXR B;  3RK2 B;  1M8O B;  3PHL A;  4D6T D;  3K5B A;  3L73 J;  4I7Z C;  2HPC A;  2KS1 A;  2N9Y B;  3S9O A; 
#chains in the Genus database with same CATH homology
 2KSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...